A Linear Input-Varying Framework for Modeling and Control of Morphing Aircraft

Material Information

A Linear Input-Varying Framework for Modeling and Control of Morphing Aircraft
Place of Publication:
[Gainesville, Fla.]
University of Florida
Publication Date:
Physical Description:
1 online resource (200 p.)

Thesis/Dissertation Information

Doctorate ( Ph.D.)
Degree Grantor:
University of Florida
Degree Disciplines:
Aerospace Engineering
Mechanical and Aerospace Engineering
Committee Chair:
Lind, Richard C
Committee Members:
Barooah, Prabir
Ifju, Peter
Crisalle, Oscar D
Graduation Date:


Subjects / Keywords:
Aircraft ( jstor )
Aircraft maneuvers ( jstor )
Aircraft wings ( jstor )
Damping ( jstor )
Eigenvectors ( jstor )
Inertia ( jstor )
Polynomials ( jstor )
Sine function ( jstor )
Trajectories ( jstor )
Velocity ( jstor )
Mechanical and Aerospace Engineering -- Dissertations, Academic -- UF
bibliography ( marcgt )
theses ( marcgt )
government publication (state, provincial, terriorial, dependent) ( marcgt )
born-digital ( sobekcm )
Electronic Thesis or Dissertation
Aerospace Engineering thesis, Ph.D.


Morphing, which changes the shape and configuration of an aircraft, is being adopted to expand mission capabilities of aircraft. The introduction of biological-inspired morphing is particularly attractive in that highly-agile birds present examples of desired shapes and configurations. A previous study adopted such morphing by designing a multiple-joint wing that represented the shoulder and elbow joints of a bird. The resulting variable-gull aircraft could rotate the wing section vertically at these joints to alter the flight dynamics. This paper extends that multiple-joint concept to allow a variable-sweep wing with independent inboard and outboard sections. The aircraft is designed and analyzed to demonstrate the range of flight dynamics which result from the morphing. In particular, the vehicle is shown to have enhanced crosswind rejection which is a certainly critical metric for the urban environments in which these aircraft are anticipated to operate. Mission capability can be enabled by morphing an aircraft to optimize its aerodynamics and associated flight dynamics for each maneuver. Such optimization often consider the steady-state behavior of the configuration; however, the transient behavior must also be analyzed. In particular, the time-varying inertias have an effect on the flight dynamics that can adversely affect mission performance if not properly compensated. These inertia terms cause coupling between the longitudinal and lateral-directional dynamics even for maneuvers around trim. A simulation of a variable-sweep aircraft undergoing a symmetric morphing for an altitude change shows a noticeable lateral translation in the flight path because of the induced asymmetry. The flight dynamics of morphing aircraft must be analyzed to ensure shape-changing trajectories have the desired characteristics. The tools for describing flight dynamics of fixed-geometry aircraft are not valid for time-varying systems such as morphing aircraft. This paper introduces a method to relate the flight dynamics of morphing aircraft by interpreting a time-varying eigenvector in terms of flight modes. The time-varying eigenvector is actually defined through a decomposition of the state-transition matrix and thus describes an entire response through a morphing trajectory. A variable-sweep aircraft is analyzed to demonstrate the information that is obtained through this method and how the flight dynamics are altered by the time-varying morphing. Also, morphing vehicles have inherently time-varying dynamics due to the alteration of their configurations; consequently, the numerous techniques for analysis and control of time-invariant systems are inappropriate. Therefore, a control scheme is introduced that directly considers a concept of time-varying pole to command morphing. The resulting trajectory minimizing tracking error for either a state response or a pole response. ( en )
General Note:
In the series University of Florida Digital Collections.
General Note:
Includes vita.
Includes bibliographical references.
Source of Description:
Description based on online resource; title from PDF title page.
Source of Description:
This bibliographic record is available under the Creative Commons CC0 public domain dedication. The University of Florida Libraries, as creator of this bibliographic record, has waived all rights to it worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.
Thesis (Ph.D.)--University of Florida, 2011.
Adviser: Lind, Richard C.
Statement of Responsibility:

Record Information

Source Institution:
Rights Management:
Copyright GRANT,DANIEL THURMOND. Permission granted to the University of Florida to digitize, archive and distribute this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Resource Identifier:
755927399 ( OCLC )
LD1780 2011 ( lcc )


This item has the following downloads:

Full Text




c2011DanielT.Grant 2


\IcandoallthingsthroughChristwhichstrengthensme" Philippians4:13 Dedicatedwithlovetomywifeandfamily 3


ACKNOWLEDGMENTS IwouldrstliketoacknowledgetheUniversityofFloridaandUnitedStatesAirForceforsupportingmyambitionandgivingmetheopportunitytoconductsuchresearch.ThanksshouldbegiventoDr.WarrenDixon,Dr.PrabirBarooah,Dr.PeterIfjuandDr.OscarCrisalleforprovidingdirectionandservingasmycommitteemembers.IwouldalsoliketothankmyseniorlabfellowsDr.MujahidAbdulrahim,Dr.AdamWatkins,Dr.RyanCausey,Dr.JosephKehoeandDr.SeanRegisfordfortheirpatienceandguidancewhilementoringme.MuchthanksisgiventomycolleaguesSankethBhat,BrianRoberts,RobertLove,BaronJohnson,RyanHurley,AbePachikara,DongTranandStevenSorelyfortheirsupport,inspiration,andperseverance.IwouldliketoextendmysincerestthanksandgratitudetoDr.RickLindforhiseortsinsupportingmyeducation,guidanceinacademia,andprovidingmewithaninvaluableopportunitytoachievesuccess.Withoutthecontinuoussupportandunconditionalloveofmyfamilyandfriends,noneofthisworkwouldhavebeenpossible.Lastandmostimportant,IwouldliketothankmylovingwifeforbeingtheshininglightbehindallthatIdo. 4


TABLEOFCONTENTS page ACKNOWLEDGMENTS ................................. 4 LISTOFTABLES ..................................... 9 LISTOFFIGURES .................................... 11 ABSTRACT ........................................ 17 CHAPTER 1INTRODUCTION .................................. 19 1.1Motivation .................................... 19 1.2ProblemDescription .............................. 20 1.3ProblemStatement ............................... 23 1.3.1Contributions .............................. 24 1.3.2Papers .................................. 25 1.4DissertationOverview ............................. 28 2EQUATIONSOFMOTION ............................. 29 2.1AircraftAxisSystem .............................. 29 2.1.1BodyAxisSystem ............................ 29 2.1.2StabilityAxisSystem .......................... 29 2.1.3EarthAxisSystem ........................... 30 2.2CoordinateTransformations .......................... 31 2.2.1EarthtoBodyFrame .......................... 31 2.2.2StabilitytoBodyFrame ........................ 33 2.3NonlinearEquationsofMotion ........................ 34 2.3.1DynamicEquations ........................... 34 ........................ 34 ...................... 39 2.3.2KinematicEquations .......................... 43 .................... 43 ...................... 44 2.3.3TheEquationsCollected ........................ 45 2.4LinearizedEquationsofMotion ........................ 46 2.5Examples .................................... 49 2.5.1Linearization ............................... 50 2.5.2AsymmetricMorphing ......................... 53 2.5.3SymmetricConguration ........................ 54 2.6ATechnicalApproachtotheEquationsofMotion .............. 55 5


3LINEARTIME-VARYINGEIGENSTRUCTURESANDTHEIRSTABILITY:ASURVEY ...................................... 57 3.1DenitionofanLTVSystem .......................... 57 3.2Kamen'sConceptofPolesofanLTVSystem ................. 57 3.2.1TwoStateSystem ............................ 57 3.2.2FourStateSystem ............................ 58 3.3ZhuandJohnson ................................ 60 3.3.1GeneralizedPD-Eigenvectors ...................... 62 3.3.2StabilityCriteria ............................ 63 3.4Wu ........................................ 64 3.4.1Formulation ............................... 64 3.4.2StabilityCriteria ............................ 66 3.5O'BrienandIglesias .............................. 67 3.5.1Formulation ............................... 67 3.5.2StabilityCriteria ............................ 69 3.5.3SpecialCases .............................. 71 3.6MethodologyComparisons ........................... 71 4LINEARTIME-VARYINGMODALANALYSIS ................. 74 4.1SystemDynamics ................................ 74 4.1.1LinearTime-InvariantSystems:Formulation ............. 74 4.1.2LinearTime-InvariantSystems:Response ............... 75 4.1.3LinearTime-VaryingSystems:Formulation .............. 76 4.1.4LinearTime-VaryingSystems:Response ............... 77 4.2ModalInterpretation:Kamen ......................... 78 4.2.1Damping ................................. 79 4.2.2Frequency ................................ 80 4.3ModalInterpretation:O'Brien ......................... 81 4.3.1DampingandNaturalFrequency .................... 81 4.3.2ModeShapes .............................. 82 4.4Example:SimpleMechanicalSystem ..................... 83 5CONTROLDESIGN ................................. 94 5.1InherentClosed-LoopNonlinearity ...................... 94 5.2Quasi-StaticApproach ............................. 95 5.2.1Synthesis ................................. 95 5.2.2Example:Gull-WingedAircraft .................... 96 5.3StabilizingControl:DisturbanceRejection .................. 97 5.3.1Synthesis ................................. 97 5.3.2Example:Chord-VaryingMorphing .................. 100 5.4FeedForwardOptimalControl ......................... 102 5.4.1State-ResponseTracking ........................ 102 5.4.2Pole-ResponseTracking ......................... 103 6


5.4.3Example:Mass-SpringSystem .................... 104 ............................. 104 ........................ 104 .... 106 107 ..... 108 110 5.5H1FeedbackControl:WithoutInertialEects ............... 112 5.6FutureWorkandChallenges .......................... 117 6EXAMPLEOFVARIABLESWEEPAIRCRAFT ................. 120 6.1Design ...................................... 120 6.1.1BiologicalInspiration .......................... 120 6.1.2MechanicalDesign ............................ 121 6.1.3TechnicalSpecications ......................... 123 6.2Modeling ..................................... 125 6.2.1ComputationalTools .......................... 125 6.2.2SweepDetermination .......................... 127 6.3AerodynamicProperties ............................ 128 6.3.1SymmetricCongurations:Aerodynamics ............... 128 6.3.2SymmetricCongurations:FlightDynamics ............. 130 6.3.3AsymmetricCongurations ....................... 133 ........................ 135 .................... 136 ...................... 138 6.4DynamicProperties ............................... 140 6.4.1MissionScenario ............................. 140 ........................ 141 ........................ 141 6.4.2MassDistribution ............................ 142 6.4.3ManeuverAssumptions ......................... 143 6.4.4DiveManuever ............................. 144 ........................... 144 ...................... 145 .................... 146 ........................... 147 ...................... 149 ................ 150 6.4.5CoordinatedTurnManeuver ...................... 152 ........................... 152 ........................ 153 .................... 154 ........................... 155 ...................... 159 7

PAGE 8 ................ 160 6.5Time-VaryingModalAnalysis ......................... 161 6.5.1Kamen'sMethod ............................ 161 ...................... 161 ..................... 163 ...................... 163 ..................... 167 6.5.2O'Brien'sMethod ............................ 169 ...................... 169 ........... 172 6.6FeedforwardControl .............................. 178 6.6.1MorphingBasis ............................. 178 6.6.2TrackingASystemResponse ...................... 182 ..................... 182 ............... 183 6.6.3TrackingaPoleResponse ........................ 184 ..................... 184 ............... 186 7CONCLUSION .................................... 188 REFERENCES ....................................... 190 BIOGRAPHICALSKETCH ................................ 200 8


LISTOFTABLES Table page 1-1Publicationsresultingfromresearch ......................... 27 4-1Mass-spring-dampersystemparameters ....................... 84 5-1Gainsforchord-varyingaircraftdisturbancerejectioncontroller ......... 100 5-2Boundsoncoecientofmorphingbasis ...................... 106 5-3Optimalpolynomialmorphingtotrackdesiredpolynomialmorphing ...... 106 5-4Optimalpolynomialmorphingtotrackdesiredsinusoidalmorphing ....... 106 5-5Optimalpiecewise-polynomialmorphingtotrackdesiredsinusoidalmorphing .. 108 5-6Optimalpolynomialmorphingtotrackdesiredpolynomialmorphing ...... 109 5-7Optimalpolynomialmorphingtotrackdesiredsinusoidalmorphing ....... 109 5-8Optimalpolynomialmorphingtotrackdesiredsinusoidalmorphing ....... 111 6-1Empennagespecications .............................. 124 6-2Referenceparametersforsymmetricsweep ..................... 125 6-3Setofeigenvalues ................................... 137 6-4Timeconstantsofnon-oscillatorymodes ...................... 137 6-5Modeshapesofnon-oscillatorymodes ....................... 138 6-6Modalpropertiesofoscillatorymodes ........................ 138 6-7Modeshapesofoscillatorymodes .......................... 139 6-8Individualpointmasses ............................... 143 6-9Characteristicsofelementsgivenascentroidposition(in)andmomentsofinertia(gin2) ........................................ 143 6-10Boundsoncoecientofmorphingbasis ...................... 181 6-11Optimalpolynomialmorphingtotrackdesiredpolynomialmorphing ...... 182 6-12Optimalpolynomialmorphingtotrackdesiredsinusoidalmorphing ....... 182 6-13Optimalpiecewise-polynomialmorphingtotrackdesiredsinusoidalmorphing .. 184 6-14Optimalpolynomialmorphingtotrackdesiredpolynomialmorphing ...... 185 6-15Optimalpolynomialmorphingtotrackdesiredsinusoidalmorphing ....... 185 9


6-16Optimalpiecewise-polynomialmorphingtotrackdesiredsinusoidalmorphing .. 187 10


LISTOFFIGURES Figure page 1-1Surveillancemissionthroughanurbanenvironment ................ 19 1-2Vision-basedpathplanning ............................. 20 1-3Readinessformissioncapability ........................... 21 1-4MorphingMAVs:A)CapableofhorizontalmorphingB)Capableofverticalmorphing ....................................... 21 2-1Body-FixedCoordinateFrame ............................ 29 2-2StabilityCoordinateFrame ............................. 30 2-3Earth-FixedCoordinateFrame ........................... 30 2-4Rotationthrough .................................. 31 2-5Rotationthrough .................................. 32 2-6Rotationthrough .................................. 33 2-7AsymmetricCongurations ............................. 53 2-8SymmetricCongurations .............................. 54 4-1Mass-Spring-DamperSystem ............................ 84 4-2Time-VaryingResponses:A)Non-Inertal:State1(|),State2()-356()-356()]TJ /F1 11.955 Tf 36.42 0 Td[()B)Inertial:State1(|),State2()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[() ....................... 86 4-3Time-VaryingModes:A)Non-Inertal:Mode1(|),Mode2(\000)]TJ /F1 11.955 Tf 27.9 0 Td[()B)Inertial:Mode1(|),Mode2()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[() ........................... 87 4-4Time-VaryingPoles:A)Non-Inertal:Pole1(\000)]TJ /F1 11.955 Tf 27.9 0 Td[(),Pole2(\001)]TJ /F1 11.955 Tf 21.92 0 Td[(),RealportionofdiscreteLTIpoles(|),Poleaverage()B)Inertial:Pole1()-267()-267()]TJ /F1 11.955 Tf 34.29 0 Td[(),Pole2()-222()]TJ /F1 11.955 Tf 27.23 0 Td[(),RealportionofdiscreteLTIpoles(|),Poleaverage() ....... 88 4-5Non-InertialTime-VaryingEigenvectors:A)Eigenvector1:(1,1)(|),(2,1)(\000)]TJ /F1 11.955 Tf 9.3 0 Td[()B)Eigenvector2:(1,1)(|),(2,1)()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() .................. 89 4-6InertialTime-VaryingEigenvectors:A)Eigenvector1:(1,1)(|),(2,1)()-119()-118()]TJ /F1 11.955 Tf 30.74 0 Td[()B)Eigenvector2:(1,1)(|),(2,1)()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() .................... 90 4-7Non-InertialQcolumnvectorvalues:A)Q11(|),Q21()-278()-278()]TJ /F1 11.955 Tf 34.55 0 Td[()B)Q12(|),Q22()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() ..................................... 90 4-8Qcolumnperiodicity:Q11(|),Q21()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[() ................... 91 11


4-9Qcolumnfrequency:ImaginarypartofdiscreteLTIpole(|),1Qcolumnperiodicity(\000)]TJ /F1 11.955 Tf 9.3 0 Td[() ........................................... 91 4-10InertialQcolumnvectorvalues:A)Q11(|),Q21(\000)]TJ /F1 11.955 Tf 27.9 0 Td[()B)Q12(|),Q22(\000)]TJ /F1 11.955 Tf 9.3 0 Td[() ........................................... 92 4-11Qcolumnperiodicity:Q11(|),Q21()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[() ................... 93 4-12Qcolumnfrequency:ImaginarypartofdiscreteLTIpole(|),LTVapproximatedfrequency()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() .................................. 93 5-1Model-FollowingSystem ............................... 97 5-2SimulationsoftheGull-MorphingAircraftModel ................. 97 5-3Chord-VaryingMAVModel(m) ........................... 100 5-4AngleofAttackResponseandAssociatedChordofAircraft ........... 101 5-5ResponsestoChord-VaryingMorphing ....................... 102 5-6ArchitectureforState-ResponseTracking ...................... 103 5-7ArchitectureforPole-ResponseTracking ...................... 104 5-8Mass-Spring-DamperSystem ............................ 104 5-9DesiredResponse(|)andOptimalResponse(\000)]TJ /F1 11.955 Tf 27.89 0 Td[()forA)First-OrderMorphingandB)Second-OrderMorphingandC)Third-OrderMorphing .......... 107 5-10DesiredResponse(|)andOptimalResponse()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()forSinusoidalMorphing 108 5-11DesiredResponse(|)andOptimalResponse()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()forSinusoidalMorphing 109 5-12DesiredResponse(|)andOptimalResponse(\000)]TJ /F1 11.955 Tf 27.89 0 Td[()forA)First-OrderMorphingandB)Second-OrderMorphingandC)Third-OrderMorphing .......... 110 5-13DesiredResponse(|)andOptimalResponse()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()forSinusoidalMorphing 111 5-14DesiredResponse(|)andOptimalResponse()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()forSinusoidalMorphing 111 6-1PicturesofSeagulls .................................. 120 6-2JointsonWing .................................... 121 6-3FloatingElbowJoint ................................. 122 6-4Feather-LikeElements ................................ 122 6-5Trackandrunnersystem ............................... 123 6-6Underwingsparstructure .............................. 124 12


6-7Modelingoftheliftvectors ............................. 125 6-8Modelingofthetrailinglegvectors ......................... 126 6-9SweepCongurations ................................. 127 6-10SweepAngles ..................................... 128 6-11VariationofLiftwithAngleofAttackforSymmetricSweep ........... 129 6-12VariationofPitchMomentwithAngleofAttackforSymmetricSweep ..... 129 6-13VariationofRollMomentwithRollRateforSymmetricSweep .......... 130 6-14VariationofYawMomentwithAngleofSideslipforSymmetricSweep ..... 130 6-15Modeltostate-spaceowchart ........................... 131 6-16NumberofUnstablePolesofLongitudinalDynamicsforSymmetricSweep ... 131 6-17NumberofUnstablePolesofLateral-DirectionalDynamicsforSymmetricSweep 132 6-18NumberofOscillatoryPolesforLongitudinalDynamicswithSymmetricSweep 132 6-19NumberofOscillatoryPolesforLateral-DirectionalDynamicswithSymmetricSweep ......................................... 133 6-20VariationofLiftwithAngleofAttackforAsymmetricSweep ........... 134 6-21VariationofPitchMomentwithAngleofAttackforAsymmetricSweep ..... 134 6-22VariationofRollMomentwithRollRateforAsymmetricSweep ......... 134 6-23VariationofYawMomentwithAngleofSideslipforAsymmetricSweep ..... 135 6-24VariationofCoupledAerodynamicsforAsymmetricSweep ............ 135 6-25NumberofUnstablePolesforDynamicswithAsymmetricSweep ........ 136 6-26NumberofOscillatoryPolesforDynamicswithAsymmetricSweep ....... 136 6-27EectiveAnglesofSideslip .............................. 139 6-28MaximumAngleofSideslipatwhichAircraftcanTrim .............. 140 6-29PointMassLocations ................................. 143 6-30ChangeinVelocityBasedonSymmetricMorphing:0deg( {2{ ),5deg( {/{ ),10deg( {{ ),15deg( {{ ),20deg( {.{ ),25deg( {{ ),30deg( {4{ ) ...... 144 6-31Closed-LoopBlockDiagram ............................. 146 6-32PlantModelwithTrimLogic ............................ 147 13


6-33MorphingCongurationforFastMorphing( | ),SlowMorphing( )-222()-222()]TJ ET 0 0 1 RG 0 0 1 rg BT /F1 11.955 Tf 398.84 -11.96 Td[() .... 148 6-34AltitudeinResponsetoFastMorphing( | ),SlowMorphing( ::: ),FixedSwept( \000)]TJ ET 0 0 1 RG 0 0 1 rg BT /F1 11.955 Tf 36.22 -50.31 Td[(),FixedStraight( )-221(\001 ) .............................. 149 6-35PitchAngle(left)andPitchRate(right)inResponsetoFastMorphing( | ),SlowMorphing( ::: ),FixedSwept( )-221()-223()]TJ ET 0 0 1 RG 0 0 1 rg BT /F1 11.955 Tf 239.46 -88.66 Td[(),FixedStraight( )-222(\001 ) ........ 149 6-36AltitudeinResponsetoFastMorphing( | ),SlowMorphing( ::: ),FixedSwept( \000)]TJ ET 0 0 1 RG 0 0 1 rg BT /F1 11.955 Tf 36.22 -127.02 Td[(),FixedStraight( )-221(\001 ) .............................. 150 6-37AltitudeinResponsetoFastMorphing( | ),SlowMorphing( ::: ),FixedSwept( \000)]TJ ET 0 0 1 RG 0 0 1 rg BT /F1 11.955 Tf 36.22 -165.37 Td[(),FixedStraight( )-221(\001 ) .............................. 151 6-38AltitudeinResponsetoFastMorphing( | ),SlowMorphing( ::: ),FastMorphingWithoutInertia( )-222(\001 ),SlowMorphingWithoutInertia( )-222()-222()]TJ ET 0 0 1 RG 0 0 1 rg BT /F1 11.955 Tf 363.15 -203.72 Td[() ........ 152 6-39ChangeinVelocityBasedonAsymmetricMorphing:0deg( {2{ ),5deg( {/{ ),10deg( {{ ),15deg( {{ ),20deg( {.{ ),25deg( {{ ),30deg( {4{ ) ...... 153 6-40Open-LoopBlockDiagram .............................. 154 6-41PlantModelwithTrimLogic ............................ 155 6-42MorphingCongurationforFastMorphing( | ),SlowMorphing( )-222()-222()]TJ ET 0 0 1 RG 0 0 1 rg BT /F1 11.955 Tf 398.84 -313.8 Td[() .... 156 6-43TurninResponsetoFastMorphing( | ),SlowMorphing( ::: ),FixedSwept( \000)]TJ ET 0 0 1 RG 0 0 1 rg BT /F1 11.955 Tf 36.22 -352.15 Td[(),FixedStraight( )-169(\001 ):A)ThecompleteturnproleB)Theturnproleat270degreesC)Theturnproleat180degrees ................... 157 6-44RollAngle(left)andRollRate(right)inResponsetoFastMorphing(|),SlowMorphing()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() .................................. 157 6-45YawAngle(left)andYawRate(right)inResponsetoFastMorphing(|),SlowMorphing()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() .................................. 158 6-46PitchAngle(left)andPitchRate(right)inResponsetoFastMorphing(|),SlowMorphing()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() ............................... 158 6-47TurninResponsetoFastMorphing(|),SlowMorphing(:::),FixedSwept(\000)]TJ /F1 11.955 Tf 9.3 0 Td[(),FixedStraight()-221(\001) .............................. 159 6-48TurninResponsetoFastMorphing(|),SlowMorphing(:::),FastMorphingWithoutInertia()-222(\001),SlowMorphingWithoutInertia()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() ........ 160 6-49LongitudinalStatesduringMorphingfrom+30degto0degover1sec:ForwardVelocity(upperleft),VerticalVelocity(upperright),PitchRate(lowerleft),PitchAngle(lowerright) ............................... 164 14


6-50LinearTime-VaryingPoles(|)andLinearTime-InvariantPoles()-20()-21()]TJ /F1 11.955 Tf 28.39 0 Td[()duringMorphingfrom+30degto0degover1sec:RealPart(upperleft)andImaginaryPart(lowerleft)ofp41andp42,RealPart(upperright)andImaginaryPart(lowerright)ofp43andp44 ................................. 165 6-51ModesAssociatedwithTime-VaryingPolesduringMorphingfrom+30degto0degover1sec:RealPart(upperleft)andImaginaryPart(lowerleft)of41and42,RealPart(upperright)andImaginaryPart(lowerright)of43and44 166 6-52NormalizedEigenvectorsAssociatedwithTime-VaryingModesduringMorphingfrom+30degto0degover1sec:Magnitude(upperleft)andPhase(lowerleft)ofv1andMagnitude(upperright)andPhase(lowerright)ofv2 ......... 167 6-53NaturalFrequencyAssociatedwithLinearTime-VaryingPoles(|)andLinearTime-InvariantPoles()-94()-95()]TJ /F1 11.955 Tf 30.16 0 Td[()duringMorphingfrom+30degto0degover1sec:Poles1and2(left)andPoles3and4(right) ................... 168 6-54EnvelopeAssociatedwithLinearTime-VaryingPoles(|)andLinearTime-InvariantPoles()-257()-257()]TJ /F1 11.955 Tf 34.04 0 Td[()duringMorphingfrom+30degto0degover1sec:Poles1and2(left)andPoles3and4(right) .......................... 169 6-55DampingRatioAssociatedwithLinearTime-VaryingPoles(|)andLinearTime-InvariantPoles()-257()-257()]TJ /F1 11.955 Tf 34.04 0 Td[()duringMorphingfrom+30degto0degover1sec:Poles1and2(left)andPoles3and4(right) .......................... 169 6-56Stabilitymodechangevstimechange:10degrees(|),20degrees()-258()-259()]TJ /F1 11.955 Tf 34.08 0 Td[(),30degrees(---)A)2secondsB)5secondsC)10secondsD)20seconds ..... 173 6-57Stabilitymodechangevsdegreechange:20seconds(|),10seconds()-216()-216()]TJ /F1 11.955 Tf 33.06 0 Td[(),5seconds(---),2seconds()A)10degreesB)20degreesC)30degrees .... 174 6-58Polechangevstimechange:10degrees(|),20degrees()-327()-328()]TJ /F1 11.955 Tf 35.73 0 Td[(),30degrees(---)A)2secondsB)5secondsC)10secondsD)20seconds .......... 175 6-59Polechangevsdegreechange:20seconds(|),10seconds()-281()-283()]TJ /F1 11.955 Tf 34.64 0 Td[(),5seconds(---),2seconds()A)10degreesB)20degreesC)30degrees ......... 176 6-60Longitudinalaircraft30degree,10secondmorphA)polesets:polesets1and2()-271()-271()]TJ /F1 11.955 Tf 34.38 0 Td[(),polesets3and4(---),time-invariantfrozentimeeigenvalues(|)B)stabilitymodes:mode1(|)mode2()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()mode3(---)mode4() .. 177 6-61LongitudinalaircraftQcolumnvectors1and2for30degree,10secondmorph:A)Q11(|)Q21()-252()-252()]TJ /F1 11.955 Tf 33.93 0 Td[()Q31(---)Q41()B)Q12(|)Q22()-252()-252()]TJ /F1 11.955 Tf 33.93 0 Td[()Q32(---)Q42() .................................... 178 6-62LongitudinalaircraftQcolumnvectors3and4for30degree,10secondmorph:A,B)Q13(|)Q23()-256()-256()]TJ /F1 11.955 Tf 34.03 0 Td[()Q33(---)Q43()C,D)Q14(|)Q24()-256()-256()]TJ /F1 11.955 Tf 34.02 0 Td[()Q34(---)Q44() ................................. 179 15


6-63LongitudinalaircraftstateresponsesA)state1(u)B)state2(w)C)state3(q)D)state4() ................................... 180 6-64Longitudinalaircraftcolumneigenvectorsfor30degree,10secondmorph:A)V11(|)V21()-100()-101()]TJ /F1 11.955 Tf 30.3 0 Td[()V31(---)V41()B)V12(|)V22()-100()-101()]TJ /F1 11.955 Tf 30.3 0 Td[()V32(---)V42()C)V13(|)V23()-98()-98()]TJ /F1 11.955 Tf 30.24 0 Td[()V33(---)V43()D)V14(|)V24()-98()]TJ -391.46 -14.45 Td[()]TJ /F1 11.955 Tf 9.3 0 Td[()V34(---)V44() ............................... 181 6-65DesiredResponse(|)andOptimalResponse(\000)]TJ /F1 11.955 Tf 27.89 0 Td[()forA)First-OrderMorphingandB)Second-OrderMorphingandC)Third-OrderMorphing .......... 183 6-66DesiredResponse(|)andOptimalResponse()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()forSinusoidalMorphing 184 6-67DesiredResponse(|)andOptimalResponse()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()forSinusoidalMorphing 185 6-68A)ResponsetoMorphingTrajectory:Desired(|),Optimized()-281()-282()]TJ /F1 11.955 Tf 34.63 0 Td[()B)ResponsetoMorphingTrajectory:Desired(|),Optimized(\000)]TJ /F1 11.955 Tf 27.89 0 Td[()C)ResponsetoMorphingTrajectory:Desired(|),Optimized()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() ............ 186 6-69ResponsetoMorphingTrajectory:Desired(|)andOptimized()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[() .... 187 6-70ResponsetoMorphingTrajectory:Desired(|)andOptimized()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[() .... 187 16


AbstractofDissertationPresentedtotheGraduateSchooloftheUniversityofFloridainPartialFulllmentoftheRequirementsfortheDegreeofDoctorofPhilosophyALINEARINPUT-VARYINGFRAMEWORKFORMODELINGANDCONTROLOFMORPHINGAIRCRAFTByDanielT.GrantMay2011Chair:RickLindMajor:AerospaceEngineering Morphing,whichchangestheshapeandcongurationofanaircraft,isbeingadoptedtoexpandmissioncapabilitiesofaircraft.Theintroductionofbiological-inspiredmorphingisparticularlyattractiveinthathighly-agilebirdspresentexamplesofdesiredshapesandcongurations.Apreviousstudyadoptedsuchmorphingbydesigningamultiple-jointwingthatrepresentedtheshoulderandelbowjointsofabird.Theresultingvariable-gullaircraftcouldrotatethewingsectionverticallyatthesejointstoaltertheightdynamics.Thispaperextendsthatmultiple-jointconcepttoallowavariable-sweepwingwithindependentinboardandoutboardsections.Theaircraftisdesignedandanalyzedtodemonstratetherangeofightdynamicswhichresultfromthemorphing.Inparticular,thevehicleisshowntohaveenhancedcrosswindrejectionwhichisacertainlycriticalmetricfortheurbanenvironmentsinwhichtheseaircraftareanticipatedtooperate. Missioncapabilitycanbeenabledbymorphinganaircrafttooptimizeitsaerodynamicsandassociatedightdynamicsforeachmaneuver.Suchoptimizationoftenconsiderthesteady-statebehavioroftheconguration;however,thetransientbehaviormustalsobeanalyzed.Inparticular,thetime-varyinginertiashaveaneectontheightdynamicsthatcanadverselyaectmissionperformanceifnotproperlycompensated.Theseinertiatermscausecouplingbetweenthelongitudinalandlateral-directionaldynamicsevenformaneuversaroundtrim.Asimulationofavariable-sweepaircraftundergoingasymmetric 17


morphingforanaltitudechangeshowsanoticeablelateraltranslationintheightpathbecauseoftheinducedasymmetry. Theightdynamicsofmorphingaircraftmustbeanalyzedtoensureshape-changingtrajectorieshavethedesiredcharacteristics.Thetoolsfordescribingightdynamicsofxed-geometryaircraftarenotvalidfortime-varyingsystemssuchasmorphingaircraft.Thispaperintroducesamethodtorelatetheightdynamicsofmorphingaircraftbyinterpretingatime-varyingeigenvectorintermsofightmodes.Thetime-varyingeigenvectorisactuallydenedthroughadecompositionofthestate-transitionmatrixandthusdescribesanentireresponsethroughamorphingtrajectory.Avariable-sweepaircraftisanalyzedtodemonstratetheinformationthatisobtainedthroughthismethodandhowtheightdynamicsarealteredbythetime-varyingmorphing. Also,morphingvehicleshaveinherentlytime-varyingdynamicsduetothealterationoftheircongurations;consequently,thenumeroustechniquesforanalysisandcontroloftime-invariantsystemsareinappropriate.Therefore,acontrolschemeisintroducedthatdirectlyconsidersaconceptoftime-varyingpoletocommandmorphing.Theresultingtrajectoryminimizingtrackingerrorforeitherastateresponseorapoleresponse. 18


CHAPTER1INTRODUCTION 1.1Motivation Miniatureairvehiclesareresourceswhosecharacteristics,suchassizeandspeed,enablearangeofmissionproles.Thesevehiclesareideallysuitedtooperatewithinurbanenvironmentsataltitudesthatareinaccessibletolargeraircraftduetodenseobstacles.Tasksincludingsurveillanceandtrackingwillbegreatlyfacilitatedbyvehiclesthatcanyattreetoplevelandintobuildings.Anillustrationofapossiblesurveillancemission,astraversedthroughanurbanenvironment,maybeseeninFig. 1-1 Figure1-1. Surveillancemissionthroughanurbanenvironment Agilityisincreasinglyrequiredforthesevehiclesasthemissiontasksconsidertheightconditionsassociatedwithurbanenvironments.Theclosespacingofobstacleswillrequireavehiclethatcanturnsharplyinasmallradiusbutyetloiterandcruise.Thewindsaroundtheseobstaclessignicantlyvaryindirectionwhichwillrequirethevehicletoincurlargeanglesofsidesliptomaintainsensorpointing.Thedurationforwhichthesensorismaintainedonthetargetiscrucialtocompletingmissionobjectivessuchaslaser-basedswathmapping[ 108 ]andvision-basedpathplanning[ 64 ],asshowninFig 1-2 19


Figure1-2. Vision-basedpathplanning Suchdisparaterequirementsplaceconstraintsonthedesignwithinwhichasinglevehiclecannotlie.Therefore,morphingisbeingincorporatedtoenablemulti-rolecapabilitiesofasinglevehicle.Essentially,thevehiclechangesshapebyalteringparameters,suchasspanorcamber,duringight.Theresultingrangeofcongurationswillhaveanassociatedrangeofightdynamicsand,consequently,maneuvering. 1.2ProblemDescription BattleeldenvironmentshavepreviouslyservedasaperformancestageformanyprovencommercialgradeUAVs.TheseUAVsaretypicallylargerinsize,anddesignedprimarilyforsurveillancefromhigheraltitudes,relativetoitssmallercounterpart,theMAVorMiniatureAerialVehicle.ThelargerUAVsmaylacktheadvantageofsizeandmaneuverabilityovertheMAV,butsignicantlymake-upforthefactwiththeirtechnologicalreadinessformissioncapability,asshowninFig. 1-3 Modernavionics,andtheirrespectivesub-systems,haverecentlymadelargeadvancesinthereductionoftheiroverallweightandsize.Asaresult,MAVsarebeginningtobeoutttedwithmoresophisticatedsensorpackagesandcontrolsystems.Itshouldbenotedhowever,thatevenwiththeseadvances,thelargerUAVisstillsuperiortotheMAVintermsofbeingmissioncapable.Duetothefactofthistechnologicalgap,ithasbeensuggestedthataviancharacteristics,andtheireectivebenets,bestudied. 20


Figure1-3. Readinessformissioncapability TwoMAVsutilizingtheconceptofwingmorphing,orshapechanging,(acommoncharacteristicofavianight)canbeshowninFig. 1-4 A B Figure1-4. MorphingMAVs:A)CapableofhorizontalmorphingB)Capableofverticalmorphing TheightdynamicsoftheaircraftshowninFig. 1-4 aresomewhatuniqueanddierentfromthosedenedforsymmetricxed-wingight.Withtheintroductionofmorphing,afewpreviouslymadeassumptionsmustnowbereconsidered.Itshouldbenotedthatmorphingchangesthesystemfromtime-invarianttotime-varying,andasaresult,introducesnewinertialtermsintothedynamics. 21


Themomentsofinertiaofabodyobviouslyhaveaprofoundinuenceonthedynamicsandassociatedmotionofthatbody.Certainlyaerospacesystems,withmultipledegreesoffreedomfortranslationandrotation,mustproperlyaccountforinertiatoahighlevelofaccuracyinordertomodelthedynamics.Thetime-varyingaspectoftheseinertiasmustbeconsideredwithsimilaraccuracytonoteitsinuenceonthesystem. Someextensiveandrigorousevaluationsoftraditionalcausesoftime-varyinginertia,suchasfuelexpenditureandmulti-bodyrotation,havebeenperformedforspacesystems.Theeectsoftranslatingmasswithinaspacestationarederivedunderanassumptionofharmonicmotionandusedtocomputelibrationalstability[ 114 ].Movingmasswasalsoincludedinthedynamicsofavehiclewithasolarsailthatcouldmoveforcontrolpurposes[ 124 ].Thedynamicsandassociatedtime-varyinginertiawasmodeledforatwo-vehicleformationinwhichaCoulombtethercontrolledtherelativedistanceandmassdistribution[ 82 ].Anotherstudyoptimizedadesignforatwo-vehicleformationwithaexibleappendagewhosemotionalteredtheinertiaproperties[ 89 ].Theinuenceofthrusters,whichexpendmassthroughactivationandthusvarytheinertia,wasinvestigatedusingaformulationoffeedbackandfeedforwardtocanceltheeects[ 118 ].Thetime-varyinginertiaduetothrusterswascoupledwitheectsofuidsloshinginanotherexaminationofspacecraftdynamics[ 51 ]. Thesetraditionalcauseshavealsobeenexaminedwithrespecttotheireectsonaircraftalthoughnotnecessarilytothesamedegreeasspacecraft.Fuelburnisoftenneglectedsinceitstimeconstantisslowerthantheightdynamicsofmanyaircraft;however,thateectsontime-varyinginertiawereshownforthecaseofaerialrefuelinginwhichmasswasrapidlytransferredfromthetankertotherecipient[ 120 ].Onasmallerscale,thedynamicsofaapping-wingmicroairvehiclewerestudiedbynotingtheeectofwingmotion[ 121 ]. Theintroductionofmorphing,orshape-changingactuation,toanaircraftwillaltertheshapeandmassdistributionofthevehicle,andasaresult,producetime-varying 22


inertias.Manystudiesintomorphingaircrafthavefocusedonthesteady-statebenetsofalteringacongurationforissuessuchasfuelconsumption[ 14 ],rangeandendurance[ 43 ],costandlogistics[ 15 ],actuatorenergy[ 93 ],maneuverability[ 99 ]andairfoilrequirements[ 103 ].Additionally,aeroelasticeectshavebeenoftenstudiedrelativetomaximumrollrate[ 66 44 9 ]andactuatorloads[ 77 ]. Morphinghasalsobeenintroducedtomicroairvehiclesforthepurposeofmanueveringcontrol[ 1 2 ].Specically,anaircraftisdesignedthatusesindependentwing-sweep,asshowninFig. 1-4 ,ofinboardandoutboardsectionsonboththerightandleftwings[ 46 ].Thataircraftisshowntousethemorphingforalteringtheaerodynamicsandachieveperformancemetricsrelatedtosensorpointing.Thewingsareabletosweepontheorderofasecond;consequently,thetemporalnatureofthemorphingmustbeconsidered. 1.3ProblemStatement Performanceofamorphingaircraftiscriticaltothesuccessofanymission;therefore,methodstoachievethisperformancemustbeconsidered.Designinganeectivecontrolschemeformorphingaircraftisanon-trivialtask,butcanbemademoreapparentbyrstunderstandingthesystemdynamics.Thedynamicperformanceoflinearsystemshaveclassicallybeenstudiedusingtime-invariantmethodssuchaseigenvalueandeigenvectoranalysis[ 97 ].Thisanalysishelpsdeterminesystemstabilityaswellasdynamicightmodes. Morphingcanbemodeledasatime-invariantsystemwithdiscretechanges[ 46 ],butisconsideredmoreaccuratewhenmodeledasatime-varyingsystem.Itiswellknown[ 127 ]thattime-invarianteigenvaluesprovidenoinformationabouttime-varyingstability.Asaresult,conceptsanalogoustotime-invarianteigenvaluesandeigenvectorshavebeendevelopedfortime-varyingsystems[ 59 86 126 130 131 127 ].Theparticularmethodologyforwhichtheseconceptsarederived,varybaseduponthesystemrepresentation.Oneapproachaddressesthenotionofpolesetsderivedfromadierentialequationwithtime-varyingcoecients[ 59 131 ].Anotherapproachaddressesthenotionofpolesets 23


derivedbytransformingthestateequationintoanupper-triangularstateequation,viaastabilitypreservingvariablechange[ 86 ]. Thechallengeariseswhenconsideringmorphingasaplausiblecontrolscheme.Typically,anaircraftiscontrolledaboutitsaxesbycommandingadeection,fromrelativetrim,inoneofitsclassicallydenedcontrolsurfaces.Itisseenhowever,thatnocontrolsurfacesarepresentinavianight,yetmaneuveringisstilldoneeciently.Thisobservationcomesasadirectresultofwingmorphing,andthus,servesasaeldofinterestincontroldesign.Themainthoughtbeing,isitpossibletoeectivelycontrolanaircraftwithmorphing,andifitis,howdoyoudescribetheresultingtime-varyingeects? 1.3.1Contributions TheclassofsystemsunderinvestigationcanberepresentedasinEquation 1{1 .Thisformdescribesasystemwithnxstatesalongwithnmorphingactuatorsandnutraditionalactuatorssuchthatx2Rnxisthestatevector,2Rnisthecommandtomorphing,andu2Rnuisthecommandtotraditionalcontrolsurfaces.ThecoecientsintheequationsofmotionarecombinedintoA2RnxnxandB2Rnxnuwhicharefunctionsofboththemorphingconguration,,andtheightcondition,. _x=A(;)x+B(;)u(1{1) Thisresearchhasresultedinthedevelopment,building,andtestingofinnovativeandtheoreticaladvancementsusedtoaddressthechallengesrelatedtotime-varyingmorphingaircraft.Asetofsolutionsareoutlinedinthedissertationtoaddressthisnovelapproachdevelopedforsystemsanalysisandcontrolsynthesis.Theresultingapproachhasresultedinthefollowingspeciccontributions. MorphingAircraft { Amorphingplatformwasdesignedsuchthatactuationofanindependentmulti-joint,asymmetricwingwasmadepossible. { Missionperformancewasevaluatedforthisaircraftthroughsimulationandighttesting. 24


