The Role of Marsh Platform Morphology in the Geomorphic Response of Tidal Inlet Systems to Sea Level Rise

Material Information

The Role of Marsh Platform Morphology in the Geomorphic Response of Tidal Inlet Systems to Sea Level Rise
Lovering, Jessica Loren
Place of Publication:
[Gainesville, Fla.]
University of Florida
Publication Date:
Physical Description:
1 online resource (140 p.)

Thesis/Dissertation Information

Doctorate ( Ph.D.)
Degree Grantor:
University of Florida
Degree Disciplines:
Geological Sciences
Committee Chair:
Adams, Peter N
Committee Members:
Martin, Ellen Eckels
Jaeger, John M
Hatfield, Kirk
Calantoni, Joseph
Graduation Date:


Subjects / Keywords:
Floods ( jstor )
Inlets ( jstor )
Marshes ( jstor )
Sea level ( jstor )
Sea level rise ( jstor )
Sediment transport ( jstor )
Sediments ( jstor )
Vegetation ( jstor )
Velocity ( jstor )
Wetlands ( jstor )
Geological Sciences -- Dissertations, Academic -- UF
ecogeomorphology -- inlet -- level -- morphology -- sea -- tidal -- wetlands
bibliography ( marcgt )
theses ( marcgt )
government publication (state, provincial, terriorial, dependent) ( marcgt )
born-digital ( sobekcm )
Electronic Thesis or Dissertation
Geology thesis, Ph.D.


Morphologic evolution of tidal inlets depends on the ecogeomorphic behavior of the back-barrier basin, and exerts a strong influence on local shoreline response to sea level rise. A tidal inlet channel acts as the principal valve for water and sediment exchange in a barrier system, but changes to back-barrier basin ecology, hypsometry, and flow network configuration can alter discharge conveyed through the inlet channel. We investigate the role of wetland vegetation on tidal inlet response to sea level rise with three approaches, each investigating a set of process linkages: (1) Marsh vertical accretion control on changes to the tidal prism, inlet channel cross-sectional area, and ebb shoal volumes due to sea level rise , (2) Feedbacks between marsh vertical accretion and sediment availability changes with sea level rise, controlled by alterations to the hydrodynamics in the back-barrier basin, and (3) the impact of marsh edge erosion on the tidal prism, inlet channel cross-sectional area, and ebb shoal volume.  Tidal inlets communicate with the adjacent shoreline; Barrier islands, ebb and flood shoal complexes, and the contiguous wetlands act together as a sand sharing system.  Alterations to one morphologic component will modify the entire budget of the system, leading to changes in the erosional-depositional patterns in local longshore sediment transport.  Incorporating changes to wetland vegetation in the back-barrier basin is crucial to understanding how shorelines with barrier island systems will evolve under sea level rise worldwide. The first study investigates the role of initial marsh vertical accretion on changes to tidal prism, inlet channel cross-sectional area, and ebb shoal volume due to a rise in relative sea level.  We investigate this phenomenon by applying a numerical hydrodynamic model, paired with empirically derived morphologic relationships, to an inlet system typical of a mixed-energy, tide dominated barrier island system. We consider two end-member, marsh accretion scenarios:(A) no vertical marsh accretion, wherein marsh islands become submerged,changing both the flooded basin area and the spatial pattern of tidal wave attenuation, and (B) a marsh accretion rate equal to the rate of sea level rise, wherein marsh tidal channels deepen but maintain their courses and the associated friction reduction leads to a more efficient tidal exchange between the ocean and back-barrier basin.  Model results show a tidal prism increase for both scenarios, leading to increases in channel cross-sectional area and ebb shoal volumes.  Under both marsh accretion scenarios, the mechanism of improved tidal exchange efficiency through channel deepening,produces increases of tidal prism that are similar in magnitude.  Under conditions with no marsh accretion, an additional mechanism, namely the expansion of flooded basin area, further increases the magnitude of the tidal prism. Scenario A (no accretion) produced a tidal prism increase four times that of the increase calculated for scenario B (pace-keeping accretion), when sea level rise magnitudes were less than 50 cm; this difference increases at higher magnitudes of sea level rise.  We found an increase in the inlet cross-sectional area and ebb shoal volume for scenario A that is approximately double that of scenario B.  The increase in equilibrium inlet channel cross-sectional area, arising from scour processes, exceeds the increase due to sea level rise alone, illustrating the influence of marsh tidal flow processes.  The second study focuses on feedbacks between marsh vertical accretion rates and changes to sediment availability under various sea level rise scenarios.  Marsh vertical accretion is a function of allochthonous sediment availability and autochthonous sediment produced in situ by marsh vegetation. Variations in the initial marsh platform accretion rate relative to sea level rise rate influence the spatial distribution of marsh platform submergence and the tidal velocity asymmetry. Increased duration of marsh vegetation submergence could lead to vegetation water-logging and drowning, leading to reduced plant production and a reduction in the autochthonous sediment production of the system.  Changes to the difference in storage capacity during low and high tide, as well as, alterations to the friction through the inlet and basin channels, leads to changes in the tidal velocity asymmetry through the inlet channel.  Modifications to the tidal velocity asymmetry alter the net transport through the inlet and the balance of sediment between the ocean and basin, altering the allochthonous sediment availability to the marsh platform. We use a numerical model with the two end-member marsh accretion scenarios described above to investigate these feedbacks.  Model results indicate that,for a static marsh platform, sea level rise causes areas farther from the inlet channel to be submerged for longer periods of time than areas closer to the channel, due to a reduction in drainage efficiency during the ebb tidal exchange.  The tidal asymmetry for this system becomes more flood dominant with sea level rise because the difference in storage capacity during low and high tide is reduced, but the net transport remains in the ebb direction for all levels of sea level rise up to 100 cm.  When the platform is able to accrete vertically at the same rate as sea level rise, the system becomes more ebb dominant because channel deepening causes a reduction in the flow and some sediment is transported in the seaward direction.  Marsh platform configuration plays a crucial role in the feedbacks of the system, with drainage efficiency of the system and variations in storage capacity determining the availability of sediment to the marsh platform. In the last study, we investigate the role of wetland vegetation loss by marsh edge erosion on tidal prism, inlet channel cross-sectional area, and ebb shoal volume. Vegetation loss can change the tidal prism for a particular inlet by:(1) increasing the map-view area of open water exchanged between the back-barrier basin and the ocean during a tidal cycle and (2) reducing the spatial rate of tidal wave attenuation within the basin.  We use a simple conceptual model to explore the geomorphic response of two Florida inlets, of contrasting wetland configurations,to uniform back basin vegetation loss that might result from current projections of sea level rise. All results show that vegetation loss causes an increase in tidal prism, inlet cross-sectional area, and ebb shoal volume, but inlets with wetland configurations that strongly increase tidal wave attenuation in the back barrier basin have an amplified response to vegetation loss.  Using empirical relationships, we find that a one percent loss of back barrier basin vegetated area results in an increase of ebb shoal volume by an amount approximately equivalent to annual to biennial longshore sediment transport rates along the Florida Atlantic coast.  The conceptual model developed in this study can be used to examine morphologic response of tidal inlet systems to wetland vegetation loss at similar barrier island complexes worldwide. ( en )
General Note:
In the series University of Florida Digital Collections.
General Note:
Includes vita.
Includes bibliographical references.
Source of Description:
Description based on online resource; title from PDF title page.
Source of Description:
This bibliographic record is available under the Creative Commons CC0 public domain dedication. The University of Florida Libraries, as creator of this bibliographic record, has waived all rights to it worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.
Thesis (Ph.D.)--University of Florida, 2013.
Adviser: Adams, Peter N.
Electronic Access:
Statement of Responsibility:
by Jessica Loren Lovering.

Record Information

Source Institution:
Rights Management:
Copyright Lovering, Jessica Loren. Permission granted to the University of Florida to digitize, archive and distribute this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Embargo Date:
Resource Identifier:
885021008 ( OCLC )
LD1780 2013 ( lcc )


This item has the following downloads:

Full Text




c2013JessicaLorenLovering 2


Idedicatethistomylovingandsupportivehusband,JosephLovering. 3


ACKNOWLEDGMENTS Iwouldliketothankmycommitteechair,PeteAdams,foralwaysprovidingsupportformyresearchideasandcontinuingtopushmetostriveforgreatnessinmywork.Hishighexpectationsofmyworkhelpedmetorealizemypotentialandtoworkhardtoachievemygoals.Iwouldalsoliketothankmycommitteemembers,JoeCalantoni,RobertDean,JohnJaeger,EllenMartin,andKrikHateldforalloftheirthoughtfulinputthroughoutmytimeintheGeologicalSciencesDepartment.Withoutthesupportofmycommittee,thisworkwouldnothavebeenpossible,andforthatIamforevergrateful.Iwouldalsoliketothankthegeomorphteamofstudentswhohavebecomeagreatresearchsupportsystemandmyclosefriends.IwanttothankKatherineMaloneforkeepingmyspiritshighandalwaysbeingmybiggestcheerleaderevenwhenthingsgottough.IamthankfulformyclosefriendshipwithShaunKline,myofcemateof6years.Hehasalwaysbeentheretolendanearandlistentomyresearchideasandtochallengemewithhisthoughtfulcontributionstomywork.IwouldalsoliketothankRichMacKenzieforhiscontagiousenthusiasmandpassionforthescience,aswellasbeingadependablefriendandcolleague.Iwouldliketothankmyparentswhoinstilledinmethevalueofhardworkandthejoyofeducation.MymomhasalwaysbeenoneofmygreatestsupportersandIknowIwouldnothavebeenabletoachievethisworkwithoutherloveandsupport.Lastly,Iwouldliketothankmyamazinghusband,JDLovering,whosharedinthisadventurewithmeandprovidedmewiththecouragetofollowmydreams. 4


TABLEOFCONTENTS page ACKNOWLEDGMENTS .................................. 4 LISTOFTABLES ...................................... 8 LISTOFFIGURES ..................................... 9 LISTOFABBREVIATIONS ................................ 12 ABSTRACT ......................................... 13 CHAPTER 1GENERALINTRODUCTION ............................ 16 1.1ProblemStatement ............................... 16 1.2OutlineofPresentation ............................. 16 1.3TidalInletSystems ............................... 17 1.3.1MorphologicElements ......................... 17 .......................... 18 ...................... 18 1.3.2InletClassication ........................... 20 1.3.3EquilibriumRelationships ....................... 21 ......................... 22 ...................... 24 1.4SaltMarshes .................................. 26 1.4.1TypesofSaltMarshes ......................... 26 1.4.2SaltMarshResponsetoSeaLevel .................. 26 2HOWDOESVERTICALMARSHACCRETIONCONTROLHYDRODYNAMICANDMORPHOLOGICRESPONSESOFATIDALINLETTOSEALEVELRISE? ......................................... 37 2.1Introduction ................................... 38 2.2Background ................................... 39 2.3Methodology .................................. 42 2.3.1StudySite ................................ 42 2.3.2TidalFlowModelandExperimentalDesign ............. 44 2.3.3EmpiricallyDerivedHydrodynamic-MorphologicRelationships ... 45 2.3.4ModelTestingandCalibration ..................... 46 2.4Results ..................................... 49 2.4.1BasinArea ............................... 49 2.4.2TidalPrism ............................... 49 2.4.3Cross-SectionalArea .......................... 51 2.4.4EbbShoalVolume ........................... 51 2.5Discussion ................................... 52 5


2.5.1RegionalImpacts ............................ 52 2.5.2ComparisonwithPreviousModelingStudies ............. 53 2.6Conclusions ................................... 54 3ECOGEOMORPHICFEEDBACKSBETWEENSEALEVELRISE,ESTUARYHYDRODYNAMICS,ANDVERTICALMARSHACCRETION .......... 71 3.1Introduction ................................... 72 3.2Background ................................... 72 3.3Methods ..................................... 74 3.3.1StudySite ................................ 74 3.3.2ModelSetup ............................... 75 3.4Results ..................................... 76 3.4.1SpatialDistributionofTidalRangeandMarshSubmergence .... 76 3.4.2TidalVelocityAsymmetry ....................... 78 3.5Discussion ................................... 80 3.6Conclusions ................................... 82 4THEROLESOFMARSHCONFIGURATIONANDMARSHMARGINRETREATONTIDALINLETMORPHOLOGY ......................... 98 4.1Introduction ................................... 98 4.2ModelDetails .................................. 100 4.2.1StudySites ............................... 103 4.3Results ..................................... 104 4.4Discussion ................................... 106 4.4.1TwoMainMechanismsforTidalPrismChange ........... 106 4.4.2MarshLossSpatialDistribution .................... 107 4.4.3InuenceonAdjacentShorelines ................... 107 4.4.4OtherInuenceonMarshLoss .................... 108 4.4.5ApplicationtoBarrierSystemsWorldwide .............. 109 4.5Conclusions ................................... 109 APPENDIX ADELFT3DMODELSETUP ............................. 117 A.1ModelPhysicalProcesses ........................... 117 A.2Delft3D-FLOWModelSetup .......................... 118 A.2.1LandBoundaryFileGeneration .................... 119 A.2.2GridGeneration ............................. 120 A.2.3BathymetryGeneration ......................... 121 A.2.4CreatinganMDF-File ......................... 122 A.2.5Executingmodelrun .......................... 126 A.2.6Viewingmodeloutput ......................... 126 BMODELINPUTPARAMETERS ........................... 127 6


REFERENCES ....................................... 130 BIOGRAPHICALSKETCH ................................ 138 7


LISTOFTABLES Table page 1-1Inletmorphologicvariables(from Hubbardetal. ( 1979 )) ............. 29 1-2Empiricalparametersforthetidalprism-inletarearelationshipsdevelopedby Jarrett ( 1976 )(formetricunits) ........................... 31 1-3Numberofinletsandcorrelationsforthetidalprism-inletarearelationshipsdevelopedby Jarrett ( 1976 )(formetricunits) ................... 33 1-4Empiricalparametersforthetidalprism-ebbshoalvolumerelationshipsdevelopedby WaltonandAdams ( 1976 )fordifferentwaveenergyregimes. .. 34 4-1Studysiteshydraulic,ecologic,andgeomorphicproperties ........... 116 4-2Inletmorphologicandhydraulicresponsetowetlandloss ............ 116 8


LISTOFFIGURES Figure page 1-1Tidalinletelementsshownonatypicalmixed-energytidalinletsystem. .... 30 1-2Morphologyofatypicaloodshoal(reproducedfrom Hayes ( 1980 ) ...... 31 1-3Conceptualmodelsofsedimentbypassing(from FitzGeraldetal. ( 2000 )). ... 32 1-4Coastalclassication(reproducedfrom Hayes ( 1979 )). ............. 33 1-5PatternsinthenumberandspacingoftidalinletsasafunctionofwaveversustidalenergyalongtheGeorgiaBight(from FitzGerald ( 1996 )). ......... 34 1-6TidalinlettypesintheGeorgiaembayment(reproducedfrom Hubbardetal. ( 1979 )) ........................................ 35 1-7Escoferstabilitycurve(from Escofer ( 1940 1977 )). .............. 36 2-1MapoftheSeaIslandChainwithaninsetoftheSaintMarysRiverEntrancebasin. ......................................... 56 2-2ContourmapoftheSaintMarysEntrancebasinbathymetry ........... 57 2-3ThecumulativedistributionoftheelevationswithintheSt.MarysRiverbasinmodeldomain .................................... 58 2-4ThetemporaldistributionofoodedbasinareaintheSaintMarysRiverEntrancebasin .................................... 59 2-5AmapoftheNOAAFernandinaBeachCurrentsProjectbottom-mountedworkhorseADCPdeploymentlocationsandcorrespondingdeploymentdates 60 2-6WaterelevationsatNOAAtidestation8720030andtheco-locatedDelft3Dmodeledwaterlevels ............................ 61 2-7TimeseriesplotsofsurfacecurrentspeedsfromADCPdataandco-locatedmodeldatafortherst3fulldaysofdeployment. ................. 62 2-8ScatterplotsofsurfacecurrentUandVcomponentswiththe95%condenceellipseandprincipalaxesfromthesixNOAAADCPstationsandco-locatedmodeldata. ...................................... 63 2-9ModelcomparisonswithNOAAADCPdata .................... 64 2-10Modeloutputofwaterlevel,instantaneousdischarge,andcalculatedtidalprism. ......................................... 65 2-11Thechangeinthetemporaldistributionofoodedbasinareaandthechangeinthetemporallyaveragedbasinareawithsealevelrise. ............ 66 9


2-12Thechangeintemporallyaveragedoodedbasinareaduetosealevelrise,forastaticmarshplatformandamarshplatformaccretingatthesamepaceassealevelrise. ................................... 67 2-13Theidealtidalprism,themodeledtidalprism,andtheratioofmodeledtoidealtidalprism. ...................................... 68 2-14Thechangeinmodeledtidalprism ......................... 69 2-15Changeincross-sectionalareaandebbshoalvolumeduetosealevelrise .. 70 3-1MapofSaintMarysEntrancewithmarshvegetatedareahighlighted,insetonamapoftheSeaIslandChain. ........................... 84 3-2MapofelevationsintheSaintMarysEntrance .................. 85 3-3ThedistributionofelevationsintheSaintMarysEntrancebasin ......... 86 3-4ThetemporaldistributionofoodedbasinareaintheSaintMarysEntrancebasinforpresentsealevelconditions. ....................... 87 3-5Thespatialdistributionofthechangeintidalrangefrompresentsealevelconditionsasaresultofasealevelriseonanaccretingmarshplatform. ........................................ 88 3-6Thespatialdistributionofthechangeintidalrangefrompresentsealevelconditionsasaresultofasealevelriseonastaticmarshplatform. ....... 89 3-7Thechangeintheaveragetidalrangeover10tidalcyclesduetosealevelriseforsevenchannellocations. .......................... 90 3-8Thespatialdistributionofsubmergencedurationforvarioussealevelrisemagnitudesonastaticmarshplatform. ...................... 91 3-9Timeseriesofwaterdepthatthreepointslocatedonthemarshplatformforsealevelriseof0to100cmat20cmintervalsforastaticmarshsystem. ... 92 3-10Thevelocitystageplotandthetimeseriesofthewaterlevelsandthespatiallyaveragedvelocitythroughtheinletforpresentsealevelandasealevelriseof60cmonastaticandanaccretingmarshplatform. .............. 93 3-11Thechangeintimeatwhichtidalowreversalsoccurduetosealevelrise .. 94 3-12Thespatiallyaveragedvelocityacrosstheinlet,thecubeofthespatiallyaveragedvelocity,andthecumulativeofthespatiallyaveragedvelocitycubedforsealevelriseonanaccretingmarshplatform. ................. 95 3-13Thespatiallyaveragedvelocityacrosstheinlet,thecubeofthespatiallyaveragedvelocity,andthecumulativeofthespatiallyaveragedvelocitycubedforsealevelriseonastaticmarshplatform. .................... 96 10


3-14Theratiooftheoodtoebbsedimenttransportproxy .............. 97 4-1Conceptualmodeloftidalinletgeomorphicresponsetosealevelrise. ..... 111 4-2Diagramillustratinghowthebasinsareparameterizedintotwosectionsoneithersideoftheinletchannel. ........................... 111 4-3Mapsoftheback-barrierbasinsexaminedinthisstudy .............. 112 4-4ThechangeintidalprismduetowetlandvegetationlossforPLIandSAI. ... 113 4-5Theimpactofmarshvegetationlossontidalprism,cross-sectionalareaofinletchannel,andebbshoalvolume. ........................ 114 4-6SchematicIllustrationofwetlandvegetationlossintwobasinswithecogeomorphiccongurationssimilartoSAIandPLI ............... 115 11


ABBREVIATIONS ADCPAcousticDopplerCurrentProlerAMAccretingMarshCIRPCoastalInletResearchProgramHWFRHighWaterFlowReversalIPCCIntergovernmentalPanelonClimateChangeLWFRLowWaterFlowReversalMHWMeanHighWaterMLWMeanLowWaterMSLMeanSeaLevelNWINationalWetlandsInventoryNGDCNationalGeophysicalDataCenterNOAANationalOceanicandAtmosphericAdministrationPLIPoncedeLeonInlet,FLSAISaintAugustineInlet,FLSMStaticMarshSMESaintMarysEntrance,FLUSGSUnitedStatesGeologicalSurvey 12


AbstractofDissertationPresentedtotheGraduateSchooloftheUniversityofFloridainPartialFulllmentoftheRequirementsfortheDegreeofDoctorofPhilosophyTHEROLEOFMARSHPLATFORMMORPHOLOGYINTHEGEOMORPHICRESPONSEOFTIDALINLETSYSTEMSTOSEALEVELRISEByJessicaLorenLoveringMay2013Chair:PeterN.AdamsMajor:GeologyThemorphologicevolutionoftidalinletsdependsontheecogeomorphicbehavioroftheback-barrierbasin,andexertsstronginuenceonlocalshorelineresponsetosealevelrise.Inthisthesis,Iinvestigatetheroleofwetlandvegetationontidalinletresponsetosealevelrisethroughthreeapproaches,witheachapproachinvestigatingaspecicsetofprocesslinkages:(1)Verticalmarshaccretioncontrolonchangestothetidalprism,inletchannelcross-sectionalarea,andebbshoalvolumesduetosealevelrise,(2)changestothesedimentavailabilitytothemarshplatformbysealevelriseinducedalterationstotheinlethydrodynamics,and(3)theinuenceofmarshcongurationandedgeerosiononthetidalprism,inletchannelcross-sectionalarea,andebbshoalvolume.Investigatinglinksamongchangestowetlandvegetation,hydrodynamicsoftheback-barrierbasin,andinletmorphologywillbeacriticaladvanceinunderstandinghowshorelineswithbarrierislandsystemswillevolveundersealevelriseworldwide.Howdoesverticalmarshaccretioninuencethetidalprism,inletchannelcross-sectionalarea,andebbshoalvolumeduringsealevelrise?Usinganumericalhydrodynamicmodel,pairedwithempiricallyderivedmorphologicrelationships,thisstudyexploresthebehaviorofaback-barrierbasinundertwoend-memberverticalmarshaccretionscenarios:(A)noaccretion,whereinmarshislandsbecomesubmerged,changingboththeoodedbasinareaandthespatialpatternoftidalwave 13


attenuation,and(B)amarshaccretionrateequaltotherateofsealevelrise,whereinmarshtidalchannelsdeepenbutmaintaintheircoursesandtheassociatedfrictionreductionleadstoamoreefcienttidalexchangebetweentheoceanandback-barrierbasin.Underbothmarshaccretionscenarios,asimilarincreaseintidalprismduetochanneldeepeningandimprovedexchangeefciencyisobserved.Onastaticmarshplatform,thisincreaseisampliedbytheadditionofoodedbasinareascontributingtotheexchange.ScenarioA(noaccretion)producedatidalprism,inletcross-sectionalarea,andebbshoalvolumeincreasedoublethatoftheincreasecalculatedforscenarioB(pace-keepingaccretion).Theincreaseinequilibriuminletchannelcross-sectionalarea,arisingfromscourprocesses,exceedstheincreaseduetosealevelrisealone,illustratingtheinuentialcontributionfrommarshtidalowprocesses.Howdoesverticalmarshaccretionchangethehydrodynamicresponsetosealevelriseintheback-barrierbasinandtheavailabilityofsedimenttothemarshplatform?Verticalmarshaccretionresultsfromallochthonoussedimentavailabilityandautochthonoussedimentproducedinsitubymarshvegetation.Increaseddurationofmarshvegetationsubmergencecanleadtovegetationwaterlogginganddrowning,leadingtoreducedplantproductionandautochthonoussedimentavailabilityonmarshplatforms.Changestotheinletexchangeefciencyduringatidalcyclemodiesthetemporalpatternoftidalvelocityasymmetryandthebalanceofsedimentbetweentheoceanandbasin,alteringtheallochthonoussedimentavailabilitytothemarshplatform.Usinganumericalmodelwiththetwoend-membermarshaccretionscenariosdescribedabove,resultsshowthat,forastaticmarshplatform,sealevelrisecausesareasfartherfromtheinletchanneltobesubmergedforlongerperiodsoftimethanareasclosertothechannel,duetoareductionindrainageefciencyduringebbtidalexchange.Theinletsysteminthisstudyisebbdominantundercurrentsealevelconditions,butbecomesmoreooddominantwithsealevelrise.Thisresponseisampliedwhenthemarshplatformisstatic,transitioningtoooddominancewithhighmagnitudesofsea 14


levelrise(>70cm).Marshplatformcongurationplaysacrucialroleinthefeedbacksofthesystem,withthespatialdistributionofdrainageefciencythroughoutthebasinandchangesinexchangeefciencyoveratidalcycledeterminingtheavailabilityofsedimenttothemarshplatform.Whataretherolesofmarshcongurationandmarshmarginretreatontidalprism,inletchannelcross-sectionalarea,andebbshoalvolume?Vegetationlosscanchangethetidalprismforatidalinletsystemby:(1)increasingthemap-viewareaofopenwaterexchangedbetweenthebasinandtheoceanduringatidalcycleand(2)reducingthespatialrateoftidalwaveattenuationwithinthebasin.Inthisstudy,Iuseasimpleconceptualmodel,asopposedtothenumericalhydrodynamicmodelusedintheaforementionedwork,toexplorethegeomorphicresponseoftwoFloridainlets,ofcontrastingwetlandcongurations,touniformback-barrierbasinvegetationlossthatmightresultfromcurrentprojectionsofsealevelrise.Allresultsshowthatvegetationlosscausesanincreaseintidalprism,inletcross-sectionalarea,andebbshoalvolume,butinletswithwetlandcongurationsthatstronglyincreasetidalwaveattenuationintheback-barrierbasinhaveanampliedresponsetovegetationloss.Fromempiricalrelationships,itisfoundthataonepercentlossofback-barrierbasinvegetatedarearesultsinanincreaseofebbshoalvolumebyanamountapproximatelyequivalenttoannualtobienniallongshoresedimenttransportratesalongtheFloridaAtlanticcoast.Theconceptualmodeldevelopedinthisstudycanbeusedtoexaminemorphologicresponseoftidalinletsystemstowetlandvegetationlossatsimilarbarrierislandcomplexesworldwide. 15


