A New Solution of Peer-To-Peer Anonymous Communication

Material Information

A New Solution of Peer-To-Peer Anonymous Communication
Park, Yangbae
Place of Publication:
[Gainesville, Fla.]
University of Florida
Publication Date:
Physical Description:
1 online resource (44 p.)

Thesis/Dissertation Information

Master's ( M.S.)
Degree Grantor:
University of Florida
Degree Disciplines:
Computer Engineering
Computer and Information Science and Engineering
Committee Chair:
Chen, Shigang
Committee Members:
Sahni, Sartaj
Liu, Chien-Lian
Graduation Date:


Subjects / Keywords:
Communication systems ( jstor )
Communications security ( jstor )
Cryptography ( jstor )
Munchausen syndrome by proxy ( jstor )
News content ( jstor )
Onions ( jstor )
Preliminary proxy material ( jstor )
Proxy reporting ( jstor )
Proxy statements ( jstor )
Simulations ( jstor )
Computer and Information Science and Engineering -- Dissertations, Academic -- UF
anonymity -- anonymous -- communication -- computer -- networks -- onionrouting -- p2p
bibliography ( marcgt )
theses ( marcgt )
government publication (state, provincial, terriorial, dependent) ( marcgt )
born-digital ( sobekcm )
Electronic Thesis or Dissertation
Computer Engineering thesis, M.S.


Anonymous communication prevents network sniffers or any third parties from identifying communication parties. Whenever we use the Internet, our IP addresses are exposed to anyone along the routes; however, these addresses often allow an adversary to trace identities of senders and recipients. Since privacy protection has become more important, the demands for anonymous communication have also increased a lot. In particular, the Tor network is the most popular and widely used anonymous communication system, but it is not very scalable. Many researchers have suggested peer-to-peer (P2P) based solution to cope with this limitation of Tor. However, none of them have yet offered the anonymity that Tor provides. Our goal is to improve anonymity of a Tor-like system based on P2P architecture. It should not depend on any central authority or trusted third party that limits scalability. In addition, it should be resistant to large-scale coordinated eavesdropping. In this thesis, we propose a new anonymous communication solution that satisfies these requirements. ( en )
General Note:
In the series University of Florida Digital Collections.
General Note:
Includes vita.
Includes bibliographical references.
Source of Description:
Description based on online resource; title from PDF title page.
Source of Description:
This bibliographic record is available under the Creative Commons CC0 public domain dedication. The University of Florida Libraries, as creator of this bibliographic record, has waived all rights to it worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.
Thesis (M.S.)--University of Florida, 2012.
Adviser: Chen, Shigang.
Electronic Access:
Statement of Responsibility:
by Yangbae Park.

Record Information

Source Institution:
Rights Management:
Copyright Park, Yangbae. Permission granted to the University of Florida to digitize, archive and distribute this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Embargo Date:
Resource Identifier:
867650430 ( OCLC )
LD1780 2012 ( lcc )


This item has the following downloads:

Full Text




c2012YangbaePark 2


Idedicatethisthesistomyparents. 3


ACKNOWLEDGMENTS Firstandforemost,Iwouldliketoexpressmysinceregratitudetomyadvisor,Dr.ShigangChen.Thisthesiswouldnothavebeenpossiblewithouthisadvice,guidance,andpersistenthelp.IwouldalsoliketothankDr.SartajSahniandDr.JonathanLiuforservingonthesupervisorycommittee.Theirconstructiveassistanceandcommentshavealwaysinspiredmetothinkcreatively.Itwasmygreatpleasureandhonortohavethemonthecommittee.Inaddition,IthankMinChen,TaoLi,WenLuo,ZhenMo,YanQiao,andYianZhenwhohavestudiedanddiscussedanumberofinterestingtopicswithme.IamgratefultoDr.LingguoCuiforgivingmevaluablecomments.Iamalsoindebtedtomyothercolleagues,including,butnotlimitedto,InchulChoi,HokyuKang,DunamKim,andCoralieRichard,whohelpedmestaysaneandhappy.Iwishthemallwellintheirfutureendeavors. 4


TABLEOFCONTENTS page ACKNOWLEDGMENTS .................................. 4 LISTOFTABLES ...................................... 6 LISTOFFIGURES ..................................... 7 ABSTRACT ......................................... 8 CHAPTER 1INTRODUCTION ................................... 9 2PREVIOUSRESEARCHANDAPPLICATIONS .................. 11 2.1LowLatencyvs.HighLatencyAnonymousCommunication ........ 11 2.2AttackModelsforAnonymousCommunication ............... 11 2.3AnonymousProxyServers .......................... 12 2.4OnionRoutingandTor ............................. 13 2.5DistributedHashTables ............................ 15 2.6DHTsandTor .................................. 16 3MOTIVATION ..................................... 19 3.1DHTLookup .................................. 19 3.2RoutingTablePrediction ............................ 21 4PROPOSEDSOLUTION .............................. 24 4.1PredictiveLookup:LocatingaRelayinaSpecialCondition ........ 24 4.2PredictiveLookup:GeneralizedVersion ................... 26 4.3YetAnotherIssueofPredictiveLookupandSolution ............ 28 4.4BuildingaVirtualCircuit ............................ 31 5SIMULATIONRESULTS ............................... 33 5.1SimulationforPredictiveLookup ....................... 33 5.2Simulationwithfcuto .............................. 35 6CONCLUSIONSANDFUTURERESEARCH ................... 38 6.1Conclusions ................................... 38 6.2FutureResearch ................................ 38 REFERENCES ....................................... 40 BIOGRAPHICALSKETCH ................................ 44 5


LISTOFTABLES Table page 2-1ComparisonofP2P ................................. 16 4-1Classicationofresultsofrangeestimationforpredictivelookup ........ 28 5-1Averagehopcountoftraditionalandpredictivelookup .............. 34 5-2Comparisonbetweentraditionalandpredictivelookup .............. 35 5-3RangeestimationsuccessratiofRESwithfcuto .................. 36 6