Time-VaryingInertias { Retainedallinertialtermsintheequationsofmotiontostudytheirtime-varyingeectswithinmorphingightdynamics. { Theresultingtime-varyinginertialeectswerecharacterizedandparamterizedbasedontheirinuencewithinthemodalstructureoftheightdynamics. Time-varyingFlightDynamics { Interpretationsweredevelopedforthetime-varyingpolesandmodalcharacteristicsofamorphingaircraft. { Theseinterpretationswerecompletedusingtwodierentmethodologiespreviouslyuntestedfortime-varyingightdynamics. MorphingControl { Aframeworkforlinearinput-varyingsystemswasformulatedtoaccountforavarietyofsystemswhosedynamicsaredependentinasetofcontroleectors. { Developedandsynthesizedoptimalfeedforwardtrackingfordesiredtime-varyingpolesandsignals. { Developedandsynthesizedoptimalfeedbackforaspeciccaseoftime-varyingsystem.Thissystemwasredenedinabilineartime-invariantformwherenoinputmatrixwasavailableforcontrolpurposes. 1.3.2Papers ThecontributionslistedinSection 1.3.1 haveresultedinmultiplepublicationsincludingjournalpapers,conferencepapers,andabookchapter,aswellas,televisiondocumentariesandaU.S.patent.Thesepublications,alongwiththedocumentariesandpatent,arelistedasfollows: BookChapter 1. D.T.Grant,S.Sorley,A.Chakravarthy,R.Lind,"FlightDynamicsofMorphingAircraftwithTime-VaryingInertias,"inMorphingVehiclesandStructures:AnAerospacePerspective,editedbyJ.Valasek,Wiley[Acceptedforpublication,scheduledforreleaseJanuary2011] JournalPapers 25


2. D.T.Grant,M.AbdulrahimandR.Lind,"DesignandAnalysisofBiomimeticJointsforMorphingofMicroAirVehicles,"InternationalJournalofMicroAirVehicles,[Accepted]. 3. D.T.Grant,M.AbdulrahimandR.Lind,"FlightDynamicsofaMorphingAircraftUtilizingIndependentMultiple-JointWingSweep,"BioinspirationandBiomimetics,[Accepted]. 4. A.Chakravarthy,D.T.GrantandR.Lind,"Time-VaryingDynamicsofMicroAirVehicleWithVariable-SweepMorphing,"JournalofGuidance,Control,andDynamics,[InReview]. 5. D.T.GrantandR.Lind,"OptimalFeedbackControlforTime-VaryingMorphingAircraft,"[FutureWorkinProgress]. ConferencePapers 6. D.T.Grant,M.AbdulrahimandR.Lind,"FlightDynamicsofaMorphingAircraftUtilizingIndependentMultiple-JointWingSweep,"AIAAAtmosphericFlightMechanicsConference,Keystone,CO,August2006,AIAA-2006-6505.[BestStudentPaper] 7. D.T.Grant,M.AbdulrahimandR.Lind,"EnhancingMissionCapabilityforMicroAirVehiclesusingBiomimeticJointsandStructures,"AustralianInternationalAerospaceCongress,Melbourne,Australia,March2007,accepted. 8. D.T.Grant,M.AbdulrahimandR.Lind,"TheRoleofMorphingtoEnhanceMissionCapabilityofMicroAirVehicles,"WorldForumonSmartMaterialsandSmartStructuresTechnology,invitedpaper,ChongqingandNanjing,China,May2007. 9. D.T.Grant,M.AbdulrahimandR.Lind,"AnInvestigationofBiologically-InspiredJointstoEnableSensorPointingofMorphingMicroAirVehicles,"Interna-tionalForumonAeroelasticityandStructuralDynamics,Stockholm,Sweden,June2007,IF-069. 10. D.T.GrantandR.Lind,"EectsofTime-VaryingInertiasonFlightDynamicsofanAsymmetricVariable-SweepMorphingAircraft,"AIAAAtmosphericFlightMechanicsConference,HiltonHead,SC,August2007,AIAA-2007-6487. 11. D.T.Grant,A.ChakravarthyandR.Lind,"ModalInterpretationofTime-VaryingEigenvectorsofMorphingAircraft,"AIAAAtmosphericFlightMechanicsCon-ference,Chicago,IL,AIAA-2009-5848. 12. D.T.GrantandR.Lind,"OptimalTrackingofTime-VaryingModesForControlofMorphingAircraft,"AIAAGuidance,Navigation,andControlConference,Toronto,ON,Canada,August2010,AIAA-2010-8203. 26


13. A.Chakravarthy,D.T.GrantandR.Lind,"Time-VaryingDynamicsofaMicroAirVehiclewithVariable-SweepMorphing,"AIAAGuidance,NavigationandControlConference,Chicago,IL,August2009,AIAA-2009-6304. TelevisionDocumentariesandFilms 14. "FlyingMosters3D":Sky3DTVDocumentary(3DImaxFeatureFilm)[AiredDecember2010] 15. "MorphingMAV":NationalGeographicChannel(5minutesegmentonMadLab)[FirstAired:Apr2008] 16. "BirdWingsforAircraft":VPRO-publictelevisioninTheNetherlands(25minutesegmentonCopyCats)[FirstAired:Dec2006] 17. "TheMagicofMotion":PBS(20minutesegmentonNatureTechDocumentary)[FirstAired:Nov2006] 18. "MorphingMAV":ScienceChannel(5minutesegmentonDiscoveriesThisWeek)[FirstAired:Jul2006] 19. "Biologically-InspiredMorphingMAV":DiscoveryChannel(5minutesegmentonBeyondTomorrow)[FirstAired:May2006] 20. "MorphingMAV":DiscoveryChannel(5minutesegmentonDailyPlanet)[FirstAired:Oct2005] Patent 21. MorphingAircraft:USPatentApplicationSerialNumberPCT/US09/54917 Thepublicationslistedabovearederivedfromcertainsectionsofthisdissertation.Relationshipsbetweenthesetopics,dissertationsections,andresultingpublicationscanbefoundinTable 1-1 Table1-1. Publicationsresultingfromresearch TopicDissertationSectionWork PlatformDesign 6.1 6.3 1. 2. 3. 6. 7. 8. 9. Time-VaryingInertias 2.1 2.6 6.4 10. Time-VaryingFlightDynamics 3.1 3.6 4.1 4.4 4. 11. 13. OptimalFeedforwardControl 5.1 5.4 12. OptimalFeedbackControl 5.1 5. 27


1.4DissertationOverview Chapter1introducesthefollowingdocumentbystrategicallyaddressingthekeyissuesdirectlyrelatedtothedissertation'smaintopicofresearch.Theseissuesarewrittenintosectionsbasedupontheircontributiontotheoverallunderstandingoftheproblembeingconsidered.Sectiontopicsinclude:motivationforconductingresearch,abackgrounddescriptionoftheproblem,andastatementformallydeningtheactualproblem. Chapter2beginsbyrecallingthetraditionalderivationandlinearizationofthenonlinearaircraftequationsofmotion.Theseaircraftequationsofmotionarethenlaterrederived,andlinearized,basedupontheassumptionthatthesystemistime-varying(aresultofmorphing).Thischapterisconcludedbyexaminingtwoexampleswhereboththesymmetricandasymmetricmorphingequationsofmotionarereducedtothetraditionallydenedequationsofmotion,asdescribedpreviouslyinthechapter. Chapter3updatesthereaderwiththemostinuentialmethodsindeningthepolesandzerosforalineartime-varyingsystem.Thefourmost-commonapproachesandtheirmethodsaregiven,eachincludingabriefdescriptionofbackgroundtheoryanddenitions.Thestabilityofeachmethodisalsoconsidered,therefore,necessaryandsucientconditionspertainingtodierentlevelsofstabilityaredened. Chapter4beginsbyreviewingthefundamentalframeworksusedtointerpretbothtime-invariantandtime-varyingsystemcharacterisitcs.Theresultingtime-varyingframeworkisthenfurtherinvestigatedfortwoofthefourmethodologiesdescribedinChapter3.Chapter4closesbyprovidingatime-varyingexamplespecictotheframeworkpreviouslymention. Chapter5motivesthederivationofasystematicapproachtoclassifyingandcontrollingthetime-varyingsystemproducedbymorphing.Morphingcontrolchallangesandapproachesaredecribedandthenfollowedbyexamplesoutliningcertainapproaches.Bothstabilizingandoptimizingperformanceareconsideredthroughtheoreticalderivationandthenimplementation.Thechatpterconcludeswithafutureworksectionwhichexpandsthepreviousworkintopossibleavenuesforfutureworkandproposestheoreticalderivations. Chapter6presentsanextensiveexamplewhichinvestigatestheeectsofbothsymmetricandasymmetricmorphing.Generatedstate-spacesystemsareusedtosimulatebasiclineartime-invariant(quasi-static)controlledmaneuverssuchasdivingandturning,aswellas,theeectsoftime-varyingmorphingonthesystem'smodalcharacterisiticsandcontrollability. 28


CHAPTER2EQUATIONSOFMOTION 2.1AircraftAxisSystem Threeaxissystemsarecommontodescribeaircraftmotion.Thesesystemsincludethebody-axissystem(xedtotheaircraft),theEarth-axissystem(assumedtobeaninertialaxissystemxedtotheEarth),andthestability-axissystem(denedwithrespecttothelocalwind). 2.1.1BodyAxisSystem Thebody-xedcoordinatesystemhasitsoriginlocatedattheaircraft'scenterofgravity.Theaxesareorientedsuchthat^xB,pointsdirectlyoutthenose,^yB,pointsdirectlyouttherightwing,and^zB,pointsdirectlyoutthebottom,asshowninFigure 2-1 Figure2-1. Body-FixedCoordinateFrame 2.1.2StabilityAxisSystem Thestabilityaxissystemsharesthesameoriginlocationasthebody-xedframe,butisrotatedrelativetothebody-xedaxistoalignwiththevelocityvector,asshowninFigure 2-2 .Theresulting^xSaxispointsinthedirectionoftheprojectionoftherelativewindontothexzplaneoftheaircraft.The^ySaxisisoutoftherightwingcoincidentwith^yB,whilethe^zSaxispointsdownwardinthedirectioncompletingthevectorsetdescribedbytheright-handruleandshowninFigure 2-2 29


Figure2-2. StabilityCoordinateFrame 2.1.3EarthAxisSystem TheEarth-xedcoordinatesystemisxedtothesurfaceoftheEarthwithits^zEaxispointingtothecenteroftheEarth.The^xEand^yEaxesareorthogonalandlieinthelocalhorizontalplane,asshowninFigure 2-3 Figure2-3. Earth-FixedCoordinateFrame 30


2.2CoordinateTransformations 2.2.1EarthtoBodyFrame AvectormaybetransformedfromtheEarth-xedframeintothebody-xedframebythreeconsectutiveconsecutiverotationsaboutthez-axis,y-axis,andx-axis,respectively.TraditionalightmechanicsdenetheanglesthroughwhichthesecoordinateframesarerelativelyrotatedastheEulerangles.TheEuleranglesareexpressedasyaw ,pitch,androll,anditisimportanttonotethataparticularsequenceofEuleranglerotationsisunique.Thefollowingillustratesthetransformationofavector,PE,intheEarth-xedframe,asdenedinEquation 2{1 ,intothebody-xedframe. PE=x^iE+y^jE+z^kE=266664XEYEZE377775(2{1) Therstrotationisthroughtheangleaboutthevector^kE,asshowninFigure 2-4 Figure2-4. Rotationthrough Therotationabout^kEbytheangle, ,isreferredtoasR3( ),whereR3( )istheshort-handnotationusedtodescribetherotationmatrixdenedinEquation 2{2 31


266664X1Y1Z1377775=266664cos sin 0)]TJ /F1 11.955 Tf 11.3 0 Td[(sin cos 0001377775266664XEYEZE377775(2{2) Thesecondrotationisthroughtheangleaboutthevector^j1=^j2,asshowninFigure 2-5 Figure2-5. Rotationthrough Therotationabout^j1bytheangle,,isreferredtoasR2(),whereR2()istheshort-handnotationusedtodescribetherotationmatrixdenedinEquation 2{3 266664X2Y2Z2377775=266664cos0)]TJ /F1 11.955 Tf 11.29 0 Td[(sin010sin0cos377775266664X1Y1Z1377775(2{3) Thethirdandnalrotationisthroughtheangleaboutthevector^i2=^i,asshowninFigure 2-6 Therotationabout^i2bytheangle,,isreferredtoasR1(),whereR1()istheshort-handnotationusedtodescribetherotationmatrixdenedinEquation 2{4 32


Figure2-6. Rotationthrough 266664XBYBZB377775=2666641000cossin0)]TJ /F1 11.955 Tf 11.3 0 Td[(sincos377775266664X2Y2Z2377775(2{4) Therefore,anyvectorintheEarth-xedframe,PE,canbetransformedintothebody-xedframe,PB,usingtherelationshipdenedinEquation 2{5 PB=R1()R2()R3( )PE(2{5) Forexample,Earth-xedgravityforcescanbeexpressedinthebody-xedcoordinatesystembyimplementingEquation 2{5 ontheEarth-xedweightvector FGE=26666400mg377775E=266664)]TJ /F5 11.955 Tf 9.3 0 Td[(mgsinmgsincosmgcossin377775B(2{6) 2.2.2StabilitytoBodyFrame Typically,aerodynamicforcesaredenedbythestabilityaxisforconvenienceyet,forcomputationalreasons,theyneedtobedenedbythebody-xedaxis.Recallingthatthistransformationcanbeaccomplishedbyrotatingthestabilityaxisthroughapositiveangleofattack,thetransformationfromthestabilitycoordinateframetothebody-xed 33


coordinateframeissimplyarotationaboutthevector^yBthroughtheangle,asdenedinEquation 2{7 266664FAxFAyFAz377775B=266664cos0)]TJ /F1 11.955 Tf 11.29 0 Td[(sin010sin0cos377775266664)]TJ /F5 11.955 Tf 9.29 0 Td[(DFAy)]TJ /F5 11.955 Tf 9.29 0 Td[(L377775S(2{7) 2.3NonlinearEquationsofMotion 2.3.1DynamicEquations TherigidbodyequationsofmotionareobtainedformNewton'ssecondlaw,whichstatesthatthesummationofallexternalforcesactingonabodyisequaltothetimerateofchangeofthemomentumofthebody;andthesummationoftheexternalmomentsactingonthebodyisequaltothetimerateofchangeofthemomentofmomentum(angularmomentum).ThetimeratesofchangeoflinearandangularmomentumarerelativetoaninertialorNewtonianreferenceframe(Earth-xedframe).Newton'ssecondlawcanbeexpressedbythevectorsdenedinEquations 2{8 2{9 XF=d dt(mv)E(2{8) XM=d dtHE(2{9) Afewadditionalassumptionsmustbemadeinordertodeveloptheright-handside,orresponseside,ofequation 2{8 .Theseassumptionsincludethattheaircraftbeconsideredarigidbody,andthatthemassoftheaircraftremainconstant.Asaresultofassumingthemasstobeconstant,themassterm,seeninEquation 2{8 ,canbemovedoutsideofthetimederivativeandredenedasEquation 2{10 34


XF=md dtvE=maE(2{10) Theaccelerationofanaircraftisnormallymeasuredinthebody-xedframe,therefore,touseEquation 2{10 ,thebody-xedaccelerationmustbetransformedintotheEarth-xedframe.Itisnotedthatsincethetransformationinvolvesarotationofcoordinates,anyvectorinthebody-xedframecanbecalculatedintheEarth-xedframebyusingthetransporttheorem[ 95 ],asseeninEquation 2{11 .Itshouldalsobenotedthatforthefollowingderivations,allofthevectorswillbeexpressedinthebody-xedcoordinatesystem,denotedbythesubscript,B,unlessotherwisestated.Forexample,thevelocityvectorasseenbyanobserverintheEarth-xedframe,expressedinthebody-xedcoordinatesystem,willbedontedasvEB. db dtA=db dtB+A!Bb(2{11) Thevelocityvector,vE,representstherateofchangeofthepositionvector,r,asviewedbyanobserverintheEarthxedreferenceframe.Sincethepositionvector,r,isnormallymeasuredwithrespecttothebody-xedcoordinatesystem,itmustbersttransformedintotheEarth-xedframe,inordertocomputethedesiredEarth-denedvelocityvector,VEB.Thus,thetransporttheoremisusedtorelatethepositionvector,r,totheEarth-denedvelocityvector,vEB,asseeninasseeninEquation 2{12 vEB=dr dtE=dr dtB+E!Br(2{12) TheEarth-denedveloctyvectorcanbeconvenientlyrewrittenanddened,asseeninEquation 2{13 35


vEB=u^i+v^j+w^k=266664UVW377775EB(2{13) ThesttermontherightsideofEquation 2{12 iscalledthebody-denedvelocity.Thebody-denedvelocityvector,vBB,issimplythetimederivativeofthepositionvector,r,asseeninEquation 2{14 .Notethatthisisonlythecasewhenthepositionvectorisdescribedbythebody-xedcoordinatesystem. dr dtB=_x^i+y^j+_z^k=vBB(2{14) ThesecondtermontherightsideofEquation 2{12 ,isdescribedbythecrossproductbetweentheEarth-denedvelocityvector,vEBandatermcalledtheangularvelocityvector.Theangularvelocityvector,E!B,describestheangularvelocityofreferenceframeB(body-xedframe)asviewedbyanobserverinreferenceframeE(Earthxedframe),representedinthebody-xedcoordinatesystem. Theangularveloctyvectorcanbeconvenientlyrewrittenanddened,asseeninEquation 2{15 B!E=p^i+q^j+r^k=266664_p_q_r377775EB(2{15) Itshouldbenoted,thattheangularvelocityvectors,E!BandB!E,arerelatedthroughasimplerelationship,asseeninEquation 2{16 E!B=)]TJ /F11 7.97 Tf 9.3 4.94 Td[(B!E(2{16) Itshouldalsobenoted,thatangularvelocityvectorsrelatingmultiplerotations,maybelinearlyaddedintooneangularvelocityvectorthatrelatestheentiretransformation. 36


Thisadditionofangularvelocityvectorscanbedescribedbytheangularvelocityadditiontheorem[ 95 ],whichisshowninEquation 2{17 A1!An=A1!A2+A2!A3+:::+An)]TJ /F15 5.978 Tf 5.75 0 Td[(1!An(2{17) ThederivationoftheEarth-denedaccelerationvector,aEB,issimilartothepreviousdenitionoftheEarth-denedvelocityvector,vEB.Thatis,theEarth-denedaccelerationvector,aEB,representstherateofchangeoftheEarth-denedvelocityvector,vEB,asviewedbyanobserverintheEarth-xedreferenceframe.Therefore,tosolvefortheaccelerationvector,aEB,thetransporttheoremmustbeappliedtothevelocityvector,vEB,asseeninEquation 2{18 aEB=dvEB dtE=dvEB dtB+E!BvEB(2{18) TheEarth-denedaccelerationvectorcanbeconvenientlyrewrittenanddened,asseeninEquation 2{19 aEB=u^i+v^j+w^k=266664_u_v_w377775B(2{19) NoticethatifthesttermontherightsideofEquation 2{19 isdenedbythebody-xedcoordinatesystem,thenonlythetimederivativeneedstobetaken.Ifthistermisnotdenedbythebody-xedcoordinatesystem,thenthetransporttheoremmustbeappliedtocompensateforthecoordinatechange. TherighthandsideofEquation 2{19 cannowbesolvedforbyrstcomputingthecrossproductbetweentheEarth-denedangularvelocityvector,B!E,andtheEarth-denedvelocityvector,vEB.Thecrossproductisthenaddedtothebody-denedaccelerationvector,aBB.Itshouldnotedthatthebody-denedaccelerationisnotsimplythesecondderivativeoftheofthebody-denedposition.Thistermisdenedastherate 37


ofchangeoftheEarth-denedvelocityvector,asseenbyanobserverinthebody-xedframe,andtherefore,canbecomputedbytakingthetimederivativeoftheEarth-denedvelocityvector. Theresultingterm,showninEquation 2{20 ,representstheaccelerationoftheaircraftasseenbyanobserverintheinertially-xedEarthframe,representedinthebody-xedcoordinatesystem. aB=266664_u+qw)]TJ /F5 11.955 Tf 11.96 0 Td[(rv_v+ru)]TJ /F5 11.955 Tf 11.95 0 Td[(pw_w+pv)]TJ /F5 11.955 Tf 11.95 0 Td[(qu377775B(2{20) Todenethelefthandside,orappliedforceside,ofEquation 2{8 ,itisrstassumedthatonlythemostsignicantforcesaectthemotionoftheaircraft.Theappliedforcescanthenbebrokendownintovectorcomponentsandarrangedinamannersuchthattheyaredenedbythevector,FEB,asseeninEquation 2{21 FEB=266664FxFyFz377775EB=266664FGx+FAxFGy+FAyFGz+FAz377775EB=XF(2{21) Aresultingsetoffull-order,nonlinearforceequations,asseeninEquation 2{22 ,canbederivedbyinsertingEquations 2{20 2{21 intoEquation 2{8 andrecallingthattheappliedforcesaregivenbyEquations 2{6 2{7 m(_u+qw)]TJ /F5 11.955 Tf 11.96 0 Td[(rv)=)]TJ /F5 11.955 Tf 9.3 0 Td[(mgsin+()]TJ /F5 11.955 Tf 9.3 0 Td[(Dcos+Lsin)m(_v+ru)]TJ /F5 11.955 Tf 11.96 0 Td[(pw)=mgsincos+FAym(_w+pv)]TJ /F5 11.955 Tf 11.96 0 Td[(qu)=mgcoscos+()]TJ /F5 11.955 Tf 9.29 0 Td[(Dsin)]TJ /F5 11.955 Tf 11.96 0 Td[(Lcos)(2{22) 38

PAGE 39 Itisshowninequation 2{2 thatNewton'ssecondlawissatisedbyequatingthesummationofmomentstothetotalrateofchangeofthemomentofmomentum(angularmomentum).ThesamerelationshipusedpreviouslytodenetheEarth-denedaccelerationcanbeusedtodenetheEarth-denedangularmomentum.Itshouldbeagainnotedthatforthefollowingderivations,allofthevectorswillbeexpressedinthebody-xedcoordinatesystem,denotedbythesubscript,B,unlessotherwisestated.Forexample,theangularmomentumvectorasseenbyanobserverintheEarth-xedframe,expressedinthebody-xedcoordinatesystem,willbedontedasHEB. Traditionally,theangularmomentumiscomputedfrommeasurementstakeninthebody-xedcoordinatesysytem.InordertoproperlydescribetheEarth-denedangularmomentumvector,itmustbersttransformedintotheinertially-xedEarthframe.Thistransformationcanbeaccomplishedbythetransporttheorem,asseeninEquation 2{23 dHEB dtE=dHEB dtB+E!BHEB(2{23) Thegeneralexpressionforangularmomentumcanbetakendirectlyfrombasicphysicsanddescribedasanobject'sinertialtensor,I,multipliedbythatobject'sangularratevector,!,asseeninEquation 2{24 H=I!(2{24) TheangularmomentumdenedinEquation 2{24 canbemaderelavanttoanaircraftbydeningtheinertialtensorintheaircraft'sbody-xedcoordinatesystem,asseeninEquation 2{25 ,andrecallingthattheEarth-denedangularvelocityvectorwaspreviouslydenedinEquation 2{15 39


IB=266664Ixx)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixy)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixz)]TJ /F5 11.955 Tf 9.3 0 Td[(IyxIyy)]TJ /F5 11.955 Tf 9.3 0 Td[(Iyz)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixz)]TJ /F5 11.955 Tf 9.3 0 Td[(IyzIzz377775B(2{25) Equations 2{15 and 2{25 canbeinsertedintoEquation 2{24 toproducetheEarth-denedangularmomentumvector,asseeninEquation 2{26 HEB=266664Ixx)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixy)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixz)]TJ /F5 11.955 Tf 9.3 0 Td[(IyxIyy)]TJ /F5 11.955 Tf 9.3 0 Td[(Iyz)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixz)]TJ /F5 11.955 Tf 9.3 0 Td[(IyzIzz377775EB266664PQR377775EB(2{26) TheEarth-denedangularmomentumvector,HEB,canbeconvenientlywritteninvectornotation,asseeninEquation 2{27 HEB=Hx^i+Hy^j+Hz^k=266664HxHyHz377775EB(2{27) InsertingEquation 2{27 intothelefthandsideofEquation 2{26 andcarryingoutthematrixmultiplicationontherighthandside,resultsintheEarth-denedvectornotationoftheaircraft'sangularmomentum,asseeninEquation 2{28 HEB=266664pIx)]TJ /F5 11.955 Tf 11.95 0 Td[(qIxy)]TJ /F5 11.955 Tf 11.96 0 Td[(rIxzqIy)]TJ /F5 11.955 Tf 11.95 0 Td[(rIz)]TJ /F5 11.955 Tf 11.95 0 Td[(pIxyrIz)]TJ /F5 11.955 Tf 11.96 0 Td[(pIxz)]TJ /F5 11.955 Tf 11.95 0 Td[(qIyz377775(2{28) Themomentsofineritaaredescibedasindicatorstotheresistancetorotationaboutthataxis,asdenedinEquations 2{29 2{31 .Therefore,Ixindicatestheresistancetorotationaboutthex-axis(relativelydened).Theproductsofinertiaaredescribedasindicatorstothesymmetryoftheaircraft,asdenedinEquations 2{32 2{34 40


Ix=Z(y2+z2)dm (2{29) Iy=Z(x2+z2)dm (2{30) Iz=Z(x2+y2)dm (2{31) Ixy=Z(xy)dm (2{32) Ixz=Z(xz)dm (2{33) Iyz=Z(yz)dm (2{34) Duetothefactthatthemasseswereassumedtobepointmasses,theintegralsinEquations 2{29 2{34 canbereducedto: Ix=m(y2+z2) (2{35) Iy=m(x2+z2) (2{36) Iz=m(x2+y2) (2{37) Ixy=m(xy) (2{38) Ixz=m(xz) (2{39) Iyz=m(yz) (2{40) ThecorrespondinginertialratescanbecalculatedbytakingthetimederivativeofEquations 2{35 2{40 ,asshowninEquationrefeqrates. 41


_Ix=m[(2y)(_y)+(2z)(_z)]_Iy=m[(2x)(_x)+(2z)(_z)]_Iz=m[(2x)(_x)+(2y)(_y)]_Ixy=)]TJ /F5 11.955 Tf 9.29 0 Td[(m[(x)(_y)+(y)(_x)]_Ixz=)]TJ /F5 11.955 Tf 9.3 0 Td[(m[(x)(_z)+(z)(_x)]_Iyz=)]TJ /F5 11.955 Tf 9.3 0 Td[(m[(y)(_z)+(z)(_y)](2{41) Thersttermontherighthandsideofequation 2{23 isdescribedastherateofchangeoftheEarth-denedangularmomentumvectorasseenbyanoberverinthebody-xedcoordinatesystem,representedinthebody-xedcoordinatesystem.ThistermcanbefoundbysimplytakingthetimederivativeofEquation 2{28 ,asseeninEquation 2{42 dHEB dt=266664_pIx)]TJ /F1 11.955 Tf 14.12 0 Td[(_qIxy)]TJ /F1 11.955 Tf 13.78 0 Td[(_rIxz+p_Ix)]TJ /F5 11.955 Tf 11.96 0 Td[(q_Ixy)]TJ /F5 11.955 Tf 11.96 0 Td[(r_Ixz_qIy)]TJ /F1 11.955 Tf 13.78 0 Td[(_rIyz)]TJ /F1 11.955 Tf 14.24 0 Td[(_pIxy+q_Iy)]TJ /F5 11.955 Tf 11.95 0 Td[(r_Iz)]TJ /F5 11.955 Tf 11.96 0 Td[(p_Ixy_rIz)]TJ /F1 11.955 Tf 14.24 0 Td[(_pIxz)]TJ /F1 11.955 Tf 14.11 0 Td[(_qIyz+_rIz)]TJ /F5 11.955 Tf 11.96 0 Td[(p_Ixz)]TJ /F5 11.955 Tf 11.95 0 Td[(q_Iyz377775(2{42) ThesecondtermontherightsideofEquation 2{23 canbefoundbytakingthecrossproductbetweenthepreviouslydenedangularmomentumvector,HEB,asseeninEquation 2{28 ,andtheangularvelocityvector,!EB,asseeninEquation 2{19 .Thistermcanbethentemporarilydenedas,HT,andrewrittenintheformshownbyEquation 2{43 HT=266664qrIz)]TJ /F5 11.955 Tf 11.95 0 Td[(qpIxz)]TJ /F5 11.955 Tf 11.95 0 Td[(q2Iyz)]TJ /F5 11.955 Tf 11.96 0 Td[(qrIy+r2Iyz+rpIxyrpIx)]TJ /F5 11.955 Tf 11.95 0 Td[(qrIxy)]TJ /F5 11.955 Tf 11.95 0 Td[(r2Ixz)]TJ /F5 11.955 Tf 11.96 0 Td[(rpIz+p2Ixz+qpIyzpqIy)]TJ /F5 11.955 Tf 11.96 0 Td[(rpIyz)]TJ /F5 11.955 Tf 11.96 0 Td[(p2Ixy)]TJ /F5 11.955 Tf 11.95 0 Td[(pqIx+q2Ixy+rqIxz377775(2{43) TherightsideofEquation 2{23 cannowbesolvedforintermsoftheEarth-denedangularmomentumvector,HEB,byinsertingEquations 2{42 and 2{43 intoEquation 2{23 ,asseeninEquation 2{44 42


HEB=266664_pIx)]TJ /F1 11.955 Tf 14.11 0 Td[(_qIxy)]TJ /F1 11.955 Tf 13.78 0 Td[(_rIxz+p_Ix)]TJ /F5 11.955 Tf 11.95 0 Td[(q_Ixy)]TJ /F5 11.955 Tf 11.95 0 Td[(r_Ixz_qIy)]TJ /F1 11.955 Tf 13.78 0 Td[(_rIyz)]TJ /F1 11.955 Tf 14.24 0 Td[(_pIxy+q_Iy)]TJ /F5 11.955 Tf 11.96 0 Td[(r_Iz)]TJ /F5 11.955 Tf 11.96 0 Td[(p_Ixy_rIz)]TJ /F1 11.955 Tf 14.24 0 Td[(_pIxz)]TJ /F1 11.955 Tf 14.11 0 Td[(_qIyz+_rIz)]TJ /F5 11.955 Tf 11.96 0 Td[(p_Ixz)]TJ /F5 11.955 Tf 11.96 0 Td[(q_Iyz377775+266664qrIz)]TJ /F5 11.955 Tf 11.96 0 Td[(qpIxz)]TJ /F5 11.955 Tf 11.96 0 Td[(q2Iyz)]TJ /F5 11.955 Tf 11.95 0 Td[(qrIy+r2Iyz+rpIxyrpIx)]TJ /F5 11.955 Tf 11.96 0 Td[(qrIxy)]TJ /F5 11.955 Tf 11.96 0 Td[(r2Ixz)]TJ /F5 11.955 Tf 11.95 0 Td[(rpIz+p2Ixz+qpIyzpqIy)]TJ /F5 11.955 Tf 11.95 0 Td[(rpIyz)]TJ /F5 11.955 Tf 11.96 0 Td[(p2Ixy)]TJ /F5 11.955 Tf 11.96 0 Td[(pqIx+q2Ixy+rqIxz377775(2{44) TheleftsideofEquation 2{44 canbeputintovectornotation,suchthatthevectorcomponentsoftheEarth-denedangularmomentumvector,HEB,aredenedbyindividualmomentterms,asshownbyEquation 2{45 .` dH dtEB=266664LMN377775EB(2{45) Afull-ordersetofnonlinearmomentequationscanbefoundbyrstinsertingEquation 2{45 intoEquation 2{44 andthenequatingsides,asseeninEquation 2{46 L=_pIx)]TJ /F5 11.955 Tf 11.96 0 Td[(qrIy+qrIz+(pr)]TJ /F1 11.955 Tf 14.11 0 Td[(_q)Ixy)]TJ /F1 11.955 Tf 11.95 0 Td[((pq+_r)Ixz+(r2)]TJ /F5 11.955 Tf 11.96 0 Td[(q2)Iyz+p_Ix)]TJ /F5 11.955 Tf 11.96 0 Td[(q_Ixy)]TJ /F5 11.955 Tf 11.96 0 Td[(r_IxzM=prIx+_qIy)]TJ /F5 11.955 Tf 11.96 0 Td[(prIz)]TJ /F1 11.955 Tf 11.95 0 Td[((qr)]TJ /F1 11.955 Tf 14.24 0 Td[(_p)Ixy+(p2)]TJ /F5 11.955 Tf 11.95 0 Td[(r2)Ixz+(pq)]TJ /F1 11.955 Tf 13.78 0 Td[(_r)Iyz+q_Iy)]TJ /F5 11.955 Tf 11.96 0 Td[(p_Ixy)]TJ /F5 11.955 Tf 11.96 0 Td[(r_IyzN=)]TJ /F5 11.955 Tf 9.3 0 Td[(pqIx+pqIy+_rIz+(q2)]TJ /F5 11.955 Tf 11.95 0 Td[(p2)Ixy+(qr)]TJ /F1 11.955 Tf 14.24 0 Td[(_p)Ixz)]TJ /F1 11.955 Tf 11.96 0 Td[((pr+_q)Iyz+r_Iz)]TJ /F5 11.955 Tf 11.95 0 Td[(p_Ixz)]TJ /F5 11.955 Tf 11.95 0 Td[(q_Iyz(2{46) 2.3.2KinematicEquations Thesixequationsofmotion,previouslydevelopedtorepresenttheforcesandmomentsactingontheaircraft,arenecessarybutnotsucient.Additionalequationsmustbeaddedinordertosolvetheoverallaircraftproblem.TheseadditionalequationsarenecessaryduetothefactthattheEuleranglesrepresentedintheforceequationscreatemorethansixunknowns. Threenewequationscanbeobtainedbyrelatingthethreebody-axissystemrates(p;q;r)tothethreeEulerrates(_ ;_;_).Itisnotedthatthisrelationshipcan 43


beillustratedbyavectorequationwherethemagnitudeofthethreebodyratesequalsthethreeEulerratesand,asseeninEquation 2{47 !B=p^i+q^j+r^k=_ i+_j+_k(2{47) Toequatebothsidesofequation 2{24 ,itisnecessarythatbothvectorsarerepresentedinthesamecoordinateframe.Thus,bytransformingtheEuleranglesintothebody-xedcoordinatesystem,threenonlinearbodyrateequationscanbewritten,asseeninEquation 2{48 p=_)]TJ /F1 11.955 Tf 15.65 3.16 Td[(_ sinq=_cos+_ cossinr=_ coscos)]TJ /F1 11.955 Tf 14.2 3.15 Td[(_sin(2{48) ThesethreebodyrateequationcanalsobedenedintermsoftheEulerangles,asseeninEquation 2{49 _=p+q(sin+rcos)tan_=qcos)]TJ /F5 11.955 Tf 11.95 0 Td[(rsin_ =(qsin+rcos)sec(2{49) Anadditionalthreeequationsarederivedfromtheightvelocitycomponentsrelativetotheinertiallydenedreferenceframe.Inordertoderivetheseequations,theinertiallydenedvelocitycomponents,representedinthebody-xedcoordinatesystem,mustrstbedened,asseeninEquation 2{50 266664xyz377775EB=266664dx/dtdy/dtdz/dt377775EB(2{50) 44


