Devices and Materials for Thz Spectrosopy

Material Information

Devices and Materials for Thz Spectrosopy Ghz Cmos Circuits, Periodic Hole-Arrays and High-Frequency Dielectric Materials
Arenas, Daniel
Place of Publication:
[Gainesville, Fla.]
University of Florida
Publication Date:
Physical Description:
1 online resource (115 p.)

Thesis/Dissertation Information

Doctorate ( Ph.D.)
Degree Grantor:
University of Florida
Degree Disciplines:
Committee Chair:
Tanner, David B.
Committee Members:
Hebard, Arthur F.
Reitze, David H.
Hirschfeld, Peter J.
Nino, Juan C.
Graduation Date:


Subjects / Keywords:
Bismuth ( jstor )
Conductivity ( jstor )
Dielectric materials ( jstor )
Electric fields ( jstor )
Interferometers ( jstor )
Raman scattering ( jstor )
Reflectance ( jstor )
Spectral reflectance ( jstor )
Transmittance ( jstor )
Wave diffraction ( jstor )
Physics -- Dissertations, Academic -- UF
arrays, bismuth, cmos, detection, ftir, ghz, hole, infrared, periodic, pyrochlores, raman, sources, spectroscopy, terahertz
bibliography ( marcgt )
theses ( marcgt )
government publication (state, provincial, terriorial, dependent) ( marcgt )
born-digital ( sobekcm )
Electronic Thesis or Dissertation
Physics thesis, Ph.D.


This dissertation is composed of three main projects, linked together by the THz region of the electromagnetic spectrum. In the first project, we detected the radiation from a silicon CMOS circuit, using a fourier transform interferometer. At the time of measurement, this 410 GHz circuit had the highest operating frequency for silicon integrated technology observed to date. The measured radiated power from the 410 GHz circuits was in the order of 0.01 microWatts. This circuit had radiated intensities comparable to those of commercially available black-body sources for the 200 - 400 GHz region. The high power and high emission per source area suggested possible spectroscopy applications. We also studied the optical properties of periodic hole-arrays with resonant frequencies in the THz region. Although the transmittance spectra of these structures have been extensively studied, here we present reflectance measurements that allow the analysis of the extinction/absorption spectra. The results were compared to predictions from the trapped-mode theory on the ohmic losses of these systems. Our results did not show the prediction of a suppression of the R + T spectra at the resonant frequency. Also, we studied the time-dependence of femtosecond pulses reflected from periodic hole arrays with resonant frequencies in the NIR region. Our results show that if the trapped modes theory is correct, then the lifetime of these modes are below 100 fs. Finally, in the third project, we studied the Raman active modes of various bismuth pyrochlores containing Zn, Mg, Ta and Nb, which have earned recent attention for high-frequency applications. The spectra of the four compositions are very similar, suggesting no major structural differences among these materials. The spectra were compared to those of other pyrochlores and specific discussions are offered for the assignment of each mode. Although there are clear differences between the spectra of these samples compared to other pyrochlores, these differences can be explained by the appearance of additional modes due to the relaxation of the selection rules (caused by the displacive disorder in the Bi pyrochlores). Some additional modes had frequencies close to modes in the IR data, and others had frequencies close to optically inactive modes calculated by computational work in the literature. The additional modes were tentatively assigned by this comparison. Finally, the existence of additional modes in the Raman spectra of all four compounds suggests no difference in the amount of disorder among these samples. ( en )
General Note:
In the series University of Florida Digital Collections.
General Note:
Includes vita.
Includes bibliographical references.
Source of Description:
Description based on online resource; title from PDF title page.
Source of Description:
This bibliographic record is available under the Creative Commons CC0 public domain dedication. The University of Florida Libraries, as creator of this bibliographic record, has waived all rights to it worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.
Thesis (Ph.D.)--University of Florida, 2009.
Adviser: Tanner, David B.
Statement of Responsibility:
by Daniel Arenas.

Record Information

Source Institution:
Rights Management:
Copyright Arenas, Daniel. Permission granted to the University of Florida to digitize, archive and distribute this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Resource Identifier:
489257358 ( OCLC )
LD1780 2009 ( lcc )


This item has the following downloads:

Full Text








First,Iwouldliketothankmyadvisor,ProfessorDavidB.Tannerforgivingmegreatopportunitiesinmygraduatecareer.Thankstohim,Ihavebeenfortunatetoworkinmanyprojectsandlearnagreatdeal.Hisadvice,teachingandcontagiousenthusiasmforphysicshavebeengreatlyvaluedandappreciated.AlsoIwouldliketothankmysupervisorycommittee:ProfessorArthurF.Hebard,ProfessorJuanNino,ProfessorDavidReitzeandProfessorPeterHirschfeld.Asagraduatestudent,Ihaveworkedinmanydierentprojectsandhavehadtheprivilegetomeet,collaborateandlearnfrommanywonderfulpeople.IwouldliketothankSinanSelcukandhisadvisorProfessorArtHebardforlettingmebepartoftheperiodicholearraysproject.ThankstoJinhoLee,TakahisaTokumotoandProfessorStephenMcGillinNHMFLforteachingmeandhelpingmeagreatdealinultrafastoptics.ProfessorKennethOforlettingmebepartofthe410GHzcircuitproject,andhisstudentsandmygoodfriendsEunyoungSeokandDonghaShim.ThankstoProfessorLevGasparovinUNFforhishelpintheRamanmeasurementandintroducingmetotheopticseldandteachingmewhenIwasanundergrad.ThankstoProfessorTomPekarekinUNFforhisinvaluableadviceinthelastsevenyears.OnceagainthankstoProfessorJuanNinoforhisteachingandpatienceinthebismuthpyrochloresproject;andhisstudentWeiQiu.AlsoimmensethankstoProfessorDavidSilvermanforlettingmebepartofhisCocrystalsprojectandhisstudentBaluAvaru.ThankstoJayHorton,MarcLink,EdStorch,RaymondFrommeyer,BillMalphurs,LarryPhelpsandRobHamersmaforallthehelpindesigning,repairingandbuildingequipment.Ilearnedagreatdealfromthem.ThankstoDr.RobertDeSerioandCharlesParksfortheirtutelagewhenIwasateachingassistant.Tomycolleaguesinthelab.NaveenMargankunte,mylabsenior,whomIlearnedsomuchinourlabandfromourtripstoNHMFL.DimitriosKoukis,whohasbeenthebestteammateanyonecouldwishtoworkwith.ThankstoNathanHeston,mygoodfriend 4




page ACKNOWLEDGMENTS ................................. 4 LISTOFTABLES ..................................... 8 LISTOFFIGURES .................................... 9 ABSTRACT ........................................ 11 CHAPTER 1INTRODUCTION .................................. 13 2DETECTIONOFRADIATIONFROMA410GHzCIRCUIT .......... 18 2.1Introduction ................................... 18 2.2ExperimentalProcedures ............................ 19 2.2.1CircuitDesign .............................. 19 2.2.2DetectionoftheRadiationUsinganInterferometer ......... 21 2.3ResultsandDiscussion ............................. 22 2.3.1DemonstrationoftheOperatingFrequency .............. 22 2.3.2EstimateoftheRadiatedPower .................... 22 2.4ConclusionsandFutureWork ......................... 24 3PERIODICHOLEARRAYS ............................ 29 3.1EnhancedTransmissionEect ......................... 29 3.2Theories ..................................... 30 3.2.1SurfacePlasmonsTheory ........................ 30 3.2.2DynamicalDiractionTheory ..................... 30 3.2.3TrappedModes ............................. 31 3.3ReectionandTransmissionStudiesofPeriodicHoleArrays ........ 32 3.3.1Motivation ................................ 32 3.3.2ExperimentalProcedures ........................ 32 3.3.3ResultsandDiscussion ......................... 33 3.4Ultra-FastOpticsStudyofPeriodicHoleArrays ............... 37 3.4.1Introduction ............................... 37 3.4.2ExperimentalProcedures ........................ 38 3.4.3ResultsandDiscussion ......................... 39 3.5ConsiderationsforNonlinearApplications .................. 39 3.6FutureWork ................................... 40 4RAMANSTUDYOFTHEPHONONMODESINBISMUTHPYROCHLORES 52 4.1Introduction ................................... 52 4.2ExperimentalProcedures ............................ 53 6


............................. 54 4.3.1TentativeAssignmentofthe\Ideal"Modes .............. 54 4.3.2TentativeAssignmentofthe\Disorder"Modes ............ 56 4.4Conclusions ................................... 60 4.5FutureWork ................................... 61 APPENDIX AEXTRACTINGELECTROMAGNETICWAVESANDTHEOPTICALCONSTANTSFROMMAXWELL'SEQUATIONS ........................ 71 A.1Introduction ................................... 71 A.2ElectromagneticWavesandtheOpticalConstants .............. 72 BBOUNDARYCONDITIONS.TRANSMITTANCEANDREFLECTANCE ... 78 CRESPONSEFUNCTIONSANDKRAMERSKRONIGANALYSIS ....... 82 DMICROSCOPICMODELSFORTHEOPTICALCONSTANTS ......... 89 D.1TheDrudeModel ................................ 89 D.2LorentzianOscillators ............................. 92 EINTERFEROMETERS ............................... 95 E.1Derivation .................................... 95 E.2PropertiesoftheInterferogram ........................ 97 E.3Resolution .................................... 98 FSURFACEPLASMONS ............................... 101 REFERENCES ....................................... 108 BIOGRAPHICALSKETCH ................................ 115 7


Table page 4-1RamanmodesandtentativeassignmentofBMN,BZN,BZTandBMT. ..... 62 4-2ComparisonbetweenIRmodesandRamanmodes. ................ 62 4-3ComparisonbetweentheRamanmodesofBMNandotherpyrochlores ..... 63 8