LISTOFFIGURES Figure page 2-1AnonymousHTTPproxy ............................... 12 2-2Anexampleofavirtualcircuit ........................... 14 2-3Messageencapsulationanddecapsulation .................... 15 2-4RangeestimationduringlookupinNISAN .................... 18 3-1DHTnodes ...................................... 19 3-2ADHTroutingtableexample ............................ 20 3-3Ascenarioofmulti-hopqueries .......................... 21 3-4Pseodu-codeoflookupfunction .......................... 22 3-5Fully-lled3-bitidspace .............................. 23 4-1Predictivelookupversion1 ............................. 25 4-2Pseudo-codeofpredictivelookupversion1 .................... 25 4-3Failureofpredictivelookupversion1 ....................... 26 4-4oaltpredandoxpredinthe8-bitDHTidspace .................... 27 4-5oxsuccvs.oxpredinalargeDHTidspace ...................... 28 4-6Locatingxusingpredictivelookupversion2 ................... 29 4-7Pseudo-codeofthepredictivelookupversion2 ................. 29 4-8Successfulrangeestimationwhenxaltisnearbyx ................ 30 4-9Pseudo-codewithpredictivetablecutoff ..................... 31 5-1Averagehopcountoftraditionalandpredictivelookup .............. 34 5-2Comparisonbetweentraditionalandpredictivelookup .............. 36 5-3RangeestimationsuccessratiofRESwhenfcutoissecret ............ 37 5-4RangeestimationsuccessratiofRESwhenfcutoisrevealed ........... 37 7


AbstractofThesisPresentedtotheGraduateSchooloftheUniversityofFloridainPartialFulllmentoftheRequirementsfortheDegreeofMasterofScienceANEWSOLUTIONOFPEER-TO-PEERANONYMOUSCOMMUNICATIONByYangbaeParkMay2012Chair:ShigangChenMajor:ComputerEngineeringAnonymouscommunicationpreventsnetworksniffersoranythirdpartiesfromidentifyingcommunicationparties.WheneverweusetheInternet,ourIPaddressesareexposedtoanyonealongtheroutes;however,theseaddressesoftenallowanadversarytotraceidentitiesofsendersandrecipients.Sinceprivacyprotectionhasbecomemoreimportant,thedemandsforanonymouscommunicationhavealsoincreasedalot.Inparticular,theTornetworkisthemostpopularandwidelyusedanonymouscommunicationsystem,butitisnotveryscalable.Manyresearchershavesuggestedpeer-to-peer(P2P)basedsolutiontocopewiththislimitationofTor.However,noneofthemhaveyetofferedtheanonymitythatTorprovides.OurgoalistoimproveanonymityofaTor-likesystembasedonP2Parchitecture.Itshouldnotdependonanycentralauthorityortrustedthirdpartythatlimitsscalability.Inaddition,itshouldberesistanttolarge-scalecoordinatedeavesdropping.Inthisthesis,weproposeanewanonymouscommunicationsolutionthatsatisestheserequirements. 8


CHAPTER1INTRODUCTIONAnonymouscommunicationpreventsnetworksniffersoranythirdpartiesfromidentifyingcommunicationparties.Cryptographyhassolvedmanyissuesforcondentialityandintegrity.Howevernetworkaddressesinpacketsarestillexposed,andanyonealongtheroutescanmonitortheaddresses.Suchaddressesoftenbecomecriticalhints,enablinganadversarytotraceidentitiesofsendersandrecipients.Sinceprivacyprotectionhasbecomemoreimportant,thedemandsforanonymouscommunicationhavealsoincreased.TheTornetwork[ 1 ]isthemostpopularandwidelyusedanonymouscommunicationsystem.Torallowshundredsofthousandsofusers[ 2 ]tosurftheInternetwithoutscaricingprivacy.ThereareavarietyofusersandcountriesaccessingTor,fromjournalistsinEgypttoIranian,Indian,Japanese,andRussianembassies[ 3 ].IntheTornetwork,thenumberoftrusteddirectoryserversislimited,andallusershavetostoreaglobalviewofthesystem.Althoughthisdesignpreventsattackersfrompoisoningthedirectoryorcircuits,itcausesascalabilityproblem.McLachanetal.[ 4 ]showthattrafctomanageaglobalviewwillsoonbecomelargerthanactualanonymoustrafc.Withregardtothisissue,someresearchersconsideradaptingpeer-to-peer(P2P)approachesonTororitsvariants[ 5 ][ 6 ][ 7 ][ 4 ][ 8 ][ 9 ].P2ParchitecturecannotbenoteasilyapplicableforTorbecauseitcausesanewproblemtoanonymouscommunication.Forexample,AP3[ 7 ]andSalsa[ 6 ]utilizeDistributedHashTable(DHT)todistributecentralizedoverhead,andusersarerequiredtomaintainonlyapartialviewofasystem.HoweverMittalandBorisov[ 10 ]showedthatattackerscanrevealidentitiesofcommunicationpartiesduringthelookupprocedure.Morerecently,NISAN[ 8 ]hasproposedananonymouslookupmechanism.NISANprovidesbetterredundancyandboundcheckingagainstactiveattackerswhileithides 9


therelationshipbetweenusersandrelaysfrompassiveattackers.HoweverWangetal.[ 11 ]showthatagroupofcompromisednodesmaystillbreakanonymityduringlookup.Inthisthesis,weproposeanewP2PanonymouscommunicationsolutionbasedonChord[ 12 ],whichiswidelyusedbymanyP2Presearchersandapplications.Oursolutioniscompletelydecentralized,anditisrobustagainstalargescaleadversary.Itdoesnotrelyonanytrustedthirdpartyonthesystem,norredundantactivitiesthatcancauseanothertypeofvulnerability.Thekeyideaofoursolutioniscalledpredictivelookup.Wendamechanismtopredictanothernode'sroutingtable.Basedonthismechanism,wedesignanewlookupprotocoltoinitiateanonymouscommunication.Wefurtherdevelopourideaintoageneralcondition,regardlessofthesizeofnodes,orthedensityofthenetwork.Therestofthisthesisisorganizedasfollows.InChapter 2 ,wedescribepreviousresearchandapplications.InChapter 3 ,weshowdetailsofroutingtablepredictionwhichwillbelaterakeymechanismforournewsolution.InChapter 4 ,weproposeanewsolution,andweexpandourideatogeneralizethesolution.InChapter 5 ,weconductedasimulation,andtheexperimentalresultsareshown.FinallyweconcludeinChapter 6 10