AnEulertransformationmaybeusedtotransformthebody-denedvelocities,(u;v;w),intothedesiredEarth-denedvelocities.Thistransformationiscompletedbyapplyingequation 2{5 ,inreverseorder,tothebody-denedvelocities,asseeninEquation 2{51 266664dx/dtdy/dtdz/dt377775EB=266664coscos sinsincos )]TJ /F1 11.955 Tf 11.95 0 Td[(cossin cossincos +sinsin cossin sinsinsin )]TJ /F1 11.955 Tf 11.95 0 Td[(coscos cossinsin +sincos )]TJ /F1 11.955 Tf 11.29 0 Td[(sinsincoscoscos377775266664uvw377775B(2{51) Afull-ordersetofnon-linearvelocityequationscanthusbefoundbyrstcompletingthethematrixmultiplicationontherighthandsideofEquation 2{51 andthenequatingbothsides,asseeninEquation 2{52 _xEB=uBcoscos +vB(sinsincos )]TJ /F1 11.955 Tf 11.95 0 Td[(cossin )+wB(cossincos +sinsin )_yEB=uBcossin +vB(sinsinsin )]TJ /F1 11.955 Tf 11.95 0 Td[(coscos )+wB(cossinsin +sincos )_zEB=)]TJ /F5 11.955 Tf 9.3 0 Td[(uBsin+vB(sincos)+wBcoscos(2{52) IntegratingEquation 2{52 yieldstheairplane'spositionrelativetotheinertially-xedreferenceframe. 2.3.3TheEquationsCollected Thenonlinearaircraftequationsofmotioncanbecollectedintoaformalset,asshowninEquation 2{53 45


m(_u+qw)]TJ /F5 11.955 Tf 11.95 0 Td[(rv)=)]TJ /F5 11.955 Tf 9.3 0 Td[(mgsin+()]TJ /F5 11.955 Tf 9.29 0 Td[(DcosA+LsinA)+TsinTm(_v+ru)]TJ /F5 11.955 Tf 11.95 0 Td[(pw)=mgsincos+FAy+FTym(_w+pv)]TJ /F5 11.955 Tf 11.96 0 Td[(qu)=FGz+FAz+FTzL=_pIx)]TJ /F5 11.955 Tf 11.96 0 Td[(qrIy+qrIz+(pr)]TJ /F1 11.955 Tf 14.11 0 Td[(_q)Ixy)]TJ /F1 11.955 Tf 11.95 0 Td[((pq+_r)Ixz+(r2)]TJ /F5 11.955 Tf 11.95 0 Td[(q2)Iyz+p_Ix)]TJ /F5 11.955 Tf 11.96 0 Td[(q_Ixy)]TJ /F5 11.955 Tf 11.96 0 Td[(r_IxzM=prIx+_qIy)]TJ /F5 11.955 Tf 11.96 0 Td[(prIz)]TJ /F1 11.955 Tf 11.95 0 Td[((qr)]TJ /F1 11.955 Tf 14.24 0 Td[(_p)Ixy+(p2)]TJ /F5 11.955 Tf 11.95 0 Td[(r2)Ixz+(pq)]TJ /F1 11.955 Tf 13.78 0 Td[(_r)Iyz+q_Iy)]TJ /F5 11.955 Tf 11.96 0 Td[(p_Ixy)]TJ /F5 11.955 Tf 11.96 0 Td[(r_IyzN=)]TJ /F5 11.955 Tf 9.3 0 Td[(pqIx+pqIy+_rIz+(q2)]TJ /F5 11.955 Tf 11.95 0 Td[(p2)Ixy+(qr)]TJ /F1 11.955 Tf 14.24 0 Td[(_p)Ixz)]TJ /F1 11.955 Tf 11.96 0 Td[((pr+_q)Iyz+r_Iz)]TJ /F5 11.955 Tf 11.95 0 Td[(p_Ixz)]TJ /F5 11.955 Tf 11.95 0 Td[(q_Iyz_=p+q(sin+rcos)tan_=qcos)]TJ /F5 11.955 Tf 11.96 0 Td[(rsin_ =(qsin+rcos)sec_xEB=uBcoscos +vB(sinsincos )]TJ /F1 11.955 Tf 11.95 0 Td[(cossin )+wB(cossincos +sinsin )_yEB=uBcossin +vB(sinsinsin )]TJ /F1 11.955 Tf 11.95 0 Td[(coscos )+wB(cossinsin +sincos )_zEB=)]TJ /F5 11.955 Tf 9.3 0 Td[(uBsin+vB(sincos)+wBcoscos(2{53) 2.4LinearizedEquationsofMotion Oftentimes,thenonlinearsetofmotionequationsislinearizedforuseinstabilityandcontrolanalysis.Thelinearizationiscarriedoutbymeansofthesmall-disturbancetheory.Whenusingthesmall-disturbancetheory,itisassumedthatthemotionoftheaircraftconsistsofsmalldeviationsfromareferenceconditionofsteadyight.Limitationsdoapplytothesmall-disturbancetheory,inthatproblemscontaininglargedisturbanceangles(i.e.:==2)cannotbelinearizedusingthismethod. Whenusingthesmall-disturbancetheory,allthevariablesintheequationsofmotionarereplacedbyareferencevalueplussomeperturbationasshowninEquation 2{54 46


u=uo+up=p0+px=x0+xM=M0+Mv=v0+vq=q0+qy=y0+yN=N0+Nw=w0+wr=r0+rz=z0+zL=L0+L(2{54) Forconvenience,thereferenceightconditionisassumedtobesteadytrimmedightwithasymmetriccongurationandnoangularvelocity.TheseassumptionscanbephysicallyillustratedasshowninEquation 2{55 v0=p0=q0=r0=0=0=0(2{55) Furthermore,thex-axisisassumedtobeinitiallyalignedalongthedirectionoftheaircraft'svelocityvector,thus,w0=0.Asaresult,u0isequaltothereferenceightspeedand0tothereferenceangleofclimb.Forreasonsofsimplication,itisnotedthattheatrigonometricidentitymaybeapplied,asdenedinEquation 2{56 sin(0+)=sin0cos+cos0sin:=sin0+cos0cos(0+)=cos0cos)]TJ /F1 11.955 Tf 11.95 0 Td[(sin0sin:=cos0)]TJ /F1 11.955 Tf 11.96 0 Td[(sin0(2{56) Ageneralsetoflinearizedmotionequationsmaybeobtained,asshowninEquation 2{57 ,byapplyingthesmall-disturbancetheory,combinedwiththepreviouslymadeassumptions,tothenonlinearsetofmotionequations,givenbyequation 2{53 ,andretainingonlytherstorderterms. 47


x0+x)]TJ /F5 11.955 Tf 11.95 0 Td[(mg(sin0+cos0)=m_uy0+y+mgcos0=m(_v+u0r)z0+z+mg(cos0)]TJ /F1 11.955 Tf 11.96 0 Td[(sin0)=m(_w)]TJ /F5 11.955 Tf 11.95 0 Td[(u0q)L0+L=Ix_p)]TJ /F5 11.955 Tf 11.95 0 Td[(Izx_rM0+M=Iy_qN0+N=)]TJ /F5 11.955 Tf 9.3 0 Td[(Izx_p+Iz_r_0+_=q_0_=p+rtan0_ 0_ =rsec0_xE0+_xE=(u0+u)cos0)]TJ /F5 11.955 Tf 11.95 0 Td[(u0sin0+wsin0_yE0+_yE=u0cos0+v_zE0+_zE=)]TJ /F1 11.955 Tf 9.3 0 Td[((u0+u)sin0)]TJ /F5 11.955 Tf 11.95 0 Td[(u0cos0+wcos0(2{57) IfallofthedisturbancesinEquation 2{57 aresetequaltozero,thentheresultingsetoflinearizedmotionequationsarerepresentativeofthosedenedforreferenceight. Iftheassumptionismadethattheaircraftisatitsreferenceightcondition,thedisturbancequantitiesareconsiderednegligibleandthereforesetequaltozero.Applyingthisassumptiontoequation 2{57 ,itisseenthatasetofequationsisdeveloped,asseeninEquation 2{58 ,whichcanbeusedtoeliminateallofthereferenceforcesandmomentsfoundinEquation 2{57 X0)]TJ /F5 11.955 Tf 11.95 0 Td[(mgsin0=0Y0=0Z0+mgcos0=0L0=M0+N0=0_xE0=u0cos0_yE0=0_zE0=)]TJ /F5 11.955 Tf 9.3 0 Td[(u0sin0(2{58) 48


Equation 2{58 canbesustitutedbackintoEquation 2{57 ,suchthattheresultinglinearizedmotionequationscanberewrittenanddened,asseeninEquation 2{59 _u=x m)]TJ /F5 11.955 Tf 11.96 0 Td[(gcos0_v=y m+gcos0)]TJ /F5 11.955 Tf 11.95 0 Td[(u0r_w=z m)]TJ /F5 11.955 Tf 11.95 0 Td[(gsin0+u0qL=Ix_p)]TJ /F5 11.955 Tf 11.95 0 Td[(Izx_rM=Iy_qN=)]TJ /F5 11.955 Tf 9.3 0 Td[(Izx_q_=q_=p+rtan0_=rsec0_xE=ucos0)]TJ /F5 11.955 Tf 11.96 0 Td[(u0sin0+wsin0_yE=u0cos0+v_zE=)]TJ /F1 11.955 Tf 9.3 0 Td[(usin0)]TJ /F5 11.955 Tf 11.96 0 Td[(u0cos0+wcos0(2{59) TheperturbationtermsrepresentaerodynamicforcesandmomentsthatcanbeexpressedbymeansofaTaylorseriesexpansion.TheTaylorseriesexpansionmaycontainallofthemotionvariables,butisnormallyreducedtoonlythesignicanttermsrelevanttothatpaticularforceormoment.Forexample,theTaylorseriesexpansionforthechangeinrollmoment,L,maybeexpressedasafunctionofthemoments,forcesandcontrolsurfacedeections,asseeninEquation 2{60 L=@L @uu+@L @vv+@L @ww+@L @qq+@L @pp+@L @rr+@L @aa+@L @rr+@L @ee(2{60) 2.5Examples Toillustratethederivationandlinearizationprocessfurther,anexamplewillbegiven.Theexamplewillexamineanaircraftthatiscapableofmorphingboth 49


symmetricallyandasymmetrically.Itisnoticedthattheonlyequationsthatvarywithsymmetryarethemomentequationsgivenbyequation 2{46 .Thenonlinearmomentequationswillrstbelinearizedandthenreducedaccordingtocongurationandaerodynamicassumptions. 2.5.1Linearization Startingwiththenonlinearmomentequations,asdenedinequation 2{46 ,thesmall-disturbancetheoryisapplied,thusresultingintheperturbationequationsshowninEquation 2{61 L0+L=_pIx+(r0q+q0r)(Iz)]TJ /F5 11.955 Tf 11.95 0 Td[(Iy)+(p0r+r0p)]TJ /F1 11.955 Tf 11.96 0 Td[(_q)Ixy)]TJ /F1 11.955 Tf 11.96 0 Td[((p0q+q0p+_r)Ixz+(2r0)]TJ /F1 11.955 Tf 11.96 0 Td[(2q0q)Iyz+p_Ix)]TJ /F1 11.955 Tf 11.96 0 Td[(q_Ixy)]TJ /F1 11.955 Tf 11.95 0 Td[(r_IxzM0+M=(r0p+p0r)(Ix)]TJ /F5 11.955 Tf 11.96 0 Td[(Iz)+_qIy)]TJ /F1 11.955 Tf 11.95 0 Td[((q0r+r0q+_p)Ixy+(2p0p)]TJ /F1 11.955 Tf 11.96 0 Td[(2r0r)Ixz+(q0p+p0q)]TJ /F1 11.955 Tf 11.95 0 Td[(_r)Iyz+q_Iy)]TJ /F1 11.955 Tf 11.95 0 Td[(p_Ixy)]TJ /F1 11.955 Tf 11.96 0 Td[(r_IyzN0+N=(p0q+q0p)(Iy)]TJ /F5 11.955 Tf 11.95 0 Td[(Ix)+_rIz)]TJ /F1 11.955 Tf 11.96 0 Td[((2q0q)]TJ /F1 11.955 Tf 11.96 0 Td[(2p0p)Ixy+(r0q)]TJ /F5 11.955 Tf 11.96 0 Td[(q0r)]TJ /F1 11.955 Tf 11.96 0 Td[(_p)Ixz)]TJ /F1 11.955 Tf 11.96 0 Td[((r0p+p0r)]TJ /F1 11.955 Tf 11.95 0 Td[(_q)Iyz+r_Iz)]TJ /F1 11.955 Tf 11.96 0 Td[(p_Ixz)]TJ /F1 11.955 Tf 11.95 0 Td[(q_Iyz(2{61) Equation 2{61 canberearrangedinsuchamannerthatitisexpressedasadierentialequation,asseeninEquation 2{62 Ix_p)]TJ /F5 11.955 Tf 11.96 0 Td[(Ixy_q)]TJ /F5 11.955 Tf 11.95 0 Td[(Ixz_r=L0+L+()]TJ /F5 11.955 Tf 9.3 0 Td[(r0Ixy+q0Ixz)]TJ /F1 11.955 Tf 14.68 3.02 Td[(_Ix)p+()]TJ /F5 11.955 Tf 9.3 0 Td[(r0(Iz)]TJ /F5 11.955 Tf 11.95 0 Td[(Iy)+p0Ixz+2q0Iyz+_Ixy)q+()]TJ /F5 11.955 Tf 9.3 0 Td[(q0(Iz)]TJ /F5 11.955 Tf 11.96 0 Td[(Iy))]TJ /F5 11.955 Tf 11.96 0 Td[(p0Ixy)]TJ /F1 11.955 Tf 11.96 0 Td[(2r0Iyz+_Ixz)r)]TJ /F5 11.955 Tf 9.29 0 Td[(Ixy_p)]TJ /F5 11.955 Tf 11.96 0 Td[(Iy_q)]TJ /F5 11.955 Tf 11.95 0 Td[(Iyz_r=M0+M+()]TJ /F5 11.955 Tf 9.3 0 Td[(r0(Ix)]TJ /F5 11.955 Tf 11.96 0 Td[(Iz))]TJ /F1 11.955 Tf 11.96 0 Td[(2p0Ixz)]TJ /F5 11.955 Tf 11.95 0 Td[(q0Iyz+_Ixy)p+(r0Ixy)]TJ /F5 11.955 Tf 11.95 0 Td[(p0Iyz)]TJ /F1 11.955 Tf 14.68 3.02 Td[(_Iy)q+()]TJ /F5 11.955 Tf 9.3 0 Td[(p0(Ix)]TJ /F5 11.955 Tf 11.96 0 Td[(Iz)+q0Ixy+2r0Ixz+_Iyz)r)]TJ /F5 11.955 Tf 9.29 0 Td[(Ixz_p)]TJ /F5 11.955 Tf 11.96 0 Td[(Iyz_q+Iz_r=N0+N+()]TJ /F5 11.955 Tf 9.3 0 Td[(q0(Iy)]TJ /F5 11.955 Tf 11.96 0 Td[(Ix)+2p0Ixy+r0Iyz+_Ixz)p+()]TJ /F5 11.955 Tf 9.3 0 Td[(p0(Iy)]TJ /F5 11.955 Tf 11.95 0 Td[(Ix))]TJ /F5 11.955 Tf 11.96 0 Td[(r0Ixz)]TJ /F1 11.955 Tf 11.96 0 Td[(2q0Ixy+_Iyz)q+()]TJ /F5 11.955 Tf 9.3 0 Td[(q0Ixz+p0Iyz)]TJ /F1 11.955 Tf 14.68 3.02 Td[(_Iz)r(2{62) 50


Theaircraftisassumedtobeatstraightandleveltrimmed(reference)ight,therefore,thedisturbancevaluescanbesetequaltozeroandEquation 2{62 canbefurtherreduced,asshownbyEquation 2{63 Ix_p)]TJ /F5 11.955 Tf 11.95 0 Td[(Ixy_q)]TJ /F5 11.955 Tf 11.96 0 Td[(Ixz_r=L)]TJ /F1 11.955 Tf 14.68 3.02 Td[(_Ixp+_Ixyq+_Ixzr)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixy_p+Iy_q)]TJ /F5 11.955 Tf 11.96 0 Td[(Iyz_r=M+_Ixyp)]TJ /F1 11.955 Tf 14.68 3.02 Td[(_Iyq+_Iyzr)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixz_p)]TJ /F5 11.955 Tf 11.96 0 Td[(Iyz_q+Iz_r=N+_Ixzp+_Iyzq)]TJ /F1 11.955 Tf 14.69 3.03 Td[(_Izr(2{63) Notethattheinertialrates(_Iterms)areretainedinthelinearizedmomentequations.Theretentionofthesetermsisdoneinordertoaccountforthefactthattheaircraftiscapableofmorphing.Solvingequation 2{63 intermsof_p;_qand_rresultsinthethreeequationsshowninEquation 2{64 _p=Ppp+Pqq+Prr+PLL+PMM+PNN D_q=Qpp+Qqq+Qrr+QLL+QMM+QNN D_r=Rpp+Rqq+Rrr+RLL+RMM+RNN D(2{64) ThecoecientsoftheperturbationtermsinEquation 2{63 areexpressedasfunctionsoftheinertialmoments,productsandrates,asseeninEquation 2{65 51


Pp=)]TJ /F5 11.955 Tf 9.3 0 Td[(I2yz_Ix+IzIy_Ix)]TJ /F5 11.955 Tf 11.96 0 Td[(IxyIz_Ixy)]TJ /F5 11.955 Tf 11.96 0 Td[(IxyIyz_Ixz)]TJ /F5 11.955 Tf 11.95 0 Td[(IxzIyz_Ixy)]TJ /F5 11.955 Tf 11.95 0 Td[(IxzIy_IxzPq=IxyIz_Iy)]TJ /F5 11.955 Tf 11.95 0 Td[(IxyIyz_Iyz+IxzIyz_Iy)]TJ /F5 11.955 Tf 11.95 0 Td[(IxzIy_Iyz)]TJ /F5 11.955 Tf 11.95 0 Td[(IzIy_Ixy+Iyz_IxyPr=)]TJ /F5 11.955 Tf 9.3 0 Td[(IxyIz_Iyz+IxyIyz_Iz+I2yz_Ixz+IxzIy_Iz)]TJ /F5 11.955 Tf 11.95 0 Td[(IxzIyz_Iyz)]TJ /F5 11.955 Tf 11.95 0 Td[(IyIz_IxzPL=I2yz)]TJ /F5 11.955 Tf 11.95 0 Td[(IzIyPM=)]TJ /F5 11.955 Tf 9.29 0 Td[(IxyIz)]TJ /F5 11.955 Tf 11.95 0 Td[(IxzIyzPN=)]TJ /F5 11.955 Tf 9.29 0 Td[(IxyIyz)]TJ /F5 11.955 Tf 11.95 0 Td[(IxzIyQp=)]TJ /F5 11.955 Tf 9.3 0 Td[(IxIz_Ixy)]TJ /F5 11.955 Tf 11.96 0 Td[(IxIyz_Ixz)]TJ /F5 11.955 Tf 11.96 0 Td[(IxzIxy_Ixz+IyzIxz_Ix+I2xz_Ixy+IxyIz_IxQq=IxIz_Iy)]TJ /F5 11.955 Tf 11.96 0 Td[(IxIyz_Iyz)]TJ /F5 11.955 Tf 11.95 0 Td[(IxzIxy_Iyz)]TJ /F5 11.955 Tf 11.96 0 Td[(IyzIxz_Ixy)]TJ /F5 11.955 Tf 11.95 0 Td[(I2xz_Iy)]TJ /F5 11.955 Tf 11.96 0 Td[(IxyIz_IxyQr=)]TJ /F5 11.955 Tf 9.3 0 Td[(IxIz_Iyz+IxIyz_Iz+IxzIxy_Iz)]TJ /F5 11.955 Tf 11.96 0 Td[(IyzIxz_Ixz+I2xz_Iyz)]TJ /F5 11.955 Tf 11.96 0 Td[(IxyIz_IxzQL=)]TJ /F5 11.955 Tf 9.3 0 Td[(IyzIxz)]TJ /F5 11.955 Tf 11.95 0 Td[(IxyIzQM=)]TJ /F5 11.955 Tf 9.3 0 Td[(IxIz+I2xzQN=)]TJ /F5 11.955 Tf 9.3 0 Td[(IxIyz)]TJ /F5 11.955 Tf 11.96 0 Td[(IxzIxyRp=I2xy_Ixz+IxzIy_Ix)]TJ /F5 11.955 Tf 11.96 0 Td[(IxIyz_Ixy+IyzIxy_Ix)]TJ /F5 11.955 Tf 11.95 0 Td[(IxzIxy_Ixy)]TJ /F5 11.955 Tf 11.96 0 Td[(IxIy_IxzRq=)]TJ /F5 11.955 Tf 9.29 0 Td[(IxzIy_Ixy+I2xy_Iyz+IxIyz_Iy)]TJ /F5 11.955 Tf 11.96 0 Td[(IyzIxy_Ixy+IxzIxy_Iy)]TJ /F5 11.955 Tf 11.96 0 Td[(IxIy_IyzRr=)]TJ /F5 11.955 Tf 9.29 0 Td[(IxzIy_Ixz)]TJ /F5 11.955 Tf 11.96 0 Td[(I2xy_Iz)]TJ /F5 11.955 Tf 11.95 0 Td[(IyzIxy_Ixz+IxIy_Iz)]TJ /F5 11.955 Tf 11.95 0 Td[(IxzIxy_Iyz)]TJ /F5 11.955 Tf 11.96 0 Td[(IxIyz_IyzRL=)]TJ /F5 11.955 Tf 9.3 0 Td[(IxzIy)]TJ /F5 11.955 Tf 11.95 0 Td[(IyzIxyRM=)]TJ /F5 11.955 Tf 9.3 0 Td[(IxzIxy)]TJ /F5 11.955 Tf 11.95 0 Td[(IxIyzRN=)]TJ /F5 11.955 Tf 9.3 0 Td[(IxIy+I2xy(2{65) Thecommondenominator,D,foundinEquation 2{64 isalsoexpressedasafunctionoftheinertialmoments,products,andrates,asseeninEquation 2{66 D=)]TJ /F5 11.955 Tf 9.29 0 Td[(IxIyIz+I2xzIy+IzI2xy+IxI2yz+2IyzIxyIxz(2{66) MotionvariablescanbeaccountedforinthemomentequationsbyexpressingthemasatermintheTaylorseriesexpansion,asseeninEquation 2{67 52


L=@L @uu+@L @vv+@L @ww+@L @qq+@L @pp+@L @rr+@L @aa+@L @rr+@L @eeM=@M @uu+@M @vv+@M @ww+@M @qq+@M @pp+@M @rr+@M @aa+@M @rr+@M @eeN=@N @uu+@N @vv+@N @ww+@N @qq+@N @pp+@N @rr+@N @aa+@N @rr+@N @ee(2{67) ThefullyexpandedsetoflinearizedmomentequationscanbeobtainedbyinsertingEquations 2{63 and 2{67 intoequation 2{63 andmultiplyingouttheterms. 2.5.2AsymmetricMorphing Figure2-7. AsymmetricCongurations Theasymmetriccaseassumesthatthereisnosymmetrytakenwithrespecttotheaircraft'scenterofgravity.Itisalsoassumedthattheaircraftisactivelymorphing,andtherefore,theinertialratesareretained.Themomentequationsspecictotheasymmetricmorphingcase,havepreviouslybeendenedandareshowninEquations 2{63 2{67 .Ifitisdeterminedthattheaircraftnolongermorphs,theinertialratesgotozeroandequation 2{63 canbefurtherreduced,asseeninEquation 2{68 Ix_p)]TJ /F5 11.955 Tf 11.96 0 Td[(Ixy_q)]TJ /F5 11.955 Tf 11.95 0 Td[(Ixz_r=L)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixy_p+Iy_q)]TJ /F5 11.955 Tf 11.95 0 Td[(Iyz_r=M)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixz_p)]TJ /F5 11.955 Tf 11.95 0 Td[(Iyz_q+Iz_r=N(2{68) 53


Figure2-8. SymmetricCongurations 2.5.3SymmetricConguration Thesymmetriccaseassumesthatthereissymmetryinthexy-andyz-planes.Asadirectresult,allofthetermsrelateddescribedbyIxyandIyzgotozero.Thesymmetricexampleissimilartoasymmetriccase,inthatitisalsoassumedtobeactivelymorphing.Therefore,theinertialratesareagainretainedandtheresultingmomentequationsforsymmetricmorphingcanbeshownbyEquation 2{69 Ix_p)]TJ /F5 11.955 Tf 11.96 0 Td[(Ixz_r=L)]TJ /F1 11.955 Tf 14.68 3.02 Td[(_Ixp+_Ixzr)]TJ /F5 11.955 Tf 9.3 0 Td[(Iy_q=M)]TJ /F1 11.955 Tf 14.68 3.03 Td[(_Iyq)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixz_p+Iz_r=N+_Ixzp)]TJ /F1 11.955 Tf 14.69 3.02 Td[(_Izr(2{69) Ifitisdeterminedthattheaircraftnolongermorphs,theinertialratesagaingotozeroandequation 2{69 canbereducedtothemomentequations,asseeninEquations 2{59 and 2{70 Ix_p)]TJ /F5 11.955 Tf 11.96 0 Td[(Ixz_r=LIy_q=M)]TJ /F5 11.955 Tf 9.3 0 Td[(Ixz_p+Iz_r=N(2{70) 54


2.6ATechnicalApproachtotheEquationsofMotion Theequationsofmotion,includingasymmetricandtime-varyingshapesofassociatedmorphingactuation,canbesimpliedintotheformgiveninEquation 2{71 .Thisformdescribesasystemwithnxstatesalongwithnmorphingactuatorsandnutraditionalactuatorssuchthatx2Rnxisthestatevector,2Rnisthecommandtomorphing,andu2Rnuisthecommandtotraditionalcontrolsurfaces.ThecoecientsintheequationsofmotionarecombinedintoA2RnxnxandB2Rnxnuwhicharefunctionsofboththemorphingconguration,,andtheightcondition,. _x=A(;)x+B(;)u(2{71) ThemodelinEquation 2{72a representstheightdynamicsforanaircraftwithaxedconguration.Inotherwords,thismodeldescribesanaircraftwithoutmorphing.Thismodelutilizesmatricesthatdependonanexogenous,butmeasurable,variablesuchasMachoraltitude.Thisformisactuallythelinearparameter-varying(LPV)dynamicswhichhavebeenextensivelystudied[ 42 ]. _x=A()x+B()uu=K()x(2{72a) ThemodelinEquation 2{72b representstheightdynamicsforanaircraftataxedightcondition.Theaircraftisallowedtomorph;however,theaerodynamicsdonotvarybecauseofMachoraltitudechanges.Theresearcherproposestodenotethisformaslinearinput-varyingdynamics(LIV)becauseofthedependencyonthecommandinputfordynamicswhicharelinearinthestates. _x=A()x+B()uu=K()x(2{72b) 55


Clearlyamorphingaircrafthashighlystructureddynamics.Inparticular,notethattheightdynamicsreverttoalinearstate-spaceforminEquation 2{72c whenbothmorphingandightconditionarexed.Themodelthusrepresentsanimportantphysicalaspectofmorphing;specically,theaircraftwillhavetraditionaldynamicsformaneuveringaroundtrimwhenmorphedintoaxedconguration. _x=Ax+Buu=Kx(2{72c) 56


CHAPTER3LINEARTIME-VARYINGEIGENSTRUCTURESANDTHEIRSTABILITY:ASURVEY 3.1DenitionofanLTVSystem Alinear-time-varying(LTV)systemcanbedenedbythecoupledlinearhomogeneousdierentialequationsshowninEquation 3{1 _x=A(t)x(t)+B(t)u(t)y(t)=C(t)x(t)+D(t)u(t)(3{1) Forthepurposesofstudyinthispaper,theLTVstateequationwillberestrictedtoformshowninEquation 3{2 _x=A(t)x(t)(3{2) FromEquation 3{2 ,itisnotedthatcoecientmatrix,A(t),iscomposedsuchthatA2R+!Rnxn,whilethestatevector,x(t),iscomposedsuchthatx2R+!Rn,andnisthenumberofstatesinthesystem.Usingthisdenitionofalineartime-varyingsystem,multipleconceptsforLTVeigenpairsandtheirstabilityhavebeendeveloped. 3.2Kamen'sConceptofPolesofanLTVSystem 3.2.1TwoStateSystem ConsiderasecondorderLTVsystemoftheform: x+a1(t)_x+a0(t)x(t)=0(3{3) whichcanbewrittenusingoperatornotationD=d dt,as (D2+a1(t)D+a0(t))x(t)=0(3{4) Ifthereexistfunctionsp1(t)andp2(t)suchthatonecanwrite (D2+a1(t)D+a0(t))x(t)=(D)]TJ /F5 11.955 Tf 11.95 0 Td[(p1(t))f(D)]TJ /F5 11.955 Tf 11.95 0 Td[(p2(t))x(t)g(3{5) 57


andwedenea(noncommutative)polynomialmultiplicationosuchthat f(D)]TJ /F5 11.955 Tf 11.96 0 Td[(p1(t))o(D)]TJ /F5 11.955 Tf 11.95 0 Td[(p2(t))gx(t)=(D)]TJ /F5 11.955 Tf 11.96 0 Td[(p1(t))f(D)]TJ /F5 11.955 Tf 11.96 0 Td[(p2(t))x(t)g(3{6) thencomparing 3{5 and 3{6 ,onecandeneDop2(t)=p2(t)D+_p2(t),andnallyarriveatanequationforp2as p22(t)+_p2(t)+a1(t)p2(t)+a0(t)=0(3{7) fromwhichonecanthendeterminep1using p1(t)+p2(t)=)]TJ /F5 11.955 Tf 9.3 0 Td[(a1(t)(3{8)(p1(t);p2(t))thenformapoleset,andp2(t)iscalledarightpole.Notethatthisisanorderedpoleset,andevenwhenp1(t)andp2(t)arecomplex,theyneednot,ingeneral,becomplexconjugate[ 59 ]. Themodeassociatedwitharightpolep2(t)isdenedas p2(t;0)=eRt0p2()d(3{9) andonecanwrite x(t)=C121(t;0)+C222(t;0)(3{10) wherep21andp22representtworightpolesdeterminedbysolvingequation 3{7 fromtwodierentinitialconditions(whicharetypicallythetwotimeinvariantpolesatt=0,alsoreferredtoasthe"frozen-time"rootsof 3{3 att=0);andC1andC2areconstants.21(t;0)and22(t;0)giveinformationaboutthestabilityoftheLTVsystem[ 59 ]. 3.2.2FourStateSystem Thegeneralizedformofa4-statesystemisexpressedinEquation 3{11 .Inthiscase,thederivativesofthestate,w(t),aremultipliedbyrealcoecientsofA0(t);A1(t);A2(t);A3(t).Theexpressionisalteredusingoperatornotation,givenasD=d dtasinEquation 3{4 ,togenerateEquation 3{12 58


0=d4w dt4+A3(t)d3w dt3+A2(t)d2w dt2+A1(t)dw dt+A0(t)w (3{11) =)]TJ /F5 11.955 Tf 5.48 -9.68 Td[(D4+A3(t)D3+A2(t)D2+A1(t)D+A0(t)w(t) (3{12) Theconceptofanordersetofpoles,(p1(t);p2(t);p3(t)p4(t)),isintroducedandrelatetothedynamicsasinEquation 3{13 )]TJ /F5 11.955 Tf 5.48 -9.69 Td[(D4+A3(t)D3+A2(t)D2+A1(t)D+A0(t)w(t)=(D)]TJ /F5 11.955 Tf 9.3 0 Td[(p1(t))[(D)]TJ /F5 11.955 Tf 9.3 0 Td[(p2(t)f(D)]TJ /F5 11.955 Tf 9.3 0 Td[(p3(t))[D)]TJ /F5 11.955 Tf 9.3 0 Td[(p4(t)]g]w(3{13) Therightpole,whichistheonlypoleneededtofullycharacterizethesystemisgeneratedasasolutiontoEquation 3{14 .Notethatagaintherightpole,p4,actuallyhas4valuesofp4iresultingfromchoiceofinitialconditionsforthepoles. 0=d3p4i dt3+(4p4i(t)+A3(t))d2p4i dt2+(6p24i(t)+A2(t)+3A3(t)p4i(t))dp4i dt+3(dp4i dt)2+p44i(t)+A3(t)p34i(t)+A2(t)p24i(t)+A1(t)p4i(t)+A0(t) (3{14) Asetofeigenvectorsareagainassociatedwitheachpole.Eacheigenvector,vi,anditassociatedpole,p4i,mustsatisfyEquation 3{15 (A(t))]TJ /F5 11.955 Tf 11.95 0 Td[(p4i(t))vi(t)=_vi(t)(3{15) Thestatesofthesystemarecomputedasalinearcombinationoftheseeigenvectorsandthemodes,givenasi=exp(Rt0p4i(t)),associatedwitheachpole.Theresultingexpressionisgivenalongwiththescalarconstants,Ci,inEquation 3{16 x(t)=C1v1(t)41(t)+C2v2(t)42(t)+C3v3(t)43(t)+C4v4(t)44(t)(3{16) 59


ThedecompositionofthestatesintotheformofEquation 3{16 indicatesthetime-varyingparametersessentiallydiagonalizethesystem.ConsiderthatamatrixdenedasV(t)=[v1(t)jv2(t)jv3(t)jv4(t)]willdiagonalizethesystemmatrixaslongasV(t)isinvertibleandbounded. ThestabilityofthesystemisdeterminedbytherelationshipinEquation 3{16 .Essentially,thesystemhasasymptoticstabilityforwhichstateswilltendtoequilibriumifandonlyifthemagnitudeofthemodegoestozeroastimegoesincreases.Thiscondition,whichisexpressedasj4ij!0ast!1foreachi=1;2;3;4,isequivalenttoaconditionontherealpartofthepolebeingR10pR()d<0. 3.3ZhuandJohnson Annth-order,scalar,lineartime-varying(LTV)system y(n)=Xnk=1k(t)y(k)]TJ /F7 7.97 Tf 6.59 0 Td[(1)(3{17) canbeconvenientlyrepresentedasDfyg=0usingthescalarpolynomialdierentialoperator(SPDO) D=n+Xnk=1k(t)k)]TJ /F7 7.97 Tf 6.59 0 Td[(1(3{18) where=d=dtisthederivativeoperatordenedonthedierentialring(D-ring),K. UsingatechniquedevelopedbyFloquet[ 39 ],theSPDOcanbefactoredinto D=()]TJ /F5 11.955 Tf 11.96 0 Td[(n(t))()]TJ /F5 11.955 Tf 11.96 0 Td[(2(t))()]TJ /F5 11.955 Tf 11.96 0 Td[(1(t))(3{19) IfDisdenedasanSPDOoperatorwithtime-varyingcoecients,k2K,k=1;2;:::;n,thenthescalarfunctionsk2K,k=1;2;:::;ngivenbythefactorizationofequation 3{19 arecalledSeriesD-eigenvalues(SD-eigenvalues)ofD.Moreover,ifthereexistssome(t)suchthat(t)=1(t),then(t)iscalledaParallelD-eigenvalue(PD-eigenvalues)ofD. 60


Amulti-setofSD-eigenvalues,)]TJ /F11 7.97 Tf 165.63 -1.79 Td[(=fk(t)gnk=1,canbedenedasaSeriesD-spectrum(SD-spectrum)forDifk(t)satisesequation 3{19 ;whereasamulti-setofPD-eigenvalues=fk(t)gnk=1canbedenedasaParallelD-spectrum(PD-spectrum)forDifk(t)arePD-eigenvaluesforDandfyk=exp(Rk(t)dt)gnk=1constitutesafundamentalsetofsolutionstoDfyg=0. Assumingthatfk(t)gnk=1isaSD-spectrumforannth-orderSPDOD,thenthePD-spectrumfk(t)gnk=1forDcanbedirectlyobtainedby k(t)=1(t)+_qk(t)q)]TJ /F7 7.97 Tf 6.58 0 Td[(1k(t);k=2;3;:::;n(3{20) where, qk(t)=Z21(t)Z32(t)ZZk;k)]TJ /F7 7.97 Tf 6.59 0 Td[(1(t)dk)]TJ /F7 7.97 Tf 6.59 0 Td[(1t(3{21) and ij(t)=eR(i(t))]TJ /F11 7.97 Tf 6.58 0 Td[(j(t))dt(3{22) Thefactthatascalarequationcanalwaysbetransformedintoanequivalentcompanioncanonicalvectorequation,_x=Ac(t)x,leadsonetodenethecompanionmatrixassociatedwithD,Ac(t)as Ac(t)=2666666666640100...........................0001)]TJ /F5 11.955 Tf 9.3 0 Td[(1)]TJ /F5 11.955 Tf 9.3 0 Td[(2)]TJ /F5 11.955 Tf 61.1 0 Td[(n377777777775(3{23) whichdirectlyresultsinthematrices 61


\(t)=2666666666641(t)10002(t).....................0............100n(t)377777777775(3{24) and (t)=diag1(t)2(t)n(t)(3{25) denedasaSeriesSpectralcanonicalform(SScanonicalform)andaParallelSpectralcanonicalform(PS-canonicalform),repectively.ItisimportanttonotethatbothmatricesaredenedoverthebasisdescribedbyDandAc(t),andthatforanytime-invariantD,therealwaysexistsanSD-spectrumoftime-invariantisatisfyingequation 3{19 Welldened(freeofnite-timesingularities)SD-andPD-spectracanbeusedtoderiveanalyticalsolutionsandstabilitycriteriaforLTVsystemsinawaysimilartothoseforLTIsystems.Inparticular,iffk(t)gnk=1isawell-denedPD-spectrumforD,thenthegeneralsolutiony(t)toDfyg=0isgivenby y(t)=nXi=1CieRi(t)dt whereCiareconstantsofintegrationdeterminedbyinitialconditions. 3.3.1GeneralizedPD-Eigenvectors AssumingthatDisannth-orderSPDOwithaPD-spectrumfk(t)gnk=1andthatfyi(t)gnk=1isafundamentalsetofsolutionsforDfyg=0,suchthatyi(t)=eR(i(t)dt),thenthematrix,D,canbedenotedbythediagonalmatrix D=diag[y1y2:::yn](3{26) 62


Then WD)]TJ /F7 7.97 Tf 6.58 0 Td[(1=V(12:::n)=266666666664111D1f1gD2f1gDnf1gD21f1gD22f1gD2nf1g............Dn)]TJ /F7 7.97 Tf 6.58 0 Td[(11f1gDn)]TJ /F7 7.97 Tf 6.59 0 Td[(1nf1g377777777775(3{27) and detV=detWnk=1y)]TJ /F7 7.97 Tf 6.59 0 Td[(1k(3{28) whereD1=(+i),Dki=DiDk)]TJ /F7 7.97 Tf 6.58 0 Td[(1i,andW=W(y1y2:::yn)istheWronskianmatrixassociatedwithfyigni=1. ThecanonicalcoordinatetransformationmatrixV(t)iscalledthemodalcanonicalmatrixforDassociatedwiththePD-spectrumfigni=1andthedeterminantinequation 3{28 iscalledtheassociatedmodaldeterminant.Itisnotedthatthecolumnvectorsvi(t)ofV(t)satisfy Ac(t)vi(t))]TJ /F5 11.955 Tf 11.96 0 Td[(i(t)vi(t)=_vi(t)(3{29) andtherowvectorsuTi(t)ofV(t)satisfy UTi(t)Ac(t))]TJ /F5 11.955 Tf 11.96 0 Td[(i(t)UTi(t)=_UTi(t)(3{30) Thus,vi(t)anduTi(t)havebeencalledcolumnPD-eigenvectorsandrowPD-eigenvectors,respectively,ofDassociatedwithit. 3.3.2StabilityCriteria AssumingthatDisawell-denednth-orderSPDOwithawell-denedPD-spectrumfk(t)gnk=1inI=[T0;1),suchthatvk(t)anduTi(t)arecolumnPD-eigenvectorsandrow 63


PD-eigenvectorsassociatedwithk(t),respectively.ThenthenullsolutiontoDfyg=0isuniformlyasymptoticallystableforallt0T0ifandonlyif thereexistsa00and0

issaidtobethemode-vectorofA(t)associatedwiththex-eigenpairfi(t);ui(t)gandisusedtodeterminethestabilityofthelineartime-varyingsystem. IfA(t)hasndistincteigenvalues,thenA(t)canalwaysbediagonalizedbyanon-singularmatrixformedbytheeigenvectorsofA(t).Thus,thex-eigenvectorsofA(t)arefoundbyusingtheeigenvectorsofA(t)andthederivedmatricesobtainedfromA(t). Toobtainthex-eigenpairsofA(t),itisrstassumedthatj=1andAj(t)=A(t).TheeigenpairsofA(t),fji(t);uji(t)gi=1;2;:::;narethencomputedtocheckfordistinctnessoftheeigenvalues,fji(t)gni. Iftheeigenvaluesaredistinctthen Sj(t)=[u1j(t)u2j(t):::unj(t)](3{34) where j(t)=diag[1j(t)2j(t):::nj(t)](3{35) butiftheeigenvalues,fji(t)gni,arenotdistinct,thenanon-singularmatrixSj(t)ischosen.OnceSj(t)andj(t)hasbeendetermined,thedierentialequation Ej(t)=_Sj(t)S)]TJ /F7 7.97 Tf 6.59 0 Td[(1j(t)+Aj(t))]TJ /F9 11.955 Tf 11.95 0 Td[(A(t)(3{36) issolved.ForcaseswhereEj(t)0,thenSj(t)=S(t)andj(t)=(t).Thecolumns,ui(t)ofS(t)givethex-eigenvectorsofA(t)andtheelementsof(t),fi(t);ui(t)g,givethex-eigenvaluesofA(t).ForcaseswhereEj(t)6=0,thenj=j+1andAj(t)=Aj)]TJ /F7 7.97 Tf 6.58 0 Td[(1(t))]TJ /F9 11.955 Tf 11.45 0 Td[(Ej)]TJ /F7 7.97 Tf 6.59 0 Td[(1(t).TheprocedureisthencontinuedbyrecalculatingtheeigenpairsofA(t),fji(t);uji(t)gi=1;2;:::;nandcheckingfortheirdistinctness.TheiterationprocessesendswhenEj(t)0. Thecalulatedx-eigenpaircanthenbeusedtoproduceasystemresponsesuchthat 65


x(t)=C1eR1(t)dte1(t)+C2eR2(t)dte2(t) whereC1andC2arecontantsofintegrationdeterminedbyinitialconditions. 3.4.2StabilityCriteria Anecessaryconditionforasymptoticstabilityandthesucientconditionfortheinstabilityofthesystem,equation 3{31 ,canbeexplicitlyanddirectlycheckedformthesystemmatrixA(t). Thenecessaryconditionforthesystem,equation 3{31 ,tobeasymptoticallystable,isthatforanyt>t0,tRt0trA()d!t!1.WheretristhetraceofA(t)andisrepresentedasA(t)=nPi=1aii(t). Thesucientconditionforinstabilityofthesystem,equation 3{31 ,isthatforanyt>t0,tRt0trA()d!1t!1. Necessaryandsucientconditionsforasymptoticstabilityandinstability,respectively,canalsobedescribedforthelineartime-varyingsystem y(n)+a1(t)y(n)]TJ /F7 7.97 Tf 6.59 0 Td[(1)+:::+an(t)y=0(3{37) Asucientconditionforinstabilityofthesystem,equation 3{37 ,isdescribedby tZtoa1()d!t!1(3{38) whereanecessaryconditionforasymptoticstabilityisdescribedby tZtoa1()d!1t!1(3{39) Thenecessaryandsucientconditionspresentedthusfaronlyprovidepartialanswerstothestabilityoflineartime-varyingsystems.Therefore,necessaryandsucientconditionsforthestabilityoflineartime-varyingsystems,intermsofmode-vectors, 66


aredeveloped.Recallthatthemode-vectorsarenon-zerodierentiablevectorsofA(t),associatedwiththex-eigenpairfi(t);ui(t)g. Thelineartime-varyingsystem, 3{31 ,isstableifandonlyifeverymode-vectormi(t)ofA(t)isboundedsuchthat kmi(t)k<1t>t0;i=1;2;:::;n(3{40) andasymptoticallystableifandonlyif,inadditiontoequation 3{39 kmi(t)k!0t!1;i=1;2;:::;n(3{41) 3.5O'BrienandIglesias 3.5.1Formulation Consideralineartime-varyingsystemasdescribedinEquation 3{42 forsomestatevector,x(t)2Rn,andassociatedmatrix,A(t)2Rnn,forallt2R. _x(t)=A(t)x(t)(3{42) Introduceanewvectorofstates,z(t)2Rn,whichrelatestox(t)throughatransformation,S(t)2Rnn,forallt2R.Therelationshipresultsasz(t)=S)]TJ /F7 7.97 Tf 6.59 0 Td[(1(t)x(t).TheexpressioninEquation 3{42 forx(t)isthuswrittenintermsofz(t)inEquation 3{43 _S(t)z(t)+S(t)_z(t)=A(t)S(t)z(t) (3{43) S(t)_z(t)=A(t)S(t)z(t))]TJ /F1 11.955 Tf 15.25 3.02 Td[(_S(t)z(t) (3{44) _z(t)=S)]TJ /F7 7.97 Tf 6.59 0 Td[(1(t)A(t)S(t))]TJ /F5 11.955 Tf 11.96 0 Td[(S)]TJ /F7 7.97 Tf 6.59 0 Td[(1(t)_S(t)z(t) (3{45) Denethematrix,P(t)=S)]TJ /F7 7.97 Tf 6.58 0 Td[(1(t)A(t)S(t))]TJ /F5 11.955 Tf 12.42 0 Td[(S)]TJ /F7 7.97 Tf 6.59 0 Td[(1(t)_S(t),suchthatEquation 3{45 isexpressedasEquation 3{46 67