CHAPTER1GENERALINTRODUCTION 1.1ProblemStatementCoastalshorelineresponsetosealevelrisehasbeenstudiedanddebatedsincethemiddleofthe20thcentury,buttherehavebeencomparativelyfewstudiesthatfocusontheimpactofsealevelriseonthemorphologyandbehavioroftidalinletsystems( Dissanayakeetal. 2009 ; FitzGeraldetal. 2007 ; Listetal. 1997 ; VanGooretal. 2003 ).Atidalinletcanbeconsideredtobeacriticalcomponentofasandsharingsystem,inwhichthesubmergedsandbodies(ebbandoodshoalcomplexes)andadjacentbeachesareinterconnected( Dean 1988 ).Tidalinletsinterruptthewavecurrent-inducedsedimenttransportalongshore,sequesteringsedimentinebbandoodshoals,shallowfeaturesthatredistributethepatternofincomingwaveenergyuxtotheshoreline.Asaresult,shorelineretreatratesnearaninletcanbeuptotwoordersofmagnitudegreaterthanmean,long-termshorelineretreatratesalonguninterruptedportionsofsandycoasts( FitzGerald 1988 ; WaltonandAdams 1976 ).Ifsealevelriseincreasesthetidalprismthatinundatesthebackbarrierbasinviatheinlet,theequilibriumvolumeoftheinlet'sebbshoalshouldincrease,andthesedimentbudgetforthesystemwilladjust,toaccommodatethisincrease,byremovingsedimentfromadjacentbeaches( Dean 1988 ).Tidalinletresponsetosealevelriseiscomplicatedbytherelationshipsbetweeninlethydrodynamics,morphodynamics,andbackbarrierbasinwetlandecology.Thisresearchadvancesourunderstandingoftheroleplayedbymarshplatformaccretionontheresponseofinletmorphologytosealevelrise,acriticalstepinunderstandingtheevolutionofsandycoasts,ingeneral,subjecttosealevelrise. 1.2OutlineofPresentationThischapterprovidesbackgroundinformationontidalinletandback-barrierbasinmarshsystems.Theelementsofatidalinletsystemaredescribedandsomedetailsconcerningtheclassicationofinletsandequilibriumrelationships,fromthe 16


scienticliterature,arereviewed.Saltmarshsystemsandtheirresponsetochangesinrelativesealevelarealsodiscussed.Chapter 2 presentsresearchthatusesanumericalhydrodynamicmodeltoexplorechangestothetidalprismofaninletduringsealevelriseundertwoend-member,marshaccretionscenarios.Theresultsofthemodelingexperimentareusedtomakeastatementaboutthechangesexpectedtooccurtotheinletcross-sectionalareaandebbshoalvolume.InChapter 3 ,thesamenumericalmodelisusedtoexplorethecontrolofmarshaccretionrateontheavailabilityofsedimenttothemarshplatform,throughalterationstothetidalvelocitytemporalasymmetryandthemarshplatformsubmergencedurations.Chapter 4 presentsaninvestigationofthedecadalscaleimpactsofmarshresponsetosealevelrise.Specically,howdoesthedecreaseinmarsharealextent,throughplatformedgeerosion,changethetidalprism,inletcross-sectionalarea,andebbshoalvolume?Theinvestigationisappliedtotwoinletsystemsofnotablydifferentinitialmarshcongurations. 1.3TidalInletSystems 1.3.1MorphologicElementsAtidalinletactsasaprincipalvalvefortheexchangeofwaterandsedimentsbetweentheoceanandaback-barrierbasin.Atidalinletsystemiscomposedoftheinletchannel,ebbandoodshoalcomplexes,adjacentbarrierislands,andthecontiguouswetlands.Eachcomponentofthetidalinletispartofasandsharingsystem,whichisassimilatedintotheregionalsedimentbudget.Themorphologyofaninletiscontrolledbygeologicsetting,riverinow,tidalexchange,andwaves.Aswaterlevelsintheoceanincreasewiththerisingtide,waterandsedimentistransportedthroughtheinletchannelandintothebasin,astheowexpandsintheopenbasinitslowsanddepositssedimentonoodshoals( DeanandWalton 1973 ).Asthewaterintheoceanlowerswiththefallingtide,waterandsedimentfromthebasinowsbackintotheoceananddepositssedimentonebbshoals( DeanandWalton 1973 ).Ebbshoalsinteract 17


withlongshorecurrentsandwaves,leadingtoasedimenttransferbetweenadjacentshorelinesandebbshoals.Theoodtidalprismofthesystemisthetotalvolumeofwaterthatowsintothebasinwitharisingoceantide,andtheebbtidalprismthevolumeofwateremptiedfromthebasinduringthefallingoceantide.TidalInletsystemscanbedividedintodifferentelements,whereeachelementhasitsownfunctioninthesandsharingsystem.Figure 1-1 showstheseelementsonaninlettypicalofamixedenergysystem. 1-2 )consistsofaoodrampandbifurcatingoodchannelsontheseawardside,andebbsshields,ebbspits,andspilloverlobesonthelandwardside.Floodcurrentsdominatetheowovertheoodrampandoodchannels;thiscanbeseenbytheexistenceofood-orientedsandwaves.Smallerbedformstransitionbetweenorientationsduringthetidalcycle( Hayes 1980 ).Theebbshieldisthetopographichigh,whichactstoprotecttheinnershoalduringebbtidalexchange.Floodshoalmorphologytendstowardanequilibriumshapeandvolumerapidlyandthendepositionslowsasitapproachesanequilibriumvolume.ThisisshowninobservationsmadeatSt.LucieInlet,FL,aftertheinletwasrstopenedthedepositionofsedimentclosetotheinletchannelwasrapidandthenslowed,atwhichpointthesedimentwasdepositedfurtherintotheinletbasin( DeanandWalton 1973 ). 1-1 ,andarecomposedofthemainebbchannel,channelmarginlinearbars,theterminallobe,swashplatform,swashbars,andmarginaloodchannels( FitzGeraldandFitzGerald 1977 ; GibeautandDavis 1993 ; Hayes 1979 1980 ).Themorphologicfeaturesoftheebbshoalcomplexaredeterminedbythedynamicbalancebetweenanetoffshoredirectedsedimentuxinducedbytheebbdominantcurrentsandanetonshoredirected 18


sedimentuxinducedbyoffshorewaves( Hayes 1980 ).Thechannelmarginlinearbars,levee-likebarsthatankthemainebbchannel,andswashbars,locatedontheswashplatform,areformedbyaninteractionoftideandwavegeneratedcurrents( Hayes 1980 ).Theterminallobe,theseawardmostsedimentdeposit,hasashallowslopeonthebasinsideoftheshoal,transitioningtoasteepslopeontheoceansideoftheshoal( BuonaiutoandKraus 2003 ).Insomemixed-energycoastalsystems,thevolumeofsedimentstoredintheebbshoalcomplexcanbecomparabletothevolumeofadjacentbarrierislands( FitzGerald 1988 ). FitzGerald ( 1988 )statedfromobservationsthatthesizeofthebarcomplexisproportionaltothesizeoftheinletandthemagnitudeoflongshoretransport.Ebbshoalstransferorbypasssedimentfromtheupdriftsideofthetidalinlettothedowndriftbarriercoastaccordingtothestateofmaturityoftheshoal,themagnitudeofthetidalprism,andlocalwaveconditions( BruunandGerritsen 1959 ; FitzGerald 1988 ; Kraus 2000 ).Naturalmechanismsforthisbypassingwererstdescribedby BruunandGerritsen ( 1959 ).Themechanismforbypassingiscontrolledbytheratiooflongshoresedimenttransport(Mmeaninyd3/yr)tothemaximumdischargeoftheinletduringspringtide(Qmaxinyd3/sec),usingtheequation: r=Mmean=Qmax.(1) BruunandGerritsen ( 1959 )describedthreemechanismsfortransport:1)bywaveinducedsedimenttransportalongtheedgeoftheterminallobe,2)throughtidalcurrentinducedsedimenttransportinthechannels,and3)bythemigrationoftidalchannelsandsandbars.Thestudyshowsthat,forahighratiooflongshoretransporttotidalcurrents(r=200-300),themainmechanismforbypassingisbywaveactionalongtheterminallobe.Withsmallratios(r=10-20),sedimenttransferismainlycontrolledbytidalowbypassingandbysandbarmigration.Theyalsonotedthatatmanyinlets,bypassingoccursasacombinationoftheseprocesses. 19


FitzGerald ( 1982 )usedeldinvestigationstodeterminethatalargeportionofsedimenttransportedatmixed-energytidalinletsystemsoccursthroughinletmigration,spitbreaching,andtheformationandlandwardmigrationofbarcomplexes. FitzGerald ( 1982 )presentedtheexistenceofdowndriftattachmentpointsforsedimentbypassing.Thelocationofthesepointsiscontrolledbythebypassingbar,whichisdependentoninletsize,ebbchannelorientation,andtherelativestrengthofwaveandtidalforces. GaudianoandKana ( 2001 )documentedtheepisodicbypassingbycyclicshoalattachmentalongthecoastofSouthCarolina.Usinghistoricalphotographsspanning58years,theyshowacycleofdiscretebarsbecomingdetachedfromebbshoalsandmigratingonshoretoadjacentshorelines. FitzGeraldetal. ( 2000 )constructedarangeofsedimentbypassingconceptualmodelsbuiltonworkdoneinpreviousstudiesby BruunandGerritsen ( 1959 ), Bruun ( 1966 ).and FitzGerald ( 1982 1988 ),andissummarizedinFigure 1-3 1.3.2InletClassication Davies ( 1964 )classiesdepositionalshorelinesaccordingtotidalrange,wheremicrotidalcoastshaveatidalrangeofupto2m,mesotidalcoastshaveatidalrangeof2to4m,andmacrotidalcoastshaveatidalrangeofover4m. Hayes ( 1975 )wasthersttorecognizetheinuenceoftidalrangeonthemorphologicfeaturesoftidalinletandbarrierislandsystems.Usingthetidalrangeclassicationof Davies ( 1964 )andassumingmoderatewaveenergy, Hayes ( 1975 )describedthemorphologicfeaturesofeachtypeofsystem.Microtidalcoastsaretypicallylongandcontinuousbarrierislandchainswithfewtidalinlets,withsmallornonexistentebbtidalshoalsandlargeoodtidalshoals.Mesotidalcoaststypicallyformdrumsticktypebarrierislands,punctuatedbyfrequenttidalinlets.Thesesystemsgenerallyhavelargeebbshoalsandoodshoalsthataresmallornonexistent.Macrotidalcoaststypicallyconsistofintertidalatsandsaltmarshesratherbarrierislandsystems. Hayes ( 1979 )renestheclassicationsystemtoincludetherelationshipbetweentidalrangeandwaveenergy.Themodied 20


classicationisbrokenintovezones:tide-dominated(high),tide-dominated(low),mixed-energy(tide-dominated),mixed-energy(wave-dominated),andwave-dominated.Figure 1-4 illustratestheclassicationzonerangesforeachcombinationofwaveandtidalrange.NumerousstudiesdiscussthemorphologyofinletsystemsalongtheGeorgiaBightbarriersystem,extendingbetweenCapeHatteras,NCandCapeCanaveral,FL( Hayes 1994 ; Hubbardetal. 1979 ; Nummedaletal. 1977 ). Nummedaletal. ( 1977 )showsthatthewaveenergyandtidalrangesarecontrolledbythewidthofthecontinentalshelfandinnershelfslope.Astheshelfwidens,thetidalrangesareincreasedandthewaveenergyisattenuated.ThetidalrangeincreasesandthewaveenergydecreasesastheshelfwidensbetweenNorthCarolinaandGeorgiaandthereverseoccursbetweenGeorgiaandFloridawherethecontinentalshelfnarrows. Hayes ( 1994 )quantiesthistrendinordertomakesacomparisonbetweenthenumberofinletsperunitlengthofcoastline,tidalrange,andwaveenergy.Figure 1-5 from FitzGerald ( 1996 )summarizestheresultsofthesestudiesandillustratesthetrendinshelfwidth,tidalrange,waveheight,andnumberofinletsalongtheGeorgiaBight. Hubbardetal. ( 1979 )usedobservationsfromtheGeorgiaBighttoclassifyinletmorphologyasafunctionofwaveversustidedominance,astheseparameterscontrolsthezonesofequilibriumbetweenonshoreandoffshoresedimentand,therefore,thelocationofdeposition.Figure 1-6 illustratessomeofthemorphologicfeaturesseenineachofthesesystems.Theydescribetide-dominatedinletsascharacterizedbyanebbdominateddeepcentralchannelankedbyextensivechannelmarginbars.Incontrast,wavedominatedinletsaredescribedtobecontrolledbypredominatelylandwardtransport,havingsmallebbtidaldeltaswhichareoftenbreachedbynumerousshallowchannels.Transitionalinletshaveshoalswhicharecontainedintheinletthroat. Hubbardetal. ( 1979 )alsonotesthatinletsystemsintheGeorgiaBightthathavealargertidalrangehavemarshesbehindthebarriersthatareextensiveandrepresenta 21


largeportionofthetotalmarshlandsalongtheentireAtlanticshoreline.ThemorphologicvariablesassociatedwitheachinlettypearedescribedinTable 1-1 1.3.3EquilibriumRelationshipsDespitethecomplexityoftidalinletsystems,somepredictiverelationshipshavebeendevelopedwhichrelatethevolumeandlocationoftheebbshoalcomplexandtheinletcross-sectionalareatothetidalprism.Tidalinletsystemstendtoremaininadynamicequilibrium,andvariationfromtheequilibriumstateinoneofthecomponentswillresultinsedimentexchangebetweenthecomponents( Dean 1988 ; Stiveetal. 1998 ).Largerscalepermanentchangestothesystemcancausetheentireinletsystemtoshifttowardsanewequilibriumstate. LeConte ( 1905 )wasthersttolookintotherelationshipbetweentidalprismandtidalinletminimumcross-sectionalarea,basedonobservationsofasmallnumberofinletsonthePaciccoastoftheU.S..Thestudyconcludesthatnaturerequires33squarefeetofmean-tidesectionforeachandeverymillioncubicfeetoftidalwaterspassinginandoutatspringtides.Thispioneeringworkwasexpandedby O'Brien ( 1931 )toincludemoreinlets.Thisstudydeterminedthattherelationshipbetweentidalprismandcross-sectionalareaisnotquitelinear,butfollowthepowerlawrelationship: A=CPq(1)whereA(m2)isthecross-sectionalarea,P(m3)isthespringtidalprism,andCandqareempiricalparametersobtainedfromobservationaldata. O'Brien ( 1969 )completedafollow-upstudywithmoretidalinlets,includingsomeontheAtlanticcoastandoneontheGulfofMexico.Theadditionofthisdatasupportedtheoriginalstudycompletedby LeConte ( 1905 )thattherelationshipwaslinear(q=1).Physicalmodelsofthesystemalsofoundthattherelationshipbetweentidalprismandcross-sectional 22


areaatun-modiedinletscouldbeapproximatedasliner( DelmonteandJohnson 1971 ; Johnson 1972 ; Lin 1969 ; Nayak 1971 ). Jarrett ( 1976 )compileddatafrom108NorthAmericaninlets,59ontheAtlanticcoast,24ontheGulfofMexico,and25onthePaciccoast.Thestudyseparatedtheinletsintothreecategoriesaccordingtoengineeringmodication:(1)allinlets,(2)inletswithnojettiesorasinglejetty,and(3)inletswithtwojetties.Withinthecategories,inletswerefurtherseparatedaccordingtothefollowinggeographiclocations:(a)inletsonallthreecoasts,(b)inletsontheAtlanticcoast,(c)inletsontheGulfcoast,and(d)inletsonthePaciccoast.Theempiricalparameters,Candq,calculatedforeachofthetwelvecombinations,alongwiththecoefcientofdeterminationisshowninTable 1-2 andTable 1-3 .Studiesinvestigatingtheempiricalparameters,Candq,foradditionalinletdatasetinclude vandeKreeke ( 1992 )and Powelletal. ( 2006 )forNorthAmericaninlets, Shigemura ( 1980 )forJapaneseinlets, Diekmannetal. ( 1988 )forinletsintheWaddenSea, GerritsenandLouters ( 1990 )and vandeKreeke ( 1993 )forDutchinlets,and HumeandHerdendorf ( 1993 )forinletsinNewZealand.Workpresentedby Escofer ( 1940 )canbeusedtoexplainthetheoreticalderivationoftherelationshipbetweentidalprismandcross-sectionalarea.Thediagramillustratesthehydraulicrelationshipbetweentheinletcross-sectionalareaandthepeakmeanvelocitythroughtheinletchannel.Thepeakmeanvelocityisthemaximumowduringatidalcyclespatiallyaveragedthroughthecross-sectionoftheinletthroat.Thisrelationshipproducestheso-calledEscoferstabilitycurve,theshapeofwhichisdependentonthehydraulicpropertiesoftheinlet(i.e.,backbasinarea,tidalrange,inletlength,inletwidth,andfrictionthroughtheinletthroat).Itwasdeterminedthatthereisacriticalvalueofthevelocity,beyondwhichnetscouroftheinletoccurs.Fieldobservationshavefoundthatthiscriticalvelocityisapproximately1m/s,regardlessofsedimentcharacteristics( Bruunetal. 1960 ; O'Brien 1969 ).Iftheinletcross-sectionalareaislessthanequilibrium,thevelocityexceedsthecriticalvalue, 23


generatingsufcientlyhighbedshearstresstoscouruntiltheequilibriumcross-sectionisreached.Ifthecross-sectionalareaoftheinletisgreaterthantheequilibriumvalue,thevelocitydecreases,loweringthebedshearstress,leadingtodepositioninthechanneluntilequilibriumcrosssectionalareaisattained.Figure 1-7 illustratesanexampleEscofercurveforaninlet. vandeKreeke ( 2004 )usedtheEscofercurvetoinvestigatehowthereductionofbackbasinareafortheFrisianinlet,locatedontheNorthSeaalongtheDutchcoast,wouldchangetheequilibriumcross-sectionalareaoftheinlet.Anextrapolationoftheobservationsofthecross-sectionalareachangeduringa17yearperiodfollowingbasinreductioniswithintherangeofvaluespreviouslypredictedusingtheEscofercurveforanewequilibrium( vandeKreeke 1993 ).BasedontheEscofermethods,theequilibriumcross-sectionalareawasexpectedtoreducefrom22,000m2to15,500m2 vandeKreeke ( 2004 ).Fieldmeasurementsofthethistransformationindicateanadaptationtimescaleofapproximately30years( vandeKreeke 2004 ).,sometransportedlandwardanddepositedonoodshoal,andsometransportedseawardanddepositedonebbshoals.Asebbshoalsgrow,theybecomeshallowerandmoresusceptibletowaveforces.Thesewaveforcestendtotransportsedimentofftheshoalandbackintothenearshoresystem.Thesetwoforcesacttobalancethegrowthoftheshoal.SomestudiesfrominletsalongtheNorthAmericancoasthaveshownthatebbdeltavolumedependsonthetidalprism,inletgeometry,shorelineconguration,offshorebathymetry,waveclimate,littoraldrift,sedimentsize,andfreshwaterrunoff( FitzGerald 1988 ; HicksandHume 1996 ; Hubbardetal. 1979 ; MarinoandMehta 1987 ; WaltonandAdams 1976 ). WaltonandAdams ( 1976 )exploredthisrelationshipbycomparingebbshoalvolumesunderthethreewaveenergyregimes:(1)highlyexposed,(2)moderatelyexposed,(3)mildlyexposed.Thestudyuses44inletsalongtheAtlanticcoast,Paciccoast,andGulf 24


ofMexicotoperformedalinearregressionttothepowerlawrelationship: V=aPb,(1)whereVisvolumeofsedimentstoredintheebbshoal(m3),PistheTidalprism(m3),andaandbareempiricalparametersdeterminedfromobservations.TheresultsofthestudyareshowninTable 1-4 foreachofthewaveregimesandforalltheinlets. FitzGerald ( 1988 )usedtheregressioncurvetocalculatethatachangeintidalprismof5%atKennebecRiverestuarywouldleadtoanincreaseintheebbshoalvolumebybetween0.57108and1.04108m3. FitzGerald ( 1988 )estimatesthatthedecitcouldcauselocalsedimenterosionofthecoast,leadingtoover100mofshorelinerecession.Theresponsetimeofthesystemtoreachthisnewequilibriumisunknown,butispredictedtotaketensofyears( FitzGerald 1988 ). MarinoandMehta ( 1987 )builduponthe WaltonandAdams ( 1976 )studybyexpandingthefactorsinuencingtheebbshoalvolumetoincludethetidalprism,inletwidthtodepthratio,thecross-sectionalarea,andspringtidalamplitude.Theyestimateebbshoalvolumesfrom18inletslocatedontheAtlanticcoastofFlorida,totaling420millioncubicmetersofsediment.ThestudyusesadimensionalanalysisapproachtodeterminewhichparametersmostaccuratelyexplainthetrendsfoundintheebbshoalvolumesofftheFloridaAtlanticcoast.Alinearregressionisappliedtotheobservationaldatatotthesamepowerlawrelationshipas WaltonandAdams ( 1976 ),ndinga=5.5910)]TJ /F7 7.97 Tf 6.58 0 Td[(4andb=1.39,withacorrelationcoefcientof0.75.Theyproposethatthisislowduetotheinuenceofotherfactorsoutsidethewaveandtidalenergy.Theydiscoveredthatifallotherfactorsweretoremainconstant,thenagreaterwidthtodepthratiooftheinletchannelwouldresultinsmallerebbshoalsandviceversa. HicksandHume ( 1996 )calculatedsandvolumesfor17ebbshoalslocatedatnaturalinletsalongtheNewZealandNorthIslandcoast.Theyfoundthatthemaincontrolonebbshoalvolumewastidalprism,theanglebetweentheoutowjetand 25


shoreline(),andthewaveclimate.Largertidalprisms,lowerenergywaveclimates,andlargeroutowjetangles(moreshorenormal)tendtoincreasetheebbshoalvolume.Theyfoundthattheempiricalequation: V=1.3710)]TJ /F7 7.97 Tf 6.59 0 Td[(3P1.32(sin)1.38(1)accountsfor83%ofthevarianceintheebbshoalvolume.Includingtheeffectsofoutowjetanglesisofhigherimportanceonactivemargincoasts,suchasthoseinNewZealand,whererockyshorelinesmaydictatethisangle.Theyfoundthathigh-energycoaststendtohavesmallershoalsthanonthoseonlow-energycoastswithasimilarmagnitudetidalprism.Therearelinksbetweentidalprismandtheextent(bothseawardanddowndrift)oftheebbshoalcomplex( Carr-Bettsetal. 2012 )andtheminimumdepthovertheebbshoalcrest( BuonaiutoandKraus 2003 ). Carr-Bettsetal. ( 2012 )foundthattheseawardanddowndriftextentoftheebbshoalremainsconstantfortidalprismslessthat108m3andincreaselinearlywithtidalprismfortidalprismsgreaterthan108m3.Thisrelationshipbetweentidalprismandebbshoallocationwashighlycorrelatedformildlyorhighlywave-exposedinlets,buttherewasnocorrelationformoderatelyexposedcoasts.Astidalprismincreases,theebbshoalspreadsfurtheroffshoreandinthedowndriftdirection,andtheshoaloccupiesadeeperwaterdepth( BuonaiutoandKraus 2003 ; Carr-Bettsetal. 2012 ). 1.4SaltMarshes 1.4.1TypesofSaltMarshesSaltmarshesinhabittheupperintertidalregionbetweenthetidalatsandtheuplandenvironment,andaredominatedbyavarietyofhalophytic(salt-tolerant)vegetation.Mostmarshmorphologiescanbeclassiedasrampedorplatform,dependingontherelativeamountofsupratidal(highmarsh)andintertidal(lowmarsh)vegetation.Marshsystemswithlargeamountsofhighmarshesplantsexhibitaplatform 26


morphology,thosewithanevenlydistributedamountofhighandlowmarsheshavearampedprole.Thedistributionoflowmarshvegetationspeciesarecontrolledbyphysicalstressestothesystem,suchasoodingandanoxia,whilethedistributionofhighmarshvegetationiscontrolledbyinterspecicplantcompetition( DonnellyandBertness 2001 ).Netverticalaccretioninmarshesisdependentonthebalanceoftidalrange,wind-waveclimate,sedimentsupply,relativesealevelrise,sedimentcompaction,subsidence,andvegetationproductivity( Reed 1990 ).Marshsedimentscanhavetwomodesoforigins:allochthonous(mineral,negrainparticlesbroughtfromoodingwateroutsidethemarshes)andautochthonous(deadorganicmatterproducedfromthesaltmarshvegetation).Therelativeamountofsedimenttypesdependsontheavailabilityofmineralsediments,tidalrange,storminess,vegetationtype,andvegetationproductivity,factorswhichvaryspatiallyacrossthemarsh( deGrootetal. 2011 ). 1.4.2SaltMarshResponsetoSeaLevelMarshescanrespondtosealevelriseby:(1)activelyexpandingverticallyandlaterallyifaccretionratesarefasterthanlocalsubmergence,(2)maintainingastableelevationbytrappingsedimentsandaccretingverticallyatthesamerateaslocalsubmergence,or(3)themarshsystemdrownsbynotbeingabletoaccreteverticallyatthesamerateofsubmergence( Orsonetal. 1985 ).Whenanon-aquaticplanthasitsrootssubmergedforprolongedperiodsoftime,theplantisnotsuppliedwithsufcientoxygenandwillbecomewaterloggedanddrown.Asthedrowningofindividualplantsoccur,themarshsystemwilllosebiomassandtheamountofinsitusedimentproductionwillbecomereduced.Thisfurtherretardstheabilityofthesystemtoaccretevertically,andtheentiremarshsystemmaydrown( Orsonetal. 1985 ).Marshplantshavesomenegativefeedbackmechanismswhichgivethemtheabilitytomaintainelevationwithmoderatelevelsofrelativesealevelrise. Morrisetal. ( 2002 )completedastudyonSpartinaalterniorainSouthCarolinatoinvestigatehowthemarshcordgrassrespondstoanincreaseinsealevel.Theyfoundthatthebiomass 27


ofthiscordgrassincreaseswithdepthbelowhightide(uptoalimit).Higherbiomassincreasesaggradationratesonadeeperplatform,allowingtheplantstoequilibratetoaslightincreaseintherateofsealevelrise.Theyfoundthatthereisanoptimalrateofrelativesealevelriseforplantgrowth,whichalsorepresentstheupperlimitatwhichthecommunityisabletosustaintheelevation.Numerouseldstudiesandnumericalmodelshavebeenusedtoshowthatthestabilityofamarshsystemishighlydependentonthemagnitudeofthetidalrangeofthesystem( KirwanandGuntenspergen 2010 ; Kirwanetal. 2010 ; Reed 1995 ; Simasetal. 2001 ).Lossofmarshvegetationcanvarygreatlybetweenregions,withlowtidalrangeareas(suchastheAtlanticcoastofNorthandCentralAmerica,theBaltic,andtheMediterranean)beingparticularlyvulnerable( Reed 1995 ). Kirwanetal. ( 2010 )compiledtheresultsofvenumericalmodelsofmarshevolutiontondthresholdratesofsealevelriseatwhichmarsheswouldnotsurviveunderavarietyofsuspendedsedimentconcentrationsandtidalranges.Theyfoundthatforagivensuspendedsedimentconcentration,theabilityofamacrotidalmarsh(TR>4m)wasabletoadapttoasealevelriserateuptoanorderofmagnitudegreaterthanamicrotidalmarsh(TR<2m).Themodelresultsindicatethatforsuspendedsedimentconcentrationsover20mg/Landatidalrangeover1m,thethresholdrateofrelativesealevelwouldbeapproximately10mm/yr.Theypredictthatthisconversionofmarshtosubtidalenvironmentwouldoccurabout30-40yearsafterthethresholdratewasmet. DonnellyandBertness ( 2001 )tookcoresamplesfromaNewEnglandmarshsystemtoseetheevolutionofplantzonalboundariesovertime.Theyfoundthatthelowermarshes,dominatedbycordgrasses(Spartinaalterniora),slowlymovedlandwardattheexpenseofhighermarshspecies,dominatedbymarshhay(Spartinapatens),spikegrass(Distichlisspicata),andblackrush(Juncusgerardi).Thetimingoftheonsetofthisboundarymigrationwasshowntomatcharegionalincreaseofsealevelriserate(from2.4mm/yrto4.2mm/yr)recordedbyaNewYorktidegage.The 28


abilityofthecordgrasstooxygenatethesubstrateallowedthespeciestosurviveduringthehigherrateofsealevelrise.Themarshhay,spikegrass,andblackrushwerenotabletotoleratetherelativelyhighriserates.Thevariationinverticalaccretionandtolerancetosealevelrisebetweenplantsspeciesindifferencezonesofthemarshtransformedthedistributionofplantsacrossthemarshsystem. DonnellyandBertness ( 2001 )predictthattheNewEnglandmarshwilllikelybecomeacordgrass-dominatedsysteminthefutureifrelativesealevelratesremainconstant. Nicholls ( 2004 )usedaclimatemodeltoshowthatunderanIPCCSRESA1FIworld,thatthepotentialcoastalwetlandlossduetosealevelriseis5-20%bythe2080s. Nicholls ( 2004 )alsoinvestigatesthesocio-economicinuenceoncoastalwetlands,ndingthatthewetlandlossduetosealevelriseissmallincomparisontothepotentialhuman-induceddirectandindirectinuencesthatincreasewithpopulationgrowth.HendsthatcoastalwetlandsaremuchmoreatriskunderIPCCscenarioswithlowersocialenvironmentalconsciousness;thisfactorcangreatlyinuencethemarshsystem'svulnerabilitytosealevelrise.Globalcoastalwetlandshavebeendecliningatarateofapproximately1%peryearduringthelate20thcentury,primarilyduetohumanreclamation( Hoozemansetal. 1993 ). 29


