Identification of Neurosecretory Molecules in Aplysia Californica and Related Molluscs

Material Information

Identification of Neurosecretory Molecules in Aplysia Californica and Related Molluscs Genomic Approaches
Sloan, Jinnie
Place of Publication:
[Gainesville, Fla.]
University of Florida
Publication Date:
Physical Description:
1 online resource (229 p.)

Thesis/Dissertation Information

Master's ( M.S.)
Degree Grantor:
University of Florida
Degree Disciplines:
Medical Sciences
Committee Chair:
Moroz, Leonid L.
Committee Members:
Anderson, Peter A.
Denslow, Nancy D.
Graduation Date:


Subjects / Keywords:
Complementary DNA ( jstor )
Exons ( jstor )
Gene banks ( jstor )
Generally accepted auditing standards ( jstor )
Genomics ( jstor )
Modeling ( jstor )
Molecules ( jstor )
Neurons ( jstor )
Neuropeptides ( jstor )
Signals ( jstor )
Medicine -- Dissertations, Academic -- UF
aplysia, bioinformatic, genomic, in, invertebrate, learning, memory, mollusc, neuron, neuropeptide
bibliography ( marcgt )
theses ( marcgt )
government publication (state, provincial, terriorial, dependent) ( marcgt )
born-digital ( sobekcm )
Electronic Thesis or Dissertation
Medical Sciences thesis, M.S.


ABSTRACT OF THESIS PRESENTED TO THE GRADUATE SCHOOL OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF MASTER OF SCIENCE IDENTIFICATION OF NEUROSECRETORY MOLECULES IN APLYSIA CALIFORNICA AND RELATED MOLLUSCS: GENOMIC APPROACHES By Jinnie Amber Sloan August 2009 Chair: Leonid L. Moroz Major: Medical Sciences Several major questions related to the molecular underpinnings of neuronal identity and function such as, What makes a neuron a neuron? What is the genomic basis of unique neuronal phenotypes? How different is the transcriptional profile of one neuron from another? Can molecular techniques be used to determine neuronal identity? remain at the center of research in neuroscience. As a first step to answering these questions, and providing a list of molecular markers to identify specific neurons types, we have attempted to identify and quantify nearly all transcripts likely to be uniquely expressed in different neuronal classes (such as neuron-specific secretory products) and play a crucial role in neuron identity and function. This includes transcripts that encode neuropeptides, prohormones and related secretory signal peptides. Molluscs have served as powerful model organisms for cellular and system neuroscience for more than 40 years (McPhie and Miller, M., 2006; Kandel, 1970). Their nervous systems consist of simplified networks of large identified neurons, allowing unprecedented opportunities to study the principles of organization of neural circuits as well as learning and memory mechanisms. As our major experimental models, we chose Aplysia californica and related species, sea slugs belonging to the class of Gastropod Mollusca and species belonging to 14 cephalopod molluscs. Our long-term goal is to identify neurosecretory molecules of peptide nature using a combination of comparative and genomic approaches. We have chosen neurosecretory molecules as putative molecular markers because they are highly abundant in neurons and are responsible for cell signaling and modulation. Originally, the major limitation in using Aplysia californica, as well as other molluscs, has been the lack of genomic information available for these model species. To overcome this limitation, we have aimed to bridge the gap between genomic and non-genomic models. The Moroz lab has sequenced > 980,000 ESTs/cDNAs from eight key mollusan species (Gastropods: Aplysia californica, Pleurobranchaea californica, Clione limacina, Tritonia diomedea, Melibe leonina, Lymnaea stagnalis, and Cephalopods: Octopus vulgaris, Nautilus pompilius). These sequences were assembled and cross-annotated using the extensive transcriptome and genomic information from Aplysia californica. My thesis deals with comparative analysis and identification of both evolutionary conserved and novel transcripts that encode neuropeptides, prohormones and other predicted secretory products. As a part of the project, we have also employed computational approaches to predict novel signal molecules based on shared predicted protein motifs that are conserved across all secreted signaling proteins. Through this work, I identified a selected list of candidate transcripts predicted to encode secretory molecules across selected molluscs and identified putative neuropeptides present in individual neuronal classes including motor neurons, sensory neurons, and interneurons. This work also led to the identification of a set of neuropeptides that is co-expressed in sensory and motor neurons. The developed molecular resources and the ability to map gene expression has allowed me to provide a detailed study of the genomics of identified cells and provide a critical bridge between genes, circuits and behavior in the broad evolutionary context. Overall these 15 identified neurosecretory products may be the first step to creating a comprehensive list of gene products expressed in individual neurons that can be used for molecular identification of neuron types. ( en )
General Note:
In the series University of Florida Digital Collections.
General Note:
Includes vita.
Includes bibliographical references.
Source of Description:
Description based on online resource; title from PDF title page.
Source of Description:
This bibliographic record is available under the Creative Commons CC0 public domain dedication. The University of Florida Libraries, as creator of this bibliographic record, has waived all rights to it worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.
Thesis (M.S.)--University of Florida, 2009.
Adviser: Moroz, Leonid L.
Electronic Access:
Statement of Responsibility:
by Jinnie Sloan.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
Copyright Sloan, Jinnie. Permission granted to the University of Florida to digitize, archive and distribute this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Embargo Date:
LD1780 2009 ( lcc )


This item has the following downloads:

Full Text

peptides: identification, cloning processing, distribution, and action. J Neurosci. 19(21), 9618-

Myomodulin-like Neuropeptides Precursor3*
Gene Bank Accession Number: EU934739
Reference: n/a

U \ L7 Frequency
-, ,-I i'- l .. |'.|l l~' .d SN Frequency
SO MCC Frequency

Neurosecretory Protein 1 20 22 23 24 25 26 27 28 29 3031

Figure 4-2. Digital expression of neurosecretory products predicted by traditional cloning.

In addition to providing the ability to identify and isolate individual neurons, the giant

polyploidy neurons ofAplysia contain vast amounts of genetic material with a chromosome copy

number up to 100,000n (Gillette, 1991) and RNA content estimated at up to 0.2 pg in some

cases. This makes Aplysia an attractive model for gene expression profiling as large amounts of

RNA can be made readily available for sequencing.

Limitations of Sequencing Technology

Over the last several decades, our understanding and application of high- and low-

throughput methods to study gene expression has continued to grow. Each method has different

sensitivities as well as advantages and disadvantages due to basic technological constraints and

the absolute number of each mRNA molecule to be measured. One major obstacle to using

high-throughput sequencing to measure gene expression is the amount of data generated by this

method. For research scientists, the complexity of the transcriptome becomes overwhelming, if

not impossible, to understand without the use of bioinformatics approaches.

As the sequencing technology continues to grow, and EST coverage begins to reach

genomic scales, many researchers are faced with a daunting task of sifting through generated

data to find transcripts with function relevant to their research aims. To address this problem,

our lab has devised a method for quantifying transcript expression and abundance, in a user

friendly output, to create a digital expression profile (DEP) for each transcript. We have applied

this method to individual neurons in the memory-forming network ofAplysia to determine what

transcripts are relevant for the function and maintenance of specific cell types, including motor

neurons (MN) L7 and R2, sensory neurons (SN) and MCC interneurons.

Here, we applied the method to a selected list of transcripts previously predicted by our lab

to encode secreted signaling molecules to quickly screen hundreds of transcripts from individual

Cross-Species Analysis

Using the analysis of predicted Lottia SSMs, a cross-species transcriptome analysis of

Pleurobranchaea californica, Clione limacina, Tritonia diomedea, Melibe leonina, Lymnaea

stagnalis, Octopus vulgaris, and Nautilus pompilius revealed homologous predicted SSMs in all

related molluscs (Table 2-2). For each species, the percentage of all Lottia secretary proteins for

which homologs exist varies across species (Figure 2-5), suggesting different evolutionary rates

between species. Species with more homologous proteins may be closer common ancestors to

Lottia than those with few homologs. O ne precaution to such conclusions however, is that the

number of transcripts in the EST collection for each species varies (i.e. 273,922 inLymnaea vs.

10,209 in Melibe) and fewer homologs may be present simply as a function of low coverage.

My analysis also shows that classically and non-classically secreted proteins evolve at different

rates across species (Figure 2-5). There is a consistently higher percentage of non-classically

secreted proteins than classically secreted proteins found in each species, suggesting non-

classically secreted proteins are more highly conserved.

Genomic Organization of Selected Neurosecretory Products

Our preliminary comparison of predicted neurosecretory products across species revealed

they are likely subject to great evolutionary divergence. To determine if variability in

evolutionary divergence may be due to differences in the genomic organization, the intron/exon

boundaries of selected neurosecretory products were analyzed using the recently released Aplysia

genome, available on trace archives ofNCBI. Most vertebrate genes are composed of seven to

eight exons, however the number ofintron/exon boundaries found in the selected neuropeptides

fromAplysia is relatively small, an average of four exons (Table 2-3). While there is some

variation in the number of exons between selected neuropeptides (most have 3, 4 or 5 exons),

downloaded and added to the above results in FASTA file format. All redundant sequences were

removed and the master list was aligned with cDNA ESTs fromAplysia as described below.

To ensure that all results represent SSMs, all Aplysia homologs were screened using

SMART (Schultz et al., 1998), and any sequences with a transmembrane domains or enzyme

protein family domains were removed.

Genomic approach h

To facilitate prediction of the Lottia secretome, 23,851 full length protein sequences were

downloaded from the Joint Genome Institute (JGI) website (, May 2009).

These sequences represent the best filtered protein-coding gene models as determined by JGI's

genomic assembly. The latest release ofNCBI's non-redundant protein database, NR, was

downloaded to provide annotation for any predicted secretary products. NR contains protein

sequence entries from the following databases: GenPept, Swissprot, PIR, PDF, PDB, and NCBI


Classical Secretory Prediction*

The original data set of 23,851 full length protein sequences from the Lottia genome was

analyzed with TargetP 1.1. Batches of 1000 sequences were fed to TargetP via a custom

wrapper script (Citarella, M.R. unpublished), written in Perl using the 'short' output option for

TargetP. Sequences were considered to be targeted to the secretary pathway if they had a SP

secretaryy pathway) score > .80. All other sequences were discarded from the prediction. The

selected sequences were then analyzed with SignalP 3.0 for the presence of a signal sequence

using both Neural Network and Hidden Mark Model methods and the 'short' and 'no-graphics'

output options. Proteins were determined to have a signal sequence if SignalP returned a "Y" for

four out of the five scores for the Neural Network method a nd the Hidd en Markov Mod el

method predicted that it contained a signal peptide. Transmembrane domains were then

Feeding circuit activating peptide precursor
Gene Bank Accession Number: 22947345
Intron/Exon Boundaries:
Exon Intron 3' Exon 5' Sequence Exon 3' Sequence Exon Intron 5' Sequence Placement in
Number Sequence Length Sequence

Intron 1

Exon 1 2

FMRFamide neuropeptide precursor
Gene Bank Accession Number: 84551
Intron/Exon Boundaries: Coding Region: 149-1942 nt
Exon Intron 3' Exon 5' Sequence Exon 3' Sequence Exon Intron 5' Sequence Placement in
Number Sequence Length Sequence
1 tcaaatct ag AGTTCTTCAA CCGACTGATC 137 gt aagttgct -20-117
2 caatctgc ag GCGCCCGTGA CTGTGCGAGA 140 gt gagtaccc 118-257
3 ggtatctg ag ATTTGGCCGG AATACAACCA 1695 gt gatatttg 258-1952


Exon 2 3

L11 neuropeptide precursor
Gene Bank Accession Number: 155779
Intron/Exon Boundaries :
Exon Intron 3' Exon 5' Sequence Exon 3' Sequence Exon Intron 5' Sequence Placement in
Number Sequence Length Sequence
1 ggaccccc ag GTCATCATGC CTGCACGTGA 117 gt tgtcgttg -6-110
2 cccacagg ag GTTTGITTTCG CCTACAACAG 141 gt gggctata 111-251
3 ttttccacag AGTTTTCTTA ACGAAACTAT 87 gt caatagac 385471



No oovesae In genom

Exon 1


Hypothetical protein 2 secretaryy, pheromone like peptide similar to seductin)
Gene Bank Accession Number: AAN83922
Cummins, S. F., Nichols, A. E. et al. (2004). Characterization ofAplysia enticin and temptin, two
novel water-borne protein pheromones that act in concert with attraction to stimulate mate
attraction. J BiolChem. 279(24), 25614-22.

Insulin-like 2+
Gene Bank Accession Number: 19850964
Moroz, L. L., Edwards, J. R. et al. (2006). Neuronal transcriptome ofAplysia: neuronal
compartments and circuitry. Cell 127(7), 1453-67.

Insulin-like 7+
Gene Bank Accession Number: 94434859
Moroz, L. L., Edwards, J. R. et al. (2006). Neuronal transcriptome ofAplysia: neuronal
compartments and circuitry. Cell 127(7), 1453-67.

Figure 2-1. Summary of model organism and number ofESTs/cDNAs collected. More than
980,000 ESTs/cDNAs were collected from the CNS of five key model species (Pleurobranchaea
californica, Clione limacina, Tritonia diomedea, Melibe leonina, andLymnaea stagnalis). Here,
the number of ESTs for each species is shown under their name.

D digital E xp session P rofling ..................................................................... ..................69


A MODERN VIEW OF ANIMAL PHYLOGENY ....... ......................................... 220

B M O LL U SC A N C L A SSE S ......................................................................... ....................222

L IS T O F R E F E R E N C E S ............................................... ............................... .........................223

B IO G R A P H IC A L SK E TC H ............................................................................. ....................229




0 I C II

I I11"11 1 |


elk 6S1 ev2O \9iU 0- d
OMCC Frequency 0o y~'O St
Predicted Neurosecretory Product \G

Figure 4-4. Digital expression of neurosecretory products predicted by genomic approach.

Isolation of Fulicin in the CNS of Aplysia

454 sequencing revealed higher expression of transcripts aligning to the coding regions of

the MIP gene than real time PCR (RT-PCR) experiments (Table 3-1). We found that MIP

showed strong sequence similarity to another gene, Fulicin, in its 5' region (Figure 3-4) as

supported by previous work in Mytilus edulis showing MIP and F ulicin have a structurally

similar C-terminal region (Hirata et al., 1988; Kim et al., 1991).

MIP and Fulicin share 5' UTR and coding region

We postulate that the shared 5' untranslated region may serve as a molecular mechanism

underlying the observed co-localization of these two neuropeptides. To understand the

functional role of this shared region, we extended the sequence of the coding region into the 5'

UTR of each of these genes to check if the shared sequence continued upstream of the protein

start site.

Using 5' RACE, we extended the non-coding region of both Fulicin and MIP to reveal a

480 nt region, called TxFrag 2, that includes the 5' UTR and the 21 amino acid signal peptide of

MIP and Fulicin (Figure 3-1A, blue and Figure 3-5).

TxFrag2: Structure and Function

Alignment of TxFrag2 to genomic data available onNCBI reveals that the 480 nt region is

transcribed from four defined fragments of DNA separated by three intergenic splice sites,

characteristic oftransgenic noncoding RNA. The fourth defined fragment contains the signal

sequence shared by both MIP and Fulicin. At the end of the signal sequence there is a splice site

in both MIP and Fulicin, the start of Exon 2 marks the beginning of the unique coding region of

both genes.

Previous work mapping short noncoding RNAs (sRNAs) indicates sRNAs cluster at the 5'

and 3' of genes. Similar to these results, Transfrag2 is located at the 5' of MIP and Fulicin. Like

Gene Bank Accession Number: n/a
Reference: n/a
Full Length Clone:

Leptin precursor 1
Gene Bank Accession Number: n/a
Reference: n/a
Comment: Predicted only, not cloned

Leucokinins precursor
Gene Bank Accession Number: n/a
Reference: n/a
Comment: Predicted only, not cloned


BLAST Basic Local Alignment Search Tool

CNS Central Nervous System

ER Endoplasmic reticulum

ESTs Expressed Sequence Tags

DEP Digital Expression Profile

IN Interneuron

MN Motor Neuron

NCBI National Center for Biotechnology Information

ncRNA Noncoding RNA

NR protein database for Blast searches, compiled by NCBI

PCR Polymerase Chain Reaction

RACE Rapid Amplification ofcDNA Ends

SN Sensory Neuron

sRNA Short Noncoding RNA

SSMs Secreted Signaling Molecules

UTR Untranslated region


* Cloned by Jinnie Sloan

+ Cloned by the Moroz lab

Phase II


23,851 3,640


I 1,853


Predion Results Phase III Honllog Resilts
Blast against ESTs
--0 181-


-- -- 75

+- 50

----- 38

S--- 296

p 94
.)I. 128


167 101
Expressed in 2 Secreted
or more species Signaling

Figure 2-4. Workflow for Computational Prediction of SSMs. The filtered gene models for
Lottia gigantea were downloaded from JGI. After filtering the original 23,851 predicted proteins
through four protein prediction software programs, 859 proteins were predicted to be classically
secreted signal molecules. That is, contained signal sequences, no transmembrane domains, and
were targeted for secretion outside the cell. Using BLAST alignments, 400 c lassically-secreted
homologs were identified inAplysia ETSs.


FIRFamide related neuropeptides precursor*
Gene Bank Accession Number: n/a
Reference: n/a
Partial Clone:


Neuropeptide CP2 precursor
Gene Bank Accession Number: 18844703
Vilim, F. S., Alexeeva, V. et al. (2001). Cloning, expression and processing ofthe CP2
neuropeptide precursor ofAplysia. Peptides 22(12), 2027-38.

Neuropeptide Y mRNA, complete cds
Gene Bank Accession Number: 155793
Rajpara, S. M., Garcia, P. D. et al. (1992). Identification and molecular cloning of a neuropeptide
Y homolog that produces prolonged inhibition in Aplysia neurons. Neuron 9(3), 505-13.

Neurotoxic peptide caeron-like precursor
Gene Bank Accession Number: n/a
Reference: n/a
Comment: Predicted only, not cloned

Gene Bank Accession Number: 71148939
Moroz, L. L., Edwards, J. R. et al. (2006). Neuronal transcriptome ofAplysia: neuronal
compartments and circuitry. Cell 127(7), 1453-67.

Neurotoxin-like 2+
Gene Bank Accession Number: 71148941


R3-14 peptide 2
Gene Bank Accession Number: n/a
Reference: n/a
Comment: Predicted only, not cloned

Schitos omin-like
Gene Bank Accession Number: 56200042
Moroz, L. L., Edwards, J. R. et al. (2006). Neuronal transcriptome ofAplysia: neuronal
compartments and circuitry. Cell 127(7), 1453-67.

Second (short fragments obtained from MS data)*
Gene Bank Accession Number: n/a
Reference: n/a
Partial Clone:

Gene Bank Accession Number: 158906123
Reference: (Zhang et al., 2008)

Prothoracicostatic peptide 2
Gene Bank Accession Number: n/a
Reference: n/a
Comment: Predicted only, not cloned

Putative pheromone-2+
Gene Bank Accession Number: n/a
Reference: n/a
Partial Clone:

FMRFamide 5

The partial sequence and clone for FMRFamide 5 was obtained (not submitted) using


3'. The resulting cDNA fragment was 698 bp.

Allatotropin-OR precursor

The partial sequence and clone for Allatotropin-OR precursor was obtained (not submitted)


3'. The resulting cDNA fragment was 746 bp.


The partial sequence and clone for Second was obtained (not submitted) using terminal


resulting cDNA fragment was 712 bp.

Neurosecretory Predictions

Preditions were performed by Jinnie Sloan, Mathew Citarella, Drs. A. Kohn and L. Moroz.

Software scripts were written by M. C itarella.

Homology search using unbiased shotgun approach

A cross species master list of secreted signaling molecules submitted to NCBI was created

by manual word search. Search terms included any combination of the following words: signal,

peptide, growth factor, hormone, and neuropeptide. Any results containing the word "receptor"

were eliminated.

All sequences submitted to PeptideDB (, May 2009), a public resource

for bioactive peptides that includes cytokines and growth factors, peptide hormones,

antimicrobial peptides, toxins and venom peptides, and antifreeze proteins, were manually

SFY 1-like peptide ......................................................................................... .. ........ ......36
SFY3-like peptide ................................................. .. ...................... ... 36
FIRFamide related neuropeptide precursor .............................................................36
M ajor royalj elly protein (M RJ) .....................................................................36
F M R F am ide 5 ...................................................... 37
A llatotrop in-O R precursor........... .................. .......... ............... ............... 37
S e c o n d ..............................................................................3 7
N eurosecretory Predictions ...................... ...................... ................................ 37
Homology search using unbiased shotgun approach ................. ...... ............37
Genomic approach....................... .. .. ............................. ... .. 38
C classical Secretory Prediction* ........................................ .......................... 38
Non-classical Secretory peptide Prediction* ................................. .................39
Cross-Species Analysis of Predicted Proteins ........................ .................... 39
Annotation of Predicted Proteins................................................... .... ........... .40

3 MAPPING EXPRESSION OF NEUROPEPTIDE TRANSCRIPTS..................................50

In tro d u c tio n ....................................................................................................... ............. 5 0
M ytilus Inhibitory Peptides .......................................... ................... ............... 50
F ulicin ....... ............................................................. 5 1
R results ........................... ... ......... ...... ..... ................................... 5 1
Cloning ofAplysia Fulicin precursor mRNA ...............................................51
Localization ofFulicin in the CNS ofAplysia ........................... ............... 52
C o-localization of M IP and F ulicin ....................................................................... ... ...52
Isolation ofFulicin in the CN S ofAplysia ................................................. ............... 53
MIP and Fulicin share 5' UTR and coding region ......................... ........................53
TxFrag2: Structure and Function.............................. ................. ............... 53
Discussion .................. ........................................................54
Colocalization of Fulicin and M IP ............................................................................ 54
TxFrag2: M odulator of Expression? .......................................................... ............... 55
M materials and M methods .......................... ...................... .. .. .... ........ ........ 56
Animals .................... ................... ....... .... ...............56
Cloning of full-length cDNA encoding Fulicin.............................................................56
Sequence analysis and A lignm ents ............................................................................... 56
In-situ hybridization of Fulicin and M IP in Aplysia ....................................... .......... 57
Im a g in g ................... ......................................................... ................ 5 8


In tro d u c tio n ............................................................................................................................. 6 5
A advantages ofAplysia ........................... .......... ................. .. ........ .... 65
Limitations of Sequencing Technology............................................ ...................... 66
Results and Discussion .................. .............. ................ ............ .. ....... 67
Sensory N eurons ...................................................................... ........ 67
Motor Neurons.............................................. 67
Intern e u ro n s .......................................................................................6 8
D isc u s sio n ................... ...................6...................9..........



* BLAST: finds regions of local similarity between sequences. This program can be used to
compare nucleotide or protein sequences to a sequence database in order to determine the
functional and evolutionary relationship between sequences. The statistical significance
calculated between sequences can be used as a guide to compare sequences and identify
members of gene families.

* Exon: the nucleic acid sequene within a gene that is present in the mature form of an RNA

* In situ hybridization: used to localize a specific DNA or RNA sequence in a specific
tissue or cells by using labeled complementary DNA or RNA. Transfrag

* Intron: a region of DNA within a gene that is not translated into protein. These regions
are included in the transcribed pre-mRNA and removed by splicing to produce a mature

* Neuropeptide: small protein-like molecules that can be secreted by neurons to
communicate with each other. Neuropeptides can act on neighboring neurons as
anterograde or retrograde messengers or the neuron secreting the neuropeptide (orthograde
messengers) through cell surface receptors to modulate or mediate neuronal
communication. Typically neuropeptides alter the communication of a neuronby
increasing or decreasing its excitability. Neuropeptides are assembled by ribosomes
attached to the ER then transferred to the Golgi Apparatus to be packaged into vesicles and
transported to synaptic terminals. Some neuropeptides are secreted directly into the blood
stream and are referred to as neurohormones. Secreted neuropeptides can have long lasting
effects from seconds to days.

* Prepropeptide: the inactive precursor of a peptide that requires posttranslational
modifications to become the active peptide molecule. The prepropeptide of neuropeptides
is characterized by a signal peptide that targets the protein to the secretary pathway for
posttranslational modifications including the cleavage of the signal peptide in the ER.

* Signal Peptide: a short (3-60 amino acid) sequence made up of a positively charged
sequence found on the N-terminal region, a hydrophobic region and a polar uncharged C-
terminal region (cleavage site) that targets the transportation of a protein. In the case of
secretary signaling peptides, the signal peptide targets the preprotein to the ER for further
posttranslational modifications.