_z(t)=P(t)z(t)(3{46) ThestabilityofthesysteminEquation 3{42 isequivalenttothestabilityofthesysteminEquation 3{46 ifthematrix,S(t)isaLyapunovtransformation.Suchequivalenceisparticularlyadvantageousinthatcertainconditionscanbeimposedsuchthatthestatematrix,P(t),inEquation 3{46 isuppertriangularforallt2R.Assuch,thepolesandassociatedstabilityofP(t)arerelativelyeasytoextract. ApolesetofP(t)isdenedbasedonitsnatureasuppertriangular.Thisset,asgiveninDenition 3.5.1 ,utilizestransitionmatricesforbothP(t)andS(t). Denition3.5.1. ThesetoffunctionsP:=fp1;:::;pnginL1(C)isapolesetofAifthereexistfunctionskij2CL1,i=1;:::;n;j>iandaninvertiblenxnmatrixS0suchthat S(t)=A(t;0)S0)]TJ /F7 7.97 Tf 6.59 0 Td[(1P(t;0);t2R+(3{47) isaLyapunovtransformationwhereP=fpijgand pij=8>>>><>>>>:pi:i=jkij:ij(3{48) AsuitablechoiceofS(t)hasbeenshowntobetheuniquesolutionofthematrixdierentialequation,giveninEquation 3{49 ,whichresultsinaLyapunovtransformation[ 126 127 ].NotethisexpressionagreeswiththepreviousdenitionforP(t)fromEquation 3{45 _S(t)=A(t)S(t))]TJ /F9 11.955 Tf 11.96 0 Td[(S(t)P(t);S(0)=S0(3{49) ThepolesetasgiveninDenition 3.5.1 dependsonthestate-transitionmatrix,A(t;0),associatedwiththesysteminEquation 3{42 .Thismatrixcanbedirectly 68


computedusingknowledgeofA(t)soitrepresentsaknownquantity.Furthermore,thismatrixcanbeseparatedintoelementsusingastandardQR-decompositionusinganorthogonalmatrixofQ2RnnwithQQ1=IandanuppertriangularmatrixofR2RnnasinEquation 3{50 A(t;0)=Q(t)R(t)(3{50) TheelementsinEquation 3{50 arecomparedtotherelationshipinEquation 3{47 whichcanbeexpressedasA(t;0)=S(t)P(t;0)S)]TJ /F7 7.97 Tf 6.59 0 Td[(10.Inthisway,thecomputationofS(t)isdirectlycomputedastheorthogonalmatrixoftheq-rdecompositionwhilethetransitionmatrixassociatedwiththestabilitymatrixofP(t)iscomputedasthetriangularmatrixusingtheequivalanceinEquation 3{51 A(t;0)=[Q(t)][R(t)]=[S(t)]P(t;0)S)]TJ /F7 7.97 Tf 6.59 0 Td[(10(3{51) Inthisway,astraightforwardq-rdecompositionisusedtodetermineboththepolesofP(t)andthemodeshapesofS(t).Suchanapproachishighlyadvantageouscomputationallysincetheelementsareeasilyfoundusingmaturealgorithms. Anissueofnoteisthenon-uniquenatureofthisdecomposition.Essentially,thematricesassociatedwithaq-rdecompositioncanbescaledbyanyunitarymatrix.Theinformationrelatingtostabilityisretained;however,theneedtointerpretthepolesissomewhathighlightedbythisresult.Considerthatthisnon-uniquenatureimpliesthatthesignofanyrealvaluealongthediagonalofR(t)bearbitrarilychangedsotheconceptofamodemustreecttheabilitytovarythesignofP(t;0)usingtherelationshipfromEquation 3{51 3.5.2StabilityCriteria Anotionofstabilitymustbedenedforthetime-varyingsystemgiveninEquation 3{42 thatrelatesusefulproperties.Inthiscase,stabilityreferstothestateremainingbounded 69


byanexponentialdecay.ThisnotionisuniformexponentialstabilityandisdescribedinDenition 3.5.2 Denition3.5.2. Thestateequation,_x(t)=A(t)x(t)withx(0)=xo,isuniformlyexponentiallystableifthereexistnite,positiveconstantsof;2RsuchthatkA(t;)ke)]TJ /F11 7.97 Tf 6.59 0 Td[((t)]TJ /F11 7.97 Tf 6.59 0 Td[() Asimilarnotionofstabilityisassociatedwiththepolesandtheirstabilitymodes.ThisnotionalsorequiresthetransitionmatrixtoremainboundedbyanexponentialdecayasnotedinDenition 3.5.3 [ 86 ]. Denition3.5.3. Thestabilitymodesassociatedwithp2CL1(C)isuniformlyexponentiallystableifthereexistsnite,positiveconstantsof;2Rsuchthatjp(t;t0)je)]TJ /F11 7.97 Tf 6.59 0 Td[((t)]TJ /F11 7.97 Tf 6.59 0 Td[(t0);8(tt00) Arelaxednotionofstabilityisalsodenedinwhichthetransitionremainsboundedandconvergestotheorigin.ThisnotionofasymptoticalstabilityisdescribedinDenition 3.5.4 [ 86 ]. Denition3.5.4. Thestabilitymodeassociatedwithp2CL1(C)isasymptoticallystableif,foranyto2R+,thereexistsanite,positiveconstantsuchthatjp(t;t0)j6;tt0andjp(t;t0)j!0;t!1. AnotionofsimplyremainingboundedisalsousedtodescribestabilityasuniformlystableinDenition 3.5.5 [ 86 ]. Denition3.5.5. Thestabilitymodeassociatedwithp2CL1(C)isuniformlystableifthereexistsanite,positiveconstantsuchthatjp(t;t0)j6;8(tt00). Finally,ageneralizedconceptofboundednessisgivenasnonexponentialinDenition 3.5.6 Denition3.5.6. Thestabilitymodesassociatedwithp2CL1(C)isnon-exponentialifthereexistsnite,positiveconstants1;2suchthat16jp(t;t0)j62;8(tt00). ThefundamentaltheoremisstatedinTheorem 3.5.7 whichnoteshowconditionsonthestabilitymodescanguaranteestabilityofthesystem.Theproofisnotpresentedhere;however,suchaproofisgivenintheliterature[ 86 ]. 70


Theorem3.5.7. SupposethatA(t)hasapolesetofP.ThenthesystemofEquation 3{42 isuniformlyexponentiallystableifandonlyifpicorrespondstoanexponentiallystablemodefori2[1;n]. 3.5.3SpecialCases SpecialcasesdoexistwherethematrixfunctionA(t)isneitherconstantwithtimenorcontinuouslyvaryingwithtime.Infact,A(t)canfollowthenatureofaT-periodicsystemoronewithanitetime-variation. Recallingthefactthataperiodicstateequationcanequalatime-invariantstateequationbymeansofaFloquetdecomposition[ 39 ];Itcanbeshownthatthetime-invarianteigenvaluesdeterminethestabilityoftheequivalentperiodicstateequationandarecalledcharacteristicexponents[ 25 ].Thissetofcharacteristicexponentscanthenbesaidtoformapolesetoftheperiodicstateequation.Moreprecisely,supposethatAisT-periodic;thatis,thereexistsaniteT0suchthatA(t+T)=A(t)forallt2R.Thenitcanbeshown[ 86 ]thatthecharacteristicexponentsofAareapolesetofA. Whenthematrixfunction,A(t),hasanitetime-variation;thatisA(t)isconstantoutsideaniteinterval,itcanbesaidthatthefrozen-timeeigenvaluesformapolesetofA.Asmentionedearlier,thisisnotthecasewhenA(t)iscontinuouslyvaryingwithtime.Itisdirectlyduetothefactthatthefrozen-timeeigenvaluesmayormaynotcontaininformationabouttheoriginalstateequation,equation 3{42 .Moreprecisely,supposethatthereexistsaniteT>0suchthatA(t)=ATforalltT.Thenitcanbeshown[ 86 ]thesetoffrozen-timeeigenvaluesfi(t)gni=1satisfyingdet(A(t))]TJ /F5 11.955 Tf 12.53 0 Td[(i(t)I)=0ateacht2R+isapolesetofA. 3.6MethodologyComparisons Theeigenstructureforalineartime-varyingsystemcanbefoundbyvariousmethodologies,yeteachisspecictoitsown.Individualmethodsaredevelopedfromabasicsetofassumptionsspecictothemathematicalapproachitisbuiltupon,andthereforepossessesitsowncomparativeadvantages. 71


Kamen'smethodinvolvescomputinganth-orderinput-outputdierenceequationwithtimevaryingcoecients.Thisdierenceequationisbasedonthesystem'slineartime-varyingdynamics,andfromit,anorderedpairofrightandlefteigenvaluescanbecalculated.Therighteigenvaluesarethenusedtodescribethesystem'stransientperformanceandstability.AfewbenetsofKamen'smethodinclude Arightpoleset,p21(t);p22(t),canbelinkedtothetime-invariantsystemviainitialconditions(frozentimeeigenvaluesatt=tdesired) TheVandermondematrix,V(t),diagonalizesthesystemmatrixwhenV(t)isinvertibleandbounded ThecalculatedLTVpolesareuniqueforalmostallinitialconditions Integratingtherightpolesetcaninuencethestabilityofthesystem whereas,thedisadvantagesinclude LTVpolescansometimeshaveanite-timesingularity,resultinginp21(t);p22(t)! Higherordersystemsaremorediculttoconvertintoaninput-outputordinarydierentialequation ZhuandJohnson'smethodalsoutilizesthenth-orderinput-outputdierenceequation,butinadditionaddsastatespaceapproachbyndingasimilaritytransformation,L(t),withdet(L(t))=constant,suchthat_z=L)]TJ /F7 7.97 Tf 6.59 0 Td[(1(AL)]TJ /F1 11.955 Tf 15.65 3.02 Td[(_L)z.InsteadofdeningLTVpolesbyrightandleftsets,ZhuandJohnsonuseorderedpolessetscalledSeriesD-spectra(SD-spectra)andParallelD-spectra(PD-spectra).AdeningbenetofZhuandJohnson'smethod,isthattheLTVpolesetscanbederivedaswell-dened(freeofnite-timesingularities). O'BrienandIglesias'smethodintroducesastate-spaceonlyapproachtosolvingforthetime-varyingeigenstructure.ItisshownthatbyapplyingaQRdecompositiontothecalculatedtransitionmatirx,eigenvectorsandeigenvaluescanbecomputed.BenetstoO'BrienandIglesias'smethodinclude Polesgiveinformationonstabilitythroughassociatedstabilitymodes 72


Stabilitymodesarealwayscalculatedbeforepoles,thereforeassuringthatthepolesarealwaysbounded Moresuitableforhigherordersystems StabilityispreservedthroughLyapunovtransformations whereas,thedisadvantagesinclude TheLTVpolesblowuparoundii=0,wherepii=_ii.ii Thismethoddoesnotalwaysdiagonalizethesystem TheLTVpolescannotbelinkedtothetime-invariantsystem TheLTVpolesarenon-uniqueduetothenon-uniquenessoftheQRdecomposition Wu'smethodintroducesaslightydierentapproachtosolvingforlineartime-varyingsystemsinthestate-spaceform.X-eigenpairs,fi(t);ui(t)g,arefoundbyevaluatingthematrixdierential, 3{36 ,withanonsingularmatrix,S(t),developedfromtheeigenvectorsofA(t).BenetsofWu'smethodinclude Thesystemmatrixcanalwaysbediagonalized Thex-eigenpairinuencesstability whereas,thedisadvantagesinclude Thex-eigenpairisnotnecessarilylinkedtotheinitialLTIsystem Thex-eigenpairisnotunique 73


CHAPTER4LINEARTIME-VARYINGMODALANALYSIS 4.1SystemDynamics Theconceptofaneigenvalue/eigenvectoranditsrelationshiptomodaldynamicsiswelldenedfortime-invariantsystems[ 88 ];however,thissamerelationshipissomewhatunderdevelopedfortime-varyingsystems.Thepurposeofthischapteristointroducenewconceptsusedfortime-varyingmodalanalysis.Tobegin,areviewofsomebasictime-invariantconceptswillbegiven. 4.1.1LinearTime-InvariantSystems:Formulation AsystemisconsideredtobeLinearTime-Invariant(LTI)ifitexhibitsbothlinearityandtimeinvariance. Linearitycanbedenedasanyrelationshipbetweenasystem'sinputandoutput,suchthatitpreservestheoperationsofsuperpositionandscalarmultiplication.Thepropertiesofscalarmultiplicationandsuperpositionofalinearsystem,y=f(x),areshowninEquation 4{1 ,respectively. f(x)=f(x)f(x1+x2)=f(x1)+f(x2)(4{1) Time-invariancealsoreferstoshift-invariance,whichstatesthatifaninputtoasystemisshiftedbysometime,t,thentheoutputofthatsystemwillalsobetimeshiftedbyt,asshowninEquation 4{2 y(t)=f(t)y(t)]TJ /F1 11.955 Tf 11.96 0 Td[(t)=f(t)]TJ /F1 11.955 Tf 11.96 0 Td[(t)(4{2) Inotherwords,atime-invariantsystemisonewhosebehavior(itsresponsetoinputs)doesnotchangewithtime. ThefundamentalresultinLTIsystemtheoryisthatanyLTIsystemcanbecharacterizedentirelybyasinglefunctioncalledthesystem'simpulseresponse.The 74


outputofthesystemissimplytheconvolutionoftheinputtothesystemwiththesystem'simpulseresponse.Thismethodofanalysisisoftencalledthetimedomainpoint-of-view.Thesameresultistrueofdiscrete-timelinearshift-invariantsystemsinwhichsignalsarediscrete-timesamples,andconvolutionisdenedonsequences Equivalently,anyLTIsystemcanbecharacterizedinthefrequencydomainbythesystem'stransferfunction,whichistheLaplacetransformofthesystem'simpulseresponse(orZtransforminthecaseofdiscrete-timesystems).Asaresultofthepropertiesofthesetransforms,theoutputofthesysteminthefrequencydomainistheproductofthetransferfunctionandthetransformoftheinput.Consequently,convolutioninthetimedomainisequivalenttomultiplicationinthefrequencydomain MostLTIsystemconceptsaresimilarbetweenthecontinuous-timeanddiscrete-time(linearshift-invariant)cases. 4.1.2LinearTime-InvariantSystems:Response ConsideranLTIsystemdenedbyadierentialequation,asrepresentedinEquation 4{3 oritsequivalentstate-spacerepresentation,asrepresentedinEquation 4{4 xn+a1xn)]TJ /F7 7.97 Tf 6.59 0 Td[(1+:::+an)]TJ /F7 7.97 Tf 6.58 0 Td[(1_x+anx=p(t)(4{3) _x=Ax+Bu(4{4) Thecompletesolution,x(t),ofEquation 4{3 isderivedfromtwoparts,theparticularsolution(forcedresponse)andthecomplimentarysolution(naturalresponse).Theparticularsolutiondependsonthefunctionalformoftheinput,p(t),whilethecomplimentarysolutionisfoundbysettingtheinputfunctiontozeroandsolvingtheassociatedhomogeneousdierentialequation.Forthepurposesofthispaper,onlythecomplimentaryornaturalresponsewillbeconsidered. Foradynamicsystem,boththenaturalandforcedresponseconsistsofatransientandsteady-stateportion.Thetransientresponseisdenedastheresponsegeneratedby 75


thesystem'schangefrominitialconditiontonalstate,whereasthesteady-stateresponseisdenedasthebehaviorofthesystem'soutputastimegoestoinnity. TheunforcedornaturalresponseforeachstatecanthenbedescribedasthesolutiontohomogeneoussolutiontoEquation 4{4 ,asseeninEquation 4{5 x(t)=nXi=1viexpit(4{5) TheeigenvectorisshowninEquation 4{5 asvi,whiletheeigenvaluesarerepresentedbyi.TakingthederivativeonbothsidesofEquation 4{5 andsubstitutingintheunforcedversionofEquation 4{4 for_x,resultsinthewellknowneigenvector-eigenvaluerelationshowninEquation 4{6 Ax=x(4{6) 4.1.3LinearTime-VaryingSystems:Formulation Lineartime-Varying(LTV)systemssharethesamelinearpropertiesasthepreviouslymentionedLTIsystem,yettheLTVsystemisnottime-invariantorshift-invariant.Thisfactsuggeststhatifaninputtoasystemisshiftedbysometime,t,thentheoutputofthatsystemwillnotbetimeshiftedbythesamet,asshowninEquation 4{7 y(t)]TJ /F1 11.955 Tf 11.96 0 Td[(t)6=f(t)]TJ /F1 11.955 Tf 11.96 0 Td[(t)(4{7) Assumingthatthelineartime-varyingstateequationisdenotedinstate-spaceform,asshowninEqutaion 4{8 ,andthatAisacontinuous,uniformlyboundedfunction(A2CL1),thenthestatespacerealizationcanbeshowntohavetheformdescribedbyEquation 4{9 _x(t)=A(t)x(t);x(0)=x0(4{8) 76


G:=264A B C D375=8><>:_x(t)=A(t)x(t)+B(t)u(t)y(t)=C(t)x(t)+D(t)u(t)9>=>;(4{9) ItwillalsobeassumedthateachcoecientmatrixgeneratedbyG,isagainanelementofthecontinuous,uniformlyboundedspace(CL1). Forthecaseofmultivariablelinear,time-varyingsystems,aneigenstructureequation,reminiscentoftheclassicallydenedeigenvector-eigenvalueequationforconstantmatrices(Equation 4{6 ),canbedenedandshownasEquation 4{10 (A(t))]TJ /F5 11.955 Tf 11.96 0 Td[(pi(t)I)x(i)(t)=_x(i)(t);i=1;:::;n(4{10) InEquation 4{10 ,thetime-varyingeigenvalueisdenedaspi(t),wheretheassociatedtime-varyingeigenvectorisdenedasx(i)(t).Thestabilityofthestateequation,Equation 4{8 ,hasbeenshowntohavearelationdirectlylinkedtothebehaviorofthetermsinEquation 4{11 [ 126 ];[ 127 ]. Zt0pi()dx(i)(t);i=1;:::;n(4{11) Thestabilityofthestateequationhasalsobeenshowntohavearelationdirectlyrelatedtothemodesasscoiatedwitheachpolepi(t)[ 86 ];[ 130 ];[ 131 ],asshowninEquation 4{12 Zt0pi()d;i=1;:::;n(4{12) 4.1.4LinearTime-VaryingSystems:Response First,considerthetime-varyingresponseequationdenedusingthemodedenitionsprovidedbyWu[ 126 ]andKamen[ 59 ],asshowninEqaution 4{13 x(t)=nPi=1Cii(t)exphRt0pi()dix(t)=nPi=1Cii(t)(4{13) 77


InEquation 4{13 ,thetime-varyingpoles,pi,arecomposedsuchthatpi:R+!C,whilethetime-varyingeigenvectors,i,arecomposedsuchthati:R+!CN.Itshouldbenotedthatthetime-varyingeigenvectorsareassumedtobedierentiableforalltime,tandthateacheachlinearly-independentsolution,i(t),canbedenedasamodeofthesystem[ 126 ]. Asecondtime-varyingresponseequationcanbedenedusingthemodedenitionsprovidedbyO'Brien[ 86 ],asshowninEqaution 4{14 x(t)=A(t;0)x0(4{14) InEquation 4{14 ,A(t;0)isrepresentativeofthetime-varyingstatetransitionmatrixandcanberelatedtothetime-varyingpolesandeigenvectorsviaEquation 3{51 BothEquation 4{13 and 4{13 mayberearrangedsuchthatarelationshipcanbedevelopedbetweenthetime-varyingpoles/eigenvectorsandthecoeeicentmatrix,A(t).ThisrelationshipisdeemedanLTVEigenrelation[ 112 ],anddependingonthetime-varyingalgorithmused,canbeshownaseitherEquation 3{29 3{32 ,or 3{49 .Anysetoftime-varyingpolesandeigenvectorsthatsatisfytheseequationswillbereferredtoasanLTVEigenpair[ 112 ]. GiventhisdenitionofanLTVeigenpair,itcanbeshownthatneitherthestabilitynorthefrequencycharacteristicsofanLTVsystemcanbedeterminedfromeithertheLTVpolesoreigenvectorsalone.Instead,eacheigenpairmustbeanalyzedtogetherasawhole.SinceLTIanalysistechniquesarebasedontheassumptionthatstabilityandoscillatorycharacteristicsareisolatedwithinthepoles,newanalysistechniquesareclearlynecessary. 4.2ModalInterpretation:Kamen Considertheoscillatoryresponseofa2-statesystem,asoriginallygiveninEquation 3{10 ,withthecoecientsnormalizedtoeasepresentationasinEquation 4{15 .SubstitutethedenitionofmodeintermsofpolesfromEquation 3{9 togenerateEquation 4{16 .Also, 78


assumethegeneralizedpolestobecomplexconjugatessuchthatp21=p22=pR+|pIasinEquation 4{17 .ThecomplexexponentialscanthenbeexpressedintermsofsinesandcosinesasinEquation 4{18 andcombinedtogenerateEquation 4{19 x(t)=1(t)+2(t) (4{15) =eRt0p21()d+eRt0p22()d (4{16) =eRt0(pR()+|pI())d+eRt0(pR()+|pI())d (4{17) =eRt0pR()dcosZt0pI()d+|eRt0pR()dsinZt0pI()d+eRt0pR()dcosZt0pI()d)]TJ /F5 11.955 Tf 11.96 0 Td[(|eRt0pR()dsinZt0pI()d (4{18) =2eRt0pR()dcosZt0pI()d (4{19) AnoscillatoryresponsewithdecayisdemonstratedinEquation 4{19 tobegeneratedbyapairofpoleswhicharecomplexconjugates.Thenatureoftheoscillationsandthedecayarebothdeterminedbytheintegralsofrealandimaginarypartsofthesepoles.Also,theequal-but-oppositenatureoftheimaginarypartsofthesepolesmeanstheresponseinEquation 4{19 issimplydoubletherealpartofthemodeasnotedinEquation 4{18 4.2.1Damping Thedecayingnatureoftheresponse,whichissimilartothedampingratioofalineartime-invariantsystem,isdeterminedbythevaryingmagnitudeoftheexponentialinEquation 4{19 .TheresultingenvelopeisgiveninEquation 4{20 usingtherealpartofthepoleandequivalentlyinEquation 4{21 byaddingthecomplex-conjugatepoles. envelope(x(t))=eRt0pR()d (4{20) =eRt0p21()+p22() 2d (4{21) 79


4.2.2Frequency Theoscillationsoccurwithafrequencyrelatedtotheimaginarypartofthetime-varyingpole.Atime-varyingequivalenttonaturalfrequency,!(t),isgeneratedbycomparingthecosinetermofEquation 4{19 toastandardtermindynamicsofcos(!t).Thetime-varyingequivalenttoanaturalfrequencyresultsfromthiscomparisonandisgiveninEquation 4{22 .Notethatanystablesystemwillhave!tendto0astimeincreases. !(t)=Rt0pI()d t(4{22) TheperiodicityoftheoscillationsresultsdirectlyfrominvertingthefrequencyofEquation 4{22 andisgiveninEquation 4{23 .Alternatively,suchperiodicitycanresultsimplybynotingwhentheangleinthecosinetermrepeatsitselfasgiveninEquation 4{24 T(t)=2t Rt0pI()d (4{23) =maxT>02R2 2T:Zt0pI()d=Zt+T0pI()d=0 (4{24) Also,atime-varyingequivalenttodampingratioiscomputedbyrelatingtheenvelopeofEquation 4{20 andthefrequencyinEquation 4{22 .Essentially,theenvelopeisequivalentto)]TJ /F5 11.955 Tf 9.3 0 Td[(!nandthefrequencyisrelatedto!np 1)]TJ /F5 11.955 Tf 11.95 0 Td[(2.theresultingdampingratioisgiveninEquation 4{25 (t)=vuut 1 1+Rt0pI()d Rt0pR()d2(4{25) 80


4.3ModalInterpretation:O'Brien 4.3.1DampingandNaturalFrequency Considerthesame2-stateoscillatorysystemdescribedbyEquation 3{10 ,butnowrepresentedasthestate-spacesystemshowninEquation 4{4 Theresponseofthesystem'sdynamicswillvaryinmagnitudeaccordingtotheassociatedstability.Theparameterofdampingisusedtodescribetherateofvariationinthisresponsewithpositivedampingusedforstablesystemsthatdecaytozeroandnegativedampingusedforunstablesystemsthatgrowtoinnity. Therateofmagnitudevariationcanbeextractedfromthepairofpolesassociatedwiththemode.Considerthatthetime-invariantdynamicshavecomplex-conjugatepoleswith1=2=R+|IsoR=1+2 2.Asimilarrelationholdsforthepolesofthetime-varyingsystemasshowninEquation 4{26 envelope(x(t))=expp1(t)+p2(t) 2(4{26) Simulationresultssuggeststhatthetime-varyingfrequencyoftheoscillatorybehaviorcanbeapproximatedbythedominantzero-crossingperiodicityoftheeigenvectors.Forsimplicty,anapproximationisformulatedbyassumingthesystemresponsemaintainsasinusoidalnature.Inthiscase,thematricesderivedbydecomposingthestate-transitionmatrixwillalsohaveasinusoidalnature.Abasicpropertyofanysinusoidgivenasx(t)=sin(!t)hasx(t)=)]TJ /F5 11.955 Tf 9.3 0 Td[(!2sin(!t)sothefrequencyofoscillationisgeneratedby!=q )]TJ /F7 7.97 Tf 10.99 4.71 Td[(x x.Therefore,theresultingfrequencyofthetime-varyingsystemmaybeapproximatedbyEquation 4{27 !i(t)2r )]TJ /F5 11.955 Tf 10.49 8.09 Td[(qii qii(4{27) 81


4.3.2ModeShapes Systemdynamicsoftenutilizemodeshapestodescribetheactualmotionofavehicle.Essentially,amodeshapepresentstherelativemagnitudebetweenstateswhichisindependentofanydecayoroscillations.Thesemodeshapesarenormallyfounddirectlyfromthetime-invariant,scalereigenvectorsderivedinEquation 4{6 .Unfortunately,thetime-varyingeigenvectorsfoundinthispaperdocontainfrequencyinformationandthereforearemorediculttointerpret. AmodeshapeisgeneratedbynotingtherelationshipbetweentheQandRmatrices;specically,considerthescalarvalues,rij(t),oftheupper-triangularmatrixgivenasR(t)andthecolumns,qi(t),oftheunitarymatrixgivenasQ(t). x(t)=nXj=1jXi=1qjrijxj()(4{28) Amodeshapecanbeimmediatelyrealizedfromtherstcolumn,q1(t)oftheQ(t)matrix.Thismodeshapeisidentiedbyconsideringthemotionthatwouldresultfromaninitialconditioninwhichtheonlynon-zerocomponentistherststate.Theresultingresponseissimplyascalar,r11(t)x1(),multipliedbythevectorofq1(t)asshowninEquation 4{29 .Themodeshapewhichdescribestherelativevariationsbetweeneachstateisthusgivenasv1(t)=q1(t). x(t)=q1(t)r11(t)x1()ifx()=[x1()0:::0] (4{29) =v1(t)r11(t)x1() (4{30) AnothermodeshapeisthendeterminedasacombinationoftherstandsecondcolumnsoftheQmatrix.Considertheresultingmotiongivenaninitialconditioninwhichonlythesecondstatehasanon-zerocomponent.ThemodeshapeinresponsetothismotionisactuallytheparentheticalexpressioninEquation 4{32 whichismultipliedbythescalarsofr22(t)andx2()togeneratetheresponse. 82


x(t)=(q1r12+q2r22)x2()ifx()=[0x2()0:::0] (4{31) =q1(t)r12(t) r22(t)+q2(t)r22(t)x2() (4{32) =v2(t)r22(t)x2() (4{33) AgeneralizedexpressionforamodeshapeiscomputedbyextendingEquation 4{30 andEquation 4{33 tonth-ordersystems.SuchanexpressionisgiveninEquation 4{34 vi(t)=iXj=1qj(t)rji(t) rii(t)(4{34) Theresponseofthemorphingaircraftiswrittenintermsofthegeneralizedmodeshape,vi(t),fromEquation 4{34 .ThisresponseisalinearcombinationofthemodeshapesasshowninEquation 4{35 x(t)=nXi=1vi(t)rii(t)xi()(4{35) 4.4Example:SimpleMechanicalSystem Tohelpillustratetheconceptofdeterminingthelineartime-varyingpolesandstabilitymodes,usingaQRdecomposition[ 86 ],asimplesecondordersystemwillrstbeanalyzed.Inthisanalysis,correlationstolineartime-invariantsystemswillbemadeforthepurposeofcharacterizinglineartime-variantdynamicmodalproperties.Thisexampleiscomposedofamass-spring-dampersystem,asshowninFigure 4-1 ,andwillonlyconsiderthehomogeneousorunforcedsolution.Inaddition,anassumptionwillbemadethatthewheelsattachedtothecartarefrictionless. TheparametersforthisexamplearelistedinTable 4-1 ,whereitisseenthatonlythedampingcoecientchangeswithtime. Themassanddampingcoecientarechangedwithtime,asshowninEquation 4{36 ,insuchamannerthatthesystemexperiencesanincreaseinmassandspansallthree 83


Figure4-1. Mass-Spring-DamperSystem Table4-1. Mass-spring-dampersystemparameters Parameterst=0st=20st=30s M(kg)279.5K(N/m)888C(Ns/m)0812011.5 dampingcharacteristics,simultaneously.Astimeprogresses,thesystemtransitionsfrominitiallybeingunderdampedandlighttocriticallydampedandmoderate,andnallytooverdampedandheavy.Thevaluesforthesetime-varyingmasses/dampingratiosandtheircorrelatedtimesareshowninTable 4-1 C(t)=0:4(t)M(t)=2+0:25(t)(4{36) StartingfrombasicprincipalsandNewton'ssecondlaw,asseeninEquation 4{37 ,theordinarydierentialequationdescribingthesystem'sdynamicscanbederived,asshowninEquation 4{40 .ItcanbeseenfromEquations 4{39 and 4{40 thatthetimerateofchangeinmass,_M(t),isrepresentativeofinertialeectsonthesystemanddirectlymodiesthecontributionofthetime-varyingdampingseeninthea1(t)coecient. 84


F=d(Mv) dt (4{37) =Mdv dt+vdM dt (4{38) =Mx+_x_M (4{39) x+C(t)+_M(t) M(t)_x+K M(t)x=x+a1(t)_x+a0(t)x=0 (4{40) Fromobservation,itisdeterminedthatanequivalentstate-spacecanonicalrepresentationofEquation 4{40 canbeformedandshownasEquation 4{41 Ax+Bu=26401)]TJ /F5 11.955 Tf 9.3 0 Td[(a0(t))]TJ /F5 11.955 Tf 9.3 0 Td[(a1(t)375264x1x2375+264b1b23750(4{41) Thetwostatesofthesystem,representedinEquation 4{41 ,arethedisplacementposition,x,andtherateofchangeindisplacementposition,_x.Itisalsonotedthatthecoecientsfoundinthestate-spacestatematrix,a0(t)anda1(t),canberepresentedasfunctionsshowninEquations 4{42 and 4{43 a0(t)=8>>>><>>>>:0:t08 2+0:25t:0>>><>>>>:0:t00:2t+0:25t 2+0:25t:0

Whenassumingthatinertialeectscanbeneglected,thenEquation 4{40 reducestotheEquation 4{44 andthestate-spacecoecient,a1(t),canberewrittenasshowninEquations 4{45 x+C(t) M(t)_x+K M(t)x=x+a1(t)_x+a0(t)x=0 (4{44) a1(t)=8>>>><>>>>:0:t00:2t 2+0:25t:0

Thesystemresponseforeachcase,asshowninFigure 4-2 ,showthatthestatesinitallyoscillatebeforeeventuallyconverginguponasteadystateequilibriumvalue.Thisconvergenceoccursroughlyaroundtensecondsfortheinertialcaseandaround20secondsforthenon-inertialcase. A B Figure4-3. Time-VaryingModes:A)Non-Inertal:Mode1(|),Mode2()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[()B)Inertial:Mode1(|),Mode2()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() ReferencingFigure 4-3 ,itiscleartoseethatthemodalresponses,forbothinertialandnon-inertialcases,alsoexhibitaperiodofdecayingoscillationsbeforenallyconverginguponzero.Notethattheconvergencewindowineachcaseisthesameasthatpreviouslyseeninthesystemresponses.Itshouldalsobenoticedthatbothmodesforeachcaseareboundedbysomeconstant,,andconvergetozeroastimegoestoinnity,thereforesuggestingthatthesystemmodesareasymptoticallystable[ 86 ].Animportantobservationtonoteisthatwhenthemodesapproachzero,thecorrespondingpolesbecomeincreasinglyill-conditioned.Theill-conditioningisbroughtaboutbythederivationofanLTVpole,asshowninSection 3.5 ,whichisdenedbydividingamode'stimerateofchangebythemodeitself.Therefore,whenthevalueofeachmodecrossesbelowsomepre-determinedthreshold,thepolevalueisceasedtobecalculated,asshowninFigures 4-4A and 4-4B 87


A B Figure4-4. Time-VaryingPoles:A)Non-Inertal:Pole1()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[(),Pole2()-221()]TJ /F1 11.955 Tf 27.23 0 Td[(),RealportionofdiscreteLTIpoles(|),Poleaverage()B)Inertial:Pole1()-219()-219()]TJ /F1 11.955 Tf 33.14 0 Td[(),Pole2()-218()]TJ /F1 11.955 Tf 27.15 0 Td[(),RealportionofdiscreteLTIpoles(|),Poleaverage() Theassociatedpolesforthemass-spring-dampersystem,showninFigure 4-4A ,arefoundtooscillate,inanequal-but-oppositefashion,aboutalinedrawnthroughtheaverageofthetwoLTVpoles,(pole1+pole2)=2.Thispoleaverageisfoundtomatch,atdiscretepointsintime,therealpartofthecomplex-conjugateLTIpoles,asshowninFigure 4-4A .AnotableobservationisthatboththeLTIandLTVcomplex-conjugatepolessharethesamesimilarity,suchthattheaverageofthetwocomplex-conjugatepolesequaltherealpartsofeachLTIpole.ThisobservationsuggeststhatthemodaldampingforanLTVsystem,excludinginertialeects,isdirectlyrelatedtotheaverageofitsoscillatingpolepairsandcanbeapproximatedastheLTIdamping,asshownbyEquation 4{46 !LTV=(pole1+pole2)=2=Re(pLTI)(4{46) Thecorrespondingnon-inertialeigenvectors,asderivedinSection 4.3.2 ,canbeshowninFigure 4-5 Conversely,fromFigure 4-4B itisseenthatwheninertialeectsareincluded,theLTVpoleaveragedoesnotcorrespondwiththerealpartofthecomplex-conjugateLTI 88


A B Figure4-5. Non-InertialTime-VaryingEigenvectors:A)Eigenvector1:(1,1)(|),(2,1)()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()B)Eigenvector2:(1,1)(|),(2,1)()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() poles.Instead,itisobservedthattheLTVpoleaveragediersfromtherealpartoftheLTIpolebyafactorroughlyequivalenttothemassrateofchange,_M.ThisfactsuggeststhatthedampingoftheLTVsystem,experiencingmassdisplacment,cannotaccuratelyberepresentedastherealpartsofeachLTIpole.Rather,thedampingoftheinertialLTVsystemcanberelatedtothediscreteLTIdampingbythesummationoftheLTVpoleaverageandthemassrateofchange,asshowninEquation 4{47 .ThecorrespondinginertialeigenvectorscanbeshowninFigure 4-6 !LTV=(pole1+pole2)=2=Re(pLTI))]TJ /F1 11.955 Tf 17.59 3.02 Td[(_M(4{47) Althoughsimilarintheory,theillustrativerepresentationofsuchacomplex-conjugatepolevariessignicantlyfromtheclassicallydenedLTIsystem[ 97 ]totherelativelynewdenedLTVsystem[ 86 ];[ 126 ].Thecomplex-conjugaterepresentationfortheaforementionedLTVsystemisshowninFigure 4-4A asanoppositephase,oscillatingpolepair.Frequencyinformation,however,isnotastrivialtondfromanoppositephase,oscillatingLTVpolepairasisthedamping.AsmentionedinSection 4.1.4 ,thefrequencyinformationissplitbetweenthepoleandeigenvector;therefore,neitherthe 89


A B Figure4-6. InertialTime-VaryingEigenvectors:A)Eigenvector1:(1,1)(|),(2,1)()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()B)Eigenvector2:(1,1)(|),(2,1)()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() polenortheeigenvector,alone,canprovideacompleterepresentationofthetime-varyingfrequency.However,simulationresultssuggestthatasucientapproximationofthemodalfrequenciesmaybefoundbyreferringtotheperiodicityofthecolumnvectorsoftheorthonormalmatirx,Q,asshowninFigures 4-7 4-12 .AssumingthatQissinusoidalinnature,thenthisresultcanbeshownasthesamefrequencyapproximationderivedpreviouslyinEquation 4{24 A B Figure4-7. Non-InertialQcolumnvectorvalues:A)Q11(|),Q21()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[()B)Q12(|),Q22()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() 90


Figures 4-7A 4-7B representthecolumnsofthenon-inertial,time-varyingQmatrixwhichcorrespondtotheLTVpolesshowninFigure 4-4A .FromFigures 4-7A 4-7B ,itisseenthatthetermsQ11andQ22representthesameresponse,whilethetermQ12representsthesameresponseasQ21,justoutofphaseby180degreesorradians.Asaresult,theperiodicityforeachoftheseresponsesisidenticalandthereforesuggeststhatthemodalfrequencycanbefoundbyinvertingthemeasuredQcolumnperiodicityandmultiplyingby2,asshowninFigures 4-8 and 4-9 Figure4-8. Qcolumnperiodicity:Q11(|),Q21()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() Figure4-9. Qcolumnfrequency:ImaginarypartofdiscreteLTIpole(|),1Qcolumnperiodicity()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() 91