CHAPTER2PREVIOUSRESEARCHANDAPPLICATIONS 2.1LowLatencyvs.HighLatencyAnonymousCommunicationAnonymouscommunicationcanbecategorizedbasedonlatency.Lowlatencycommunicationistypicallyforinteractiveapplicationswhichrequireshortdelayoftransmission.Forinstance,webbrowserswillshowHTTPError408(Requesttimeout)unlesstheyretrieveawebpagewithinafewseconds.Likewise,mostpeoplewillclosevoicechattingiftheirpartnersbecomemute.Althoughlowlatencycommunicationcanbenetmostapplications,itisweakagainstapowerfulglobaladversarywhocanmonitortheentirenetwork[ 13 ][ 14 ][ 15 ][ 16 ].Theglobaladversarycanmeasureend-to-enddatatransmissionandreceptiontime,andtheycanthendiscoversendersandcorrespondingrecipients.Highlatencycommunicationusuallytakeshoursorevendaystotransmitamessage,anditisrobustagainstaglobaladversary.Mixminion[ 17 ]andMixmaster[ 18 ]arewell-knownexamplesofhighlatencycommunicationsystems.Howeverduetohighlatency,onlylimitedapplicationsareabletousehighlatencycommunicationsystems,suchasemails.Inthisthesis,wefocusonlowlatencyanonymouscommunication.WeassumethatthereisnoglobalattackerontheInternet,butwestillconsidertheexistenceofsemi-globalattackers. 2.2AttackModelsforAnonymousCommunicationTypicallyattackmodelsforanonymouscommunicationareclassiedintoactiveandpassiveattacks.Activeattackersjoininandmanipulateanonymouscommunicationchannelsactivelysothattheycanbreakanonymity,ortheydamagethesystemitself.Althoughactiveattackscouldcausecriticaldamage,theyareusuallyvisibleduetoabnormalactivities. 11


Ontheotherhand,passiveattackersonlyobservesomeportionofanonymoustrafc.Unlikeactiveattackers,passiveattackersdonotexposethemselves,sotheyarerarelydetected.Furthermore,MittalandBorisov[ 10 ]showthatseveraldefensetechniquesagainstactiveattackscreatenewvulnerabilitiesofanonymityfrompassiveattacks.Wefocusonpassiveattacksparticularlyinthisthesis. 2.3AnonymousProxyServersAproxyserverisanetworknodethatforwardsincomingpacketstoothers.Ananonymousproxyserverhasananonymizerthatconcealstheoriginalsender'sidentity.Figure 2-1 showshowanHTTPanonymousproxysystemworks. Figure2-1. AnonymousHTTPproxy FirstclientAencryptsaHTTPrequestmessagewithasharedsecretkeyKABorB'spublickeyKB+.NextAsendstheencryptedrequesttotheanonymousproxy 12


serverB.Authenticationisoptionallyrequiredatthismoment.OnceBacceptsAanditsmessage,theanonymizerremovesanyA'sidentityfromthemessage.ProxyBthenforwardstheanonymousmessagetowardtheactualdestinationC.WhenBreceivesaresponsefromC,itencryptstheresponseagainwithKABorA'spublickeyKA+,andthenforwardstoA.AkeyroleinthismodelistheproxyB.IfBiscompromised,attackerscantraceA'saddress.MoreoverevenwithoutcontrolsoverB,attackerscanstillusetrafcortiminganalysisattackstondaconnectionfromAtoB,andacorrespondingconnectionfromBtoC. 2.4OnionRoutingandTorReedetal.[ 19 ]proposedafreelyavailableanonymouscommunicationsystemcalledonionrouting.Onionroutingutilizesmultiplenetworknodestopreventeavesdroppingandtrafcanalysis.Torisapredominantimplementationofonionrouting,servinghundredsofthousandsofusers[ 2 ].Tortypicallycallsthenetworknodesrelays,andanyonecanrunaTorrelayvoluntarily.OnionroutingisbasedonPublicKeyEncryption.Eachrelayoruserhasapublicandprivatekeypair.Publickeysareavailableforall,whileprivatekeysshouldbekeptinsecret.Thelistofrelaysiscalledthedirectory.IntheTornetwork,allclients,aswellasseveraltrusteddirectoryserversmaintainthedirectory.Beforetransmittingactualmessages,anonionroutingclienthastochooseseveralrelays.TypicallyTorselectsthreerandomrelays.Themorerelaystheclientuses,thehigheranonymityandperformanceareobtained[ 20 ],butlatencywillalsoincreasemore.Next,theclientcreatesavirtualcircuitcomposedofthechosenrelays,asFigure 2-2 shows.AvirtualcircuitisanetworktunnelontopoftheInternet.Iftheclientselectsthreerelays,messageswillbetransmittedthroughthethreerelays. 13


Asapowerfuladversarymayattempttotracethesequenceofrelaystodiscovercommunicationparties,Torexpireseachvirtualcircuitevery10minutes. Figure2-2. Anexampleofavirtualcircuit Inordertohideidentitiesofsendersandrecipients,anactualmessageiswrappedinseverallayersofencryption.Figure 2-3 showshowaclienttransmitsamessagethroughavirtualcircuitthatconsistsofthreerelaysR1,R2,andR3.ItrstencryptsthemessagewithR3'spublickeyKR3+.Next,theclientencryptsR3'saddressandthepreviouslyencryptedmessagewithR2'spublickeyKR2+.Thisprocedurecontinuesuntiltheclientencryptswiththerstrelay'spublickey,whichisKR1+inFigure 2-3 .WhentherstrelayR1receivesthewrappedmessagefromtheclient,R1decryptsthemessagewithR1'sprivatekeyKR2)]TJ /F1 11.955 Tf 10.41 -5.15 Td[(toextractthepayloadandthenextdestination.Thisislikepeelinganonion,butR1canonlypeeltherstlayerbecausetheotherlayersareencryptedwithotherkeys,KR2+andKR3+.FromtheperspectiveofR1,thedestinationisR2,andnootherrelaysordestinationarevisiblebecausetheiraddressesareencryptedwithdifferentkeys.OnceR1forwardsthemessagetoR2,R2hasnowaytorecognizetheclient'sexistence,thoughR2canseeR3.R3knowsthenaldestination,butitisunabletotracewhosentthismessage.Thus,noonecandeanonymizethecommunication.AlthoughTorisaverysuccessfulonionroutingapplication,itdependsonasingledirectoryauthority.Inaddition,eachclientmanagesaglobalpictureofthenetwork,and 14


Figure2-3. Messageencapsulationanddecapsulation(KR+:R'spublickey) thesecausescalabilityissues.McLachanetal.[ 4 ]showthattrafctomanagetheglobalviewwillbecomelargerthanactualanonymoustrafcinthenearfuture. 2.5DistributedHashTablesPeer-to-peer(P2P)systemshavebeenverysuccessfulinaddressingresourcesharingandcontentaccessovertheInternet[ 12 21 23 ].SomeresearchershaveconsideredP2PapproachestoresolvescalabilityissuesinaTornetwork[ 7 ][ 6 ][ 4 ][ 8 ][ 9 ].AvarietyofP2Psystemsareavailablenow,buttheyarebrieycategorizedintocentralizedanddecentralizedsystems.Decentralizedsystemsareagainclassiedintounstructuredandstructuredsystems.IncentralizedP2Psystems,asingledirectoryauthoritymaintainsacentralizeddirectory.Thisstructurehasseveraladvantages.Itpreventsmaliciousnodesfrom 15