Figure page 2-1CircuitDiagram .................................... 26 2-2Emissionspectrumofthe410GHzcircuit. ..................... 26 2-3Observedemissionpeakforthe410GHzcircuit. .................. 27 2-4Emissioncomparisonbetweenthecircuitandblackbodysources. ......... 27 2-5Sourcecompartmentdiagram. ............................ 28 2-6Sourcecompartment.Collectingmirrorandaperture. ............... 28 3-1Aperiodicholearray. ................................. 41 3-2Transmittancespectraoftwoperiodicholearrays. ................. 41 3-3R+TspectraforZnSe. ............................... 42 3-4PredictedR+Tfromtrappedmodestheory. .................... 42 3-5RandTspectra.Dg=6m(ZnSesubstrate). .................. 43 3-6R+Tspectra.Dg=6m(ZnSesubstrate). .................... 43 3-7RandTspectra.Dg=8m(ZnSesubstrate). .................. 44 3-8R+Tspectra.Dg=8m(ZnSesubstrate). .................... 44 3-9Reectanceandtransmittancespectrafortwoperiodichole-arraysonaquartzsubstrate. ....................................... 45 3-10Sumofthereectanceandtransmittancespectraforthetwoperiodichole-arraysonaquartzsubstrate. ................................ 45 3-11Caricatureofasharppulsetransmittedthroughanarray. ............. 46 3-12Caricatureofabroadpulsetransmittedthroughanarray. ............ 46 3-13Caricatureofapulsewithtimewidthcomparabletothemodeslifetime ..... 47 3-14NHMFLSetup. .................................... 48 3-15Autocorrelationdataforthereectedpulsefromthesilverlm. ......... 49 3-16Autocorrelationdatafortheperiodicholearrays. ................. 50 3-17Comparisonoftheautocorrelateddataforthereectedpulsefromthesilverlmsandthevarioushole-arrays. .......................... 51 9


................................. 64 4-2BMNRamanspectrum. ............................... 65 4-3BZNRamanspectrum. ................................ 66 4-4BMTRamanspectrum. ............................... 67 4-5BZTRamanspectrum. ................................ 68 4-6ComparisonofRamanspectrabetweenthefoursamples. ............. 69 4-7NormalmodesofalinearO-A-Omolecule. ..................... 70 A-1Boundaryconditionsataninterface. ........................ 77 C-1Complexplane .................................... 88 E-1Diagramofabasicinterferometer. .......................... 99 E-2Interferenceinaninterferometer. .......................... 99 E-3Caricatureofaninterferogram. ........................... 100 E-4Resolution. ...................................... 100 F-1Surfaceplasmonsattheinterface. .......................... 107 F-2TEandTMpolarizationforasurfacewave .................... 107 10






1 2 ],multiferroics[ 3 ],manganites[ 4 ],nanostructures[ 5 ],heavyfermions[ 6 ],andothers.Theinfraredspectrumisseparatedintothreeregions(withvariousboundariesdependingonthedivisionscheme),thefar-infrared(10-700cm1;0.3-21THz;1000-15m),themid-infrared(700-4000cm1;15-2.5m),andthenear-infrared(4000-14000cm1;2.5-0.7m).The\THz"regionofthespectrumisnowusedtospecifythe0.3-3THzrange,althoughsomeauthorsmayextendthisdenitionto30THz[ 7 ].The0.3-3THzregionwasonceconsideredapoorlydevelopedregionofthespectrumduetothelackofintensesources[ 8 ].Blackbody(thermal)sources,themostcommoninspectroscopy,havelowintensityattheselowfrequencies.Foralongtime,thefrequenciesintheTHzregionwereconsideredtoofastforsolid-statecircuits,andtooslowforsolid-statelasers[ 9 ].OneoftherstalternativewaystogenerateTHzradiationbeganinthe60swiththeuseofnonlinearcrystalsfordierencefrequencygeneration[ 10 ]andparametricamplication[ 11 { 13 ].However,judgingfromtheliterature,theexplosioninTHzresearchandsourcesseemedtooccurinthemid80swiththeuseoffemtosecondlaserstoinduceTHzradiationfromvarioussystems;suchasphotoconductingstructures[ 14 { 20 ]andelectro-opticmaterials[ 21 22 ].ThegenerationofTHzradiationfromquantumcascadelaserswasalsoanimportanteldinthe90sandcontinuestobeso[ 23 24 ].Forthelastdecade,thenewexcitingandpowerfulsystemsforTHzradiationincludefreeelectronlasers(FEL)[ 9 ],synchrotronsources[ 25 26 ],andothersystemsthatalsouserelativisticelectronstogenerateTHzradiation[ 27 { 29 ]. 13


30 ],andhencethedetectionofcertaincancercells[ 31 32 ].ThehightransmissionofTHzradiationthroughnon-metallicmediasuchasshoes,clothesandcardboard,hasalsomotivatedtheuseofTHzimagingfordetectionofconcealedweapons[ 33 34 ].Furthermore,thereiscontinuousresearchinthedetectionofdangerousmaterials,suchasexplosives[ 35 36 ],chemicalagents[ 37 38 ],andevenillicitdrugs[ 7 39 ].Areviewoftheseandotherapplications,aswellasotherTHzsourcesnotmentionedhere,isgivenbySiegelinreference[ 8 ].AlthoughthesenewTHzsourceshaveallowednewexcitingresearchinthisregion,theirsizesarebigandtheircostsarehigh.Forwidespreadapplications,itisdesirabletobuildmorecompact,andmoreimportantly,cost-ecientsourcesanddetectors.Onepossibilityistheuseofmainstreamsilicontechnology,suchasCMOS(complimentarymetal-oxidesemiconductors),tobuildfastcircuits.TherstprojectofmygraduatestudiesdealsinthisareaandispresentedinChapter2.ThischaptershowsthedetectionofTHzradiationfroma410GHzCMOScircuitequippedwithapatchantenna.ThecircuitwasdesignedbyDr.KennethO'sgroupintheSiliconMicrowaveIntegratedCircuitsandSystemsResearchGrouplocatedatUniversityofFloridaDepartmentofElectricalandComputerEngineering.And,itwasconstructedatTexasInstruments.Whenthecircuitwasconstructed,therewerenoavailablehigh-frequencyprobesabove325GHz[ 40 ]atthetime.Ourcontributiontothisprojectwastodemonstratetheoperating-frequencyofthecircuitbymeasuringitselectromagneticradiationusingaFourierTransformInterferometer.Atthetimeofmeasurement,thiscircuithadthehighestoperatingfrequencyofanycircuitfabricatedwithsiliconintegratedmainstreamtechnology;and,marksthersttimeforthirtyyearsthataCMOScircuitisfasterthan 14