Figures 4-10A 4-10B representtheinertialLTVQcolumnswhichcorrespondtotheLTVpolesshowninFigure 4-4B .ThesameconclusionscanbedrwanfromFigures 4-10A 4-10B ,asthatpreviouslydeterminedfromFigures 4-7A 4-7B .However,itshouldbenotedforthiscasethattheQtermsbecomeincreasinglyill-conditionedasthecorrespondingmodes,showninFigure 4-3B ,approachzero,asshowninFigures 4-6 and 4-10 .Thisconditionisadirectresultofthealgorithmusedtoanalyzethetime-varyingsystem. A B Figure4-10. InertialQcolumnvectorvalues:A)Q11(|),Q21()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()B)Q12(|),Q22()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() Aspreviouslyshown,themodalfrequencycanbefoundbyinvertingthemeasuredQcolumnperiodicityandmultiplyingby2.TheresultingQcolumnperiodictyandmodalfrequencyfortheinertialcasecanbeshowninFigures 4-11 and 4-12 ItcanbeseenfromFigures 4-9 and 4-12 thatthetime-varyingfrequencies(forboththeinertialandnon-inertialcases)aresimilartotheimaginarypartsofthetime-invariantpoles.Asaresult,itmaybeinferredforthisexample,thattheinclusionofinerialeectsdonotsignicantlyalterthefrequecyinformation;therefore,theimaginarypartsofthetime-invariantpolesmaybeusedtoapproximatethetime-varyingfrequency. 92


Figure4-11. Qcolumnperiodicity:Q11(|),Q21()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() Figure4-12. Qcolumnfrequency:ImaginarypartofdiscreteLTIpole(|),LTVapproximatedfrequency()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() 93


CHAPTER5CONTROLDESIGN 5.1InherentClosed-LoopNonlinearity Anymorphingsystem,regardlessofopen-looplinearity,willhaveaclosed-loopnonlinearityinthepresenceofstatefeedback[ 28 ].Theintroductionofthisnonlinearityhasbeenespeciallyproblematicforthecommunityinvestigatingactivesystems.Considerthatmorphingaircrafthavebeenextensivelystudiedbythecommunitybuthavefocusedpredominatelyonaerodynamicperformance[ 122 ]andmaterials[ 125 ].Inparticular,theseprogramshavedemonstratedclearbenetsofmorphingasmeasuredbyaerodynamicperformancerelatedtoliftanddrag[ 58 ].Aircrafthavebeenoptimized[ 18 ]usingmorphingtoimproveliftandminimizedragalongwithfuelconsumption[ 14 ],rangeandendurance[ 43 ],costandlogistics[ 15 ],actuatorenergy[ 93 ],andmaneuverability[ 99 ].Additionally,aeroelasticeectshavebeenoftenstudiedrelativetomaximumrollrate[ 66 44 9 ]andactuatorloads[ 77 ].Someinvestigationshaveconsideredcontrolofmorphingsystems;however,theydonotfullyaddressmanueveringight.Astudyusingpiezoelectricmaterialsdesignedcontrolonlytoachieveroll.[ 70 ]Avarietyofotherstudieshaveinvestigatedcontrolbutonlyinthecontextofacutationenergy[ 57 ]andcontrolauthority[ 19 ]forsimplechangesinightcondition.Otherstudieshaveconsideredmorphingforcontrolsurfacesbutnotassociatedcontrolsynthesis.[ 101 102 ]Also,astudydesignednonlinearcontrollersbutitsmorphingmodelusedsimplyadistributedsetofcontroleectorsratherthanashapewithfullytime-varyingdynamics.[ 117 ] Toillustratethenotionofthisinherentclosed-loopnonlinearity,rstconsidertheLIVgeneralizedmodel,asshowninEquation 5{1 .Thecorrespondingstatevectorisgivenasx2Rnwhilethecontroleectorisgivenas2R. _x=A()x+B()u(5{1) 94


Assumingthereisnocontrolmatrix,B,andthatthestatedynamicshaveananedependence,usingA0;A1;A22Rnn,thenEquation 5{1 mayberewritteninthebilinearform[ 17 81 ],asshowninEquation 5{2 .Itshouldbenotedthatthemorphingrate,_,asseeninEquation 5{2 ,isgeneratedfromtheinclusionoftheinertialrates,_I,asdescribedinSection _x=(A0+A1+A2_)x(5{2) Forthepurposeofsimplicity,themorphingrateterm,asshowninEquation 5{2 ,isassumedtobezero.Therefore,toachievegeneralizedfeedbackinthesystem,agenericcontrollaw,asdenedinEquation 5{3 ,isappliedtothenewlytruncatedformofEquation 5{2 =Kx(5{3) Asaresult,thegeneralizednonlinear(inthestates)expressioncanbedevelopedwhichdescribestheclosed-loopsystem,asseeninEquation 5{4 _x=(A0x+A1Kx2)(5{4) 5.2Quasi-StaticApproach 5.2.1Synthesis Quasi-staticvariationsareconsideredwhenthetimescalesofmorphingaremuchlessthanthetimescalesofmaneuvering.Suchquasi-staticmorphingisactuallythemostprevalentoftheschemesbeingadoptedforUAVandpilotedvehicles.ThevariablesweepontheF-14isanexampleofsuchaschemealongwiththevariablespanbeingproposedbyDARPA[ 123 ].Thequasi-staticmorphingisessentiallybeingusedtochangeightconguration,suchascruiseordive,relatedtosegmentsofthemissionprole.Theresultingdynamicsareslowlytime-varyingwithrespecttothemorphingduetothe 95


disparity,whichmaybeordersofmagnitude,betweentimescalesofcongurationandmaneuvering. Thecontrollersneededtohandlethisquasi-staticmorphingwouldhavetobedesignedsuchthattheychosetheoptimalvalueofmorphingalongwithobtainingdesiredperformancemetricsformaneuvering.Ifitwereassumedthatanaircrafthadasetofslowactuatorstoalterightconguration,aswellas,asetoffastactuatorsformaneuvering,thenthefollowingactuationchoiceswouldensue.Thechoiceofmorphingactuationwouldbe,inessence,choosinganoptimaldesignfromwithinarangeadmittedbythemorphingscheme,whereasthechoiceofmaneuveringactuationwouldbeastandarddesignoftheautopilot. Asynthesismethodforthisapplicationwouldmostlikelybeformulatedasastandardmodel-followingapproachwhichallowedhandlingqualitiestobedirectlyutilized.Thecontrollerwouldseektocommandthemorphingsystem,P()=fA();B();C;Dg,torespondsimilarlytoadesiredsystem,X=f^A;^B;C;Dg,andtrackmaneuveringcommandsthroughouttheightenvelope.Therststepinthedesignprocesswouldneedtobethechoiceofmorphingvalueswhichminimizesthedierencebetweenthemorphingdynamicsandthedesireddynamics(forthemissionsegment),asinEquation 5{5 .Thenextstepwouldneedacontrollertocommandtheeectorsusedformaneuvering.ThiscontrollercouldbederivedfromtraditionalapproachesforrobustornonlinearsystemsasinEquation 5{6 =argmin2RW1kA())]TJ /F1 11.955 Tf 15.04 3.03 Td[(^Ak+W2kB())]TJ /F1 11.955 Tf 14.75 3.03 Td[(^Bk(5{5) K=argminK2SkX)]TJ /F5 11.955 Tf 11.96 0 Td[(Fl(P;K)k(5{6) 5.2.2Example:Gull-WingedAircraft Aninitialcontrollerhasbeensynthesizedforavariablegull-wingedaircraft[ 2 ].Asetofdesireddynamicswereformulatedforcruise-loiterandaggressive-maneuver 96


r H() G P() 6 X() ? -e Figure5-1. Model-FollowingSystem congurationsbyvarying,forexample,frequencyoftheshort-periodmode.Thevalueofgull-wingmorphingisdeterminedusingEquation 5{5 toapproximatethesedesiredcharacteristics.AfeedbackcontrollerwasdesignedfromEquation 5{6 usinganinner-loopH1,G,andouter-loopPID,H,withgainschedulingacrossconguration,,asshowninFigure 5-1 .Apredenedmissionprolefromcruisetoaggressiveandbacktocruise,showninFigure 5-2 ,indicatesthatthemorphingvariedwithdesiredmodalpropertieswhiletheresponsestopitchdoubletstrackedthedesiredmaneuvers. Figure5-2. SimulationsoftheGull-MorphingAircraftModel Thisexampledemonstratestheeectivenessoftheapproach;however,severalissuesarenotyetrigorouslyaddressed.TherstissuewouldbedeningcomputationalstrategiesforEquation 5{5 whenvariousordersofpolynomials(A())wereusedwithmultipletypesofmorphing,.Asecondissuewouldinvolveconsiderationofndingastandardizedformulation,suchasLPV,wherethemaneuveringcontrollercouldinherentlyincludegainschedulingandrobustness. 5.3StabilizingControl:DisturbanceRejection 5.3.1Synthesis Aclassofsuboptimalcontrollersaresynthesizedfordisturbancerejection.Theabilitytorejectdisturbances,suchaswindgusts,isobviouslyanimportantfeatureofanyight 97


controller.Theresultingclosed-loopsystemwillbeinherentlynonlinearduetotheeectsofstatefeedback;consequently,thecontrollerswillensuretheorigin,ortrimcondition,isgloballyasymptoticallystableforthesenonlineardynamics.[ 5 49 54 56 65 76 109 ] Anapproachfordisturbancerejectionhasbeenformulatedthatusesaconstant-gainmatrixforfeedback.ThisapproachguaranteesthedesiredstabilitypropertiesasstatedinLemma1.Essentially,theargumentresultsfromshowingthatalltrajectoriesoftheclosed-loopsystemareniteandconvergetozero. Lemma5.3.1. Giventhesystem,_x=(A0+A1)x,thentheoriginisgloballyasymptoticallystableusingthecontrollaw=Kxif 1. A0<0 2. A1K)]TJ /F5 11.955 Tf 16.14 0 Td[(A0<0 Proof:Theclosed-loopsystemisformulatedas_x=A0x+A1Kx2whichisobviouslynonlinear.Thesolutiontothisdierentialequationcanbeexpressedasx(t)=)]TJ /F11 7.97 Tf 6.58 0 Td[(A0 A1K)]TJ /F11 7.97 Tf 6.59 0 Td[(A0e)]TJ /F12 5.978 Tf 5.76 0 Td[(A0t.Inthiscase,thesteady-statevalueshowslimt!1x(t)=0ifA0<0soalltrajectoriesconvergetotheoriginifA0isnegativedenite.Asingularitywillalsoarisesuchthatlimt!1x(t)=1ifA1K)]TJ /F5 11.955 Tf 12.38 0 Td[(Aoe)]TJ /F11 7.97 Tf 6.59 0 Td[(A0t=0.Thissingularitycorrespondstot=)]TJ /F7 7.97 Tf 6.58 0 Td[(1 A0lnA1K A0whichhasasolutiont2Rwitht>0ifA0<0andK

2. A1K1<0 Proof: Theclosed-loopsystemcanbeexpressedas_x=(A0+A1K0)x+(A1K2)x3.DeneaLyapunovfunctionasV(x)=1 2x2sothefollowingconditionsaresatised. 1. V(0)=0 2. V(x)0 3. _V(x)=(A0+A1K0)x2+(A1K2)x4 NowV(x)isavalidLyapunovfunction,andconsequentlytheoriginisgloballyasymptoticallystable,ifA0+A1K0<0andA1K2<0. 2 Animportantconsiderationistheformulationoftheopen-loopmodel.Specically,thesecontrollersassumetheLIVdynamicscanbeexpressedasarst-orderfunctionofthemorphinginput.Suchanassumptionwillrestrictthesystemswhichcanbeconsideredforcontrolsynthesis;however,therestrictionisnotnecessarilyunreasonable.Theexamplesinthispapercanbesatisfactorilymodeledasrst-orderfunctionsand,ifsecond-orderfunctionsareneeded,theLemmascanbeextendedtoconsiderhigherorders. Anotherconsiderationistheuseofcontroleectors.Thesedesignsassumethatshape,representedby,istheonlyeectorusedtorejectdisturbances.Theinclusionoftraditionaleectorscanbeconsideredbuttheinitialresultsassumemorphingistheonlyeectoravailableforcontrol. Also,thesecontrollersdonotguaranteeanypropertiesrelatedtoperformance.TheLemmasmerelyindicatethestabilityoftheoriginforthenonlinearclosed-loopsystem.Noinformationaboutthespeedatwhichresponsesconvergetotheorigincanbeprovided.Theseconditionsactuallyapplydirectlytoresponsesfrominititalconditionsandarenotevenformulatedtoconsiderotherperformancemetricssuchastrackingorrobustness.Assuch,theseresultsarelimitedinnaturetosimplestabilityforgustrejection. 99

PAGE 100

5.3.2Example:Chord-VaryingMorphing AnothermodeloftheMAVisgeneratedbyassumingapurevariationinchord.Thismodelindicatessomepropertiesoftheightdynamicsofachord-varyingmorphingwhilethespanandcamberarekeptconstant.Thechordforthismodelischosentorangefrom11.43cmto22.86cmwhilethespanremainsat60.96cm.TherepresentativemodelinTORNADO[ 80 ]resultedincongurationssuchasthoseshowninFig. 5-3 Figure5-3. Chord-VaryingMAVModel(m) TheLIVframeworkisagainusedtorepresenttheightdynamics.ThemodelinEq. 5{7 indicatesarst-orderttothestate-spacematricesfortheightdynamicsatasetofchordvalues.Theperturbationtochord,,rangesbetween0:05715m. _x=0BBBBBBB@266666664)]TJ /F1 11.955 Tf 9.3 0 Td[(0:075)]TJ /F1 11.955 Tf 9.3 0 Td[(0:1240)]TJ /F1 11.955 Tf 9.3 0 Td[(9:81)]TJ /F1 11.955 Tf 9.3 0 Td[(1:538)]TJ /F1 11.955 Tf 9.3 0 Td[(7:45612:0002:686)]TJ /F1 11.955 Tf 9.3 0 Td[(5:848)]TJ /F1 11.955 Tf 9.3 0 Td[(32:9340001:000377777775+266666664)]TJ /F1 11.955 Tf 9.3 0 Td[(0:330)]TJ /F1 11.955 Tf 9.3 0 Td[(2:09300)]TJ /F1 11.955 Tf 9.3 0 Td[(3:957)]TJ /F1 11.955 Tf 9.29 0 Td[(15:3310025:32495:187)]TJ /F1 11.955 Tf 9.3 0 Td[(160:16000003777777751CCCCCCCAx(5{7) ApairofcontrollersaredesignedusingLemma 5.3.1 andLemma 5.3.2 forthemodelinEq. 5{7 .ThismodelsatisestheconditionsoftheLemmasincludingstabilityfor=0.TheresultinggainsforthesecontrollersaregiveninTable 5-1 Table5-1. Gainsforchord-varyingaircraftdisturbancerejectioncontroller controlleralgorithm Lemma1=0)]TJ /F1 11.955 Tf 9.3 0 Td[(100:1xLemma2=[0]+0)]TJ /F1 11.955 Tf 9.3 0 Td[(10)]TJ /F1 11.955 Tf 9.3 0 Td[(0:5x2 100

PAGE 101

Responsestoagustfortheopen-loopsystemandclosed-loopsystemsareshowninFig. 5-4 .Theopen-loopsystemreturnstotrimtodemonstratetheexpectedstabilitywhenthechordisnotvariedfromthenominalcondition.Theclosed-loopsystems,usingLemma 5.3.1 andLemma 5.3.2 ,arealsostableandabletorejecttheinitialdisturbance. TheresponsesinFig. 5-4 indicatethatchord-varyingmorphingcanindeedbebenecialtorejectinggustssinceeachcontrollerreturnsthevehicletotrimfasterthantheopen-loopsystem.Theincreaseinrejectionisperhapsnotoverlysignicantbutatleastisclearlynoticeable.Thecontrollerchangesthechordwhichactuallyhastheeectofreducingthemomentofinertiaand,subsequently,increasingthestabilityderivatives.Astheactuationplotshows,thecontrollerreducesthechordtorejectthisdisturbancebutthencanquicklyincreasethechordtoreturntoaerodynamiceciency. Figure5-4. AngleofAttackResponseandAssociatedChordofAircraft TheabilityofthecontrollertoreturnthevehicletotrimisalsoevidentintheresponsesofallstatesasshowninFig. 5-5 .Eachstatereturnstoequilibriumalthoughtheratesofdecayintheoscillationsaftertheinitialdisturbanceclearlyvarybetweenresponses. Thebehaviorofthecontrollers,andconsequentlytheclosed-loopresponses,canbedeterminedfromFig. 5-5 inassociationwithTable 5-1 .Inparticular,thisassociationcanexplainthedierencesbetweenactuationresponsesinFig. 5-4 .ThechordvariationsusingthecontrollerofLemma 5.3.1 showanoscillatorynaturewhereasthechordvariations 101

PAGE 102

Figure5-5. ResponsestoChord-VaryingMorphing fromthecontrollerofLemma 5.3.2 settlestoaconstantsteady-statevalue.Thedierentbehaviorsiscausedbythelinearandquadraticnatureofthecontrollers.Essentially,asmallchordiscommandedbyscalingsmallvaluesofthestatesbutanevensmallerchordiscommandedbyscalingquadraticvaluesofthosesmallstates. 5.4FeedForwardOptimalControl 5.4.1State-ResponseTracking Morphingcanbeusedtotrackadesiredsignal,yd(t),forthesystemresponse.Theactualresponseisexpressedasy(t)=P((t))wheretheplantmodelisexplicitywrittenashavingtime-varyingdynamicsduetothemorphingcommand.Inthiscase,morphingisrestrictedtobetheonlycontroleector. Anoptimizationcomputesthemorphingcommandthataddressestracking.Thisoptimizationsearchesoverthemorphingtrajectorytominimizethetrackingerrorateveryinstanceintime,asshowninEquation 5{8 min(t)s Zt0kyd(t))]TJ /F5 11.955 Tf 11.95 0 Td[(P((t))k2dt(5{8) 102

PAGE 103

SuchanoptimizationiseectivelyafeedforwardschemeasdepictedinFigure 5-6 .Thecompensatoractuallygeneratesanoptimaltrajectoryforthemorphingbasedonano-lineminimization yd (t) P((t)) -y Figure5-6. ArchitectureforState-ResponseTracking Suchafeedforwardelementrepresentsacriticalaspectofmanynonlinearcontrolschemes.Themorphingdynamicscertainlyhaveanonlineardependencyontheinputcommandsoamulti-elementcontrollerislikelynecessary.Someaspectoffeedbackmaybeutilizedfornoiseandrobustness;however,designingthisfeedforwardcontrollerisaninitialsteptowardsamulti-elementcontroller. 5.4.2Pole-ResponseTracking Amorphingcommandcanalsobegeneratedfortrackingofapoleresponse.Denepd(t)asthedesiredlocationfortime-varyingpoles.Suchdesiredpolescandirectlyrelatetotraditionalparametersoffrequencyanddamping.Assuch,thetrackingofapoleresponseisanalogoustotrackingofmodalparameters. Thepole,p(t),isnotedasbeingrelatedtothediagonalelementsofthedecompositionofthestate-transitionmatrix.Specically,theithtermisgivenaspi(t)=r)]TJ /F7 7.97 Tf 6.58 0 Td[(1ii((t))d/dt(rii((t)))whereriiisthediagonaltermofR(t)asconstrainedbyQ(t)R(t)=A(t;0).Note,thecompletepoleformulationmaybeseeninSection 3.5 TheoptimizationtocomputethemorphingcommandisgiveninEquation 5{9 min(t)s Zt0kpd(t))]TJ /F5 11.955 Tf 11.95 0 Td[(rii((t))_rii((t))k2dt(5{9) Suchoptimizationisagainafeedforwardscheme.Theblockdiagramforthisscheme,asshowninFigure 5-7 ,diersfromFigure 5-6 byincludingseveralelementsrelatedtothepoles.Specically,ablockofQRisincludedtorepresenttheQRdecompositionandablockofisincludedtorepresentthecomputationofthestate-transitionmatrix. 103

PAGE 104

pd (t) (P((t))) QR s ? -r)]TJ /F7 7.97 Tf 6.59 0 Td[(1ii_rii Figure5-7. ArchitectureforPole-ResponseTracking 5.4.3Example:Mass-SpringSystem Amorphingmass-springsystemiscontrolledtotrackdesiredstateresponsesandpolesignals.Thissystem,asshowninFigure 5-8 ,isasinglemassattachedtoawallthroughaspringanddamper. Figure5-8. Mass-Spring-DamperSystem Controlisactuatedthroughthedamperofthissystem.Essentially,thedampingisassumedtobeadjustableinordertoalterthesystemdynamics.TheequationofmotionisthusgiveninEquation 5{10 .Thesedynamicsareobviouslydependentonthedampingsocommandingadampingtrajectorywillrequireanalysisusingtime-varyingpoles. mx=kx)]TJ /F5 11.955 Tf 11.95 0 Td[((t)_x(5{10) Themassis8kgandthespringconstantis2N/m. Theoptimalmorphing,thatischosentogenerateasystemresponseorpoleresponsethattracksadesiredresponse,isrestrictedtobeingathird-orderpolynomialoftime.AnymorphingtrajectoryisthusrestrictedtoliewithinthesetofallpolynomialswithrealcoecientsasnotedinEquation 5{11 104

PAGE 105

23Xi=0itii2R(5{11) Also,thecoecientsofthemorphingtrajectoryareboundedtopreventthesystemfromimmediatelybecomingoverdamped.Thehigher-ordertermsinthepolynomialhavethepotentialtodominateastimeincreases;consequently,thesetermsarerestrictedmorethanthelower-orderterms.Theexactvaluesoftheseboundsaredeterminedsuchthatanymorphingtrajectoryallowsthesystemtovarybetweenunderdampedandoverdamped.ThevalueofthedampingratiogiveninEquation 5{12 representstheboundarybetweenunderdampedandoverdamped. =(t) 2p km(5{12) Boundsonthecoecientsareinitiallychosentolimitthetimeatwhichthesystembecomescriticallydampedto7.5s.Suchatimeisarbitrarilychosenforthisexamplebutmayeasilybealteredtoconsiderdierenttypesofresponses.Giventhistimeconstraint,thecoecientsofEquation 5{11 mustsatisfytheexpressionsinEquation 5{13 .Theprocedureactuallyndsthecoecientssequentiallybyconsideringonlyonecoecienttobeanon-zerovalueatatime.Indongso,thesolutiondeterminesthemaximumcontributionneededbyeachmorphingcoecienttoachievethedesireddampingtransient. iti 2p km=Pi(7:5)i 8=1i=1;2;3(5{13) Also,aconstraintisintroducedsuchthat(t)>0forallvaluesoftime.Thisconstraintnotesthatthedesiredresponseisassumedtobeboundedandthusthesystemmusthavepositivedamping.Thecoecientsofeachpolynomialareadditionallylimitedtomaintainthispositivecondition. TheresultingboundsonthecoecientsaregiveninTable 5-2 105

PAGE 106

Table5-2. Boundsoncoecientofmorphingbasis CoecientUpperBoundLowerBound 04-411.07-1.0720.14-0.1430.02-0.02 Asetofdesiredresponsesaregeneratedusingpolynomialmorphing.Thesepolynomialsrangeasarst-order,second-orderandthird-orderfunctions.TheoptimizedvaluesofthemorphingcommandsaregeneratedforfeedforwardcontrolandshowninTable 5-3 .TheoptimizedmorphingisessentiallyidenticaltothedesiredmorphingwhichisanticipatedsincethedesiredmorphingcanbeexactlyduplicatedbythemorphingbasisofEquation 5{11 Table5-3. Optimalpolynomialmorphingtotrackdesiredpolynomialmorphing desiredactual 0:5+t0:5+t0:5t+0:076t20:5t+0:076t2)]TJ /F1 11.955 Tf 9.3 0 Td[(0:75t+0:1t2+0:02t3)]TJ /F1 11.955 Tf 9.3 0 Td[(0:75t+0:1t2+0:02t3 Theoptimizedstateresponses,muchliketheoptimizedmorphingtrajectories,areessentiallyidenticaltothedesiredstateresponses.TheseresponsesareshowninFigure 5-9 Anotherdesiredresponseisattemptedtobetrackedusingthepolynomialmorphing;however,thisdesiredresponseisassociatedwithamorphingcomposedofasinusoidaladdedtoapolynomial.ThisdesiredmorphingcannotbeduplicatedusingtherestrictedbasisofEquation 5{11 sosomeerrormustresultinthetracking.TheoptimizedpolynomialformorphingisgiveninTable 5-4 alongwiththisdesiredmorphing. Table5-4. Optimalpolynomialmorphingtotrackdesiredsinusoidalmorphing desiredactual 0:94t+sin(t)0:5343+1:0700t)]TJ /F1 11.955 Tf 11.96 0 Td[(0:0812t2+0:0094t3 106

PAGE 107

A B C Figure5-9. DesiredResponse(|)andOptimalResponse()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()forA)First-OrderMorphingandB)Second-OrderMorphingandC)Third-OrderMorphing TheresultingstateresponseisshowninFigure 5-10 asreasonablyclosetothedesireresponse.Someerrorispresent;however,thedesiredmorphingisnotexcessivelyfaroutsidetherangeofthemorphingbasissothefeedforwardcontrolisnearlyabletoprovidethecorrecttracking. Apiecewise-polynomialmorphingisconsideredtoexpandtherangeofthemorphingbasisseeninEquation 5{11 .Inthiscase,themorphingbasisisallowedtobearst-orderpolynomialwhosecoecientscanvaryatdiscretepointsintime.Anadditionalconstraint 107

PAGE 108

Figure5-10. DesiredResponse(|)andOptimalResponse()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[()forSinusoidalMorphing ofcontinuityisimposedonthispiecewise-polynomialmorphingtoensurephysicalactuatorscouldpotentiallyimplementsuchacommand. Anoptimalvalueofpiecewise-polynomialmorphingisgeneratedtotrackadesiredresponsethatcontainsasinusoid.TheresultingcommandisgiveninTable 5-5 alongwiththemorphingassociatedwiththedesiredresponse. Table5-5. Optimalpiecewise-polynomialmorphingtotrackdesiredsinusoidalmorphing desiredactual 0:94t+sin(t)0:068+1:734t:0t1:521:959+0:399t:1:52
PAGE 109

Figure5-11. DesiredResponse(|)andOptimalResponse()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[()forSinusoidalMorphing variousorders.Theoptimalmorphing,asgiveninTable 5-6 ,isabletoeectivelymatchthemorphingassociatedwiththedesiredpoles. Table5-6. Optimalpolynomialmorphingtotrackdesiredpolynomialmorphing desiredactual 1:07t1:07t1+0:75t+0:024t21+0:75t+0:024t2)]TJ /F1 11.955 Tf 9.3 0 Td[(0:2t+0:13t2+0:039t3)]TJ /F1 11.955 Tf 9.3 0 Td[(0:2t+0:13t2+0:039t3 Theoptimizedpolesignals,muchliketheiroptimizedmorphingtrajectories,areessentiallyidenticaltothedesiredpolesignals.Formodalreasons,thepolesignalswillbetruncatedat10seconds.ThesesignalsareshowninFigure 5-12 Anotherpoleresponseisattemptedtobetrackedusingthepolynomialmorphing.Thisdesiredresponseisagainassociatedwithamorphingcomposedofasinusoidaladdedtoapolynomial.Duetodampingconstraints,itremainsthesamedesiredsinusoidalmorphingasthatusedforthestateresponse.TheoptimizedpolynomialformorphingisgiveninTable 5-7 alongwiththisdesiredmorphing. Table5-7. Optimalpolynomialmorphingtotrackdesiredsinusoidalmorphing desiredactual 0:94t+sin(t)0:8532+0:7648t)]TJ /F1 11.955 Tf 11.96 0 Td[(0:1248t2+0:0200t3 109

PAGE 110

A B C Figure5-12. DesiredResponse(|)andOptimalResponse()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[()forA)First-OrderMorphingandB)Second-OrderMorphingandC)Third-OrderMorphing Althoughusingthesamedesiredmorphing,theoptimizedpolynomialinTable 5-7 isdierentfromthatinTable 5-4 .Thisresultissimplyduetotheoptimizationofadierentcostfunction. TheresultingpolesignalisshowninFigure 5-13 .Someerrorispresent;however,thefeedforwardcontrolisagainnearlyabletoprovidethecorrecttracking. Thepiecewise-polynomialmorphingisusedtotrackapoleresponseassociatedwithasinusoidalmorphing.TheresultingmorphingandthedesiredtrajectoryaregiveninTable 5-8 110

PAGE 111

Figure5-13. DesiredResponse(|)andOptimalResponse()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[()forSinusoidalMorphing Table5-8. Optimalpolynomialmorphingtotrackdesiredsinusoidalmorphing desiredactual 0:94t+sin(t)0:104+1:673t:0t1:522:182+0:269t:1:52
PAGE 112

5.5H1FeedbackControl:WithoutInertialEects Feedforwardcontrol,asshowninSection 5.4 ,isonemethodwhichcanbeusedforoptimaltracking,whileanotherisH1feedbackcontrol[ 21 23 55 61 100 129 ].H1controltypicallyachievesoptimalityfromderivingacontroller(robustorstabilizing)whichsolvessomemathematicaloptimizationproblem[ 29 45 48 ].Inthecaseoftracking,arobustcontrollerisusedandisdesignedsuchthatsomedesiredlevelofperformanceisobtained.Thisrobustcontrollermustbecapableofmaintainingperformancedespitetheinclusionofexogeneousinputsintothesystem,suchasnoise,disturbance,andreferencesignals.Whenallexogeneoussignalsareavailabletothesystem,theproblemisthenconsidera"fullinformation"H1problem[ 24 71 ],asshowninEquations 5{14 5{16 _x(t)=Ax(t)+B2w(t)+B1u(t) (5{14) z(t)=C1x(t)+D11w(t)+D12u(t) (5{15) y(t)=C2x(t)+D21w(t)+D22u(t) (5{16) Itshouldbenotedthatxrepresentsthesystemstatevariables,yisthesystemmeasuredoutput,zisthesystemcontroloutput,uisthesystemcontrol,andallstatematriceshaveproperdimensions.Itshouldbenotedhowever,thatthefullinformationassumptionrequiresthattheirbefullstate,disturbance,andcontrolfeedback,asdescribedbyEquation 5{17 C2=[I00]TD21=[0I0]TD22=[00I]T(5{17) TheexogeneousinputsinEquation 5{17 maybedescribedbyEquation 5{18 w(t)=[drn]T(5{18) 112

PAGE 113

Forthepurposesofthisstudy,the"fullinformation"standardwillbeappliedtothelineartime-varyingproblem.However,itisobviouswhentransformedintothebilinearform,Equation 5{1 cannotaccuratelybedescribedbythetime-invariantsystemdenedinEquations 5{14 5{16 .Therefore,Equations 5{14 5{16 mayberedenedforthebilineartime-invariantsystem[ 105 ],asshowninEquations 5{19 5{21 _x(t)=(A0+A1u(t))x(t)+B2w(t)+(B0+B1x(t))u(t) (5{19) z(t)=C1x(t)+D11w(t)+D12u(t) (5{20) y(t)=C2x(t)+D21w(t)+D22u(t) (5{21) Thisnewbilineartime-invariantsystemisbaseduponEquation 5{2 withouttheinertialcontribution,asshowninEquation 5{22 _x=A0x+A1xu(5{22) Itshouldbenotedthatthelineartime-invariantsystem,showninEquation 5{1 ,wasassumedtohaveananedependencewithinthestates.Fromthisresult,itwasfurtherassumedthatthelineartime-varyingsystemhadananedependencewithintheinputcommand,u(t),thusgivingtheformofabilinearsystem.Inmakingthisassumption,itisseenthatthetime-varyingdependencehasmovedoutsideofthestatematrixintothecontrolinput,u,andstatevariable,x.Thisfactsuggeststhatabilineartime-invariantcontrollermaybeusedtosucientlycontroltheunderlyingtime-varyingsystem[ 4 68 ]. InordertosimplifytheH1bilinearproblemandprovideareasonablesolution,thesimplifyingassumptions,showninEquation 5{23 ,needtobemade. 113

PAGE 114

DT12C1=0DT12D12=IB0DT12=0D21DT21=ID11sucientlysmall(5{23) FromEquation 5{23 ,itismentionedthatD11mustbesucientlysmall.ThissuciencysuggeststhatthemaximalsingularvalueofD11mustbesmallerthanthecorrespondingH1normoftheclosed-loopcontrolsystem.ItisalsoseenfromEquation 5{23 thatA0andB0mustbestabilizable;However,itisrecalledthatforthetime-varyingprobleminquestion,thereexistsnoexternalinputindependentofthestatecommand.Asaresult,ithasbeenshown[ 106 ]thattheoptimalcontrolofabilinearsystemcanbeachievedifandonlyifthereexistsascalar,r,suchthattherealpartsoftheeigenvaluesof(A0)]TJ /F5 11.955 Tf 12.77 0 Td[(r(A1+B1))arenegativeandthecostfunction,asseeninEquation 5{24 ,isminimized. J=1 2Z10fzT(t)z(t))]TJ /F5 11.955 Tf 11.95 0 Td[(2wT(t)w(t)gdt(5{24) BycombiningEquation 5{24 withthepartialderivativeoftheclosed-loopLyapunovfunction,,theHamiltonianfunctioncanbedenedandwrittenasEquation 5{25 H=1 2zTz)]TJ /F5 11.955 Tf 13.15 8.09 Td[(2 2wTw+T_x(5{25) SubstitutingEquations 5{19 5{21 intoEquation 5{25 resultsinEquation 5{26 ,fromwhichthemaximalexogeneousinputvectorandminimalcontrolcommandmaybefound. 114

PAGE 115

H=1 2(xTCT1C1x+xTCT1D11w+xTCT1D12(u+r)+(u+r)TDT12D11w+wTDT11D11w+(u+r)TDT12D12(u+r))-222(2wTw)+T(Ax+(A1+B1)x(u+r)+B2w) (5{26) Themaximalexogeneousinputvector,w,andminimalcontrolcommand,u,arefoundbytakingthepartialderivativeofEquation 5{26 ,respectively,andsettingitequaltozero.TheresultingoptimaltermscanbedescribedbyEquations 5{27 5{28 u=)]TJ /F5 11.955 Tf 9.3 0 Td[(r)]TJ /F1 11.955 Tf 15.95 8.09 Td[(1 2(D12D11BT2)]TJ /F5 11.955 Tf 11.95 0 Td[(xT(A1+B1)T)+xT(A1+B1)T(5{27) w=)]TJ /F1 11.955 Tf 13.3 8.09 Td[(1 2(DT11D12xT(A1+B1)T)]TJ /F5 11.955 Tf 11.96 0 Td[(BT2)(5{28) UsingthesimplifyingassumptionsfoundinEquation 5{23 ,theclosed-loopformoftheHamiltonianmaybefoundbysubstitutingEquations 5{27 5{28 backintoEquation 5{25 .Theresultingclosed-loopformoftheHamiltoniancanbeshownbyEquation 5{29 HCL=1 2(xTCT1C1x+(A0)]TJ /F5 11.955 Tf 11.95 0 Td[(r(A1+B1))+(A0)]TJ /F5 11.955 Tf 11.95 0 Td[(r(A1+B1))TT)-222((A1+B1)xxT(A1+B1)TT+1 2((A1+B1)xxT(A1+B1)TT+B2BT2T)]TJ /F1 11.955 Tf 12.44 3.16 Td[((A1+B1)xDT12D11BT2)]TJ /F1 11.955 Tf 12.45 3.16 Td[(B2DT11D12xT(A1+B1))) (5{29) Theclosed-loopLyapunovfunction,,forbilinearsystemshasbeenshowntobeaquadraticfunctionofthestatevector[ 10 62 69 79 32 ]andthereforecantaketheformshowninEquation 5{30 =1 2xTPx(5{30) 115

PAGE 116

ThepartialderivativeofEquation 5{30 canbetakenwithrespecttoxtond,asshowninEquation 5{31 =@ @x=xTP(5{31) SubstitutingEquation 5{31 intoEquation 5{29 givesthenalversionoftheclosed-loopHamiltonian,asshownbyEquation 5{32 HCL=1 2xT(CT1C1+P(A0)]TJ /F5 11.955 Tf 11.95 0 Td[(r(A1+B1))+(A0)]TJ /F5 11.955 Tf 11.96 0 Td[(r(A1+B1))TP)-222(P(A1+B1)xxT(A1+B1)P+1 2(P(A1+B1)xxT(A1+B1)P+PB2BT2P)]TJ /F5 11.955 Tf 11.96 0 Td[(P(A1+B1)xDT12D11BT2P)]TJ /F5 11.955 Tf 11.95 0 Td[(PB2DT11D12xT(A1+B1)TP))x (5{32) IthasbeenshownforbilinearsystemsthatthealgebraicRiccatiequationisderivedfromthelinearpartsoftheclosed-loopHamiltonianfunction[ 106 ].Therefore,thealgebraicRiccatiequationrelatedtoEquation 5{32 canbeshownbyEquation 5{33 [ 92 ]. P(A0)]TJ /F5 11.955 Tf 11.95 0 Td[(r(A1+B1))+(A0)]TJ /F5 11.955 Tf 11.95 0 Td[(r(A1+B1))TP+CT1C1+1 2PB2BT2P=0(5{33) ForthesingleinputbilinearsystemdescribedbyEquation 5{22 ,itcanbesaidthattheclosed-loopnonlinearsystemsfromtheH1statefeedbackcontrolaregloballyasymptoticallystableifandonlyifthefollowingconditionsaremet: (A0;B2)stabilizable (A0;C1)observable eig(A0)]TJ /F5 11.955 Tf 11.95 0 Td[(r(A1+B1))<0 Itshouldbenotedthattheconstantvalue,r,canbefoundusingmethodssuchastheRouthcriterion. 116

PAGE 117

5.6FutureWorkandChallenges Multipleavenueshavebeenestablishedtocontinuethecontrolworkpresentedthroughoutthispaper.Twoareasofparticularinterestwouldbethethoroughinvestigationandderivationofadynamiccontrolapproach,aswellas,theinclusionofaninertialtermwithinboththefeedforwardandH1feedbackoptimaizations. Fromthesetwotopics,theareaclosesttorealizationatthistimewouldbetheinclusionoftheinertialterm,_,asshowninEquation 5{2 .Therefore,themainfocusofthissectionwillprimarilycenteraroundtheconceptsandchallangessurroundingtheintroductionofthisterm. ItisclearlyseenfromSection thatinertiaplaysacrucialroleinthedynamicoutcomeofthedescribedtime-varyingsystem.Typically,inertialeectsareneglectedduetotheirsmallinuenceonthedynamics;However,theeectsofinertiaintime-varyingsystemsarestillyettobefullyunderstood,althoughintialtestingsuggeststhatslightchangesininertiacouldbesignicantifunaccountedfor[ 47 ]. Anobviouschallengeregardingtheintroductionoftheinertialterm,_,intotheoptimalcontrolarchitectureisthedecisionofwhichtermtakesprecedence,themorphingangleorthemorphingrate?Thesetwotermsarelinkedthrougharstderivativerelationshipandthereforecannotbecontrolledindependently.Asaresult,theoptimizationproblembecomeseitherndingthecorrectratewhichproducesthedesiredmorphingtrajectoryorviceversa.Thekeytothisconceptisnotjustndingthecorrectterm,butratherndingthecorrecttermwhichminimizestheeectoftheotherandmaintainsthedesiredobjective. Beforethisproblemcanbeaddressed,theabilitytoeectlystabilizethesystemshouldrstbeconsidered.ItwasshowninSection 5.3.1 thatatime-varyingsystem,withoutinertia,couldbesuboptimallycontrolledwhileguaranteeinggloballyasymptoticstability.Anaddendumtothisillustrationwouldbetoaddtheinertialterm,asshowninEquation 5{2 ,andrederiveasubotpimalcontroller. 117