Table1-1. Inletmorphologicvariables(from Hubbardetal. ( 1979 )) InletType VariablesWaveDominatedTransitionalTideDominated PrincipalshoallocationsInsidethebay,asamulti-lobateooddeltaInthethroatSeawardoftheinletaslonglinearchannelmarginbars Ebb-tidaldeltaSmallandclosetothebeachVariableLargeextendsfarfromshore Flood-tidaldeltaLarge;lobateordigitatePoorlydevelopedorabsentGenerallyabsent ChannelcharacterPoorlydened:oftenmultipleVariable;oftenonemainchannelandoneormoresecondarychannels.Unstableinshallowerportions5-10mdepthsTendstowardstability.Depthsgreaterthan10m. Width/depthratioModerateVerylargeSmall LagoonWide;openFringingmarsh;marsh-lledMarsh-lledandchannelized SwashbarsPoorlydevelopedVariableVariable SwashplatformsPoorlydevelopedVariableWelldeveloped ChannelmarginbarsAbsentVariableLarge SandbodycharacterTabularVariablePod-like;connedtonearchannels Sandby-passingBarby-passingVariable;ofteninpackets;channelabandonmentimportantPrimarilybyebbcurrentsinthemainchannelandlandwardtransportbywaves 30


Figure1-1. Tidalinletelementsshownonatypicalmixed-energytidalinletsystem. 31


Figure1-2. Morphologyofatypicaloodshoal(reproducedfrom Hayes ( 1980 )).Arrowsindicatedominantdirectionoftidalcurrents Table1-2. Empiricalparametersforthetidalprism-inletarearelationshipsdevelopedby Jarrett ( 1976 )(formetricunits) LocationAllinletsNooroneJettyTwoJetties CqCqCq AllInlets2.4110)]TJ /F7 7.97 Tf 6.58 0 Td[(40.933.6510)]TJ /F7 7.97 Tf 6.59 0 Td[(51.041.4810)]TJ /F7 7.97 Tf 6.59 0 Td[(30.83 AtlanticCoast6.0410)]TJ /F7 7.97 Tf 6.58 0 Td[(51.021.9810)]TJ /F7 7.97 Tf 6.59 0 Td[(51.086.7010)]TJ /F7 7.97 Tf 6.59 0 Td[(40.87 GulfCoast9.3010)]TJ /F7 7.97 Tf 6.58 0 Td[(40.846.9410)]TJ /F7 7.97 Tf 6.59 0 Td[(40.861.4310)]TJ /F7 7.97 Tf 6.59 0 Td[(30.81 PacicCoast4.7510)]TJ /F7 7.97 Tf 6.58 0 Td[(40.888.8310)]TJ /F7 7.97 Tf 6.59 0 Td[(61.101.8810)]TJ /F7 7.97 Tf 6.59 0 Td[(30.82 32


Figure1-3. Conceptualmodelsofsedimentbypassing(from FitzGeraldetal. ( 2000 )). 33


Figure1-4. Coastalclassication(reproducedfrom Hayes ( 1979 )). Table1-3. Numberofinletsandcorrelationsforthetidalprism-inletarearelationshipsdevelopedby Jarrett ( 1976 )(formetricunits) LocationAllinletsNooroneJettyTwoJetties No.ofInletsr2No.ofInletsr2No.ofInletsr2 AllInlets1080.90710.92370.88 AtlanticCoast590.92400.94190.81 GulfCoast240.87210.8730.88 PacicCoast250.92100.97150.93 34


Figure1-5. PatternsinthenumberandspacingoftidalinletsasafunctionofwaveversustidalenergyalongtheGeorgiaBight(from FitzGerald ( 1996 )). Table1-4. Empiricalparametersforthetidalprism-ebbshoalvolumerelationshipsdevelopedby WaltonandAdams ( 1976 )fordifferentwaveenergyregimes. WaveRegimeNo.ofInletsab HighlyExposed78.710)]TJ /F7 7.97 Tf 6.58 0 Td[(51.23 ModeratelyExposed1810.510)]TJ /F7 7.97 Tf 6.59 0 Td[(51.23 MildlyExposed1613.810)]TJ /F7 7.97 Tf 6.59 0 Td[(51.23 AllInlets4410.710)]TJ /F7 7.97 Tf 6.59 0 Td[(51.23 35


Figure1-6. TidalinlettypesintheGeorgiaembayment(reproducedfrom Hubbardetal. ( 1979 )),includingA)tide-dominatedinletsB)wave-dominatedinletsandC)transitionalinlets. 36


Figure1-7. Escoferstabilitycurve(from Escofer ( 1940 1977 )). 37


CHAPTER2HOWDOESVERTICALMARSHACCRETIONCONTROLHYDRODYNAMICANDMORPHOLOGICRESPONSESOFATIDALINLETTOSEALEVELRISE?Sedimentaryaccretioninback-barriermarshesexertsacontrolonthemorphologicresponseoftidalinletsystemstorelativesealevelrise.Weinvestigatethisphenomenonbyapplyinganumericalhydrodynamicmodel,pairedwithempiricallyderivedmorphologicrelationships,toaninletsystemtypicalofamixed-energy,tidedominatedbarrierislandsystem.Weconsidertwoend-member,marshaccretionscenarios:(A)noverticalmarshaccretion,whereinmarshislandsbecomesubmerged,changingboththeoodedbasinareaandthespatialpatternoftidalwaveattenuation,and(B)amarshaccretionrateequaltotherateofsealevelrise,whereinmarshtidalchannelsdeepenbutmaintaintheircoursesandtheassociatedfrictionreductionleadstoamoreefcienttidalexchangebetweentheoceanandback-barrierbasin.Modelresultsshowatidalprismincreaseforbothscenarios,leadingtoincreasesinchannelcross-sectionalareaandebbshoalvolumes.Underbothmarshaccretionscenarios,themechanismofimprovedtidalexchangeefciencythroughchanneldeepening,producesincreasesoftidalprismthataresimilarinmagnitude.Underconditionswithnomarshaccretion,anadditionalmechanism,namelytheexpansionofoodedbasinarea,furtherincreasesthemagnitudeofthetidalprism.ScenarioA(noaccretion)producedatidalprism,inletcross-sectionalarea,andebbshoalvolumeincreasedoublethatoftheincreasecalculatedforscenarioB(pace-keepingaccretion).Theincreaseinequilibriuminletchannelcross-sectionalarea,arisingfromscourprocesses,exceedstheincreaseduetosealevelrisealone,illustratingtheinuenceofmarshtidalowprocesses.Ourresultsindicatethatprocessesthatretardback-barriermarshaccretionwillhavetheinadvertentconsequencesofincreasingbothinletchannelcross-sectionalareasandebbshoalvolumes.Increasesinebbshoalvolumescouldprofoundlyimpactregionalsedimentbudgetsandleadtochangesintheerosion-depositionpatternsofadjacentshorelines. 38


2.1IntroductionAtidalinletactsasthepassagewayforexchangeofwaterandsedimentbetweentheoceanandaback-barrierbasin.Theinletsystemiscomposedoftheinletchannel,ebbandoodshoalcomplexes,adjacentbarrierislands,andthecontiguouswetlands,witheachcomponentparticipatinginasandsharingsystem,whichisassimilatedintotheregionalsedimentbudget( Dean 1988 ; Hayes 1979 ).Despitetheimportanceofincludingtheinuenceoftidalinletsinregionalsedimentbudgets,fewstudieshaveinvestigatedthemorphologicresponseoftidalinletsystemstochangesinrelativesealevel( FitzGeraldetal. 2008 ).Themorphologyoftheinletsystemiscontrolledbylocalriverinow,tidalexchange,andwaves.Aswaterlevelsintheoceanincreasewiththerisingtide,waterandsedimentistransportedthroughtheinletchannelandintothebasin,anduponowexpansioninthebasin,transportcapacitydecreasesandsedimentisdepositedonoodshoals.Asoceanwaterlevellowerswiththefallingtide,waterandsedimentfromthebasinowsbackouttotheoceananddepositssedimentonebbshoalsseawardoftheinletchannel.Ebbshoalsalterwavetransformationandinterruptlongshorecurrents,leadingtoasedimentexchangebetweentheshoalsandadjacentshorelines.Increasestothetidalprism,thetotalvolumeofwaterexchangedduringatidalcycle,canincreasethestorageofsedimentinebbshoals,whichcausestheshoalstoactasalocalsedimentsink,alteringthewaveenergyux,andtherefore,theerosional-depositionalpatternsoftheadjacentbarrierislandshorelines( Dean 1988 ; FitzGerald 1988 ).Figure 1-1 illustratessomeofthecomponentsofatypicalmixed-energytidalinletsystem.TwomodelingstudiesexploringinletresponsetosealevelrisehavebeenundertakenforinletsystemsoftheWestFrisianIslandsintheNorthSea,whichconsistoflarge,un-vegetatedtidalatsthatconnecttheopenoceantotheWaddenSea( Dissanayakeetal. 2009 ; VanGooretal. 2003 ).Theirresultspredictincreases 39


forinletchannelcross-sectionalareasandoodtidaldeltas,butdecreasesinvolumesofebbshoalcomplexes.ThesepredictionsconictwiththechangesrecordedineldstudiesperformedalongtheLouisianacoast( FitzGeraldetal. 2004 2007 ; Listetal. 1994 1997 ).TheinletsintheseeldstudiesconnecttheGulfofMexicotoBaratariaBay,whichhasexpansiveregionsofwetlandsconnectedbyacomplexnetworkoftidalchannels.Highrates(approximately10mm/yr)ofrelativesealevelrisehaveledtomarshdegradation,resultinginanincreaseinbasinarea,tidalprism,cross-sectionalarea,andebbshoalvolumes( FitzGeraldetal. 2004 2007 ; Listetal. 1994 1997 ).Thelossofmorethan1,100km2ofwetlandareahasledtoanincreaseinbarrierislandsegmentationandbreakup( FitzGeraldetal. 2007 ).Thisstudyexplorestheroleofwetlandstabilityonthehydrodynamicandmorphologicresponseofatidalinletsystemtochangesinsealevel.WehaveperformedtwosetsofexperimentsusingtheDelft3Dnumericalmodel:(A)sealevelriseinabasinwithnoverticalmarshaccretion,and(B)sealevelriseinabasinwhereverticalmarshaccretionratesareequaltotherateofsealevelrise.Therstexperimentrepresentsamarshsystemwhichisunabletokeeppacewithsealevelrise,whereasthesecondexperimentrepresentsasystemthatisable.Weusethesetwoscenariostobracketthepotentialshort-term(decadal)responseofthesystem,andtohighlighttheroleofwetlandvegetationinthisresponse.Wedonotinvestigatemarshedgeerosionsinceitwouldbeexpectedtooccurmultipledecadesafterthresholdrateswereachieved( Kir-wanetal. 2010 ).ThenumericalexperimentsarerunfortheSt.MarysRiverentrance,ontheFlorida-Georgiaborder,asystemthatistypicalofthoseseenintheSeaIslandchainofbarrierislandslocatedonthesoutheastcoastofNorthAmerica.Wedonotinvestigateascenarioofmarshexpansionforthissitebecausethewetlandscovermostofthelocalundevelopedlandandthereislittlespaceforlateralexpansion. 40


2.2BackgroundWetlandvegetationresponsetosealevelriseiscomplex,withmanyfactorscontributingtotheresilienceofthesystem.Wetlandscanrespondtosealevelriseby:(1)activelyexpandingverticallyandlaterallyifaccretionratesarefasterthanlocalsubmergence,(2)maintainingastableelevationbytrappingsedimentsandaccretingverticallyatarateequaltotherateoflocalsubmergence,or(3)drowningduetoaninabilitytoaccreteverticallyattherateofsubmergence( Orsonetal. 1985 ).Ifvegetationissubmerged,itmaybecomewaterloggedanddie.Thiscanleadtomarshplatformedgeerosion,whichisexpectedapproximately30-40yearsafterthresholdratesofsealevelrisearereached( Kirwanetal. 2010 ).Therateofmarshaccretionisabalancebetweenstorm,ice,andtidalsedimentation,bioproductivity,decomposition,compaction,andsubsidence.Theseprocessesarecontrolledbyfactorsthatincludeclimatechange,sealevelrise,andregionaltectonics( ArgowandFitzGer-ald 2006 ).Numerouseldstudiesandnumericalmodelshavebeenusedtoshowthattheresilienceofawetlandsystemtoachangeinrelativesealevelisdependentonthemagnitudeofthetidalrangeandsedimentsupplyofthesystem( KirwanandGuntenspergen 2010 ; Kirwanetal. 2010 ; Reed 1995 ; Simasetal. 2001 ).Marshecosystemshavetheabilitytoregulatetheirelevationwithinanarrowrangeoftheintertidalzonebyincreasingsedimenttrappingandbioproductivitywhenthevegetationisatalowerelevationinthetidalrange,leadingtofeedbacksinthesystemthatpromoteverticalaccretionwithincreasesinsealevel( Boormanetal. 2001 ; MendelssohnandMorris 2000 ; Morris 2007 ; Morrisetal. 2002 ).Thesefeedbackshavelimitations,giventhattheoptimalrateofplantproductivityoccursatasubmergencedepthequaltothedrowningpoint( Morrisetal. 2002 ).AtmostinletsontheU.S.Atlanticcoast,wetlandvegetationcoversabroadarealextentaroundtheback-barrierbasinchannels.Ifthewetlandsystemisunabletomaintainverticalaccretionratessufcienttokeeppacewithsealevelrise,thosebroad 41


areasmaybecomesubmerged.Thiswouldleadtoincreasesinoodedbasinarea,allowingforanincreasedtidalprism.Thedeepeningofchannelsshouldreducesomeofthetidalwaveattenuationinthesystemandleadtoamoreefcienttidalexchange.Bothofthesechangeswouldincreasethetidalprismandleadtoanincreaseininletchannelcross-sectionalareaandebbshoalvolume.Ithasbeensuggestedthatthesizeofsomemorphologicfeaturesofatidalinletsystemcanbepredictedusingempirically-derivedrelationshipsbasedonthehydrodynamiccharacteristicsofthesystem. O'Brien ( 1931 1969 )comparedinletchannelcross-sectionalareatotidalprismforstableinlets,whichwerethoughttobeinastateofequilibrium,andrevealedapowerlawrelationshipbetweenthetwovariables.Alargertidalprismimpliesthatlargerowvolumesmustbeexchangedduringatidalcycle.Thecross-sectionalareaofthechannelgovernstheconstrictionofowandthecurrentvelocitiesthatoccurduringtheexchange.Accordingto O'Brien ( 1931 1969 ),anequilibriumowrateexists,atwhichthecurrentexhibitsnonettransportinthechannel.Iftheowvelocityexceedstheequilibriumrate,scourwilloccuruntiltheequilibriumowrateisattained.Iftheowvelocityisbelowtheequilibriumrate,channelsedimentationwilloccuruntilthecross-sectionalareareestablishestheequilibriumowrate. Jarrett ( 1976 )expandedtheinvestigationperformedby O'Brien ( 1931 1969 )bycompilingdatafrom108inlets,59fromtheAtlanticcoast,24fromtheGulfofMexico,and25fromthePaciccoast,andseparatedtheinletsintothreecategories:(1)allinlets,(2)inletswithnojettiesorasinglejetty,and(3)inletswithtwojetties.Withineachcategory,theywerefurtherseparatedaccordingtothefollowinggeographiclocations:(a)inletsonallthreecoasts,(b)InletsontheAtlanticcoast,(c)inletsontheGulfcoast,and(d)inletsonthePaciccoast.Foreachofthesetwelvecombinations,powerlawrelationshipsweret,and95%condenceintervalsforthepowerlawconstantswereestablished.Duringtidalexchange,sedimenttransportedlandwardduringtheoodinglimbisdepositedonoodshoal,andsedimenttransportedseawardduringtheebbinglimb 42


isdepositedonebbshoal.Asebbshoalsgrow,thewaterdepthstheyoccupybecomeshallowerandmorestronglyinuencedbytheassailingwaveeld.Waveactionentrainssedimentandlongshorecurrentstransportsedimentofftheshoalandbacktothenearshoresystemadjacenttotheshoal( Kraus 2000 ).Therefore,ebbtidalowandwaveactionacttogethertobalancethegrowthoftheshoal. WaltonandAdams ( 1976 )exploredthisrelationshipbycomparingebbshoalvolumesunderthreewaveenergyregimesdenedbywaveheightandperiod.Theyfoundthattheirdatacouldbettoapowerlawrelationshipbetweentidalprismandebbshoalvolumeforeachofthethreewaveenergyregimes. 2.3Methodology 2.3.1StudySiteTheSaintMarysEntrance(SME)isatidalinletlocatedontheborderofFloridaandGeorgiainsoutheasternNorthAmericathatconnectstheCumberlandSoundtotheAtlanticOcean.TheinletisborderedonthenorthbyCumberlandIslandandonthesouthbyAmeliaIsland.BothAmeliaandCumberlandislandsarepartofthebarrierislandstringknownasSeaIslandsshowninFigure 2-1 .Theinletsinthisareafallintothemixed-energytide-dominatedrangeoftheclassicationsystemdevelopedby Hayes ( 1979 ),whichcategorizesthemorphologicfeaturesoftidalinletsbasedontheirrelativestrengthoftideandwaveforces,aconceptfurtherexploredby FitzGerald ( 1996 ).Ingeneral,thisislandchaincharacterizedbyfrequentlyspacedinlets,withwell-developedebbshoalcomplexes.Thesebarrierislandsareseparatedfromthemainlandbyacomplexnetworkoftidalcreeksandmarshislands.ThebanksoftheCumberlandSoundandattachedchannelsaremostlyborderedbycoastalmarshvegetation,coveredpredominatelybythesmoothcordgrass,Spartinaalterniora.Theareaofwetlandcoverageinthebasin,calculatedfromdataavailablefromtheNWI,isapproximately197km2,whichisapproximately80%ofthebasinareathatliesbelowthespringhightidewaterelevation. 43


Thelowmarshrepresentsapproximately60%ofthetotalarealextentinGeorgiasaltmarshes,whereapproximately80-96%ofthenetprimaryproductionisduetoSpartinaalterniora( FreyandBasan 1985 ).Approximatelytwo-thirdsoftheproductionofSpartinaalternioraoccursasrhizomesbelowthesurface,makingitphysicallyinaccessibletograzingherbivores( Fogeletal. 1989 ).Georgiasaltmarshesexhibitlittleornopeatduetotheextensiveraftingofmaterialoutofthemarsh,thehighmeantemperatures,intensebacterialdegradation,andhighlevelsofbioturbation;alayerofsediment30cmthickmayremainintheactivebioturbationzoneforuptoseveraldecades( Fogeletal. 1989 ).AveragesedimentationratesalongtheGeorgiacoasthavebeenestimatedas3-5mm/yr( Hattonetal. 1983 ).Fieldmeasurementsperformedby Craft ( 2007 )indicateawidevariationinboththespatialandtemporalverticalaccretionratethroughoutthemarshsystem,withshort-termratesvaryingbetween5.30.5and9.91.1andlongtermratesvaryingbetween1.30.3and3.40.6.Thisvariationislikelyduetothemixtureofsedimentsources,bothexternalandinternaltothemarshsystem,whicharenotsuppliedatanunsteadypaceand/orinanonuniformspatialpattern( NicholsandBoon 1994 ).Theproportionsofsand,silt,andclayvarythroughoutthemarshsystem;thecreekbanksarecomposedofamixtureofsilt-andclay-sizedsediment,whereasthehighmarshescontainmostlysand-sizedsediment( FreyandBasan 1985 ).TheSt.Marys,Cumberland,Crooked,North,Jolly,BellandAmeliaRiversowintotheestuarybasin,withtheSt.MarysRiverbeingtheprimarycontributoroffreshwater.TheriverdischargeatUSGSstation02231254(located30.7439N,81.6544W),approximately20kminlandfromtheinletentrance,isgenerallytidallydominated,punctuatedwithrainevents,whichtemporarilyincreasedischargevalues.Twoharborsarelocatedintheestuary,whichserveasabaseforsubstantiallocalcommercialandshingeets.TheKingsBayNavalbase,locatedapproximately14kmnorthoftheinletintheCumberlandSound,servesasaportfornavalsubmarines.Insupportofthe 44


defense,commercial,andrecreationalnavigation,theinletisstabilizedwithtwojettiesandisregularlydredgedtomaintainadepthofapproximately14m( Parchure 1982 ).Channelsbetweentheinletandthenavalbase(northoftheinlet),aswellasbetweentheinletandFernandinaBeachMarina(southoftheinlet),aredredgedtomaintainnavigation.BathymetryobtainedfromtheNationalGeophysicalDataCenter(NGDC)3arc-secondCoastalReliefModelisdisplayedinFigure 2-2 .Thetideispredominatelysemi-diurnalwithameanrangeof1.75mandspringrangeof2.5m.Tidalprismmeasurementforthisinlethavebeenreportedas1.75108m3,1.58108m3,1.70108m3,and3.3108m3by Bruunetal. ( 1978 ), O'BrienandClark ( 1974 ), EnvironmentalScienceandEngineering,Inc. ( 1980 ),and Powelletal. ( 2006 ),respectively.Figure 2-3 showsthebasinhypsometriccurve,thedistributionofbasinelevation,illustratingthat25%ofthebasinresideswithinthespringtidalrange.Usingthedistributionofbasinelevations,andthetemporalobservationsofwaterlevels(takenover40tidalcycles),anestimateoftheoodedportionofbasinareacanbecalculated.Figure 2-4 displaysthetemporaldistributionofoodedbasinareaovertherangeoftidalelevations(shadedarea)andthetemporallyaveragedbasinarea(blueline).Thedistributionofelevationsisbimodalrepresentingthemarshchannelsandthemarshplatforms.Duringthetransitionfromebbtooodtide,themarshchannelsarethersttoexperienceinundationuntilthemarshplatformedgeisovertopped(ZoneA),afterwhichtimetheoodedbasinarearapidlyexpandswhilethemarshplatform(ZoneB)continuestobeinundated.Duringthehigherportionoftherisingtidelimb,theregionofoodedmarshplatformenlargesuntilmaximumtidalelevationisreached(ZoneC).Thetemporallyaverageoodedbasinsizeis178km2,butthatpreciseamountofbasinareaissubmergedforonlyashortduration. 2.3.2TidalFlowModelandExperimentalDesignDelft3DisamodelingsuitedevelopedbyDeltaresandiscapableofsimulatingthree-dimensionalunsteadyoweldsresultingfromwaves,tides,rivers,winds,and 45


othercoastalcurrents.Thesystemofequationsconsistsofthehorizontalmomentumequation,thecontinuityequation,thetransportequation,andaturbulenceclosuremodel,describedindetailby Lesseretal. ( 2004 ).Themodelusescurvilinear,boundary-ttedgrids,andcanbeusedtoprovideowpredictionsforareaswithcomplexbathymetry.Inoursimulations,themodelisforcedwithwaterlevelsproscribedbyasetofastronomicaltidalconstituentsderivedfromNOAAtidalstations.Themodeldoesnotincorporatefreshwaterinowfromlocalriversourcessincethenetdischargethroughtheinletchannelduetoriverinputintothesystemislessthan5%ofthetotalinletdischargeattributabletothetides( Parchure 1982 ).Themodeldomainisacurvilinearsetof419x319x8gridcells,withanaveragehorizontalgridspacingof100mx100mintheestuary,increasinginthex-directiontowardsdeeperoceancells.Themodelusesasigmacoordinatetransformationintheverticaldirection,dividingthedepthintoanevenlyspaced,constantnumberofverticalslices,varyinginthicknesswithchangesinwaterlevel.Thisresultsinasmoothrepresentationofthelocalbathymetryandhighcomputingefciency.Watersurfaceelevationsandowvelocitiesfromonemodelrun,simulatinga52-dayperiodwascomparedwithavailableinsitudata,inordertoconductamodelvalidationstudy.Subsequently,twoseriesofmodelrunswereconductedforeachofthewetlandaccretionscenarios.Therstexperimentalseries,withnomarshaccretion,wasexecutedbyloweringthebaselevelofthebathymetryevenlythroughoutthemodeldomain.Inthesecondexperimentalset,withwetlandaccretionequaltosealevelrise,thebaselevelwasloweredinareasofthebathymetrythatarenotclassiedbytheNationalWetlandInventory(NWI)asvegetatedarea.Eachseriesofmodelrunsranthroughthefollowingsetofsealevelrisemagnitudes:5,10,20,30,40,50,60,70,80,90,and100cm.Allofthesimulationswererunusingtidalelevationconditionsduringthesamesixdayinterval,fromNovember08,2011toNovember14,2011,whichcomprised10fulltidalcycles.Thismodeldoesnotincorporatesedimenttransportinto 46


thesystembecausethereisnotsufcientdatausedforcalibrationtocondentlymodelmorphologychangetothesystem.Inordertoaccuratelymodelsedimenttransportatthislocation,detailedinformationaboutthesedimentdistribution,longshoretransport,andriverineinputwouldberequired.Sincethemodeldoesnotincorporatesedimenttransport,themagnitude,ratherthantherateofsealevelrise,isusedinthisstudy.Therateofsealevelrisedictatesthetimetowhicheachsealevelrisemagnitudewouldbereached.Forexample,asealevelriserateof2mm/yrwouldrequire250yearstoreach50cmofsealevelrise,whilearateof10mm/yrwouldrequire50yearstoreachthismagnitude. 2.3.3EmpiricallyDerivedHydrodynamic-MorphologicRelationshipsInthisstudy,weusethemodeloutputoftheinstantaneousdischargethroughtheinletchanneltocalculateameantidalprismoverthe10modeledtidalcycles,inordertomakeestimatesaboutchangestotheinletcross-sectionalareaandebbshoalvolume.Therelationshipbetweenthetidalprismandtheinletchannelcross-sectionalareathatweapplyinthisstudywasestablishedby Jarrett ( 1976 )forU.S.Atlanticcoastinletswithtwojetties: A=1.584010)]TJ /F7 7.97 Tf 6.59 0 Td[(4P0.95(2)wherePisthetidalPrism(m3)andAistheminimumcross-sectionalarea(m2).Similarly,weuseanempiricalrelationshiptoinvestigatechangestotheequilibriumebbshoalvolumeusingarelationshippublishedby WaltonandAdams ( 1976 ).Wechosetherelationshipdevelopedformoderatelyexposedcoasts,basedonthewaveenergyregimeintheareaoftheSaintMarysEntrance: V=6.610)]TJ /F7 7.97 Tf 6.59 0 Td[(3P1.23(2)whereVistheebbshoalvolume(m3).Weapplytheseformulastothetidalprismmodelcalculationsforbothmarshplatformaccretionscenariosandallsealevelrise 47