41 { 46 ].Periodicholearraysexhibitaneectwhereatresonantwavelengths,thetransmittancethroughthemetallmsexceedsthevaluepredictedbydiractionandgeometricoptics[ 47 ].Theexplanationofenhancedtransmissioninperiodichole-arraysremainscontroversialandseveraladditionaltheorieshavebeenproposed.AmongthesetheoriesistheTrappedModestheory,whichstatesthatataresonantfrequencynearthediractionthreshold,theelectromagneticeldsgettrappedinthesub-wavelengthsstructuresforacharacteristiclifetime[ 48 49 ].Thistheoryisfascinatingbecauseitsuggeststemporalmanipulationoflightandhasproposedexcitingapplicationsinnonlinearoptics[ 50 ].Thenonlinearopticspossibilitiesareimportantbecausetheycouldleadtoopticalsignalprocessing,wherethepurposeistocontrollightusinglight[ 44 ].Manyoftheapplicationsofthesestructures,includingnonlinearoptics,isrelevanttotheinfraredandTHzregionduetoourabilitytotunetheresonantfrequencyofthesestructuresbychangingtheperiodicityoftheholes.Inthiswork,wetrytotesttwopredictionsfromthetrappedmodestheory.Wemeasuredthetimecharacteristicsofa100fspulsereectedbyperiodichole-arrays,toseeifthelifetimeofthetrappedmodeswascomparabletothepulsetemporalwidth.TheotherpredictionstatesthatwhenEMmodesgettrappedattheresonantfrequency(redshiftedfromthediractionthreshold), 15


49 ].Inthisworkwewereabletomeasurenotonlytransmittance,butalsoreectance,forperiodichole-arraysandtestedtheprediction.Chapter4isabouttheRamanstudyofphononmodesinbismuthpyrochlores.Bismuthpyrochloreshaveearnedrecentattentionforhigh-frequencyapplicationsthankstotheirlowloss,high-permittivityandgoodtemperaturestability[ 51 ].WepresenttheRamanspectraoffourdierentbismuthpyrochlores:Bi3=2ZnNb3=2O7(BZN),Bi3=2ZnTa3=2O7(BZT),Bi3=2MgNb3=2O7(BMN)andBi3=2MgTa3=2O7(BMT).ThepurposeofthisworkwastocomparehowtheRamanactivemodesbehavedacrossthefoursamplesandtocomparethemtootherpyrochlorestructures.Ourresultsshowthatspectraisoverallsimilarforthefourbismuthpyrochlores,butshowskeydierencestootherpyrochlorematerials.TheobservationofmorethanthesixRamanmodespredictedfromtheidealpyrochlorestructureconrmedthedisplacivedisorderinthebismuthpyrochlores.Comparisontotheinfrareddata[ 52 ]andcomputationalworkonotherpyrochlores[ 53 ]allowedidenticationoftheadditionalmodesduetotherelaxationoftheselectionrules.Besidestheprojectsmentionedinthisthesis,I'vehadtheopportunitytostudyothertypesofmaterialsusingIRspectroscopy[ 54 55 ].Inourlab,itiscommontocollaboratewithgroupsinterestedintheopticalpropertiesoftheirsamples.Inthisdissertation,theappendicesgiveabriefoverviewsoftheopticalconstants.Theseappendicesaremeanttoprovideapedagogicalintroductionforthebenetofyoungerstudentswhochoosetoreadthisthesis.AppendixArstshowshowtheopticalconstantsareobtainedfromMaxwell'sequationsandapropagatingwavesolution.Itshowswhytheycanbecomplexfunctions,andhowtheopticalconstantsareinter-related.Then,appendixBshowshowtheboundaryconditionsataninterfacebetweentwomediarelatetheopticalconstantstoreectanceandtransmittance.AppendixCshowsthederivationandtheuseofthe 16