* Transcript: an RNA molecule produced from a gene.

* Transmembrane Domain: a short span of amino acids (15-35) composed of mostly
hydrophobic regions separated by polar connecting loops that form stable secondary
structures in membranes.


Whitnin precursor (SPTR)
Gene Bank Accession Number: 56200044
Moroz, L. L., Edwards, J. R. et al. (2006). Neuronal transcriptome ofAplysia: neuronal
compartments and circuitry. Cell 127(7), 1453-67.

Signaling Molecules

Wnt-2 protein precursor
Gene Bank Accession Number: 46981372
Brown, B., Kohn, A.B et al. (2007). Unpublished.

other intergenic sRNAs (IRNAs), TxFrag2 includes the 5' boundary of the protein-coding gene

but excludes most of the other exons of the coding region. Previous work on IRNAs suggests

they are involved in regulation of gene expression (Davis et al., 2006; Martianov et al., 2007).

These studies suggest that IRNA transfrags serve as precursors to functional sRNAs via sense

and antisense transcription of the IRNA (Kapranov et al., 2007).

To see if TxFrag2 is transcribed in the sense or antisense direction, 454 and SOLiD

transcripts that aligned to the 480 nt TxFrag2 region were counted and compared to the

quantities of sense and antisense MIP and Fulicin (Figure 3-5B). This showed that TxFrag 2 is

transcribed in both the sense and antisense direction where as the coding region of MIP and

Fulicin are made only in the sense direction.


Colocalization of Fulicin and MIP

This is a unique example of two neuropeptides showing exclusive co-localization

throughout the CNS ofAplysia. After several in situ experiments, we have found that transcripts

for both MIP and Fulicin consistently colocalize to specific neurons of the CNS ofAplysia,

predominately those neurons in the abdominal ganglia responsible for the gill and siphon


Analysis of the protein sequence of MIP and F ulicin reveal that structurally, they share a

conserved C-terminal. Further analysis of the nucleotide coding region of the sequences shows

that this results from a conserved 5' UTR region that extends through the first exon of both

genes. Preliminary analysis using recently released genomic information fromAplysia

californica further supports that MIP and Fulicin share the same splice sites and exon regions

covering the TxFrag2 region until after the signal sequence.

produces an electropherogram image along with a gel-like image of the sample representing peak

ratios of the 28s/18s RNA contained in the sample. Additionally RNA concentration was

measured spectrophotometrically by using the GeneSpec III systemTM (Mirai Bio).

454 Library Construction

Library construction was completed by Dr. Kohn and Jinni e Sloan. The protocol for

transcription analysis was developed by Drs. A. Kohn, Y. Panhin and L Moroz.

3' end amplified cDNA library construction for 454 s equencing:

This technique targets the 3' end of the transcripts being expressed. Amplified cDNA was

generated using the Marathon cDNA amplification kit (Cat # 634913, BD Biosciences, Clontech,

Mountain View CA). The first strand synthesis utilized the AMV Reverse Transcriptase and an

oligo(dT) primer, Trsa (Matz, 2002). After second strand synthesis and clean-up following the

Marathon kit protocol, the entire sample ofcDNA was fractionated by digestion with 20 units of

Alu 1 and NEBbuffer 2 (Cat # RO 137SO, New England BioLabs, Ipswich, MA) for 1 hour at

370C. The enzyme was heat inactivated at 650C for 20 min. The double stranded adaptor was

made with A adaptors then added to the ligation mixture at a final concentration of 1 IM along

with the digested cDNA, 2 Units T4 DNA ligase and 5 x ligase buffer (Cat # 634913, BD

Biosciences, Clontech, Mountain View CA). The ligation was performed at 160C overnight.

The cDNA was purified using DNAclear (Cat#1756, Ambion Inc, Austin, TX) and eluted in 16

1l of RNAase-free water. Amplification of the cDNA was performed using 16 ld of the purified

cDNA, Advantage 2 buffer, dNTP and taq polymerase (Cat # 639201, BD Biosciences,

Clontech, Mountain View CA). The primers A per B per added to the amplification were at a

final concentration of 0.05 IM with B adaptor at a final concentration of 0.01 pM. This full

length B adaptor was modified to complement with the Trsa primer along with the B adaptor on

the beads and was added to ensure the eventual attachment of the cDNA on the beads. The PCR

Pedal peptide 2+
Gene Bank Accession Number: 94434888
Moroz, L. L., Edwards, J. R. et al. (2006). Neuronal transcriptome ofAplysia: neuronal
compartments and circuitry. Cell 127(7), 1453-67.

Pedal peptide 4+
Gene Bank Accession Number: 94434899
Moroz, L. L., Edwards, J. R. et al. (2006). Neuronal transcriptome ofAplysia: neuronal
compartments and circuitry. Cell 127(7), 1453-67.


LFRFamide precursor*
Gene Bank Accession Number: EU886298
Reference: n/a

Major royal jelly protein*
Gene Bank Accession Number: n/a
Reference: n/a
Partial Clone:

MIP-related peptide precursor
Gene Bank Accession Number: 8886135
Fujisawa, Y., Furukawa, Y. et al. (1999). The Aplysia mytilus inhibitory peptide-related

A Buccal g.

Cerebral g.
7 Pleural g.
\ Pedal g.

/ nominal
JB Abdominal g

Head ganglia


Mantle and
Visceral Hump

Figure 1-2. Organization of the Aplysia central nervous system. A) Diagram showing the central
ganglia that make up the central nervous system ofAplysia. B) Representations ofAplysia
showing the areas, color coded as in (A), innervated by specific ganglia. Some ganglia
(pleural/pedal) have multiple functions innervating the same regions of the body as indicated by
the gradient coloring, however there is some specificity in innervating. [Modified from Moroz,
L.L., Edwards, J.R., Puthanveettil, S.V., Kohn, A.B., Ha, T., Heyland, A., Knudsen, B., Sahni,
A., Yu, F., Liu, L., et al. (2006). Neuronal transcriptome of Aplysia: neuronal compartments and
circuitry. Cell 127, 1453-1467.]

iccal mass


Li, L., Floyd, P. al. (2001). Cerebrin prohormone processing distribution and action in
Aplysia californica. J Neurochem. 77(6), 1569-80.

Clionin precursor+
Gene Bank Accession Number: FJ214338
PubMed ID Reference: n/a not released

ELH precursor [Contains: Beta-bag cell peptide (Beta-BCP)
Gene Bank Accession Number: 119268
Scheller, R. H., Jackson, J. F. et al. (1983). A single gene encodes multiple neuropeptides
mediating a stereotyped behavior. Cell. 32(1), 7-22.

Enticin precursor
Gene Bank Accession Number: 74814556
Cummins, S. F., Nichols, A. E. et al. (2004). Characterization ofAplysia enticin and temptin, two
novel water-borne protein pheromones that act in concert with attraction to stimulate mate
attraction. J BiolChem. 279(24), 25614-22.

Feeding circuit activating peptide precursor
Gene Bank Accession Number: 22947345
Sweedler, J. V., Li, L. et al. (2002). Identification and characterization of the feeding circuit
activating peptides, a novel neuropeptide family ofAplysia. J Neurosci. 22(17), 7797-808.

FMRFamide neuropeptide precursor
Gene Bank Accession Number: 84551
Taussig, R. and Scheller, R. H. (1986). The Aplysia FMRFamide gene encodes sequences related
to mammalian brain peptides. DNA. 5(6): 453-61.

Gene Bank Accession Number: 453657
Chun, J. Y., Korner, J. et al. (1994). The function and differential sorting of a family ofAplysia
prohormone processing enzymes. Neuron. 12(4), 831-44.

Glycoprotein hormone beta subunit (GPB5) +

Feeding circuit activating petide precursor 3 (FCAP-3)

The partial sequence and clone for FCAP-3 was obtained (not submitted) using terminal


resulting cDNA fragment was 367 bp.


The partial sequence and clone for SN4 was obtained (not submitted) using terminal


3'. The resulting cDNA fragment was 755 bp.

SFY1-like peptide

The partial sequence and clone for SFY1-like peptide was obtained (not submitted) using


The resulting cDNA fragment was 1198 bp.

SFY3-like peptide

The partial sequence and clone for SFY3-like peptide was obtained (not submitted) using


The resulting cDNA fragment was 729 bp.

FIRFamide related neuropeptide precursor

The partial sequence and clone for FIRFamide related neuropeptides precursor was

obtained (not submitted) using terminal primers 5'- CGTCATCGCTGGTGCTGTCAC-3' and 5'-

CCTCGACAAGGCTTCTCCTTCACC-3'. The resulting cDNA fragment was 2032 bp.

Major royal jelly protein (MRJ)

The partial sequence and clone for MRJ protein was obtained (not submitted) using

terminal primers 5'-CGGAAGTCCGGTACGCGTATATTTC -3' and 5'-

CTTTCAGAAGGCTATTCCTCCCACC -3'. The resulting cDNA fragment was 774 bp.

In-situ hybridization of Fulicin and MIP in Aplys ia

Full-length cDNA from Fulicin and MIP was cloned and used for the preparation of in situ

probes. For co-localized expression studies, clones were made for Fulicin and MIP from unique

regions starting after shared 5' UTR and signal sequence. The antisense probe was generated by

digestion ofcDNA from Fulcin and MIP with Not I (New England Biolabs), then transcription

with T3 polymerase from the DIG (digoxigen) RNA labeling kit (Roche Diagnostics). The

control sense probe was produced by the same protocol but used Pmel (New England Biolabs)

to digest the cDNA and T7 polymerase for transcription. The DIG-labeled antisense probes were

hybridized in whole-mount CNS preparations, and the neurons containing the probe-target

duplex were localized and visualized with alkaline phosphatase-conjugated anti-DIG antibody

fragments (Boehriger Mannheim). The detailed in situ hybridization protocol has been described

(Jezzini et al., 2005; Jezzini and Moroz, 2004; Walters et al., 2004).

Expression ofFulicin was investigated in central ganglia of four experimental CNS

preparations and two control experiments. Control in situ hybridization experiments with full-

length "sense" probes revealed no specific and selective staining in the CNS under identical

conditions and labeling protocols for either probe.

Co-localization using two-color in-situ hybridization was performed as previously

described (Jezzini et al., 2005). Briefly, unique regions ofMIP and Fulicin were cloned and

sequenced. Two probes were then made using different NTP labeling mixes. The MIP probe

was made using fluorescein-12-UTPs and the Fulicin probe was DIG-labeled. First the

fluorescein-MIP probe was hybridized in whole-mount CNS preparations, and the neurons

containing the probe-target duplex were localized and visualized with Fast Red substrate. After

the first development is stopped, a second hybridization is preformed using the DIG-Fulicin

There is currently one additional publication indicating that the preproprotein of two

neuropeptides, brandykinin and temporin in frog, share a conserved 5' UTR and signal sequence

(Suzuki et al., 2007). In this paper the authors suggest that the sequence similarity may suggest a

linked evolutionary history involving exon shuffling.

TxFrag2: Modulator of Expression?

With the completion of several genome projects, including the Human Genome Project,

the once accepted view that of noncoding RNAs (ncRNAs) as "junk" is rapidly shifting to accept

non-protein-coding transcripts are crucial for cellular function. Recent reports suggest that only

2% of the human genome codes for translated proteins (System, 2008) while nearly half of the

genome is transcribed and expressed as RNA without any messenger (mRNA), transfer (tRNA),

or ribosomal (rRNA) functions (Szell et al., 2008). Understanding the role of these ncRNAs

represents a new realm of understanding genomic data, and the accumulating data suggests

ncRNAs may play a role in organism complexity, specificity, cell regulatory machinery, and

regulation of these ncRNAs has been implicated in several human diseases (Szell et al., 2008).

Work on the human genome has demonstrated that the transcriptome does not exist

exclusively of protein-coding transcripts but also regulatory genomic elements and non-protein-

coding transcripts (Szell et al., 2008). This project, termed ENCODE (the Encylopedia of DNA

Elements), along with unbiased tiling-array data has identified a new set of transcripts (TxFrags)

that are made from fragments of defined genomic regions. Cross species genome sequencing has

shown that increasing biological complexity is correlated with increasing number of non-protein-

coding DNA sequences (Taft et al., 2007) and suggsts that differences between species may rely

upon non-coding genes rather than protein-coding genes (Pollard et al., 2006).

While the function of TxFrag2 remains to be determined, expression ofboth sense and

antisense transcripts suggest that it may serve in a regulator mechanism in these cells. It is our

probe and the neurons are localized and visualized with alkaline phosphatase-conjugated anti-

DIG antibody fragments (Boehriger Mannheim).


Images were captured with a Nikon Digital Sight DS-5M digital camera mounted on an

upright Olympus SZX12 microscope. Figures were prepared using Adobe Photoshop.

Results and Discussion

Identification of Predicted Secreted Signal Molecules

Homology results

Through cross species homology search, 109 putative neuropeptides were identified from

the Aplysia CNS transcriptome, 88 predicted to be secreted signaling molecules (Object 2-2),

and 21 predicted to be involved in the secretary pathway though not necessarily secreted (Object


While homology searches can provide a wealth of information when initially annotating

transcriptomes, it limits annotation to only sequences with homology to known sequences.

Indeed when annotating the >203,000 transcripts of the Aplysia transcriptome (Moroz et al,

2006), only 43,672 sequences can be annotated, showing the enormous complexity of the

neuronaltranscriptome (Figure 2-2, insert). Furthermore, preliminary results from cross-

species transcriptome analysis suggst that many neuropeptides are quickly evolving even

between closely related species (Figure 2-2). Due to these limitations, we suspected that many

SSMs ofthe Aplysia CNS could not be identified through homology searches, and decided to

employ bioinformatics approaches for a more comprehensive list of SSMs using genomic scale


Prediction results

To identify novel and unannotated SSMs, publicly available software was used to complete

genome-scale profiling of all SSMs. These software programs rely upon conserved protein

motifs to predict prepropeptides. Signal peptide prediction software identifies conserved protein

motifs required for processing and directing proteins to secretary pathways (Figure 2-3).

Accurate predictions rely upon the use of full length peptide sequences. Because there is



Gastropod molluscs have served as powerful model organisms for cellular and system

neuroscience for more than 60 years. The central nervous system (CNS) of these models

consists of a simplified network of relatively large identified neurons, allowing unprecedented

opportunities to study the principles of organization of neural circuits as well as learning and

memory mechanisms. However, a major limitation to identifying the neurosecretory products of

neurons of the molluscan models has been the lack of genomic information.

To overcome these limitations, we have sequenced >980,000 ESTs/cDNAs from the CNS

of eight molluscan species (Gastropod s: Aplysia californica, Pleurobranchaea californica,

Clione limacina, Tritonia diomedea, Melibe leonina, Lymnaea stagnalis, and Cephalopods:

Octopus vulgaris, Nautilus pompilius) (Figure 2-1). These sequences were assembled and cross-

annotated using the extensive transcriptome and genomic information from Aplysia californica

(Moroz et al., 2006). This comparative approach allowed identification of both evolutionary

conserved neuronal genes and numerous novel genes including neuropeptides, prohormones and

other predicted secretary products. It is estimated that there are >320,000 putative unique gene

products (including non-coding and small RNAs) present in our comparative neurogenomic

database, which likely correspond to >50-60% of the total number of genes expressed in the

nervous systems of these molluscs.

A selected list of genes identified in that study represents major group of transcripts

implicated in the control of neural excitability, synaptic functions and plasticity, receptors,

adhesion molecules, developmental genes, and homologs of genes involved in neurological

disorders, etc. Specifically, we looked for putative neurosecretory products that may function as

BD Biosciences, Clontech, Mountain View CA). This ligation was performed at 160C overnight.

Again the cDNA was purified using DNAclear (Cat#1756, Ambion Inc, Austin, TX) and eluted

in 16 ld of RNAase-free water. Amplification of the cDNA was performed using 16 [l of the

purified cDNA, Advantage 2 buffer, dNTP and taq polymerase (Cat # 639201, BD Biosciences,

Clontech, Mountain View CA). The primers added to the amplification were at a final

concentration of 0.05 IM and the sequences were A per and B per. The PCR amplification

protocol consisted of 17 cycles of 95C for 30 sec, 65C for 30 sec, 720C for 1 min. Preparation

and sequencing of the Amplicon product used the GS emPCR Kit II (Amplicon A and Paired

End) (Cat # 04 891 384 001 Roche Applied Science) GS Sequencing Kit (70x75) (Cat # 04 853

342 001 Roche Applied Science)

Primers for 3' and 5' libraries are listed in Table 2-4.

Cloning of selected Signaling Molecules

Amplified cDNA libraries were constructed from the CNS ofAplysia californica, as

described elsewhere (Matz, 2002; Moroz et al., 2006). Full-length cDNA sequences for six

sequences and the partial sequence of an additional nine sequences were obtained. The full-

length copy of coding sequences were amplified from appropriate CNS cDNA libraries and

cloned into pC R4-TOPO (Invitrogen). For each sequence, three clones were isolated and

sequenced by SeqWright (Houston, TX).

Hypothetical protein 2

The full length sequence for Hypothetical protein 2 was identified based on BLAST results

against the National Center for Biotechnology Information (NCBI) as Aplysia californica

hypothetical protein previously cloned (Cummins et al., 2004) (Genebank accession number

AAN83922). Using terminal primers 5'-CTCTGAACCGTCGCGAACTGTGT-3' and 5'-


Wnt-16 precursor
Gene Bank Accession Number: n/a
Reference: n/a
Comment: Predicted only, not cloned


Gene Bank Accession Number: 56200040
Moroz, L. L., Edwards, J. R. et al. (2006). Neuronal transcriptome ofAplysia: neuronal
compartments and circuitry. Cell 127(7), 1453-67.

Preprogo nadotropin-releasing hormone-like protein

signaling molecules since these are important for modulation of the central and peripheral

nervous system in bot h vertebrates and invertebrates are involved in neuron communication,

identity and development. Most neurosecretory signaling molecules appear to be neuron-

specific, making them ideal candidates for markers for neuronal identification and to understand

the genomic basis for neuronal identity.

Previous work using released genomes to screen for secreted signaling molecules and

neuropeptides precursors. Several models including Danio rerio (Klee, 2008), Drosophila

(Wegener and Gorbashov, 2008), Arabidopsis thaliana (Emanuelsson et al., 2000), Apis

mellifera (Hummon et al., 2006), Tribolium castaneum (Amare and Sweedler, 2007) and Homo

sapiens (Emanuelsson et al., 2000) have been investigated. These results have been useful for

understanding organism-wide expression of SSMs; however, none of these predictions have

aimed at understanding neuron-specific expression of SSMs due to limitations in cell-specific

mapping in these models. The large and easily identifiable neurons ofAplysia will allow the

current work to go beyond the scope of these investigations to look at what SSMs are responsible

for learning and memory, neuron identity and plasticity in single neurons.

At the start of this project, 31 non redundant signaling peptides had been found by

traditional cloning techniques and submitted to NCBI for Aplysia californica (Object 2-2). This

represents over 20 years of work by numerous labs searching for individual proteins. Here, a

comprehensive list was created using both genomic and transcriptomic screening to identify all

non redundant transcripts predicted to encode secretary signaling peptides expressed in the CNS

ofAplysia californica. It is shown that screening genomic and transcriptomic data for transcripts

encoding proteins of interest represents a faster, more comprehensive way to identify putative

SSMs important for neuronal processes.


Object page

2-1 Intron/Exon Boundaries of selected neurosecretory genes........................ ...............77

2-2 Identified neurosecretory products likely to be signaling molecules.............................82

2-3 Controversial predicted neurosecretory products. ....................................................127

2-4 Predicted Lottia secreted signaling proteins. ...................................... ............... 149

2-5 Controversial predicted Lottia secreted signaling proteins ................ ......... ..........155

2-6 Predicted signaling molecules found in Lymnaea stagnalis. ........................................170

2-7 Predicted secreted signaling molecules found in Pleurobranchaea californica..............181

2-8 Predicted secreted signaling molecules found in Tritonia diomedea. ..........................189

2-9 Predicted secreted signaling molecules found in Melibe leonine ..................................195

2-10 Predicted secreted signaling molecules found in Clione limacine..............................199

2-11 Predicted secreted signaling molecules found in Octopus vulgaris ..............................201

2-12 Predicted secreted signaling molecules found in Nautilus pompilius. ..........................209



One major goal of neuroscience is to understand the molecular mechanisms underlying

learning and memory. Despite several advances in our understanding of these mechanisms, the

complexity of the mammalian brain poses many technical challenges to studying mechanisms of

synaptic plasticity and learning. The small neuron size of mammalian brains makes isolation of

individual neurons difficult and the overall complexity of neuronal networks affecting behavior

poses problems for correlating neuronal function to specific behaviors. For this reason, many

researchers turn to simpler model organisms, such as invertebrates, for studying learning and


Aplysia californica: a model for learning and memory

Aplysia californica (Figure 1-1) is an important model for studying mechanisms of

learning and memory because it has a simple nervous system that consists of 20,000 relatively

large and identifiable neurons (Figure 1-1) (Kandel, 1979). The nervous system ofAplysia

consists of a system often connected ganglia with specialized functions (Figure 1-2). The

simple and quantifiable behavior, the gill and siphon withdraw reflex, has been extensively

studied over the last 40 years providing keys to the cellular understanding of learning and

memory (Kandel, 1976; Kandel, 2001; McPhie, 2006). Although about 200 neurons identified in

the central ganglia can participate in the gill and siphon withdraw reflex, the cellular circuitry

that modifies this reflex can be simplified to a network of monosynaptic connections between

three neuron types: a presynaptic sensory neuron, a post synaptic motor neuron and a modulatory

interneuron ((Kandel, 1976; Kandel, 2001). When the application of serotonin (5-HT) or nitric

oxide (NO) are applied locally to substitute for the action of the facilitory interneuron (Antonov


Secretory signaling peptides/proteins found by homology search to Lottia genomic

Strong Annotation

Lottia Protein Model: jgi_Lotgil_119019_e_gwl.30.87.1
NR Annotation: PREDICTED: similar to seleno protein N, 1 isoform 2 precursor [Canis familiaris]
NRE value: 2.00E-85
Ac Annotation: Seleno protein Nprecursor_[0.0]_ [6]_APL all 052305.8412.C1
Ac E Value: 7.00E-69

Lottia Protein Model: jgi_Lotgil_121665_e_gwl.37.7.1
NR Annotation: hedgehog [Patella vulgata]
NRE value: 1.00E-171
Ac Annotation: Sonichedgehog protein precursor (SHH) (HHG-1) [Contains: Sonic hedgehog protei_[3.65288E-
39]_[1]_L7ALL-ET 3 V2MC01DELVF_253
Ac E Value: 3.00E-32

Lottia Protein Model: jgi_Lotgil_159314_fgenesh2_pg.C sca 20000054
NR Annotation: Buccalin precursor [Contains: Buccalin-D; Buccalin-E; Buccalin-F; Buccalin-G; Buccalin-H;
Buccalin-A; Buccalin-I; Buccalin-J; Buccalin-K; Buccalin-L; Buccalin-B (BUCb); Buccalin-M; Buccalin gene-
predicted acidic peptide A (BGPAP A); Buccalin-N; Buccalin-O; Buccalin-P; Buccalin-Q; Buccalin-R; Buccalin-C;
Buccalin-S; Buccalin gene-predicted acidic peptide B (BGPAP B)] gb|AAB27696.21 buccalin precursor [Aplysia

Figure 1-1. The Aplysia model system.. A) Image ofAplysia californica. (Image courtesy of
(Rudman, 2003). B) The abdominal ganglia from Aplysia, showing large, easily identifiable
neurons. C) The gill and siphon withdraw reflex can be simplified in cell culture to two neurons,
a sensory cell (i.e. SN) and a motor neuron (i.e. L7) and still exhibit many of the same behavioral
and cellular responses seen in mammalian conditioning including long-term synaptic plasticity
and memory. [ Image A courtesy of Rudman, W.B. (2003). Ink glands (Syndney, Sea Slug
Forum). Images B and C courtesy of Lovell andMoroz, unpublished.]