magnitudesinordertounderstandthecontrolofmarshprocessesontheresponseoftheinletmorphologytochangesinrelativesealevel. 2.3.4ModelTestingandCalibrationPriortoexecutingthefullsuiteofnumericalexperiments,themodelwasrunforpurposesoftestingandcalibration,tosimulatetidalconditionsfora52-dayperiodfromNovember08,2011toDecember30,2011.ComparisonsitesincludedpointsclosesttotheNOAAtidalstationandADCPlocations.TheNOAAFernandinaBeachCurrentsProjectbottom-mountedworkhorseADCPlocationsanddeploymentperiodsareshowninFigure 2-5 .Watersurfaceelevationcomparisonwithtidestation8720030isshowninFigure 2-6 ,withthelengthoftherecordbrokenintofourpanels.Displayedare(1)thetidalstationdata(redline),(2)theDelft3Dmodelresults(blue),and(3)thedifference(green)betweenobservationandmodelresults-underpredictionshavepositivevaluesandoverpredictionshavenegativevalues.Thephaseofthesignalappearstobeaccuratelypredicted,withmostofthedifferencesarisingfromdiscrepanciesinmagnitude.Thewaterelevationdifferencesforthisrecordpassedat-testofthenullhypothesisthattheyfollowanormaldistributionwithameanof-2.1cmandastandarddeviationof19.7cm.Thestandarddeviationisapproximately8%oftherangeoftidalelevationsinthisrecord.Someofthisdifferentislikelyduetothelackofwindinducedset-upandset-downincorporatedintothemodel.Timeseriesplotsofobservedandmodeledsurfacecurrentspeeds,foreachofthesixstations,areshowninFigure 2-7 .Thedatadurationdisplayedisfortherstthreefulldaysofdeploymentateachstationinordertoexploreameaningfulcomparison.AplotofthesurfacecurrentsfortheentiredeploymentofeachstationareshowninFigure 2-8 asU-Vscatterplotsalongwiththe95%condenceellipsesoftheADCPcurrentmeasurementsandtheco-locatedmodeledcurrents.TheUandVvelocitiesaretheeastingandnorthingcomponentsofvelocity,respectively.Theaxesarestretched 48


toshowvariability(axisexaggerationsindicatedonplots).Forbothplots,thecoloreddatarepresenttheADCPobservationdata,coloredbystation,andtheblackdatapointsaretheco-locatedmodelresults.Figure 2-9 showsthecalculatedmeanspeed,speedstandarddeviation,andprincipalaxiscalculatedoverthedeploymentperiodateachofthesixstations.ThemajorityofthemodelstationshaveaphasesimilartothereportedADCPcurrents,withtheexceptionofFEB1108,whichislocatedclosetothesouthernjetty.Thislocationmayhavesomemodelinginaccuraciesduetotheproximityofthehardstructure(jetty).Thislocationmayalsobeinuencedbyacombinationofchannelandalongshorecoastalow;themodeloutputexhibitsgreaterchanneldirectedowandsmallermagnitudesthantheADCPobservationsatFEB1108.Longshorecurrentsarenotincludedinthemodelcalculations,makingthisaplausiblesourceofthediscrepancy.ThemodeltendstounderpredictcurrentspeedsduringoodtideatstationFEB1101,whichislocatedinthecenterofthejettystructuresontheoceansideoftheinlet.Thismaybeduetotheinuenceofthejetties,whichconstrictowandincreasecurrentvelocitythroughtheinlet.Thejettiesareincludedinthemodelasshallowregions,ratherthanthindams,becausethejettiesdoallowsomepassage(overtopping)ofwaterduringhightide.Experimentalrunsusingthindamjettiesreducedtheowthroughthechannelandthecurrentsinthebasinweresignicantlyunderpredicted.ThemodeloverpredictscurrentspeedsatstationFEB1104,apointinanarrowingsectionoftheAmeliaRiver,2.5kmsouthoftheinletchannel,byapproximately20cm/s.TherealsoexistsadepthdiscrepancybetweentheNOAAADCPdataandtheNGDCCoastalReliefModeldatausedtoconstructthemodelbathymetryatthatlocation;theADCPdepthisreportedat12m,whiletheNGDCdepthis8.3m.ThisareaisintheQuarantineReach,adredgedsectionofthebasin,maintainedatapproximately11meters.ThedatescorrespondingtothebathymetricsurveyandADCPdeployments 49


maybeseparatedbyadredgingeventleadingtothisdepthdiscrepancy,whichwouldcertainlyinuencecurrentvelocities.ThetwoADCPsinthechannelthroat(FEB1102andFEB1103)arelocatedoneithersideofwherethemodeltidalprismcalculationsaremade.Thisminimumcross-sectionoftheinletchannelwaschosenbecausethetotalvolumeuxthroughthisplaneovereachtidalcycleisequivalenttothetidalprism.Themodelmakesthemostaccuratevelocitypredictionsinthisarea;theco-locatedmodeloutputshavemeanspeedswithin2.2cm/s,standarddeviationswithin4.4cm/s,anddirectionwithin2.8degreesoftheADCPdata.Modelcalculationsoftidalprismsduringthe52-daysimulationrangefrom1.3108m3to2.7108m3.Modeledinletchannelwaterelevations,modeledinstantaneousdischargesthroughtheinlet,andmodeledtidalprismvalues,foreachtidalcycle,areshowninFigure 2-10 .Themeanofthetidalprismduringthismodelsimulationwas1.87108m3,comparingwellintherangeofreportedvaluesof1.75108m3,1.58108m3,1.70108m3,and3.3108m3publishedin Bruunetal. ( 1978 ), O'BrienandClark ( 1974 ), EnvironmentalScienceandEngineering,Inc. ( 1980 ),and Powelletal. ( 2006 ),respectively.Thesevaluesareshown,forcomparisonpurposes,inthebottompanelofFigure 2-10 asthedashedhorizontallines. 2.4ResultsBelow,wepresentthemodelingresultsofsimulatedsealevelriseandthemorphologiceffectsorganizedintofoursectionscorrespondingtothevariablesofinterest.Wedescribethesimulatedchangesinbasinarea,tidalprism,inletcross-sectionalarea,andebbshoalvolumefortheincrementedsealevelrisescenariosinthetwo,end-membermarshaccretionscenariosdescribedabove:nomarshaccretionandmarshaccretionatarateequaltothatofsealevelrise. 2.4.1BasinAreaThechangeintemporallyaveragedoodedbasinareawascalculatedforeachsealevelrisemagnitudeunderthetwoendmembermarshaccretionscenarios.Figure 2-11 50


displaysthechangeinthetemporaldistributionofoodedbasinareaandthechangeinthetemporallyaveragedbasinarea(verticallines)withsealevelriseforeachmarshaccretionscenario.Theblacklinesshowinitialbasinareadistribution,thebluelinesare10cmincrementalsealevelrisestepsbetweenzeroand100cm,withasealevelriseof50cmand100cmhighlightedasgreenandredlines,respectively.Inthecaseofnomarshaccretion,boththechannelsandmarshplatformareoodedwithincreasedfrequencyandduration.Inthecaseofsealevelrise-pacedmarshaccretion,thechanneledgesbecomeoodedmorefrequentlywithsealevelrise,buttheplatformisoodedwiththesamefrequencyandduration.Eventually,thechannelsidesbecomesteepandarecontinuouslysubmerged.Figure 2-12 displaystherelationshipbetweensealevelrisemagnitudeandtemporallyaveragedsubmergedbasinareaforbothofthemarshaccretionscenarios. 2.4.2TidalPrismTheidealtidalprism,consideredtobethatwhichwouldoccuriftidalexchangewereinstantaneousanduniformthroughoutthebasin,iscalculatedasthetemporallyaveragedsubmergedbasinareamultipliedbythemeantidalrange.Themodeledtidalprism,averagedforthetentidalcyclessimulated,wascalculatedfromtheinstantaneousdischargethroughtheinletchannelforbothofthemarshaccretionscenariosandforeachofthesealevelrisemagnitudes.TheupperpanelinFigure 2-13 displaysthecalculatedidealtidalprisms(circles)andmodeledtidalprism(squares)forthescenarioofzeromarshaccretion(red)andmarshaccretionequaltosealevelrise(blue).Inallcases,theidealandmodeledtidalprismsexhibitanincreasewithrisingsealevel.Forthestaticmarshscenario,thetidalprismincreasesatagreaterratethanforthepace-keepingmarshaccretionscenario,becausethebasinareaincreasesatagreaterratewithrisingsealevel.Thetidalexchangeefciencywascalculatedastheratioofmodeledtoidealtidalprism,andisshowninthelowerplotinFigure 2-13 overtherangeofinvestigated 51


sealevelrisevalues.Theincreaseinthisratioindicatesthatthetidalprismexchangebecomesmoreefcientwithincreasesinsealevelduetoareductionintidalwaveattenuation.Theincreaseisslightlygreaterinthemarshaccretionscenariobecausetheonlyadditionalbasinareathatisbecomingoodedisinthechannels.Inthecaseofastaticlandscape,shallowareasthatwerenotpreviouslywithinthetidalrangearenowaccessible;theseshallowareasretardexchangeowmoreseverelythandothebasinchannels.Thetidalprismincreasesduetoacombinationoftheincreasedbasinareaandincreasedtidalexchangeefciency.InFigure 2-14 weseparatetheincreasedmodeledtidalprismintothesetwo,aforementioned,componentsforboththestaticmarsh(red)andpace-keepingmarshaccretion(blue)scenarios.Thetotalmodeledtidalprismincreasesareshownassolidlines,andthecomponents,fromthebasinareaincreaseandfrommoreefcientexchange,areshownascirclesanddashedlines,respectively.Theincreaseintidalexchangeefciencycontributesasimilaramounttoeachofthesystems,regardlessofmarshaccretionrates,duetochanneldeepening.Theincreasedefciencyisresponsibleforapproximatelytwo-thirdstheincreaseintidalprisminthemarshaccretionscenario,whereasitisonlyone-thirdinthecaseofastaticmarshsystem. 2.4.3Cross-SectionalAreaSealevelriseincreasesthecross-sectionalareaoftheinletchannelduetoincreasingwaterlevelandoodingofadjacentshoreline.Theequilibriumvalueofthechannelcross-sectionalarea,theareanecessarytoconveytidalows,alsoincreaseswithsealevelriseduetothescourassociatedwiththeincreaseintidalprism.Theempiricalrelationshipbetweentidalprismandcross-sectionalareadevelopedby Jar-rett ( 1976 )isusedtocalculateequilibriumcross-sectionalareaforeachsealevelrisescenario.TheupperpanelofFigure 2-15 showsthechangeincross-sectionalareaduetosealevelriseinthechannel(green)andthechangeinequilibriumcross-sectional 52


areaduetoscourfromtidalprismincreaseforastaticlandscape(red)andforabasinwithpace-keepingmarshaccretion(blue).Theapproximaterateofincreaseis61m2and28m2per1cmofsealevelriseforstaticmarshesandaccretingmarshes,respectively.Atpresent-daysealevel,themeasuredcross-sectionalareaisgreaterthantheequilibriumprediction,likelyduetochanneldredgingregularlyperformedatthissite( Johnstonetal. 2002 ).Assealevelrises,theequilibriumareaincreasesatafasterpacethantheincreaseinthecross-sectionalareaduetosealevelriseinthechannel.Forsealevelrisemagnitudesatwhichtheequilibriumcross-sectionalareaexceedsthecross-sectionalareacreatedbysealevelriseinthechannel,scourshouldoccurtoenlargethechannelbywideningordeepening,untilsufcientareaisachievedtoaccommodatetheincreasedtidalprism. 2.4.4EbbShoalVolumeUsinganempiricallyderivedequilibriumrelationshipdevelopedby WaltonandAdams ( 1976 ),weexploretheimpactofsealevelriseontheebbshoalvolumeoftheinletsystem.Aplotofthechangeinebbshoalvolumeovertherangeofsealevelrisemagnitudesforstaticmarshes(red)andpace-keepingmarshes(blue)isprovidedinthelowerpanelofFigure 2-15 .Thisguredisplaysthesensitivityofebbshoalstochangesinmarshaccretionrates;staticmarshenvironmentsshowanincreaseinebbshoalvolumemorethandoubletheamountcalculatedwhenmarshesaccreteatthesamerateassealevelrise.Forevery1cmofsealevelrise,increasesintheequilibriumvolumeofsedimentstoredinebbshoalsof0.66km2and0.30km2arepredictedtooccurforstaticandpace-keepingaccretingmarshes,respectively. 2.5DiscussionInthissection,weconsiderthepotentialimpactsofsealevelriseonebbshoalvolumeandtheinuencethatsuchachangemightexertonlocallongshoretransportpatterns.Wecompareourmodelingresultswithpreviousstudiesfocusedontidalinletresponsetosealevelriseandspeculateonwhythereisdisagreementwithmodeling 53


studiesofinletsalongtheWestFrisianIslandsintheNorthSea.Finally,wediscussthequalitativeagreementofourmodelresultswitheldstudiesfromtheLouisiana(U.S.)Gulfcoast. 2.5.1RegionalImpactsThecurrentrateofsealevelriseatNOAAtidalstation8720030(locationshowninFigure 3-1 ),calculatedusingdataovera110yearrecordbetween1897and2006,is2.020.2mm/yr( Zervas 2009 ).Assumingasteadyrate,themagnitudeofsealevelriseshouldbe5cmin22.7years.Resultsofthismodelingstudypredictanincreaseintheebbshoalvolumeatthissiteofbetween3.6106and6.83106m3(2.23%to4.24%increase),forthepace-keepingmarshaccretionandstaticmarshscenarios,respectively;nearlyadoublingoftheebbshoalvolumeifaccretionhalts.Thelocallongshoresedimenttransportratehasbeenreportedtobeapproximately3.8105m3/yr( Dean 1988 ),totaling8.63106m3overthe22.7years.Thepredictedincreaseinequilibriumebbshoalvolumeisbetween41and79%ofthislongshoretransport.Astidalprismincreases,theebbshoalspreadsfurtheroffshoreandinthedowndriftdirection,andtheshoaloccupiesadeeperwaterdepth( BuonaiutoandKraus 2003 ; Carr-Bettsetal. 2012 ).Thischangeinlocationreducestheimpactofwave-inducedtransportoffoftheshoals.Ifall16inletsintheseaislandchainweretoexperiencesimilarincreasesinebbshoalvolume,thelongshoretransportalonecouldnotprovideadequatesedimenttosustainthisgrowth.ThisdeciencyinthesedimentbudgetcouldtriggershorelineretreatandbeachvolumelossfromthebarrierislandswithintheSeaIslandChain.Althoughthismodelwassetupforaparticularsite,theSt.MarysEntrance,theresultssuggestthattherelationshipsandconsequencesoftheseinterrelatedprocessesareapplicabletobarrierislandsystemsworldwide. 54


2.5.2ComparisonwithPreviousModelingStudiesTherehavebeentwo,previouslypublished,modelingstudies,whichinvestigatetheinuenceofsealevelriseontidalinletslocatedalongtheWestFrisianIslandsintheNorthSea.Therststudy,by VanGooretal. ( 2003 )usesathree-elementsemi-empiricalequilibriummodelandthesecondstudy,by Dissanayakeetal. ( 2009 ),usesDelft3D,thesamemodelusedinourstudy.Bothpreviousmodelingstudiesconcludethatanincreaseinsealevelwoulddriveanincreaseincross-sectionalareaandadecreaseinebbshoalvolume. Dissanayakeetal. ( 2009 )hypothesizedthatthedecreaseinebbshoalvolumeismostlikelyduetothedecreasedbedfrictionfrominletchanneldeepening,allowingforhigheroodcurrentvelocitiesthroughtheinlet.Theinletsinthisareahaveexpansiveregionsofunvegetatedtidalats,withdifferentbasinhypsometriestothoseseenontheU.S.Atlanticcoast.Thismayaccountforthedifferenceinebbshoalchangepredictionsbetweenstudiesatthatlocationandtheresearchconductedinthisstudy.Ourresultsareinagreementwitheldobservationsreportedby Listetal. ( 1994 1997 )and FitzGeraldetal. ( 2004 2007 )atsiteslocatedwithinBaratariaBay,Louisiana,whichfoundanincreaseinbothinletchannelcross-sectionalareaandebbshoalvolume.StudiesoftheBaratariatidalinletshavebeenperformedtoshowhowamultipletidalinletsystemevolveswithhighratesofrelativesealevelrise(approx.10mm/yr)mixedwithsubstantialmarshloss( FitzGeraldetal. 2004 2007 ; Listetal. 1994 1997 ).TheBaratariaBayisconnectedtotheGulfofMexicobyfourtidalinlets:Abel,Barataria,Caminada,andQuatreBayou. Listetal. ( 1994 1997 )performedacomparativestudyofthebathymetricevolutionofa157kmreachofthisbarrierislandschain,locatedofftheLouisianacoastwestoftheMississippiRiverdelta,overthreesurveyperiods(1880s,1930s,and1980s),withdepthsoundingsbetween7kmlandwardoftheislandstoanoffshoredepthof12m(3000km2totalarea).Theirassessmentrevealedincreasesinebbshoalvolumeandtidalprismthatfollowedtherelationshipsdevelopedby Walton 55


andAdams ( 1976 ).Theyconcludedthatthechangesinbarrierislandsandtidalinletsystemscannotbeconsideredindependentofthehydrodynamicandmorphologicbehavioroftheback-barrierwetlands. FitzGeraldetal. ( 2007 )lookedattheevolutionofthecross-sectionalareaofthefourtidalinletsconnectedtoBaratariaBayandfoundconsistentincreasesovertimeduetotheincreasedtidalprism,likelydrivenbylocalwetlandloss.Notably,thetotalcross-sectionalareaoftheinletshasquadrupledsince1880.ADCPswereusedtocalculatethetidalprismforeachoftheinlets,andtheresultingcomparisonswiththe Jarrett ( 1976 )equation,whichrelatestidalprismandinletcross-sectionalarea,showedthatthemeasuredtidalprismsof3(outof4)inletsfellwithinthe95%condenceintervalpublishedby Jarrett ( 1976 ).Theoneinletthatdidnotmatchthepredictedrelationship(BaratariaPass)hasasmallercross-sectionalareathanpredicted,which,theauthorspostulate,maybeduetothestratigraphyofthearea;theinletmaybetryingtocutintoconsolidatedclaysthatresisterosion.Measurementsfromtheeldstudies,describedabove,followasimilarqualitativetrendtothemodelingresultspresentedinthispaper. 2.6ConclusionsBecauseoftheircriticalroleinthecoastallandscape,theresponseoftidalinletsystemstosealevelriseisimportanttoconsideroverthecourseofthenextcentury.Inthispaper,wehavedemonstratedthattheaccretionarybehaviorofback-barrierwetlandsexertsignicantcontrolonthegeomorphicresponseoftheinletsystemsandtheirmorphologiccharacteristics(e.g.inletchannelcrosssectionsandebbshoals).Assealevelrises,marshesmustaccreteverticallyatacomparablerateinordertocounteractsubmergence.Ifmarshesdonotmaintainsufcientverticalaccretion,thesubmergedportionoftheback-barrierbasinwillincreaseinarealextent,whichleadstoanincreaseinthetidalprism.Ifthemarshvegetationaccretesatapacesufcienttokeepupwithsealevelrise,thenonlythemarshchannelswilldeepenandunvegetated 56


coastlinewillbecomeooded.Weusedthetwoend-memberscenariosofzeromarshaccretionandpace-keepingmarshaccretiontobrackettherangeofpotentialinletsystemresponses.Aftersatisfactorycalibration,themodelingprocedureusedinthisstudycalculatesthatsealevelrise,inboththenon-accretingandpace-keepingmarshcases,drivesanincreaseintidalprismthroughtwomechanisms:(1)anincreaseinsubmergedbasinareaand(2)anincreaseinthetidalexchangeefciencyfromchanneldeepening.Sealevelrise,affectingalandscapewithnon-accretingmarshes,increasesthetidalprismapproximatelytwiceasmuchasalandscapewithmarshesmaintaininganaccretionarypacecomparabletorisingsealevel.Themorphologicconsequencesofthisincreasedtidalprismincludechangestotidalinletchannelcross-sectionalareaandebbshoalvolume.Equilibriuminletchannelcross-sectionalareaincreasesinboththenon-accretingandpace-keepingmarshexperiments.Inasystemexperiencingmarshaccretionequaltosealevelrise,theincreaseinequilibriumchannelareaisapproximately1.5timestheincreaseduetochanneloodingalone(i.e.elevatedwaterlevelsinthechannelduetosealevelrisealone).Inanon-accretingmarshlandscape,theincreaseinequilibriumchannelareaisapproximately3timestheincreaseduetooodingalone.Ebbshoalvolumesincreaseduetosealevelriseinbothnon-accretingandaccretingmarshes.Theebbshoalvolumeapproximatelydoublesforasystemwithnomarshaccretioncomparedtoasystemofpace-keepingmarshaccretion.Increasesinebbshoalvolumescouldprofoundlyimpacttheregionalsedimentbudgetandleadtochangeswithintheerosional-depositionalpatternsofadjacentshorelines. 57


Figure2-1. MapoftheSeaIslandChainwithaninsetoftheSaintMarysRiverEntrancebasin.Thismapdisplaysvegetatedarea,NOAAtidalstation8720030,andADCPdeploymentlocations. 58


Figure2-2. ContourmapoftheSaintMarysEntrancebasinbathymetryfromdataavailablefromtheNationalGeophysicalDataCenter(NGDC)CoastalReliefModelat3-arcsecondresolution. 59


Figure2-3. ThecumulativedistributionoftheelevationswithintheSt.MarysRiverbasinmodeldomain(greenshadedarea).Barsontheleftrepresentthepercentageofsurfaceareawithineach1minterval,showingapeakaroundMSL.Theyellowareahighlightstheelevationsthatarewithinthespringtidalrange. 60


Figure2-4. ThetemporaldistributionofoodedbasinareaintheSaintMarysRiverEntrancebasin(shadedarea)andthetemporallyaveragedoodedbasinarea(blueline).Therearetwodistinctregionsofelevations:themarshchannelsandthemarshplatform.Fromlowtohightide,themarshchannelsexpanduntilthemarshplatformedgeisreached(ZoneA).Asthemarshplatformisovertopped,thebasinarearapidlyexpands(ZoneB).Slowlytheoodedareaofmarshplatformexpandsuntilmaximumtidalelevationisreached(ZoneC). 61


Figure2-5. AmapoftheNOAAFernandinaBeachCurrentsProjectbottom-mountedworkhorseADCPdeploymentlocationsandcorrespondingdeploymentdates.Thecoloredlocationdotsmatchthecoloredbarsforeachlocation.NameswereretainedfromtheNOAAproject,beginningwithFEBfollowedbythetwodigityear11andtheprojectstationnumber(01-04,07,and08). 62


Figure2-6. WaterelevationsatNOAAtidestation8720030andtheco-locatedDelft3Dmodeledwaterlevels.Themodeldataisshowninblack,thetidalobservationsarered,andthedifferenceisshowningreen.Underpredictionshavepositivevaluesandoverpredictionshavenegativevalues. 63


Figure2-7. TimeseriesplotsofsurfacecurrentspeedsfromADCPdataandco-locatedmodeldatafortherst3fulldaysofdeploymentateachstation.TheADCPdataiscoloredaccordingtothestationandthemodeldataisblack. 64


Figure2-8. ScatterplotsofsurfacecurrentUandVcomponentswiththe95%condenceellipseandprincipalaxesfromthesixNOAAADCPstationsandco-locatedmodeldata.TheADCPdataiscoloredaccordingtostation,theco-locatedmodeldataisblack,andtheprincipalaxesaredashedlines.Noteunequalsizeaxestohighlightdifferencesinellipses. 65


Figure2-9. ModelcomparisonswithNOAAADCPdata.A)Themeansurfacecurrentspeed,B)thestandarddeviationofthesurfacecurrentspeed,andC)theprincipalaxisdirectionforthesixNOAAADCPstations(red)andtheco-locatedmodeldata(blue). 66


Figure2-10. Modeloutputofwaterlevel,instantaneousdischarge,andcalculatedtidalprism.A)Thewaterelevationsintheinletchannel,B)themodeloutputofinstantaneousdischargethroughtheinlet,andC)thecalculatedtidalprismforeachtidalcycleduringa52daysimulation.Tidalprismcalculationsarebetween1.3108m3and2.7108m3forthissimulation,withameanof1.87108m3.Reportedvaluesby Bruunetal. ( 1978 ), O'BrienandClark ( 1974 ), EnvironmentalScienceandEngineering,Inc. ( 1980 ),and Powelletal. ( 2006 )areplottedin(C)ashorizontaldashedlines. 67


Figure2-11. Thechangeinthetemporaldistributionofoodedbasinareaandthechangeinthetemporallyaveragedbasinarea(verticallines)withsealevelrise.Theblacklinesshowinitialbasinareadistribution,thebluelinesare10cmincrementalsealevelrisestepsbetweenzeroand100cm.Asealevelriseof50cmisshowningreen,and100cmisshowninred.Thechangesinbasinareawithsealevelintheaccretingmarshplatformscenarioarelimitedtochanneledges.Inthemodelscenarioswithastaticmarshplatform,allareasofthebasinthatareoodedbecomeoodedforalongerportionofthetidalcycle. 68


Figure2-12. Thechangeintemporallyaveragedoodedbasinareaduetosealevelrise,forastaticmarshplatformandamarshplatformaccretingatthesamepaceassealevelrise. 69


Figure2-13. Theidealtidalprism,themodeledtidalprism,andtheratioofmodeledtoidealtidalprism.A)Theidealtidalprism(circles)andmodeledtidalprism(squares)forstaticmarshes(red)andaccretingmarshes(blue),andB)theratioofmodeledtoidealtidalprism.Theincreaseinthisratioindicatesthatthetidalprismexchangebecomesmoreefcientwithincreasesinsealevelduetoareductionintidalwaveattenuation. 70


Figure2-14. Thechangeinmodeledtidalprism(solidlines)fromthebasinareaincrease(circles)andfrommoreefcienttidalexchange(dashed),forstaticmarshes(red)andaccretingmarshes(blue). 71


Figure2-15. Changeincross-sectionalareaandebbshoalvolumeduetosealevelrise.Thechangeincross-sectionalareaduetochannelooding(green)andthechangeintheequilibriumcross-sectionalareaforstaticmarshes(red)andaccretingmarshes(blue)isshownin(A).Thechangesinequilibriumebbshoalvolumewithsealevelriseforstaticmarshes(red)andaccretingmarshes(blue)isshownin(B).Thegreyareashighlighttherangeofpredictivechangesifmarshverticalaccretionwerebetweentheend-memberscenarios. 72