40 ].The300GHz-3THzspectrum(dubbedtheTHzregion)hasbeenextensivelystudiedforuseinradars,remotesensing,advancedimagingandbio-agentandchemicaldetection[ 8 56 57 ].Tobringthepricedownoftheseapplications,itisdesirabletobuildtheTHZcircuitsusingthemain-streamsiliconintegratedtechnologyCMOS(Complimentarymetal-oxidesemiconductors)[ 40 58 ].ATHzcircuitcouldalsobeusefulinspectroscopyapplications,sinceblackbodysourceshavelowpowerintheTHzregionandtheirintensitydiesoatlongerwavelengths.Furthermore,thesecircuitscouldlaterbedesignedwithtunablefrequenciessothattheycanbeusedinspectroscopywithouttheuseofinterferometers.Inthiswork,wereportTHzradiationfroma410GHzCMOScircuit.Thiscircuithasthehighestoperatingfrequencyamongthosefabricatedusingcost-ecientsiliconintegratedtechnology.ItwasdesignedbyDr.KennethO'sgroupintheSiliconMicrowaveIntegratedCircuitsandSystemsResearchGrouplocatedattheUFElectricalandComputerengineeringdepartment(UF-EEL).Atthetimeofthecircuit'sdesignandconstruction(2007),highfrequencyprobescouldnotbeusedtomeasureitsoutputduetothelackofprobesavailableabove325GHz[ 40 ].Instead,theoperatingfrequencyoftheCMOScircuitwasdemonstratedbymeasuringitselectromagneticradiationfromanon-chippatchantennausinganinterferometer.AllopticalmeasurementswereperformedattheTannerlabinUF-Physics.Weestimatedthe410GHzradiationpowerofthecircuitataround0.001-0.01W.Atthesefrequency,thepowerfromthiscircuitiscomparabletocommerciallyavailableblackbodysourcesusedininterferometers.And,thesmaller 18


2.2.1CircuitDesignAspreviouslystated,allthecreditincircuitdesigngoestoourcollaboratorsDr.EunyoungSeok,DonghaShimandP.I.Dr.KennethOfromUF-EEL.ThecircuitwasbuiltinNXPSemiconductorsandTexasInstruments.Figure 2.4 showsadiagramoftheircircuit.Thepush-pushoscillatorisequippedwithapatch-antennatoextractthesignal.TheresonantfrequencyofthecircuitisdeterminedbythecapacitancesofthetransistorsM1andM2andtheinductorsL1andL2.Asalloscillators,theamplier(i.e.transistor)limitsthemaximumfrequencyofthefundamental.Thisfrequencyisreferredtoasfmaxandcorrespondstothemaximumfrequencyatwhichthetransistorwillgiveanamplicationhigherthanunity.Forourcircuit,thisfrequencyisaround200GHz.Toincreasetheoperatingfrequency,thesecondharmonicofthefundamentalwasgeneratedbyusingapush-pushoscillatorarchitecture.Inthisdesign,thecross-coupleddesignofthetransistorsintheoscillatorcoreissuchthattheirsignalsare180degreesoutofphase.Unlikethefundamental,thesecondharmonicsignalgeneratedduetononlinearityofthetransistorsisinphase: 19


TwoPMOStransistors(M3andM4)areusedtobiasthecore,andtwoquarterwavetransmissionlines(T.L1andT.L2)areusedtoisolatethesecomponentsfromthefundamentalandsecondharmonic.Detailsonthecircuit'sandpatchantennadesigncanbefoundinreferences[ 40 ]and[ 59 ]. 20


1 21


2.3.1DemonstrationoftheOperatingFrequencyFigure 2-2 showstheresultsforthepowerspectrumofthecircuit,andthebackgroundspectrum(circuito).Thesignalat410GHzconrmstheoperatingfrequencyofthecircuit,althoughthefundamentalofthecircuitisalsoobservedat205GHz.Theremainingbaselineintensityabove10cm1inthebackgroundseemslikeblackbodyradiationfromthecircuitbeinghotterthanroomtemperature.Figure 2-3 showsthespectrumofthe410GHzcircuitneartheemissionpeak(thebackgroundhasbeensubtractedforthisgure).TheFWHM(FullWidthHalfMaximum)ofthepeakisaround0.1cm1whichcorrespondstotheresolutionofourmeasurements.Thissuggeststhatwecannotresolvethewidthoftheemissionpeakwithourinterferometrysetup. 2-4 showsacomparisonbetweenthepowerofthe410GHzradiation(substractedfromthebackground)tothepowerofthemercurylampatthesameconditions.Thespectrashowsthattheradiationpowerofthecircuitiscomparabletothatofacommerciallyavailablespectroscopysourceforthenarrow3GHzbandofemission.Toestimatethepowerfromamercurylampat410 22


c2;(2{8)whereB(T)isthespectralradiancewithSIunitsofW/m2Hzsr(srreferstosteradians,theunitsofsolidangle),kBistheBoltzmannconstantequalto1.38x1023J/K,andisthefrequency.Ourmercuryarclamphasatemperaturecloseto5000K,whichyieldsaspectralradianceofaround2.6x1013W/m2Hzsrfor410GHz.Toestimatetheradiationareafromtheblackbodysourceandthecollectedsolidangle,werefertoFig. 2-5 and 2-6 .Thecollectingmirrorhasadiameterof70mmanditimagesthesourceintoanapertureofvaryingdiameter(Fig. 2-5 ).Sinceonlythelightthatpassesthisaperturegoesintotheinterferometer,theeectiveradiationareafromthesourceisapproximatelytheareaoftheaperture(whichhasa10mmmaximumdiameterfortheBruker113v): Area=(5mm)2=8105m2:(2{9)Tocalculatethecollectedsolidangle,weusethediameterofthecollectingmirroranditsdistancetothesource(Fig. 2-6 ): =2(1cos);(2{10)whereistheangleoftheradiationconeandisequalto: tan=35 240;(2{11)whichyieldsasolidangleof0.07sr.Thereforethepowerradiatedfromthemercurylampinthefrequencywidth(d)of3GHzisapproximately: 23