Jinnie Amber Sloan

August 2009

Chair: Leonid L. Moroz
Major: Medical Sciences

Several major questions related to the molecular underpinnings of neuronal identity and

function such as, "What make s a neuron a neuron? What is the genomic basis of unique neuronal

phenotypes? How different is the transcriptional profile of one neuron from another? Can

molecular techniques be used to determine neuronal identity?" remain at the center of research in

neuroscience. As a first step to answering these questions, and providing a list of molecular

markers to identify specific neurons types, we have attempted to identify and quantify nearly all

transcripts likely to be uniquely expressed in different neuronal classes (such as neuron-specific

secretary products) and play a crucial role in neuron identity and function. This includes

transcripts that encode neuropeptides, prohormones and related secretary signal peptides.

Molluscs have served as powerful model organisms for cellular and system neuroscience

for more than 40 years (McPhie and Miller, M., 2006; Kandel, 1970). Their nervous systems

consist of simplified networks of large identified neurons, allowing unprecedented opportunities

to study the principles of organization of neural circuits as well as learning and memory

mechanisms. As our major experimental models, we chose Aplysia californica and related

species, sea slugs belonging to the class of Gastropod Mollusca and species belonging to

Feeding circuit peptide 2+
Gene Bank Accession Number: n/a
Reference: n/a
Partial Clone:

FFELamide/FMRFamide -3
Gene Bank Accession Number: n/a
Reference: n/a
Comment: Predicted only, not cloned

Fifth (short peptide fragments obtained from MS data)
Gene Bank Accession Number: n/a
Reference: n/a
Comment: Predicted only, not cloned

Digital Expression Profiling

Digital Expression Profiles (DEP) are made by taking the entire set of data from a

sequencing project before assembly. In this dataset, each sequence read represents the

expression of a single transcript in the cell or tissue the library was made from, such that there is

a 1 to 1 ratio of sequence read to transcript.

From this data set, any sequence of interest can be aligned using BLAST (le-04) and by

counting the number of reads generated from the 454 sequencing that have significant BLAST,

the number of times that transcript was sequenced from the library can be determined. To

determine the frequency of expression, these counts are normalized to the total number of

sequences in the sequencing project. By normalizing the counts, the frequency of expression

across different sequencing projects can be compared.

Secretory Product DEP In situ


Sensorin + + +

PTSP-like + +

Capsulin + + +

LFRFamide + + +

SF Y3 +

7B2 s.g. + + +

Heatshock + + +

MIP + +

FMRFamide + + +

R15 + +

Delta-like +

Ependymin + +

Putative Pheremone 2 + +

Theromacin +

Fulicin +

Myomodulin + +

Insulin-like + +

Buccalin + + +

Table 4-1. Validation of DEP using in situ hybridization. Comparison of secretary products
predicted to expressed in Sensory (SN), Motor (MN) or Inter (IN) neurons by DEP compared to
expression confirmed by in situ hybridization.

Table 2-3. Genomic organization of neurosecretory genes. Preliminary analysis of the genomic
organization of selected neurosecretory products shows that all genes have a similar
intron/exon organization, with an average of 3-5 exons. (See Supplemental A for
detailed information.)
Neuropeptide Number Number
Introns Exons
Atrial gland-specific antigen precursor 9 10
Feeding circuit activating peptide precursor 1 2
FMRFamide neuropeptide precursor 2 3
L11 neuropeptide precursor 2 3
Buccalin precursor 3 4
Conopressin 3 4
Fulicin-like neuropeptide precursor 4 5
MIP-related peptide precursor 4 5
Neurotoxin-like- 1 3 4
Pleurin 2 3
Whitnin precursor 2 3

responsible for regulation are more highly variable. This may suggest one means for species

specificity at the neuronal level. Using recently released genomic data fromAplysia californica,

the intron/exon boundaries of neuropeptides were analyzed to determine if sequence

conservation and variability was due to the genomic arrangement of these genes. Preliminary

analysis of 5 conserved, divergent and moderately conserved neuropeptides does not reveal any

clear differences between the genomic organization of each type of neuropeptide.

Perhaps the most important finding is the large number of sequences with shared identity

found in bothAplysia and Lottia. These sequences represent a portion of the Aplysia secretome

that has be en effectively predicted without having to perform expensive genomic sequencing or

repeat the computationally expensive process of secretome prediction. This is a major step in

bringing genomic-scale proteomics to a species without a sequenced genome.

Methods and Materials

Animals and Tissue Collections

Specimens ofAplysia californica weighing 150-280 g were collected in the wild by

Marinus Scientific (Long Beach, CA). Specimens ofPleurobranchaea californica, Clione

limacina, Tritonia diomedea, Melibe leonina, and Lymnaea stagnalis were obtained from the

Friday Harbor Labs, University of Washington. Octopus vulagris was obtained from Italy and

Nautilus pompilius from the Phillipines. Prior to dissection of gastropods, animals were

anesthetized by injecting a volume of isotonic MgCl2 (337mM) equivalent to 50%-60% of their

weight. Dissection ofCepholopods and Gastropod Mollusca was performed by Dr. Moroz.

Total RNA from whole CNS was extracted using RNAqueousTM (Ambion, Austin, TX) kit.

RNA isolation was performed by Dr. A Kohn, Jinnie Sloan, and Yelena Bobkova. Before

further processing of the RNA, quality was checked using a 2100 BioanalyzerTM (Agilent

Technologies). Small aliquots of extracted RNA were loaded on a 6000 Nano Lab chip that

AGGCAACAGTGGAATCGAAGCTCTC-3', our lab cloned the full length sequence of

Hypothetical protein 2, resulting in a 788 bp fragment.

LFRFamide precursor

The full length sequence and clone for LFRFamide was obtained (Genebank accession

number EU886298) using terminal primers 5'-GGCCTCAGTTCGAAACCTCG-3' and 5'-

ATTGGTCACCCTGTCCTCGG-3'. The resulting cDNA fragment was 1074 bp.

Myomodulin-like Neuropeptide Precursor3

The full length sequence and clone for Myomodulin-like Neuropeptide Precursor 3 was

obtained (Genebank accession number EU934739) using terminal primers 5'-


-3'. The resulting cDNA fragment was 1690 bp.


The full length sequence and clone for Conopressin was obtained (Genebank accession

number FJ172359) using terminal primers 5'-CCAACTACAGGATGTCTCACTC-3' and 5'-

GACGTTGAGTGGACACTGTGA -3'. The resulting cDNA fragment was 1983 bp.

Ependymin-related protein 2

The full length sequence and clone for Ependymin-related protein 2 was obtained (not

submitted) using terminal primers 5'-CTGGTATCAGAGCCACTCACCTC-3' and 5'-

TGGTTGAATGTATACGTGCATGTAC -3'. The resulting cDNA fragment was 873 bp.


The full length sequence and clone for Betsin was obtained (not submitted) using terminal


-3'. The resulting cDNA fragment was 538 bp.

Intron 1 2 3 4

Exonl1 2 3 4 5

MIP-related peptide precursor
Gene Bank Accession Number: 8886135
Intron/Exon Boundaries: coding region: 668-2873 nt
Exon Intron 3' Exon 5' Sequence Exon 3' Sequence Exon Intron 5' Sequence Nucleotide
Number Sequence Length location
1 CCCTTGGGGT TGACCATAGA gt atgttgtt 1456
2 gttgtttc ag ATTCCAAAAA AGTGGTTCAG 144 gt aggttgct 457-600
3 tctcgtt ag GTTACCACAG AATTGTACFG 33 gt gagtggaa 601-633
4 cttattcc ag ATTTTrTCFG TCACGTGCAG 107 gt gagtagga 634-740
5 ttccatgc ag ATACGCAAAG AGGTAGCTTT 2139 gt ccatccag 741-2879

Intron 1 2 3 4

Exon 2 3 4 5

Gene Bank Accession Number: 71148939
Intron/Exon Boundaries: Coding Region: 10-423 nt
Exon Intron 3' Exon 5' Sequence Exon 3' Sequence Exon Intron 5' Sequence Nucleotide
Number Sequence Length location

Intron 1 2 3

Exon 2 3 4

Gene Bank Accession Number: 56200040
Intron/Exon Boundaries: Coding Region: 189-755
Exon Intron 3' Exon 5' Sequence Exon 3' Sequence Exon Intron 5' Sequence Placement in
Number Sequence Length Sequence

Figure 4-1. Semi-intact preparation ofAplysia abdominal for identifying neurons of the gill and
siphon withdraw reflex. The nerves connecting the abdo minal ganglia to the gill and siphon
remain intact. By removing the sheath surrounding the neurons, cells can be impaled and
recorded from to determine cell identity. For example, L7 can be identified by impaling cells in
the vicinity of L7 until a cell is found that when stimulated, results in the contraction of the gill
and siphon.

*. .connectives- ~2 Pleural ganglia

P5 Pee P5

P4 -- Pleuroabdominal P6
P6 / P7

P8 CP8
P9 -R13 P9
O0 R2
A6 Abdominal

A5 A2

Figure 3-2. Schematic overview of the distribution ofFulicin-like transcript in the CNS of
Aplysia. Each circle represents a single cell showing staining for the Fulicin-like transcript.
Positions of identified cells MCC, R2, and LP1 are indicated, (viewed from caudal surface).
Most significant staining was seen in the Abdominal and Pleural ganglia.

Full Text




2 2009 Jinnie Amber Sloan


3 To my mother Lisa and my family for all their support and love


4 ACKNOWLEDGMENTS I would lik e to thank my colleagues, collaborators and teachers at the Whitney Laboratory for Marine Biosciences. This work is a reflection of the keen insight and vision of my mentor, Leonid L. Moroz, who always strives to push science and those around him to accom plish what may seem impossible. I am grateful to my dissertation committee, Peter Anderson and Nancy Denslow. I will be forever grateful to Andrea Kohn for her continual support and guidance in my pursuits both as a scientist and as a friend. To Mathew Citarella I would like to thank for years of support and his contribution to the bioinformatics aspects of this work, none of this would have been possible without his help. Jim Netherton, Yelena Bobkova, and Rebecca Virata for their technical support. I am also grateful to Thomas Ha for teaching me in situ hybridization protocols and the semi intact preparation.


5 TABLE OF CONTENTS page ACKNOWLEDGMENTS ...............................................................................................................4 L IST OF TABLES ...........................................................................................................................8 LIST OF FIGURES .........................................................................................................................9 G LOSSARY OF TERMS ..............................................................................................................12 ABSTRACT ..................................................................................................................................13 CHAPTER 1 INTRODUCTION ..................................................................................................................16 Introduction .............................................................................................................................16 Aplysia californic a : a model for learning and memory ..........................................................16 Neuropeptides .........................................................................................................................17 2 I DENTIFICATION OF NEUROSECRETORY PRODUCTS IN GASTROPOD MOLLUSCS ...........................................................................................................................23 Introduction .............................................................................................................................23 Results and Discussion ...........................................................................................................25 Identification of Predicte d Secreted Signal Molecules ...................................................25 Homology r esults ......................................................................................................25 Prediction r esults ......................................................................................................25 Confirmation of Expression of Selected Neuronal Transcripts .......................................28 Cross Species Analysis ...................................................................................................29 Genomic Organization of Select ed Neurosecretory Products .........................................29 Conclusions .............................................................................................................................30 Methods and Materials ...........................................................................................................31 Animals and Tissue Collections ......................................................................................31 454 Library Construction ................................................................................................32 3' end amplified cDNA library construction for 454 sequencin g: ............................32 5' end target amplified cDNA library construction for 454 sequencing: .................33 Cloning of selected Signaling Molecules ........................................................................34 Hypothetical protein 2 ..............................................................................................34 LFRFamide precursor ...............................................................................................35 Myomodulin like Neuro peptide Precursor 3 ............................................................35 Conopressin ..............................................................................................................35 Ependymin related protein 2 ....................................................................................35 Betsin ........................................................................................................................35 Feeding circuit activating petide precursor 3 (FCAP 3) ..........................................36 SN4 ...........................................................................................................................36


6 SFY1 like peptide .....................................................................................................36 SFY3 like peptide .....................................................................................................36 FIRFamide related neuropeptide precursor ..............................................................36 Major royal jelly protein (MRJ) ...............................................................................36 FMRFamide 5 ...........................................................................................................37 Allatotropin OR precursor ........................................................................................37 Second ......................................................................................................................37 Neurosecretory Predictions .............................................................................................37 Homology search using unbiased shot gun approach ................................................37 Genomic approach ....................................................................................................38 Classical Secretory Prediction* ................................................................................38 Non classical Secretory peptide Prediction* ............................................................39 Cross Species Analysis of Predicted Proteins ..........................................................39 Annotation of Predicted Pr oteins ..............................................................................40 3 M APPING EXPRESSION OF NEUROPEPTIDE TRANSCRIPTS .....................................50 Introduction .............................................................................................................................50 Mytilus Inhibitory Peptides ..............................................................................................50 Fulicin ..............................................................................................................................51 Results .....................................................................................................................................51 Cloning of Aplysia Fulicin precursor mRNA ..................................................................51 Localization of Fulicin in the CNS of Aplysia ................................................................52 Co localization of MIP and Fulicin .................................................................................52 Isolation of Fulicin in the CNS of Aplysia ......................................................................53 MIP and Fulicin share 5 UTR and coding region ..........................................................53 TxFrag2: Structure and Function .....................................................................................53 Discussion ...............................................................................................................................54 Colocalization of Fulicin and MIP ..................................................................................54 TxFrag2: Modulator of Expression? ...............................................................................55 Materials and Methods ...........................................................................................................56 Anima ls ............................................................................................................................56 Cloning of full length cDNA encoding Fulicin ...............................................................56 Sequence analysis and Alignments .................................................................................56 In situ hybridization of Fulicin and MIP in Aplysia .......................................................57 Imaging ............................................................................................................................58 4 GENE EXPRESSION PROFILING FOR INDI VIDUAL NEURONS .................................65 Introduction .............................................................................................................................65 Advantages of Aplysia .....................................................................................................65 Limit ations of Sequencing Technology ...........................................................................66 Results and Discussion ...........................................................................................................67 Sensory Neurons ..............................................................................................................67 Motor Neurons .................................................................................................................67 Interneurons .....................................................................................................................68 Discussion ...............................................................................................................................69


7 D igital Expression Profling .............................................................................................69 APPENDIX A MODERN VIEW OF ANIMAL PHYLOGENY .................................................................220 B MOLLUSCAN CLASSES ...................................................................................................222 LIST OF REFERENCES .............................................................................................................223 BIOGRAPHICAL SKETCH .......................................................................................................229


8 LIST OF TABLES Table page 21 Annotation of Lottia predicted secretory products against NCBIs NR database. ............45 22 Summary of Cross Species Predictions. ............................................................................46 23 Genomic Organization of Neurosecretory Genes. ............................................................48 24 Adaptors and Primers for 5 and 3 454 libraries ..............................................................49 31 Comparison of Real Time PCR of Aplysia MIP related gene and 454 sequencing. ............. 41 Validation of DEP using in situ hybridization ...................................................................76


9 LIST OF FIGURES Figure page 11 The Aplysia model system.. ...............................................................................................20 13 Conserved motifs found in neuropeptides. ........................................................................22 21 Summary of model organism and number of ESTs/cDNAs collected. .............................41 23 Conserved Signaling Molecule Motif. ...............................................................................43 24 Workflow for Computational Prediction of SSMs. ...........................................................44 25 Comparative analysis of predicted Lottia secretory products. ...........................................47 31 Fu licin Gene and Protein Predictions ................................................................................59 32 Schematic overview of the distribution of Fulicin like transcript in the CNS of Aplysia ...............................................................................................................................60 33 Colocalized expression of MIP and Fulicin transcripts. ....................................................61 34 Alignment of the coding region of Aplysia MIP like protein against the identified Aplysia Fulicin like protein. ...............................................................................................63 41 Semi intact preparation of Aplysia abdominal for identifying neurons of the gill and siphon withdraw reflex. ......................................................................................................72 42 Digital expr ession of neurosecretory products predicted by traditional cloning. ..............73 44 Digital expression of neurosecretory products predicted by genomic approach. ..............75


10 LIST OF OBJECTS Object page 21 Intron/Exon Boundaries of selected neurosecretory genes. ...............................................77 22 Identifi ed neurosecretory products likely to be signaling molecules. ................................82 23 Controversial predicted neurosecretory products. ...........................................................127 24 Pre dicted Lottia secreted signaling proteins. ...................................................................149 25 Controversial predicted Lottia secreted signaling proteins. .............................................155 26 Predicted signaling molecules found in Lymnaea stagnalis. ...........................................170 27 Predicted secreted signaling molecules found in P leurobranchaea californica. .............181 28 Predicted secreted signaling molecules found in T ritonia diomedea. .............................189 29 Predicted secreted signaling molecules found in M elibe leonine ....................................195 210 Predicted secreted signaling molecules found in C lione limacine. ..................................199 211 Predicted secreted signaling molecules found in Octopus vulgaris ................................201 212 Predicted secreted signaling molecules found in N autilus pompilius. ............................209


11 LIST OF ABBREVIATIONS BLAST Basic Local Alignment Search Tool CNS Central Nervous System ER E ndoplasmic reticulum ESTs Expressed Sequence Tags DEP Digital Expression Profile IN Interneuron MN Motor Neuron NCBI National Center for Biotechnology Information ncRNA Noncoding RNA NR protein database for Blast searches, compiled by NCBI PCR Polymerase Chain Reaction RACE Rapid Amplification of cDNA Ends SN Sensory Neuron sRNA Short Noncoding RNA SSMs Secreted Signaling Molecules UTR Untranslated region Symbols Cloned by Jinnie Sloan + Cloned by the Moroz lab


12 GLOSSARY OF TERMS BLAST : finds regions of local similarity between sequences. This program can be used to compare nucleotide or protein sequences to a sequence database in order to determine the functional and evolutionary relationship between sequences. The statistical significance calculate d between sequences can be used as a guide to compare sequences and identify members of gene families. Exon : the nucleic acid sequene within a gene that is present in the mature form of an RNA molecule. In situ hybridization : used to localize a specif ic DNA or RNA sequence in a specific tissue or cells by using labeled complementary DNA or RNA. Transfrag Intron : a region of DNA within a gene that is not translated into protein. These regions are included in the transcribed pre mRNA and removed by sp licing to produe a mature RNA. Neuropeptide : small protein like molecules that can be secreted by neurons to communicate with each other. Neuropeptides can act on neighboring neurons as anterograde or retrograde messengers or the neuron secreting the neu ropeptide (orthograde messengers) through cell surface receptors to modulate or mediate neuronal communication. Typically neuropeptides alter the communication of a neuron by increasing or decreasing its excitability. Neuropeptides are assembled by riboso mes attached to the ER then transferred to the Golgi Apparatus to be packaged into vesicles and transported to synaptic terminals. Some neuropeptides are secreted directly into the blood stream and are referred to as neurohormones. Secreted neuropeptides can have long lasting effects from seconds to days. Prepropeptide : the inactive precursor of a peptide that requires posttranslational modifications to become the active peptide molecule. The prepropeptide of neuropeptides is characterized by a signal p eptide that targets the protein to the secretory pathway for posttranslational modifications including the cleavage of the signal peptide in the ER. Signal Peptide : a short (3 60 amino acid) sequence made up of a positively charged sequen c e found on the N terminal region a hydrophobic region and a polar uncharged C terminal region (cleavage site) that targets the transportation of a protein. In the case of secretory signaling peptides, the signal peptide targets the preprotein to the ER for further pos ttranslational modifications. Transcript : an RNA molecule produced from a gene. Transmembrane Domain : a short span of amino acids (1535) composed of mostly hydrophobic regions separated by polar connecting loops that form stable secondary structures in membranes.


13 ABSTRACT OF THESIS PRESENTED TO THE GRA DUATE SCHOOL OF THE UNIVERSITY OF FLORIDA IN PARTIAL F ULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF MASTER OF SCIENCE IDENTIFICATION OF NEUROSECRETORY MOLECULES IN APLYSIA CALIFORNICA AND RELATED MOLLU SCS: GENOMIC APPROACHES By Jinnie Amber Sloan August 2009 Chair: Leonid L. Moroz Major: M edical Science s Several major questions related to the molecular underpinnings of neuronal identity and function such as, What makes a neuron a neuron? What is th e genomic basis of unique neuronal phenotypes? How different is the transcriptional profile of one neuron from another? Can molecular techniques be used to determine neuronal identity? remain at the center of research in neuroscience. As a first step to answering these questions, and providing a list of molecular markers to identify specific neurons types, we have attempted to identify and quantify nearly all transcripts likely to be uniquely expressed in different neuronal classes (such as neuron specific secretory products) and play a crucial role in neuron identity and function. This includes transcripts that encode neuropeptides, prohormones and related secretory signal peptides M olluscs have served as powerful model organisms for cellular and sys t em neuroscience for more than 4 0 years (McPhie and Miller, M., 2006; Kandel, 1970) Their nervous systems consist of simplified networks of large identified neurons, allowing unprecedented opportunities to study the principles of organization of neural ci rcuits as well as learning and memory mechanisms. As our major experimental models, we chose Aplysia californica and related species sea s lugs belonging to the class of Gastropod Mollusca and species belonging to


14 cephalopod molluscs Our long term goal is to identify neurosecretory molecules of peptide nature using a combination of comparative and genomic approaches. We have chosen neurosecretory molecules as putative molecular markers because they are highly abundant in neurons and are responsible for ce ll signaling and modulation Originally, the major limitation in using Aplysia californica, as well as other molluscs, has been the lack of genomic information available for these model species. To overcome this limitation, we have aimed to bridge the ga p between genomic and non genomic models. The Moroz lab has sequenced >980,000 ESTs/cDNAs from eight key mollusan species ( Gastropods: Aplysia californica, Pleurobranchaea californica, Clione limacina, Tritonia diomedea, Melibe leonina, Lymnaea stagnalis, and Cephalopods: Octopus vulgaris, Nautilus pompilius ). These sequences were assembled and cross annotated using the extensive transcriptome and genomic information from Aplysia californica My thesis deals with comparative analysis and identification of both evolutionary conserved and novel transcripts that encode neuropeptides, prohormones and other predicted secretory products. As a part of the project, we have also employed computational approaches to predict novel signal molecules based on shared pr edicted protein motifs that are conserved across all secreted signaling proteins. Through this work, I identified a selected list of candidate transcripts predicted to encode secretory molecules across selected molluscs and identif ied putative neuropeptide s present in individual neuronal classes including motor neurons, sensory neurons, and interneurons This work also led to the identification of a set of neuropeptides that is co expressed in sensory and motor neurons. The developed molecular resources an d the ability to map gene expression has allowed me to provide a detailed study of the genomics of identified cells and provide a critical bridge between genes, circuits and behavior in the broad evolutionary context. Overall these


15 identified neurosecreto ry products may be the first step to creating a comprehensive list of gene products expressed in individual neurons that can be used for molecular identification of neuron types.