CHAPTER3ECOGEOMORPHICFEEDBACKSBETWEENSEALEVELRISE,ESTUARYHYDRODYNAMICS,ANDVERTICALMARSHACCRETIONThemorphologicresponseofatidalinlettosealevelriseisdependentonthemarshplatformresponseintheback-barrierbasin.Theverticalaccretionrateofthemarshsystemcontrolstheoodedbasinareaandthetidalwaveattenuationintheestuary,regulatingthetidalprism,inletcross-sectionalarea,andebbshoalvolumes.Alterationsofthehydrodynamicswithintheestuaryleadtochangesinthespatialdistributionofmarshsubmergence.Submergencedurationimpactstheaccessofoxygenbyhalophyticvegetationand,therefore,thestabilityofthemarshplatform.Deviationoftemporalsymmetryofthetidalcurrentvelocitythroughtheinletchannelresultsinadifferenceinnettransportbetweenthebasinandocean.Nettransportinuencestheavailabilityofsedimentforthemarshplatform,acriticalcomponentofmarshverticalaccretion.Inthisstudyweusedanumericalmodeltoinvestigatetheroleofmarshverticalaccretiononthehydrodynamicresponseintheback-barrierbasintochangesinsealevelrisebyinvestigatingtwomarshaccretionend-memberscenarios:(A)noverticalmarshaccretion,and(B)marshaccretionatarateequaltotherateofsealevelrise.Weransimulationsforasuiteofsealevelrisescenariosbetween0and100cmat10cmincrementfortheSaintMarysEntrance,aninletrepresentativeofamixed-energy,tidedominatedsystem.Modelresultsindicateforastaticmarshplatform(scenarioA),sealevelrisecausesareasfarfromtheinletchanneltobesubmergedforlongerperiodsoftimethanareasclosetotheinletchannel,duetoareductionindrainageefciencyduringtheebbtidalexchange.Thetidalasymmetryforthissystembecomesmoreooddominantwithsealevelrisebecausethedifferenceinstoragecapacitybetweenlowandhightideisreduced.Theinletsystemtransitionsfromebbtoooddominanceathighlevelsofsealevelrise(>70cm).Whentheplatformisabletoaccreteverticallyatthesamerateassealevelrise(ScenarioB),thesystembecomesslightlylessebbdominant,withmoregrosssedimenttransportthroughtheinlet, 73


butsimilarnettransport.Sealevelrisealterstheback-barrierbasinhydrodynamics,changingthedistributionofallochthonoussedimentsandthesubmergenceofthemarshplatform,leadingtofeedbacksbetweenmarshaccretion,hydrodynamics,andinletmorphology. 3.1IntroductionTheresponseofbarrierislandcoastalsystemstosealevelriseiscriticallyinuencedbytidalinletmorphologyandhydrodynamics.Inletsactaspartofasandsharingsystem,inwhichtheinletchannel,ebbandoodshoalcomplexes,andadjacentbarrierislandsareinterconnected( Dean 1988 ; Hayes 1979 ).Chapter 2 explorestherelationshipbetweenmarshverticalaccretionintheback-barrierbasinandthetidalprism,cross-sectionalarea,andebbshoalvolumeforarangeofrelativesealevelrisescenarios.Resultsofthatstudyshowthatmarshplatformswithnoverticalaccretionleadtoanampliedincreaseintidalprism,inletcross-sectionalarea,andequilibriumebbshoalvolumewithsealevelrise.Increasesintheequilibriumebbshoalvolumemayprovideasinkforlongshoresedimenttransportinthevicinityofaninlet,leadingretreatofadjacentshorelines.Sealevelriseinducedchangesinthehydrodynamiccharacteristicsofaninletsystemcanchangetheresilienceofamarshplatformbyalteringtheavailabilityofsedimentandthedurationofvegetationsubmergence.Inthisstudy,weusedanumericalmodeltoinvestigatehowsealevelandmarshplatformelevationinuencethespatialdistributionoftidalrangeandmarshsubmergencedurations,aswellasthetidalinletvelocityasymmetry,inordertounderstandhowchangesinsealevelwouldinuencefactorsthatcontrolmarshplatformresilience. 3.2BackgroundMarshverticalaccretionrateisafunctionoftidalrange,sedimentavailability,andvegetationproductivitysincethemarshplatformaccretesthroughtheaccumulationofautochthonousplantmaterialandallochthonoussediment( ArgowandFitzGerald 2006 ; D'Alpaosetal. 2011 ; KirwanandGuntenspergen 2010 ; Kirwanetal. 2010 ; 74


Mudd 2011 ; Reed 1995 ; Simasetal. 2001 ).Changesinthehydrodynamicsofaninletsystemduetosealevelrisemayimpactthesefactors,leadingtofeedbacksbetweenthemarshvegetation,hydrodynamics,andmorphodynamics.Assumingnonetsedimentaccumulationduetoareductioninowvelocity,increasedwaterdepthdecreasesthefrictionintheinletandbasinchannels,modifyingthespatialdistributionofowthroughoutthebasin,thetidalcurrentvelocityasymmetry,andthedurationofsubmergenceofthemarshplatform( SeeligandSorensen 1978 ; SpeerandAubrey 1985 ).Changesinthetidalvelocityasymmetryalterthenetowofallochthonoussedimentsintoandoutofthebasin,aswellastheavailabilityofsedimentforaccretionofthemarshplatform( Gardineretal. 2011 ).Therearetwoprincipalcontrolsontidalinletvelocityasymmetryalteredbychangesinrelativesealevel:(1)frictionalinteractionbetweenthetidalcurrentandchannelbottoms,and(2)theintertidalwaterstorage.Highratiosoftidalamplitudetochanneldepthcorrespondtoshortebbdurationswithhighoodvelocitiesandooddominantsedimenttransport( FriedrichsandAubrey 1988 ; SeeligandSorensen 1978 ; SpeerandAubrey 1985 ).Channeldeepening(andthereforefrictionreduction)shouldmakeasystemlessooddominant(moreebbdominant).Ahighratioofintertidalstoragevolumetobasinchannelvolumeprolongsooddurationwithhigherebbvelocitiesandebbdominantsedimenttransport( BoonandByrne 1981 ; DiLorenzo 1988 ; FriedrichsandAubrey 1988 ; NummedalandHumphries 1978 ; SpeerandAubrey 1985 ).Athightide,thelargeroodedsurfaceareadoesnotdrainefcientlythroughtheinlet,leadingtoasubstantiallagtimebetweentheoceanandbasintidalpeaks.Duringlowtide,thesurfaceareaissmallerandthereisashorterlagtimebetweentheoceanandbasintidalpeaks.Thesedifferencesinlagtimesresultinprolongedooddurationsandhigherebbowvelocities/shearstresses( FitzGeraldandNummedal 1983 ). 75


Ifmarshaccretionrateisnotsufcienttokeeppacewithsealevelrise,themarshplatformwillbecomesubmergedforprolongedperiodsoftimesandthevegetationwillbedeniedadequateoxygen,leadingtoplantwaterlogginganddrowning( D'Alpaosetal. 2011 ; Kirwanetal. 2010 ; MariottiandFagherazzi 2010 ; Morrisetal. 2002 ; Orsonetal. 1985 ).Localplantdrowningalterstheproductivityofthemarshplatformsystemandreducestheavailabilityofautochthonoussediments,makingtheentiresystemmorevulnerabletosubmergencewithsealevelrise( Orsonetal. 1985 ). 3.3Methods 3.3.1StudySiteThestudysiteforthisresearchistheSaintMarysEntrance(SME,Figure 3-1 ),aninletlocatedonsoutheasternAtlanticcoastoftheNorthAmerica,atthesouthernendofaregionreferredtoastheSeaIslandChain,whichextendsfromsouthernNorthCarolinatonorthernFlorida.TheSMEislocatedonthestateborderbetweenFloridaandGeorgia,atthesouthendofCumberlandIslandandthenorthendofAmeliaIsland.Theinlethascharacteristicsthataretypicalofamixed-energytidedominatedsystem( Hayes 1979 ),withalargeebbshoalcomplexandanexpansiveregion(197km2)ofwetlandsintheback-barrierbasin.Theback-barrierbasinconsistsofalarge,atmarshplatformdissectedbytidalchannels.Figure 3-2 showsthe3arc-secondresolutionbathymetryofthebasinderivedfromthefreely-available,NationalGeophysicalDataCenter(NGDC)CoastalReliefModel,withthemeanhighwater(MHW)andmeanlowwater(MLW),at0.88mand-0.95mrelativetomeansealevel(MSL),shownasthinandthickblackcontourlines,respectively.ThecumulativedistributionofelevationwithinthebasinisshowninFigure 3-3 asthegreenshadedregion.Theelevationsaredividedinto1mintervals,andthepercentageofthebasinthatresideswithineachofthoseintervalsinshowninthebargraphontheleft.Theproportionofbasinareathatlieswithinthespringtidalrangeisshowninyellow. 76


Giventhatasubstantialfractionofthebasinhasanelevationwithinthespringtidalrange,thesizeoftheoodedbasinareamorethandoublesduringatidalcycle.Thetemporaldistributionoftheoodedbasinareacalculatedusingmodelsimulationsdescribedinsection 3.3.2 isshown,astheshadedarea,inFigure 3-4 .Asthebasinllsduringtherisinglimbofthetidalcycle,theslopedchanneledgesbecomesubmerged,then,asthemarshplatformedgeisovertopped,thefractionofthebasinsubmergedquicklyincreasesdrasticallyinsize.Asthetidecontinuestorise,theoodedareaoftheplatformcontinuestoexpand,untilthemaximumelevationisreached.Thereversepatterniswitnessedduringtheebbingportionofthetidalcycle. 3.3.2ModelSetupThethree-dimensionalhydrodynamicnumericalmodelingsuite,Delft3D,wasusedtoinvestigatetheroleofverticalmarshaccretiononthehydrodynamicresponseoftheback-barrierbasintoincreasesinsealevelrise.Weappliedtwoend-memberresponsesofmarshaccretiontothemodel:(A)noverticalmarshaccretion,and(B)verticalmarshaccretionthatkeepspacewithsealevelrise.AreasofmarshcoverageweredeterminedusingvegetationcoverageinformationavailablefromtheNationalWetlandsInventory(NWI)providedbytheU.S.FishandWildlifeService.Inmodelsimulationsusinganaccretingmarshplatform(scenarioB),onlythebasinchannels,unvegetatedshorelines,andoceandeepenedwiththerisingsealevel.Insimulationsusingastaticplatform(scenarioA),increasestomeansealevelwereappliedevenlythroughouttheentiremodeldomain(i.e.ocean,basinchannels,marshplatforms).Aseriesofmodelsimulations,coveringarangeofsealevelrisemagnitudes,between0and100cmat10cmincrements,wereconductedforbothmarshaccretionscenarios.Themodelgridiscurvilinear,consistingofahorizontalgridof419x319cells,whichisfurtherexpandedverticallyinto8layers.Theaveragegridspacinginthebasinis100mx100m,increasinginthex-direction(eastward)intothedeepeningoceandomain.Weutilizedasigmacoordinatetransformationintheverticaldirection, 77


whichdivideswaterelevationintoevenlyspacedslices,varyinginthicknesswithchangesinwaterelevation.Inthesemodelsimulations,wedonotincorporatesedimenttransportormorphologicchanges,becauseofalackofsufcientinsituobservationstoadequatelycalibratesimulationsofsedimenttransportwithinthesystem.AcalibrationandvalidationstudywasperformedusingNOAAADCPdata,tidalstationwaterelevations,andpreviouslydocumentedtidalprismmeasurements.DetailedinformationandresultsofthisstudycanbefoundinChapter 2 3.4Results 3.4.1SpatialDistributionofTidalRangeandMarshSubmergenceAsmentionedabove,forsimulationsinwhichthemarshplatformisabletomaintainverticalaccretionatthesamepaceassealevelrise,onlythebasinchannelsandtheiradjacentunvegetatedshorelinehaveincreaseddepth.Deeperbasinchannelsreducethedegreeoftidalwaveattenuationwithinthebasin,leadingtoanincreaseinthetidalrangeinareasfar(10-20km)fromtheinletchannel.ThiscanbeseenintheFigure 3-5 ,wherethechangeintidalrange,withrespecttoitsvalueforpresentsealevel,isshownfor10,20,40,60,80,and100cmofsealevelrise.Channellocationsclosetothethroatshowsmallincreasesintidalrange(e.g.1-5cmpermeterofsealevelriseforsiteswithina10kmalong-channelpathoftheinletthroat),butthetidalrangeincreasegrowswithgreateralong-channeldistances.Theincreaseintidalrangeatdistalregionsofthebasinraisestheeffectivebasinareacontributingtothetidalprism.Anincreaseintidalrangealsooccursonunvegetatedsectionsofthechanneledgesassealevelrisecausesthoseareastoresidelowerwithinthetidalrange.Forsimulationsinwhichmarshplatformelevationisstatic,sealevelrisecausesadecreaseinthetidalrangeinchannelreacheswithinapproximately15kmoftheinletthroatbecausewaterisredistributedontothemarshplatform.Oncetheowisallowedtoexpandhorizontally,theverticalchangeinwaterelevationisreduced.Figure 3-6 78


showsthechangeintidalrangethroughoutthebasinonastaticmarshplatform.Tidalrangesforallareasofthemarshplatformincrease,withthegreatestincreaseforlocationsclosetotheinletchannel,probablybecausethesearethelocationswheretidalexchangeismostefcient.Figure 3-7 showsthechangeintidalrangeforsevenlocationswithinbasinchannelsinordertohighlightthedifferenceintidalrangechangebetweenthemarshaccretionscenarios.Thefourpointswithin15kmfromtheinletchannelexperienceaslightincreaseintidalrangewithsealevelrisewhenthemarshplatformisaccretingverticallyatthesamepaceassealevelrise.Pointsinmoredistalregions,withlongeralong-channeltraveldistances,experiencemoredramaticincreasesintidalrangewithsealevelrise.Asimilartrendisseeninthecaseofastaticmarshplatform,wherethesedistalpointshaveincreasedtidalrangesduetoareductioninfrictioninthechannelsallowingmorewatertoaccessthisportionofthebasin.Whenthemarshplatformisstatic,thecloserpointsdecreaseintidalrangeduetothedistributionofwaterontotheadjacentmarshplatform.Whenthemarshvegetationisabletoaccreteverticallyatthesamepaceassealevelrise,littlechangeinsubmergencedurationshouldoccursincetheplatformmaintainsasteadyelevation,relativetosealevelrise,withinthetidalrange.Underpresentsealevelconditions,themarshplatformissubmergedapproximately50%ofthetimethroughoutthebasin.Modelresultsshowthatwhenmarshplatformelevationisstatic(non-accreting),thesubmergencedurationincreasesnon-uniformly,inspiteofanearlyuniformmarshplatformelevationthroughouttheback-barrierbasin.Figure 3-8 showsthespatialdistributionofsubmergencefrequencyforsealevelrisemagnitudesof0,20,40,60,80,and100cmonastaticmarshplatform.Distalmarshplatformareas,locatedfarfromtheinletchannel,experiencelongerdurationsofsubmergence,foragivensealevelrise,ascomparedtoproximalareas. 79


Figure 3-9 displaysthechangeinthewaterdepthatthreepoints(SiteA,SiteB,andSiteCshowninthegurefromtoptobottom)onthemarshplatformforsealevelriseconditionsof0,20,40,60,80,and100cm,onastaticmarshplatform.SitesA,B,andCareapproximately18,13,and9kmalong-channelfromtheinletthroat,respectively.Whilethereareincreasingmaximumdepthsduringhightidewithsealevelriseatallthreelocations,SiteAshowsincreasinglowtidelevelsbecausethewaterdoesnotfullydrainingfromtheplatformduringlowtide.Theseplotsillustratethenon-uniformspatialdistributionofdrainageefciency.Areasofthemarshplatformsthatarefartherfromtheinletchanneldonotfullydrainduringatidalexchangeand,therefore,haveaslightlylowerincreaseintidalrangeandmaintainalayerofwaterforalargerproportionofthetidalcycle. 3.4.2TidalVelocityAsymmetryFigure 3-10 (A)showsavelocity-stageplotforresultsfromthreenumericalmodelsimulations:(i)forthepresentsealevelcondition,(ii)forasealevelriseof60cmonastaticmarshplatform,and(iii)for60cmonanaccretingmarshplatform.Theplotillustratestheowspeedatdifferenttimesduringthetidalcycle.ThetimeseriesofwaterelevationinthechannelandowspeedsareshowninFigure 3-10 (B).Thevelocity-stageplotdemonstratesthatthereisareversalfromoodingtoebbingow(negativetopositivevelocityvalues),referredhereinashighwaterowreversal(HWFR),thatoccursnearlytwohoursafterhightide,duringthefallinglimbofthetidalcycle.Thisdelayisduetothephaseshiftbetweenthetideinthebasinandoceancausedbytheinertialeffectofthewaterintheinlet.HWFRisobservedtooccurattwodiscretewaterlevels.Theowalsoreversesfromebbingtoooding(positivetonegativevelocityvalues),referredtohereinaslowwaterowreversal(LWFR),duringtherisinglimbofthetidalcycle,alsoattwowaterlevels.Thetwowaterlevels,occurringduringeachowreversal,arecausedbydiurnalinequalityproducedbytheeffectofthemoon'sdeclination,whichcontributetochangingthewaterlevelofhighandlowtideoccurrence. 80


Forpresentsealevelconditions,owintothebasin(tidalooding)occursforalongerportionofthetidalcyclethanowoutofthebasin(tidalebbing);thiscausesthepeakowspeedstobegreaterduringtheebbexchangethanduringtheoodexchange.Thisdifferenceinowdurationsiscreatedbytheinteractionofthetidalharmoniccontsituentsoftheforcingtides.Sealevelrisecausespeakcurrentvelocities,duringbothebbandoodexchange,toincreaseinboththestaticandaccretingmarshscenarios,thoughtheeffectisdemonstrablygreaterinmodelsimulationsforthestaticmarshplatform.Thepositionwithinthetidalcycleatwhichtheowreversesfromoodingtoebbingdoesnotchangesignicantlywithsealevelriseineitherofthemarshaccretionscenarios.Thereversalfromebbtooodtidalexchangeisdelayedinthesimulationswithastaticmarshplatform,causingtheebbingowtooperateoveranincreasedportionofthetidalcycle.Theinstantatwhichthewaterelevationonthebasinsideoftheinletchannelisequaltotheelevationontheoceansideoftheinletchannelrepresentsattimeatwhichthereisnotidalowthroughtheinletchannel-identiedaboveasthereversals(HWFRandLWFR).ThechangeinthetimingofHWFRandLWFRasafunctionofsealevelriseisshowninFigure 3-11 .Figure 3-11 (A)showsthischangeforanaccretingmarshplatformandFigure 3-11 (B)showsthischangeonastaticmarshplatform.AnincreaseinthelagduringHWFRshouldprolongoodtidalexchangeandanincreaseinthelagduringLWFRshouldprolongebbtidalexchange.Therelativedurationsofeachlagchangedeterminesifthesystemisintransitiontoamoreoodorebbdominantsystem.Onamarshplatformthatkeepspacewithsealevelrise,theLWFRlagincreasesandtheHWFRlagdecreases,leadingtoanoverallincreaseinthedurationoftheebbtidalexchange.SealevelriseonastaticmarshplatformincreasesthelagofboththeLWFRandHWFR.Inthiscase,theLWFRlagisgreaterthantheHWFRlag,andtherefore,thesystemhasincreasedebbtidalexchangedurations. 81


Atpresentsealevel,theinletisclassiedasanebbdominantsystembecauseofthehigherebbdirectedcurrentvelocities.Bedloadsedimenttransportisproportionaltothecubeofthespatially-averagedvelocityacrosstheinletchannelresultinginanetseawardsedimenttransportinebbdominantsystems( Bagnold 1963 ; FryandAubrey 1990 ).Figure 3-12 and 3-13 showmodelresultsofthespatiallyaveragedvelocity,thecubeofthespatiallyaveragedvelocity,andcumulativesumofthecubeofthespatiallyaveragedvelocityfortheaccretingmarshplatformandthestaticmarshplatform,forsealevelrisemagnitudesrangingbetween0and100cmat10cmintervals.Positivevaluesrepresentowintheebbdirection.Forbothmarshaccretionscenarios,themagnitudeofthespatiallyaveragedvelocityincreasesintheebbandooddirectionwithsealevelrise.Thisincreaseisampliedwhenthemarshplatformisstatic.Thevelocitycubedisusedasanestimateofnettransportinordertoestimatedominantdirection.Resultsfortheaccretingmarshplatformshowanoverallslightincreaseinthegrosstransportthroughtheinlet,andaslightshifttowardthebalanceoftransportintheooddominantdirection.Forastaticmarshplatform,thegrosstransportthroughtheinletincreases,andthenettransporttransitionsfrombeingdominantlyintheebbdirectiontotheooddirectionwithincreasesinsealevel.Figure 3-14 displaysmodelresultsoftheratioofoodtoebbtransport,estimatedasthespatially-averagedvelocitycubedfortherangeofsealevelmagnitudesinvestigatedonanaccretingandastaticmarshplatform.Onanaccretingmarshplatform,theratioofoodtoebbtransportslightlyincreaseswithhighermagnitudesofsealevelrise,implyingthatthesystembecomesslightlylessebbdominant.Whentheplatformisstatic,theratioofoodtoebbtransportincreases,becomingaooddominantsystemathighlevelsofsealevelrise(>70cm).Oncethetransitiontoooddominanceoccurs(ratioofoodtoebbsedimenttransportgreaterthan1),theratioofoodtoebbsedimentexchangebecomeslesssensitivetosealevelrise. 82


3.5DiscussionInourmodelresults,werevealnon-uniformincreasestothevegetation(marshplatform)submergencedurationwhenthemarshwasstatic(non-accreting),despitetherelativelyattopographyontheplatforms.Itisnotablethat,holdingotherfactorsconstant(sedimentdistribution,vegetationtypes,etc.),marshvegetationatgreaterdistancesfromtheinletchannelmay,surprisingly,bemorevulnerabletodrowningfromanincreaseinlocalsealevel.Thisphenomenonarisesbecauseofthedecreaseddrainageefciencyatdistalregionsofthebasin.Whenanareaofvegetationdiesoff,theplantsceasetocontributetotheallochthonoussedimentsandthemarshmaybecomelessefcientatverticalaccreting.Verticalaccretionatarateslowerthantherateofsealevelrisewillleadtoanincreasethesubmergencedurationsthatthesystemexperiencesduringincreasesinlocalsealevel,leadingtoafeedbackthatputstheentiremarshsystematriskofsubmergenceanddie-off.TheSMEback-barrierbasinhasalargeportionofmarshplatformatanelevationclosetopresentmeansealevelandisdissectedbynumeroustidalchannels.Theoodedareaofthebasinapproximatelydoublesinsizewhencomparingbetweenlowandhightide.Thistypeofbasinhypsometryisinlinewiththosedescribedtobeebbdominant,whichisseeninmodelresultsbytheprolongedooddurationandhigherquantitiesofnetsedimenttransportoutofthebasin,seaward.Boththefrictioninthechannelsandthedrainageefciencyofthesystemarealteredbychangestolocalsealevelandbytherateofverticalmarshaccretion.Inmodelexperimentswithaccretingmarshes,thebasinchannelsdeepen,therebyreducingthefrictionaldragwithinthesystem,whichwouldbeexpectedtoleadtoanincreaseintheebbdominanceofthesystem( FriedrichsandAubrey 1988 ; SeeligandSorensen 1978 ; SpeerandAubrey 1985 ).Thisisnotseeninourresults,possiblyduetotheoodingofunvegetedareasadjacenttothebasinchannelsimposingagreaterinuenceonthesystem.Thereis 83


onlyaslightchangeinthetidalvelocityasymmetryinthissystem(approximately1%increaseintheratioper10cmofsealevelrise).Inmodelsimulationswithastaticmarshplatform,theoodedbasinareaincreasesduringlowertidalstagesandthedifferenceinthewaterstoragebetweenhighandlowtideisreduced.Thisreducesthedifferenceinthelagtimebetweentheoceanandbasinhighandlowtideoccurrencetimes,decreasingtheebbdominanceofthesystem.ThischangeisillustratedbytheincreaseintheLWFRlagshowningure 3-11 .Atsealevelriseover70cm,thechangeinstoragecapacityduetosealevelriseisreducedbecausethemarshplatformisoodedforthemajorityofthetidalcycle.Atthatpointfrictionalchangesbecomeamoresignicantforceforchangeinthesystem'sbehavior.Tidalasymmetryhasbeenfoundtobeanimportantfactorinthetransportandaccumulationofsedimentinaninletsystem.Whenthemarshplatformisstatic,thenetsedimenttransporttransitionsfromebbtoooddominance.Thisincreaseintransportintothebasinprovidesmoreallochthonoussedimenttothemarshplatform,increasingtheabilityoftheplatformtoaccretevertically.Acorrelationbetweenoodtidaldominantsystemsandhighratesofmarshaccretionhasbeendocumented( Gardineretal. 2011 ).Thisfeedbackcouldhelptoprotectthemarshsystembyallowingittomaintainverticalaccretionratesequaltosealevelrise.Increasesinsedimenttransportintothebasinmayhaveimplicationsforlongshoresedimentmovementandaccumulationonadjacentshorelines.Thesechangestothebalanceoftheinletsystemcouldalterthealongshoreerosional-depositionalpatternandleadtolocalshorelineerosion.Thisimpactmaybeampliedbychangestotheequilibriumebbshoalvolume,leadingtoalocalsedimentsinkinboththemarshplatformandtheebbshoal( LoveringandAdams inreview ). 84


3.6ConclusionsInthisresearch,weaimtounderstandtheroleofverticalmarshaccretionandsealevelriseonsomeofthesedimentfeedbackwithintheestuary,specicallysubmergencedurationandtidalvelocityasymmetry.Submergencedurationisacriticalfactorinthevegetation'sabilitytomaintainadequateaccesstooxygenandtheplant'ssusceptibilitytodrowning.Ifthevegetationdrownsthenthereisdecreasedinsitusedimentproductionandtheentiremarshsystemwillhavelessautochthonoussedimentforverticalaccretion.Thetidalvelocityasymmetryintheinletsystemcontrolsthenettransportofsedimentintoandoutoftheestuary,impactingallochthonoussedimentdeliverytothemarshplatform.Usingtheresultsofournumericalmodelingstudy,weconclude: Submergencedurationincreasesnon-uniformlythroughoutthebasinwithsealevelrise,despitetherelativelyatmarshplatformtopography,duetoadecreaseindrainageefciencythroughoutthebasinandinletchannels.Sealevelrisecausesdistalreachesofthemarshplatformtomaintainalayerofwatercoverforalongerportionofthetidalcyclethanregionsmoreproximaltotheinletchannel,makingtheseareasmoresusceptibletowaterlogginganddrowning. Tidalvelocityasymmetryshiftsintheooddominantdirectionwithsealevelriseduethedecreaseinthedifferenceinstoragecapacitybetweenhighandlowtideforbothverticalmarshaccretionscenarios.Thiseffectisampliedwhenthemarshplatformisstatic. Ashiftinthetidalvelocityasymmetryintheooddominantdirectioncausesanincreaseinthenetsedimenttransportinthebasindirectionleadingtobasininllingandmoresedimentavailabilitytothemarshplatformforverticalaccretion.Thesedimentdeliveredtothemarshplatformisattheexpenseofothermorphologicelementsoftheinlet,includingtheebbshoalcomplexandadjacentbarrierislands,whichcouldleadtoerosionofthelocalshoreline. 85


Figure3-1. MapofSaintMarysEntrancewithmarshvegetatedareahighlighted,insetonamapoftheSeaIslandChain.SMEisthesouthernmostinletintheSeaIslandchainlocatedontheAtlanticcoastoftheUS. 86


Figure3-2. MapofelevationsintheSaintMarysEntrancereferencedtoMSL,withtheMLWandMHWelevationscontoursshown.ElevationsarefromtheNationalGeophysicalDataCenter(NGDC)CoastalReliefModelat3-arcsecondresolution. 87


Figure3-3. ThedistributionofelevationsintheSaintMarysEntrancebasinisshowninthebargraph.Theelevationsthatliewithinthespringtidalrangearehighlightedintheyellowzone.Thegreyshadedregionsisthecumulativedistributionofelevations,indicatingthepercentageofthebasinthatisaboveeachelevation.ThereisapeakinthebasinareaisaroundMSL,withapproximately20%ofthebasinresidingwithin0.5mofMSLandapproximately25%withinthespringtidalrange. 88