PAGE 118

StartingwithEquation 5{2 ,itisseenbyredeningthemorphingrate,_,astheproductoftwopartialderivatives,thatEquation 5{2 canberedenedintermsof_x,asshowninEquation 5{34 _x=A0x+A1x+A2x@ @x@x @t=A0x+A1x+A2x@ @x_x(5{34) ItshouldbenotedthatsinceisscalarandEquation 5{34 representsaSISOsystem,thenEquation 5{34 maybewrittenassowithoutalgebraicissues. Afterrearrangingterms,Equation 5{34 canberewrittenintheformshowninEquation 5{35 _x=(I)]TJ /F5 11.955 Tf 15.86 0 Td[(A2x@ @x))]TJ /F7 7.97 Tf 6.59 0 Td[(1(A0x+A1x)=A)]TJ /F7 7.97 Tf 6.59 0 Td[(1~A(5{35) NoticingtherightsideofEquation 5{35 ,itisrecalledthat~Ahasalreadybeenshowntoachievegloballyasymptoticstabilityusingsuboptimalcontrollers.Therefore,Awouldneedtobegloballyasymptoticallystablefortheenitiresystemtoachievegloballyasymptoticstabilityoratleastgloballystableforthesystemtobestable. AnotherwaytolookattheproblemistoseethatEquation 5{35 mayberearrangedsuchthatittakestheformshowninEquation 5{36 _x=(I)]TJ /F5 11.955 Tf 15.85 0 Td[(A2x@ @x))]TJ /F7 7.97 Tf 6.59 0 Td[(1(A0+A1)x=A)]TJ /F7 7.97 Tf 6.59 0 Td[(1^Ax(5{36) Now,thequadraticLyapunovfunction,asshowninEquation 5{30 ,canbeusedtochecktheoverallstabilityofthenewlydenedtime-varyingsystem,asdescribedbyEquation 5{36 .SubstitutionofEquation 5{36 intothepartialderivativeofEquation 5{30 resultsinthestabilitymetricshowninEquation 5{37 @ @x=xT(I)]TJ /F5 11.955 Tf 15.86 0 Td[(A2x@ @x))]TJ /F7 7.97 Tf 6.58 0 Td[(1(A0+A1)x=xTAx(5{37) 118

PAGE 119

ItiscleartoseefromEquation 5{37 thatinorderforthetime-varyingsystem(withinertia)toachievestability,thenAwouldneedtobenegativedenite. 119

PAGE 120

CHAPTER6EXAMPLEOFVARIABLESWEEPAIRCRAFT 6.1Design 6.1.1BiologicalInspiration Theseagullisalogicalchoicefromwhichtoderivebiologicalinspirationsinceitissoadeptatagileyinginwindyconditions.Suchbirdsareroutinelyseentrackingboats,divingtocatchprey,andlandingonbuoysdespiteheavywindsandstronggustsfromdierentdirections.Themissionsenvisionedforaminiatureairvehiclerequireasimilarsetofabilities;therefore,abiomimeticapproachiswarranted. Theskeletalstructureoftheseagullisacriticalcomponentthatenablesightcapability.Inparticular,thejointsattheshoulderandelbowareusedtorotatethewingsandconsequentlyaltertheightdynamics.Suchrotation,asseeninFig. 6-1 ,causesdisplacementinbothverticalandhorizontaldirectionswhichcorrelatestowingdihedralandwingsweep. Figure6-1. PicturesofSeagulls Thewings,asshowninFig. 6-1 ,willusuallyvarythesweepbetweentheinboardandoutboard.Thevariationresultsfromtheindependentactuationabouttheshoulderandelbowtovarythehorizontalrotation.Thismorphingprovidesavarietyofchangesintheightcharacteristicssuchasstability,divespeed,andturnradius. Also,thewingsareshowninFig. 6-1 tovarythesweepbetweenrightandleftwingsalongwiththeinboardandoutboard.Thisvariationutilizes4degreesoffreedomresulting 120

PAGE 121

fromindependentactuationofshoulderandelbowoneachwing.Thismorphingenablesseveralmaneuversrelatedtohoming,rolling,andrejectingcrosswinds. Emphasisisplacedontherelationshipbetweenwingsweepandmaneuvers.Thesweepisalreadyadesignparameterwhoseeectsonaerodynamicshavebeenstudiedfortraditionalaircraft;however,thestudyofbirdsprovidesadditionalinsightintotheperformancethatmaybeachievableusingindependentmulti-jointsweep.Inthiscase,thecorrelationsbetweensweepanddiveareaugmentedwithcorrelationsbetweensweepandagilityforbothturningandtrimming. 6.1.2MechanicalDesign Avehiclewhichfeaturestheindependentmulti-jointcapabilityisdesignedbyretrottinganexistingaircraft[ 3 ].Thebasicconstructionusesskeletalmembersofaprepregnated,bi-directionalcarbonberweavealongwithrip-stopnylon.Thefuselageandwingsareentirelyconstructedoftheweavewhilethetailfeaturescarbonsparscoveredwithnylon.Theresultingstructureisdurablebutlightweight. Thewingsactuallyconsistofseparatesectionswhichareconnectedtothefuselageandeachotherthroughasystemofsparsandjoints.Thesejoints,asshowninFig. 6-2 ,arerepresentativeofashoulderandelbowwhichservetovarythesweepofinboardandoutboard.Therangeofhorizontalmotionadmittedbythesejointsisapproximately30deg. Figure6-2. JointsonWing 121

PAGE 122

Itisnotedthatconventionalaileroncontrolsurfacesareomittedfromtheaircraft'snaldesign.Thisfeatureisadirectresultofspan-wiseinconsistenciescreatedbythedynamicrangeofmorphingcongurations.Therefore,theelbowjointsaredesignedinsuchamannerthattheyallowbothhorizontalsweepandrollingtwist.Thismotionisaccomplishedbycreatingaoatingjointthatcloselymimicsthevariousrangesofmotionattainablebyanautomobile'suniversaljoint,asshownifFig. 6-3 Figure6-3. FloatingElbowJoint Thewingsurfacemustbekeptcontinuousforanycongurationofsweepingbecauseofaerodynamicconcerns.Thisvehicleensuressuchcontinuitybylayeringfeather-likestructures,asshowninFig. 6-4 ,withinthejoint. Figure6-4. Feather-LikeElements Thesestructuresretractontoeachotherunderthewingwhenboththeinboardandoutboardaresweptback.Conversely,theycreateafan-likecoveracrosstheensuinggap 122

PAGE 123

whentheinboardissweptbackandtheoutboardissweptforward.Thecontractionandexpansionofthesurfaceareacreatedbythesestructuresissmoothlymaintainedbyatractandrunnersystemimplementedontheouterregionsofeachmember,asseeninFigure 6-5 Figure6-5. Trackandrunnersystem Spars,formedfromhollowshaftsofcarbonber,areplacedalongtheleadingedgeofeachwing.Thesesparsactasbotharigidsourcetomaintaintheleading-edgecurvatureandaconnectionofeachindependentwingjoint.Theinboardsparistranslatedhorizontallybyaservo-drivenlinearactuatorlocatedinsidethefuselage.Theinboardsparisthenconnectedtotheinboardwingsectionattheshoulderjointlocatedontheoutsideofthefuselage.Theinboardsparthenconnectsattheelbowjointtooutboardsparatroughlythequarter-spanpoint.Theoutboardwingregionisactivatedindependentlyoftheinboardregionbymeansofaservoattachedattheelbow.Anillustrationofthesparconguration,withcorrespondingattachmentpoints,canbeseeninFig 6-6 6.1.3TechnicalSpecications Thevehicleisxed-wingdesignthatincludesafuselageandempennageforatotalweightof596g.Thefuselagehasatotallengthof48cmandiscomposedofacylindicalbaywithlargestdiameterof7cmthatstretchesfor30cmandaboomwithdiamterof1cmthatstretchesfor18cm.Thewingsaremountedonthetopofthecylindrical 123

PAGE 124

Figure6-6. Underwingsparstructure baywhiletheavionicsaremountedinsidethecylindricalbay.Thecomponentsoftheempennage,includingtheelevatorandrudderwhichactascontrolsurfaces,aredescribedinTable 6-1 Table6-1. Empennagespecications SectionReferenceReferenceReferenceSpan(cm)Chord(cm)Area(cm2) HorizontalTail30.487.62232.26VerticalTail15.247.62116.13Rudder30.484.57139.29Elevator15.243.0446.33 Referenceparametersforthemorphingwingvarybasedonsweepconguration.ArepresentativesetoftheseparametersaregiveninTable 6-2 foralimitedsetofsymmetriccongurationsinwhichtheleftandrightwingshaveidenticalsweep. Theavionicsconsistsofactuatorsandamotor.AsetofeightHitechHS-65MGmetalgearservosprovideactuationandaredistributedasthreeservostocontroltheinboardsweep,outboardsweepandwingtwistofeachwingalongwithtwoservostocontrolthe 124

PAGE 125

Table6-2. Referenceparametersforsymmetricsweep InboardOutboardReferenceReferenceReference(deg)(deg)Span(cm)Chord(cm)Area(cm2) -15-3066.1714.681028.11-10-2073.9713.121003.45-5-1078.8112.38976.250080.3911.84947.1151078.6111.62916.68102073.6111.69885.66153065.7212.13854.76 elevatorandrudder.ThemotorisanE-ightsix-seriesbrushlesselectricmotorpoweredbyathree-cellThunderPowerLi-polymer2100mAhbattery. 6.2Modeling 6.2.1ComputationalTools Aerodynamicsolutionsforthree-dimensionalwingsofanyshapeorsizecanbecalculatedbyusingavortex-latticemodel.Assumingtheowtobeincompressibleandinviscid,thewingismodeledasasetofliftingpanelswitheachcontainingasinglehorse-shoevortex.Bothspan-wiseandchord-wisevariationinliftcanbemodeledasasetofstepchangesfromonepaneltothenext,asshowninFig 6-7 Figure6-7. Modelingoftheliftvectors Locatedatthepanelquarter-chordpositionisaboundvortex,whichshedstwotrailingvortexlines.Therequiredstrengthoftheboundvortexoneachpanelwillneedtobecalculatedbyapplyingasurface-owboundarycondition.Thisboundaryconditionstatesthereiszeroownormaltothesurfaceofthewing.Foreachpanelthiscondition 125

PAGE 126

isappliedatthethree-quarter-chordpositionalongthecenterlineofthepanel.Thenormalvelocityismadeupofafreestreamcomponentandaninducedowcomponent.Thisinducedcomponentisafunctionofstrengthsofallvortexpanelsonthewing.Thus,foreachpanelanequationcanbesetupwhichisalinearcombinationoftheeectivestrengthsproducedfromallpanel.Bysolvingtheseequations,onecanproduceamodelthateectivelydescribestheaerodynamicqualitiesandcontrollabilityofanaircraft. AVL[ 30 ]isavortex-latticemodelthatisbestsuitedforaerodynamiccongurationswhichconsistmainlyofthinliftingsurfacesatsmallanglesofattackandsideslip.Thesesurfacesandtheirtrailingwakesarerepresentedassingle-layervortexsheets,discreditedintohorseshoevortexlaments,whosetrailinglegsareassumedtobeparalleltothelongitudinalx-axis,asshowninFig 6-8 Figure6-8. Modelingofthetrailinglegvectors AVLprovidesthecapabilitytoalsomodelslenderbodiessuchasfuselagesandnacellesviasource-doubletlaments.Theresultingforceandmomentpredictionsareconsistentwithslender-bodytheory,buttheaerodynamicsaregenerallychallengingtocompute,thereforethemodelingofbodiesshouldbedonewithcaution.Ifafuselageisexpectedtohavelittleinuenceontheaerodynamicloads,itshouldbeleftoutoftheAVLmodelentirely.Thisexclusionofthebodyisprescribedtoavoidpotentialinaccuraciesfromenteringtheoverallmodel. 126

PAGE 127

AVLassumesquasi-steadyow,whichallowsunsteadyvorticitysheddingtobeneglected.Moreprecisely,itassumesthelimitofsmallreducedfrequency,whichmeansthatanyoscillatorymotion(e.g.inpitch)mustbeslowenoughsothattheperiodofoscillationismuchlongerthanthetimeittakestheowtotraverseanairfoilchord.Thisassumptionisvalidforvirtuallyanyexpectedightmaneuver.Also,theroll,pitch,andyawratesusedinthecomputationsmustbeslowenoughsothattheresultingrelativeowanglesaresmall,asjudgedbythedimensionlessrotationrateparameters. 6.2.2SweepDetermination Thisvehicleisabletoachieveawiderangeofsweeporientationsinbothsymmetricandasymmetriccongurations.SomerepresentativecongurationsareshowninFig. 6-9 todemonstratetherange. Figure6-9. SweepCongurations Acoordinatesystemisdenedtofacilitatetheproperdescriptionofeachconguration.Sweepanglesassociatedwiththeinboardsectionsaredenotedas1fortherightwingand3fortheleftwing,whileoutboardsectionsuse2fortherightwingand4fortheleftwing.Theseangles,asshowninFig. 6-10 ,aredenedsuchthatpositivevaluesindicateabackwardsweep.Also,eachangleisdescribedrelativetotheright-sidereferencelinethatisperpendiculartothefuselagereference. 127

PAGE 128

6nose -rightside 1 2 3 4 Figure6-10. SweepAngles 6.3AerodynamicProperties 6.3.1SymmetricCongurations:Aerodynamics Theaerodynamicsareevaluatedforthesymmetriccongurationsinwhichthesweepoftherightwingisequivalenttothesweepoftheleftwing.Inthiscase,theonlydegreesoffreedomaretheinboardandoutboardangleswhicharesharedbyeachwing.Theaerodynamicsarecomputedusingavortex-latticemethodthatisdesignedtoconsiderthinairfoils[ 30 ].Asetofrepresentativedataispresentedthatisparticularlyinformativewithrespecttothemaneuversanticipatedforthisclassofvehicle. ThevariationofliftwithrespecttoangleofattackisshowninFig. 6-11 forarangeofsweepcongurations.ThedatashowthattheaircraftobtainsitshighestCLalongaridgelinecorrelatingtoequalbutoppositesweepofinboardandoutboard.Conversely,thisderivativedecreasessignicantlyforcongurationsofinboardandoutboardbeingbothsweptbackorbothsweptforward.Assuch,theliftismoredependentonangleofattackbyutilizingtheadditionaldegreeprovidedbytheelbowtoopposethesweepoftheshoulder. Anotherlongitudinalparameter,Cm,isshowninFig. 6-12 forthesweepcongurations.Thisparameterisdirectlyindicativeofthestaticstability;consequently,thepositivevaluesindicatetheaircraftbecomesmorestaticallyunstableasthewingsaregraduallysweptforward.Thisinstabilityisdemonstrativeofacenterofgravitywhichliesaftofthe 128

PAGE 129

Figure6-11. VariationofLiftwithAngleofAttackforSymmetricSweep neutralpoint.Thecenterofgravityisrelativetotheplacementofmasseswithin,oron,theaircraft,andthereforeshiftsaccordingtoeachmorphingconguration. Figure6-12. VariationofPitchMomentwithAngleofAttackforSymmetricSweep Thedamping-in-rollderivative,towhichClpiscommonlyreferred,isshowninFig. 6-13 forthecongurationspace.Arollratecausesvariationsinangleofattackalongthespanofthewingwhichcreatesarollingmoment.Thisderivativeisnegativeforallsweepcongurations,withthelargestvaluedmagnitudesoccurringinregionscorrespondingtocongurationswithequalbutoppositesweepoftheinboardandoutboardsections.Themagnitudedecreasesforcongurationswithinboardandoutboardbeingbothforwardsweptorbothbackwardsweptwhichsuggestsapotentialitytoauto-rotateorspin. ThevehiclehasdirectionalstaticstabilityasevidencedbythedatainFig. 6-14 forallsymmetriccongurations.Thisdatarelatesthederivativeofyawmomentwithangle 129

PAGE 130

Figure6-13. VariationofRollMomentwithRollRateforSymmetricSweep ofsideslipwhosepositivitydemonstratesthestabilitycondition.Thestabilityisincreasedasthebackwardsweepincreasesbecausethestabilizingcontributionsofthefuselageandverticaltaildominateasthewingloseseectiveness. Figure6-14. VariationofYawMomentwithAngleofSideslipforSymmetricSweep 6.3.2SymmetricCongurations:FlightDynamics Linearizedmodelsoftheightdynamicsarecomputedbyrelatingtheaerodynamiccoecientstothestandardequationsofmotionforight[ 33 ],asgiveninFig. 6-15 .Theselinearizedmodelshavedecoupledstatesthatallowseparateanalysisoflongitudinaldynamicsandlateral-directionaldynamics.Modelsarecomputedforeverysymmetriccongurationintherangeofsweepanglestoindicatethevariedstabilityproperties. Thelongitudinaldynamicsarestable,asshowninFig. 6-16 ,forthemajorityofobtainablecongurations.Largevaluesofforwardsweepfortheinboardrequirealargevalueofbackwardsweepfortheoutboardtomaintainstability.Thesweepof 130

PAGE 131

Figure6-15. Modeltostate-spaceowchart theoutboardsectionisallowedtodecreaseastheinboarddecreasesitsforwardsweep.Eventually,thevehiclecanremainstabledespiteasmallvalueofforwardsweepfortheoutboardaslongastheinboardhasalargevalueofbackwardsweep. Figure6-16. NumberofUnstablePolesofLongitudinalDynamicsforSymmetricSweep Stabilityofthelateral-directionaldynamics,asshowninFig. 6-17 ,isachievedforasmallsetofcongurations.Theonlyregionofstabilitycorrespondstocongurationswithlargevaluesofbackwardsweepofbothinboardandoutboard.Theoneunstablepole,showninFig. 6-17 ,correspondstoaclassicallydenedspiralmodethatiscommonlyfoundtobeunstablewithalargetimeconstant. SomemodalpropertiesofthelongitudinaldynamicsarepresentedinFig. 6-18 toindicatethenumberofcomplexpoles.Eachpairofpolesrelatestoanoscillatorymodeso 131

PAGE 132

Figure6-17. NumberofUnstablePolesofLateral-DirectionalDynamicsforSymmetricSweep responsecharacteristicscanbedirectlyinferred.Inthiscase,thevehicledemonstratesaclassicalsetofphugoidandshort-periodmodesforthemajorityofcongurationsincludingallthosewithbackwardsweepoftheoutboardsections.Thephugoidmodeislostastheoutboardsectionsincreaseinforwardsweepuntileventuallyeventheshort-periodmodeislostforlargevaluesofforwardsweepfortheoutboard.Itcanbesaidthattheintroductionofunstablepoles,asshowninFig. 6-16 ,isdirectlyrelatedtothelossofbothoscillatorymodes,asshowninFig. 6-18 ,orviceversa. Figure6-18. NumberofOscillatoryPolesforLongitudinalDynamicswithSymmetricSweep ThenumberofoscillatorypolesisshowninFig. 6-19 forthelateral-directionaldynamics.Itisseenthatvehicleretainstwo-oscillatorypolesregardlessofthesweepconguration.Therefore,itcanbeinferredthatthevehiclehasaclassicdutchrollmode 132

PAGE 133

forallcongurations.Itcanbesaidthattheintroductionofunstablepoles,asshowninFig. 6-17 ,isnotcausedbyachangeinmodenature. Figure6-19. NumberofOscillatoryPolesforLateral-DirectionalDynamicswithSymmetricSweep 6.3.3AsymmetricCongurations Theaerodynamicsarealsocomputedforasetofasymmetriccongurationsinwhichtherightwingandleftwinghavedierentsweep.Theindependenceofinboardandoutboardoneachwingpresentsasetofcongurationswith4degreesoffreedom;consequently,thedatamustberestrictedtofacilitatepresentation.Theaerodynamicsarepresentedhereforcongurationsinwhichtherightwingisxedwith1=2=0andtheleftwingismorphedfrom-30degto30deginboththeinboardandoutboard. Asetofstandardparameterscanbecomputedtodirectlycomparetheaerodynamicsofsymmetricandasymmetriccongurations.Thevariationwithangleofattackforlift,showninFig. 6-20 ,andmoment,showninFig. 6-21 ,canbecomparedwithFig. 6-11 andFig. 6-12 ,respectively.Theclearsimilaritybetweenthesymmetricandasymmetricvaluesindicatessomerelationshipbetweenthecongurationscanbeinferred.Inparticular,thevariationcausedbysweepingbackasinglewingaresimilarinnaturetothevariationcausedbysweepingbackbothwings.Themagnitudeissmallerwhensweepingbackthesinglewingsosomelossofeciencyissuggested;however,thestabilityderivativesdisplaythesameshapeforeachsituation. 133

PAGE 134

Figure6-20. VariationofLiftwithAngleofAttackforAsymmetricSweep Figure6-21. VariationofPitchMomentwithAngleofAttackforAsymmetricSweep ThevariationofrollmomentwithrollratecanbecomparedinFig. 6-22 withFig. 6-13 alongwithvariationofyawmomentwithangleofsideslipshowninFig. 6-23 andFig. 6-14 forasymmetricandsymmetriccongurations.Again,thevariationsaresimilarinnatureforeachsetofcongurationssuggestingasimilarityinowphysicsbutalossofeciencyintheeect. Figure6-22. VariationofRollMomentwithRollRateforAsymmetricSweep 134

PAGE 135

Figure6-23. VariationofYawMomentwithAngleofSideslipforAsymmetricSweep Anadditionalsetofaerodynamicparametersarecomputedfortheasymmetriccongurationsthatarenullforthesymmetriccongurations.Theseparameters,whichareshowninFig. 6-24 ,representthecouplingbetweenlongitudinaldynamicsandlateral-directionaldynamics.Thedatashowsthatsweepingtheleftwingcausesadramaticincreaseinmagnitudeoftheseparameters.Sucharesultisexpectedsincetheseparametersreecttheasymmetrythatincreaseswithsweep. Figure6-24. VariationofCoupledAerodynamicsforAsymmetricSweep Asetofmodelsthatrepresenttheightdynamicsarealsocomputedfortheasymmetriccongurations.Theselinearizedmodelsdonothavelongitudinalparametersdecoupledfromlateral-directionalparameters;consequently,theanalysismustconsiderasinglecoupledsystem. Thedynamicsareunstable,asshowninFig. 6-25 ,foranycongurationofasymmetricsweep.Thesystemisshowntohaveoneunstablepoleforthemajorityofcongurations 135

PAGE 136

andthreeunstablepolesforasmallregion.Thesmallregionisindicatedbyalargeforwardsweepoftheinboardsectionandaequaldisplacementofsweeparoundtheoutboardneutralposition. Figure6-25. NumberofUnstablePolesforDynamicswithAsymmetricSweep ThenumberofoscillatorymodesispresentedinFig. 6-26 todemonstratesomepropertiesofthevehiclemotion.Inthiscase,thevehiclehastheclassical3oscillatorymodesformostcongurationswhentheoutboardhasneutralorbackwardsweep.Astheoutboardissweptforwardoftheneutralposition,aregionofmodeswappingiscreated.Thisregionofforwardsweepfortheoutboardsectionindicatesthatamodeisgainedorlossstrictlydependingonthesweepoftheinboardsection. Figure6-26. NumberofOscillatoryPolesforDynamicswithAsymmetricSweep Themodesofarepresentativecongurationischaracterizedtodemonstratethecoupledmotionwhichresultsfromanasymmmetricsweepofthewings.Theconguration 136

PAGE 137

ischosentohaveastraightwingontherightwithnosweepso1=2=0andastraightwingontheleftwithbackwardssweepso3=4=15deg.Theeigenvaluesgeneratedfromthisconguration,asshowninTable 6-3 ,indicatesevenstablepolesandoneunstablepolewhichisadistributionexpectedfromFig. 6-25 Table6-3. Setofeigenvalues Eigenvalues -17.59426.401i-37.202-2.78413.394i-0.1920.685i0.0610 FromTable 6-3 ,itcanbeseenthatthedynamicshavetwonon-oscillatorymodes.Thetimeconstantsofthesemodes,asshowninTable 6-4 ,indicatestheonemodehasastableconvergenceandtheotherhasanunstabledivergence.Thestableconvergenceisatleasttwoordersofmagnitudefasterthantheunstabledivergence. Table6-4. Timeconstantsofnon-oscillatorymodes ModeEigenvalueTimeConstant 1-37.200.026920.061-16.393 Theightmotionassociatedwitheachofthesemodesisdeterminedbythemodeshapes.SuchshapesaregiveninTable 6-5 todescribetherelativevalueofeachstateduringtheresponse.Theconvergenttermischaracterizedbymostlyrollratewithminorcontributionsfromangleofattack,rollangleandpitchrate.Thismodeissimilarinnaturetotheclassicallydenedrollmode.Thedivergenttermischaracterizedbyfullycoupledmotioninwhichtherollangleisvaryingalongwithprimarilytheyawrate,butalsotheforwardvelocity.Thismodeissimilarinnaturetotheclassicallydenedunstablespiralmode. 137

PAGE 138

Table6-5. Modeshapesofnon-oscillatorymodes statemode1mode2 forwardvelocity-0.0007-0.1324angleofattack-0.03980.0163pitchrate-0.05380.0003pitchangle-0.00140.0053angleofsideslip-0.00030.0100rollrate0.99710.0557yawrate-0.02310.3811rollangle-0.02680.9131 Table 6-3 alsoindicatesthattheightdynamicshavethreeoscillatorymodes.ThevaluesofnaturalfrequencyanddampingaregiveninTable 6-6 foreachmode.Themodewiththelowestnaturalfrequencyisunstablewhiletheothermodesarestable. Table6-6. Modalpropertiesofoscillatorymodes ModeEigenvalueFrequency(rad/s)Damping 3-17.59426.401i31.730.5464-2.78413.394i13.680.2035-0.1920.685i0.710.270 Theeigenvectorsassociatedwiththesemodesarealsocomplexsothemagnitudeandphaseofeachmodeshapeisusedtoanalyzetherelationshipbetweenstates.Theresultingdata,giveninTable 6-7 ,showsthatmodes3and5areprimarilydominatedbylongitudinalmotionwithonlyasmallcouplingtothelateral-directionalmotion,whilemode4isthedirectopposite.Suchmotionisnotentirelyunexpectedsinceeventhesymmetriccongurationshadoscillatorymodesaectingboththelongitudinalandlateral-directionaldynamics.Assuch,mode3haspropertieswithsomesimilaritytoashort-periodmode,whilemode4haspropertiessimilartoadutch-rollmodeandmode5similartoaphugoidmode. Sensorpointinginurbanenvironmentsisaprimemissionforwhichmicroairvehiclesarebeingdeveloped.Crosswinds,bothsteady-statewindandtime-varyinggusts,presentasignicantchallengetomaintainingsensorpointingduringight.Thecommonapproach 138

PAGE 139

Table6-7. Modeshapesofoscillatorymodes Mode3Mode4Mode5statemagnitudephase(deg)magnitudephase(deg)magnitudephase(deg) forwardvelocity0.02-42.60.0195.30.990.0angleofattack0.49-102.60.0536.10.08-179.1pitchrate0.620.00.0787.70.050.2pitchangle0.02-123.70.005-14.00.07-105.5angleofsideslip0.0002-61.20.0781.30.0002-20.3rollrate0.61-28.50.24-66.50.0051.5yawrate0.02-129.10.970.00.003-82.8rollangle0.02-152.20.02-168.30.007-104.2 tosensorpointingdespitecrosswindsisturningintothewindandcrabbingdownrangetoperiodicallypointthesensor;however,suchanapproachiscertainlynotoptimalduetothelackofcontinuouscoveragebythesensoralongthedesiredlineofsight. Asymmetricwing-sweepcanenhancetheabilitytoperformsensorpointinginthepresenceofsuchcrosswinds.Inparticular,onewingcanbesweptdownwindwhileonewingissweptupwind.Theaircrafthas,inasense,rotatedthewingsintothewindwhilethefuselageremainspointedinitsoriginaldirection.Thischangeintheeectivesideslipanglecaneasilybeillustrated,asseeninFig. 6-27 Figure6-27. EectiveAnglesofSideslip Theangleofsideslipatwhichtheaircraftcantrimisanindicatoroftheamountofcrosswindinwhichtheaircraftcanmaintainsensorpointing.Arepresentativedemonstration,showninFig. 6-28 ,presentsthemaximumpositivevaluesforangleof 139

PAGE 140

sideslipatwhichtheaircraftcantrim.Thewingsareconstrainedinthisdemonstrationsuchthatinboardandoutboardanglesareidenticalwhichlimitsthedegreesoffreedomandfacilitatespresentation.Also,eachconditioncorrespondstothelargestangleofsideslipatwhichtheaircraftcantrimgivendeectionlimitsof15degfortherudderandelevatoralongwithaileron. Figure6-28. MaximumAngleofSideslipatwhichAircraftcanTrim ThedatainFig. 6-28 demonstratesthatwingsweepisbenecialforsensorpointing.Specically,aforward)]TJ /F1 11.955 Tf 9.3 0 Td[(30degsweepoftheleftwingandabackward30degsweepoftherightwingallowsanangleofsideslipof44degtobemaintained.Thismaximumangledecreasesastheleftwingdecreasesitsforwardsweepandtherightwingdecreasesitsbackwardsweep.Thevehicleiseventuallyunabletotrimatanypositiveangleofsideslipwhenthebothwingsaresweptbackward. 6.4DynamicProperties 6.4.1MissionScenario Thevariablewing-sweepvehicleisdesignedforsurveillanceinurbanoperations.Inparticular,itisdesignedtoallowightinconstrainedareaswithlimitedairspace.Arepresentativemissionisplacingasensorintoawindowonabuildingwhichisclosetootherbuildings. 140

PAGE 141 Themissionproleforsuchamissioninvolvesseveralsegments.Theinitialightisstandardstraight-and-leveloperationatanaltitudeabovethebuildings.Uponreachingtheopeningbetweenthosebuildings,thevehicleentersasteepdivetorapidlydecreasealtitudewithoutincurringmuchforwardorsidetranslation.Theaircraftceasesthediveandreturnstostraight-and-levelightasquicklyaspossiblewhenthealtitudereachesthedesiredvalueassociatedwiththewindow. Themorphingvariestoincreaseperformanceofthemetricsassociatedwitheachmissionsegment.Theinitialightusesacruisecongurationwiththewingshavingnosweep.Thedivethenutilizesafullyswept-backconguration.Finally,thevehiclereturnstoanominalcongurationforenteringthewindow.Ineachcase,theaircraftusesasymmetricsweepofthewingstoavoidanycouplingassociatedwithasymmetriccongurations[ 46 ]. Themissionproleforsuchamissionagaininvolvesseveralsegments.Theinitialightisstandardstraight-and-leveloperationatanaltitudewithinthebuildings.Uponreachingadesiredopeningbetweenbuildings,thevehicleentersacoordinatedturntorapidlychangeheadingwithoutincurringmuchchangeinaltitude.Theaircraftceasestheturnandreturnstostraight-and-levelightasquicklyaspossiblewhentheheadingreachesthedesiredvalueassociatedwiththewindow. Themorphingagainvariestoincreaseperformanceofthemetricsassociatedwitheachmissionsegment.Theinitialightusesacruisecongurationwiththewingshavingnosweep.Theturnthenutilizesanequal-but-oppositecongurationarrangement.Anexampleofthisequal-but-oppositemorphingwouldbetheleftwingfullyforwardandtherightwingfullyswept.Finally,thevehiclereturnstoanominalcongurationforenteringthewindow.Itshouldbenotedthattheasymmetricmorphingcausesthedynamicstoexperiencecross-coupling. 141

PAGE 142

6.4.2MassDistribution Anelementalbreakdownoftheaircraft'smassdistributionallowsformoreaccurateinertialmomentsandratestobecomputed.Thesemassesarerepresentedaspointmassesandarelocatedatsomedistancefromtheaircraft'scenterofgravity.Thecenterofgravityisafunctionofwingmorph;therefore,ittranslatesalongthethree-dimensionalbody-axisaccordingly.Themagnitudeofthistranslationalchangeisfoundtobenegligiblethroughoutthedesiredmorphingrange,sinceverylittlemassisactivelymovedwhensweepingthewings,andthereforeassumedstationaryforthismodel. Adirectresultofhavingthisxedcenterofgravityisthattheaircraft'snon-dynamicpointmassesprovideforaconstantinertialmoment,whereonlythedynamicpointmasses,suchastheleftandrightwingsections,createanon-constantmoment.Theoverallmagnitudeofthisnon-constantmomentisdirectlydependentonhowtheaircraftisbeingmorphed.Iftheaircraft'swingsaresymmetricalwithrespecttothecommonlyassignedxz-plane,thenonlythexzinertialproducttermappears,whereas,ifthewingsareasymmetricalwithrespecttothexz-plane,thenallthreeinertialproducttermswillappear. Thewingisdividedintoseparateinboardandoutboardsections,whereacentroidlocationisfoundforeach.Basedonhowthewingismorphed,athreedimensionalaverageistakenbetweentheinboardandoutboardcentroids.Thisaverageistakenwithrespecttothecenterofgravityandisrepresentativeofanoverallcentroidlocationfromwhichthatwing'spointmassislocated. Asimplediagramillustratingtheaircraft'ssectionaldistributionandcenterofgravitylocationisshowninFigure 6-29 .NotethatinFigure 6-29 ,thecoordinatesystemisuniquetothemodelingprogramandisorientedoppositetotheearlierdenedaircraftbody-axis.ThisgureisaccompaniedbyTable 6-8 ,whichliststhemassesforeachsection.ThesemassesarethenusedtocalculatetheindividualinertialmomentslistedinTable 6-9 142

PAGE 143

Figure6-29. PointMassLocations Table6-8. Individualpointmasses MB(g)MF(g)MM(g)MTB(g)MVT(g)MHT(g)MRW(g)MLW(g) 1302955015884545 Table6-9. Characteristicsofelementsgivenascentroidposition(in)andmomentsofinertia(gin2) elementSymbolXYZIxxIyyIzzIxyIxzIyz batteryB-2.50.0-1.753981211812.50.0-5960.0fuselageF0.00.0-1.759039030. 6.4.3ManeuverAssumptions Asetofplantmodelsaregeneratedtorepresenttheightdynamicsateachconguration.Essentially,theforcesandmomentsaectingthevehiclearecomputedusinganassumptionofsteady-stateconditions.Theresultingmodelsdonotproperlyrelatetheunsteadyaerodynamicsbutwillincludethedominantsteady-stateaerodynamics.Thetime-varyinginertiasarethenintroducedtoaccountforthemorphingusingtheexpressionsderivedinSection 143

PAGE 144

6.4.4DiveManuever Thevehicleisconstrainedinthismaneuvertosimplifythecongurationspace.Thephysicalvehiclehas4degrees-of-freedominthateachinboardandoutboardcansweepindependentlyontheleftandrightsides;however,thissimulationconstrainstheleftandrightwingstosymmetricsweepwiththeoutboardhavingtwiceasmuchsweepastheinboard.Thisconstraintlimitsthesystemtoasingledegree-of-freedomwhichisappropriateforthelongitudinalnatureofthealtitudechangeassociatedwiththemission. Theightdynamicsforeachcongurationaretrimmedforstraightandlevelight.Actually,thethrustisheldconstantforeachofthesecongurationstonotethepropulsionisnotaectedbythemorphing.Suchanapproachisparticularlyusefulforrelatingmodelsthatmaybetrimmedatvariousairspeeds.Inthiscase,thethrustanddragwereheldconstantsothatthetrimroutinefoundthecorrectairspeed,asshowninFigure 6-30 ,torelateeachmodel. Figure6-30. ChangeinVelocityBasedonSymmetricMorphing:0deg( {2{ ),5deg( {/{ ),10deg( {{ ),15deg( {{ ),20deg( {.{ ),25deg( {{ ),30deg( {4{ ) Figure 6-30 relatestheoveralldragtovelocitywhereeachtrendline(designatedbylinetype),representsamorphingconguration.AconstantthrustoftwoNewtonsischosenand,thusalineisdrawntorepresentthisvalue.Itisshownthatasthewingsaremorphedfurtherback,theintersectionatwhichthetrendlinescrosstheconstant 144

PAGE 145

thrustlinesteadilyincreases.ThispointofintersectionrepresentsthevelocitynecessarytomaintaintwoNewtonsofdragatthatconguration.Overall,Figure 6-30 suggeststhatbysweepingthewingsback,highervelocitiescanbeattained,whilemaintainingaconstantdrag(equaltothrustintrimmedcases).Thistrendisasensibleresultduetothefactthatlesssurfaceareaisexposedtotheoncomingairowwhilethewingsaremorphedbackward. Thevelocitiesfoundateachintersectionarethenusedascorrespondingtrimvelocitieswhenperformingthedivemaneuver. Acontrollerisformulatedforthisaircrafttoenableamaneuverenvisionedinitsmissionprole;namely,acompensatorwillcommandthevehicletotrackadesiredaltitudeprole.Amulti-looparchitectureisusedtorepresentthecontrollerwhichwillbederivedinamodularapproach. Apairofcontrollersareactuallycomputedforthisaircraftsuchthatonecontrollerisappropriateforthenominalcongurationwhiletheotherisappropriatefortheswept-backconguration.Essentially,thecontrollersarederivedusinganassumptionofinstantaneousmorphing.Suchanapproachsimplyswitchesbetweenfeedbackgainstomatchtheassumedswitchbetweennominaldynamicsandswept-backdynamics.Obviouslythemorphingisnotinstantaneous;however,thisassumptionisnotoverlyunreasonablegiventhefastrateofmorphingontheaircraft. Aninner-loopcontrollerisderivedtotrackcommandstopitchrate.Thiscompensatoriscomputedusingalinear-quadraticregulator[ 87 ]usingafeedbackelement,K,andafeedforwardelement,k,alongwithanintegrator.Actually,thedesignisbasedonshort-perioddynamicstoavoidthepolesandzeroesassociatedwiththephugoiddynamics.Theguaranteeofnosteady-stateerrorinresponsetoastepcommandisonlyassociatedwiththeshort-periodmodelbutthefull-orderdynamicsusedinthesimulationstillshowanacceptableresponse. 145

PAGE 146

Anouter-loopcontrollerisderivedtoaecterrorinaltitude.Thedierencebetweencommandedaltitudeandmeasuredaltitudeisprocessedthrougharst-orderlter,F,toshapethephaseproperties[ 115 ].Theresultingsignalissomewhatindicativeofapitchcommandsoitsderivativeisusedasapitch-ratecommandfortheinner-loopcontroller. Theresultingclosed-loopsystem,asshowninFigure 6-31 ,incorporatesthevariouselementsusingappropriatefeedbackinthemulti-looparchitecture.Anadditionalfeedforwardelement,Z,isincludedinthedesigntoaectthepitchduringtheresponse. a F s 1 s k P K 6 6 ? Z ?huwq Figure6-31. Closed-LoopBlockDiagram Thesimulationofthemorphingaircraftmustproperlyaccountforthetime-varyingdynamics.Essentially,themorphingiscommandedtochangethroughoutthesimulationsotheightdynamicsmustchangeaccordingly.Theplant,P,inFigure 6-31 ,isthussomewhatcomplicatedinitsimplementation. Adiscretizedtypeofmorphingisutilizedinthesimulationtorepresentthesymmetricwing-sweepvariations.ThephysicalaircraftshowninFigure 6-9 hasasweepthatvariesasacontinuousfunctionoftime;however,adiscretizedversionofthismorphingsimpliesthesimulationwithoutlossofgenerality.Inthiscase,thedynamicsassumea5-degreesweepcanbeaccomplishedinstantaneouslybuteach5-degreeincrementmustbeseparatedbysomeminimumtime. 146

PAGE 147

Astandardstate-spaceformulationisusedtorepresenttheplantasshowninFigure 6-32 .Theplantdynamics,whichvarywithmorphingpositionandrate,aregivenbythequadrupleoffA;B;C;Dg. u U B 1 s -y X A 6 D ? Figure6-32. PlantModelwithTrimLogic TheelementofXisusedtoaccountforthechangeintrimconditionsforeachconguration.Considerthatatanypointintime,t,thetotalstatevalue,x(t),isactuallytheadditionofatrimvalue,xo(t),andperturbation,x(t),suchthatx(t)=xo(t)+x(t).Thistotalstatemustremaincontinuousdespitethemorphingeventhoughthetrimvalue,xo(t),willchange.Sincetheplantmodelusesstateperturbationsasafeedback,thenthelogicofXissuchthatx(t+t)=xo(t)+x(t))]TJ /F5 11.955 Tf 11.2 0 Td[(xo(t+t)forsomeintegrationstep-sizeoft. TheelementofUissimilarinnaturetoX.Inthiscase,theelementisusedtoreectthevariationsinelevatorpositionassociatedwithtrim. Thewingcongurationaltersduringthemissiontoreectthedesiredperformance.Therstcongurationhasnosweeptoreectacruiseprole.Thewingsarethensweptbacktothemaximumvaluewhenthediveisinitiated.Uponreachingthedesiredaltitude,thevalueofthesweepisreducedtoreturntoaproleforenteringthewindow.Theangleofthesweep,asshowninFigure 6-33 ,isvariedforsimulationsbasedonfastmorphingorslowmorphing. 147