16 CHAPTER 1 INTRODUCTION Introduction One major goal of neuroscience is to und erstand the molecular mechanisms underlying learning and memory. Despite several advances in our understanding of these mechanisms, the complexity of the mammalian brain poses many technical challenges to studying mechanisms of synaptic plasticity and lea rning. The small neuron size of mammalian brains makes isolation of individual neurons difficult and the overall complexity of neuronal networks affecting behavior poses problems for correlating neuronal function to specific behaviors. For this reason, m any researchers turn to simpler model organisms, such as invertebrates, for studying learning and memory. Aplysia californica : a model for learning and memory Aplysia californica (Figure 1 1) is an important model for studying mechanisms of learning and me mory because it has a simple nervous system that consists of 20,000 relatively large and identifiable neurons (Figure 1 1) (Kandel, 1979) The nervous system of Aplysia consists of a system of ten connected ganglia with specialized functions (Figure 1 2) The simple and quantifiable behavior, the gill and siphon withdraw reflex, has been extensively studied over the last 40 years providing keys to the cellular understanding of learning and memory (Kandel, 1976; Ka ndel, 2001; McPhie, 2006) Although about 200 neurons identified in the central ganglia can participate in the gill and siphon withdraw reflex, the cellular circuitry that modifies this reflex can be simplified to a network of monosynaptic connections be tween three neuron types: a presynaptic sensory neuron, a post synaptic motor neuron and a modulatory interneuron ( (Kandel, 1976; Kandel, 2001) When the application of serotoni n (5 HT) or nitric oxide (NO) are app lied locally to substitute for the action of the facilitory interneuron (Antonov


17 et al., 2007) this experimental set up can be further simplified in cell culture to consist of two neurons, a sensory cell (i.e. SN) and a motor neuron (i.e. L7) and still exhibit many of the same behavioral and cellular responses seen in mammalian conditioning including long term synaptic plasticity and memory (Figure 1 1) (Kandel, 2001; Lewin and Walters, 1999) The synaptic strength or ability for these neurons to communicate can be changed, a term called synaptic plasticity. Modification to neuronal circuits through synaptic plasticity is responsible for different types of learning. One major obstacle in understanding how changes in synaptic plasticity affects learning and behavior is the het erogeneity of neuron types. Since each neuron may be unique, it is likely that they form and maintain information in different ways. Be fore the mechanism of plastcit y can be understood, neuron types (motor vs. sensory vs. inter neurons) need to reliably identified by marker s In mammals, there is strong evidence that neurotransmitters are in part responsible for changes in synaptic strength. Here, I propose the use of neurotransmitters, neuropeptides in particular, as neuronal markers to aid research of neuronal plasticity. Neuropeptides Neuropeptides are small peptides used by neurons to communicate to one another. They are the most diverse group of neuronal secreted chemical messengers and they function as hormones, neuromodulators or neurotransmitt ers to regulate physiological processes Cellular signaling through neuropeptides allows neurons to modulate the central and peripheral nervous system in both vertebrates and invertebrates (Strand et al., 1991) Neuropeptides can also regulate intercellular signaling (Caneparo et al., 2007) disease ho s t response (Boldajipour et al., 2008; Merritt, 2007) embryonic development (Ugriumov, 2009) and organogenesis (Pickart et al., 2006) Despite a range of functional roles, all classical neuropeptides are targeted to and processed by the regulated secretory pathway via conserved protein motifs (Figure 13)


18 Before they are posttr anslationally processed into small peptides by enzymatic cleavage, neuropeptides exist as a larger prepropeptide (Southey et al., 2008) This prepropeptide is targeted for cotranslational translocation (CTT) into the endoplasmic reticulum (ER) by an N terminal signal sequence, or signal peptide. Signal peptides are composed of three regions: a positively charged N terminal region, a hydrophobi c region, and a polar uncharged C terminal region. Only the C terminal region typically shows conserved properties due to the presence of the cleavage site (Emanuelsson et al., 2007) Only those proteins lacking a transmembrane domain will pass through the ER and eventually be secreted outside of the outer cell membrane Secondary signal sequences on neuropeptides then interact with chaperone proteins to target the neuropeptide to secretor y vesicles Not all proteins that pass through the ER are targeted to vesicles that fuse with the plasma membrane to release its contents outside of the cell; those with different secondary signal sequences will be directed to various terminal destination s including the cell membrane, the ER, the Golgi apparatus, and other organelles (Klee, 2008) Prepropeptide s are then enzymatically cleaved to release functional neuropeptides. Some prepropeptides are made of highly repetitive units, and are processed to release several similar if not identical peptides. Other prepropeptides are made of unique units. Resear ch in mollusks has revealed expression of numerous families of neuropeptides (Krajniak et al., 1989; Smit et al., 1991) as well as individual neuropeptides (Banvolgyi et al., 2000; Kuroki et al., 1990; Smit et al., 1992) Physiological studies in Aplysia californica have demonstrated that neuropeptide modulation plays a crucial role in the initiation and regulation of several behaviors including feeding, egg laying, and card io activity (Campanelli and Scheller, 1987; Scheller et al., 1983; Sossin et al., 1987; Sweedler et al., 2002) Due to the lack of genomic information on Aplysia, it is likely that most neuropeptides remain unident ified. Using


19 the conserved structural architecture of neuropeptides we will screen ou r large collection of neuronal transcripts from Aplysia and identify putative neuropeptides. Using the large neurons of Aplysia and unbiased shotgun sequencing, we ca n approach full coverage of all transcripts expressed in individual neurons in a simple memory forming network. It is my hypothesis that by using the variability of peptide, protein, and related secretory product expression in different neuron types that I will be able to identify patterns of peptide and protein expression that would give a signature for individual cell types. Coupled with the upcoming release of the Aplysia genome, this model system provides a unique opportunity to complete genome wide annotation of individual neurons to identifiy molecular markers of neuronal identity


20 Figure 11. The Aplysia model system .. A) Image of Aplysia californica. (Image courtesy o f (Rudman, 2003) B) The abdominal ganglia from Aplysia showing large, easily identifiable neurons. C) The gill and siphon withdraw reflex can be simplified in ce ll culture to two neurons, a sensory cell (i.e. SN) and a motor neuron (i.e. L7) and still exhibit many of the same behavioral and cellular responses seen in mammalian conditioning including long term synaptic plasticity and memory. [ Image A courtesy of Rudman, W.B. (2003). Ink gl ands (Syndney, Sea Slug Forum) Images B and C cour tesy of Lovell and Moroz, unpublished.] 1mm 1mm A B SN L7 1 + Serotonin (5 HT) 0.2mm Motor neur ons Sensory neurons Motor neurons Sensory neurons C


21 Figure 12. Organization of the Aplysia central nervous system. A) Diagram showing the central ganglia th at make up the central nervous system of Aplysia B) Representations of Aplysia showing the areas, color coded as in (A), innervated by specific ganglia. Some ganglia (pleural/pedal) have multiple functions innerva ting the same regions of the body as ind icataed by the gradient coloring however there is some specificity in innervating [ Modified from Moroz, L.L., Edwards, J.R., Puthanveettil, S.V., Kohn, A.B., Ha, T., Heyland, A., Knudsen, B., Sahni, A., Yu, F., Liu, L., et al. (2006). Neuronal transcript ome of A plysia : neuronal compartments and circuitry. Cell 127, 14531467.] Head ganglia Buccal g. Pleural g. Pedal g. Cerebral g. Abdominal g Buccal mass Intestine Buccal mass Buccal mass Intestine Intestine Eye Parapodium Foot Parapodium Foot Mantle and Visceral Hump Mantle and Visceral Hump A. B.


22 Figure 13. Conserved motifs found in neuropeptides. All classical neuropeptides are targeted to the secretory pathway by signal peptides, short positively charged N terminal regions found on the C terminal region of a prepropeptide (Klee, 2008; Schatz and Dobberstein, 1996) The larger prepropeptides that encode neuropeptides are also characterized by regions of intrinsic disorder, and internal repeats that usually indicate the regions where peptides will be processed from. Importantly, prepropeptides destined to be fully processed into small pepti des lack transmembrane domains (Corsi and Schekman, 1996) Signal Peptide Intrinsic Disorder Internal Repeats


23 CHAPTER 2 IDENTIFICATION OF NE UROSECRETORY PRODUCT S IN GASTROPOD MOLLU SCS Introduction Gastropod molluscs have served as powerful model organisms for cellular and system neurosci ence for more than 60 years. The central nervous system (CNS) of these models consists of a simplified network of relatively large identified neurons, allowing unprecedented opportunities to study the principles of organization of neural circuits as well as learning and memory mechanisms. However, a major limitation to identifiying the neurosecretory products of neurons of the molluscan models has been the lack of genomic information. To overcome these limitations, we have sequenced >980, 000 ESTs/cDNAs f rom the CNS of eight mollusc an species ( Gastropods: Aplysia californica, Pleurobranchaea californica, Clione limacina, Tritonia diomedea, Melibe leonina, Lymnaea stagnalis, and Cephalopods: Octopus vulgaris, Nautilus pompilius ) ( Figure 2 1). These sequenc es were assembled and cross annotated using the extensive transcriptome and genomic information from Aplysia californica (Moroz et al., 2006) This comparative approach allowed identification of both evolutionary c onserved neuronal genes and numerous novel genes including neuropeptides, prohormones and other predicted secretory products. It is estimated that there are >320,000 putative unique gene products ( including non coding and small RNAs) present in our compara tive neurogenomic database, which likely correspond to >5060% of the total number of genes expressed in the nervous systems of these molluscs. A selected list of genes identified in that study represent s major group of transcripts implicated in the contr ol of neural excitability, synaptic functions and plasticity, receptors, adhesion molecules, developmental genes, and homologs of genes involved in neurological disorders, etc. Specifically, we looked for putative neurosecretory products that may function as


24 signaling molecules since these are important for modulation of the central and peripheral nervous system in both vertebrates and invertebrates are involved in neuron communication, identity and development. Most neurosecretory signaling molecules app ear to be neuron specific, making them ideal candidates for markers for neuronal identification and to understand the genomic basis for neuronal identity. Previous work using released genomes to screen for secreted signaling molecules and neuropeptides pre cursors. Several models including Danio rerio (Klee, 2008) Drosophila (Wegener and Gorbashov, 2008) Arabidopsis thaliana (Emanuelsson et al., 2000) Apis mellifera (Hummon et al., 2006) Tribolium castaneum (Am are and Sweedler, 2007) and Homo sapiens (Emanuelsson et al., 2000) have been investigated. These results have been useful for understanding organism wide expression of SSMs; however, none of these predictions hav e aimed at understanding neuron specific expression of SSMs due to limitations in cell specific mapping in these models. The large and easily identifiable neurons of Aplysia will allow the current work to go beyond the scope of these investigations to look at what SSMs are responsible for learning and memory, neuron identity and plasticity in single neurons. At the start of this project, 31 non redundant signaling peptides had been found by traditional cloning techniques and submitted to NCBI for Aplysia californica ( Object 22) This represents over 20 years of work by numerous labs searching for individual proteins. Here, a comprehensive list was created using both genomic and transcriptomic screening to identify all non redundant transcripts predicted to encode secretory signaling peptides expressed in the CNS of Aplysia californica. I t is shown that screening genomic and transcriptomic data for transcripts encoding proteins of interest represents a faster, more comprehensive way to identify putative SSMs important for neuronal processes.


25 Results and Discussion Identification of Predicted Secreted Signal Molecules Homology r esults Through cross species homology search, 109 putative neuropeptides were identified from the Aplysia CNS transcriptome, 8 8 predicted to be secreted signaling molecules ( Object 22) and 21 predicted to be involved in the secretory pathway though not necessarily secreted ( Object 23). While homology searches can provide a wealth of information when initially annotating tran scriptomes, it limits annotation to only sequences with homology to known sequences. Indeed when annotating the >203,000 transcripts of the Aplysia transcriptome (Moroz et al, 2006) only 43,672 sequences can be annotated, showing the enormous complexity of the neuronal transcriptome ( Figure 22, insert ). Furthermore, preliminary results from cross species transcriptome analysis suggest that many neuropeptides are quickly evolving even between closely related species ( Figure 22). Due to these limitation s, we suspected that many SSMs of the Aplysia CNS could not be identified through homology searches, and decided to employ bioinformatics approaches for a more comprehensive list of SSMs using genomic scale searches. Prediction r esults To identify novel an d unannotated SSMs, publicly available software was used to complete genome scale profiling of all SSMs. These software programs rely upon conserved protein moti fs to predict prepropeptides. Signal peptide prediction software identifies conserved protein motifs required for processing and directing proteins to secretory pathways ( Figure 23). Accurate predictions rely upon the use of full length peptide sequences. Because there is


26 currently no available genome for Aplysia and the Aplysia transcriptome r epresents a collection of partial length sequences, a set of full length protein models with which we could perform a computational secretome prediction is lacking Therefore, proteins predicted from the genome of Lottia gigantea, a related marine mollus c were used for computational SSM prediction. Lottia is a limpet belonging to a basal branch of G astropoda I t was chosen as the first mollusc to have its genome completed due to its small predicted genome. The availability of the Lottia genome made it possible to predict putative secreted signaling molecules that could then be used to search the Aplysia transcriptome for secretory products and effectively bridge the gap between genomic and non genomic species. A computational flowchart was used to scree n the Lottia genome for SSMs ( Figure 24). First, a set of 23,851 full length proteins predicted by the Lottia Filtered Gene M odels was downloaded from the JGI website. The Filtered Gene Models includes gene models selected as the best representative mod el available for each gene via a second layer of bioinformatics methods including manual annotation and the use of experimental data. Protein sequences were then screen e d for the presence of a signal peptide. Signal peptides are predicted by a characteri stic N terminal sequence 15 40 amino acids that contains 25 positively charged amino acids, 715 hydrophobic amino acids, and 37 neutral (often polar) amino acids that make up the cleavage site. Through the use of TargetP 1.1 (Emanuelsson et al., 2000) 3640 were predicted by the presence of a signal peptide to be directed to the secretory pathway. 1853 of those proteins were further predicted to contain a signal sequence by SignalP 3.0 (Bendtsen et al., 2004b) Not all proteins with signal peptides are secreted, like receptor proteins. To remove possible non secreted proteins, proteins were screened for the presence of transmembrane domains b y looking for repeated hydroph obic amino acid sequences 15 35 amino acids in length separated by polar


27 connecting loops. Following screening for transmembrane domains by TMHMM 2.0c, 1034 candidate proteins were predicted to have no transmembrane domains 859 proteins were confirmed t o have a signal sequence and no transmembrane domains by Phobius (Kall et al., 2004) (see materials and methods for further information about prediction software). All sequences were then manually screened through SMART for transmembrane domains, and protein domains to remove any possible receptors or enzymes from the list. To ensure that predicted SSMs were likely to represent SSMs actually expressed by molluscs, only those SSMs shown to be expressed in the transcriptomes of two or more of our molluscan species were kept on the list. 87 predicted SSMs were predicted to be classically secreted proteins in Lottia including 22 putative neurosecretory products likely to be signaling molecules ( Object 24) and 65 of controversial or unknown function ( Object 25). Interestingly, more proteins (937) were identified by SecretomeP (Bendtsen et al., 2004a; Bendtsen et al., 2004b) as secreted via a non classical secretory pathway compared to those predicted to be secreted via classical pathways. Nonclassica lly secreted proteins are those proteins lacking a signal peptide that are still secreted by the cell These include some growth factors, interleukins and galectins. One possible explanation for this difference is that the SecretomeP program has inherent problems for prediction with our model species. SecretomeP relies upon machine learning algorithms to predict secretion from sequence information and currently has only been trained against Gram positive bacterial, Gram negative bacterial and mammalian s equences. The lack of training for invertebrate proteins may result in false positives. In fact, closer inspection revealed that many of the secretory products predicted by SecretomeP were annotated as molecules that rarely leave the cell.


28 Annotation o f the Lottia SSMs against NCBIs NR database reveal that 14 classically secreted peptides had no hits to the database and therefore could not be annotated ( Table 21, Object 2 5). This could be a product of the evolutionary distance between Lottia and other commonly sequenced organisms used in the NR database. If the species represented by the sequences in NR are divergent enough from Lottia the predicted proteins will not be similar enough to the database entries to provide signifi cant hits for annotati on. This would suggest that homology search alone is insufficient for cataloging a list of molecular markers for neurons in the Aplysia CNS. The fact that more than 24% of the classically secreted peptides were overlooked by homology searching suggests t hat the use of bioinformatic approaches is crucial to identify all putative SSMs. Alignment of the 87 predicted Lottia SSMs against the Aplysia CNS transcriptome reveal 73 homologous putative neurosecretory molecules in Aplysia ; 21 are predicted to be secr eted signaling molecules ( Object 22 ) 28 are likely to be involved in the secretory pathway though not necessarily signaling molecules, and 24 are of unknown function ( Object 23). Confirmation of Expression of Selected Neuronal Transcripts As expected, the Aplysia neuronal transcriptome expresses many secreted signaling molecules including classical neuropeptides, growth factors, and hormones. To ensure that SSMs found through transcriptome analysis are expressed, and to determine the full length seque nce of each SSM, 94 of the identified 194 SSMs have been cloned from Aplysia cDNAs (including those previously submitted to NCBI by other labs). For this work I have cloned 15 newly identified SSMs including six full length gene products and nine partial sequences ( sequence information can be found in Object 22 ).


29 Cross Species Analysis Using the analysis of predicted Lottia SSMs, a crossspecies transcriptome analysis of Pleurobranchaea californica, Clione limacina, Tritonia diomedea, Melibe leonina, Lymnaea stagnalis Octopus vulgaris, and Nautilus pompilius re vealed homologous predicted SSMs in all related molluscs ( Table 22). For each species, the percentage of all Lottia secretory proteins for which homologs exist varies across species ( Figure 25), suggesting different evolutionary rates between species. Species with more homologous proteins may be closer common ancestors to Lottia than those with few homologs. One precaution to such conclusions however, is that the number of transcripts in the EST collection for each species varies (i.e. 273,922 in Lymnaea vs. 10,209 in Melibe ) and fewer homologs may be present simply as a function of low coverage. My analysis also shows that classically and non classically secreted proteins evolve at different ra tes across species ( Figure 25). There is a consistently higher percentage of non classically secreted proteins than classically secreted proteins found in each species suggesting non classically secreted proteins are more highly conserved. Genomic Organ ization of Selected Neurosecretory Products Our preliminary comparison of predicted neurosecretory products across species revealed they are likely subject to great evolutionary divergence. To determine if variability in evolutionary divergence may be due to differences in the genomic organization, the intron/exon boundaries of selected neurosecretory products were analyzed using the recently released Aplysia genome, available on trace archives of NCBI. Most vertebrate genes are composed of seven to eight exons, however the number of intron/exon boundaries found in the selected neuropeptides from Aplysia is relatively small, an average of four exons ( Table 23). While there is some variation in the number of exons between selected neuropeptides (most have 3, 4 or 5 exons),


30 there does not appear to be any clear correlation between the number of exons and the conservation or divergence of the neuropeptide. ( Object 2 1). Conclusions This comparative approach allowed identification of both evolutionary conse rved neuronal genes products and numerous novel predicted secreted proteins including neuropeptides, prohormones and other predicted secretory products. Our results reveal that homologous searching of transcriptomes is the quickest way to identify functio nally relevant transcripts for neuronal processes. However, genomic approaches are more useful for identifying novel transcripts, though the computational resources and manual screening require significantly greater investment in time Part of the obsta cle to using genomic approaches is identifying functionally relevant transcripts that are likely to be expres sed at the protein level, and not merely represent untranscribed regions of the genome. To ensure that the predicted transcripts are likely to be transcribed, the sequences were screened against eight gastropod CNS transcriptomes; of 676 predicted signaling molecules, only 167 were expressed in two or more of the transcriptomes. This suggests that at least 167 of the transcripts predicted to encode a secreted signaling protein are expressed and are likely functionally important since they have been conserved across mollusc species. As an additional method to validate expression of predicted transcripts, 15 of the identified transcripts believed to encode signaling molecules were cloned from cDNAs created from isolated Aplysia californica CNSs It is likely that some of the remaining predicted transcripts may also be functionally relevant but not highly conserved across species. This is not surpr ising given that the comparison between Aplysia and Lottia neuropeptides reveals that those neuropeptides responsible for development regulation share highly conserved transcript sequences while those


31 responsible for regulation are more highly variable. T his may suggest one means for species specificity at the neuronal level. Using recently released genomic data from Aplysia californica the intron/exon boundaries of neuropeptides were analyzed to determine if sequence conservation and variability was due to the genomic arrangement of these genes. Preliminary analysis of 5 conserved, divergent and moderately conserved neuropeptides does not reveal any clear differences between the genomic organization of each type of neuropeptide. Perhaps the most important finding is the large number of sequences with shared identity found in both Aplysia and Lottia These sequences represent a portion of the Aplysia secretome that has been effectively predicted without having to perform expensive genomic sequencing or repeat the computationally expensive process of secretome prediction. This is a major step in bringing genomic scale proteomics to a species without a sequenced genome. Methods and Materials Animals and Tissue Collections Specimens of Aplysia californi ca weighing 150280 g were collected in the wild by Marinus Scientific (Long Beach, CA). S pecimens of Pleurobranchaea californica, Clione limacina, Tritonia diomedea, Melibe leonina, and Lymnaea stagnalis were obtained from the Friday Harbor Labs, Univers ity of Washington. Octopus vulagris was obtained from Italy and Nautilus pompilius from the Phillipines. Prior to dissection of gastropods animals were anesthetized by injecting a volume of isotonic MgCl2 (337mM) equivalent to 50% 60% of their weight. Disse c tion of Cepholopods and Gastropod Mollusca was performed by Dr. Moroz. Total RNA from whole CNS was extracted using RNAqueousTM (Ambion, Austin, TX) kit. RNA isolation was performed by Dr. A Kohn, Jinnie Sloan, and Yelena Bobkova. Before further p rocessing of the RNA, quality was checked using a 2100 BioanalyzerTM (Agilent Technologies). Small aliquots of extracted RNA were loaded on a 6000 Nano Lab chip that


32 produces an electropherogram image along with a gel like image of the sample representing peak ratios of the 28s/18s RNA contained in the sample. Additionally RNA concentration was measured spectrophotometrically by using the GeneSpec III systemTM454 Library Construction (Mirai Bio). Library construction was completed by Dr. Kohn and Jinnie Sloan. The protocol for transcription analysis was developed by Drs. A Kohn, Y. Panhin and L. Moroz. 3' end amplified cDNA library construction for 454 sequencing: This technique targets the 3' end of the transcripts being expressed. Amplified cDNA wa s generated using the Marathon cDNA amplification kit (Cat # 634913, BD Biosciences, Clontech, Mountain View CA). The first strand synthesis utilized the AMV Reverse Transcriptase and an oligo(dT) primer, Trsa (Matz, 2002) After second strand synthesis and clean up following the Marathon kit protocol, the entire sample of cDNA was fractionated by digestion with 20 units of Alu 1 and NEBbuff er 2 (Cat # RO137S0, New England BioLabs, Ipswich, MA) for 1 hour at 37C. The enzyme was heat inactivated at 65C for 20 min. The double stranded adaptor was made with A adaptors then added to the ligation mixture at a final concentration of 1 M along with the digested cDNA, 2 Units T4 DNA ligase and 5 x ligase buffer (Cat # 634913, BD Biosciences, Clontech, Mountain View CA). The ligation was performed at 16C overnight. The cDNA was purified using DNAclear (Cat#1756, Ambion Inc, Austin, TX) and elut ed in 16 l of RNAase free water. A mplification of the cDNA was performed using 16 l of the purified cDNA, Advantage 2 buffer, dNTP and taq polymerase (Cat # 639201, BD Biosciences, Clontech, Mountain View CA). The primers A pcr B pcr added to the ampli fication were at a final concentration of 0.05 M with B adaptor at a final concentration of 0.01 M. This full length B adaptor was modified to complement with the Trsa primer along with the B adaptor on the beads and was added to ensure the eventual att achment of the cDNA on the beads. The PCR


33 amplification protocol consisted of two cycles of 95C for 30 sec, 50C for 30 sec, 72C for 1 min, followed by 15 cycles of 95C for 30 sec, 65C for 30 sec, 72C for 1 min. Half of this PCR product was used for asymmetrical PCR to generate single strand cDNA. An excess of 10 times A pcr primer final concentration of 0.5 M was added along with 6 more cycles of 95C for 30 sec, 65C for 30 sec, 72C for 1 min performed. Controls were performed in which the ori ginal PCR product was diluted 1:50 and 1 l used in a total volume of 20 l. Only either A pcr primer or only B pcr primer were added at a final concentration 0.05 uM and 15 cylces of of 95C for 30 sec, 65C for 30 sec, 72C for 1 min were performed. Thi s was to ensure that the PCR suppressive effect was occurring. The ssDNA was measured for size and concentration then processed for bead attachment. This shotgun library was sequenced with GS Sequencing Kit (70x75) (Cat # 04 853 342 001 Roche Applied Sci ence). 5' end target amplified cDNA library construction for 454 sequencing: This technique targets the 5' end of the transcripts being expressed and is very similar to the previous protocol with a few minor revisions. Copied cDNA, first strand synthesis and second strand synthesis were generated same as described. After second strand synthesis and clean up following the Marathon kit protocol, the entire sample of cDNA was ligated with the double stranded A adaptors at a final c oncentration of 1 M along with 2 units T4 DNA ligase and 5 x ligase buffer (Cat # 634913, BD Biosciences, Clontech, Mountain View CA). The ligation was performed at 16C overnight. This cDNA was fractionated by digestion with 20 units of Alu 1 and NEBbuffer 2 (Cat # RO137S0, New England BioLabs, Ipswich, MA) for 1 hour at 37C. The enzyme was heat inactivated at 65C for 20 min. The cDNA was purified using DNAclear (Cat#1756, Ambion Inc, Austin, TX) and eluted in 16 l of RNAase free water. A second double stranded adaptor was made with B adaptors added at a final concentration of 1 M along with the digested cDNA, 2 Units T4 DNA ligase and 5 x ligase buffer (Cat # 634913,


34 BD Biosciences, Clontech, Mountain View CA). This ligation was performed at 16C overnight. Again the cD NA was purified using DNAclear (Cat#1756, Ambion Inc, Austin, TX) and eluted in 16 l of RNAase free water. Amplification of the cDNA was performed using 16 l of the purified cDNA, Advantage 2 buffer, dNTP and taq polymerase (Cat # 639201, BD Biosciences, Clontech, Mountain View CA). The primers added to the amplification were at a final concentration of 0.05 M and the sequences were A pcr and B pcr. The PCR amplification protocol consisted of 17 cycles of 95C for 30 sec, 65C for 30 sec, 72C for 1 mi n. Preparation and sequencing of the Amplicon product used the GS emPCR Kit II (Amplicon A and Paired End) (Cat # 04 891 384 001 Roche Applied Science) GS Sequencing Kit (70x75) (Cat # 04 853 342 001 Roche Applied Science) Primers for 3 and 5 libraries are listed in Table 2 4. Cloning of selected Signaling Molecules Amplified cDNA libraries were constructed from the CNS of Aplysia californica, as described elsewhere (Matz, 2002; Moroz et al., 2006) Full length c DNA sequences for six sequences and the partial sequence of an additional nin e sequences were obtained. The full length copy of coding sequences were amplified from appropriate CNS cDNA libraries and cloned into pCR 4 TOPO (Invitrogen). For each sequence three clones were isolated and sequenced by SeqWright (Houston, Hypothetical protein 2 TX). The full length sequence for Hypothetical protein 2 was identified based on BLAST results against the National Center for Biotechnology Information (NCBI) as Apl ysia californica hypothetical protein previously cloned (Cummins et al., 2004) (Genebank accession number AAN83922). Using terminal primers 5 CTCTGAACCGTCGCGAACTGTGT 3 and 5 -


35 AGGCAACAGTGGAATCGAAGCTCTC 3, our lab cloned the full length sequence of Hypothetical protein 2, resulting in a 788 bp fragmen t. LFRFamide precursor The full length sequence and clone for LFRFamide was obtained (Genebank accession number EU886298) using terminal primers 5 GGCCTCAGTTCGAAACCTCG 3 and 5 ATTGGTCACCCTGTCCTCGG 3. The resulting cDNA fragment was 1074 bp. Myomodul in like Neuropeptide Precursor 3 The full length sequence and clone for Myomodulin like Neuropeptide Precursor 3 was obtained (Genebank accession number EU934739) using terminal primers 5 CCTGAGTCCAGCCTAAGCGGTAAGT 3 and 5 GTACTGTGTAGGACGTAGGAAGCAG 3. The resulting cDNA fragment was 1690 bp. Conopressin The full length sequence and clone for Conopressin was obtained (Genebank accession number FJ172359) using terminal primers 5 CCAACTACAGGATGTCTCACTC 3 and 5 GACGTTGAGTGGACACTGTGA 3. The resulting cDNA fragment was 1983 bp. Ependymin related protein 2 The full length sequence and clone for Ependymin related protein 2 was obtained (not submitted) using terminal primers 5 CTGGTATCAGAGCCACTCACCTC 3 and 5 TGGTTGAATGTATACGTGCATGTAC 3. The resulting cDNA fragment was 873 bp. Be tsin The full length sequence and clone for Betsin was obtained (not submitted) using terminal primers 5 GTAACTTTCGTCCCTCCTGCCA 3 and 5 CTTCTACTTGACCCACTCGGACC 3. The resulting cDNA fragment was 538 bp.