Table2-1. ComparisonofP2P P2PtypesLookuptimeStoragerequirementApplication(s) CentralizedO(1)O(N)Napster,eDonkey,BitTorrentDecentralized&UnstructuredO(N)O(1)GnutellaDecentralized&StructuredO(lg(N))O(lg(N))DHTs,BitTorrent poisoningthedirectory,anditalsorespondstoqueriesveryquicklybecausethedirectoryisstoredinalocalarea.Howeverthedirectorybecomesbottleneckedwhenthenumberofnodesandqueriessoars,sothisarchitectureisnotveryscalable.DecentralizedP2Psystemsarebasedonoverlaynetworks.Eachnodestoresandsharesonlyasmallportionofthedirectory.Inparticular,unstructuredP2Psystemsdonotimposeanytopologyorstructureonthenetwork,sothenetworkexpandsarbitrarily.InanN-nodesystem,thiscausesqueryingtimetoexpandtoO(N)intheworstcase.Ontheotherhand,astructuredP2Psystemhasaconsistentprotocolthatrestrictsnodesfromforminganinefcientoverlaynetwork.DistributedHashTables(DHTs)areofthisclass.Becauseofthestrictstructure,importantoperations,suchasjoining,Lookup,andquitting,canbedonewithinO(lg(N))orO(lg2(N))[ 12 ].Thus,DHTsaregenerallyfasterthanunstructuredP2Psystems,andmorereliablethancentralizedP2P.Chord[ 12 ],Pastry[ 24 ],CAN[ 25 ],andTapestry[ 26 ]arefamousexamplesofDHTs. 2.6DHTsandTorDHTshavebeenadaptedbymanyresearcherstoresolveTor'sscalabilityissues,andSalsa[ 6 ]isoneofthepioneeringworks.SalsareliesonaDHTsystemtostoredirectoryinformation.Itcalculatesacryptographichashvalueofthenode'sIPaddresstocreateanidentityintheDHT.Unlikelesharingapplications,anonymouscommunicationdoesnotneedexternaldatatoshare,suchasles,sonodesonlysharedirectoryinformation.WhenaSalsaclientneedstolocatearelay,itgeneratesarandomvalue,andndsthecorrespondingnodewhichisuniqueintheDHTidspace.HoweverlaterMittalandBorisov[ 10 ]showthatthisisnotadequatelysecure.Moreovertheyalso 16


provethatSalsa'sdefensemechanismagainstactiveattacksironicallyincreasesthreatsofpassiveattacks.Torsk[ 4 ]proposessecretbuddyscheme.Insteadofanonymizinglookupitself,aTorskclientexecutesrandomwalkstoselectsecretbuddynodes,andthesenodeswillserveasproxiesduringlookup.TheclientthengeneratesarandomvalueintheDHTidspace,andndthecorrespondingnodetoselectarelay.HoweverWangetal.[ 11 ]presentbuddyexhaustionattacks,andthisblockshonestnodesfromchoosingasecretbuddy.TheyalsoshowthatTorskisweakagainspassiveattacks,astherandomvalueisleakedtoothers.Thisenablesintermediatenodestoquerytherandomvalue,whicheventuallyexposestherelay.Panchenkoetal.[ 8 ]introduceanalternativeapproach,namedNISAN.InNISAN,aclientalsoneedsarandomvaluex.However,insteadofannouncingxtoothernodes,theclientasksothernodestosendtheirroutingtables1.Thispreventsothernodesfromknowingthevaluex,whichshouldbekeptsecret.AlthoughNISANprotectsxfrombeingdirectlyrevealed,itisstillfarfromperfect.Wangetal.[ 11 ]provethatattackerscanstillshrinkrangeofxsignicantly.Thisiscalledrangeestimation,anditisbasedonthefactthataclientwillqueryonlynodesprecedingx.WhenquerierQinFigure 2-4 queriestoacompromisednodeC,Ccanestimatex'sboundaryxasfollows:m:thenumberofbitsinagivenidspaceidn:theidentierofnodenx=(idMAX,idMIN) 1NISANisbasedonChord-likeDHT,andChordcallsroutingtablesngertables.Inthisthesis,wealwaysuseroutingtablestopreventconfusion. 17


idMIN=idCidMAX=(idQ+2i)mod2mwhereidQ+2i)]TJ /F7 7.97 Tf 6.58 0 Td[(1

CHAPTER3MOTIVATIONInthischapter,wedescribemotivatingideasrelatedtoournewsolution.Itconsistsofseveralsteps.WerstexplainalookupprocedureofChord-likeDHT,andthendiscoverhowtopredictothernodes'routingtables. 3.1DHTLookupEveryDHTnodehasasinglem-bitidentier(id)positionedinasharedidspace.TypicallyanidisgeneratedbyrunningacryptographichashfunctionsuchasSHA-1.Forsimplicity,weusesmallidspacestodescribeexamples.Figure 3-1 shows5nodesin8bitDHTidspace. Figure3-1. DHTnodes Chapter 2 showsthataDHTsystemdoesnotrelyonacentraldirectoryservice.Instead,everyDHTnodenhasaroutingtableTnthatconsistsofmroutingentries.EachentryEn,ihasakeykn,ianditscorrespondingnodeokn,i. 19



exampleofmulti-hopqueries,andFigure 3-4 showsthepseudo-codeoftheDHTqueryfunction. Figure3-3. Ascenarioofmulti-hopqueries 3.2RoutingTablePredictionLet'srstassumethataDHTidspaceisfullylled,likeFigure 3-5 .InFigure 3-5 ,nodeAshallhavenodeB,C,andEinitsroutingtablebecausethedistancefromA 21


Figure3-4. Pseodu-codeoflookupfunction toB,C,orEisexactlythepowerof2.Likewise,nodeCshallhavenodeD,E,andG.NodeDshallhavenodeE,F,andH.WenotethatnodesA,C,andDmustcontainnodeEintheirroutingtables.Inotherwords,EisreachablefromA,C,orDwithinasinglehop.ThefollowingformulashowshowtoderiveacollectionCidTofkeysidnofnodesthatmusthaveaspecicnodeTintheirroutingtables.CkisthegeneralizedversionofCidTforanyidk.CidT=fidnjidn=(idT)]TJ /F8 11.955 Tf 11.95 0 Td[(2i)mod2m,0i