PAGE 148

Figure6-33. MorphingCongurationforFastMorphing( | ),SlowMorphing( )-222()-222()]TJ ET 0 G 0 g BT /F1 11.955 Tf 438.74 -186.8 Td[() Thealtitudevariation,showninFigure 6-34 ,isthefundamentalmetricusedtoevaluateperformance.Inthiscase,themorphingvehiclesareabletochangetherequiredaltitudeandreturntostraight-and-levelightwithin2.2s.Thefastandslowmorphingaresimilarfortherstsecondbutthenbegintodivergesomewhat.Thefastmorphinghasreachedafullyswept-backcongurationatthistimesoitsresponseahassomewhatlargerovershootthanthatseenwiththeslowmorphing.Thisobservationisadirectresultofthefastmorphingcaseacquiringahighervelocitysoonerandretainingitforalongerperiodoftime.Twoothercasesareconsiderwheremorphingisnotutilized.Thesecasesincludedivemaneuversperformedwiththenominalstraight-wingandfullysweptcongurations.ItisseeninFig. 6-34 thatthenominalcongurationreachesthethedesiredaltitudetheslowestbuthasthesmallestovershoot,whilethefullysweptcongurationreachesthedesiredaltitudemuchfaster,yethasthelargestovershoot. ThestatesassociatedwithpitchareshowninFigure 6-35 inresponsetothealtitudecommandwhilemorphing.Theslowmorphing,incomparisontothefastmorphing,incursagreaterpitchangleduringtheinitialresponsebutthenincursasmallerpitchangleasthevehiclereachesitsnalaltitude.ThisbehaviorcorrelateswiththealtituderesponseofFigure 6-34 148

PAGE 149

Figure6-34. AltitudeinResponsetoFastMorphing( | ),SlowMorphing( ::: ),FixedSwept( )-222()-222()]TJ ET 0 G 0 g BT /F1 11.955 Tf 139.37 -170.84 Td[(),FixedStraight( )-221(\001 ) Figure6-35. PitchAngle(left)andPitchRate(right)inResponsetoFastMorphing( | ),SlowMorphing( ::: ),FixedSwept( )-222()-222()]TJ ET 0 G 0 g BT /F1 11.955 Tf 279.35 -357.97 Td[(),FixedStraight( )-222(\001 ) Thelateral-directionalstatesarefoundnottovarywithalongitudinaldivemaneuver.Thisresultissomewhatexpected,duetothefactthattheaircraftissymmetricallymorphingandthusthecross-couplinginertiasarecancelledoutduetosymmetry. Finally,theelevatorangleisshowninFigure 6-36 todemonstratetheresponsedoesnotincurexcessiveactuation.Themorphingcertainlyinuencestheelevatorinthatthecontroleectivenessdecreasesasthewingsaresweptback.Assuch,theslowmorphinghastheslowestspeedbutalsousesthesmallestrotationofelevator. Theclosed-loopsystemisnotabletosuccessfullycompletethemissionusingonlythenominalcontrollerdesignedforthenominalwingconguration.Thevehicleisabletodivebetweenthebuildingsandsuccessfullychangealtitudewithininanitetimeasshownin 149

PAGE 150

Figure6-36. AltitudeinResponsetoFastMorphing( | ),SlowMorphing( ::: ),FixedSwept( )-222()-222()]TJ ET 0 G 0 g BT /F1 11.955 Tf 139.37 -165.43 Td[(),FixedStraight( )-221(\001 ) Figure 6-34 ;however,ifconstrainedtoacertainspaceandtime,theresultingightpathsassociatedwithmorphingmissthewindowandintersectthesideofthebuilding,asseeninFigure 6-37 .Thisfailuredirectlyresultsfromtheinabilitytoaccountfortime-varyingeectsinthecontrollerdesign.NotethatinFigure 6-37 thecoordinatesarebasedonanEarth-xedframewithaxesdenedbyX,Y,andH. Theightcontrollerneedstobealteredtocompensateforthetime-varyingparametersassociatedwithmorphing.Althoughmorphingintroducesinertialratesintothedynamics;theseratesarefoundtohavelittleeectontheoverallplantdynamicsandthereforealtertheightpathslightly,asseeninFig. 6-38 .Itshouldbenotedthattheinertialrates,asshowninEquationrefeq41,arecalculatedfromwingscontaininglessthanfteenpercentoftheaircraft'soverallmass.Whenthemassesofthewingsegmentsareincreased(orthetimetomorphisdecreased,asshownbythefastmorphinginFig. 6-38 ),thenthecontributionsfromtheinertialratesbecomemoreprominentintheoveralldynamics.Theresultingchangeindynamicswouldaltertheightpathfurther,thusillustratingtheimportanceofinertialrates. Dierentapproachesmaybetakentoaltertheightcontroller,buteachhasit'sownchallenges.Acompensatortoregulatethepitchisdicultbecausethegainsmustbeoptimizedtothedynamicsbutthosedynamicsarerapidlychangingduringthemorphing. 150

PAGE 151

Figure6-37. AltitudeinResponsetoFastMorphing( | ),SlowMorphing( ::: ),FixedSwept( )-222()-222()]TJ ET 0 G 0 g BT /F1 11.955 Tf 139.37 -468.51 Td[(),FixedStraight( )-221(\001 ) Alternatively,atrackingcontrollercanbeusedafterthemaneuverwhenthedynamicsareknownandxedbutthevehiclemustre-hometowardstheoriginalwaypointorre-locatethewindowusingvisionfeedbackandthencomputeanewtrajectory. 151

PAGE 152

Figure6-38. AltitudeinResponsetoFastMorphing( | ),SlowMorphing( ::: ),FastMorphingWithoutInertia( )-221(\001 ),SlowMorphingWithoutInertia( )-222()-222()]TJ ET 0 G 0 g BT /F1 11.955 Tf 456.7 -396.51 Td[() 6.4.5CoordinatedTurnManeuver Thevehicleisconstrainedinthismanuevertoagainsimplifythecongurationspace.Thismaneuverconstrainstheleftandrightwingstoequal-but-oppositeasymmetricsweepwiththeoutboardhavingnorelativesweepcomparedtotheinboard.Thisconstraint,likethedivemaneuver,limitsthesystemtoasingledegree-of-freedomwhichisappropriateforthelateral-directionalnatureofthechangeinturnperformanceassociatedwiththemission. 152

PAGE 153

Theightdynamicsforeachcongurationaretrimmedforsteadybankedight,andagainthethrustisheldconstantforeachofthesecongurations.Therefore,thetrimroutinefoundthecorrectairspeed,asshowninFigure 6-39 ,torelateeachmodel. Figure6-39. ChangeinVelocityBasedonAsymmetricMorphing:0deg( {2{ ),5deg( {/{ ),10deg( {{ ),15deg( {{ ),20deg( {.{ ),25deg( {{ ),30deg( {4{ ) Fig. 6-39 relatestheoveralldragtovelocitywhereeachtrendlinerepresentsamorphingconguration.AconstantthrustoftwoNewtonsisagainchosenasthedesiredvalue.Itisshownthatasthewingsareasymmetricallymorphed(equalbutopposite,wheretheangleismeasuredwithrespecttotherightwing),theintersectionatwhichthetrendlinescrosstheconstantthrustlinesteadilyincreases.ThispointofintersectionrepresentsthevelocitynecessarytomaintaintwoNewtonsofdragatthatconguration.Overall,Fig. 6-39 suggeststhatbyasymmetricallysweepingthewingsinanequalbutoppositemanner,slowervelocities(inabankedturn)areattainedwhilemaintainingaconstantdrag(equaltothrustintrimmedcases). Thevelocitiesfoundateachintersectionarethenusedascorrespondingtrimvelocitieswhenperformingthecoordinatedturnmaneuver. Thecoordinatedturnmaneuverusesabasicclosed-loopapproachforcontrollingthesystem,althoughanopen-loopdesigncouldbeused.Anopen-loopcontrollerwould 153

PAGE 154

besucientbecauseeachplantmodelispreviouslytrimmedforabankedturn.Themodelingtool,AVL,incorporatesaninternalcommandusedfortrimmingmodelsatauserdenedbankangle.Therefore,ifnopilotcommandsaregivenandallexternaldisturbancesareneglected,theaircraftwillremaintrimmedandcompletethemaneuver. Itisnotedthatthemodelsusedtosimulatethismaneuverareperturbationmodelsandthereforeproducestateperturbations.Asaresult,abasicfeedbackloopisincorporatedtomeasurethedierencebetweenthebankangleperturbationandzero.Azerocommandisgiventorepresentthedesiredperturbationfromtrim.Themeasureddierenceisthenmultipledbyaproportionalgainandfedintotheplantasanaileroncontrolcommand.Thisfeedbackloopisincorporatedtoguaranteecontinuitythroughoutmorphing,asdescribedfurtherinSection .Theresultingclosed-loopsystemcanbeseeninFigure 6-40 u k P ?uwqpr Figure6-40. Open-LoopBlockDiagram Likeinthedivemaneuver,themorphingisagaincommandedtochangethroughoutthesimulationandthereforetheightdynamicschangeaccordingly.Althoughtheplant,P,inFigure 6-40 ,isslightlydierentfromtheplantmodelderivedforthedivemaneuverinFigure 6-31 ,itisstillsomewhatcomplicatedinitsimplementation. 154

PAGE 155

Adiscretizedtypeofmorphingisagainutilizedinthesimulationtorepresenttheasymmetricwing-sweepvariations.Theturnsimulationisidenticaltothedivesimulationinthatthephysicalaircrafthasasweepthatvariesasacontinuousfunctionoftimeandadiscretizedversionofthismorphingisusedinthesimulation. Astandardstate-spaceformulationisusedtorepresenttheplantasshowninFigure 6-41 .Theplantdynamics,whichvarywithmorphingpositionandrate,aregivenbythequadrupleoffA;B;C;Dg. u E A R B 1 s -y X A 6 D ? Figure6-41. PlantModelwithTrimLogic TheelementofXisagainusedtoaccountforthechangeintrimconditionsforeachconguration.Thesameconsideration(asthatforthedivesimulation)ismadetoaccountforthecontinuityofthetotalstatedespitethemorphing,aswellasthefeedbackofperturbations. TheelementsA,EandRaresimilarinnaturetoU,asseeninFigure 6-32 .Inthiscase,theelementsareusedtoreectthevariationsinaileron,elevator,andrudderposition,respectively,associatedwithtrim. Amissionischosenfortheturnmaneuver,similartothedivemaneuver,suchthatitwillagaintryytointoaonemeterwindow.Thewingcongurationaltersduringthemissiontoreectthedesiredperformance.Therstcongurationhasnosweepto 155

PAGE 156

reectacruiseprole.Thewingsarethenasymmetricallyswept(equalbutopposite)toachieveamaximummorphedcongurationconsistingoftheleftwinghavingafullforwardsweepwhiletherightwingisequalbutopposite.Themaximummorphedcongurationismaintaineduntiltheendofthemaneuverwhenthevalueofthesweepisreducedtoreturntoaproleforenteringthewindow.Theangleofthesweep,asshowninFigure 6-42 ,isvariedforeachsimulationbasedonfastmorphingorslowmorphing. Figure6-42. MorphingCongurationforFastMorphing( | ),SlowMorphing( )-222()-222()]TJ ET 0 G 0 g BT /F1 11.955 Tf 438.74 -334.56 Td[() Theturnvariation,showninFigure 6-43 ,isthefundamentalmetricusedtoevaluateperformance.Inthiscase,themorphingvehiclesareabletochangetherequiredturningradiusandreturntostraight-and-levelightata270degreeheadingchange.Thefastandslowmorphingaresimilarduringtherstandlastsectionsofthemaneuverbutvarysomewhatthroughouttheactualturn.Theresponseoffastmorphingmorecloselyresemblesthatofthenon-morpedsweptresponseduetothefactthefastmorphingreachesthefullysweptcongurationatanearliertime.Therefore,thefastmorphingresponsecontainsalargerportionproducedfromthesweptwingcongurationthanthatoftheslowmorphingresponsewhichtakeslongertoachievethesameconguration. ThelateralperturbationstatesareshowninFigure 6-44 astherollangleandrollrate.Itisseenthatthefastermorphinginboththerollangleandrateperturbations 156

PAGE 157

A B C Figure6-43. TurninResponsetoFastMorphing( | ),SlowMorphing( ::: ),FixedSwept( )-222()-222()]TJ ET 0 G 0 g BT /F1 11.955 Tf 139.37 -355.98 Td[(),FixedStraight( )-221(\001 ):A)ThecompleteturnproleB)Theturnproleat270degreesC)Theturnproleat180degrees achievehighermagnitudes.Therollangledisplaysthistrendthroughouttheentiremaneuver,whiletherollrateonlyhaslargermagnitudesatthetransientregions. Figure6-44. RollAngle(left)andRollRate(right)inResponsetoFastMorphing(|),SlowMorphing()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() 157

PAGE 158

ThedirectionalperturbationstatesinFigure 6-45 indicatetheyawrateandsideslipangle.Itisnoticedthatthefastermorphingincurslargerperturbationsinbothdirectionalstatesthroughouttheentiremaneuver. Figure6-45. YawAngle(left)andYawRate(right)inResponsetoFastMorphing(|),SlowMorphing()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() Itisnotedthattheturnmaneuverrequirestheaircrafttomorphasymmetrically,andthereforeresultsincoupleddynamics.ThestateperturbationsassociatedwithpitchareshowninFigure 6-46 inresponsetothesimplecontrolsurfacecommandwhilemorphing.Thefastmorphing,incomparisontotheslowmorphing,incursagreaterpitchrateperturbationatbothtransientregions,yetbehavesverysimilarduringthesteadystateregion.Incontrast,thepitchangleperturbationassociatedwithfastmorphinghasahighermagnitudethroughouttheentiremaneuver. Figure6-46. PitchAngle(left)andPitchRate(right)inResponsetoFastMorphing(|),SlowMorphing()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() 158

PAGE 159 Theclosed-loopsystemisnotabletosuccessfullycompletethemission.Thevehicleisabletoturnbetweenthebuildingsandsuccessfullychangeheadingwithinthedesiredtimeandairspace.However,whentheeectsofmorphingareintroduced,theresultingightpathmissesthewindowandintersectsthesideofthebuilding,asseeninFigure 6-47 .Thisfailuredirectlyresultsagainfromtheinabilitytoaccountfortime-varyingeectsinthecontrollerdesign.NotethatinFigure 6-37 ,thecoordinatesarebasedonanEarth-xedframewithaxesdenedbyX,Y,andH. Figure6-47. TurninResponsetoFastMorphing(|),SlowMorphing(:::),FixedSwept()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[(),FixedStraight()-221(\001) 159

PAGE 160

TheeectsofmorphingonthetrajectoryoftheightpathcanbetterbeseeninFigs. Itwasseeninthepreviousmissionthatinertialrateswereintroducedasaresultofmorphing.Duetothesymmetryoftheaircraftinthatmaneuver,mostinertialmomentsandthereforerates,werecancelledout.Inthecaseoftheturnmaneuver,alltheinertialmomentsandratesarekept.Thepresenceofthesetermshasamorepronouncedeectontheturnradius,asseeninFigure 6-48 ,thanthatseenfordiveinthepreviousmission,asseeninFigure 6-38 Figure6-48. TurninResponsetoFastMorphing(|),SlowMorphing(:::),FastMorphingWithoutInertia()-221(\001),SlowMorphingWithoutInertia()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() 160

PAGE 161

Theightcontrollerforthismissionalsoneedstobealteredtocompensateforthetime-varyingparametersassociatedwithmorphing.Simplyintroducingacompensatortoregulatethelateral-directionalstatesischallengingbecausethegainsmustbeoptimizedtothedynamicsbutthosedynamicsarerapidlychangingduringthemorphing.Itispointedoutthatthedynamicsarenowcoupled(duetoasymmetricmorphing)andthereforethecontrollermustalsocompensateforthelongitudinalstates.Atrackingcontrollermayalsobeusedbutthesamedicultiesarisethatwerepointedoutwiththedivemaneuver. 6.5Time-VaryingModalAnalysis 6.5.1Kamen'sMethod Theintroductionofsymmetricmorphingvariestheaerodynamicsandassociatedvaluesofstabilityderivatives.Thesevariationsresultingfrommorphingthesweepsymmetricallyareprimarilyrestrictedtosomederivativesofverticalforceandallthederivativesofpitchmoment.Assuch,thestandardstate-spacerepresentationofthelinearizeddynamicsismodiedinEquation 6{1 toreectthedependencyofthesederivativesonthemorphinggivenas.Ithasbeenshown[ 20 ]thatastheorderofthedynamicsystemincreases,sodoesthediucltytorepresentthem(usingKamen'smethod).Therefore,themodalanalysisutilizingKamen'smethodwillbelimitedtothefourthordersystemdescribedbyEquation 6{1 .Thestatesofthissystemaregivenasuforforwardvelocity,wforverticalvelocity,qforpitchrate,andforpitchanglewhilethestabilityderivativesincludeXiforderivativeoflongitudinalforcewithrespecttotheistate,Ziforderivativeofverticalforcewithrespecttotheistate,andMiforderivativeofpitchmomentwithrespecttotheistate. 161

PAGE 162

266666664_u_w_q_377777775=266666664XuXwXq)]TJ /F5 11.955 Tf 9.3 0 Td[(gcos0ZuZw()u0)]TJ /F5 11.955 Tf 9.3 0 Td[(gsin0Mu()Mw()Mq()00010377777775266666664uwq377777775(6{1) Theanalysisoftime-varyingdynamicsusingthepolesdenedinEquation 3{14 requiresthestate-spacesysteminEquation 6{1 tobeformulatedasadierentialequation.Inthiscase,theequationinvolvingtheverticalvelocity,w,isconsidered.Theequationsinvolvingtheotherstatescanalsobederived;however,thepolesassociatedwiththeverticalvelocityaresucienttocharacterizetheentiresystemsinceanypolesetofobtainedbyatransformationofthesepoles. Thegeneralformofthefourth-orderexpressionforverticalvelocityisgiveninEquation 6{2 byincludingtime-varyingcoecients,A1;A2;A32R,whicharelengthyandthusdenedintheAppendix. d4w dt4+A3(t)d3w dt3+A2(t)d2w dt2+A1(t)dw dt+A0(t)w=0(6{2) ThecoecientsinEquation 6{2 havesignicantlydierentdependenciesonthemorphinginthateachdependsonthestabilitiesderivativesofZw;Mw;Mq;muwhichvarywithmorphingbutnoteachdependsontheratesofchangesofthesestabilityderivatives.ThevalueofA0dependsonboththerstderivativeandsecondderivativewithrespecttotimeforall4ofthesestabilityderivatives;conversely,A3dependsonlyontherstderivativeandsecondderivativewithrespecttotimeforMqandMu.TheeectofmorphingonA3canevenbefurthermitigatedbynotingthatA3dependsonthemorphingvaluebutnotthemorphingrateif_Mu _Mq=Mu Mq=)]TJ /F11 7.97 Tf 10.5 4.71 Td[(Zu uo.Assuch,thetimevariationsofcertainstabilityderivativesonlyaectcertaincoecientsdependingontherateofchangeofthemorphingtrajectory. 162

PAGE 163

Also,thedynamicshaveapotentialtoexperienceabifurcationthatreducestheorderofthedynamics.ThecoecientsinEquation 6{2 eachcontainafractionwiththesamedenominatorwhichiszeroforcertainvaluesofmorphing.ThelossoforderisequivalentlyviewedbymultiplyingEquation 6{2 bythisdenominatorsothatthedependenceond4w dt4isscaledbyzero. TheightdynamicsofthevehicleshowninFigure 6-9 areanalyzedduringsymmetricmorphingfromabackwardsweeptohavingnosweep.Specically,thesweepvariedfrom+30degto0degin1secandthenremainsatasweepangleof0degforeachwing.Thismorphingwouldbevaluablewhentransitioningfromadivetostraight-and-levelightsimilarinamannertobiologicalsystemslikegullsandhawks.Thistransition,especiallywhenoperatingimmersedindenseobstaclessuchasurbanenvironments,maystillrequirerapidmaneuveringforpositioningalongwithgustrejectionsotheightdynamicsduringthemorphinremainofcriticalimportance. TheresponseofthestatesareshowninFigure 6-49 asaresultofthemorphing.Theaircraftisalineartime-varyingsystemsfortheinitial1sec;however,theresponsestillresemblesthetraditionalmodesforalineartime-invariantsystem.Thepitchrateandverticalvelocityshowahigh-frequencyresponsethatisheavilydampedtoresembletheshort-periodmode;conversely,theairspeedandpitchanglearedominatedbyalow-frequencyresponsethatislightlydampedtoresembleaphugoidmode. Thetime-varyingpolesassociatedwithFigure 6-49 arecomputedtosatisfyEquation 3{14 andshowninFigure 6-50 alongwiththetime-invariantpolesthatignorethetime-varyingeectsofmorphing.Theseresultindicateseveralcharacteristicsoftime-varyingpoles.Considerthatthetime-invariantpolesassociatedwiththeshort-periodmoderemainsimilarforanyvalueofmorphing;however,thetime-varyingpolesofp41andp42,whichareinitiallyclosestinvaluetotheshort-periodpoles,decaytozeroatarate 163

PAGE 164

Figure6-49. LongitudinalStatesduringMorphingfrom+30degto0degover1sec:ForwardVelocity(upperleft),VerticalVelocity(upperright),PitchRate(lowerleft),PitchAngle(lowerright) similartodecayofthestateresponseduetodamping.Also,notethatthepolesofp43andp44showthelowmagnitudeandslowdecayassociatedwithaphugiodmode;however,thesepolesvaryduringtheinitialresponsewhichisdominatedbytheashort-periodresponse.Assuch,thetime-varyingpolesdierinnaturefromtime-invariantpolesinthattheshort-periodmodeandphugoidaresomewhat,butnotcompletely,distinctandthemagnitudeofthepolesdecaysastheresponsedecays. ThemodesdenedinEquation 3{9 associatedwitheachpoleinFigure 6-50 areshowninFigure 6-51 .Thedecompositionoftheresponseactuallydependsontheeigenvectorsandthesemodes,asopposedtothetime-varyingpoles,sotheymustbeconsideredwhenevaluatingtheightdynamics.Theindistinctseparationbetweentheshort-periodmodeandthephugiodmodethatisevidentinthepolesisalsoevidentinthemodes.Themodesof41and42showtheinitialvariationthatwouldindicateashort-periodresponse;however,thesemodesremainsignicantafterthedecaydueto 164

PAGE 165

Figure6-50. LinearTime-VaryingPoles(|)andLinearTime-InvariantPoles()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()duringMorphingfrom+30degto0degover1sec:RealPart(upperleft)andImaginaryPart(lowerleft)ofp41andp42,RealPart(upperright)andImaginaryPart(lowerright)ofp43andp44 short-perioddampingandthenshowvariationmoreconsistentwiththephugoidmode.Themodesfor43and44showsomeinitialinconsistencyaround1secbutthenarequiteconsistentwiththephugiodmode.Indeed,therealpartsof43and44areremarkablysimilartotheresponseofforwardvelocity,whichispredominatelyduetothephuoidmode,inFigure 6-49 Thenatureofthemodesagreeswiththemathematicalpropertiesthatrelatethemtoboththeresponseandthepoles.TheresponsesofFigure 6-49 areoscillatoryandindeedthepolesofFigure 6-50 arecomplexconjugatessothemodesofFigure 6-51 arealsocomplexconjugates.TherealandimaginarypartsofthemodesarenotedinEquation 4{18 tobe90ooutofphaseandindeedthisphasedierenceisseenforthealltimesofthephugoidresponseof43andtheinitialtimesofshort-periodresponseof41until0:2secwhenthedampinghascausedtheresponsetodecay.Also,thestateresponseshouldbeproportionaltotherealpartofthemodeasnotedinEquation 4{19 whichis 165

PAGE 166

Figure6-51. ModesAssociatedwithTime-VaryingPolesduringMorphingfrom+30degto0degover1sec:RealPart(upperleft)andImaginaryPart(lowerleft)of41and42,RealPart(upperright)andImaginaryPart(lowerright)of43and44 demonstratedbytheverticalvelocityinFigure 6-49 matchingtherealpartof1andtheforwardvelocityinFigure 6-49 matchingtherealpartof3. TheissueofstabilityisdirectlyindicatedbythemodesofFigure 6-51 .Thesemodesdemonstratethatthesystemduringthismorphingtrajectoryhasasymptoticstabilitysincethemagnitudeofeachmodedecaystozeroastimeincreases.ThisresultcorrelateswiththeresponsesshowninFigure 6-49 thatobviouslyreturntoequilibrium.Notethatoneguaranteeforasymptoticstabilityishavingnegativereal-partforthetime-varyingpole.TherealpartofthepolesinFigure 6-50 predominatelyassociatedwiththephugoidmodeareindeedalwaysnegative;however,therealpartofthepolespredominatelyassociatedwiththeshort-periodmodearesometimespositivesothemodemustbecomputedtoascertainstability. Finally,theeigenvectorsassociatedwitheachmodeofFigure 6-51 aregraphedinFigure 6-52 toshowtherelativeresponseofeachvehiclestateasnormalizedbythe 166

PAGE 167

verticalvelocity.Theseeigenvectors,similarlyasthethepolesandmodes,showbothshort-periodcharacteristicsandphugiodcharacteristicsbuteachisclearlydominatedbyonetypeofdynamic.Theeigenvectorofv1initiallyshowsshort-periodmotion,withlittlevariationinforwardvelocityandaphasedierenceof90obetweenpitchrateandverticalvelocity,untilthedampingdecaysthatmotionandthephugoidresponseisevident.Theeigenvectorofv2steadilytransitionstothephugiodresponsewhichisprimarilymotioninforwardvelocityandpitchanglewhichare90ooutofphase.Also,notethattheseeigenvectorsnearlyconvergetosimilarmagnitudesandphasesexceptfora90odierenceinphaseofthepitchanglebetweenv1andv2. Figure6-52. NormalizedEigenvectorsAssociatedwithTime-VaryingModesduringMorphingfrom+30degto0degover1sec:Magnitude(upperleft)andPhase(lowerleft)ofv1andMagnitude(upperright)andPhase(lowerright)ofv2 AmodalinterpretationofthepolesinFigure 6-50 isconductedtorelatethesemathematicalconstructstostandardparametersassociatedwithightdynamics.Theparametersaredirectlycomputedfromthetime-invariantpoleswhiletheircounterparts 167

PAGE 168

fromthetime-varyingpolesresultfrominterpretationsthatrelatecharacteristicsoftheresponses. ThenaturalfrequenciesasshowninFigure 6-53 havesomecommonalitiesbutalsosomecleardierenceswhencomparingthetime-varyingpolesandthetime-invariantpoles.Thevaluesarereasonablyclosefortheentiretrajectorywhenconsideringthepolesassociatedwiththephugoidmode;however,thevaluesareonlycloseforashorttimewhenconsideringtheshort-periodmode.Thedierenceinnaturalfrequenciesfortheshort-periodmoderesultsfromtherelationshipofthetime-varyingpolestothestates.Essentially,theshort-periodpoleisinitiallyrelatingtheoscillatorybehavioroftheresponsebutthesignicantdecreaseinresponsemagnitudeduetodampingisactuallyreectedbythetime-varyingpoledecayingtozero. Figure6-53. NaturalFrequencyAssociatedwithLinearTime-VaryingPoles(|)andLinearTime-InvariantPoles()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()duringMorphingfrom+30degto0degover1sec:Poles1and2(left)andPoles3and4(right) TheenvelopethatboundstheresponsesareshowninFigure 6-54 .Theparametersaresimilarforthephugoidmodebutagain,aswiththenaturalfrequency,theparametersdierforthetime-varyingpolesandthetime-invariantpolesfortheshort-periodmode.Inthiscase,theenvelopeboundstheresponseofthepitchrateandverticalvelocitywhichdominatetheshort-periodresponsebutthen,afterthatmodehasdampedout,theenvelopereecttheboundonthepitchangle. 168

PAGE 169

Figure6-54. EnvelopeAssociatedwithLinearTime-VaryingPoles(|)andLinearTime-InvariantPoles()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()duringMorphingfrom+30degto0degover1sec:Poles1and2(left)andPoles3and4(right) ThedampingratioisshowninFigure 6-55 forthetime-varyingpolesandtime-invariantpoles.Thesevaluesaresmallforbothtypesofpolesandthusarereasonablyclose. Figure6-55. DampingRatioAssociatedwithLinearTime-VaryingPoles(|)andLinearTime-InvariantPoles()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()duringMorphingfrom+30degto0degover1sec:Poles1and2(left)andPoles3and4(right) 6.5.2O'Brien'sMethod AsopposedtoKamen'smethod,itwasshowninSection 3.5 ,thatO'Brien'smethodcaneasilybeimplementedonhigherordersystems.Therefore,individual,eightstate,quasi-staticplantmodelsaretakenatperiodiccongurationsovertheentiremorphing 169

PAGE 170

range.Thesemodelsareshowntobe8x8realstatematrices.Eachperiodiccongurationrepresentesadiscretepointintime.Plantmatricesarethenbrokendownbyelements,whereeachelementisplacedintocorrespondingvectors.Theelementvectorsaretheneachanalyticallyttoauniquepolynomial.Byplacingthesefunctionsbackintotheiroriginalpositionswithintheplantmatrix,anequivalenttime-varyingmatrix(ormodel)canbeformed,asshowninEquation 6{3 A(t)=2666666666666666666664f11(t)f12(t)f13(t)f14(t)f21(t)f22(t)f23(t)f24(t)f31(t)f32(t)f33(t)f34(t)f41(t)f42(t)f43(t)f44(t)00f55(t)f56(t)f57(t)f58(t)f65(t)f66(t)f67(t)f68(t)f75(t)f76(t)f77(t)f78(t)f85(t)f86(t)f87(t)f88(t)3777777777777777777775(6{3) ThefunctionsdenedinEquation 6{3 arefoundtohaveapolynomialstructure,asshowninEquation 6{4 170

PAGE 171

f11(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(0:09t)]TJ /F1 11.955 Tf 11.96 0 Td[(0:33f55(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(0:03t2+0:07t)]TJ /F1 11.955 Tf 11.95 0 Td[(0:77f12(t)=0:13t2)]TJ /F1 11.955 Tf 11.96 0 Td[(0:67t)]TJ /F1 11.955 Tf 11.96 0 Td[(0:29f56(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(0:0013t2)]TJ /F1 11.955 Tf 11.95 0 Td[(0:002t)]TJ /F1 11.955 Tf 11.96 0 Td[(0:0017f13(t)=)]TJ /F1 11.955 Tf 9.29 0 Td[(0:03t2)]TJ /F1 11.955 Tf 11.96 0 Td[(0:08t)]TJ /F1 11.955 Tf 11.96 0 Td[(0:15f57(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(0:0006t)]TJ /F1 11.955 Tf 11.95 0 Td[(0:99f14(t)=0:03t)]TJ /F1 11.955 Tf 11.96 0 Td[(9:79f58(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(0:001t+0:41f21(t)=0:16t2)]TJ /F1 11.955 Tf 11.96 0 Td[(0:66t)]TJ /F1 11.955 Tf 11.96 0 Td[(1:49f65(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(31:3t2+643t)]TJ /F1 11.955 Tf 11.95 0 Td[(1013f22(t)=0:79t2)]TJ /F1 11.955 Tf 11.96 0 Td[(3:45t)]TJ /F1 11.955 Tf 11.96 0 Td[(8:95f66(t)=5:94t2)]TJ /F1 11.955 Tf 11.96 0 Td[(20:73t)]TJ /F1 11.955 Tf 11.95 0 Td[(25:23f23(t)=0:19t2)]TJ /F1 11.955 Tf 11.96 0 Td[(0:23t+22:41f67(t)=0:6t3)]TJ /F1 11.955 Tf 11.96 0 Td[(1:17t2)]TJ /F1 11.955 Tf 11.96 0 Td[(3:92t+14:76f24(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(0:12t2+0:51t+0:62f68(t)=0f31(t)=)]TJ /F1 11.955 Tf 9.29 0 Td[(0:63t3+5:96t2)]TJ /F1 11.955 Tf 11.95 0 Td[(5:12t)]TJ /F1 11.955 Tf 11.95 0 Td[(9:33)]TJ /F1 11.955 Tf 11.96 0 Td[(0:33f75(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(2:82t3+25:38t2)]TJ /F1 11.955 Tf 11.96 0 Td[(70:61t+279f32(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(3:27t3+31:99t2)]TJ /F1 11.955 Tf 11.95 0 Td[(2:76t)]TJ /F1 11.955 Tf 11.95 0 Td[(81:14f76(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(0:29t2+0:87t+0:05f33(t)=)]TJ /F1 11.955 Tf 9.29 0 Td[(1:06t3+4:47t2)]TJ /F1 11.955 Tf 11.95 0 Td[(3:19t)]TJ /F1 11.955 Tf 11.95 0 Td[(30:32f77(t)=)]TJ /F1 11.955 Tf 9.3 0 Td[(0:22t2+1:03t)]TJ /F1 11.955 Tf 11.95 0 Td[(6:57f34(t)=0f78(t)=0f41(t)=0f85(t)=0f42(t)=0f86(t)=1f43(t)=1f87(t)=0f44(t)=0f88(t)=0(6{4) Altogether,thetwelvestatevectorincludesthethreeorientationangles(,, ),thethreeangularrates(p,q,r),thepositionvector([xyz]),andthevelocityvector([uvw]).Forthepurposesofconvenience,thestatevectorwillbereducedtoeightstatesandaugmentedtoinclude.Thereduced,augmentedstatevectorcanbeshowninequation 6{5 171

PAGE 172

x(t)=2666666666666666666664u(t)w(t)q(t)(t)(t)p(t)r(t)(t)3777777777777777777775(6{5) Applyingthetime-varyingalgorithmdenedinSection 3.5 tothetime-varyingmodelinequation 6{3 ,ateacht2R+,producesanLTVpoleset,stabilitymodes,andcorrespondingeigenvectors.Duetotheextensiveamountofdataproducedforeachmorphingconguration,aswellasthepotentialenvelopeforwhichtheaircraftcanmorph,onlycertainmorphingtrajectoriesandcongurationsarechosentostudythetime-varyingdynamics.Inadditiontolimitingtheamountofcongurations,onlythelongitudinalsystemdynamicsareconsidered.Thecongurationsarechosensuchthattheyincludedsymmetricsweepfromstraight(0degrees)tosweptpositionsof10,20,and30degrees.Eachofthesemorphingtrajectoriesareperformedatratesof2,5,10,and20seconds.Increasingtherateofmorphingalsoincreasestheoveralleectthetime-varyinginertiacontributesintothesystem'sdynamics. Thesetime-varyingeectsareevident,asshowninFigures 6-56 6-59 .Clearly,thestabilitymodesinFigures 6-56 6-57 showtwomodeswhichconvergeuponzeroquickly(modesAandB),whiletwomodesconvergeuponzeroaftersomelengthyperiodoftime(modesCandD).ObservationsshowthatmodesAandBshowlittlechangefromvaryingthemorphingrateorangle.ThisresultissimplyduetothefactmodesAandBhavealreadyconvergeduponzerobeforeanyinertialeectshavebeenintroduced. 172

PAGE 173

A B C D Figure6-56. Stabilitymodechangevstimechange:10degrees(|),20degrees()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[(),30degrees(---)A)2secondsB)5secondsC)10secondsD)20seconds Conversely,modesCandDdoexperiencetheeectsofinertiaandthereforeshowlargedierencesastimeprogresses.ObservationsofFigures 6-56 6-57 suggestthatastheallowablemorphingtimeisreduced,thedeviationincoincidentmodesshapesincrease.Thisobservationleadstothefollowingintuitiveresult;asthemorphingtimeisreduced,theoveralleectsofinertiaincrease,andthereforeproducelargersystemerrorswhicharepreviouslyunaccountedfor. ThepolesetscorrespondingtotheaforementionedstabilitymodesareshowninFigures 6-58 6-59 .Likethetrendshownwiththestabilitymodes,thepolesetsalsodeviateintimebaseduponthemoprhingrateorangle.Thisobservationisintuitivedue 173

PAGE 174

A B C Figure6-57. Stabilitymodechangevsdegreechange:20seconds(|),10seconds()-203()-204()]TJ /F1 11.955 Tf 32.77 0 Td[(),5seconds(---),2seconds()A)10degreesB)20degreesC)30degrees tothefactthatthepolesetsaredirectlycomputedfromthestabilitymodes.ItshouldbenotedthatinFigures 6-59 A6-59 B,thatsomepolesetsseemtoconvergeuponaconstantvalue.Thisconvergingactionisduetothefactthattherespectivepolesethasreachedtheendofitsmorphingmaneuverandhasindeedbecometime-invariant.Thesystem'stime-invariancedemonstratesthatthestateequationisT-periodicandthereforeavalidrepresentationofthetime-varyingpolesetcanbegivenbythesystem'sfrozentimeeigenvalue[ 86 ].AnotherimportantobservationderivedfromFigures 6-58 6-59 isthattwopolesetscreateahighfrequency,oppositephase,oscillatingpair,whiletheothertwopolesetscreatealowfrequency,oppositephase,oscillatingpair.Recallfromthe 174

PAGE 175

previouslyshownmechanicalsystemexamplethatanoppositephase,oscillatingpolepairisrepresentativeofdiscretecomplex-conjugatepolepair.Usingthisfact,itcanstatedthatthepolesetsgeneratedforthelongitudinalaircraftexamplearedirectlycomparabletotheclassicallydenedtimeinvariantphugoidandshortperioddynamicmodes. A B C D Figure6-58. Polechangevstimechange:10degrees(|),20degrees()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[(),30degrees(---)A)2secondsB)5secondsC)10secondsD)20seconds Togainabetterunderstandingforthedampingandfrequencyelementsoftheselongitudinalaircraftmodes,letusconsiderasinglecasewheretheaircraftmorphs30degreesin10seconds.Thecorrespondingpolesets,stabilitymodes,andorthonormalvectormatrixareshowninFigures 6-60 6-62 175

PAGE 176

A B C Figure6-59. Polechangevsdegreechange:20seconds(|),10seconds()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[(),5seconds(---),2seconds()A)10degreesB)20degreesC)30degrees ThepolesetsfoundinFigure 6-60 Aoscillatedirectlyaboutlineswhicharecontinuousrepresentationsofthefrozentimeeigenvalues.Aconclusion,similartothatfoundwiththemechanicalsystemexample,canbedrawnsuchthattheaverageoftheoppositephase,oscillatingpolesetpairscanbeusedtondthedampingofthedynamicmodalresponses.Figure 6-60 Aalsoillustratesaninitialtransientregionwheretwopolesetsswap.Thisregion,alongwiththeill-conditionedregionfortheshort-period-likepolesetsaredisregarded.ItcanbeseenfromFigure 6-60 A6-60 Bthattheill-conditionedregionfortheshort-period-likepolesetsdirectlycorrelatestothetime 176

PAGE 177

A B Figure6-60. Longitudinalaircraft30degree,10secondmorphA)polesets:polesets1and2()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[(),polesets3and4(---),time-invariantfrozentimeeigenvalues(|)B)stabilitymodes:mode1(|)mode2()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()mode3(---)mode4() thatthecorrespondingstabilitymodesconvergeuponzero.Thisisthesameintuitiveresultthatwasshownearlierinthemechanicalsystemexample. Animportantobservationtakenfromthepreviousmechanicalsystemexample,inSection 4.4 ,wasthatthedynamicmodalfrequenciescouldbestudiedbylookingattheperiodicityofthecolumnvectorsinQ.Thissameobservationcanbeappliedtothelongitudinalaircraftexample.Fromthisexample,itcanbeseenthatcolumnvectors1and2,asseeninFigure 6-61 ,describeresponseswithagreaterperiodicitythanthatfoundincolumnvectors3and4,asshowninFigure 6-62 Therelativedierencesinperiodicityonceagainsuggeststhatthereexistscomparabletraitsbetweenthecalculatedtime-varyingdynamicmodesandtheclassicallydenedtime-invariantphugoidandshort-perioddynamicmodes.Figures 6-62 A6-62 Drepresentthecolumnvectorsthatdescribethehighlydamped,higherfrequencytime-varyingpolesets,andlikethepolesets,thecolumnvectorsbecomeill-conditionedasthecorrespondingstabilitymodesconvergeuponzero.ThisresultisduetothefactthatthemultiplicationofQandRmustlinearlycombinetocreatethesimulatedstateresponses,asshowninFigure 6-63 177

PAGE 178

A B Figure6-61. LongitudinalaircraftQcolumnvectors1and2for30degree,10secondmorph:A)Q11(|)Q21()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()Q31(---)Q41()B)Q12(|)Q22()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()Q32(---)Q42() Thestatesforthisexampleareu(thebodyrelatedx-axisvelocity(m/s)),w(thebodyrelatedz-axisvelocity(m/s)),q(themeasuredpitchrate(deg/s)),and(themeasuredpitchangle(deg)),wheretheirrelativeresponsesareshowninFigures 6-63 A6-63 D.RecallthatthestateresponsesareunforcedresponseswiththeinitialconditionvectordescribedbyEquation 6{6 266666664u0w0q00377777775=26666666415000377777775(6{6) 6.6FeedforwardControl 6.6.1MorphingBasis Thepolynomialbasisusedtoconstrainthemass-springexample,showninSection 5.4.3 ,willalsobeusedasthebasisconstraintforthisexample.Recall,thatanymorphingtrajectoryisrestrictedtoathird-orderpolynomialoftimeandmustliewithinthesetofallpolynomialswithrealcoecients,asseeninEquation 5{11 178