36 Feeding circuit ac tivating petide precursor 3 (FCAP 3) The partial sequence and clone for FCAP 3 was obtained (not submitted) using terminal primers 5 AACAGGCGCAGGCTCAGA3 and 5 ACACGTGGATCGCCGCCGCC 3. The resulting cDNA fragment was 367 bp. SN4 The partial sequence a nd clone for SN4 was obtained (not submitted) using terminal primers 5 ATGCAGTGAGGGATGCTGTGT 3 and 5 GGTCAAGGCCAATTTCCCGTG 3. The resulting cDNA fragment was 755 bp. SFY1 like peptide The partial sequence and clone for SFY1 like peptide was obtained (not submitted) using terminal primers 5 -GTGGAAGTACGCAGAGAGG3 and 5 -CATCCCTCTTGTAGAAGCTGGA3. The resulting cDNA fragment was 1198 bp. SFY3 like peptide The partial sequence and clone for SFY3 like peptide was obtained (not submitted) using terminal primers 5 -GTATCAAGACCGACGACCATG3 and 5 -GTGAGCTCATCCCGCGGTTG3. The resulting cDNA fragment was 729 bp. FIRFamide related neuropeptide precursor The partial sequence and clone for FIRFamide related neuropeptides precursor was obtained (not submitted) using terminal primers 5 CGTCATCGCTGGTGCTGTCAC3 and 5 -CCTCGACAAGGCTTCTCCTTCACC3. The resulting cDNA fragment was 2032 bp. Major royal jelly protein (MRJ) The partial sequence and clone for MRJ protein was obtained (not submitted) using terminal primers 5 CGGAAGTCCGGTACGCGTATATTTC 3 and 5 CTTTCAGAAGGCTATTCCTCCCACC 3. The resulting cDNA fragment was 774 bp.


37 FMRFamide 5 The partial sequence and clone for FMRFamide 5 was obtained (not submitted) using terminal primers 5GGTGGATCAAGCCTTGGAGCT3 and 5CACTCAGGTTATTCAACACGTCAAC3. The resulting cDNA fragment was 698 bp. Allatotropin OR precursor The partial sequence and clone for Allatotropin OR precursor was obtained (not submitted) using terminal primers 5 -CAAGTGGTGATTCGGCCGC3 and 5GTCAAT ATAGTTCCCTCTCGTGG3. The resulting cDNA fragment was 746 bp. Second The partial sequence and clone for Second was obtained (not submitted) using terminal primers 5 -GCTAATGAGCGATTTCTGCGAG3 and 5 -CGTCCTTCTCCGAAAGGCCTAAGCC3. The resulting cDNA fragme nt was 712 bp. Neurosecretory Predictions Preditions were performed by Jinnie Sloan, Mathew Citarella, Drs. A. Kohn and L. Moroz. Software scripts were written by M. Citarella. Homology search using unbiased shotgun approach A cross species master list o f secreted signaling molecules submitted to NCBI was created by manual word search. Search terms included any combination of the following words: signal, peptide, growth factor, hormone, and neuropeptide. Any results containing the word receptor were e liminated. All sequences submitted to PeptideDB (, May 2009) a public resource for bioactive peptides that includes cytokines and growth factors, peptide hormones, antimicrobial peptides, toxins and venom peptides, and antifreeze proteins were manually


38 downloaded and added to the above results in FASTA file format. All redundant sequences were removed and the master list was aligned with cDNA ESTs from Aplysia as described below. To ensure that all results represent SSMs, all Aplysia ho mologs were screened using SMART (Schultz et al., 1998) and any sequences with a transmembrane domains or enzyme protein family domains were removed. Genomic approach To facilitate prediction of the Lottia secretome, 23 ,851 full length protein sequences were downloaded from the Joint Genome Institute (JGI) website (, May 2009) These sequences represent the best filtered protein coding gene models as determined by JGIs genomic assembly. The latest relea se of NCBIs non redundant protein database, NR, was downloaded to provide annotation for any predicted secretory products. NR contains protein sequence entries from the following databases: GenPept, Swissprot, PIR, PDF, PDB, and NCBI RefSeq. Classical S ecretory Prediction* The original data set of 23,851 full length protein sequences from the Lottia genome was analyzed with TargetP 1.1. Batches of 1000 sequences were fed to TargetP via a custom wrapper script ( Citarella, M.R. unpublished), written in Pe rl using the short output option for TargetP. Sequences were considered to be targeted to the secretory pathway if they had a SP (secretory pathway) score > .80. All other sequences were discarded from the prediction. The selected sequences were then analyzed with SignalP 3.0 for the presence of a signal sequence using both Neural Network and Hidden Mark Model methods and the short and nographics output options. Proteins were determined to have a signal sequence if SignalP returned a Y for four out of the five scores for the Neural Network method and the Hidden Markov Model method predicted that it contained a signal peptide. Transmembrane domains were then


39 predicted using TMHMM 2.0c4Non classical Secretory peptide Prediction* using the default settings. Only sequences with no predicte d transmembrane domains or one transmembrane domain and more than four residues of that domain in the first 60 amin o acids were considered further (these proteins are retained since a single predicted transmbrane domain in the first 60 amino acids of a pro tein may be a signal sequence falsely identified as a trans membrane domain). These proteins were analyzed with the web version of Phobius using the short option. Proteins with no predicted transmembrane domains and a confirmed signal sequence were sele cted as the final predicted classically secreted proteins. 14,595 full length protein sequences that were localized to other with a score > .75 by Ta rgetP during classical secretory peptide prediction were ana lyzed with the web version of SecretomeP 2.0 in sets of 100 with the mammalian option checked. Sequences were determined to be secreted via a non classical pathway if their NN score exceeded .75 and there was no predicted signal peptide by SignalP. Unless otherwise noted, the above predictions were all performed with the standalone version of the software package mentioned on an Intel Pentium 4 with 1GB RAM running Ubuntu Linux 8.04. Cross Species Analysis of Predicted Proteins All homology searches including the final set of classically and non classically secreted proteins from Lottia were aligned with cDNA Expressed Sequence Tags (ESTs) from Aplysia californica CNS using NCBIs standalone BLAST package. The following options were set program: bl astp, e value: 1e 04, processors: 3, wordsize: default(3). The results of each BLAST were parsed with a custom Perl script, For each predicted secretory protein, a homolog was said to be found in a species if there was a BLAST hit for t hat species with an e -


40 value less than or equal to 1e 04. Furthermore, a single sequence from a given species could be reported as a homolog for at most one Lottia secretory protein. Annotation of Predicted Proteins To annotate the list of predicted secre tory proteins in Lottia the latest release of NCBIs NR database was downloaded and each predicted protein was BLASTed against it using NBCIs standalone package set for blastp with default settings. Annotation for a given predicted protein was determine d as the identifier of the sequence from the NR database with the lowest e value hit to the predicted protein, so long as the e value was less than or equal to 1e 04.


41 Figure 21. Summary of model organism and number of ESTs/cDNA s collected. More than 980,000 ESTs/cDNAs were collected from the CNS of five key model species ( Pleurobranchaea californica, Clione limacina, Tritonia diomedea, Melibe leonina, and Lymnaea stagnalis ). Here, the number of ESTs for each species is shown under their name Nudibranchia Melibe leonina Tritonia diomedea Aplysia californica Cl ione limacina Gastropoda Lymnaea stagnalis Lottia gigantea Pleurobranchaea californica Acanthopleura spinosa (259,277) (131,851) (115,599) (10,809) (273,922) (220,000/2,392,545) (188,590) Melibe leonina (259,277) (131,851) (115,599) (10,809) (273,922) (220,000/2,392,545) (188,590) Melibe leonina (259,277) (131,851) (115,599) (10,809) (273,922) (220,000/2,392,545) (188,590) Melibe leonina (259,277) (131,851) (115,599) (10,809) (273,922) (220,000/2,392,545) (188,590) Opisthobranchia Polyplacophore Pulmonata Prosobranchia


42 1.00E-116 1.00E-107 1.00E-98 1.00E-89 1.00E-80 1.00E-71 1.00E-62 1.00E-53 1.00E-44 1.00E-35 1.00E-26 1.00E-17 1.00E-08 1.00E+01 Dorsal -ventral Buccalin Pedal peptide 1 Conopressin Ependymin Temptin Prothoracicostatic Myomodulin Pleurin Whitnin Intersectin -2 insulin PTSP-like Neuropeptide Y SN 4 Enterin Tolloid 2 Orcokinin Venom protein 2 FMRFamide Fulicin-like MIP-related Neurotoxin -1 LFRFamide Neuronal Transcript Figure 22. Analysis of Evolutionary Dynamics of Neuronal Transcripts. Preliminary analysis suggests that some neuropeptides may be fast evolving molecules. The sequence conservation between Aplysia and Lottia reveals that proteins involved in development (i.e. Dorsal ventral patterning) have the highest sequence similarity (indicated by a high e value from sequence alignments), while neuropeptides involved in regulatory mechanisms (i.e. FMRFamide) have t he most variability. These likely reflect differences in biological constraints between these two neuronal processes. The fast evolutionary divergence of some neuronal genes may account for the large amount of unannotated sequences from the neuronal tran scriptome of Aplysia (insert). E value Aplysia californica 203,440 transcripts 43,672 annotated 159,768 unannotated


43 FMRFamide Internal Repeats Intrinsic Disorder Signal Peptide Figure 23. Conserved Signaling Molecule Motif. Example of the conserved motifs of secreted signaling molecules (here the neuropeptide FMRFamide is shown). Secreted signaling molecules are targeted to the secretory pat hway by their signal peptides, and often are characterized by intrinsic disorder, internal repeats, and cysteine rich regions. They are differentiated from proteins encoding receptors by a lack of transmembrane regions.


44 Figure 24. Workflow for Com putational Prediction of SSMs. The filtered gene models for Lottia gigantea were downloaded from JGI. After filtering the original 23,851 predicted proteins through four protein prediction software programs, 859 proteins were predicted to be classically secreted signal molecules. That is, contained signal sequences, no transmembrane domains, and were targeted for secretion outside the cell. Using BLAST alignments, 400 classically secreted homologs were identified in Aplysia ETSs.


45 Table 2 1. Annotation of Lottia predicted secretory products against NCBIs NR database. The results of the annotation show the ~24% of the classically predicted secreted peptides cannot be mapped to a biological function due to poor annotation. This could be a product of th e evolutionary distance between Lottia and other commonly sequenced organisms. If the species represented by the sequences in NR are divergent enough from Lottia the predicted proteins will not be similar enough to the database entries to provide signifi cant hits for annotation. Data Set Number Annotated Number Unannotated Percent w ith Predicted in Annotation Percent w ith Hypothetical in Annotation Percent of Peptides with unknown or ambiguous functions Classically Secreted Peptides 83 1 4 46.53 % 5.94 % ~ 24%


46 Table 2 2. Summary of Cross Species Predictions. Results of c ross species predictions using homology search against nonbiased shotgun transcriptomes and homology search against our Lottia genomic predictions. Results show th at more predicted neurosecretory products are found using the genomic approach perhaps suggesting a genomic approach as a more robust form of predicted signaling molecules in gastropod molluscs. It is unclear whether differences across species represents sequence divergence from the model organism used ( Lottia ) or is simply an artifact of different levels of coverage of the sequencing for each species. Species Shotgun Genomic Object Aplysia californica 90 74 2 1 to 2 3 Lottia gigantea 75 87 2 4 to 2 5 Lymnaea stagnalis 66 48 2 6 Pleurobranchaea californica 45 42 2 7 Tritonia diomedea 37 28 2 8 Mel ibe leonina 18 14 2 9 Clione limacina 9 2 10 Octopus vulgaris 31 2 11 Nautilus pompilius 44 2 12


47 Figure 25. Comparative analysis of predicted Lottia secretory products. Th e percentage of all predicted Lottia secretory proteins for which homologs were found in each species. While some variation in expression of homologous sequences may be due to the number of ESTs collected, it may also provide insight to the evolutionary d istance between species. These data suggests SSMs between Lottia and Aplysia are the most conserved, followed by Lymnaea and Pleurobranchaea. Furthermore, classically and non classically secreted proteins appear to evolve at different rates across specie s with non classically secreted peptides being more highly conserved. Aplys ia Clione Lymnaea Melibe Pleurobranchaea Tritonia


48 Table 2 3. Genomic organization of neurosecretory g enes. Preliminary analysis of the genomic organization of selected neurosecretory products shows that all genes have a similar in tron/exon organization, with an average of 3 5 exons. (See Supplemental A for detailed information.) Neuropeptide Number Introns Number Exons Atrial gland specific antigen prec ursor 9 10 Feeding circuit activating peptide precursor 1 2 FMRFamide neuropeptide precursor 2 3 L11 neuropeptide precursor 2 3 Buccalin precursor 3 4 Conopressin 3 4 Fulicin like neuropeptide precursor 4 5 MIP related peptide precursor 4 5 Neu rotoxin like 1 3 4 Pleurin 2 3 Whitnin precursor 2 3


49 Table 2 4. Adaptors and Primers for 5 and 3 454 libraries Primer Name P rimer sequence Trsa 5' CGCAGTCGGTAC (T) 13 3' 3 bias library A Adaptor 5' CCATCTCATCCCTGCGTGTCCCATCTGTTCCCTCCCTGTCTCAG 3' and 5' CTGAGACAGGA 3' A pcr 5' CCATCTCATCCCTGCGTGTC 3' B pcr 5' CCTATCCCCTGTGTGCCTTG 3' B adaptor,Trsa 5' CCTATCCCCTGTGTGCCTT GCCTATCCCCGCAGTCGGTACTTTT 3'). 5 bias library A Adaptor 5' GCCTCCCTCGCGCCATCAG 3' and 5' CCTGATGGCGCGAGGG 3' B Adaptor 5' GCCTTGCCAGCCCGCTCAG 3' and 5' CTGAGCGGGCTGGCA 3' A pcr 5' GCCTCCCTCGCGCCATCAG 3' B pcr 5' GCCTTGCCAGCCCGCTCAG 3'


50 CHAPTER 3 MAPPING EXPRESSION O F NEUROPEPTIDE TRANS CRIPTS Introduction One major fun ction of n europeptides in both vertebrates a nd invertebrates is to act as extracellular chemical messengers to modulate the communication between neurons of the central and peripheral nervous systems (Kaldany et al., 1985; Strand, 1999) Physiological studies in Aplysia californica have demonstrated peptidergic modulation plays a crucial role in the initiation of several behaviors including feeding, egg laying, and cardioregulation (Campanelli and Scheller, 1987; Scheller et al., 1983; Sossin et al., 1987; Sweedler et al., 2002) Several families of neuropeptides are expressed in molluscs (Fujiwara Sakata and Kobayashi, 1992; Price and Greenberg, 1977; Smit et al., 1991) as well as individual neuropeptides, (Banvolgyi et al., 2000; Kuroki et al., 1990; Smit et al., 1992) To support the identification of putative signaling molecules identified in the first chapter of this thesis, in situ hybridization was performed for a select number of signaling molecules to test for expression of the RNA transcript. Here, the expression of two putative neuropeptides MIP and Fulicin, is described for the CNS of Aplysia. Mytilus Inhibitory Peptides One set of identified neuropeptides in Aplysia belongs to the Mytilus inhibitory peptides (MIPs) family (Fujisawa et al., 1999) Originally isolated from t he pedal ganglia of the bivalve Mytilus edulis (Hirata et al., 1987) MIPs can inhibit tar get muscles and hyperpolarize central neurons (Kiss and Osipenko, 1997; Kissler et al., 1997; Yongsiri et al., 1989) A plysia MIP related peptides (AMRPs) are expressed in the CNS and peripheral tissues including t he digestive tract, vasculature and reproductive organs where they have a dose dependent inhibitory action on target tissues (Fujisawa et al., 1999; Hirata et al., 1987)


51 Fulicin Previously unidentified in Aply sia, Fulicin was initially isolated from the African giant snail Achatina fulica (Ohta et al., 1991) In Achatina Fulicin has been shown to regulate female egg laying behavior, potentiate tetanic contraction of the peni s retractor muscle and modulate actions of the ganglionic neurons as well as buccal and ventricular muscles (Fujisawa et al., 2000; Ohta et al., 1991) Fulicin was shown to share the C terminal portion Phe Val NH2 with Mytilus inhibitory peptides (MIPs), and both peptides depress the phasic contraction of the ABRM muscle in Mytilus edulis (Hirata et al., 1988; Kim et al., 1991) However, Fulicin was shown to be 10,000 t imes less potent than MIPs, presumably due to the lack of Pro residue required for inhibitory activity of MIPs (Kim e t al., 1991) This chapter focuses on the mapping of these two neuropeptides exclusively to provide further insight into possible explanations for the shared C terminal region of these two protein precursor. Here we cloned, localized, and show predicted gene products of an Aplysia Fulicin related peptide (AFRP) Using two color in situ hybridization (Jezzini et al., 2006) we show co localized expression of MIP and Fulicin transcripts in the CNS of Aplysia Fina lly, we postulate that the shared region of MIP and Fulicin, TxFrag2, is a regulatory genomic element that provides a molecular mechanism to regulate expression of two ne uropeptides in a single neuron. Results Cloning of Aplysia Fulicin precursor mRNA As d escribed in Chapter 1 of this work, a putative neuropeptide Fulicin was identified during annotation of transcripts generated fr om unbiased shotgun sequencing. The identified Aplysia Fulicin like transcript was cloned resulting in a full length sequence w ith a 1059 base pair open reading frame coding for a 352 amino acid precursor ( Figure 3 1A ).


52 The predicted Fulicin precursor protein contains a hydrophobic signal peptide and a cleavage site between Asp and Thr, which suggests this protein is targeted to the secretory pathway. Analysis of monobasic, dibasic and tribasic cleavage sites suggest that there are 13 copies of 10 different predicted amidated peptides processed from the Fulicin precursor ( Figure 31B ). Localization of Fulicin in the CNS of Aply sia Since Fulicin has not been localized to the CNS of Aplysia we first wanted to map expression of Fulicin using in situ hybridization. The Fulicin transcript showed neuron specific expression with the most intense staining in specific neurons of the abd ominal and pleural ganglia ( Figure 3 2). Interestingly, Fulicin clearly labels the L7 motor neuron in addition to other motor neurons critical to the function of the gill and siphon withdraw circuit. Expression is localized in the LP1 neur on of the pleur al ganglia, and small subsets of neurons in the cerebral, pedal and buccal ganglia, suggesting that Fulicin expression is not ubiquitous It was noted that many of the neurons positive for Fulicin expression are the same neurons known to express MIP, sugg esting that besides sequence similarity, the expression of these two neuropeptides may also be similar. Co localization of MIP and Fulicin To further investigate the possible co expression of MIP and Fulicin in the CNS of Aplysia, co localization was perfo rmed using two color in situ hybridization ( Figure 3 3). Using two color in situ hybridization labeling with specific probes we found that MIP and Fulicin were exclusively co expressed. During the staining protocol it became apparent that some cells do s tain with different intensities, suggesting that the expression level of these peptides may not be uniform in positively labeled cells, but rather expression levels are neuron specific.


53 Isolation of Fulicin in the CNS of Aplysia 454 sequencing revealed higher expression of transcripts aligning to the coding regions of the MIP gene than real time PCR (RT PCR) experiments ( Table 31). We found that MIP showed strong sequence similarity to another gene, Fulicin, in its 5 region ( Figure 34) as supported b y previous work in Mytilus edulis showing MIP and Fulicin have a structurally similar C terminal region (Hirata et al., 1988; Kim et al., 1991) MIP and Fulicin share 5 UTR and coding region We postulate that the s hared 5 untranslated region may serve as a molecular mechanism underlying the observed colocalization of these two neuropeptides. To understand the functional role of this shared region, we extended the sequence of the coding region into the 5 UTR of e ach of these genes to check if the shared sequence continued upstream of the protein start site. Using 5 RACE, we extended the non coding region of both Fulicin and MIP to reveal a 480 nt region, called TxFrag 2, that includes the 5 UTR and the 21 amino acid signal peptide of MIP and Fulicin ( Figure 31A, blue and Figure 35). TxFrag2: Structure and Function Alignment of TxFrag2 to genomic data available on NCBI reveals that the 480 nt region is transcribed from four defined fragments of DNA separated b y three intergenic splice sites, characteristic of transgenic noncoding RNA. The fourth defined fragment contains the signal sequence shared by both MIP and Fulicin. At the end of the signal sequence there is a splice site in both MIP and Fulicin, the st art of Exon 2 marks the beginning of the uniq ue coding region of both genes. Previous work mapping short noncoding RNAs (sRNAs) indicates sRNAs cluster at the 5 and 3 of genes. Similar to these results, Transfrag2 is located at the 5 of MIP and Fulicin Like


54 other intergenic sRNAs (IRNAs), TxFrag2 includes the 5 boundary of the protein coding gene but excludes most of the other exons of the coding region. Previous work on IRNAs suggests they are involved in regulation of gene expression (Davis et al., 2006; Martianov et al., 2007) These studies suggest that IRNA transfrags serve as precursors to functional sRNAs via sense and antisense transcription of the IRNA (Kaprano v et al., 2007) To see if TxFrag2 is transcribed in the sense or antisense direction, 454 and SOLiD transcripts that aligned to the 480 nt TxFrag2 region were counted and compared to the quantities of sense and antisense MIP and Fulicin ( Figure 35B ). This show ed that TxFrag 2 is transcribed in both the sense and antisense direction where as the coding region of MIP and Fulicin are made only in the sense direction. Discussion Colocalization of Fulicin and MIP This is a unique example of two neuropeptides showing exclusive co localization throughout the CNS of Aplysia After several in situ experiments, we have found that transcripts for both MIP and Fulicin consistently colocalize to specific neurons of the CNS of Aplysia, predominately those neurons i n the abdominal ganglia responsible for the gill and siphon withdraw. Analysis of the protein sequence of MIP and Fulicin reveal that structurally, they share a conserved C terminal. Further analysis of the nucleotide coding region of the sequences show s that this results from a conserved 5 UTR region that extends through the first exon of both genes. Preliminary analysis using recently released genomic information from Aplysia californica further supports that MIP and Fulicin share the same splice sites and exon regions covering the TxFrag2 region until after the signal sequence.