Figure3-5. Fully-lled3-bitidspace 23


CHAPTER4PROPOSEDSOLUTIONInthischapter,weexploreanewlookupmechanismcalledpredictivelookuptoobfuscaterangeestimation.WerstassumethattheDHTidspaceisfull,andthenwegeneralizeourmethodbyremovingtheassumption.Wealsodealwithhowtobuildavirtualcircuitusingthenewlookupmechanismtomakeitevenmoredifcultforattackerstoestimatetherange. 4.1PredictiveLookup:LocatingaRelayinaSpecialConditionThepreviouschaptershowsthatwhenDHTidspaceisfull,wecanpredictCk,asetofmnodesthathaveaspecickeykintheirroutingtables.WecallCkpredictiontable.Withthisknowledge,wecandesignanewlookupprocess.FirstwegeneratearandomidxandcorrespondingpredictiontableCx.Nextwegeneratearandomindexi(0i

Figure4-1. Predictivelookupversion1 Thismechanismsuppressesrangeestimationbecauseitforcesthemajorityofqueriestoheadtoxalt.Thereforepassiveattackersarehighlyunabletoestimatethecorrectrangeofx.Figure 4-2 showsthepseudo-codeofpredictivelookupversion1. Figure4-2. Pseudo-codeofpredictivelookupversion1 25


4.2PredictiveLookup:GeneralizedVersionAlthoughpredictivelookupversion1limitsrangeestimation,thisisnotalwaysapplicable.PracticalDHTidspacesaresobig;forinstance,Kademlia[ 27 ]isafamousDHTprotocolusedbymanyapplications,suchasBitTorrent,andithasa160-bitidspace.Suchanidspaceissospaciousthatitisunrealistictobelledout.Whenpredictivelookupversion1locatesoalt,itreturnstherstsuccessorofxaltunlessoalt'sidisexactlyxalt.Becauseoaltsucceedsxalt,oalt's(i+1)-throutingentryalsorefersox'ssuccessordenotedbyoxsucc.Thus,thequerierwillfailtolocatethecorrectox.InFigure 4-3 ,thequeriergeneratesx=8inthe4-bitidspace,anditchoosesthelastentryonC8,soxalt=0.Sincethereisnosuchnodewhoseidis0,nodeAbecomesoalt.IfthequerierfollowsnodeA'slastroutingentry,itwilleventuallyarriveatnodeF,whichisanincorrectdestination. Figure4-3. Failureofpredictivelookupversion1 Suchafailurecausesadditionallookuptorelocatex.Therearetwowaystorelocatexfromtheincorrectdestinationoxsucc.Therstoptionissearchingbackwardfromoxsucc.Thisrequirestosendaquerytoeverynodebetweenxandoxsuccbecauseeachnodeonlyholdstheclosestpredecessorpointerinthebackwarddirection.Theotheroptionissearchingforward,butthisisalsoabadideabecausexistoofaraway 26


fromoxsucc.Therefore,alltheseoptionsareriskyenoughtoenablerangeestimationagain.Wefocusonhowtominimizetherelocationprocess.Insteadoflookingforoaltwhichistherstsuccessorofxalt,thequeriercansearchoalt'srstpredecessoroaltpred.InFigure 4-4 ,nodeAisoalt,whereasnodeGisoaltpred.oaltpredcanbeobtainedwithinconstanttimebecauseeachChordnodemaintainsapredecessorpointer.Wenotethatoaltpredistheclosestpredecessorfromxalt,andoaltistheclosestsuccessorfromxalt.Thus,unlikeoalt,oaltpred'sroutingentrypointsx'spredecessor,whichisdenotedbyoxpred.SinceChordidspaceisdirectional,thenewdistancefromoxpredtoxisshorterthaneithertheforwarddistanceorbackwarddistancefromoxsucctox.Figure 4-5 comparesthenewdistancewiththebackwarddistancewhennodesarenear-uniformlydistributed. Figure4-4. oaltpredandoxpredinthe8-bitDHTidspace Althoughthismethoddoesnotguaranteeaonehopincrementduringlookup,itaddsreasonablysmallhopsingeneralbecausethedistancefromoxpredtoxistypicallyshorterthanthedistancefromthequeriertoxalt.Wenamethismethodpredictive 27


Figure4-5. oxsuccvs.oxpredinalargeDHTidspace Table4-1. Classicationofresultsofrangeestimationforpredictivelookup ClassLeakagewhilelocatingxaltLeakagewhilelocatingxSafety SafeXXSafeMisestimatedOXSafeLeakedXOUnsafeConfusingOOAlmostsafe lookupversion2,andFigure 4-6 andFigure 4-7 showtherevisedwaytolocatexusingpredictivelookupversion2.Forsimplicity,Figure 4-6 isdrawninarecursivewayalthoughitisactuallydoneiteratively.Withregardtopredictivelookupversion2,anattemptforrangeestimationresultsinoneoffollowing: 1. Therelayiscompletelysafe:whennoqueryisleakedduringthewholeprocess,therelayisobviouslysafe. 2. Therelayismisestimated:whenoneormorequeriesonlyduringthersttraditionallookupstepareleaked,theattackersmisestimatetherangeoftherelay. 3. Therelayisleaked:whenoneormorequeriesonlyduringthepredictivelookupstepareleaked,theattackerscancorrectlyestimatetherangeoftherelay. 4. Therelayisconfusing:whenbothtraditionallookupstepandpredictivelookupstepareleaked,theattackershavetodecidewhichrangeincludesacorrectrelay.Weuseshufingandconcurrentqueryingtoconfuseattackersevenmoreinthisscenario.MoredetailsaboutthetechniquesaredescribedinSection 4.4 4.3YetAnotherIssueofPredictiveLookupandSolutionThereisyetanotherminorissue:whichentrydoesalookupinitiatorhavetochooseinCx?TherearetotalmentriesavailableinCx,butchoosingakeynearbythetargetx 28