Figure3-4. ThetemporaldistributionofoodedbasinareaintheSaintMarysEntrancebasinforpresentsealevelconditions.Theoodedareaofthebasinisalways100km2orlarger.Asthetiderisesfromlowtide,thechannelbanksaresubmergedandtheoodedareaincreasestoapproximately150km2.Asthemarshplatformisovertopped,theoodedareagrowsquicklytonearly225km2.Atthatpoint,thetiderisestoitsmaximumelevationandtheoodedbasinareacontinuestoexpanduntilitreachesamaximumof240km2. 89


Figure3-5. Thespatialdistributionofthechangeintidalrangefrompresentsealevelconditionsasaresultofasealevelriseonanaccretingmarshplatform.Increasesintidalrangeoccurinareasofthebasinchannelsthatarefartherfromintheinletandalongnon-vegetatedareasofthechanneledges.Littlechangeoccursonthemarshplatformorinthebasinchannelsthatareclosetotheinlet. 90


Figure3-6. Thespatialdistributionofthechangeintidalrangefrompresentsealevelconditionsasaresultofasealevelriseonastaticmarshplatform.Increasesinthetidalrangeonthemarshplatformoccurovertheentireplatform,butthereisanampliedincreaseinareasthatareclosertotheinlet.Tidalrangeinthechannelsdecrease,likelyduetotheredistributionofwaterontotheadjacentplatforms. 91


Figure3-7. Thechangeintheaveragetidalrangeover10tidalcyclesduetosealevelriseforsevenchannellocations,indicatedonthemapin(A).Thechangeisshownforanaccreting(B)andastatic(C)marshplatform.Whenthemarshplatformaccretesvertically,thetidalrangeinallofthechannellocationsincreaseduetoareductionintidalwaveattenuationwithchanneldeepening.Inthestaticmarshplatform,moreproximallocationsdecreaseintidalrangebecausetheowisdistributedbetweenthechannelsandthemarshplatform. 92


Figure3-8. Thespatialdistributionofthesubmergencedurationduetosealevelriseonastaticmarshplatform.Thedurationisshownasthepercentageoftimeduringa10tidalcycleperiod.Initially,themarshplatformissubmergedapproximately50%ofthetime.Thesubmergencedurationsincreasethroughoutthebasinassealevelincreases,withmoredramaticincreasesatmoredistalareasofthebasin. 93


Figure3-9. Timeseriesofwaterdepthatthreepointslocatedonthemarshplatformforsealevelriseof0to100cmat20cmintervalsforastaticmarshsystem.Thelocationofthepointsareindicatedonthemap,labeledassiteA,B,andC.Theyareatapproximately18,13,and9kmalong-channeldistancesfromtheinletchannel,respectively.Thetwoclosersites(BandC)tendtodrainmoreefciently,withamorerapiddecreasesinwaterlevel,reachingzeroatlowtideforsealevelriseupto60cm. 94


Figure3-10. Thevelocitystageplotandthetimeseriesofthewaterlevelsandthespatiallyaveragedvelocitythroughtheinletforpresentsealevelandasealevelriseof60cmonastaticandanaccretingmarshplatform.Thetopplotshowsthevelocitystageplotforthespatiallyaveragedcurrentacrosstheinletcross-sectionforpresentsealevel(black)andforasealevelincreasesof60cmonanaccreting(blue)andstatic(red)marshplatformforthetidalsignalshowninthelowerplot.Onthelowerplot,thegreenlineisthetimeseriesofwaterelevationsandtheblack,blue,andredlinescorrespondwiththetopplot.Positivevaluesofcurrentspeedrepresentowoutofthebasin(ebbcurrents)andnegativevaluesrepresentowintothebasin(oodcurrent).Thechangefromebbtooodandfromoodtoebbareindicatedasthelowwaterowreversal(LWFR)andhighwaterowreversal(HWFR),respectively. 95


Figure3-11. ThechangeintimeatwhichtidalowreversalsoccurduetosealevelriseforA)anaccretingandB)astaticmarshplatform.Thisisshownforthehighwaterowreversal(HWFR)andthelowwaterowreversal(LWFR).Thetimechangeofthereversalsindicatethechangeindurationoftheoodandebbtidalexchange,withanincreaseintheHWFRindicatinglongerooddurations,andanincreaseintheLWFRindicatinglongerebbdurations. 96


Figure3-12. Thespatiallyaveragedvelocityacrosstheinlet,thecubeofthespatiallyaveragedvelocity,andthecumulativeofthespatiallyaveragedvelocitycubedforsealevelriseonanaccretingmarshplatform.Positiveowvaluesindicateowoutofthebasin(ebbcurrent)andnegativevaluesindicateowintothebasin(oodcurrent).Thecubeofthevelocityisusedasaproxyforthenetbedloadsedimenttransport,withthecumulativeofthecubeindicatingthedominanttransportdirection. 97


Figure3-13. (Thespatiallyaveragedvelocityacrosstheinlet,thecubeofthespatiallyaveragedvelocity,andthecumulativeofthespatiallyaveragedvelocitycubedforsealevelriseonastaticmarshplatform..Positiveowvaluesindicateowoutofthebasin(ebbcurrent)andnegativevaluesindicateowintothebasin(oodcurrent).Thecubeofthevelocityisusedasaproxyforthenetbedloadsedimenttransport,withthecumulativeofthecubeindicatingthedominanttransportdirection. 98


Figure3-14. Theratiooftheoodtoebbsedimenttransportproxyisshownforanaccretingmarshplatform(blue)andastaticmarshplatform(red)foranincreaseofsealevelbetween0and100cm.Thespatiallyaveragedvelocitycubedisusedasaproxyforsedimenttransport.Avalueofonerepresentsequaloodandebbtransport,withvalueslessthanoneindicatingebbdominanttransport,andgreaterthanonerepresentingooddominanttransport. 99

PAGE 100

CHAPTER4THEROLESOFMARSHCONFIGURATIONANDMARSHMARGINRETREATONTIDALINLETMORPHOLOGYMorphologicevolutionoftidalinletsdependsontheecogeomorphicbehavioroftheback-barrierbasin,andexertsastronginuenceonlocalshorelineresponsetosealevelrise.Atidalinletchannelactsastheprincipalvalveforwaterandsedimentexchangeinabarriersystem,butchangestoback-barrierbasinecology,hypsometry,andownetworkcongurationcanalterdischargeconveyedthroughtheinletchannel.Wetlandvegetationlosscanchangethetidalprismforaparticularinletby:(1)increasingthemap-viewareaofopenwaterexchangedbetweentheback-barrierbasinandtheoceanduringatidalcycleand(2)reducingthespatialrateoftidalwaveattenuationwithinthebasin.WeuseasimpleconceptualmodeltoexplorethegeomorphicresponseoftwoFloridainlets,ofcontrastingwetlandcongurations,touniformbackbasinvegetationlossthatmightresultfromcurrentprojectionsofsealevelrise.Allresultsshowthatvegetationlosscausesanincreaseintidalprism,inletcross-sectionalarea,andebbshoalvolume,butinletswithwetlandcongurationsthatstronglyincreasetidalwaveattenuationintheback-barrierbasinhaveanampliedresponsetovegetationloss.Usingempiricalrelationships,wendthataonepercentlossofback-barrierbasinvegetatedarearesultsinanincreaseofebbshoalvolumebyanamountapproximatelyequivalenttoannualtobienniallongshoresedimenttransportratesalongtheFloridaAtlanticcoast.Theconceptualmodeldevelopedinthisstudycanbeusedtoexaminemorphologicresponseoftidalinletsystemstowetlandvegetationlossatsimilarbarrierislandcomplexesworldwide. 4.1IntroductionTheresponseofatidalinlettosealevelrisehasbeenshowntobehighlydependentontheecogeomorphicresponseofvegetationintheadjoiningback-barrierbasin.TheBaratariaBay,locatedinsoutheasternLouisiana,hasexperiencedmarshlossduetosealevelriseandhighenergystormwaves( Barras 2006 ; Barrasetal. 100

PAGE 101

1994 ; BritschandDunbar 1993 ),whichhasledtoanincreaseinthetidalprismoftheinterconnectedfourinletcomplex,anincreaseinthecross-sectionalareaoftheinletchannels,andanincreaseinebbshoalvolumes( FitzGeraldetal. 2004 2007 ; Listetal. 1994 1997 ).Studiesoftheareahaveshownthatduringthepast100yearstherehasbeenarapidincreaseinthenumberandsizeofinlets( Levin 1993 ; McBrideetal. 1992 ),whichmaybeadirectresponsetoincreasesintidalprismvolumes.Theincreaseinebbshoalvolumeresultingfromincreasedtidalprismisinagreementwiththepredictiverelationshipdevelopedby WaltonandAdams ( 1976 )( Listetal. 1997 ). FitzGeraldetal. ( 2007 )foundthatthefourtidalinletshavequadrupledinsizesince1880.Threeofthefourinletsfellwithinthe95%condenceintervalofthetidalprismandcross-sectionalarearelationshipdevelopedby Jarrett ( 1976 ).Relationshipsbetweentidalprismandmorphologyhavebeenextensivelystudiedandquantied,however,theprocessbywhichwetlanddegradationandconversiontoopenwaterexertscontrolonthetidalprismofasystemmustbefurtherexplored.StudiesusingtheHadCM3climatemodelpredictthat,underanIPCCSRESA1FIworld,thepotentialworldwidecoastalwetlandlossduetosealevelriseisestimatedtobe5-20%bythe2080s( Nicholls 2004 ).Thisstudyexaminestheinuenceofback-barrierbasinvegetationlossontransformationofthetidalprismand,subsequently,cross-sectionalareaandebbshoalvolume.Weinvestigatetwomechanismsfortidalprismchangeresultingfromwetlandareaconversiontoopenwater:(1)thecontributionofincreasedback-barrierbasinopenwaterareatotidalprismvolume,and(2)reductionintidalwaveattenuationwithintheback-barrierbasin.Weinvestigatetwoinletswithsimilartidalrangesandwaveclimatesbutwithstronglycontrastinginitialecogeomorphicconditionsintheiraccompanyingback-barrierbasins,inordertohighlightthecontroloftheinitialwetlandcongurationontheevolutionofthetidalinletduetovegetationdeterioration.Weconcludewithadiscussionoftheimplicationsofcontinuedsealevelriseonthemorphologicevolution 101

PAGE 102

oftidalinlets,ebbshoal,andadjacentbeach/dunecomplexesandcommentontheapplicationofthisconcepttobarriersystemsworldwide. 4.2ModelDetailsWehavedevelopedaconceptualmodeltoexploretheprocesslinkagesamongback-barrierbasinwetlandvegetation,hydraulicsofatidalinlet,andthegeomorphicevolutionoftheinletsystemunderascenarioofwetlandconversiontoasubtidalenvironment.Figure 4-1 organizestheprocessesandlinkages,whicharedescribedinsomedetail,below.Iftherateofsealevelriseisrapidenoughtooutpaceverticalaccretionofthevegetation,non-aquaticplantsmayexperiencerootsubmergenceforprolongedperiods,preventingaccesstooxygen,whichwillpromotewaterloggingandsubsequentdrowning(Figure 4-1 ,ProcessA).Asplantdrowningoccurs,thewetlandsystemlosesbiomass,decreasingtheamountofinsitusedimentproduction.Thisinhibitsthebasin'sabilitytoaccretevertically,andtheback-barrierecosystemmaybecomemorevulnerabletoinundationfromsealevelrise( Muddetal. 2009 ; Orsonetal. 1985 ).Thesusceptibilityofsaltmarshestoinundationhasbeenshowntobedependentonthesedimentsupplyandtidalrangeofthesystem;systemswithgreatersedimentavailabilityandhighertidalrangeareabletoaccreteverticallyatamorerapidpace( D'Alpaosetal. 2011 ; KirwanandGuntenspergen 2010 ; Kirwanetal. 2010 ; Reed 1995 ; Simasetal. 2001 ).Thereexistsathresholdrateofsealevelriseforwhichmarshesfailtomaintainasufcientverticalaccretionrate;ifthisthresholdvalueisreached,thendegradationcanbeexpectedtocommenceapproximately30-40yearslater( Kirwanetal. 2010 ).Mangroveforestsrespondsimilarlytosealevelriseandaresensitivetotheavailabilityofallochthonoussediments( EllisonandStoddart 1991 ).Therelationshipbetweensealevelriseandvegetationdegradationisnotquantitativelyaddressedinthisstudy,butisakeycomponentinthesequenceofback-barrierbasinexpansion.Sealevelrisecouldleadtosubmergenceoflow-lying,unvegetatedland,generatingincreasedbasinareaandtidalprism(Figure 4-1 ,ProcessB).Inthis 102

PAGE 103

study,thisisconsideredanegligibleincreasesincecoastalstructuresbordermostunvegetatedsectionsofthebasinboundariesinourstudysites,butthisshouldbeaddressedinundevelopedlocations.Sealevelriseincreasesdepthintheback-barrierchannelstherebyreducingthespatialrateoftidalwaveattenuation(Figure 4-1 ,ProcessC),acomponentwhichissignicantlysmallerthantheeffectsofvegetationontidalwaveattenuation( MollerandSpencer 2002 )andisignoredinthisstudy.Theactualtidalprismofaninlet(P)canbeestimatedastheidealtidalprism,wherethetidalexchangeisinstantaneousanduniformthroughoutthebasin,lessthelossintidalprismduetotidalwaveattenuation.Ateachofourstudysites,theinletconnectsalong,narrow,shore-parallelbasintotheocean.Weparameterizebasingeometries,bydeningtwosectionsofbasinseparatedatthelocationoftheinletchannel,andbycalculatingthelengths(L1andL2)andmeanwidths(w1andw2)ofeachsection(Figure 4-2 ).Formorecomplexbasingeometries,thebasinmaybesubdividedintomoresections.Weassumethatthetidalwaveheightattenuatesataspatially-uniformrate(R)withinthebasin.Undertheseassumptions,thetidalprismcanbecalculatedas P=H(L1w1+L2w2))]TJ /F9 11.955 Tf 13.15 8.09 Td[(1 2R(L21w1+L22w2),(4)whereHisthetidalrange.Itisexpectedthatthevegetationlosswouldoccurfrommarshedgeerosion( Allen 1997 ; D'Alpaosetal. 1993 ; FitzGeraldetal. 2007 ; Kirwanetal. 2008 )orseawardedgeretreatofmangroves( Ellison 1991 ).Areductioninwetlandareawould,therefore,increasechannelwidthandreducethetortuosityofthesystem;wetlandvegetationlossshouldreducetidalwaveattenuationintheback-barrierbasin(Figure 4-1 ,ProcessD).Decreasedtidalwaveattenuationincreasestheactualtidalprism,P,orthevolumeofwatermovingthroughthebasinduringatidalcycle(Figure 4-1 ,ProcessE).Initialmeanattenuationratescanbeestimatedusingequation 4 ifbasingeometryandtidalprismareknown.Weassumethattidal 103

PAGE 104

waveattenuationratevarieslinearlybetweeninitialmeanattenuationrateandtheratecalculatedwithinanunvegetatedend-memberversionofthebasin,aswetlandvegetationlossvariesfrom0to100%.Areductioninvegetatedwetlandareawouldlikelyincreasetheopen-waterback-barrierbasinarea,resultinginanincreasedtidalprism(Figure 4-1 ,ProcessF).Inpractice,thischangeinvegetationareacanbecalculatedusinginformationfromtheU.S.FishandWildlifeServicesNationalWetlandsInventory(NWI),forexample.Wetlandareascanbedividedintotwocategories:highvegetationzoneandlowvegetationzone,classiedthroughtheNWIasareasthatareirregularlyoodedandregularlyooded,respectively.Inthisstudy,weestimatethatlowvegetationzones,wherethetidalwatersalternatelyoodandexposelandsurfacesatleastoncedaily,effectivelycontributetheirareatothetidalprismduringhalfofthetidalcycle.Highvegetationzonesoodlessfrequentlyand,therefore,donotsignicantlycontributetothetidalprism.Inthisstudy,weestimatethatvegetationconversiontoasubtidalenvironmentoccursatarateproportionaltotheinitialcoveragebyeachofthetwozones.Thisisnotalwaysthecase,however,asevidencedbysitesinsouthernNewEnglandwherereplacementofhighmarshvegetationwithlowmarshvegetationhasoccurredbecauseoftheabilitypossessedbysomecordgrassplantspecies(inlowmarshareas)towithstandhighratesofsealevelrise( DonnellyandBertness 2001 ).Itisassumedthatthelossoccursuniformlythroughoutthebasin,butwenotethatvegetationlossoccurringclosetotheinletshouldincreasethetidalprismmoresignicantlythanlossoccurringatdistalsiteswithinthebasin,wheretheinuenceoftidalwaveattenuationislow.Thecross-sectionalareaoftheinletchannel(AC)increaseswithtidalprisminordertoconveyalargervolumeofwaterduringatidalcycle( D'Alpaosetal. 2010 ; Jarrett 1976 ; O'Brien 1931 ; Powelletal. 2006 )(Figure 4-1 ,ProcessG).Inthisstudy,weemploytherelationshipdevelopedby Powelletal. ( 2006 ),whichwasderivedfrom 104

PAGE 105

observationsofFloridainlets, AC=6.2510)]TJ /F7 7.97 Tf 6.58 0 Td[(5P1.00.(4)Inadditiontotheinuenceoninletmorphology,tidalprismhasbeenshowntocorrelatewithgrossandnetsedimenttransportthroughtheinletandwithdepositionvolumeonebbshoals(Figure 4-1 ,ProcessH)( FitzGerald 1988 ; MarinoandMehta 1987 ; WaltonandAdams 1976 ).Inthisstudy,weestimateebbshoalvolume(VE)fromanempiricallyderived,power-lawrelationshipby MarinoandMehta ( 1987 ),thatdependssolelyupontidalprismsize: VE=5.5910)]TJ /F7 7.97 Tf 6.59 0 Td[(4P1.39.(4) 4.2.1StudySitesWechosetwositesfromtheFloridaAtlanticcoasttowhichweapplytheconceptualmodel.SaintAugustineInlet(SAI)andPoncedeLeonInlet(PLI)areseparatedbyapproximately100kmandarebothsubjecttosemi-diurnal,micro-tidal(range<2m)conditions.Someofthehydraulic,morphologic,andecogeomorphicpropertiesoftheinletsystemsareshowninTable 4-1 .Inthisstudy,weusethemeanofthemeasureddata,derivedfrom WaltonandAdams ( 1976 )and Powelletal. ( 2006 )fortidalprisms,inletcross-sectionalareas,andebbshoalvolumes.Theback-barrierbasinofSAIisanorderofmagnitudesmallerinspatialextentthanthatofPLI,andthecongurationsofthesebasinsareillustratedinFigure 4-3 .Despitethesignicantlylargerbasinarea,PLIhasasmallermeasuredtidalprism,whichislikelyduetothepresenceofanextensivenetworkofchannelsseparatedbyislandsofwetlandvegetationbetweentheinletandMosquitoLagoon.SAIhasadistinctmainchannelborderedbymarshvegetation,whereasPLIhasamixtureofmarshvegetationandmangroveforestoccupyingthesidesofthebasinaswellasthebasinislands,whichcharacterizetheanastomosednetworkofsmallchannels.Thevegetatedislandsattenuatethetidalwaveasitmovesthroughthebasin,reducingthetidalprismofthesystem. 105

PAGE 106

ThemeasuredtidalprismatPLIisapproximately11%oftheidealtidalprism,whichiscalculatedbymultiplyingtidalrangebyopen-waterbasinarea.Usingequation 4 ,ameanattenuationrateof4.7cm/kmthroughoutthebasinisrequiredinordertocausethisdegreeoftidalwaveattenuation.Forcomparison,studiesofwaterlevelsthroughanunimpededsectionoftheIndianRiverclosetotheinletatPLIdeterminedanattenuationrateofapproximately1.1cm/km( MilitelloandZarillo 2000 ).SAItidalprismmeasurementsyieldvaluesthatareclosertotheideal(88%),requiringameanrateofonly1.6cm/kmthroughoutthebasintoaccountforthedifferencefromideal.PLIhasasmallercross-sectionalareaandebbshoalvolumethanSAI,aswouldbeexpectedtoaccompanythesmallerobservedtidalprism.Atbothstudysites,thepredictiverelationshipdevelopedby Powelletal. ( 2006 )(equation 4 )and MarinoandMehta ( 1987 )(equation 4 )underpredictsthecross-sectionalareaandebbshoalvolumesmeasurementspresentedin Powelletal. ( 2006 )and WaltonandAdams ( 1976 ).ThisisshowninFigure 4-5 asthegreen(SAI)andblue(PLI)stars.AtPLI,thecross-sectionalareaandebbshoalvolumesare23%and158%largerthanpredictedusingthetidalprism.AtSAI,thecross-sectionalareaandebbshoalvolumesare82%and320%largerthanpredictedusingthetidalprism.Theunderpredictionofthecross-sectionalareaatthesestudysitesmaybeduetothedynamicnatureoftheseinlets;untilSAIwasjettiedinthe1940sandPLIwasjettiedinthe1960s,theyshowedhighvariabilityininletwidth.AerialphotographsavailablefromtheU.S.ArmyCorpofEngineersCoastalInletResearchProgram(CIRP)showthatthewidthofSAIhasvariedbetween450mand250moverthe24yearintervalfrom1975to1999uctuatingbyasmuchas50mwithina6monthperiod.WhilefeweraerialphotographsareavailableforPLI,theyshowasimilarrangeofvariability,witha65muctuationinwidthbetweenphotographstakenoveratwo-yearinterval.Thedifferencebetweenactualandpredictedvaluesforebbshoalvolumeatthestudysitesmaybeduetothedifcultyinmeasurement(reportedvaluesvarygreatlybetweenstudies,asshowninTable 4-1 ),or 106

PAGE 107

theinuenceofotherfactorssuchas,channeldepthtowidthratio,inletcross-sectionalarea,orlongshorecomponentofwaveenergyux,allofwhichhavebeenshowntoexertinuenceonebbshoalvolume( MarinoandMehta 1987 ).Weusetheserelationshipstoinvestigatetrendsthatareseeninnaturebetweenthemorphologyofaninletanditshydrodynamicproperties,inordertoshoworderofmagnitudechangesfromvegetationloss-nottomakepredictionsforagivensite. 4.3ResultsWeuseequation 4 tocalculatechangestotidalprism,whichshouldariseduetoaconversionofwetlandvegetationtoopenwaterintheback-barrierbasin,thenweuseequations 4 and 4 tocalculatethecorrespondingchangestocross-sectionalareaofinletchannel,andebbshoalvolume.Thisconversionisconsideredtorepresentasituationinwhichbasinvegetationcannotmaintainasufcientlyhighaccretionratetokeepupwithsealevelrise.Overtherangeofcalculations,itisevidentthatwetlandlossleadstoanoverallincreaseintidalprismforbothstudysites(Figure 4-4 ).Table2presentsthechangeinvegetatedarea,tidalprism,cross-sectionalarea,andebbshoalvolumeforeachinletbasedonthe5-20%wetlandlosspredictedby Nicholls ( 2004 )underIPCCSRESA1FIscenariobytheyear2080.DespitePLIhavingasimilaramountofwetlandareatoSAI,itismoresensitivetochangesinwetlandareapercentage.Wecalculatethattheseinletsystemsshouldexperienceanincreaseintidalprismof3.02m3and1.47m3forevery1m2ofvegetationlossatPLIandSAI,respectively.Figure 4-4 illustratestherelativeinuenceoftheincreaseinbasinarea(rstterminequation 4 )andthereductionintidalwaveattenuation(secondterminequation 4 )onthetidalprismofeachinlet.DashedlinesrepresentPLIandsolidlineswithcircularmarkersrepresentSAI.Theblacklinesarethetidalprism(P),whichistheidealtidalprism(greenline),dependentsolelyonbasinarea,lesstheattenuatedtidalprism(blueline),dependentonbasinareaandattenuationrate.PLIshowedanincreaseof1.24m3per1m2lossduetoanincreaseinbasinarea,and1.77m3per1m2lossdueto 107

PAGE 108

adecreaseintheamountoftidalprismreductionfromtidalwaveattenuation.AtSAI,thebasinareaincreasecausesatidalprismincreaseof1.51m3per1m2loss.Giventhatthemeantidalwaveattenuationrateissimilartotherateinun-vegetatedareas,theincreaseinopen-waterarea(overwhichthetidalwaveattenuates)causesadecreaseinthetidalprismby0.4m3per1m2.Figure 4-4 highlightsthesignicanceofthedecreaseintidalwaveattenuationwithwetlandlossforsomeinletsystems,suchasPLI,whichhavewetlandcongurationsthatprovideahighdegreeoftidalwaveattenuation.Thisisnotthecaseatallinlets,asseenintheSAIexample,wherechangestothetidalwaveattenuationratehaverelativelylittleinuenceonhowthetidalprismrespondstochangesinmarsharea.Initially,anincreasedtidalprismshouldincreasethemeangrossdischargethroughtheinletchannelduringeachtidalcycle,increasingtheowvelocity,shearstress,andsedimenttransportcapacitythroughthethroatoftheinlet.Thishastheeffectofscouringthechanneluntilthecross-sectionalareaofthethroataccommodatesthedecreasedowsuchthatthereisnonettransportthroughthechannel;anewequilibriumcross-sectionalareaisachievedatthatpoint( O'Brien 1931 ).Usingtherelationshippresentedby Powelletal. ( 2006 )(equation 4 ),wendthattheincreaseincross-sectionalareaforevery1m2ofvegetationlossis1.78cm2and0.92cm2,atPLIandSAI,respectively(Figure 4-5 ).Thepredictiverelationshipof MarinoandMehta ( 1987 )revealsthat1m2ofvegetationlossshouldresultinanincreasedebbshoalvolumeof2.98m3forPLI,and1.29m3forSAI(Figure 4-5 ). 4.4Discussion 4.4.1TwoMainMechanismsforTidalPrismChangeThisstudyexaminestheinuenceofchangesincongurationofvegetatedwetlands,whichmayarisefromsealevelchange,onthemorphologicevolutionofatidalinletsystem.Theresultsarenotintendedtobeusedasapredictivetoolforeitheroftheexampletidalinletsystemspresented,butrathertoidentifyandexplore 108

PAGE 109

thetwomainfactorsgoverningtidalprismresponsetochangesinwetlandvegetationarea:(1)map-viewareaoftheback-barrierbasin,and(2)thespatialrateoftidalwaveattenuationwithinthebasin.Herein,weinvestigatedasimplescenarioofuniformwetlandvegetationretreatwithintheback-barrierbasininordertohighlighttherelativeimportanceofthetwofactorsatPLIandSAI,stemmingfromtheirdifferencesininitialwetlandconguration.Whilethetwostudysiteshavesimilartotalwetlandareaintheirback-barrierbasins,thecongurationsofthesewetlandsystemsdiffer.SAIhasfringingwetlandsalongthesidesofthebasin,creatingonemainbasinchannel,whereasPLIhasacombinationoffringingwetlandsandanetworkofwetlandislandswhichcreatesacomplexwebofhighlysinuousbasinchannels.TheintricatechannelnetworkatPLIreducesthetidalwaveasittravelsthroughthebasinbyincreasingtheowresistancebywetlandvegetationandincreasingthepathdistancethroughwhichthetidalwavetravels.AreductioninwetlandareaatPLIwouldincreasethemapviewopenwaterareaanddecreasethespatialrateoftidalwaveattenuation.SuchachangewouldcausethetidalprismatPLItorespond(increase)moresensitivelythanwouldbeexpectedtooccuratSAI,wherewetlandlosswouldhaveanegligibleimpactontidalwaveattenuationrate.Theseresultsindicatethataninletwhoseback-barrierbasinhasahigherinitialspatialrateoftidalwaveattenuationholdsgreaterpotentialfortidalprismchangeduetovegetationloss. 4.4.2MarshLossSpatialDistributionInourconceptualmodel,weassumethat,aswetlandlossoccurs,thewaveattenuationratechangeslinearlybetweentheinitialestimatedaverageattenuationinthebasinandthemeasuredattenuationthatoccursinanunvegetatedbasin.Ifwetlandlossoccursinareasfarfromtheinletchannel,itwouldnothavethesameimpactonwaveattenuationaslossofawetlandislandclosetotheinletchannel.Thisisduetothefactthatatdistalbasinregions,thetidalwaveissmallincomparisontoareasproximaltotheinletchannel.Theassumptionoflinearratechangewithwetlandlosswilloverpredict 109