55 There is currently one additional publication indicating that the preproprotein of two neuropeptides, brandykinin and temporin in frog, share a conserved 5 UTR and signal sequence (Suzuki et al., 2007) In this paper the authors suggest that the sequence similarity may suggest a linked evolutionary history involving exon shuffling. TxFrag2: Modulator of Expression? With the comple tion of several genome projects, including the Human Genome Project, the once accepted view that of noncoding RNAs (ncRNAs) as junk is rapidly shifting to accept non protein coding transcripts are c rucial for cellular function. Recent reports suggest th at only 2% of the human genome codes for translated proteins (System, 2008) while nearly ha lf of the genome is transcribed and expressed as RNA without any messenger (mRNA), transfer (tRNA), or ribosomal (rRNA) functions (Szell et al., 2008) Understanding the role of these ncRNAs represents a new realm of understanding genomic data, and the accumulating data suggests ncRNAs may play a role in organism complexity, specificity, cell regulatory machinery, and regulation of these ncRNAs has been implicated in several human diseases (Szell et al., 2008) Work on the human genome has demonstrated that the transcriptome does not exist exclusively of protein coding transcripts but also regulatory genomic elements and non protein coding transcripts (Szell et al., 2008) This project, termed ENCODE (the Encylopedia of DNA Elements), along with unbiased tiling array data has identified a new set of transcripts (TxFrags) that are made from fragments of defined genomic regions. Cross species genome sequencing has shown that increasing biological complexity is correlated with increasing number of non protein coding DNA sequences (Taft et al., 2007) and suggests that differences between species may rely upon non coding genes ra ther than proteincoding genes (Pollard et al., 2006) While the function of TxFrag2 remains to be determin ed, expression of both sense and antisense transcripts suggest that it may serve in a regulator mechanism in these cells. It is our


56 hypothesis that TxFrag2 may function similar to miRNAs, regulating the expression of MIP and Fulicin by binding antisense t ranscripts to complementary upstream translation regions. However, the large size of TxFrag2, 480nt, compared to a normal miRNA, ~20nt, challenges any conclusions about the mechanism of TxFrag2 regulatio n. Overall, these data provide evidence for a possi ble molecular mechanism underlying how neurons can regulate expression of multiple neuropeptides within a single cell. Materials and Methods Animals Specimens of Aplysia californica weighing 150280 g were collected in the wild by Marinus Scientific (Lon g Beach, CA). Animals were anesthetized by injection of 50% (volume/body weight) isotonic MgCl2 (337 Cloning of full length cDNA encoding Fulicin m M ) prior to surgical removal of the central nervous system (CNS). Terminal primers were designed from two overlapping ESTs that shared high identity to mRNA for the F ulicin precursor in Achatina fulica (Genebank accession number D13986). A full length cDNA sequence called fulicin like neuropeptide pr ecursor (Genbank accession number AAW30458) was obtained using terminal primers: 5' CAATCAACCCGCAATGTGTACC 3' Sequence analysis and Alignments and 5' CTAAGAATCCGGGCACGACGC 3' from an amplified cDNA library. The amplified PCR product was 1064 bp. The initial multiple alignment was done using ClustalX ver. 1.83 (Jeanmougin et al., 1998; Thompson et al., 1997) with default parameters. All protein predictions were determined with Prosite (Gattiker et al., 2002) and SMART (Letunic et al., 2006)


57 In situ hybridization of Fulicin and MIP in Aplysia Full length cDNA from Fulicin and MIP was clone d and used for the preparation of in situ probes. For co localized expression studies, clones were made for Fulicin and MIP from unique regions starting after shared 5 UTR and signal sequence. The antisense probe was generated by digestion of cDNA from Fulcin and MIP with Not I (New England Biolabs), then transcription with T3 polymerase from the DIG (digoxigen) RNA labeling kit (Roche Diagnostics). The control sense probe was produced by the same protocol but used Pme1 (New England Biolabs) to digest t he cDNA and T7 polymerase for transcription. The DIG labeled antisense probes were hybridized in whole mount CNS preparations, and the neurons containing the probe target duplex were localized and visualized with alkaline phosphatase conjugated anti DIG a ntibody fragments (Boehriger Mannheim). The detailed in situ hybridization protocol has been described (Jezzini et al., 2005; Jezzini and Moroz, 2004; Walters et al., 2004) Expression of Fulicin was investigated in central ganglia of four experimental CNS preparations and two control experiments. Control in situ hybridization experiments with full length "sense" probes revealed no specific and selective staining in the CNS under identical conditions and labeling p rotocols for either probe. Co localization using two color in situ hybridization was performed as previously described (Jezzini et al., 2005) Briefly, unique regions of MIP a nd Fulicin were cloned and sequenced. Two probes were then made using different NTP labeling mixes. The MIP probe was made using fl uorescein 12UTPs and the Fulicin probe was DIG labeled. First the fluo rescein MIP probe was hybridized in whole mount CNS preparations, and the neurons containing the probe target duplex were localized and visualized with Fast Red substrate. After the first development is stopped, a second hybridization is preformed using the DIG Fulicin


58 probe and the neurons are localized and visualized with alkaline phosphatase conjugated anti DIG antibody fragments (Boehriger Mannheim). Imaging Images were captured with a Nikon Digital Sight DS 5M digital camera mounted on an upright Olympus SZX12 microscope. Figures were prepared using Adobe Photoshop.




60 Figure 32. Schematic overview of the distribution of Fulicin like transcript in the CNS of Aplysia Each circle represents a sing le cell showing staining for the Fulicin like transcript. Positions of identified cells MCC, R2, and LP1 are indicated, (viewed from caudal surface). Most significant staining was seen in the Abdominal and Pleural ganglia. Cerebrobuccal connective MCC B1 B2 B5 B6 B4 SC SC C1 C2 C3 C4 C5 E Cluster E Cluster B Clus ter A Cluster Pleuroabdominal connectives Pec Pleuroabdominal connectives R3 R13 R2 A6 A5 A4 A2 BC BC LP1 Cerebropedal connective Cerebropleural connective P5 P6 P7 P9 P8 P5 P4 P6 P9 P8 Cerebrobuccal connective MCC B1 B2 B5 B6 B4 SC SC C1 C2 C3 C4 C5 E Cluster E Cluster B Cluster A Cluste r Pleuroabdominal connectives Pec Pleuroabdominal connectives R3 R13 R2 A6 A5 A4 A2 BC BC LP1 Cerebropedal connective Cerebropleural connective P5 P6 P7 P9 P8 P5 P4 P6 P9 P8 Pleural ganglia Abdominal ganglia


61 Figure 33. Colocalized expression of MIP and Fulicin transcripts. MIP specific staining shown in red, Fulicin specific staining shown in blue. A ) and B ) the gradual co localized development of Fulicin and MIP in the A bdominal ganglia. C ) Cells in the Pleural ganglia, including LP1 show co localized expression. A B C


62 Table 3 1. Comparison of Real Time PCR of Aplysia MIP related gene and 454 sequencing. Comparison of 454 sequence frequency to RT PCR reveal significantly higher levels of expression of the MIP gene, suggesting that another gene may be expressed that has sequence similarity to MIP. Transcript Copy Number (Average) 5Reads 5Frequency (1,010,896 total) 3Reads 3Frequency (468,723 total) MIP (coding AF454399.1) 2.12E+05 9295 9.19E -03 170 3.63E -04


63 Signal Sequence Figure 34. Alignment of the coding region of Aplysia MIP like protein against the identified Aplysia Fulicin lik e protein B oth share complete identity at their 5 ends, including the signal sequence. It is also noted that the transcripts share repetitive regions at their 3 ends.


64 A B Figure 35. Intergenic splicing and expression of TxFrag 2. A ) TxFrag2 is composed of 3 intergenic splice sites and 1 intron/exon boundary that is conserved in both MIP and Fulicin. B ) Transcriptional profile showing t he number of sequences in our 454 library that align to the unique region of TxFrag2, MIP and Fulicin in the sense and antisense direction. TxFrag2 is present mostly in the antisense direction, suggesting it may function in a regulatory mechanism. 454 Counts (1,500,000 total) Sense Antisense TxFrag2 6 50 MIP 9,810 325 Fulicin 1 0


65 CHAPTER 4 GENE EXPRESSION PROF ILING FOR INDIVIDUAL NEURONS Introduction T he primary motivations for the identification of putative neurosecretory products as described here was to identify neuron specific signaling molecules that may be responsible for neuronal identity, communication and plasticity. While other labs have created comprehensive lists of putative secreted signaling molecules in other models, the complexity of the brain systems in these models has presented a challenge to identifying neuron specific neurosecretory products. Our lab has combined high throughput sequencing with the large an d easily identifiable neurons of Aplysia californica, to determine what signaling molecules are expressed in individual identified neurons. Advantages of Aplysia In order to perform gene expression profiling of a single neuronal typ e, a homogenous sample of RNA mu st be isolated from an individual neuron. In many model systems this would be difficult if not impossible due to the complexity of the brain tissue, the inability to identify and isolate single neurons and the small size of the cells However, the large and identifiable neurons of Aplysia offer a means of accomplishing this goal. The gill and siphon withdraw of Aplysia represents a simple and quantifiable behavior with a well defined network of neurons. The cellular circuitry that drives th is behavior can be simplified to two neurons of the abdominal ganglia, a sensory ce ll (SN) and a motor neuron (L7) Due to the location of these cells, a semi intact preparation can be used to confirm the identity of these cells using electrophysiology ( F igure 4 1). By using this type of arrangement our lab has identified individual motor, sensory and interneuron cells that can be used to provide insight into the expression of transcripts in a single neuron type


66 In addition to providing the ability to identify and isolate individual neurons, the giant polyploidy neurons of Aplysia contain vast amounts of genetic material with a chromosome copy number up to 100,000n (Gillette, 1991) and RNA content estimated at up to 0.2 g in some cases This makes Aplysia an attractive model for gene expression profiling as large amounts of RNA can be made readily available for sequencing. Limitations of Sequencing Technology Over the last several decades, our understanding and application of high and low throughput methods to study gene expression has continued to grow. Each method has different sensitivities as well as advantages and disadvantages due to basic technological constraints and the absolute number of each mRNA molecule to be measured. One major obstacle to using highthroughput sequencing to measure gene e xpression is the amount of data generated by this method. For research scientists, the complexity of the transcriptome becomes overwhelming, if not impossible, to understand without the use of bioinformatics approaches. As the sequencing technology contin ues to grow, and EST coverage begins to reach genomic scales, many researchers are faced with a daunting task of sifting through generated data to find transcripts with function relevant to their research aims. To address this problem, our lab has devised a method for quantifying transcript expression and abundance, in a user friendly output, to create a digital expression profile (DEP) for each transcript. We have applied this method to individual neurons in the memory forming network of Aplysia to dete rmine what transcripts are relevant for the function and maintenance of specific cell types, including motor neurons (MN) L7 and R2, sensory neurons (SN) and MCC interneurons. Here, we applied the method to a selected list of transcripts previously pred icted by our lab to encode secreted signaling molecules to quickly screen hundreds of transcripts from individual


67 cells involved in learning and memory in Aplysia. This method will be particularly useful for studying model systems that are lacking in geno mic information Results and Discussion F rom the DEP, preliminary analyse s of selected transcripts encoding secreted signaling molecules could be easily screened to determine differential expr ession in specific neuron types (i.e. motor (L7), sensory (SN clu ster) and interneurons (MCC)). It also allows us to identify abundant transcripts for each neuron type as indicated below. Sensory Neurons The digital expression profile using neurosecretory products predicted by traditional cloning for sensory neurons s upports previous work indicating robust expression of Sensorin A in sensory neurons (Cai et al., 2008) ( Figure 4 2). As expected from previous publications, Sensorin A appears to be the most abundant transcript encoding a secreted signaling molecule in the sens ory cell. In addition to Sensorin A, DEP indicates a low expression of other neurosecretory transcripts determined by traditional cloning including Prothoraracicostatic peptide like protein (PTSP) and Capsulin ( Figure 4 2) Further profiling using SSMs identified here ( Figure 4 3) suggests that sensory cells of the gill and siphon withdraw response may also express low levels of the predicted SSMs LFRFamide p recursor and SFY3 like peptide. DEP also suggests expression of predicted 7B2 secretory granule neuroendocrine protein which is unlikely to a secreted signaling molecule but may be involved in the processing of neuropeptides. Screening of the SSMs predicted from the Lottia genome shows low expression of heatshock, and an unknown protein product ( Fi gure 4 4). Motor Neurons O ur digital expression profile of neurosecretory products predicted by traditional cloning ( Figure 4 2) and homology search ( Figure 4 3) support previous experiments suggesting both


68 MIP ( Figure 4 3) and FMRFamide ( Figure 4 2) are e xpressed in the L7 motor neuron. Furthermore, these DEPs and that for the neurosecretory products predicted using a genomic approach suggest the expression of several other putative neurosecretory products including Capsulin, R151 and R152, Delta like p recursor, Ependymin related protein, 7B2 secretory granduale neuroendocrine protein, LFRFamide, Putative Phermon e 2, Theromacin like, heatshock like protein, and Fulicin. However, further investigation with in situ hybridization does not support the expre ssion of most of the products predicted by DEP including Capsulin, R15 1 and R152, and Delta like precursor. While some of these predicted SSMs may not be involved in cell signaling, several, including Fulicin, LFRFamide, and Ependymin related protein 2 may prove to be key signaling molecules involved in cell to cell communication including retrograde signaling. Of particular interest to this thesis was the prediction of a Fulicin like neurosecretory product in Aplysia and DEP supporting the expression of Fulicin in L7 motor neuron ( Figure 4 4) as suggested in Chapter 3 of this thesis. Interneurons DEP reveals the expression of Capsulin, FMRFamide, Myomodulin, R151 and R152, 7B2 secretory granduale neuroendocrine protein, Ins ulin like proteins, LFRFa mide, p utative Phermone 2, Buccalin, and heatshock protein in MCC interneurons. In situ hybridization has not confirmed the expression of any MCC specific neurosecretory product, suggesting that all proteins predicted to be expressed in MCC by DEP are due to inputs from synaptic terminals of other neurons.


69 Discussion Digital Expression Profling Although some transcripts are co expressed in different neuron types, the level of expression for each type is unique. Furthermore, the overall expression profil e of transcripts across neuron types is unique, creating a sort of laundry list of transcripts unique to cell function. This presents a potential method for identifying neuron function based exclusively on molecular data and excluding the need for physiol ogical studies. Furthermore, this information can be applied to systems like the gill and siphon withdraw network in Aplysia californica to enhance our understanding of key molecular components of a learning network. We also suspect that transcripts wit h a low frequency of expression in DEP may indicate contamination to the library by way of synaptic input from other neurons in the circuit. Indeed, by combining DEP with in situ hybridization, we have found some transcripts with low DEP expression do no t show any positive labeling using in situ hybridization methods ( Table 41). While this may at first seem a drawback to the sequencing technology, this contamination could actually be used as insight to the identification of synaptic input to specific n eurons being studied. Implications of Neuron specific Expression While the cellular mechanics underlying learning and memory of the gill and siphon withdraw network has been well defined and studied, limitations in the molecular understanding of this net work has hindered progress in understanding cellular identity and plasticity. Some signaling molecules of this system have been identified (i.e. Sensorin) while others, for example the molecules are involved in the retrograde signaling from L7 neurons to sensory neurons, remain elusive. This work presents a major contribution to the understanding of the molecular mechanisms underlying cell identity and plasticity in a learning behavior. From here it is hoped


70 that researchers will be able to study the eff ects of identified putative neurosecretory products to determine what if any role these molecules have on cell signaling and learning and memory. It is likely th at several of these identified putative neur o secretory products may prove to be crucial to the overall understanding of this neuronal circuit. Methods Animals and Dissection Aplysia californica weighing up to 150g were obtained from the National Resource for Aplysia at the University of Miami, and Aplysia weighing 150g 400g were collected in the w ild by Marinus Scientific, Long Beach, California. Animals were anesthetized by injection of isotonic (340 mM) MgCl2Single neuron collection was performed previously by Th omas Ha. Briefly, ganglia were first incubated in 1% Protease IX (Sigma) at 34 for 45 min to soften the connective tissue of the neuronal sheath. Then ganglia were pinned to a sylgard dish in artificial seawater (ASW: 460 mM NaCl, 10nM KCl, 55mM MgCl (approximately 50% of the body weight) before removal of muscle or nervous tissue. 2, 11 mM CaCl2, Construction of 454 Libraries 10mM HEPES, pH 7.6), the cells were exposed by mechanical removal of overlying sheath with fine forceps, and the dish was flooded with 70% ethanol. After two minutes the cells were mechanically removed with fine forceps placed in 250 l 70% E thanol and stored at 20C until RNA isolation. The MCC neurons were identified visually. The identity of the L7 neurons was first confirmed by electrophysiology (see Figure 41) before fixation and collection. Libraries were constructed as previously described in this thesis, Chapter 2 methods.


71 Digital Expression Profiling Digital Expression Profiles (DEP) are made by taking the entire set of data from a sequencing project before assembly. In this dataset, each sequence read represents the expression of a single transcript in the cell or tissue the library was made from, such that there is a 1 to 1 ratio of sequence read to transcript. From this data set, any sequence of interest can be aligned using BLAST (1e 04) and by co unting the number of reads generated from the 454 sequencing that have significant BLAST, the number of times that transcript was sequenced from the library can be determined. To determine the frequency of expression, these counts are normalized to the to tal number of sequences in the sequencing project. By normalizing the counts, the frequency of expression across different sequencing projects can be compared.


72 Abdominal Ganglia Siphon Gill Figure 41. Semi intact preparation of Aplysia abdominal for identifying neurons of the gill and siphon withdraw reflex. The nerves connecting the abdominal ganglia to the gill and siphon remain intact. By removing the sheath surrounding the neurons, cells can be impaled and recorded from to determine cell identity. For example, L7 can be identified by impaling cells in the vicinity of L7 until a cell is found that when stimulated, results in the contraction of the gill and siphon.


73 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 0 0.001 0.002 0.003 0.004 0.005 0.006 Frequency of Expression Neurosecretory Protein L7 Frequency SN Frequency MCC Frequency capsulin FMRFamide myomodulin PTSP like peptide R152 R151 SensorinA Fig ure 4 2. Digital expression of n eurosecretory products predicted by traditional c loning.


74 Figure 43. Digital expression of n eurosecretory products predicted by homology search against unbiased shot gun sequencing. Predicted Neurosecretory Products Frequenc y of Expression 7B2 secretory granule neuroendorine protein Delta like precursor Ependymin related protein 2 Insulin like LFRFamide precursor MIP Putative Pheromone -2 SFY3 like peptide Theromacin


75 Figure 44. Digital e xpression of neurosecretory products predicted by genomic approach. Reticulocalbin1 precursor Kinesin-like Insulin-like Unknown Unknown Unknown hypothetical protein Buccalin Unknown FlbAprotein BEL-2 Unknown Unknown Fulicin ependymin-related VonWillebrand factor precursor Unknown similar to orphan G protein Cell wall protein DAN4 precursor P protein Unknown Unknown Out at first protein hypothetical protein Heatshock Unknown unknown IG-H3 precursor 0 0.00005 0.0001 0.00015 0.0002 0.00025 0.0003 0.00035 0.0004 0.00045 0.0005 Frequency of Expression Predicted Neurosecretory Product L7 Frequency SN Frequency MCC Frequency


76 Secretory P roduct DEP In situ SN MN IN SN MN IN Sensorin + + + PTSP like + + Capsulin + + + LFRFamide + + + SFY3 + 7B2 s.g. + + + Heatshock + + + MIP + + FMRFamide + + + R15 + + Delta like + Ependymin + + Putative Pheremone 2 + + Theromacin + Fulicin + Myomodulin + + Insulin like + + Buccalin + + + Table 4 1. Validation of DEP using in situ hybridization Comparison of secretory products predicted to expressed in Sensory (SN), Motor (MN) or Inter (IN) neurons by DEP compared to expression confirmed by in situ hybridization.