Figure4-6. Locatingxusingpredictivelookupversion2 Figure4-7. Pseudo-codeofthepredictivelookupversion2 29


isgenerallyinsecure.Thisisbecausewhenattackersestimaterangeofx,theresultwillaccidentallyintersectwithbothxandxaltifxandxaltareclosed,asFigure 4-8 shows. Figure4-8. Successfulrangeestimationwhenxaltisnearbyx Whennodesarenear-uniformlydistributed,theprobabilityPrneighborthataclientselectsthetarget'sneighborisasfollows:distance=2m Nxalt,x=2iPrneighbor=Pr(distance>xalt,x)=Pr(2m N>2i)=Pr(lg(2m N)>i)=Pr(m)]TJ /F3 11.955 Tf 11.96 0 Td[(lg(N)>i),(0i

nodes,andxalt,xisthedistancefromxalttox.Sincemisxed,andlog(N)doesnotvarydramatically,Prneighbordependsoni.Wheniistoosmall,predictivelookupisnolongerbenecial.Withregardtothisissue,weproposepredictiontablecutofftechnique,whichrestrictsclientsfromselectingsmalli.Abasicpredictiontablehasmelement,butclientscutthefrontpart(therstmfcutoentries)ofthetableoptionallysothattheydonotselectsmalli.WewillexploretheimpactofcutoffratiofcutomorebyobservingthesimulationresultsinChapter 5 Figure4-9. Pseudo-codewithpredictivetablecutoff 4.4BuildingaVirtualCircuitWehavediscussedhowtolocateasinglerelaywithpredictivelookupmechanism,butinordertobuildavirtualcircuit,wehavetoselectmultiplerelays.Tortypicallyrequiresthreerelays,butmorerelaysarerecommendedinaP2Pbasedenvironmentbecauseofsecurityandscalabilityissues.First,anyP2PanonymouscommunicationisinevitablyweakerthanTorintermsofanonymitybecausethelookupprocessreliesonqueriestoothernodes.WheneveraqueriersendsarequestmessageusingaDHTprotocol,thereceiveratleastrecognizesthatthequerierisattemptingtoinitiateanonymouscommunication.ThususingthesameconstantnumberofrelaysthatTorusesisnotagoodidea.Moreover,P2Parchitectureismorescalable;thesystemcansupportmorevolunteernodes,andthisprovidesmoreoptionstoutilizemorerelays.Although 31



CHAPTER5SIMULATIONRESULTSWewriteaJavaapplicationtosimulateaDHTbasedanonymouscommunicationsystemwhichhas32-bitidspace.(m=32)Thenwesetup500,000nodes,(N=500,000)andassignadifferentidentierforeachnoderandomly.OnceallnodesjoinintotheDHT,weselect10,000randomsourcessrciandcorrespondingrandomtargetkeysxi.(0i<10000,i2Z) 5.1SimulationforPredictiveLookupWesimulateatraditionallookupmethodandournewpredictivelookupmethodtoseehowmuchoursolutionimprovesanonymity.Forbothmethods,weconsiderthefollowingcriteria. 1. Theaveragenumberofqueries(hops)thatsourcenodessend.(=hopcount) 2. RangeEstimationSuccessRatiofRESfRES=8>><>>:0,ifNrange=0orx=2[range]1 Nrange,ifx2[range]whererangeistheestimatedrangebytheattackersandNrangeisthenumberofnodesintherange.fRES=1meansthattheattackersexactlyndtherelay.fRESiszerowhentheyfailtoestimaterange.fRES=0.5meansthattheyndtwonodes,andoneofthemshallbetherelay.Likewise,fRES=1 3meansthattheyndthreenodes,andoneofthemiscertainlytherelay.ThelowerfRESis,themoreanonymousitis.Wexfcuto=0,andsettheratioofcompromisednodesfasavariable.Wethensimulatetraditionallookupandpredictivelookup10,000timesfordifferentf.Werstmeasurehowmanyhopsareadditionallyrequiredforpredictivelookup.Figure 5-1 showsthattheaveragehopcountofpredictivelookupisapproximately25%largerthanatraditionallookup.Furthermore,wesimulate1millionnodeswhichgreatlyexceed 33


Table5-1. Averagehopcountoftraditionalandpredictivelookup NAveragehopcountoftraditionallookupAveragehopcountofpredictivelookup 100006.4647.99620,0007.0488.76930,0007.3668.95240,0007.5399.42250,0007.7349.50160,0007.7429.50070,0007.9489.88380,0007.99210.04590,0008.11210.278100,0008.13010.291.........500,0009.24411.960.........1,000,0009.90812.952 currentTorusers,andwendthatpredictivelookuprequiresonly3morehopswhichisnear-constant. Figure5-1. Averagehopcountoftraditionalandpredictivelookup WhenitcomestofRES,Table 5-2 andFigure 5-2 showthatpredictivelookupisapproximately4timesmoresecurethantheoriginalDHTlookupwhen20%ofnodesarecompromised.Whenitcomestolargef,thedifferencebecomesmore 34


Table5-2. Comparisonbetweentraditionalandpredictivelookup ffRESoftraditionallookupfRESofpredictivelookup 0000.050.00290.00070.100.01120.00330.150.02780.00780.200.03260.00820.250.06610.01360.300.09850.02000.350.12770.02320.400.15810.02670.450.17330.02540.500.23150.03260.550.20880.03280.600.24580.03580.650.28170.03860.700.30920.04050.750.35090.04190.800.39150.04680.850.43640.05640.900.46260.05350.950.50430.0548 signicantupto10times.However,usinganyP2Pbasedanonymouscommunicationsolutionisnotrecommendedwhentheportionofcompromisednodesistoohigh. 5.2SimulationwithfcutoWhileweanalyzetheprevioussimulationresults,wenotethatmanyqueriersattempttoselectxaltwhichisveryclosedtox.Wesetxedf=0.3andvariablefcutoratioatthistime.WemeasurerangeestimationsuccessratiofRESforthedifferentfcutovalues.Figure 5-3 showsthatrangeestimationismorelikelytofailwhenfcutoislarge.However,theattackersmayndthefcutovalueiftheyreverse-engineeronionroutingapplications.Whenattackersknowthefcutovalue,theycandesignanewrangeestimationalgorithmtoexcludethecutoffedrange.Figure 5-4 showsthatfcutoshouldnotexceed0.8whenf=0.3andanadversaryknowsfcuto. 35


Figure5-2. Comparisonbetweentraditionalandpredictivelookup Table5-3. RangeestimationsuccessratiofRESwithfcuto fcutofRESwhenfcutoissecretfRESwhenfcutoisrevealed 00.02000.02000.050.01400.01470.100.01520.01690.150.01720.02020.200.01520.01900.250.01280.01710.300.01180.01690.350.01480.02280.400.01090.01820.450.00920.01670.500.00890.01780.550.00790.01760.600.00660.01650.650.00730.02090.700.00400.01330.750.00490.01960.800.00400.02000.850.00350.02330.900.00330.03300.950.00170.0340 36