2-4 suggeststhatthepowerofthecircuitishigherthan0.001W,butlowerthanourrstestimate(0.01W)usingthesensitivityofthedetectorreportedbythecompany.Theeciencyinemissionperunitareaisveryhighforthe410GHzsource.Themercuryarclamphasanareaofapproximately8x105m2whilethepatchantenna(200x200m2)forthe410Ghzcircuithasanareaintheorderof4x108m2.Thissuggeststhatthe410GHzsourceisintheorderof1000moreecientinemissionperunitarea.(Theequivalentofhavinga106Kblackbodysource). 24




Circuitdiagramforthepush-pushoscillatorsystemwithanon-chippatchantenna. Emissionspectrumofthe410GHzcircuit. 26


Observedemissionpeakforthe410GHzcircuit. Emissioncomparisonbetweenthe410GHzcircuitandthemercurylampandglobarlampnormallyusedinourBruker113vinterferometer. 27


DiagramofthesourcecompartmentforthemercurylampusedinourBruker113vinterferometer.Notdrawntoscale! Dimensionsforthecollectingmirrorandapertureusedtocalculateradiationareafromthesourceandthecollectedsolidangle. 28


60 ]showedthatforwavelengthslargerthantheholesizea,thetransmittancefallsoas: lima 1Ta !4:(3{1)However,Ebbesenetal.[ 47 ]discoveredthatforaperiodicarrayofsuchsub-wavelengthholes,thetransmittancespectracanexhibitlargetransmittancepeaks.Thiseectisevenmorepuzzlinginthateveninthegeometricopticslimit(a)thetransmittanceshouldnotexceedtheopenareafractionfoftheholes.Theopenareafractionofsquareholesonasquaregridisgivenby: Dg!2;(3{2)whereDgisthehole-separation(SeeFig. 3-1 ).Figure 3-2 showstwoexamplesfortheenhancedtransmittanceeectforperiodicholearrays.ThespectrashownareforpatternedsilverlmsonaZnSesubstratewithtwodierentperiodicitiesandopenareafractionof0.44(Fig. 3-3 showsthetransmittanceandreectanceofthesubstrate.)Thespectrashowthatthelocationoftheenhancedtransmittancepeakchangesfordierentperiodicitiesofthesample.Theenhancedtransmissioneecthasreceivedmuchattention[ 47 61 { 70 ]andhassuggestedmanyexcitingapplicationsinlightmanipulationandnonlinearoptics[ 44 50 71 72 ].However,theexplanationofthiseectremainscontroversial.And,althoughtheoriginal[ 47 ]andstillpopular[ 62 66 73 { 78 ]explanationbyEbbesenetal.attributedtheeecttosurfaceplasmons,otherexplanationshavebeenproposed.Inthenextsections,wewillmentiononlytwooftheothertheories:dynamicaldiractionandtrappedmodestheory(althoughthereaderissuggestedtosee 29


79 { 83 ]foradditionaltheories).AlthoughIcannotoerinsightintothevalidityofthesetheoreticalorcomputationalarguments,thepurposeofthisworkwastoidentifypredictionsoeredbythesealternatetheoriesandtothenmeasurethem. 3.2.1SurfacePlasmonsTheoryTheenhancedtransmissioneectwasoriginallyattributedtotheinteractionoflightwithsurfaceplasmons(SPs)intheperforatedmetallm.Surfaceplasmonsareelectromagneticwavesconnedtotheinterfacebetweenapositivedielectricandanegativedielectric.Thewavepropagatesalongthesurfaceandcanonlycoupletolightwhenthesurfacehasaperiodicstructure.(SeeAppendixFforabriefdiscussiononsurfaceplasmons).ThemechanismproposedconsistsinexcitationofaSPinthetopofthelm,andareemissionoflightbyanSPatthebottomofthelm.Ebbesenetal.attributedthecausalroleofenhancedtransmissiontoSPsduetotwoimportantresults:One,usingangledependenttransmittancemeasurements,Ebbesenshowedthatthefrequencyofenhancedtransmissionversusthewavevectorkgivesadispersioncurvecharacteristicofsurfaceplasmons;and,theyshowedthatperiodicholearraysinGe(positivedielectric)didnotshowenhancedtransmission. 84 ]and[ 85 ]arguethatSPsdonotplayacausalroleinenhancedtransmission,andthattheeectislinkedtodiraction.Theinspirationforthistheoryisbasedondynamicaldiractiontheoryforx-rays.Perfectlyorientedcrystalsradiatex-raylightcoherentlyandcauseanomalouseectsatwavelengthsclosetothelatticeconstantofthecrystal(d).Ewald[ 86 ]createdthecoherentdynamicaldiractiontheorytoexplaintheseeectswhichwereunaccountedforbytraditionalkinematicdiractiontheory.ThetheoryconsistsinsolvingMaxwell'sequationsinaperiodicmedia,wheretheperiodicityofthedielectricfunction,(~r),iswrittenas: 30