PAGE 110

tidalprismchangewherewetlandlossoccursatafringingmarshinthebackofthebasin,andwillunderpredictinthecaseofnear-channelwetlandloss.Giventhatwetlandlosspatternscannotbereliablypredicted,weoptforaconservativemethod(linear)toestimatewaveattenuationchangeasafunctionofwetlandloss. 4.4.3InuenceonAdjacentShorelinesEbbshoalvolumechangescanimpactadjacentenvironments,suchasbeachanddunecomplexesoneithersideoftheinlet.Shorelinechangeisparticularlysensitivetoinletsystemmorphologyasebbshoalsinterruptlongshoresedimenttransport(LST)andgradientsinLSTleadtobeacherosionandaccretion.Forinletsystemscomparabletothosepresentedinthestudy,avegetationlossof1%,shouldincreaseebbshoalvolumeby6105m3,byincorporatingafractionofthesteadyowofLSTpassingtheinlet.Inthesand-sharingconceptof Dean ( 1988 )and Kraus ( 2000 ),theebbshoalcomplexconsistsofamainebbtidalshoal,aseriesofbypassingbars,andattachmentbars.Iftheebbshoalcomplexisoutofequilibriumduetoachangeinhydrodynamicproperties,suchasashiftinthetidalprism,itwilladjustitsvolumebysequesteringsandfromthepassingowofLSTuntilanewequilibriumvolumeisachieved.Inthisscenario,theebbshoalactsasalocalsedimentsinkandinterruptstheowofLSTpasttheinletchannel.Alongthecoastalreachinthevicinityofthetwoexamplesitespresentedherein,theLSTratesareapproximately3.8105m3/yr( Dean 1988 ),implyingthatsuchachangeinebbshoalwouldbeequaltoapproximately19monthsofLSTinthearea.Therearelinksbetweentidalprismandtheextent(bothseawardanddowndrift)oftheebbshoalcomplex( Carr-Bettsetal. 2012 )andtheminimumdepthovertheebbshoalcrest( BuonaiutoandKraus 2003 ).Astidalprismincreases,theebbshoalspreadsfurtheroffshoreandinthedowndriftdirection,andtheshoaloccupiesadeeperwaterdepth. 110

PAGE 111

4.4.4OtherInuenceonMarshLossAlthoughwehavechosentoidentifysealevelriseasthemostlikelydriverofvegetationlossinback-barrierbasins,anthropogenicdisturbancescanplayamajorroleinexacerbatingsealevelriseeffects( Mudd 2011 ; Nicholls 2004 ).Naturalandanthropogenicprocesses,suchasinvasivespeciesestablishment,overshing,nitrogeneutrophication,risingwatertemperatures,increasedatmosphericcarbondioxide,alteredhydraulicandsedimentationregimes,drainage,reclamation,andshorelinedevelopment,mightalsocontributetowetlandlossandthereforeinuencemorphologicchangesinthesesystems( Sillimanetal. 2009 ).Furtherresearchintotherelationshipsbetweenwetlandvegetationandtidalinletmorphologywillprovidevaluableprogresstowardourunderstandingofthelong-termmorphologicalevolutionofsandycoastalsystemsglobally. 4.4.5ApplicationtoBarrierSystemsWorldwideWhilethefocusofthisstudywasoncontrastingwetlandcongurationsinthebasinsoftwoFloridainlets,theconceptualmodelcanbeappliedtootherbarrierislandsystems.Forthetwostudysitesusedhere,thebasingeometriescouldbeparameterizedintotwomainsections,whichmayneedtobemodiedformorecomplexbasinsystems.Wewereabletoneglectthechangeinbasinareaduetosealevelriseoodingadjacentshorelinesbecauseofthehighlyurbanizedandmodiedcoastalareasurroundedthesebasins.Wenotethatbasinareachangeatthemarginsshouldnotbeneglectedincaseswithbasinedgesaregentlyslopedandunmodiedbyseawalls.Therelationshipsbetweentidalprismandcross-sectionalareawaschosenfromastudyofFloridainletsforoursites,butcouldbemodiedtomoregeneralrelationship,suchasthosepresentedby Jarrett ( 1976 ),forothersites.Ourconceptualmodel,whichincludestheinuenceofthewetlandvegetationchangesontidalinletresponsetosealevelrise,canprovideinsightintothemorphologicresponseofotherinletsystems,including 111

PAGE 112

changestothechannelcross-sectionalareaandthevolumeandpositionoftheebbshoalcomplex. 4.5ConclusionsInthispaper,weshowprogresstowardunderstandinghowtheecogeomorphicpropertiesofatidalinletsystemcontroltheevolutionoftheinletandadjacentshorelinemorphologyduetolossinwetlandarea.Usingoursimpleconceptualmodel,weconclude: Atbothstudysites,wetlandvegetationlossthatleadstobankdestabilizationanderosioncreatesanincreaseintidalprism,increaseincross-sectionalarea,andincreaseinebbshoalvolume. Initialwetlandcongurationcontrolstheresponseofthetidalinletmorphologytowetlandloss;inletswithwetlandcongurationsthatimposeahigherspatialrateofwaveattenuationhavegreaterpotentialfortidalprismchangeduetovegetationlossthatleadstobankerosion. Fortheinletsinthisstudy,smallamountsofmarshplatformloss(1%)canincreasetheequilibriumvolumeoftheassociatedebbshoalcomplexbyanamountequivalenttoonetotwoyearsofaccumulatednetlongshoretransportinthearea.Figure 4-6 showsthechangestothetidalinletmorphologythatwouldoccurduetoalossinwetlandvegetation,including:(1)anincreaseincrosssectionalareaoftheinlet,(2)anincreaseinthevolumeoftheebbshoalcomplex,and(3)anincreaseinthedowndriftandseawardextentofthemainebbshoal.PlotAandBofFigure 4-6 illustratesauniformwetlandvegetationlossthatcouldoccurinbasinssimilartoSAIandPLI,respectively. 112

PAGE 113

Figure4-1. Conceptualmodeloftidalinletgeomorphicresponsetosealevelrise.Lettersrepresentspecicprocesseslinkingkeyvariables(showninblueboxes)asdescribedinthetext. Figure4-2. Diagramillustratinghowthebasinsareparameterizedintotwosectionsoneithersideoftheinletchannel. 113

PAGE 114

Figure4-3. Mapsoftheback-barrierbasinsexaminedinthisstudy:(A)thebasinassociatedwithSaintAugustineInlet(SAI),andthe(B)northand(C)southsectionsofbasinassociatedwithPoncedeLeonInlet(PLI).BothsitesarelocatedalongtheNorthFloridaAtlanticOceancoast,withinapproximately100kmofoneanother.ThislocationisshownastheredboxintheinsetmapofFlorida.Thescalebarandnortharrowapplytoallthreebasinmaps. 114

PAGE 115

Figure4-4. ThechangeintidalprismduetowetlandvegetationlossforPLIandSAI.Theblacklinesarethetotalchangeintidalprism,whichiscalculatedastheidealtidalprism(greenlines)lessthelossintidalprismduetotidalwaveattenuationinthebasin(bluelines).Thepercentlossforeachinletinshownbelowthegureforeachinletandthegreyhighlightedareascorrespondtotheextentofworldwidewetlandloss,aspredictedby Nicholls ( 2004 )underIPCCSRESA1FIscenarioby2080.Thisgurehighlightstherelativeimportanceofthereductionintidalwaveattenuationandincreaseinbasinareaonthehydrodynamicsresponseoftheinletsystemstochangesinwetlandarea. 115

PAGE 116

Figure4-5. Theimpactofmarshvegetationlossontidalprism,cross-sectionalareaofinletchannel,andebbshoalvolume.SaintAugustineInlet(SAI)isshowningreen,andPoncedeLeonInlet(PLI)isshowninblue.Starsindicatetheaveragemeasurementsofcross-sectionalareaandebbshoalvolumepublishedin Powelletal. ( 2006 )and WaltonandAdams ( 1976 ).Grayshadingshowsextentofworldwidewetlandloss,aspredictedby Nicholls ( 2004 )underIPCCSRESA1FIscenarioby2080. 116

PAGE 117

Figure4-6. SchematicIllustrationofwetlandvegetationlossintwobasinswithecogeomorphiccongurationssimilartoSAIandPLI.Vegetationlosswithineachbasinincreaseschannelcross-sectionalarea,ebbshoalvolume,andthedowndriftandseawardextentofthemainebbshoal.Decreaseinthetidalwaveattenuationinbasin(B)leadstoahigherchangeintidalprismofthesystemandanintensicationoftheseeffects. 117

PAGE 118

Table4-1. Studysiteshydraulic,ecologic,andgeomorphicproperties SaintAugustinePoncedeLeonInlet,FLInlet,FL TidalRange(m)1.61.3Meas.TidalPrism(m3)2.51071.71073.711071.63107IdealTidalPrism(m3)3.521071.56108Cross-SectionalArea(m2)4600150024611068EbbShoalVolume(m3)4.31071.71078.11071.45107BasinArea(m2)2.21071.2108HighVegetationArea(m2)4.691075.02107LowVegetationArea(m2)5.821064.38106N.BasinLength,L1(km)2637S.BasinLength,L2(km)1852N.BasinAvg.Width,w1(m)495550N.BasinAvg.Width,w2(m)5001860Avg.Att.Rate(cm/km)1.64.7 Firstvaluesofmeasuredtidalprism,cross-sectionalarea,andebbshoalvolumesarefrompublisheddatain Powelletal. ( 2006 )andthesecondlistedvaluesarepublishedin WaltonandAdams ( 1976 ).WetlandareavaluescalculatedbasedonNWIestuarineenvironmentdata.Thebasinareaisclassiedassubtidal.Highandlowvegetationareaareclassiedasintertidalwithemergentvegetationorscrub-shrub,andirregularlyandregularlyoodedwaterregimes,respectively. Table4-2. Inletmorphologicandhydraulicresponsetowetlandloss SaintAugustinePoncedeLeonInlet,FLInlet,FL VegetationLoss(km2)2.64-10.542.73-10.92P(107m3)0.38-1.530.72-2.93AC(m2)238-955448-1834VE(107m3)0.25-1.070.39-1.89 118

PAGE 119

APPENDIXADELFT3DMODELSETUPThisappendixisintendedtoactasaguideforthesetupandexecutionoftheDelft3D-FLOWmodulewithintheDelft3DmodelingsuiteforsimulationssimilartothosepresentedinChapter 2 andChapter 3 .ThesemodelrunsusedDelft3DutilitiesandtheDelft3D-FLOWmodulewithoutwindorwaveinputsanddidnotcalculatesediment,temperature,orsalinitytransport.ThisappendixwillgiveabriefdescriptionofthephysicalprocessesthatcanbemodeledusingDelft3D-FLOWandtoactasaguideforthegeneralstepsofmodelsetup.MoredetailedinformationisprovidedintheDelft3D-FLOWusermanual( Deltares 2009 ). A.1ModelPhysicalProcessesTheDelft3D-FLOWmodeliscapableofsimulatingtwo-dimensional(depthaveraged)orthree-dimensionalowusingtheunsteadyshallowwaterequations.Theequationsarederivedfromthethree-dimensionalNavierStokesequationsforincompressiblefreesurfaceowundertheshallowwaterandBoussinesqassumptions.Detailedhydrodynamicequationsarepresentedin Deltares ( 2009 ).Themodelisforcedattheopenboundariesbytides,atthefreesurfacebywindstress,andbypressuregradientsduetogradientinthefreesurfaceelevationanddensity.Delft3D-FLOWiscapableofsimulationthefollowingphysicalphenomena: Freesurfacegradients(barotropiceffects). TheeffectoftheEarth'srotation(Coriolisforce). Waterwithvariabledensity(equationofstate). Horizontaldensitygradientsinthepressure(barocliniceffects). Turbulenceinducedmassandmomentumuxes(turbulenceclosuremodels). Transportofsalt,heatandotherconservativeconstituents. Tidalforcingattheopenboundaries. Spaceandtimevaryingwindshear-stressatthewatersurface. 119

PAGE 120

Spacevaryingshear-stressatthebottom. Spaceandtimevaryingatmosphericpressureonthewatersurface. Timevaryingsourcesandsinks(e.g.riverdischarges). Dryingandoodingoftidalats. Heatexchangethroughthefreesurface. Evaporationandprecipitation. Tidegeneratingforces. Effectofsecondaryowondepth-averagedmomentumequations. Lateralshear-stressatwall. Verticalexchangeofmomentumduetointernalwaves. Inuenceofwavesonthebedshear-stress(2Dand3D). Waveinducedstresses(radiationstress)andmassuxes. Flowthroughhydraulicstructures. Winddrivenowsincludingtropicalcyclonewinds. A.2Delft3D-FLOWModelSetupBeforebeginningmodelsetup,theusershouldselecttheworkingdirectoryforthemodelsimulation.Thiscanbedonebyselectingthe`Selectworkingdirectory'buttononthebottomofthemainDelft3Dmenu.Itisimportanttonotethatalluserinputlesandattributelesforamodelsimulationshouldbestoredinthesamedirectory.ThegeneralstepsthatwillbepresentedinthisappendixforthesetupandexecutionoftheDelft3D-FLOWmodule,are: 1. Creationofalandboundaryle 2. Generationofmodelgridandenclosureles 3. Generationofabathymetryleusingsampleles 4. CreationofanMDF-lewhichspecies: 120

PAGE 121

Modeldomain Timeframe Processes Initialconditions Boundaryconditions Physicalparameters Numericalparameters Operations Monitoring Output 5. Executionofmodelsimulations 6. Viewingmodeloutput A.2.1LandBoundaryFileGenerationThelandboundaryleconsistsofclosedpolygonswhichrepresenttheland-waterinterface.Theselescanbeusedforgridgenerationandinthecreationofoutputimages.ThelesmustbecreatedbytheuserinautilityoutsideoftheDelft3Dmodel,suchasMATLAB.Thelesareasciitextleswiththeextension`.ldb.'Intheseles,eachpolygonhasaheaderwiththepolygonlabelontherstline,followedonthenextlinebythenumberofpolygonpointsandthenumberofcoordinatesspecied(usually2forX,Ycoordinates),followedonthelinesbelowasalistofXandYpoints.Thisisrepeatedforeachpolygonthatmakesuptheentirelandboundaryofinterest.EachpolygonmusthavethesamerstandlastsetofX,Ycoordinates.Exampleoftheleformatusingasphericalcoordinatesystemforalandboundaryisshownbelow: L00162-81.49231030.647717-81.49265330.647631-81.49341630.647675 121

PAGE 122

-81.49280530.648373-81.49216530.647991-81.49231030.647717L00242-81.49533130.649523-81.49433130.649611-81.49353830.649931-81.49533130.649523L00382-81.48694630.633556-81.48673230.633736-81.48673230.634113-81.48719830.635128-81.48742730.635008-81.48758730.634333-81.48751830.633995-81.48694630.633556 A.2.2GridGenerationThemodelgridcanbecreatedusingthebuilt-inutility,Delft3D-RGFGRID,developedbyDeltares.ThisprogramcanbelaunchedthroughthemainDelft3Dmenu,byclickingonthe`Grid'buttonandthenthe`RGFGRID'button.Thisapplicationiscapableofgeneratingcurvilineargridsusingeitheraspherical(indecimaldegrees)orcartesian(inmeters)coordinatesystem.AsimplerectangulargridcanbecreatedbyinputtingtheXandYorigins,gridcellspacing,andthenumberofgridcellsintheXandYdirection.Morecomplexgridscanbecreatedbyimportingalandboundaryletouse 122

PAGE 123

asareferenceforgridboundarylocations.Individualgridcellscanbemanuallymovedordeleted,gridlinescanbesnappedtolandboundarylocations,andgridsectionscanbesmoothed,allowingforcompleteusercontrolovereachgridcelllocation.Gridlinesshouldbesmoothedalonglandboundaries,reducingthestaircaseboundariesandreducingarticialdiffusion.Theoutputofthisprogramisagridlewiththeextension`.grd'andagridenclosurelewiththeextension`.enc.'Theenclosureleisgeneratedautomaticallywhenthegridleisexported. A.2.3BathymetryGenerationOnceamodelgridhasbeencreatedusingtheDelft3D-RGFGRIDutility,abathymetrymaybeinterpolatedontothegridusingtheDeltf3D-QUICKINutility.ThisutilitycanbelaunchedthroughthemainDelft3Dmenu,byclickingonthe'Grid'buttonandthenthe`QUICKIN'button.Oncetheprogramisopened,thegridmustbeimportedintotheprogrambyselectingFile!Import!Grid.Abathymetrycanbecreatedusingasamplele,anasciitextle,withalistof(X,Y,Z)coordinates.Thesetofcoordinatesforeachsamplepointareonaline,andareseparatedbyaspaceortab.Insphericalcoordinates,theX,YcoordinatesareindecimaldegreesandtheZcoordinatesareinmeters.Incartesiancoordinates,allcoordinatesareinmeters.DepthsinDelft3Darepositivevalues.Thesesamplepointsdonotneedtobeevenlyspaced,andmultiplelescanbeimported.ThesamplelescanbeimportedintheprogrambyselectingFile!Attributes!OpenSamples.Oncethesamplesareimportedintotheprogram,abathymetrycanbecreatedtocorrespondwiththeimportedgridbyeithertriangularinterpolation,gridcellaveraging,oracombinationofthetwo.Gridcellaveragingrequireshigherresolutionofsamplepointsthantriangularinterpolation,andmaynotbeanoptionsfornegridresolutionsrelativetosampleresolution.ThesetwomethodsareavailableundertheOperationstab.Polygonscanbebecreatedandusedtoisolatedindividualgridareastoapplytheseinterpolations,whichisusefulforlargegridsorgridswithmanysampleinputles 123

PAGE 124

withdifferentresolutions.Internaldiffusioncanbeusedtopopulategridcellsthatareontheedgesofthegridwhichmaynothaveenoughsamplessurroundingthecelltoestimateavalueforthatlocation.Thisdiffusionwillassignthedepthvalueoftheclosestcelltoallthecellswithnotdepth.Thedepthofindividualgridcellscanbemanuallyalteredinthisprogramandlargeareascanbesmoothed.TheparametersforsmoothingandinterpolationofsamplestothegridcanbechangedintheSettings!GeneralParameters.Onceadesireddepthvaluehasbeenfoundforeachgridcell,thebathymetryleshouldbeexportedinFile!Export!Depth.Itwillbesavedasa`.dep'andmustbeusedinconjunctionwiththegridlefromwhichiswascreatedbecauseitdoesnotcontainhorizontalcoordinatedata. A.2.4CreatinganMDF-FileTheMasterDenitionFlowle,orMDF-File,isthemaininputleusedtoruntheDelft3D-FLOWmodule.ItcanbecreatedbylaunchingauserinterfacethroughtheDelft3Dmainmenu,byselecting`Flow'andthenselecting`Flowinput.'Auserinterfacelauncheswithtabsontheleftwhichopenadifferencesetofinputoptionsontheright.Thetabsshouldbeselectedfromtoptobottomandtheappropriateinformationforeachtabshouldbecompletedbeforecontinuingontothenextsection.Belowarebasicinstructionsforeachtab.FordetailedinstructionseetheDelft3D-FLOWusermanual( Deltares 2009 ) Description.Thedescriptioninputisusedonlyforthereferenceoftheuseranddoesnotinuencethemodelrun. Domain.Inthissectiontheusershouldselect`Gridparameters'andthenopenthegridandenclosurelescreatedintheprevioussteps.Theco-ordinatesystemandnumberofgridcellsshouldbereadfromthegridle.Theuserthenneedstospecifythenumberoflayersinthez-direction.Avalueofoneindicatesatwo-dimensional,depthaveragedmodelrun.Forathree-dimensionalmodelsimulation,avaluegreaterthan 124

PAGE 125

oneshouldbeselected.Anoptionforlayerthicknesswillpopulatetheuserinterfaceandtheusercanspecifythelayerthickness(asapercentageofthewatercolumn)foreachlayer.Thedefaultisforevenlyspacedlayers.Theusershouldselectthe`Bathymetry'buttonatthetopandopenthebathymetrylecreatedintheprevioussteps.Drypointsandthindamsmaybeaddedinthissectiontorepresentjettiesandareaswithnoow. Timeframe.Herethemodelsimulationdaterangeandtimestepshouldbespecied.Generally,thereferencedateisthesameasthesimulationstartdate.ThedefaulttimezoneisGMT,butcanbemodiedinthissection. Processes.Thistaballowstheusertospecifywhichprocessestoincludeinthemodelsimulation.Forthisexample,noneoftheconstituentsorphysicalprocessesareselected.Iftheseareselectedthenmoreinputinformationinthefollowsectionsbecomeavailable.Ifnooptionsareselected,asinthisexample,onlythehydrodynamicpropertiesarecalculatedwithoutwindorwaveforces. Initialconditions.Thissectionallowsuserstospecifyauniformwaterlevelthroughoutthedomainastheinitialcondition,toincludeaninitialconditionsle,toincludearestartle,ortoincludeamaple.Usinginitialconditionsorrestartlescanreducethespin-uptimeofthemodel,butarenotnecessary.Thedefaultforthissectionisauniformwaterlevelofzerometersthroughoutthedomain. BoundaryConditions.Asetofinitialandboundaryconditionsforwaterlevelsandhorizontalvelocitiesmustbespecied.Initialverticalvelocitiesarenotnecessarytospecify,astheyarecomputedthroughthecontinuityequation.Boundariesofthemodelareclassiedasopenedorclosedboundaries.Closedboundariesarelocationswithoutow,suchasland-waterlines(riverbanks,coastlines).Openboundariesarealwayswater-waterboundariesthatintersecttheoweld.Theseboundariesshouldalwaysbesituatedasfarfromtheareaofinterestaspossible.Reectionatopen 125

PAGE 126

boundariesshouldbeminimalsincetheopenboundariesshouldnothamperlongwavepropagation.Tospecifytheboundaryconditions,rstindividualboundarysegmentsmustbedenedbyclickingthe`add'button.Eachsegmentmusthaveanuniquenameandtheusermustspecifytheindices(m,n)ofeachendpoint.Thevisualizationareacanbeusedtohelpwiththisprocess.ItcanbeopenedthroughthetopmenubyselectingView!Visualizationarea.Inthiswindow,boundarysegmentscanbeaddedmanually.Theboundariescanbebrokenintonumeroussegments,andshoulddependonthedomainsize.Allareasofopenwaterattheborderofthegridshouldbedenedasaboundary.Closedboundaries,whichborderland,donotneedtobespeciedasaboundaryhere.Onceeachboundaryisdenedinspace,theboundaryconditionsmustbespecied.Thetypeofboundariesthatcanbespecied,include:Waterlevel,Current,Neumann,Totaldischarge,Dischargepercell,orRiemann.Forthisexampleweusewaterlevels,butdetailsofeachofthesetypesofboundariescanbefoundin Deltares ( 2009 ).Theforcingtypeforwaterlevelscanbeastronomic,harmonic,QH-relation,ortimeseries.Forthisexamplewechoseastronomic,whichisconvenientiftidalconstituentscanbederivedfromlocaltidalgauges.Oncetheappropriateselectionshavebeenmade,theuserneedstoeditthedetailsoftheboundarybyselectingthe`Editowconditions'button.Anewboxwillopenwherethedetailsoftheboundarycanbeinput.Differentsetsofconditionscanbespeciedforeachendofeachoftheboundaries.Thesesetsofconditionscanbespeciedbyselectingthe`Add'buttonandinputtingeachsetofconstituents.Thecomponentsetislinkedtoeachendofeachboundarysegmentbythedropdownmenusontherightside.Oncetheboundarydetailshavebeeninput,theuserclosestheboxbyclickingthe`close'buttoninthebottomrightcorner.Oncethisprocesshasbeencompletedforeachboundarysegment,thelesneedtobesavedbyselectingthe`Open/Save'button.Theboundarydenitionsle(withtheextension`.bnd')containsthecoordinatesofeach 126

PAGE 127

boundarysegmentandtheastronomicowconditionsle(withtheextension`.bca')containstheconstituentsforeachendofeachboundarysegment. Physicalparameters.Inthissectiontheuserspeciestheconstantsforgravityandwaterdensity,thebottomandwallroughness,theviscosity/diffusivity,andthree-dimensionalturbulenceclosuremodeltobeusedinthesimulation.Theroughnessandviscosity/diffusivitycanbespeciedusingauniformvaluethroughoutthedomainorasalethatspeciesavalueateachgridcelllocation.Formoreinformationonthesevaluesandhowtocreatetheseles,referto Deltares ( 2009 ). Numericalparameters.Inthissectiontheusercanspecifyparametersrelatedtodryingandoodingandsomeotheradvancedoptionsfornumericalapproximations.Thesmoothingtimeisthetimeintervalatthestartofthemodelsimulationthatisusedtocreateasmoothtransitionbetweentheinitialandboundaryconditions.Longersmoothingtimeperiodscreatesmootherresultsinthebeginningofthesimulationbutincreasethecomputationtimeperiod. Operations.Dischargevaluescanbespeciedheretorepresentowintothesystembyasourcesuchasariver.Thedischargeateachgridcelllocationmustbespecied,soowacrossarivermustbedividedintosegments. Monitoring.Differentobservationtypesforoutputcanbespeciedinthissection.Observationsareindividualpoints,droguesmonitorparticlepaths,andcross-sectionsareshownforalldepthsalonganm-orn-gridindexsegment.Morethanonespecicobservationpointorcross-sectionmustbespeciedorthemodelwillnotrun(i.e.therecanbeoneobservationaslongasthereisalsoonecross-sectionspecied). Additionalparameters.ThissectionprovidesaccesstoadditionalfunctionsthatarenotsupportedbytheFLOW-GUI,allowingformoreexibilitywithoutalteringtheFLOW-GUI.Unlesstheuserhasaccesstoadditionaloptions,itshouldremainblank. Output.Thetimeinterviewformodeloutputandthedetailsoftheoutputcanbespeciedinthissection.Themapresultsarethesnapshotsofthecomputedquantities 127

PAGE 128

fortheentiremodeldomain,thehistorylestorestheresultsforthespeciedmonitoringobservationpoints,drogues,andcross-sections,andthecommunicationlestoresdatarequiredforotherDelft3Dmodules.Thestarttimeandendtimemustbeintherangeofthemodeltimeframe,butdonothavetocovertheentirerange.Theintervalsetsthetimestepofoutputforthemapleandthehistoryintervalsetsthetimestepforoutputofthehistoryle.Bothofthesevaluesmustbeamultipleofthemodeltimestep.Unlessothermodulesarebeingused,theintervalforthecommunicationlecanbesettozero.Onlinevisualizationshouldgeneralbeuncheckedunlessitisneededfortroubleshooting.Bydefaultallmodeloutputdetails(underthe`Details'button)areselected.Someofthesemaybeunselectedinordertoreduceoutputlesize. A.2.5ExecutingmodelrunAfterallthedetailsoftherunhavebeenspeciedthroughtheFLOW-GUI,theMDF-leshouldbesavedbyselectingFile!SaveMDF.Thiscreatesanasciitextlewiththeextension`.mdf'thatcontainsinputinformationandthenamesoflestoreferenceduringthemodelsimulation.Alllesforthesimulationneedtobesavedinthesamefolder.Oncethelehasbeensaved,theFLOW-GUIcanbeclosed.Whenthemodelisreadytoberun,selectthe`Start'buttonfromthemainDelft3DmenuandselecttheMDF-lethathasbeencreatedandselectOK.Aboxshouldappeartoshowthatthemodelisrunning. A.2.6ViewingmodeloutputTheQUICKPLOTutilitycanbeusedtoopen,view,andexportmodeloutput.Itreadsthemapoutputle(trim-name.dat)andthehistoryle(trih-name.dat).Oncetheseleshavebeenloadedintotheprogram,specicdaterangesandmodeldatacanbeexportedinavarietyofformatsformanipulationoutsideofthepargram,includingMATLABmat-les. 128