77 O bject 21. Intron/Exon Boundaries of selected neurosecretory genes Preliminary analysis of neuropeptides across gastropod species Aplysia and Lottia suggests that some neuropeptides evolve at different rates. These results (see Chapter 2) suggest that some neuropeptides involved in development (i.e. Dorsal ventral patterning peptide) have a more closely conserved coding sequence than those neuropeptides involved in neuron regulation (i.e. MIP). To see if these differences are due to underlying discrepancies in the neuropeptide genomic organization, the intron/exon boundaries of 12 selected neuropeptides were exami ned. Selected neuropeptides show a relatively simple genomic organization, with an average of 35 exons. Those neuropeptides shown to be more highly divergent do not appear to have differences in their genomic organization compared to closely conserved neuropeptides. Atrial gland specific antigen precursor (AGSA) (Mollusk derived growth factor) (MDGF) Gene Bank Accession Number: 22261794 Intron /Exon Boundaries : Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Length Intro n 5 Sequence 1 gggcaggt ag CCATGTCGTC CATCTTGGCG 209 gt acgtttaa 2 tcttgttt ag GAAAAAAGAA ATGCCTAAAG 130 gt aagggatt 3 ctccccccc ag GCGGTGCTCT CCGGACCCAT 147 gt gagtctat 4 tcattccc ag TTTGTGTTTG TCGATGACTG 67 gt aaggaggc 5 tgctgtac ag GTTGAAGAAA TTTT GCTCAG 97 gt aagtgaaa 6 ttatcatc ag GTCATCGGAC GCTGTTTGGG 114 gt gagtcaaa 7 acccctgc ag TTCTTCGAGC CTGGCCTAAG 128 gt aggctaaa 8 ttccctcc ag GTTCAAGAGC GCTGAAACCA 206 gt acgtatgc 9 ctgttaac ag ACTGGCAGGA CTCTAATCAG 158 gt ttgtagag 10 tgtcctgc ag ATCCTG GGCC CTATCCCATC 69 gt tatctcct Intron 1 2 3 4 5 6 7 8 9


78 Feeding circuit activating peptide precursor Gene Bank Accession Number: 22947345 Intron/Exon Boundaries: Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Length Intron 5 Seq uence Placement in Sequence 1 GACCAGACAG CCTCAACTTC CCACTGCAAG 87 GTAAGAAAAC 18 69 2 TCTCGTTCAG ACACCGGAAC AAATGTAAGG 2162 GTCAGTTACA 70 2231 FMRFamide neuropeptide precursor Gene Bank Accession Number: 84551 Intron/Exon Boundaries: Coding Re gion: 1491942 nt Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Length Intron 5 Sequence Placement in Sequence 1 tcaaatct ag AGTTCTTCAA CCGACTGATC 137 gt aagttgct 20 117 2 caatctgc ag GCGCCCGTGA CTGTGCGAGA 140 gt gagta ccc 118 257 3 ggtatctg ag ATTTGGCCGG AATACAACCA 1695 gt gatatttg 258 1952 L11 neuropeptide precursor Gene Bank Accession Number: 155779 Intron/Exon Boundaries : Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Lengt h Intron 5 Sequence Placement in Sequence 1 ggaccccc ag GTCATCATGC CTGCACGTGA 117 gt tgtcgttg 6 110 2 cccacagg ag GTTTGTTTTCG CCTACAACAG 141 gt gggctata 111 251 3 ttttccac ag AGTTTTCTTA ACGAAACTAT 87 gt caatagac 385 471


79 Buccalin precursor Gene Bank Accession Number: 404497 Intron/Exon Boundaries: Coding region: nt 2711786 Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Length Intron 5 Sequence Exon on Seq 1 tttcggca ag AAATCCTGAC ACACACGCAG 181 gt agggatct g 1 167 2 tttgtttc ag TTTACTTAAC GCCTTTATCT 86 gt aagacttg 168 253 3 cctccccc ag GTTCCCCCCC AGAGGAACAG 1516 gt gagctggc 254 1770 4 ctccctcc ag TCGTCGAAGA AGTGACCGCT 29 gt gacgtagt 1771 1800 Conopressin Gene Bank Accession Number: FJ172359 Intro n/Exon Boundaries: Coding region: nt 106684 Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Length Intron 5 Sequence Exon on Seq 1 gtttttaa ag TTTGCATAAG TTAGAGGCAA 58 gt ttcaagtg 19 72 2 tcctgcac ag AACGAAATCA ACAGCGACAG 195 gt a agaacgt 73 267 3 ttatttcc ag TGCATGGCGT TGTGATTCAG 208 gt aggtcgtc 268 475 4 ttcccccc ag AATCATGTGC GCCCAGTGAC 209/1516 gt gaggagcc 476 684 Fulicin like neuropeptide precursor+Gene Bank Accession Number: 56792350 Intron/Exon Boundaries: 3531533 Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Length Intron 5 Sequence Nucleotide location 1 GGGGATCATC TGACCATAGA gt atgttgtt 1 247 2 gttgtttc ag ATTCCAAAAA AGTGGTTCAG 144 gt aggttgct 248 391 3 tctcgttt ag G TTACCACAG AATTGTACTG 33 gt gagtggaa 392 424 4 cttattcc ag ATTTTTTCTG TCACGTGCAG 107 gt gagtagga 425 531 5 ctccatcc ag ATACCACGAA ATAGGACACG 1001 gt attttcta 532 1533


80 MIP related peptide precursor Gene Bank Accession Number: 8886135 Intron/Exo n Boundaries: coding region: 6682873 nt Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Length Intron 5 Sequence Nucleotide location 1 CCCTTGGGGT TGACCATAGA gt atgttgtt 1 456 2 gttgtttc ag ATTCCAAAAA AGTGGTTCAG 144 gt aggttgct 457 600 3 tctcgttt ag GTTACCACAG AATTGTACTG 33 gt gagtggaa 601 633 4 cttattcc ag ATTTTTTCTG TCACGTGCAG 107 gt gagtagga 634 740 5 ttccatgc ag ATACGCAAAG AGGTAGCTTT 2139 gt ccatccag 741 2879 Neurotoxin like 1 Gene Bank Accession Nu mber: 71148939 + Intron/Exon Boundaries: Coding Region: 10423 nt Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Length Intron 5 Sequence Nucleotide location 1 GCTGAGCA AG TCACAATCAC CAGCGTGAAC 70 GT AAGTCTTA 10 60 2 TC CTCCCC AG GCAAAGGTGG GCAACGAAAG 130 GT GAGGCGTG 61 190 3 GATATTGC AG GGACGTGCCA TTCGTTCCAG 129 GT CAGTACAC 191 319 4 CTTACGTC AG GATTCTTTTC CATAGATGAC 129 GT CAACACCT 320 448 Pleurin Gene Bank Accession Number: 56200040 + Intron/Exon Boundaries: C oding Region: 189755 Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Length Intron 5 Sequence Placement in Sequence 1 TTGTCACCAG AAGTGAGTGA CTCACCAACA 155 GTAAGCCATC 2 156 2 TATCAAACAG TAAACCGCTC CTTGAGCTCA 482 GTGGCCG AAT 176 657 3 TGTTTCACAG GTGATCAAGC CTTTGATGAC 94 GTCATCTGAG 682 776


81 Whitnin precursor (SPTR) Gene Bank Accession Number: 56200044 + Intron/Exon Boundaries: Exon Number Intron 3 Sequence Exon 5 Sequence Exon 3 Sequence Exon Length Int ron 5 Sequence Placement in S S equence 1 TGTGTTTCAG ATCCTTCAGC TGTGCTGCAG 115 GTCAGACACA 13 102 2 TGTCTTCCAG GAGGCCTCGG CATTCAAGAG 99 GTGGGTGGCA 103 201 3 ATCATCTCAG CTTGTGGACG GGAGTGGTAC 146 GTGCCTTGGG 202 347


82 Object 22. Identified neurosecretory products likely to be signaling molecules Secreted Signal Molecules found prior by traditional cloning Abdominal ganglion neuropeptides L5 67 precursor Gene Bank Accession Number: 113521 Reference: Shyamala, M., Fisher, J.M. et al. (1986). A n europeptide precur sor expressed in Aplysia neuron L 5. DNA. 5 (3), 2038. Aplysianin A precursor Gene Bank Accession Number: 26419361 Reference: Cummins, S. F., Nichols, A. E. et al. (2004). Characterization of Aplysia enticin and temptin, two novel water borne protein pheromones that act in concert with attracti n to stimulate mate attraction. J Biol Chem 279(24), 2561422. Atrial gland specific antigen precursor (AGSA) (Mollusk derived growth factor) (MDGF) Gene Bank Accession Number: 22261794 Reference: Sossin, W. S., Kreiner, T. et al. (1989). A dense core vesicle protein is restricted to the cortex of granules in the exocrine atri al gland of Aplysia california J Biol Chem 264 (28), 1693340. Attractin precursor Gene Bank Accession Number: 38257306 Reference: Fan, X., Wu, B. et al. (1997). Molecular cloning of a cDNA encoding a potential water borne pheromonal attractant rele ased during Aplysia egg laying. Brain Res Mol Brain Res 48(1), 16770. Calreticulin Gene Bank Accession Number: 262054 Refer ence: Kennedy, T. E., Kuhl, D. et al. (1992). Long term sensitization training in Aplysia leads to an increase in calreticulin, a major presy naptic calcium binding protein. Neuron 9 (6), 101324. Capsulin Gene Bank Accession Number: 31088940 Reference: Cummins, S. F., Nichols, A. E et al. (2004). Characterization of Aplysia enticin and temptin, two novel water borne protein pheromones that act in concert with attracti n to stimulate mate attraction. J Biol Chem 279(24), 2561422. Cerebrin prohormone precursor Gene Bank Accession Number: 74843746 Reference:


83 Li, L., Floyd, P. D. et al. (2001). Cerebrin prohormone processing, distribution and action in Aplysia californica J Neurochem 77 (6), 156980. Clionin precursor Gene Bank Acce ssion Number: FJ214338 + PubMed ID Reference: n/a not released CDS: ATGACGTCATCCATGATCCTCGCTGTCCTGGCCATCTCCCTGTCGTGCCTGCTGACCGCTGTGACGTCA TCACCACTTGGCCCAGTCCAGCCGGCCATATCCCTGTCCAAGATGGAACCCGATCACGCCTGTTTGTTC ATGTGCAACATCTGTTTCCCGGATCTGGAGGACACGGGTCTGCTCCTGGACT GCAGCAACAAAGTGTG TGGTCCCATCATGGCGGGCATGTGTGCTATGGAGAAGCTCGTCTGGCTGGGCCACAACTGCCGTCAGT ACGACATGGTGCAGAAAATGTGGGCTCCGCACGGCGCTCTCTAA Protein: MTSSMILAVLAISLSCLLTAVTSSPLGPVQPAISLSKMEPDHACLFMCNICFPDLEDTGLLLDCSNKVCGPIM AGMCAMEKLVWLGHNCRQYDMVQKMWAPHGAL ELH precurs or [Contains: Beta bag cell peptide (Beta BCP) Gene Bank Accession Number: 119268 Reference: Scheller, R. H., Jackson, J. F. et al. (1983). A single gene encodes multiple neuropeptides me diating a stereotyped behavior. Cell. 32(1), 722. Enticin precursor Gene Bank Accession Number: 74814556 Reference: Cummins, S. F., Nichols, A. E. et al. (2004). Characterization of Aplysia enticin and temptin, two novel water borne protein pheromones that act in concert with attracti n to stimulate mate attraction. J Biol Chem 279(24), 2561422. Feeding circuit activating peptide precursor Gene Bank Accession Number: 22947345 Reference: Sweedler, J. V., Li, L. et al. (2002). Identification and characte rization of the feeding c ircuit activating peptides, a novel neuropeptide f amily of A plysia J Neurosci 22(17) 7797808. FMRFamide neuropeptide precursor Gene Bank Accession Number: 84551 Reference: Taussig, R. and Scheller R. H. (1986). The Aplysia FMRFa mide gene encodes sequences related to mammalian brain peptides. DNA 5(6): 45361. FUR Gene Bank Accession Number: 453657 Reference: Chun, J. Y., Korner, J. et al. (1994). The function and differential sorting of a family of A plysia prohormone processing enzymes. Neuron 12(4), 83144. Glycoprotein hormone beta subunit (GPB5) +


84 Gene Bank Accession Number: AY928334 Reference: Heyland, A., Moroz L. (2005) U npublished Hypothetical protein Gene Bank Accession Number: 26892018 Refe rence: Cummins, S. F., Nicho ls, A. E. et al. (2004). Characterization of Aplysia enticin and temptin, two novel water borne protein pheromones that act in concert w ith attractin to stimulate mate attraction. J Biol Chem 279(24), 2561422. Insulin precursor Gene Bank Accession Number: 8886137 Reference: Floyd, P. D., Li, L. et al. (1999). Insulin prohormone processing, distribution, and relation to metabolism in Aplysia californica J Neurosci 19 (18), 773241. L11 neuropeptide prec ursor Gene Bank Accession Number: 155779 Reference: T aussig, R., Kaldany, R.R. et al. (1984). A cDNA clone encod ing neuropeptides isolated from Aplysia neuron L11. Proc Natl Acad Sci U S A 81 (15), 498892. Myomodulin [Aplysia californica] Gene Bank Acce ssion Number: 400327 Reference: Lopez, V., Wickham, L. et al. (1993). Molecular cloning of myomodulin cDNA, a neuropeptide precursor gene expressed in neuron L10 of Aplysia californica. DNA Cell Biol 12(1): 53 61. Myomodulin gene 2 neuropeptide precurso r Gene Bank Accession Number: 77378085 Reference: Proekt, A., Vilim, F.S. et al. (2005). Identification of a new neuropeptide precursor reveals a novel source of extrinsic modulation in the feeding system of Aplysia. J Neurosci. 25(42), 963748. Neuropeptide precursor 1 Gene Bank Accession Number: 20372612 Reference: Matz, M.V., Meleshkevitch, E. et al. (2001). Unpublished Neuroprepeptide Gene Bank Accession Number: 155771 Reference: Nambu, J. R., Taussig, R. et al. (1983). Gene is olation w ith cDNA probes from identified Aplysia neurons: neuropeptide modulator s of cardiovascular physiology. Cell 35 (1), 4756. PRQFVamide precursor protein


85 Gene Bank Accession Number: 29469911 Reference: Furukawa, Y., Nakamaru, K. et al. (20 03). PRQF Vamide, a nov el pentapeptide identified from the CNS and gut of Aplysia J Neurophysiol 89(6), 311427. PTSP like peptide neurotransmitter precursor+Gene Bank Accession Number: 87045866 Reference: Moroz, L. L., Edwards, J. R. et al. (2006). Neuronal t ranscriptome of A plysia : neuronal compartments and circuitry. Cell 127(7), 145367. Putative pheromone Gene Bank Accession Number: 115371642 Reference: Cummins, S. F., Degnan, B. M. et al. (2008). Characterization of Aplysia Alb 1, a candidat e water bor ne protein pheromone released during egg laying. Peptides 29 (2), 15261. R151 neuroactive peptide precursor Gene Bank Accession Number: 155797 Reference: Buck, L. B., Bigelow, J. M. et al. (1987). Alternative splicing in individual Aplysia n eurons ge nera tes neuropeptide diversity. Cell 51(1), 12733. R152 Neuroactive polyprotein precursor Gene Bank Accession Number: 113523 Reference: Buck, L. B., Bigelow, J. M. et al. (1987). Alternative splicing in individual Aplysia neurons generates neuropeptide dive rsity. Cell 51(1), 12733. R3 14 neuropeptide precursor Gene Bank Accession Number: 155782 Reference: Scheller, R. H., Kaldany, R. R. et al. (1984). Neuropeptides: mediators of behavior in Aplysia Science 225(4668), 13008. Sensorin A precursor Gene Ba nk Accession Number: 134428 Reference: Brunet, J. F., Shapiro, E. et al. (1991). Identification of a peptide specific for Aplysia sensory neurons by PC R based differential screening. Science 252(5007), 8569. Temptin precursor Gene Bank Accession Number: 74811743 Reference: Cummins, S. F., Nichols, A. E. et al. (2004). Characterization of Aplysia enticin and temptin, two novel water borne protein pheromones that act in concert with attracti n to stimulate mate








89 TCCCTCAGCCCCGCGCCTTCCTGTCTCCTGGCCTGGTTGTGGGCGTCAAGAAAAGCCTGCTTGTC TCCC CAGGTCAGGGACTTGAGATGACCGCCCCAGCAACACGTGACCAGACACAGGACACTGACCAACACAC TGACCGCCGCTCTCCTCATCCCGACAGACGTGGACACAACTTTTCGTGGAGGAGGTCAGCTGATGTTTC GGCCAAGCCAGACTCGAGCCGCCTCGAGCC Appetite regulating hormone precursor Gene Bank Accession Number: n/a Reference: n/a Comment: Predicted only, not cloned Prediction: CTCTGTTTTGCTTTTTAAAATGATCCTTGCAAAACTAGCAATGTTACAGGGAAATGGTTTTCTATCTTTA AATATGACATTAAATGAGATGATGACTCCAGGAAAA Astacin like protein Gene Bank Accession Number: n/a Reference: n/a Comment: Predicted only, not cloned Predicted: CTTGAGATCAAAGAAGGACATTGCCTGCCTCTGGCCCAGGTCACGTTGTAACAGAGGGTCACGTGTCT CCAGGGTGATGCGGCCGTTCTTGGAGAAAAACGAGGAGCCGTAGTGCATGATAGATCCTACGTCATAG GGCACTCCCATGTTGTCTATGTCGCCCCATGATTCCCGTTTAAAGTTGAACTCCTCCCCTCTCTTCACGT TCTCCTCCAGGTATGTGACGTAATCATCTCGGT CCGGTCTGGACTGCTCGTGCCAGAAGCCCAGGGCGT GGCCTAGTTCATGGAGGAGGACTCCTTTCTCAAGGCAGCCTTTGGCCGTGGAGACTTCCTGGTACTTGA AGGCTTTCTCTCGACCTACATATGACCAACACCCCACGTCTTTACGGAAGTCCAG Atrial gland specific antigen precursor 2 (AGSA) (Mollusk derived growth factor) (MDGF) Gene B ank Accession Number: 155709 Reference: Sossin, W. S., Kreiner, T. et al. (1989). A dense core vesicle protein is restricted to the cortex of granules in the exocrine atrial gland of Aplysia california J Biol Chem 264 (28), 1693340.(Sossin et al., 1989) Bradykinin like neuropeptide (LUQ 1) Gene Bank Accession Number: 155765 Reference: Wickham, L. and Desgroseillers L. (1991). A bradykin in like neuropeptide precursor gene is expressed in neuron L5 of Aplysia californica DNA Cell Biol 10 (4), 24958. Buccalin precursor Gene Bank Accession Number: 404497 Reference: Miller, M. W., Beushausen, S. et al. (1993). The buccalin related neuro peptides: isolation and characterization of an Aplysia cDNA clone encoding a fa mily of peptide cotransmitters. J Neurosci 13(8) 334657. Central nervous system APGWamide Gene Bank Accession Number: 4099286 Reference: Fan, X., Croll, R.P. et al. (1997) Unpublished.






92 ACGACGACTGTGTCTACGACTATCTTGAAGTCCGTGAT GGCCCCTCTGAAATGTCTCCCCTCATCGGCA ACTACTGCGGCTACAAGATCCCAGAGGACATCAAGTCCACCGGAAGGCACCTCTACGTCAAGTTTGTC AGTGACGGCTCCGTGCAGAAGGCGGGATTTTCTGCCACTTTTGTCAAAGAGTACAACGAGTGTGAGAA GGAGGAGCATGGCTGTGATCACGTGTGTGTCAACACCCTGGGCAGTTACCGCTGCTCCTGTAGGATCG GCTACGAGCTGCACTCTGACGGCAAGAGGTGTGAAGATGCATGCGGCGGTTACATTGACCAGGAGAA TGGCACAATTACCTCCCCTTCCTACCCGGACCTGTACCCGCCCAACAAGAACTGCGTGTGGCAGATTGT TGCCCCTGACGACCACAAGATCAACATCAACTTCACTCACTTCGACCTGGAGGGCCACAATCAAGACT GCGAGTATGATTCAGTGCGTGTGAGCAGTGGAAAGGGGAAGGAACTCAAACTACACGGCGTGTTCTG TGGCTA CACGTTTCCAGCTCCAGTGACGTCAGA ELH Atrial gland peptide A precursor (ELH 18) Gene Bank Accession Number: 119272 Reference: Mahon, A. C., Nambu, J. R. et al. (1985). Structure and expre ssion of the egg laying hormone gene family in Aplysia J Neurosci 5(7) 187280. ELH egg laying hormone related precursor [Pro 25] B Gene Bank Accession Number: 2599363 Reference: Kurosky, A., Gorham, E. L. et al. (1997). Expression and genet ic variation of the Aplysia egg laying hormone g ene family in the atrial gland. I nvert Neurosci 2 (4) 26171. Endothelinlike precursor Gene Bank Accession Number: n/a Reference: n/a Comment: Predicted only, not cloned Predicted: GACAATGTGTGCGATTGTGTGTCTCCTTGTGTTTTAATGCTTGTGCTCTGTGTATGTGTAA Endozepine related 1F protein precursor ( b inds GABAA receptors in the central nervous system, and it increases the mitochondrial synthesis of pregnenolone. ) Gene Bank Accession Number: n/a Reference: n/a Comment: Predicted only, not cloned Predicted: GCCGCATGGGGTGAATATCGTACAGGCCGGATAAGTTTGAGGCAGCGGTGAAAGTAATTCGTGGTTTG CCCAAGAATGGTTCTTTCCAGCCTTCCCATGAGCTTATGCTCAAATTTTACAGCTATTTCAAGCAAGCC ACAGAAGGACTCTGCACATCTCCAAAGCCAGGTTTCTGGGATTTGGTCAATCGCAAGAAATGGGAGGC GTGGACCGATTTGGGTAAAATGGAAAGCGAGGAGGCCATGCTGCTGTATGTGGATGAGTTGAAAAAA AAAAAAAGTACCGACTGCG Enterin Ge ne Bank Accession Number: 74844518 Reference: Furukawa, Y., Nakamaru, K. et al. (2001). The enterins: a novel f amily of neuropeptides isolated from the enteric nervous system and CNS of Aplysia J Neurosci 21(20), 824761. Enterin neuropeptides precursor 2 Gene Bank Accession Number: n/a















PAGE 100


PAGE 101


PAGE 102


PAGE 103


PAGE 104


PAGE 105


PAGE 106


PAGE 107


PAGE 108


PAGE 109


PAGE 110


PAGE 111


PAGE 112


PAGE 113


PAGE 114


PAGE 115


PAGE 116


PAGE 117


PAGE 118


PAGE 119


PAGE 120


PAGE 121


PAGE 122


PAGE 123


PAGE 124


PAGE 125


PAGE 126

126 Lottia P rotein Model : jgi_Lotgi1_169325_fgenesh2_pg.C_sca_84000054 NR Annotation: Insulin precursor [Contains: Insulin B chain; Insulin B chain'; Insulin A chain] gb|AAF80383.1|AF160192_1 insulin precursor [Aplysia californica] NR E value: 4.00E 13 Ac Annotation: CNSN01 F 005950 501 (unknown) Ac E Value: 2.00E 11 Sequence: MEVTCKCPLVLLGVLFLNFGTVLTHLEWTCTLETKRESPRGVCGQRLPEVLSMVCKRYGGYRDTWFRKR NGEGTNSRLGNIILGKRDAFSYLGKRGQSYGEQGITCECCYHSCSFRELRQYCRNSQQRISIKK*

PAGE 127

127 Object 23. Controversial predicted neurosecretory produ cts All software programs are inherently flawed in that they can only use those parameters they are programmed with to make predictions about whether a protein may or may not be a secreted signaling molecules. Due to these flaws, our final list of predic ted secreted signaling molecules was manually screened for conserved motifs, signal peptides, and annotated to make the most conservative list of predicted neurosecretory products. Here, we show those transcripts predicted to be secretory molecules due to targeting to the classical signaling cascade but are unlikely to be secreted outside of the cell. Some of these predicted secretory molecules may be part of the secretory apparatus but do not encode for signaling peptides. Furthermore, many of these pre dicted molecules have motifs of non secretory products but may be secretory in our model species. Further experimentation is needed to determine the functional role of these products, so we have decided to leave these products in this supplemental section to provide a complete unbiased review of all predicted products for future researchers. Found by Homology Search 7B2 secretory granule neuroendocrine protein+Gene Bank Accession Number: 94471618 Reference: N/A CDS: ATGAACATCCTTCTCCTCGCCGCCACCCTTGTGGGTG TGACCTTGGCCAGCTATGACCCCTACGTAGAC ATGGCCCAGCTGTACCGGATGCAGCTTCTGGCCAACGCCTTTGACGACTACCTGCCTGAGAGCCAGCT TCTGGACAGCCGCAGCGAGGAGCCGTACTGGCCCGAGCTAGAGGACGTGGCTGAGCCGCAGGACGAC AAGGATGCCATCTATAACGACAGGTTCTACAGCGGGGCTCATCTCAGAGATCAGGAGCATTTGGAGCA TAGCGCTCTGCACGGTTATCA GTCGGTGTCTGGCGGTGCATCAGAAGTCCCCCCTAACCCCAAACAGG TCAAGTCGGACAAACAGCTGCCTGAGTACTGTAACCCACCCAACCCCTGCCCTGTGGGCAAGACAGCC AAGGACAACTGTGTAGAGAACTTCGACAACAGCGCGGAGAACAACGAGCGCCTATTGTCCCAACAAG ACTGTCCCTGCGACACCGAGCACATGTTCTCCTGCCCCGCCGGAAGCCAGACGGTGTCCTCCAAGGCC CAGAGC TCGGGCAACCAGCAGATGGCGCTCAACAAGGTCATGGACGAGATCGCCAAGATGGAGCATG ATGGGGAGAGCTTGGAAAACAACCCCACAATGTCGGAGACGCGGAAAAGAGTGACGCTGGTGGCAAA GAAGTCTCCACATATTATTCACAAACGATCTGAGCAATCAGACCACAGCAATCCTTTCCTGCAAGGAG CTCCTGTAGCTATTGCTGCTAAGAAAGACCCCAATACCGCACAGAGGGTCATTCCCCAGT GGGCCAGA TACGACCAGCCCTTGCGGTGA Protein: MNILLLAATLVGVTLASYDPYVDMAQLYRMQLLANAFDDYLPESQLLDSRSEEPYWPELEDVAEPQDDK DAIYNDRFYSGAHLRDQEHLEHSALHGYQSVSGGASEVPPNPKQVKSDKQLPEYCNPPNPCPVGKTAKDN