84 ].Treacyetal.[ 85 ]arguedthatholearraysarebasicallythesamesystemexceptwithnegativedielectricconstantsasopposedtotheclosetounitydielectricinx-raydiraction.Theirtheoryandcalculationsalsosuccesfullyexplaintheenhancedtransmittanceeect.Theelegantpartofthistheoryisthatitarguesthatenhancedtransmission,anomalousx-raydiractionincrystals,andevengapsinphotoniccrystalsareallbasicallythesameeect.Fordiscussionsonphotoniccrystals,pleasereference[ 41 87 88 ]. 48 { 50 89 { 92 ]statesthatataresonantfrequency,wheretheenhancedtransmittanceeectoccur,theelectromagneticeldsgettrappedinthevicinityoftheholesanddecaybyemittingnearlymonochromaticlight.Thecharacteristicdecaytimeisrelatedtotheinverseofthewidthofthetransmittancepeak.Similartothedynamicaldiractiontheory,thetrappedmodestheoryarguesthatETeectispurelygeometricandnotduetosurfaceplasmons.Theircalculationsconsistonfullysolvingthetime-dependentMaxwell'sequationsforradiatingboundaryconditions.Theirresultsshowaresonantfrequencynearthediractionthresholdswheretheelectromagneticmodesgettrappedandenhancedtransmittanceoccurs.Thereareseveralpredictionsoeredbythetrappedmodestheory[ 49 50 ].Wewillstateheretheonesrelevanttothisdissertation: 1. Ohmiclossesandthereforeabsorptionshouldincreaseattheresonantfrequencyduetothe\longer"exposureofthemodestodissipativeprocesses.Thisohmiclosses(orabsorptive)peakshouldalsodependontheopen-areafractionofthearray. 2. Trapping(ordelay)oflightinsideperiodicholearraysoccursattheresonantfrequency. 3. Thetrappingoflightin2Dstructurescanleadtousefulapplicationsinnonlinearoptics. 31


3.3.1MotivationAsstatedintheprevioussection,thetrappedmodestheorystatesthatlightgetstrappedinthevicinityoftheholesattheresonantfrequency,andthendecaysbyemission.Theypredictthatatthisfrequency,electromagneticeldsareexposedtoenergy-lossmechanismsforalongertime.Theircomputations[ 49 ]showadipinthespectraofthesumofthetransmittanceandreectanceneartheresonantwavelength(SeeFig. 3-4 ).Thisdipisattributedtoabsorptionduetoohmiclosses,andisthereforeredshiftedfromthediractionthreshold(redshiftedsimilarlytotheenhancedtransmittancepeak).Asof2006,whenthisprojectgotstarted,therewasnotmuchworkdoneonthereectanceofperiodicholearrays,andthereforedataontheextinctionorabsorptionofthesesampleswaslimited.Thelackofreectancedatawasperhapsduetothehigherdicultyofmeasuringreectanceinsteadoftransmission.Inthiswork,wepresentreectanceandtransmittancedatafortwosetsofsamplesfabricatedbydierentmethodsandmeasuredwithdierentequipmentatdierentspectra.FortheNIR-VISregion,weshowdatafromsilverlmsgrownonquartz,andwealsoshowdatafortheFIRregionforsilverlmsgrownonZnSe. 93 ].Thereectanceandtransmittancedataof 32


FIR:AglmsonZnSe.Figure 3-3 showsthereectanceandtransmittanceoftheZnSesubstrateandtheirsumR+Tspectra.Asshownbythisgure,theabsorptionintheZnSesubstrateisverysmallforfrequenciesbetween650-4000cm1butbecomesverystrongforfrequenciesbelow650cm1.Thereisastrongphononmodearound200cm1andthethicknessofthematerial(1cm)makesthetransmittanceverysensitivetosmallabsorptioncoecients.TheindexofrefractionoftheZnSesubstratenswas2.4andthisvaluewasconrmedbyboththereectanceandtransmittancemeasurement.Fornormalincidence,theenhancedtransmittancepeakoccursnearthediractionthreshholdassociatedwiththeindexofrefractionofthesubstrate: 33


3-5 showourresultsforthereectanceandtransmittanceofDg=6mholearrays.Thediractionthresholdsandthestrongesttransmittancepeakareobservednear700cm1,and,thenextthresholdislocatedaround1000cm1.Thereectancedatashowedthedipassociatedwiththetransmittancepeakandthediractionthresholds.Ithasbeenpredictedandobservedthatarrayswithlargeropenareafractionsfhavelargerwidthstransmittancepeaks[ 49 94 ].Theopenareafractionofthesesamplesisgivenby: 49 ].Ourdatasupportspreviousresultsfortherelationbetweenwidthandopenareafraction.Forthef=0.25sample(leftofFig. 3-5 )thefullwidthhalfmaximum(FWHM)is40cm1and70cm1forourf=0.44sample(right).ThemainpurposeofthereectancemeasurementswastotestthepredictionofthetrappedmodestheorythatadipoccursintheR+Tspectra(correspondingtoapeakintheabsorption)duetoohmiclosses.Thetheoryalsostatesthatsmalleropenareafractionsamplesshouldhavemorepronounceddipssincethemodesarelongerlived.Figure 3-6 showsourresultsfortheR+TspectraoftheDg=6msamples.Forsimplicity,weplotR+Tinsteadofabsorptionorextinction,becauseatwavelengthssmallerthanthediractionthresholdnsDg,bothabsorptionanddiractionlossesarepossible: 34