Figure5-3. RangeestimationsuccessratiofRESwhenfcutoissecret Figure5-4. RangeestimationsuccessratiofRESwhenfcutoisrevealed 37


CHAPTER6CONCLUSIONSANDFUTURERESEARCH 6.1ConclusionsInthispaper,weproposedanewanonymouscommunicationsystembasedonP2Parchitecture.Inparticular,wefocusedonChord-likeDHTs,andwepresentedpredictivelookup.Thenewlookupmechanismisdesignedtoprotectanonymitywithoutrelyingonanytrustedpartieswhichusuallybecomeeasytargetsofactiveattacks.Oursolutionsuppressesthepossibilityofrangeestimationfrompassiveattackers.Wehavealsodealtwithsideeffectsofoursolution,andsuggestedpredictiontablecutofftoreducetheriskofaccidentaldeanonymization.Moreover,shufingandconcurrentqueryingobfuscatealargegroupoftimingattackerswhilelocatingmultiplerelays.Werunsimulationstoassessoursolutioninapracticalenvironment,andthesimulationsshowthatwhen30%ofnodesareoccupiedbyanadversary,theanonymityincreasesupto5timesbysacricingonlytinyadditionallatencyduringcircuitinitialization.Thisshowsthatoursolutionisnotonlysecure,butitisalsoverypractical. 6.2FutureResearchAlthoughthisthesisdiscoversanewanonymouscommunicationsolution,moreresearchisstillnecessaryinthiseld.NoneoftheP2Pbasedsolutionsguaranteesperfectanonymityyet.InterestingresearchissueswillrisewhenwejointlyconsiderotheraspectsofnetworkingsuchasQoS/resourcemanagement/distributedcomputing[ 28 36 ],DDoSattacks[ 37 38 ],wirelessclients[ 39 ],etc.Webelievethisareaisstillimmature,soenthusiasticresearchersmayconsiderjumpingintothiseld.ThecompatibilitywithTorisanotherimportantissue.SinceTorisadominantanonymouscommunicationapplication,manypeopleareconsideringusingToronly.WithoutabsorbingtheTorusers,anyothersolutionmaynotreplaceTorevenifitprovidesbetteranonymityorscalability. 38


Wefocusedonpassiveattacksinthisthesis,butwealsoneedpreciseanalysisagainstactiveattacks.Asdifferentsolutionsmayintroducedifferenttypesofattacks,anewvulnerabilitycanbealwaysdiscovered,andoursolutionneedstobeanalyzedandtestedmore.Finally,thetypesofidentityleakageshowninSection 4.2 couldbemorepreciselyclassied.Eachclassmayhavehiddensub-classeswhichmayhavedifferentvulnerabilities,andthisisanotherinterestingissuespeciedforoursolution. 39


REFERENCES [1] R.Dingledine,N.Mathewson,andP.Syverson,Tor:thesecond-generationonionrouter,inProceedingsofthe13thconferenceonUSENIXSecuritySymposium-Volume13,ser.SSYM'04.Berkeley,CA,USA:USENIXAssociation,2004,pp.21. [2] S.HahnandK.Loesing,Privacy-preservingwaystoestimatethenumberoftorusers,TorProject,Tech.Rep.,2010,tech.rep.,TorProject, [3] D.Goodin,Toratheartofembassypasswordsleak,TheRegister,September2007. [4] J.McLachlan,A.Tran,N.Hopper,andY.Kim,Scalableonionroutingwithtorsk,inProceedingsofthe16thACMconferenceonComputerandcommunicationssecurity,ser.CCS'09.NewYork,NY,USA:ACM,2009,pp.590. [5] M.J.FreedmanandR.Morris,Tarzan:apeer-to-peeranonymizingnetworklayer,inProceedingsofthe9thACMconferenceonComputerandcommunicationssecurity,ser.CCS'02.NewYork,NY,USA:ACM,2002,pp.193. [6] A.NambiarandM.Wright,Salsa:astructuredapproachtolarge-scaleanonymity,inProceedingsofthe13thACMconferenceonComputerandcommunicationssecurity,ser.CCS'06.NewYork,NY,USA:ACM,2006,pp.17. [7] A.Mislove,G.Oberoi,A.Post,C.Reis,P.Druschel,andD.S.Wallach,Ap3:cooperative,decentralizedanonymouscommunication,inProceedingsofthe11thworkshoponACMSIGOPSEuropeanworkshop,ser.EW11.NewYork,NY,USA:ACM,2004. [8] A.Panchenko,S.Richter,andA.Rache,Nisan:networkinformationserviceforanonymizationnetworks,inProceedingsofthe16thACMconferenceonComputerandcommunicationssecurity,ser.CCS'09.NewYork,NY,USA:ACM,2009,pp.141. [9] P.MittalandN.Borisov,Shadowwalker:peer-to-peeranonymouscommunicationusingredundantstructuredtopologies,inProceedingsofthe16thACMconferenceonComputerandcommunicationssecurity,ser.CCS'09.NewYork,NY,USA:ACM,2009,pp.161. [10] ,Informationleaksinstructuredpeer-to-peeranonymouscommunicationsystems,inProceedingsofthe15thACMconferenceonComputerandcommuni-cationssecurity,ser.CCS'08.NewYork,NY,USA:ACM,2008,pp.267. [11] Q.Wang,P.Mittal,andN.Borisov,Insearchofananonymousandsecurelookup:attacksonstructuredpeer-to-peeranonymouscommunicationsystems, 40