PAGE 128


PAGE 129


PAGE 130


PAGE 131


PAGE 132


PAGE 133


PAGE 134


PAGE 135


PAGE 136


PAGE 137


PAGE 138


PAGE 139


PAGE 140


PAGE 141


PAGE 142


PAGE 143


PAGE 144


PAGE 145


PAGE 146

146 Lottia Protein Model : jgi_Lotgi1_167022_fgenesh2_pg.C_sca_63000026 NR Annotation: predicted protein [Nematostella vectensis] gb|EDO43826.1| predicted protein [Nematostella vectensis] NR E value: 2.00E 08 Ac Annotation: CNSN01 F 102728 501 (un known) Ac E Value: 7.00E 34 Sequence: MVAVRIRKYKNLLFFALLFAGVLSISTIFYSNHYQIMNTGTRSDVNTGFSYSNANSSKYVIYICDGKNSCGG YGDRQKGIVASYIISVMMNRQFGVIMNDSCDIKQMFKPNQINWIVDNNDIKSKTSKRIKALDGYSDKLRKS MIEMDLDQEYKEEVIYFSLNLEFVFYLRQNKRYEKQLKWLEHLSMSEIYNVVWQSIFKLRPYIREKLDPFL DLKKQGLKLISAQIRLGKNPTIPHDSRVVNSLNNMNVLWQFYKKYNDSSKYRIFISTDSDTVREKARSIFPD VYSDVPGKVFHVERSNKTDICNGWRKVILDQVILSLSDVLVISNSGFGRIAAFFRQNENDLYCLNLDKIRRC TTQSEIFVDKTW* Lottia Protein Model : jgi_Lotgi1_168040_fgenesh2_pg.C_sca_71000102 NR Annotation: No match found NR E value: Ac Annotation: PEG003 C 229928 501 (unknown) Ac E Value: 1.00E 17 Sequence: MVGTRYLQLATSLAVFLLVLFLTCTQAAPVDDFETDNEALRKALFIARLLSSSDRLKNTKPEGSNLDFSELA SIPFSNQQKRYRPPMQGRSGGMSLCLWKVCPAAPWLVSKRSEKTWDKNNMLGK* Lottia Protein Model : jgi_Lotgi1_170051_fge nesh2_pg.C_sca_92000069 NR Annotation: hypothetical protein TTHERM_00439050 [Tetrahymena thermophila SB210] gb|EAR97557.1| hypothetical protein TTHERM_00439050 [Tetrahymena thermophila SB210] NR E value: 3.00E 08 Ac Annotation: PEG001 C 000321 501 (unknown ) Ac E Value: 2.00E 18 Sequence: MKMINIFIVVYCLISPCLGFWLSSKTVDPKVDISTECINKALTGDCGFFTCFEERLPCGEYGYAESYGGKYC WQFQQSHHLFTKKGVEFVEKLTRCHMNRSITSYRQNQIECFSHYDQSFVIMGDCYVESGFCDVVIDNFMSL ARILEPKDFTNYRVVREVFRAAKQCPNNISGGIISKFLSYKRGSSL* Lottia Protein Model : jgi_Lotgi 1_171167_fgenesh2_pg.C_sca_110000033 NR Annotation: No match found NR E value: Ac Annotation: CNSN01 C 005636 501 (unknown) Ac E Value: 2.00E 23 Sequence: MAISHDWSFTLLWLIWIFTLLFSDSYGKRTQNYYMEGLDCGDSKHIGGATVYSNFRGDVSTVYGNDIECQ MTFKAENKDWRLMLRIIELDIPDRTSTGLC NDALYVYDESSIYARAMEEANGNTGLCGNILPPTLYSTGQY LTVHFSVSLQNQKDIV* Lottia Protein Model : jgi_Lotgi1_171450_fgenesh2_pg.C_sca_115000014 NR Annotation: No match found NR E value: Ac Annotation: CNSN01 F 059701 501 (unknown) Ac E Value: 1.00E 09

PAGE 147


PAGE 148


PAGE 149


PAGE 150


PAGE 151


PAGE 152


PAGE 153


PAGE 154


PAGE 155

155 Object 25. C ontroversial predicted Lottia secreted s ignaling proteins All software programs are inherently flawed in that they can only use those parameters they are programmed with to make predictions about whether a protein may or may not be a secreted signaling molecules. Due to these flaws, our final list of predicted secreted signaling molecules was manually screened for conserved motifs, signal peptides, and annotated to make the most conservative list of predicted neurosecretory products. Here, we show those transcripts predicted to be secretory mo lecules due to targeting to the classical signaling cascade but are either unlikely to be secreted outside of the cell, or unlikely to serve as neurosecretory signaling molecules. Some of these predicted secretory molecules may be part of the secretory ap paratus but do not encode for signaling peptides. Furthermore, many of these predicted molecules have motifs of non secretory products but may be secretory in our model species. Further experimentation is needed to determine the functional role of these products, so we have decided to leave these products in this supplemental section to provide a complete unbiased review of all predicted products for future researchers. Annotated Lottia Protein Model: jgi_Lotgi1_108564_e_gw1.8.40.1 NR Annotation: PREDICTE D: hypothetical protein [Strongylocentrotus purpuratus] ref|XP_001179636.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus] NR E value: 2.00E 86 Sequence: MYLSCYLPVILLFIEDLKQAVVAMMLRKDEVEEKNKSLKAMLDREMEISSTLRAEIEEMKISFKLSKDKEIA KNETLQKENELLK HQLRKYINAVQLLRTEGAKDDTQGITLEDPQPIIPPAKPSIDYSHEASEYEKKLIQVAEM HGELMEFNELLHRQINCKEAVIRNLKEELTDLRGPLPYDAQSSDDSLSGDLESSLISRCLINIWIPSAFLGGSK TDSHHVYQVYVRIRDEEWNVYRRYSKFLDVHTRLKKVYPLIEKFEFPPKKTIGSKDPKVVTARRKMLQSY LRKVINHLLEKNADLSSNVSKEKLIAVLPFFK* Lottia Protein Model : jgi_Lotgi1_118077_e_gw1.28.72.1 NR Annotation: LOC100124858 protein [Xenopus tropicalis] NR E value: 1.00E 108 Sequence: MGSTLNILVILGCILVPFSFSNFLEWGPDLEGPWCATRPIEQCCPGRDDECTVPILGTKCYCDIFCNETAEDC CPDFWNLCLGVTRPTPWPLTTTTSRVPINILCNVYWFKCTKLHFSSHWECSNDDCLL EADHITQINNGPYS WVASNYSDFWGLTLEDGVKYRLGTFPLGSNVVQMTPLRVKLTDVLPESFDARTKWPSYIKPIRDQGNCGA

PAGE 156


PAGE 157


PAGE 158


PAGE 159


PAGE 160


PAGE 161


PAGE 162


PAGE 163


PAGE 164


PAGE 165


PAGE 166


PAGE 167


PAGE 168


PAGE 169


PAGE 170


PAGE 171


PAGE 172


PAGE 173


PAGE 174


PAGE 175


PAGE 176


PAGE 177


PAGE 178


PAGE 179


PAGE 180


PAGE 181


PAGE 182


PAGE 183


PAGE 184


PAGE 185


PAGE 186


PAGE 187


PAGE 188


PAGE 189


PAGE 190


PAGE 191


PAGE 192


PAGE 193


PAGE 194


PAGE 195


PAGE 196


PAGE 197


PAGE 198


PAGE 199


PAGE 200


PAGE 201


PAGE 202


PAGE 203


PAGE 204


PAGE 205


PAGE 206


PAGE 207


PAGE 208


PAGE 209


PAGE 210


PAGE 211


PAGE 212


PAGE 213


PAGE 214


PAGE 215


PAGE 216


PAGE 217


PAGE 218


PAGE 219


PAGE 220

220 APPENDIX A MODERN VIEW OF ANIMAL PHYLOGENY A. A conservative consensus of the current state of all animal phy logeny. Phyla for which a large amount of data (genome or EST pr ojects) is available are ind icated in red. The dashed lines indicate controversial relationships. [ Image taken from Philippe, H., and Telford, M.J. (2006). Large scale sequencing and the new animal phylogeny. Trends Ecol Evol 21, 614620.]

PAGE 221

221 B. Recent work h as improved the resolution of the animal tree of life by sampling from 29 animals belonging to 21 phyla. Phylogeny is based on collected ESTs and a maximum likelihood analysis. [Image taken from Dunn, C.W., Hejnol, A., Matus, D.Q., Pang, K., Browne, W.E. Smith, S.A., Seaver, E., Rouse, G.W., Obst, M., Edgecombe, G.D ., et al (2008). Broad phylogenomic sampling improves resolution of the animal tree of life. Nature 452, 745749.]

PAGE 222

222 APPENDIX B MOLLUSCAN CLASSES The t opology of the molluscan phylogeny is still highly debated. There are two pr evailing models, A) Aculiferan and B) T estarian models. Recent work (Sigwart and Sutton, 2007) incorporating both Paleozoic and extant molluscs supports the monophylyl of Aculifera. [Image taken from Sigwart, J.D., and Sutton, M.D. (2007). Deep molluscan phylogeny: synthesis of palaeontological and neontological data. Proc Biol Sci 274, 24132419.] A B

PAGE 223

223 LIST OF REFERENCES Amare, A., and Sweedler, J.V. (2007). Neuropeptide precursors in Tribolium castaneum Peptides 28, 12821291. Antonov I., Ha, T., Antonova, I., Moroz, L.L., and Hawkins, R.D. (2007). Role of nitric oxide in classical conditioning of siphon withdrawal in Aplysia J Neurosci 27, 1099311002. Banvolgyi, T., Barna, J., Csoknya, M., Hamori, J., and Elekes, K. (2000). Reorga nization of peptidergic systems during brain regeneration in Eisenia fetida (Oligochaeta, Annelida). Acta Biol Hung 51, 409416. Bendtsen, J.D., Jensen, L.J., Blom, N., Von Heijne, G., and Brunak, S. (2004a). Feature based prediction of non classical and leaderless protein secretion. Protein Eng Des Sel 17, 349356. Bendtsen, J.D., Nielsen, H., von Heijne, G., and Brunak, S. (2004b). Improved prediction of signal peptides: SignalP 3.0. J Mol Biol 340, 783795. Boldajipour, B., Mahabaleshwar, H., Kardash, E., Reichman Fried, M., Blaser, H., Minina, S., Wilson, D., Xu, Q., and Raz, E. (2008). Control of chemokine guided cell migration by ligand sequestration. Cell 132, 463473. Cai, D., Chen, S., and Glanzman, D.L. (2008). Postsynaptic regulation of long t erm facilitation in Aplysia Curr Biol 18, 920925. Campanelli, J.T., and Scheller, R.H. (1987). Histidine rich basic peptide: a cardioactive neuropeptide from Aplysia neurons R3 14. J Neurophysiol 57, 12011209. Caneparo, L., Huang, Y.L., Staudt, N., Ta da, M., Ahrendt, R., Kazanskaya, O., Niehrs, C., and Houart, C. (2007). Dickkopf 1 regulates gastrulation movements by coordinated modulation of Wnt/beta catenin and Wnt/PCP activities, through interaction with the Dally like homolog Knypek. Genes Dev 21, 465480. Corsi, A.K., and Schekman, R. (1996). Mechanism of polypeptide translocation into the endoplasmic reticulum. J Biol Chem 271, 3029930302. Cummins, S.F., Nichols, A.E., Amare, A., Hummon, A.B., Sweedler, J.V., and Nagle, G.T. (2004). Characteriz ation of Aplysia enticin and temptin, two novel water borne protein pheromones that act in concert with attractin to stimulate mate attraction. J Biol Chem 279, 2561425622. Davis, S., Lollo, B., Freier, S., and Esau, C. (2006). Improved targeting of miRN A with antisense oligonucleotides. Nucleic Acids Res 34, 22942304. Dunn, C.W., Hejnol, A., Matus, D.Q., Pang, K., Browne, W.E., Smith, S.A., Seaver, E., Rouse, G.W., Obst, M., Edgecombe, G.D ., et al (2008). Broad phylogenomic sampling improves resolutio n of the animal tree of life. Nature 452, 745749.

PAGE 224

224 Emanuelsson, O., Brunak, S., von Heijne, G., and Nielsen, H. (2007). Locating proteins in the cell using TargetP, SignalP and related tools. Nat Protoc 2, 953971. Emanuelsson, O., Nielsen, H., Brunak, S ., and von Heijne, G. (2000). Predicting subcellular localization of proteins based on their N terminal amino acid sequence. J Mol Biol 300, 10051016. Fujisawa, Y., Furukawa, Y., Ohta, S., Ellis, T.A., Dembrow, N.C., Li, L., Floyd, P.D., Sweedler, J.V., Minakata, H., Nakamaru, K., et al. (1999). The Aplysia mytilus inhibitory peptide related peptides: identification, cloning, processing, distribution, and action. J Neurosci 19, 96189634. Fujisawa, Y., Masuda, K., and Minakata, H. (2000). Fulicin regulat es the female reproductive organs of the snail, Achatina fulica. Peptides 21, 12031208. Fujiwara Sakata, M., and Kobayashi, M. (1992). Neuropeptides regulate the cardiac activity of a prosobranch mollusc, Rapana thomasiana. Cell Tissue Res 269, 241247. Gattiker, A., Gasteiger, E., and Bairoch, A. (2002). ScanProsite: a reference implementation of a PROSITE scanning tool. Appl Bioinformatics 1, 107108. Gillette, R. (1991). On the Significance of Neuronal Giantism in Gastropods. Biol Bull, 6. Hirata, T ., Kubota, I., Iwasawa, N., Takabatake, I., Ikeda, T., and Muneoka, Y. (1988). Structures and actions of Mytilus inhibitory peptides. Biochem Biophys Res Commun 152, 13761382. Hirata, T., Kubota, I., Takabatake, I., Kawahara, A., Shimamoto, N., and Muneoka, Y. (1987). Catch relaxing peptide isolated from Mytilus pedal ganglia. Brain Res 422, 374376. Hummon, A.B., Richmond, T.A., Verleyen, P., Baggerman, G., Huybrechts, J., Ewing, M.A., Vierstraete, E., Rodriguez Zas, S.L., Schoofs, L., Robinson, G.E., e t al. (2006). From the genome to the proteome: uncovering peptides in the Apis brain. Science 314, 647649. Jeanmougin, F., Thompson, J.D., Gouy, M., Higgins, D.G., and Gibson, T.J. (1998). Multiple sequence alignment with Clustal X. Trends Biochem Sci 23, 403405. Jezzini, S.H., Bodnarova, M., and Moroz, L.L. (2005). Twocolor in situ hybridization in the CNS of Aplysia californica. J Neurosci Methods 149, 1525. Jezzini, S.H., and Moroz, L.L. (2004). Identification and distribution of a twopore domain potassium channel in the CNS of Aplysia californica Brain Res Mol Brain Res 127, 2738. Jezzini, S.H., Reagin, S., Kohn, A.B., and Moroz, L.L. (2006). Molecular characterization and expression of a two pore domain potassium channel in the CNS of Aplysia californica. Brain Res 1094, 4756.

PAGE 225

225 Kaldany, R.R., Nambu, J.R., and Scheller, R.H. (1985). Neuropeptides in identified Aplysia neurons. Annu Rev Neurosci 8, 431455. Kall, L., Krogh, A., and Sonnhammer, E.L. (2004). A combined transmembrane topology and signal peptide prediction method. J Mol Biol 338, 10271036. Kandel, E.R. (1976). Cellular basis of behavior : an introduction to behavioral neurobiology (San Francisco, W. H. Freeman). Kandel, E.R. (2001). The molecular biology of memory storage: a dia logue between genes and synapses. Science 294, 10301038. Kapranov, P., Cheng, J., Dike, S., Nix, D.A., Duttagupta, R., Willingham, A.T., Stadler, P.F., Hertel, J., Hackermuller, J., Hofacker, I.L., et al. (2007). RNA maps reveal new RNA classes and a pos sible function for pervasive transcription. Science 316, 14841488. Kim, K.H., Takeuchi, H., Kamatani, Y., Minakata, H., and Nomoto, K. (1991). Slow inward current induced by achatin I, an endogenous peptide with a D Phe residue. Eur J Pharmacol 194, 99106. Kiss, T., and Osipenko, O.N. (1997). Effect of molluscan neuropeptide RAPYFVamide on identified Helix pomatia L. neurons. Gen Pharmacol 29, 97102. Kissler, S., Susal, C., and Opelz, G. (1997). Anti MIP 1alpha and anti RANTES antibodies: new allies o f HIV 1? Clin Immunol Immunopathol 84, 338341. Klee, E.W. (2008). The zebrafish secretome. Zebrafish 5, 131138. Krajniak, K.G., Greenberg, M.J., Price, D.A., Doble, K.E., and Lee, T.D. (1989). The identification, localization, and pharmacology of FMRFa mide related peptides and SCPB in the penis and crop of the terrestrial slug, Limax maximus Comp Biochem Physiol C 94, 485492. Kuroki, Y., Kanda, T., Kubota, I., Fujisawa, Y., Ikeda, T., Miura, A., Minamitake, Y., and Muneoka, Y. (1990). A molluscan neuropeptide related to the crustacean hormone, RPCH. Biochem Biophys Res Commun 167, 273279. Letunic, I., Copley, R.R., Pils, B., Pinkert, S., Schultz, J., and Bork, P. (2006). SMART 5: domains in the context of genomes and networks. Nucleic Acids Res 34, D257260. Lewin, M.R., and Walters, E.T. (1999). Cyclic GMP pathway is critical for inducing long term sensitization of nociceptive sensory neurons. Nat Neurosci 2, 1823. Martianov, I., Ramadass, A., Serra Barros, A., Chow, N., and Akoulitchev, A. (2007 ). Repression of the human dihydrofolate reductase gene by a non coding interfering transcript. Nature 445, 666670.

PAGE 226

226 Matz, M.V. (2002). Amplification of representative cDNA samples from microscopic amounts of invertebrate tissue to search for new genes. M ethods Mol Biol 183, 318. McPhie, D.M., M. (2006). Biological Bulletin Virtual Symposium: Marine Invertebrate Models of Learning and Memory. Biological Bulletin, 3. Merritt, W.M.S.A.K. (2007). Markers of angiogensis in ovarian cancer. Dis Markers, 12. Moroz, L.L., Edwards, J.R., Puthanveettil, S.V., Kohn, A.B., Ha, T., Heyland, A., Knudsen, B., Sahni, A., Yu, F., Liu, L., et al. (2006). Neuronal transcriptome of A plysia : neuronal compartments and circuitry. Cell 127, 14531467. Ohta, N., Kubota, I., Ta kao, T., Shimonishi, Y., Yasuda Kamatani, Y., Minakata, H., Nomoto, K., Muneoka, Y., and Kobayashi, M. (1991). Fulicin, a novel neuropeptide containing a D amino acid residue isolated from the ganglia of Achatina fulica. Biochem Biophys Res Commun 178, 486493. Philippe, H., and Telford, M.J. (2006). Large scale sequencing and the new animal phylogeny. Trends Ecol Evol 21, 614620. Pickart, M.A., Klee, E.W., Nielsen, A.L., Sivasubbu, S., Mendenhall, E.M., Bill, B.R., Chen, E., Eckfeldt, C.E., Knowlton, M., Robu, M.E., et al. (2006). Genome wide reverse genetics framework to identify novel functions of the vertebrate secretome. PLoS One 1, e104. Pollard, K.S., Salama, S.R., Lambert, N., Lambot, M.A., Coppens, S., Pedersen, J.S., Katzman, S., King, B., Onodera, C., Siepel, A., et al. (2006). An RNA gene expressed during cortical development evolved rapidly in humans. Nature 443, 167172. Price, D.A., and Greenberg, M.J. (1977). Structure of a molluscan cardioexcitatory neuropeptide. Science 197, 670671. R udman, W.B. (2003). Ink glands (Syndney, Sea Slug Forum). Schatz, G., and Dobberstein, B. (1996). Common principles of protein translocation across membranes. Science 271, 15191526. Scheller, R.H., Jackson, J.F., McAllister, L.B., Rothman, B.S., Mayeri, E., and Axel, R. (1983). A single gene encodes multiple neuropeptides mediating a stereotyped behavior. Cell 32, 722. Schultz J., Milpetz, F., Bork, P., and Ponting, C.P. (1998). SMART, a simple modular architecture research tool: identification of signaling domains. Proc Natl Acad Sci U S A 95, 58575864.

PAGE 227

227 Sigwart, J.D., and Sutton, M.D. (2007). Deep molluscan phylogeny: synth esis of palaeontological and neontological data. Proc Biol Sci 274, 24132419. Smit, A.B., Geraerts, P.M., Meester, I., van Heerikhuizen, H., and Joosse, J. (1991). Characterization of a cDNA clone encoding molluscan insulin related peptide II of Lymnaea stagnalis Eur J Biochem 199, 699703. Smit, A.B., Thijsen, S.F., Geraerts, W.P., Meester, I., van Heerikhuizen, H., and Joosse, J. (1992). Characterization of a cDNA clone encoding molluscan insulin related peptide V of Lymnaea stagnalis Brain Res Mol B rain Res 14, 712. Sossin, W.S., Kirk, M.D., and Scheller, R.H. (1987). Peptidergic modulation of neuronal circuitry controlling feeding in Aplysia J Neurosci 7, 671681. Sossin, W.S., Kreiner, T., Barinaga, M., Schilling, J., and Scheller, R.H. (1989). A dense core vesicle protein is restricted to the cortex of granules in the exocrine atrial gland of Aplysia california J Biol Chem 264, 1693316940. Southey, B.R., Sweedler, J.V., and Rodriguez Zas, S.L. (2008). Prediction of neuropeptide cleavage site s in insects. Bioinformatics 24, 815825. Strand, F.L. (1999). New vistas for melanocortins. Finally, an explanation for their pleiotropic functions. Ann N Y Acad Sci 897, 116. Strand, F.L., Rose, K.J., Zuccarelli, L.A., Kume, J., Alves, S.E., Antonawic h, F.J., and Garrett, L.Y. (1991). Neuropeptide hormones as neurotrophic factors. Physiol Rev 71, 10171046. Suzuki, H., Iwamuro, S., Ohnuma, A., Coquet, L., Leprince, J., Jouenne, T., Vaudry, H., Taylor, C.K., Abel, P.W., and Conlon, J.M. (2007). Express ion of genes encoding antimicrobial and bradykininrelated peptides in skin of the stream brown frog Rana sakuraii Peptides 28, 505514. Sweedler, J.V., Li, L., Rubakhin, S.S., Alexeeva, V., Dembrow, N.C., Dowling, O., Jing, J., Weiss, K.R., and Vilim, F .S. (2002). Identification and characterization of the feeding circuit activating peptides, a novel neuropeptide family of A plysia J Neurosci 22, 77977808. System, G.M.I. (2008). Human Genome Project Information. Szell, M., Bata Csorgo, Z., and Kemeny, L. (2008). The enigmatic world of mRNA like ncRNAs: their role in human evolution and in human diseases. Semin Can cer Biol 18, 141148. Taft, R.J., Pheasant, M., and Mattick, J.S. (2007). The relationship between non protein coding DNA and eukaryotic complexity. Bioessays 29, 288299.

PAGE 228

228 Thompson, J.D., Gibson, T.J., Plewniak, F., Jeanmougin, F., and Higgins, D.G. (1997). The CLUSTAL_X windows interface: flexible strategies for multiple sequence alignment aided by quality analysis tools. Nucleic Acids Res 25, 48764882. Ugriumov M.V. (2009). Endocrine functions of the brain in adult and developing mammals Ontogenez 40, 1929. Walters, E.T., Bodnarova, M., Billy, A.J., Dulin, M.F., Diaz Rios, M., Miller, M.W., and Moroz, L.L. (2004). Somatotopic organization and functional properties of mechanosensory neurons expressing sensorin A mRNA in Aplysia californica J Comp N eurol 471, 219240. Wegener, C., and Gorbashov, A. (2008). Molecular evolution of neuropeptides in the genus Drosophila. Genome Biol 9, R131. Yongsiri, A., Takeuchi, H., Kubota, I., and Muneoka, Y. (1989). Effects of Mytilus inhibitory peptides on a gia nt neurone of Achatina fulica Ferussac. Eur J Pharmacol 171, 159165. Zhang, L., Tello, J.A., Zhang, W., and Tsai, P.S. (2008). Molecular cloning, expression pattern, and immunocytochemical localization of a gonadotropin releasing hormone like molecule in the gastropod mollusk, Aplysia californica. Gen Comp Endocrinol 156, 201209.

PAGE 229

229 BIOGRAPHICAL SKETCH Jinnie was born in Tampa, Florida in 1984. She g raduated from Land O Lakes Hi gh School in 2002. From there she went to the University of Central Florida and graduated with a Bachelor of Science degree in micro and m olecu lar b iology in 2006. Following graduation Jinnie be gan her graduate work at the University of Florida with a focus in neuroscience from a bioinformatic and molecular biology perspective. She completed a Master of Science in medical scienes in 2009.