PAGE 129

APPENDIXBMODELINPUTPARAMETERSThisappendixincludesthemodelinputparametersforthe52-daymodelsimulationdescribedinChapter 2 .ThissimulationwasusedformodelcalibrationandcomparisonwithavailableADCPdata.ThelistsarebrokenintogroupswhichcorrespondtothetabsintheFLOW-GUIdescribedinAppendix A Domain. CoordinateSystem:Spherical GridpointsintheM-direction:420 GridpointsintheN-direction:302 Numberoflayers:8(12.5%ofdeptheach) TimeFrame. Referencedate:08112011 Simulationstarttime:08112011000000 Simulationstoptime:30122011000000 Timestep:0.5min Localtimezone:0+GMT Processes. Noconstituentorphysicalprocessesselected(hydrodynamicsonly) InitialConditions. Uniformvalues Waterlevel:0m Boundaries. 3boundarysegments:North,East,andSouth Typeofopenboundary:Waterlevel 129

PAGE 130

Forcingtype:Astronomic Reectionparameteralpha:0s2 TidalconstituentsIncluded(Name,Amplitude(m),Phase(deg)): M2,8.0269704e-001,1.5706319e+001 S2,1.5658684e-001,1.3463423e+001 N2,1.6423517e-001,3.5913640e+002 K2,2.5928995e-002,8.6506397e+000 K1,1.0109143e-001,1.9361364e+002 O1,7.7357689e-002,2.0546273e+002 P1,3.7856681e-002,1.9961633e+002 Q1,1.7017450e-002,2.0305634e+002 MF,7.5714709e-003,3.4363395e+002 MM,2.9204701e-003,3.2804466e+002 M4,7.1590335e-003,3.4327001e+002 MS4,4.6285343e-003,2.4064482e+002 MN4,1.8140395e-003,1.3922591e+002 PhysicalParameters. Gravity:9.81m/s2 Waterdensity:1025kg/m3 Roughnessformula:Chezy,UniformU=65,V=65 Wallroughnessslipcondition:Free Backgroundhorizontalviscosity/diffusivity:Uniform1m2horizontaleddyviscosity Backgroundverticalviscosity/diffusivity:Uniform0m2verticaleddyviscosity Turbulencemodelfor3D:k-Epsilon NumericalParameters. Dryingandoodingcheckat:gridcellcentresandandfaces Depthspeciedat:Gridcellcorners 130

PAGE 131

Depthagridcellcentres:Max Depthatgridcellfaces:Mean Thresholddepth:0.1m Marginaldepth:-999m Smoothingtime:60min Advectionschemeformomentum:Cyclic Operations. Nodischargesincluded Monitoring. Observations:oneattidalstation8720030andoneininletchannel Drogues:nonespecied Cross-section:twothroughinletchannel,oneatminimumcross-section AdditionalParameters. Noadditionalparametersincluded Output. Mapstoragestarttime:08112011000000 Mapstoragestoptime:30122011000000 Mapstorageinterval:30min Historyinterval:6min Communicationinterval:0min Restartinterval:0min 131

PAGE 132

REFERENCES Allen,J.R.L.(1997),Simulationmodelsofsalt-marshmorphodynamics:someimplicationsforhigh-intertidalsedimentcoupletsrelatedtosea-levelchange,Sed-imentaryGeology,113,211,doi:10.1016/S0037-0738(97)00101-2. Argow,B.,andD.M.FitzGerald(2006),Winterprocessesonnorthernsaltmarshes:evaluatingtheimpactofin-situpeatcompactionduetoiceloading,wells,me,Estuar.Coast.ShelfS.,69,360. Bagnold,R.A.(1963),TheSea,chap.MechaincsofMarineSedimentation,pp.507,NewYork:Wiley. Barras,J.A.(2006),LandareachangeincoastalLouisianaafterthe2005hurricanes-aseriesofthreemaps,Tech.Rep.06-1274,U.S.GeologicalSurvey. Barras,J.A.,P.E.Bourgeois,andL.R.Handley(1994),LandlossincoastalLouisiana1956-90,Tech.Rep.94-01,NationalBiologicalSurvey,NationalWetlandsResearchCenter. Boon,J.D.,andR.J.Byrne(1981),Onbasinhypsometryandthemorphodynamicresponseofcoastalinletsystems,Mar.Geol.,40,27. Boorman,L.A.,J.Hazelden,andM.Boorman(2001),Theeffectsofratesofsedimentationandtidalsubmergenceregimesonthegrowthofsaltmarshplants,Cont.ShelfRes.,21,2155. Britsch,L.D.,andJ.B.Dunbar(1993),Landlossrates:Louisianacoastalplain,J.CoastalRes.,9(2),324. Bruun,P.(1966),Tidalinletsandlittoraldrift,Universitetsforlaget,Norway. Bruun,P.,andF.Gerritsen(1959),Naturalbypassingofsandatcoastalinlets,J.WaterwaysandHarborsDivision,85(4),75. Bruun,P.,F.Gerritsen,andN.P.Bhakta(1960),Evaluationofoverallentrancestabilityoftidalinlets,CoastalEngineering,pp.1566. Bruun,P.,A.J.Mehta,andI.G.Jonsson(1978),StabilityofTidalInlets:TheoryandEngineering,ElsevierScienceandTechnology. Buonaiuto,F.,andN.Kraus(2003),Limitingslopesanddepthsatebb-tidalshoals,Coast.Eng.,48,51,doi:10.1016/S0378-3839(02)00160-6. Carr-Betts,E.T.,M.Beck,andN.Kraus(2012),Tidalinletmorphologyclassicationandempiricaldeterminationofseawardanddown-driftextentsoftidalinlets,J.CoastalRes.,28(3),547,doi: 132

PAGE 133

Craft,C.(2007),Freshwaterinputstructuressoilproperties,verticalaccretion,andnutrientaccumulationofGeorgiaandU.S.tidalmarshes,Limnol.Oceanogr.,52,1220. D'Alpaos,A.,S.Lanzoni,M.Marani,andA.Rinaldo(1993),Landscapeevolutionintidalembayments:Modelingtheinterplayoferosion,sedimentation,andvegetationdynamics,J.Geophys.Res.,112,F01,008,doi:10.1029/2006JF000537. D'Alpaos,A.,S.Lanzoni,M.Marani,andA.Rinaldo(2010),Onthetidalprism-channelarearelations,J.Geophys.Res.,115,1,doi:10.1029/2008JF001243. D'Alpaos,A.,S.M.Mudd,andL.Carniello(2011),Dynamicresponseofmarshestopertubationsinsuspendedsedimentconcentrationsandratesofrelativesealevelrise,J.Geophys.Res.,116,1,doi:10.1029/2011JF002093. Davies,J.L.(1964),Amorphogenicapproachtoworldshorelines,Geomorphology,8,27. deGroot,A.V.,R.M.Veeneklaas,P.Kuijper,andJ.Bakker(2011),Spatialpatternsinaccretiononbarrier-islandsaltmarshes,Geomorphology,134,280. Dean,R.(1988),Sedimentinteractionsatmodiedcoastalinlets:Processesandpolicies,inHydrodynamicsandSedimentDynamicsofTidalInlets,editedbyD.G.AubreyandL.Weishar,pp.412,Springer-Verlag. Dean,R.G.,andT.L.Walton(1973),EstuarineResearch,chap.Sedimenttransportprocessesinthevicinityofinletswithspecialreferencetosandtrapping,pp.129,AcademicPress,NewYork. Delmonte,R.C.,andJ.W.Johnson(1971),Theinuenceofbedmaterialonthetidalprism-arearelationshipinatidalinlet,Tech.Rep.HEL24-8,HydraulicEngineeringLaboratory,UniversityofCalifornia,Berkeley,Calif. Deltares(2009),Delft3D-FLOW:Simulationofmulti-dimensionalhydrodynmaicowsandtransportphenomena,includingsediments,TheNetherlands,3.14ed. Diekmann,R.,M.Osterhun,andH.W.Partenscky(1988),Acomparisonbetweengermanandnorthamericantidalinlets,inProceedingsofthe21stInternationalConferenceonCoastalEngineering,pp.2681,ASCE. DiLorenzo,J.L.(1988),HydrodynamicsandSedimentDynamicsofTidalInlets,Lect.NotesCoastalEstuarineStud.,vol.29,chap.Theovertideandlteringresponseofsmallinlet/baysystems,pp.24,AGU,Washington,D.C.,doi:doi:10.1029/LN029p0024. Dissanayake,D.M.P.K.,R.Ranasinghe,andJ.A.Roelvink(2009),Effectsofsealevelriseintidalinletevolution:Anumericalmodellingapproach,J.CoastalRes.,SI56,942. 133

PAGE 134

Donnelly,J.P.,andM.D.Bertness(2001),Rapidshorewardencroachmentofsaltmarshcordgrassinresponsetoacceleratedsea-levelrise,Geology,98,14,218,223,doi:10.1073/pnas.251209298. Ellison,J.C.(1991),Mangroveretreatwithrisingsea-level,Bermuda,Estuar.Coast.ShelfS.,7(1),151,doi:10.1006/ecss.1993.1042. Ellison,J.C.,andD.R.Stoddart(1991),Mangroveecosystemcollapseduringpredictedsea-levelrise:Holoceneanaloguesandimplications,J.CoastalRes.,7(1),151. EnvironmentalScienceandEngineering,Inc.(1980),DraftsupplementtotheenvironmentalimpactstatementforprefferedalternativelocationforaeetballisticsmissilesubmarinesupportbaseatKingsBay,Georgia,Tech.rep. Escofer,F.F.(1940),Thestabilityoftidalinlets,ShoreandBeach,8(4),114. Escofer,F.F.(1977),HydraulicsandStabilityofTidalInlets,Tech.Rep.GITIReport13,U.S.ArmyEngineeringWaterwaysExperimentStations,Vicksburg,MS. FitzGerald,D.M.(1982),Sedimentbypassingatmixedenergytidalinlets,in18thCoastalEngr.Conf.,ASCE. FitzGerald,D.M.(1988),Shorelineerosional-depositionalprocessesassociatedwithtidalinlets,inHydrodynamicsandSedimentDynamicsofTidalInlets,editedbyD.G.AubreyandL.Weishar,pp.186,Springer-Verlag. FitzGerald,D.M.(1996),Geomorphicvariabilityandmorphologicandsedimentologiccontrolsontidalinlets,J.CoastalRes.,SI(23),47. FitzGerald,D.M.,andS.A.FitzGerald(1977),Factorsinuencingtidalinletthroatgeometry,inCoastalSediments,pp.563,ASCE. FitzGerald,D.M.,andD.Nummedal(1983),Responsecharacteristicsofanebb-dominatedtidalinletchannel,J.Sed.Pet.,53,833. FitzGerald,D.M.,N.C.Kraus,andE.B.Hands(2000),Naturalmechanismsofsedimentbypassingattidalinlets,Tech.Rep.ERDC/CHLCHETN-IV-30,USArmyCorpofEngineers. FitzGerald,D.M.,M.Kulp,S.Penland,J.Flocks,andJ.Kindinger(2004),Morphologicandstratigraphisevolutionofmuddyebb-tidaldeltasalongasubsidingcoast:BaratariaBay,MississippiRiverdelta,Sedimentology,51,1157,doi:10.1111/j.1365-3091.2004.00663.x. FitzGerald,D.M.,M.Kulp,Z.Hughes,I.Georgiou,M.Miner,S.Penland,andN.Howes(2007),Impactsofrisingsealeveltobackbarrierwetlands,tidalinlets,andbarrierislands:BaratariaCoast,Louisiana,inProceedingsofthe6thInternationalSym-posiumonCoastalEngineeringandScienceofCoastalSedimentProcesses,pp.1179. 134

PAGE 135

FitzGerald,D.M.,M.S.Fenster,B.A.Argow,andI.V.Buynevich(2008),Coastalimpactsduetosea-levelrise,Ann.Rev.EarthPl.Sc.,36,601. Fogel,M.L.,E.K.Sprague,A.P.Gize,andR.W.Frey(1989),DiagenesisoforganicmatterinGeorgiasaltmarshes,Estuar.Coast.ShelfS.,28,211. Frey,R.W.,andP.Basan(1985),CoastalSedimentaryEnvironments,chap.CoastalSaltMarshes,pp.255,Springer-Verlag. Friedrichs,C.T.,andD.G.Aubrey(1988),Non-lineartidaldistortioninsallwell-mixedestuaries:asynthesis,Estuar.Coast.ShelfS.,27,521,doi: Fry,A.,andD.G.Aubrey(1990),Tidalvelocityassymetriesandbedloadtransportinshallowembayments,Estuar.Coast.ShelfS.,30,453. Gardiner,S.,R.Nicholls,andT.Tanton(2011),Managementimplicationsofood/ebbtidaldominance:itsinuenceonsaltmarshandintertidalhabitatinPooleHarbour,Littoral,p.8,doi: Gaudiano,D.J.,andT.W.Kana(2001),Shoalbypassinginmixedenergyinlets:GeomorphicvariablesandempiricalpredictionsfornineSouthCarolinainlets.,J.CoastalRes.,17(2),280. Gerritsen,F.,andT.Louters(1990),MorphologicalstabilityofinletsandchannelsintheWesternWaddensea,Tech.Rep.GWAO-90.019,Rijkswaterstaat. Gibeaut,J.C.,andR.A.Davis(1993),Statisticalclassicationofebb-tidaldeltasalongthewest-centralFloridcoast,J.CoastalRes.,SI81,165. Hatton,R.S.,R.D.DeLaune,andW.H.PatrickJr(1983),Sedimentation,accretion,andsubsidenceinmarshesofBaratariaBasin,Louisiana,Limnol.Oceanogr.,28,494. Hayes,M.O.(1975),Morphologyofsandaccumulationsinestuaries,inEstuarineResearch,editedbyL.E.Cronin,pp.3,AcademicPress,NewYork. Hayes,M.O.(1979),Barrierislandmorphologyasafunctionoftidalandwaveregime,inBarrierIslandsfromtheGulfofSt.LawrencetotheGulfofMexico,editedbyS.Leatherman,pp.1,AcademicPress,NewYork. Hayes,M.O.(1980),Generalmorphologyandsedimentpatternsintidalinlets,Sedi-mentaryGeology,26(1-3),139156. Hayes,M.O.(1994),TheGeorgiaBightbarriersystem,inGeologyofHoloceneBarrierIslandSystems,editedbyR.A.Davis,pp.233,Springer-Verlag,NewYork. 135

PAGE 136

Hicks,D.M.,andT.M.Hume(1996),Morphologyandsizeofebbtidaldetlasatnaturalinletsonopen-seaandpocket-baycoasts,NorthIsland,NewZealand,J.CoastalRes.,12(1),47. Hoozemans,F.J.,M.Marchand,andH.Pennekamp(1993),Sealevelrise:aglobalvulnerabilityassessment:vulnerabilityassessmentforpopulation,coastalwetlandsandriceproductiononaglobalscale,Tech.rep.,TheHague,TheNetherlands:DelftHydraulicsandRijkswaterstaat. Hubbard,D.K.,G.Oertel,andD.Nummendal(1979),Theroleofwavesandtidalcurrentsinthedevelopmentoftidal-inletsedimentarystructuresandsandbodygeometry:examplesforNorthCarolina,andGeorgia,J.Sed.Pet.,49,1073. Hume,T.M.,andC.E.Herdendorf(1993),Ontheuseofempiricalstabilityrelationshipsforcharacterisingestuaries,J.CoastalRes.,9(2),413. Jarrett,J.T.(1976),Tidalprism-inletarearelationships,Tech.Rep.GITIReport3,USArmyCoast.Eng.ReserachCenter. Johnson,J.W.(1972),TidalinletsontheCalifornia,Oregon,andWashingtoncoasts,Tech.Rep.HEL24-12,HydraulicEngineeringLaboratory,UniversityofCalifornia,Berkeley,Calif. Johnston,S.,N.C.Kraus,M.E.Brown,andW.G.Grosskopf(2002),Dms:Diagnosticmodelingsystem.report4:Shoalinganalysisofst.marysentrance,orida,Tech.Rep.ERDC/CHL-TR-99-19,ENGINEERRESEARCHANDDEVELOPMENTCENTERVICKSBURGMSCOASTALANDHYDRAULICSLAB. Kirwan,M.L.,andG.R.Guntenspergen(2010),Inuenceoftidalrangeonthestabilityofcoastalmarshland,J.Geophys.Res.,115,1,doi:10.1029/2009JF001400. Kirwan,M.L.,A.B.Murray,andW.S.Boyd(2008),Temporaryvegetationdisturbanceasanexplanationforpermanentlossoftidalwetlands,GeophysicalResearchLetters,35,doi:10.1029/2007GL032681. Kirwan,M.L.,G.R.Guntenspergen,A.D'Alpaos,J.T.Morris,S.M.Mudd,andS.Temmerman(2010),Limitsontheadaptabilityofcoastalmarshestorisingsealevel,GeophysicalResearchLetters,37,doi:10.1029/2010GL045489. Kraus,N.(2000),Resevoirmodelofebb-tidalshoalevolutionandsandbypassing,J.Waterway,Port,Coastal,OceanEng.,126,305,doi:10.1061/(ASCE)0733-950X(2000)126:6(305). LeConte,L.J.(1905),Discussiononriverandharbouroutlets,Transactions,AmericanSocietyofCvilEngineers,PaperNo.1009,306. Lesser,G.R.,J.A.Roelvink,J.A.T.M.vanKester,andG.S.Stelling(2004),Developmentandvalidationofathree-dimensionalmorphologicalmodel,Coast.Eng.,51,883. 136

PAGE 137

Levin,D.R.(1993),TidalinletevolutionintheMississippiRiverdeltaplain,J.CoastalRes.,9(2),462. Lin,P.M.(1969),Modelingofthesedimenttransportinthevicinityofinletandcoastalregion,Master'sthesis,UniversityofFlorida,Gainesville,Fl. List,J.H.,B.E.Jaffe,A.H.J.Sallenger,S.J.Williams,R.A.McBride,andS.Penland(1994),Louisianabarrierislanderosionstudy:Atlasofseaoorchangesfrom1878to1898,USGSandLouisianaStateUniversity,MiscellaneousInvestigationsSeriesI-2150-A. List,J.H.,B.E.Jaffe,A.H.J.Sallenger,andM.E.Hansen(1997),BathymetriccomparisonsadjacenttotheLouisianabarrierislands:Processoflarge-scalechange,J.CoastalRes.,13(3),670. Lovering,J.L.,andP.N.Adams(inreview),Howdoesverticalmarshaccretioncontrolhydrodynamicandmorphologicresponsesofatidalinlettosealevelrise?,J.Geo-phys.Res. Marino,J.N.,andA.J.Mehta(1987),Inletebbshoalsrelatedtocoastalparameters,inCoastalSediments'87. Mariotti,G.,andS.Fagherazzi(2010),Anumericalmodelforthecoupledlong-termevolutionofsaltmarshesandtidalats,J.Geophys.Res.,115,F01,004,doi:10.1029/2009JF001326. McBride,R.A.,S.Penland,M.W.Hiland,S.J.Williams,K.A.Westphal,B.E.Jaffe,andA.H.J.Sallenger(1992),AnalysisofbarriershorelinechangesinLouisianafrom1853to1989,chap.4,pp.36,U.S.GeologicalSurveyMisc.Invest.SeriesI-2150-A. Mendelssohn,I.A.,andJ.Morris(2000),ConceptsandControversiesinTidalMarshEcology,chap.Eco-physiologicalcontrolsontheproductivityofSpartinaAlternioraLoisel,pp.59,KluwerAcad.Publ. Militello,A.,andG.A.Zarillo(2000),Tidalmotioninacomplexinletandbaysystem,PoncedeLeonInlet,Florida,J.CoastalRes.,16,840. Moller,I.,andT.Spencer(2002),Wavedissipationovermacro-tidalsaltmarshes:Effectsofmarshedgetopologyandvegetationchange,J.CoastalRes.,SI36,506. Morris,J.(2007),Ecologicalengineeringinintertidalsaltmarshes,Hydrobiologia,577,161. Morris,J.T.,P.V.Sundareshwar,C.T.Nietch,B.Kjerfve,andD.R.Cahoon(2002),Responsesofcoastalwetlandstorisingsealevel,Ecology,83,2869. Mudd,S.,S.Howell,,andJ.Morris(2009),Impactofdynamicfeedbacksbetweensedimentation,sealevelrise,andbiomassproductiononnear-surfacemarsh 137

PAGE 138

stratigraphyandcarbonaccumulation,Estuar.Coast.ShelfS.,82(3),377,doi:10.1006/j.ecss.2009.01.028. Mudd,S.M.(2011),Thelifeanddeathofsaltmarshesinresponsetoanthropogenicdisturbanceofsedimentsupply,Geology,39(3),511,doi:10.1130/focus052011.1. Nayak,I.V.(1971),Tidalprism-arearelationshipinamodelinlet,Tech.Rep.HEL24-1,HydraulicEngineeringLaboratory,UniversityofCalifornia,Berkeley,Calif. Nicholls,R.(2004),Coastaloodingandwetlandlossinthe21stcentury:changesundertheSRESclimateandsocio-economicscenarios,GlobalEnvironmentalChange,14,69,doi:10.1016/j.gloenvcha.2003.10.007. Nichols,M.M.,andJ.D.Boon(1994),CoastalLagoonProcesses,chap.SedimentTransportProcessesinCoastalLagoon,pp.157220,ElsevierSciencePublishers. Nummedal,D.,andS.M.Humphries(1978),HydraulicsanddynamicsofNorthInlet,SouthCarolina1975-76,Tech.Rep.GITIReport16,U.S.ArmyCoastalEngineeringResearchCenter,Ft.Belvoir,VA. Nummedal,D.,G.F.Oertel,D.K.Hubbard,andA.C.Hine(1977),Tidalinletvariability-capehatteratocapecanaveral,inCoastalSediments'77. O'Brien,M.P.(1931),Estuarytidalprismrelatedtoentranceareas,CivilEngineering,1(8),738. O'Brien,M.P.(1969),Equilibriumowareasofinletsonsandycoasts,JournalofWaterwaysandHarbors,WWI,43. O'Brien,M.P.,andR.R.Clark(1974),Hydraulicconstantsoftidalentrances,inProceedingsofthe14thCoastalEngineeringConference,vol.2,pp.1546,AmericanSocietyofCivilEngineers,Copenhagen,Denmark. Orson,R.,W.Panageotou,andS.P.Letherman(1985),ResponseoftidalsaltmarshesoftheU.S.AtlanticandGulfCoaststorisingsealevels,J.CoastalRes.,1,29. Parchure,T.(1982),St.MarysEntrance,MarineAdvisoryProgram,FloridaCooperativeExtensionService,UniversityofFlorida. Powell,M.A.,R.J.Thieke,andA.J.Mehta(2006),MorphodynamicrelationshipsforebbandooddeltavolumesatFlorida'stidalentrances,OceanDynam.,56,295,doi:10.1007/s10236-006-0064-3. Reed,D.J.(1990),Theimpactofsea-levelriseoncoastalsaltmarshes,ProgressinPhysicalGeography,14,24. Reed,D.J.(1995),Theresponseofcoastalmarshestosea-levelrise:survivalorsubmergence?,EarthSurfaceProcessesandLandforms,20,39,doi:10.1002/esp.3290200105. 138

PAGE 139

Seelig,W.N.,andR.M.Sorensen(1978),Numericalmodelinvestigationofselectedtidalinlet-baysystemcharacteristics,inProccedingsofthesixteenthcoastalengineer-ingconference,vol.2,pp.13021319. Shigemura,T.(1980),Tidalprism-throatarearelationshipsforthebaysofJapan,ShoreandBeach,48(3),30. Silliman,B.R.,E.D.Grosholz,andM.D.Bertness(2009),Humanimpactsonsaltmarshes:aglobalperspective,UniversityofCaliforniaPress,ColumbiaandPrinceton. Simas,T.,J.Nunes,andJ.G.Ferreira(2001),Effectsofglobalclimatechangeoncoastalsaltmarshes,Ecol.Model.,139,1,doi:10.1016/S0304-3800(01)00226-5. Speer,P.E.,andD.G.Aubrey(1985),Astudyofnon-lineartidalpropogationsinshallowinlet/estuarinesystems:PartII-theory,Estuar.Coast.ShelfS.,21,207,doi: Stive,M.,Z.B.Wang,M.Capobianco,P.Ruol,andM.C.Buijsman(1998),Morphodynamicsofatidallagoonandtheadjacentcoast,inProc.PhysicsofEs-tuariesandCoastalSeas,pp.397,BalkemaPress,Rotterdam. vandeKreeke,J.(1992),Stabilityoftidalinlets;Escofer'sanalysis,ShoreandBeach,60(1),9. vandeKreeke,J.(1993),AdaptationoftheFrisianinlettoreductioninbasinareawithspecialreferencetothecross-sectionalareoftheinletchannel,inProceeding8thInternationalBiennialConferencePhysicsofEstuariesandCoastalSeas(PECS),Balkema,Rotterdam,editedbyJ.DonkersandM.Scheffers,pp.180,PhysicsofEstuariesandCoastalSeas. vandeKreeke,J.(2004),Equilibriumandcross-sectionalstabilityoftidalinlets:applicationtotheFrisianInletbeforeandafterbasinreduction,Coast.Eng.,51,337. VanGoor,M.,T.J.Zitman,Z.B.Wang,andM.J.Stive(2003),Impactofsea-levelriseonthemorphologicalequilibriumstateoftidalinlets,Mar.Geol.,202,211,doi:10.1016/S0025-3227(03)00262-7. Walton,T.L.,andW.D.Adams(1976),Capacityofinletouterbarstostoresand,inProceedings15thCoastalEngineeringConference. Zervas,C.(2009),SealevelvariationsoftheUnitedStates1854-2006,Tech.rep.,NationalOceanicandAtmosphericAdministrations,USDepartmentofCommercen,NationalOceanService,CenterforOperationalOceanogrpahicProductsandServices. 139

PAGE 140

BIOGRAPHICALSKETCH JessicaLoveringwasborninMarylandandmovedtotheFloridaKeysinlateelementaryschool.ShelivedonBigPineKeyandgraduatedfromKeyWestHighSchoolin2001.ShebeganherundergraduatecareerattheUniversityofMarylandandcompletedherdegreeincivilengineeringwithaspecializationingeotechnicalengineeringattheUniversityofFlorida.Shewentontocompleteamaster'sdegreeincoastalandoceanographicengineering.SheremainedattheUniversityofFloridainordertopursueherPh.D.intheGeologicalSciencesDepartmentwithPeterAdams.ShewasawardedtheSMART(ScienceMathandResearchforTransformation)fellowshipandwillbeworkingfortheDepartmentofDefenseaftergraduation.ShewillbeginhercareerasaphysicaloceanographerattheNavalOceanographicOfcesattheStennisSpaceCenterinMississippi. 140