inProceedingsofthe17thACMconferenceonComputerandcommunicationssecurity,ser.CCS'10.NewYork,NY,USA:ACM,2010,pp.308. [12] I.Stoica,R.Morris,D.Karger,M.F.Kaashoek,andH.Balakrishnan,Chord:Ascalablepeer-to-peerlookupserviceforinternetapplications,SIGCOMMComput.Commun.Rev.,vol.31,pp.149,August2001. [13] B.N.Levine,M.K.Reiter,C.Wang,andM.K.Wright,Timingattacksinlow-latencymix-basedsystems,inProceedingsofFinancialCryptography(FC'04),A.Juels,Ed.,Springer-Verlag,LNCS3110.Springer-Verlag,LNCS3110,February2004,p.251. [14] V.ShmatikovandM.-H.Wang,Timinganalysisinlow-latencymixnetworks:attacksanddefenses,inProceedingsOFESORICS,2006,pp.18. [15] P.Syverson,G.Tsudik,M.Reed,andC.Landwehr,Towardsananalysisofonionroutingsecurity,inInternationalWorkshopOnDesigningPrivacyEnhancingTechnologies:DesignIssuesInAnonymityandUnobservability.Springer-VerlagNewYork,Inc.,2001,pp.96. [16] Y.Zhu,X.Fu,B.Graham,R.Bettati,andW.Zhao,Onowcorrelationattacksandcountermeasuresinmixnetworks,inProceedingsofPrivacyEnhancingTechnologiesworkshop,2004,pp.26. [17] G.Danezis,R.Dingledine,andN.Mathewson,Mixminion:designofatypeiiianonymousremailerprotocol,inSecurityandPrivacy,2003.Proceedings.2003Symposiumon,may2003,pp.215. [18] U.Moeller,L.Cottrell,P.Palfrader,andL.Sassaman,Mixmasterprotocolversion2,IETFInternetDraft,2005. [19] M.G.Reed,P.F.Syverson,andD.M.Goldschlag,Anonymousconnectionsandonionrouting,SelectedAreasinCommunications,IEEEJournalon,vol.16,no.4,pp.482,may1998. [20] R.DingledineandN.Mathewson,Anonymitylovescompany:Usabilityandthenetworkeffect,inProceedingsoftheFifthWorkshopontheEconomicsofInformationSecurity,ser.WEIS'06,2006. [21] Z.Zhang,S.Chen,andM.Yoon,MARCH:ADistributedIncentiveSchemeforPeer-to-peerNetworks,inProc.ofIEEEINFOCOM.IEEE,2007,pp.1091. [22] Z.Zhang,S.Chen,Y.Ling,andR.Chow,Capacity-awareMulticastAlgorithmsonHeterogeneousOverlayNetworks,IEEETransactionsonParallelandDistributedSystems,vol.17,no.2,pp.135,2006. [23] S.Chen,B.Shi,S.Chen,andY.Xia,Acom:Any-sourceCapacity-constrainedOverlayMulticastinnon-DHTP2PNetworks,IEEETransactionsonParallelandDistributedSystems,vol.18,no.9,pp.1188,2007. 41


[24] A.I.T.RowstronandP.Druschel,Pastry:Scalable,decentralizedobjectlocation,androutingforlarge-scalepeer-to-peersystems,inProceedingsoftheIFIP/ACMInternationalConferenceonDistributedSystemsPlatformsHeidelberg,ser.Middleware'01.London,UK:Springer-Verlag,2001,pp.329. [25] S.Ratnasamy,P.Francis,M.Handley,R.Karp,andS.Shenker,Ascalablecontent-addressablenetwork,SIGCOMMComput.Commun.Rev.,vol.31,pp.161,August2001. [26] B.Y.Zhao,L.Huang,J.Stribling,S.C.Rhea,A.D.Joseph,andJ.D.Kubiatowicz,Tapestry:Aresilientglobal-scaleoverlayforservicedeployment,IEEEJournalonSelectedAreasinCommunications,vol.22,pp.41,2004. [27] P.MaymounkovandD.Mazieres,Kademlia:Apeer-to-peerinformationsystembasedonthexormetric,inRevisedPapersfromtheFirstInternationalWorkshoponPeer-to-PeerSystems,ser.IPTPS'01.London,UK:Springer-Verlag,2002,pp.53. [28] Y.Tang,S.Chen,andY.Ling,StateAggregationofLargeNetworkDomains,Computercommunications,vol.30,no.4,pp.873,2007. [29] R.A.GuerinandA.Orda,QoSroutinginnetworkswithinaccurateinformation:theoryandalgorithms,IEEE/ACMTransactionsonNetworking(TON),vol.7,no.3,pp.350,1999. [30] S.ChenandK.Nahrstedt,MaxminFairRoutinginConnection-orientedNetworks,Proc.Euro-ParallelandDistributedSystemsConf,pp.163,1998. [31] K.Lui,K.Nahrstedt,andS.Chen,HierarchicalQoSRoutinginDelay-bandwidthSensitiveNetworks,inProc.of25thAnnualIEEEConferenceonLocalComputerNetworks.IEEE,2000,pp.579. [32] Z.WangandJ.Crowcroft,Quality-of-serviceroutingforsupportingmultimediaapplications,IEEEJournalonSelectedAreasinCommunications,vol.14,no.7,pp.1228,1996. [33] S.Chen,M.Song,andS.Sahni,TwoTechniquesforFastComputationofConstrainedShortestPaths,IEEE/ACMTransactionsonNetworking,vol.16,no.1,pp.105,2008. [34] S.BhatnagarandB.Nath,DistributedAdmissionControltoSupportGuaranteedServicesinCore-statelessNetworks,Proc.ofIEEEINFOCOM,2003. [35] S.ChenandY.Shavitt,SoMR:AScalableDistributedQoSMulticastRoutingProtocol,JournalofParallelandDistributedComputing,vol.68,no.2,pp.137,2008. [36] S.Chen,Y.Deng,P.Attie,andW.Sun,OptimalDeadlockDetectioninDistributedSystemsbasedonLocallyConstructedWait-forGraphs,inProc.ofthe16th 42


InternationalConferenceonDistributedComputingSystems.IEEE,1996,pp.613. [37] K.ParkandH.Lee,OntheEffectivenessofRoute-BasedPacketFilteringforDistributedDoSAttackPreventioninPower-LawInternets,Proc.ofACMSIG-COMM'2001,August2001. [38] S.Chen,Y.Tang,andW.Du,StatefulDDoSAttacksandTargetedFiltering,Journalofnetworkandcomputerapplications,vol.30,no.3,pp.823,2007. [39] Y.JianandS.Chen,CanCSMA/CANetworksBeMadeFair?inProc.ofthe14thACMinternationalconferenceonMobilecomputingandnetworking.ACM,2008,pp.235. 43


BIOGRAPHICALSKETCH YangbaeParkwasborninBusan,SouthKoreain1982.HereceivedhisBachelorofEngineeringdegreeincomputerengineeringatAjouUniversityin2004.Upongraduation,heworkedattheThirdLogisticsSupportCommandintheRepublicofKoreaArmyasamilitaryofcer,servingthreeyears.In2009,heparticipatedinthedevelopmentofhardwaretestingalgorithmandplatformatEASTLaboratory.Since2010,hehasbeenstudyingcomputerengineeringattheUniversityofFlorida,andhehasparticularlyworkedonanonymouscommunicationwithhisadvisor,Dr.ShigangChen. 44