PAGE 179

A B C D Figure6-62. LongitudinalaircraftQcolumnvectors3and4for30degree,10secondmorph:A,B)Q13(|)Q23()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()Q33(---)Q43()C,D)Q14(|)Q24()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()Q34(---)Q44() Thecoecientsofthemorphingtrajectoryareboundedsuchthattheaircraftneversweepsitswingspast30deg.Thehigher-ordertermsinthepolynomialhavethepotentialtodominateastimeincreases;consequently,thesetermsarerestrictedmorethanthelower-orderterms. Theprocedureofdeterminingtheinitialboundsactuallyndsthecoecientssequentiallybyconsideringonlyonecoecienttobeanon-zerovalueatatime.Indongso,thesolutiondeterminesthemaximumcontributionneededbyeachmorphingcoecienttoremainwithin30deg.ThisprocedurecanbeshowninEquation 6{7 179

PAGE 180

A B C D Figure6-63. LongitudinalaircraftstateresponsesA)state1(u)B)state2(w)C)state3(q)D)state4() iti=30 (max(t))ii=0;:::;3(6{7) Also,aconstraintisintroducedsuchthatj(t)j30forallvaluesoftime.Thisconstraintnotesthatthedesiredsignalisassumedtobeboundedandthusthesystemmustexperiencerealisticgeometrychange.Thecoecientsofeachpolynomialareadditionallylimitedtomaintainthisboundedcondition. TheresultingboundsonthecoecientsaregiveninTable 6-10 180

PAGE 181

A B C D Figure6-64. Longitudinalaircraftcolumneigenvectorsfor30degree,10secondmorph:A)V11(|)V21()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()V31(---)V41()B)V12(|)V22()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()V32(---)V42()C)V13(|)V23()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()V33(---)V43()D)V14(|)V24()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[()V34(---)V44() Table6-10. Boundsoncoecientofmorphingbasis CoecientUpperBoundLowerBound 030-3012-220.133-0.13330.009-0.009 181

PAGE 182

6.6.2TrackingASystemResponse Asetofdesiredresponsesaregeneratedusingpolynomialmorphing.Thesepolynomialsrangeasarst-order,second-orderandthird-orderfunctions.TheoptimizedvaluesofthemorphingcommandsaregeneratedforfeedforwardcontrolandshowninTable 6-11 .TheoptimizedmorphingisessentiallyidenticaltothedesiredmorphingwhichisanticipatedsincethedesiredmorphingcanbeexactlyduplicatedbythemorphingbasisofEquation 5{11 Table6-11. Optimalpolynomialmorphingtotrackdesiredpolynomialmorphing desiredactual 5+1:5t5+1:5t1:8t)]TJ /F1 11.955 Tf 11.96 0 Td[(0:08t21:8t)]TJ /F1 11.955 Tf 11.96 0 Td[(0:08t27)]TJ /F1 11.955 Tf 11.95 0 Td[(0:25t)]TJ /F1 11.955 Tf 11.95 0 Td[(0:1t2+0:008t37)]TJ /F1 11.955 Tf 11.95 0 Td[(0:25t)]TJ /F1 11.955 Tf 11.95 0 Td[(0:1t2+0:008t3 Theoptimizedstateresponses,muchliketheoptimizedmorphingtrajectories,areessentiallyidenticaltothedesiredstateresponses.TheseresponsesareshowninFigure 6-65 Anotherdesiredresponseisattemptedtobetrackedusingthepolynomialmorphing;however,thisdesiredresponseisassociatedwithamorphingcomposedofasinusoidaladdedtoapolynomial.ThisdesiredmorphingcannotbeduplicatedusingtherestrictedbasisofEquation 5{11 sosomeerrormustresultinthetracking.TheoptimizedpolynomialformorphingisgiveninTable 6-12 alongwiththisdesiredmorphing. Table6-12. Optimalpolynomialmorphingtotrackdesiredsinusoidalmorphing desiredactual 0:75t+cos(t)0:7874+0:153t)]TJ /F1 11.955 Tf 11.95 0 Td[(0:0819t2+0:0025t3 TheresultingstateresponseisshowninFigure 6-66 asreasonablyclosetothedesireresponse.Someerrorispresentaroundthepeaks;however,thedesiredmorphingliescloseenoughtothetherangeofthemorphingbasissuchthatthefeedforwardcontrolisnearlyabletoprovidethecorrecttracking. 182

PAGE 183

A B C Figure6-65. DesiredResponse(|)andOptimalResponse()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[()forA)First-OrderMorphingandB)Second-OrderMorphingandC)Third-OrderMorphing Apiecewise-polynomialmorphingisagainconsideredtoexpandtherangeofthemorphingbasisseeninEquation 5{11 .Thesameconstraintsplacedonthepiecewise-polynomialtechniqueseeninthemass-springexampleapplyhere.Recall,themorphingbasisisallowedtobearst-orderpolynomialwhosecoecientscanvaryatdiscretepointsintime;whereitisalsorequiredthattheoverallmorphingbecontinuousthroughouttheentireresponse. Applyingthepiecewise-polynomialtechniquetothesinusoidalmorphingresponse,resultsintheoptimizedvaluesgiveninTable 6-13 183

PAGE 184

Figure6-66. DesiredResponse(|)andOptimalResponse()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[()forSinusoidalMorphing Table6-13. Optimalpiecewise-polynomialmorphingtotrackdesiredsinusoidalmorphing desiredactual 0:75t+cos(t)1:245)]TJ /F1 11.955 Tf 11.96 0 Td[(0:103t:0t2:973:693+0:852t:2:97
PAGE 185

Figure6-67. DesiredResponse(|)andOptimalResponse()-221()-223()]TJ /F1 11.955 Tf 33.2 0 Td[()forSinusoidalMorphing showninTable 6-14 .Itisagainseenthattheoptimizedmorphingisessentiallyidenticaltothedesiredmorphing. Table6-14. Optimalpolynomialmorphingtotrackdesiredpolynomialmorphing desiredactual 8+0:75t8+0:75t)]TJ /F1 11.955 Tf 9.3 0 Td[(3+1:25t+0:02t2)]TJ /F1 11.955 Tf 9.3 0 Td[(3+1:25t+0:02t2)]TJ /F1 11.955 Tf 9.3 0 Td[(5+2t)]TJ /F1 11.955 Tf 11.95 0 Td[(0:1t2+0:008t3)]TJ /F1 11.955 Tf 9.3 0 Td[(5+2t)]TJ /F1 11.955 Tf 11.96 0 Td[(0:1t2+0:008t3 Theoptimizedpolesignalsareessentiallyidenticaltothedesiredpolesignals.ThesesignalsareshowninFigure 6-68 Anotherdesiredsignalisattemptedtobetrackedusingthepolynomialmorphing.Thisdesiredsignalisagainassociatedwithamorphingcomposedofasinusoidaladdedtoapolynomial.Forsimplicity,itremainsthesamedesiredsinusoidalmorphingasthatusedforthestateresponse.TheoptimizedpolynomialformorphingisgiveninTable 6-15 alongwiththisdesiredmorphing. Table6-15. Optimalpolynomialmorphingtotrackdesiredsinusoidalmorphing desiredactual 0:75t+cos(t)1:007+0:078t+0:0736t2)]TJ /F1 11.955 Tf 11.96 0 Td[(0:0089t3 185

PAGE 186

A B C Figure6-68. A)ResponsetoMorphingTrajectory:Desired(|),Optimized()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()B)ResponsetoMorphingTrajectory:Desired(|),Optimized()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[()C)ResponsetoMorphingTrajectory:Desired(|),Optimized()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() Althoughusingthesamedesiredmorphing,theoptimizedpolynomialinTable 6-15 isdierentfromthatinTable 5-4 .Thisresult,likethatseeninthemass-springexample,issimplyduetotheoptimizationofadierentcostfunction. TheresultingpolesignalisshowninFigure 6-69 .Someerrorispresent;however,thefeedforwardcontrolisagainnearlyabletoprovidethecorrecttracking. Applyingthepiecewise-polynomialtechniquetothesinusoidalmorphingresponse,resultsintheoptimizedvaluesgiveninTable 6-16 186

PAGE 187

Figure6-69. ResponsetoMorphingTrajectory:Desired(|)andOptimized()-222()-222()]TJ /F1 11.955 Tf 33.21 0 Td[() Table6-16. Optimalpiecewise-polynomialmorphingtotrackdesiredsinusoidalmorphing desiredactual 0:94t+sin(t)1:218)]TJ /F1 11.955 Tf 11.96 0 Td[(0:047t:0t2:979:197)]TJ /F1 11.955 Tf 11.96 0 Td[(0:660t:2:97
PAGE 188

CHAPTER7CONCLUSION Thispaperinvestigatestheeectsofwingsweepontheightcharacteristicsforaminiatureairvehicle.Inparticular,thevariationsadmittedbyamulti-jointmechanismarestudied.Suchamechanismallowsindependentchoiceofinboardandoutboardforeachwing.Thisvehicleisactuallyincorporatingabiologically-inspiredapproachthatnotestherotationsofshouldersandelbowsbygulls.Theassociatedaerodynamicsvaryinbothforceandmomentandthewingsweeprangesacrosssymmetricandasymmetriccongurations.Theresultingightdynamicsdemonstratetheasymmetricsweepisbenecialtomaintainingsensorpointingdespitecrosswinds;consequently,thebiomimeticdesignhasenhancedmissioneectivenessforthisclassofvehicles. Theequationsofmorphingarederivedforamorphingaircraftandshowntoincludetermsassociatedwithasymmetriesandtime-varyinginertias.Acriticaleectoftheseelementstermsisacouplingbetweenthelongitudinalandlateral-directionaldynamics.Essentially,thesetermsindicatethatthetransientbehaviorofmorphingcanbesignicantlydierentthanitssteady-statebehavior.Simulationsoftheclosed-loopbehaviorsforavariablewing-sweepaircraft(bothindivingandturning)indicatetheadverseinuencethatsuchtransientbehaviorcanpotentiallyhaveonmissionperformance.Inbothcases,theresultinginertiasproducedduringthetransientresponseresultedinrespectivelongitudinalandlateraltranslationsthatcausedthevehicletomissitstarget. Thispaperalsopresentsndingsbasedonobservationstakenfromparametercomputations[ 86 ]fortwodierentlineartime-varyingsystems.Comparisonsbetweenthetwotime-varyingexamplesaremade,fromwhichconclusionsaredrawnonhowtosolveforanddescribeasystem'stime-varyingdynamicmodes.Specically,itisshownthatforaparticularmorphingaircraftmaneuver,thelongitudinaltime-varyingparametersresembletheclassicallydenedtime-invariantphugoidandshort-periodcharacteristics. 188

PAGE 189

Thedampingandfrequencyrelatedtothetime-varyingdynamicmodesarefoundtoberelatedtotheaverageoftwooppositephase,oscillatingpolesetsandcolumnvectorperiodicityoftheorthonormalQmatrix,respectively.Itshouldbenotedthatduetothenatureofthedynamicmodesderivedinthispaper,onlyoscillating,complex-conjugatepolesandmodeswerestudied. Lastly,thispaperpresentsndingsbasedonamorphingcontroloftwodierentlineartime-varyingsystems.Comparisonsbetweenthetwotime-varyingexamplesaremade,fromwhichconclusionsaredrawnforthetrackingcapablilityofafeedforwarddesign.Specically,itisshownforparticularaircraftmorphingtrajectories,thatfeedforwardtrackingcanbeachievedondesiredstateresponseandpolevaluesignals.Itisalsoshownthattrackingmaybeperformedusingpiecewise-polynomialtechniques.Currently,feedforwardtrackingispreformedo-lineusingpredenedsignalsasdesiredinput. Futureworkwillconsistofstudyingthelateral-directionalaircraftmodel,fromwhichdenitionsforbothpurelyrealandcomplex-conjugatepolesandmodeswillbediscussed.Also,futureworkwillconsistofimplementingthepreviouslydenedfeedforwardcontrollerinsomeformofmulti-elementfeedbackcontroller.Feedbackwillbeutilizedforpurposesofsignalgeneration,noisecompensationandrobustness. 189

PAGE 190

REFERENCES [1] M.AbdulrahimandR.Lind,"FlightTestingandResponseCharacteristicsofaVariableGull-WingMorphingAircraft,"JournalofAircraft,inreview. [2] M.AbdurahimandR.Lind,"ControlandSimulationofaMulti-RoleMorphingMicroAirVehicle,"JournalofGuidance,ControlandDynamics,inreview. [3] M.Abdulrahim,H.Garcia,andR.Lind,"FlightCharacteristicsofShapingtheMembraneWingofaMicroAirVehicle,"JournalofAircraft,Vol.42,No.1,January-February2005,pp.131-137. [4] A.Y.AganovicandZ.Gajic,"TheSuccessiveApproximationProcedureforFinite-TimeOptimalControlofBilinearSystems,"IEEETransactionsonAu-tomationandControl,Vol.39,No.9,pp.1932-1935,Sept.1994. [5] F.Amato,C.Cosentino,A.S.Fiorillo,andA.Merola,"StabilizationofBilinearSystemsViaLinearState-FeedbackControl,"IEEETransactionsonCircuitsandSystems,Vol.56,No.1,January2009. [6] P.ApkarianandR.J.Adams,"AdvancedGain-SchedulingTechniquesforUncertianSystems,"IEEETransactionsonControlSystemsTechnology,Vol.6,No.1,January1998,pp.21-32. [7] P.ApkarianandP.Gahinet,"AConvexCharacterizationofGain-ScheduledH1Controllers,"IEEETransactionsonAutomaticControl,Vol.40,No.5,May1995,pp.853-864. [8] R.K.ArningandS.Sassen,"FlightControlofMicroAirVehicles,"AIAA-2004-4911. [9] J.Bae,T.M.Seigler,D.J.InmanandI.Lee,"AerodynamicandAeroelasticConsiderationsofaVariable-SpanMorphingWing,"JournalofAircraft,Vol.42,No.2,March-April2005,pp.528-534. [10] B.R.ABarmish,"NecessaryandSucientConditionsforQuadraticStabilizabilityofanUncertainSystem,"JournalofOptimation,Theory,andApplication,Vol.46,1985,pp.399-408. [11] G.BeckerandA.Packard,"RobustPerformanceofLinearParametricallyVaryingSystemsusingParametrically-DependentLinearFeedback,"Systems&ControlLetters,Vol.23,1994,pp.205-215. [12] J.D.BendtsenandK.Trangbaek,"RobustQuasi-LPVControlBasedonNeuralState-SpaceModels,"IEEETransactionsonNeuralNetworks,Vol.13,No.2,March2002,pp.355-368. [13] K.Boothe,K.FitzpatrickandR.Lind,"ControllersforDisturbanceRejectionforaLinearInput-VaryingClassofMorphingAircraft,"AIAAStructures,StructuralDynamicsandMaterialsConference,April2005,AIAA-2005-2374. 190

PAGE 191

[14] J.Bowman,"AordabilityComparisonofCurrentandAdaptiveandMultifunctionalAirVehicleSystems,"AIAA-2003-1713. [15] J.Bowman,B.SandersandT.Weisshar,"EvaluatingtheImpactofMorphingTechnologiesonAircraftPerformance,"AIAA-2002-1631. [16] S.Boyd,L.ElGhaoui,E.FeronandV.Balakrishnan,LinearMatixInequalitiesinSystemandControlTheory,SIAM,Philadelphia,PA,1994. [17] C.Bruni,A.GipillpandG.Koch,"BilinearSystems:AnAppealingClassof'NearlyLinear'SystemsinTheoryandApplication,"IEEETransactionsonAutomaticControl,Vol.19,1974,pp.334-348. [18] C.E.S.Cesnik,H.R.LastandC.A.Martin,"AFrameworkforMorphingCapabilityAssessment,"AIAAStructures,StructuralDynamicsandMaterialsConference,April2004,AIAA-2004-1654. [19] C.E.S.Cesnik,A.ArborandE.L.Brown,"ActiveWarpingControlofaJoined-Wing/TailAirplaneConguration,"AIAAStructures,StructuralDynamicsandMaterialsConference,April2003,AIAA-2003-1715. [20] A.Chakravarthy,D.T.GrantandR.Lind,"Time-VaryingDynamicsofaMicroAirVehiclewithVariable-SweepMorphing,"AIAAGuidance,NavigationandControlConference,Chicago,IL,August2009,AIAA-2009-6304 [21] B.M.Chen,RobustandH1Control,TheSpringerCompany,2000. [22] J.C.CockburnandB.G.Morton,"LinearFractionalRepresentationsofUncertainSystems,"Automatica,Vol.33,No.7,1997,pp.1263-1271. [23] V.ConstanzaandC.ENeuman,"OptimalControlofNon-LinearChmeicalReactorsViaanInitial-ValueHamiltonianProblem,"OptimalControlApplicationsandMethods,Vol.27,pp.41-60,2006. [24] R.F.Curtain,"State-SpaceApproachestoH1ControlForInnite-DinmesionalLinearSystems,"TransactionsoftheInstituteofMeasurementandControl,Vol.13,No.5,1991,pp.253-261 [25] H.D'Angelo,LinearTime-VaryingSystems:AnalysisandSynthesis.Boston,MA:Allyn&Bacon,1970. [26] C.Desoer,andJ.Schulman,"Zerosandpolesofmatrixtransferfunctionsandtheirdynamicalinterpretation,"IEEEtrans.CircuitsSyst.,vol.CAS-21,pp.3-8,Jan.1974. [27] R.C.DorfandR.H.Bishop,ModernControlSystems,10thed.UpperSaddleRiver,NJ:Prentice-Hall,2005 191

PAGE 192

[28] J.C.Doyle,"AnalysisofaFeedbackSystemWithStructuredUncertainties,"IEEEProceedings-D,Vol.129,1982,pp.242-250. [29] J.C.Doyle,K.Glover,P.P.Khargonekar,andB.A.Francis,"StateSpaceSolutionstotheStandardH2andH1ControlProblems,"IEEETransactionsonAutomationandControl,Vol.19,1989,pp.831-847. [30] M.Drela,andH.Youngren,"AVL-AerodynamicAnalysis,TrimCalculation,DynamicStabilityAnalysis,AircraftCongurationDevelopment,"AthenaVortexLattice,v.3.15, [31] E.L.Duke,R.F.AntoniewiczandK.D.Krambeer,DerivationandDenitionofaLinearAircraftModel,NASA-RP-1207,August1988. [32] M.Ekman,"SuboptimalControlfortheBilinearQuadraticRegulatorProblem:ApplicationtotheActivatedSludgeProcess,"IEEETransactionsonControlSystemsandTechnology,Vol.13,No.1,pp.162-168,January2005. [33] B.EtkinandL.D.Reid,DynamicsofFlightStabilityandControl,3rded.JohnWiley&Sons,Inc.,1996 [34] S.M.Ettinger,M.C.Nechyba,P.G.IfjuandM.Waszak,"Vision-GuidedFlightStabilityandControlforMicroAirVehicles,"ProceedingsoftheIEEEConferenceonIntelligentRobotsandSystems,2002,pp.2134-2140. [35] E.Feron,P.ApkarianandP.Gahinet,"AnalysisandSynthesisofRobustControlSystemsviaParameter-DependentLyapunovFunctions,"IEEETransactionsonAutomaticControl,Vol.41,No.7,July1996,pp.1041-1046. [36] I.Fialho,G.J.Balas,A.K.Packard,J.RenfrowandC.Mullaney,"Gain-ScheduledLateralControloftheF-14AircraftduringPoweredApproachLanding,"JournalofGuidance,ControlandDynamics,Vol.23,No.3,May-June2000,pp.450-458. [37] I.FialhoandG.J.Balas,"RoadAdaptiveActiveSuspensionDesignUsingLinearParameter-VaryingGain-Scheduling,"IEEETransactionsonControlSystemsTechnology,Vol.10,No1,January2002,pp.43-54. [38] A.Filippone,"FlightPerformanceofFixedandRotaryWingAircraft,"AmericanInstituteofAeronauticsandAstronautics,Reston,VA,2006,pp.251-253. [39] G.Floquet,AnnalesScientiquesdeI'EcoleNormaleSuperieure,(2)8,p.49,1879 [40] R.A.FreemanandP.V.Kokotovic,RobustNonlinearControlDesign,Birkhauser,BostonMA,1996. [41] P.Gahinet,P.ApkarianandM.Chilali,"AneParameter-DependentLyapunovFunctionsandRealParametricUncertainty,"IEEETransactionsonAutomaticControl,Vol.41,No.3,March1996,pp.436-442. 192

PAGE 193

[42] P.Gahinet,A.Nemirovski,A.J.LaubandM.Chilali,LMIControlToolbox,TheMathworks,Natick,MA,1995. [43] S.E.GanoandJ.E.Renaud,"OptimizedUnmannedAerialVehiclewithWingMorphingforExtendedRangeandEndurance,"AIAA-2002-5668. [44] F.H.Gern,D.J.Inman,andR.K.Kapania,"StructuralandAeroelasticModelingofGeneralPlanformWingswithMorphingAirfoils,"AIAAJournal,Vol.40,No.4,April2002,pp.628-637. [45] K.GloverandJ.C.Doyle,"State-SpaceFormulaeforAllStabilizingControllersThatSatisfyanH1-NormBoundandRelationstoRiskSensitivity,"SystemandControlLetters,Vol.11,1988,pp.162-172. [46] D.T.Grant,M.AbdulrahimandR.Lind,"FlightDynamicsofaMorphingAircraftutilizingIndependentMultiple-JointWingSweep,"AIAAAtmosphericFlightMechanicsConference,Keystone,CO,August2006,AIAA-2006-6505. [47] Grant,D.T.andLind,R.,"EectsofTime-VaryingInertiasonFlightDynamicsofanAsymmetricMorphingAircraft,"AIAAAtmosphericFlightMechanicsConference,HiltonHead,SC,August2007,AIAA-2007-6487. [48] K.Gu,"H1ControlofSystemsUnderNormBoundedUncertaintiesinAllSystemMatrices,"IEEETransactiononAutomationandControl,Vol.39,1994,pp.1320-1322. [49] P.O.Gutman,"StabilizingControllersforBilinearSystems,"IEEETransactionsonAutomationandControl,Vol.AC26,No.4,pp.917-922,August1981. [50] Y.Heryawan,H.C.Park,N.S.Goo,K.J.Yoon,andY.H.Byun,"DesignandDemonstrationofaSmallExpandableMorphingWing,"ProceedingsofSPIE-Volume5764,May2005,pp.224-231. [51] D.E.Hill,J.R.Baumgarten,andJ.T.Miller,"DynamicSimulationofSpin-StabilizedSpacecraftwithSloshingFluidStores,"JournalofGuidance,ControlandDynamics,Vol.11,No.6,November-December1988,pp.597-599. [52] M.Y.Hsiao,C.H.LiuandS.H.Tsai,"ControllerDesignandStabilizationForAClassofBilinearSystems,"IEEETransactionsonCircuitsandSystems,Vol.56,No.1,January2009. [53] R.A.HornandCRJohnson,MatrixAnalysis.Cambridge,U.K.:CambridgeUniv.Press,1990993,vol.3,pp.519-522. [54] A.Isidori,NonlinearControlSystems,Springer-VerlagInc.,Berlin,1995. [55] A.IsidoriandA.Astol,"DisturbanceAttenuationandH1ControlViaMeasurementFeedbackinNonlinearSystems,"IEEETransactiononAutoma-tionandControl,Vol.37,1992,pp.1283-1293. 193

PAGE 194

[56] H.Jerbi,"GlobalFeedbackStabilizationofaNewClassofBilinearSystems,"Syst.ControlLett.,Vol.42,No.4,pp.313-320,April2001. [57] C.O.Johnston,D.A.Neal,L.D.Wiggins,H.H.Robertshaw,W.H.Mason,andD.J.Inman,"AModeltoComparetheFlightControlEnergyRequirementsofMorphingandConventionallyActuatedWings,"AIAAStructures,StructuralDynamicsandMaterialsConference,April2003,AIAA-2003-1716. [58] S.P.Joshi,Z.Tidwell,W.A.CrossleyandS.Ramakrishnan,"ComparisonofMorphingWingStrategiesBasedUponAircraftPerformanceImpacts,"AIAAStruc-tures,StructuralDynamicsandMaterialsConference,April2004,AIAA-2004-1722. [59] E.W.Kamen,"Thepolesandzeroesofalineartime-varyingsystem,"inLinearAlgebraAppl.,1988,vol.98,pp.263-289. [60] E.W.Kamen,"Ontheinnerandouterpolesandzerosofalinear,time-varyingsystem,"inProc.IEEEConf.DecisionandControl,Austin,TX,Dec.1988,pp.910-914. [61] P.P.Khargonekar,I.R.PetersonandM.A.Rotea,"H1OptimalControlWithStateFeedback,"IEEETransactiononAutomationandControl,Vol.33,1988,pp.786-788. [62] P.P.Khargonekar,I.R.PetersonandK.Zhou,"RobustStabilizationofUncertainLinearSystems:QuadraticStabilizabilityandH1ControlTheory,"IEEETransac-tiononAutomationandControl,Vol.35,1990,pp.356-361. [63] J.J.Kehoe,R.S.Causey,M.AbdulrahimandR.Lind,"WaypointNaviagtionforaMicroAirVehicleusingVision-BasedAttitudeEstimation,"AIAAGuidance,NavigationandControlConference,August2005. [64] J.J.Kehoe,J.Grzywna,R.Causey,R.Lind,M.NechybaandA.Kurdila,"ManeuveringandTrackingforaMicroAirVehicleusingVision-BasedFeedback,"SAEWorldofAviationCongress,November2004. [65] H.K.Khalil,NonlinearSystems,PrenticeHall,NewJersey,1996. [66] N.S.Khot,F.E.Eastep,andR.M.Kolonay,"MethodforEnhancementoftheRollingManeuverofaFlexibleWing,"JournalofAircraft,Vol.34,No.5,September-October1997,pp.673-678. [67] J.KimandN.Koratkar,"EectofUnsteadyBladePitchingMotiononAerodynamicPerformanceofMicrorotorcraft,"JournalofAircraft,Vol.42,No.4,July-August2005,pp.874-881. [68] B.S.Kim,Y.J.Kim,andM.T.Lim,"RobustH1StateFeedbackControlMethodsforBilinearSystems,"IEEEProc.-ControlTheoryAppl.,Vol.152,No.5,Sept.2005. 194

PAGE 195

[69] V.B.KolmanovskiiandN.I.Koroleva,"OptimalControlofSomeBilinearSystemsWithAftereect,"PMMU.S.S.R.,Vol.53,No.2,1989,pp.183-188. [70] S.KwakandR.Yedavalli,"NewModelingandControlDesignTechniquesforSmartDeformableAircraftStructures,"JournalofGuidance,ControlandDynamics,Vol.24,No.4,July-August2001,pp.805-815. [71] S.Lall,K.Glover,,"RobustPerformanceandAdaptationUsingRecedingHorizonH1ControlofTime-VaryingSystems,"ProceedingsoftheAmericanControlConference,1995,pp.2384-2389. [72] B.S.Lazos,"BiologicallyInspiredFixed-WingCongurationStudies,"JournalofAircraft,Vol.42,No.5,September-October2005,pp.1089-1098. [73] L.H.LeeandM.Spillman,"Robust,Reduced-Order,LinearParameter-VaryingFlightControlforanF-16,"AIAAGuidance,NavigationandControlConference,August1997,AIAA-97-3637,pp.1044-1054. [74] T.Liu,K.Kuykendoll,R.RhewandS.Jones,"AvianWings,"AIAA-2004-2186. [75] L.Ljung,SystemIdentication:TheoryfortheUser.EnglewoodClis,NJ:Prentice-Hall,1987 [76] R.Longchamp,"StableFeedbackControlofBilinearSystems,"IEEETransactionsonAutomationandControl,Vol.AC25,No.2,pp.302-306,April1980. [77] M.H.Love,P.S.Zink,R.L.Stroud,D.R.Bye,andC.Chase,"ImpactofActuationConceptsonMorphingAircraftStructures,"AIAA-2004-1724. [78] A.G.J.MacFarlaneandN.Karcanias,"Polesandzerosoflinearmulti-variatesystems:Asurveyofalebraic,geometricandcomplex-variabletheory,"Int.J.Control,vol.24,no.1,pp.33-74,1976. [79] D.McLean,AutomaticFlightControlSystems,ThePrentice-HallCompany,NewYork,NY,1990. [80] T.Melin,AVortexLatticeMATLABImplementationforLinearAerodynamicWingApplications,M.S.Thesis,RoyalInstituteofTechnology,Stockholm,Sweden,2000. [81] R.R.Mohler,NonlinearSystems:ApplicationtoBilinearControl,ThePrentice-HallandEnglewoodClisCompanies,NewJersey,1991. [82] A.NatarajanandH.Schaub,"LinearDynamicsandStabilityAnalysisofaTwo-CraftCoulombTetherFormation,"JournalofGuidance,ControlandDy-namics,Vol.29,No.4,July-August2006,pp.831-838. [83] R.C.Nelson,FlightStabilityandAutomaticControl,TheMcGraw-HillCompanies,Boston,MA,1998. 195

PAGE 196

[84] R.A.Nicols,R.T.ReichertandW.J.Rugh,"GainSchedulingforH-InnityControllers:AFlightControlExample,"IEEETransactionsonControlSystemTechnology,Vol.1,No.2,June1993,pp.69-79. [85] U.M.L.Norberg,"Structure,FormandFunctionofFlightinEngineeringandtheLivingWorld,"JournalofMorphology,No.252,2002,pp.52-81. [86] R.T.O'BrienandP.Iglesias,"Polesandzerosfortime-varyingsystems,"Ph.D.dissertation,Dept.Elect.Comp.eng.,TheJohnsHopkinsUniv.,Baltimore,MD,1997. [87] K.Ogata,ModernControlEngineering,Prentice-Hall,UpperSaddleRiver,NJ,2002,pp.843-909. [88] K.Ogata,SystemDynamics,EnglewoodClis,NJ:Prentice-Hall,1978 [89] R.I.OliverandS.F.Asokanthan,"Control/StructureIntegratedDesignforFlexibleSpacecraftundergoingOn-OrbitManeuvers,"JournalofGuidance,ControlandDynamics,Vol.20,No.2,March-April1997,pp.313-319. [90] A.Packard,"GainSchedulingviaLinearFractionalTransformation,"SystemsandControlLetters,Vol.22,1994,pp.79-92. [91] G.Papageorgiou,K.Glover,G.D'MelloandY.Patel,"DevelopmentofaReliableLPVModelfortheLongitudinalDynamicsofDERAsVAACHarrier,"AIAAGuidance,NavigationandControlConference,August2000,AIAA-2000-4459. [92] I.R.Peterson,"DisturbanceAttentuationandH1Optimization:ADesignMethodBasedonTheAlgebraicRicattiEquation,"IEEETransactiononAutomationandControl,Vol.32,1987,pp.427-429. [93] B.C.Prock,T.A.WeisshaarandW.A.Crossley,"MorphingAirfoilShapeChangeOptimizationwithMinimumActuatorEnergyasanObjective,"AIAA-2002-5401. [94] D.L.RaneyandE.C.Slominski,"MechanizationandControlConceptsforBiologicallyInspiredMicroAirVehicles,"AIAA-2003-5345. [95] A.V.Rao,DynamicsofParticlesandRigidBodies:ASystematicApproach,CambridgeUniv.Press,Cambridge,NY,2006,pp.42-51. [96] J.Roskam,AirplaneFlightDynamicsandAutomaticFlightControls,DARcorporation,Lawrence,KS,2001. [97] W.J.Rugh,LinearSystemTheory,2nded.EnglewoodClis,NJ:Prentice-Hall,1993. [98] W.J.RughandJ.S.Shamma,"ResearchonGainScheduling,"Automatica,Vol.36,2000,pp.1401-1425. 196

PAGE 197

[99] M.T.Rusnell,S.E.Gano,V.M.Perez,J.E.Renaud,andS.M.Batill,"MorphingUAVParetoCurveShiftforEnhancedPerformance,"AIAA-2004-1882. [100] M.Sampei,T.Mita,M.Nakamichi,"AnAlgebraicApproachtoH1OutputFeedbackControlProblems,"SystemsandControlLetters,Vol.14,1990,pp.13-24 [101] B.Sanders,F.E.Eastep,andE.Forster,"AerodynamicandAeroelasticCharacteristicsofWingswithConformalControlSurfacesforMorphingAircraft,"JournalofAircraft,Vol.40,No.1,January-February2003,pp.94-99. [102] B.Sanders,G.Reich,J.JooandF.E.Eastep,"AirVehicleControlUsingMultipleControlSurfaces,"AIAAStructures,StructuralDynamicsandMaterialsConference,April2004,AIAA-2004-1887. [103] M.Secanell,A.SulemanandP.Gamboa,"DesignofaMorphingAirfoilforaLightUnmannedAerialVehicleusingHigh-FidelityAerodynamicShapeOptimization,"AIAA-2005-1891. [104] J.S.ShammaandJ.R.Cloutier,"Gain-ScheduledMissileAutopilotDesignUsingLinearParameterVaryingTransformations,"JournalofGuidance,ControlandDynamics,Vol.16,No.2,March-April1993,pp.256-263. [105] P.Shi,S.P.Shue,Y.ShiandR.K.Agarwal,"ControllerDesignforBilinearSystemswithParametricUncertainties,"MathematicalProblemsinEngineering,Vol.4,1999,pp.505-528. [106] S.P.Shue,"OptimalandH1SuboptimalFeedbackControlofDynamicalNonlinearSystemsforControlofWingRockMotion,"Ph.D.Dissertation,WichitaStateUniversity,Spring1997. [107] W.Shyy,M.BergandD.Ljungqvist,"FlappingandFlexibleWingsforBiologicalandMicroAirVehicles,"ProgressinAerospaceSciences,Vol.35,No.5,1999,pp.455-506. [108] K.C.Slatton,W.E.Carter,R.L.ShresthaandW.Dietrich(2007),AirborneLaserSwathMapping:Achievingtheresolutionandaccuracyrequiredforgeosurcialresearch,Geophys.Res.Lett.,34,L23S10,doi:10.1029/2007GL031939. [109] J.SlotineandW.Li,AppliedNonlinearControl,PrenticeHall,1990. [110] R.SmithandA.Ahmed,"RobustParametricallyVaryingAttitudeControllerDesignsfortheX-33Vehicle,"AIAAGuidance,NavigationandControlConference,August2000,AIAA-2000-4158. [111] E.D.Sontag,"ALyapunov-LikeCharacterizationofAsymptoticControllability,"SIAMJournalonControlandOptimization,Vol.21,1983,pp.462-471. [112] S.S.Sorley,"IdenticationandAnalysisofTime-VaryingModalParamters,"UniversityofFloridaMaster'sThesis,2010 197

PAGE 198

[113] A.G.Sparks,"LinearParameterVaryingControlforaTaillessAircraft,"AIAAGuidance,NavigationandControlConference,August1997,AIAA-97-3636,pp.1035-1043. [114] C.H.SpennyandT.E.Williams,"LibrationalInstabilityofRigidSpaceStationduetoTranslationofInternalMass,"JournalofGuidance,ControlandDynamics,Vol.14,No.1,January-February1991,pp.31-35. [115] B.L.StevensandF.L.Lewis,AircraftControlandSimulation,JohnWileyandSons,Hoboken,NJ,2003,pp.308-338. [116] W.Tan,A.K.PackardandG.J.Balas,"Quasi-LPVModelingandLPVControlofaGenericMissile,"AmericanControlConference,2000,pp.3692-3696. [117] G.Tao,S.Chen,J.FeiandS.M.Joshi,"AnAdaptiveActuatorFailureCompensationSchemeforControllingaMorphingAircraftModel,"IEEECon-ferenceonDecisionandControl,December2003,pp.4926-4931. [118] S.W.ThurmanandH.Flashner,"RobustDigitalAutopilotDesignforSpacecraftEquippedwithPulse-OperatedThrusters,"JournalofGuidance,ControlandDynamics,Vol.19,No.5,September-October1996,pp.1047-1055. [119] H.D.Tuan,E.Ono,P.ApkarianandS.Hosoe,"NonlinearH1ControlforanIntegratedSuspensionSystemviaParametrizedLinearMatrixInequalityCharacterizations,"IEEETransactionsonControlSystemsTechnology,Vol.9,No.1,January2001,pp.175-185. [120] S.VenkataramananandA.Dogan,"DynamicEectsofTrailingVortexwithTurbulenceandTime-VaryingInertiainAerialRefueling,"AIAA-2004-4945. [121] M.S.VestandJ.Katz,"AerodynamicStudyofaFlapping-WingMicroUAV,"AIAA-99-0994. [122] R.Wall,"TakingShape,"AviationWeekandSpaceTechnology,January5,2004,pp.54-56. [123] R.Wall,"DarpaEyesMaterialsForMorphingAircraft,"AviationWeekandSpaceTechnology,January5,2004,pp.54-56. [124] B.Wie,"SolarSailAttitudeControlandDynamics,Part2,"JournalofGuidance,ControlandDynamics,Vol.27,No.4,July-August2004,pp.536-544. [125] J.R.Wilson,"MorphingUAVsChangeShapeofWarfare,"AerospaceAmerica,February2004,pp.28-29 [126] M.Y.Wu,"Onstabilityoflineartime-varyingsystems,"Int.J.Systs.Sci.,vol.15,no.2,pp.137-150,1984. 198

PAGE 199

[127] M.Y.Wu,"Anewconceptofeigenvaluesandeigenvectorsanditsapplications,"IEEETrans.Automat.Contr.,vol.AC-25,pp.824-826,May1980. [128] J.YuandA.Sideris,"H1ControlWithParametricLyapunovFunctions,"SystemsandControlLetters,Vol.30,pp.57-69,1997. [129] K.Zhou,andP.Khargonekar,"AnAlgebriacRicattiEquationApproachtoH1Optimization,"SystemsandControlLetters,Vol.11,pp.85-91,1988. [130] J.J.Zhu,"PD-spectraltheoryformultivariablelineartime-varyingsystems,"inProc.IEEEConf.DecisionandControl,SanDiego,CA,Dec.1197,pp.3908-3913. [131] J.J.ZhuandC.D.Johnson,"Uniedcanonicalformsformatricesoveradierentialring,"LinearAlgebraAppl.,vol.147,pp.201-248,1991. 199

PAGE 200

BIOGRAPHICALSKETCH DanielThurmondGrantwasborninGainesville,Floridain1983.Asachild,heoftenfoundhimselfintriguedbythemechanicaloperationofremote-controlledtoys.Whennotlostinapileofnutsandbolts,hefoundenjoymentinbuildingmodelairplaneswithhisfather.Thecombinationofthesetwohobbieseventuallyledhimtodevelopastrongpassionforaeronauticalengineering.DanielgraduatedfromSantaFeHighSchoolin2002,afterwhichheenrolledattheUniversityofFlorida.WhileanundergraduateattheUniversityofFlorida,DanieljoinedtheMicro-AerialVehicle(MAV)Laboratory,wherehelearnedhowtobuildandysmallUnmannedAerialVehicles(UAVs).Thishands-onexperienceallowedDanieltoco-leadaDesign,Build,Fly(DBF)teamthatplacedninthataninternationalAIAAstudentcompetitionheldinWichita,Kansas.Asasenior,DanieljoinedtheFlightControlLabattheUniversityofFlorida,wherehedesigned,builtandewamulti-jointed,wing-sweepingMAV.Upongraduatinginthefallof2006,DanielenrolledintograduateschoolattheUniversityofFlorida.Danielreceivedhismaster'sdegreeinthespringof2009andthenhisdoctorateinthespringof2011.BothdegreesDanielearnedwereinaerospaceengineeringwithaprimaryfocusonadvancedightcontrolsanddynamics.Throughouthiscollegiatecareer,Danielexperiencedamultitudeofhighlightingevents.Theseeventsincludedbutnotlimitedto: WinningthetheAtmosphericFlightMechanicsstudentbestpaperawardatthe2006Guidance,Navigation,andControlConferenceinKeystone,Colorado TravelingtoWashingtonD.C.topresenthisworkforCongressduringtheeveningofaPresidentialStateoftheUnionAddress ObtainingaU.S.patentforhisworkonmorphingandurbancamouage ReceivingtheopportunitytoincludehisworkinandauthorabookchapterpublishedfortheAIAAeducationalseries FeaturinghisworkinnumerousdocumenturiesincludingNationalGeogrpahic,theScienceChannel,andSirDavidAttenborough'sim,"FlyingMonsters3D" 200