49 ]computationsshowsgoodagreementintheoverallshapeoftheR+Tspectra.However,althoughourresultsshowadipintheR+Tspectra,thisdipislocatednearthediractionthresholdandnotredshiftedattheresonantfrequency.Therefore,thisdipintheR+Tspectracouldbeattributedtodiractionlosses,andnottoohmiclosses.AnothersetofsampleswithperiodicityDgof8mandopenareafractionsof0.25and0.44werealsostudied.Thetransmittancepeakofthesesamplesarelocatednear540cm1(Figure 3-7 )wheretheabsorptionoftheZnSebecomesnoticeable.Thereforetheanalysisofthesesampleshastobemorecareful.Figure 3-8 showstheR+Tspectraforthesetwosamples.Theresultsforthesearraysisthesameasfortheprevioussamples.TheoverallshapeoftheR+Tspectraagreeswithcomputation,butthedipisseennearthediractionthresholdandnotredshiftedneartheresonantfrequency. 3-9 (right)showsthereectanceandtransmittancespectraforaperiodicholearrayonquartzwithperiodicityof0.8mandopenareafractionof0.25.Theindexofrefractionofquartzis1.4andtheabsorptioninthisregionisnegligible.Thediractionthresholdforthisperiodicityisobservedandexpectedtobearound9000cm1.Thereectancedataisalsoconsistentwiththetransmittancedata.TheR+TspectraisshowninFigure 3-10 (right).ThereisasmalldipinR+Tattheresonantfrequency,butsimilarlytotheZnSesamples,thereisamuchstrongerdipnearandblueshiftedfromthediractionthreshold.Similarresultswereobtainedforlmswithperiodicityof1m.Inconclusion,forvarioussamplesfortwodierentfabricationandopticalmeasurement,theoverallshapeoftheR+Tspectraagreeswithcomputations.However,wedonothaveadirectobservationofthetrappedmodestheorypredictionduetothefactthat 35




3.4.1IntroductionThemainpredictionfromthetrappedmodestheoryisthatlightgetstrappedinsidetheperiodicholearraysandthenisremittedwithacharacteristicdecaytime2/.Totestthisprediction,westudiedthetimedependenceofatransmittedorreectedpulsefromaperiodichole-array.Figure 3-11 showsacaricatureofthereasoning.ThepulseisGaussianintime,withadurationsetbythepropertiesofthelasersource.Ifthelifetimeofthemodesislargerthanthepulsewidth,thenthetransmittedorreectedpulsewillbebroadenedwithanexponentiallydecayingtail,characteristicofthemodelifetime.However,ifweuseapulsethatistoolong,thenweexpectthepulsetoremainthesame(Fig. 3-12 ).Ifthelifetimeofthemodesiscomparabletothedurationofthepulse(Fig. 3-13 ),thenthedetectionofthiseectwouldrelyonthefasterdecayoftheGaussianpulseinsteadofanexponentialdecayprocess.Tostudypulsesthisshort(100fs),wehadtouseautocorrelationbecausewecannotmeasuretheirtemporalprolewithequipmentsuchasstreakcameras.Inautocorrelation,abeamsplitterisusedtosplitthebeam,whicharethenmixedinanonlinearcrystaltoobtainthesum-frequency.Thisnonlinearprocessmakessignaltonoise(S/N)averyimportantissue.Also,theautocorrelationofthepulsemustbesymmetricandtherefore,weloseinformationaboutthepulse(forexample,wewouldloseinformationonthesharpleftsideofthepulseinFig. 3-11 );however,theautocorrelatedpulseshouldstilllookbroader.TheDg=6msamples(Fig. 3-5 )ontheZnSesubstrateshadwidths50cm1(1.5THz).TheQofthesesamples10andbasedonthewidthweexpectedthelifetimestobearound100fs.However,femtosecondpulsesintheFIRregionarelimitedandareonlyavailableforspecializedfreeelectronlasersinnationallabssuchasJeersonLab(Virginia,USA).IntheNIRregion,however,chirpedpulseampliers(CPA)andopticalparametricamplifers(OPA)canachieve100fspulses.ACPA-OPAsetupisavailableintheUltrafast-OpticsCellintheNationalHighMagneticFieldLab(NHMFL).Forthe 37


3-9 )resultsinlifetimesaround10-100fs.Wecarriedouttheultra-fastopticsmeasurementsforfoursampleswithresonantwavelengthsnear1600nm.Ourresultsshownobroadeningofthepulseandsuggestthatthelifetimeofthetrappedmodesinthesesamplesisbelow100fs. 3-14 showsadiagramofthesetup.Femtosecondpulseswithfrequency12500cm1(375THz;800nm)atarepetitionrateof1KHzwereobtainedfromaClark-MXRCPA-2001chirpedpulseamplier.Tobringthisfrequencyneartheresonantfrequencyofoursamples,weusedaTOPAS4/800OPAandhalvedthefrequencyto6250cm1(188THz;1600nm).TheautocorrelationofpulsesfromtheOPAshowedthatthewidthofthesepulseswerearound140fs.Thenormal-incidentreectedbeamwasmeasuredbyusingabeamsplitterinthegeometryshowninFig. 3-14 .Allfourarraysmeasuredwereinthesamesilverlm;andthelmwastransversallydisplacedfromtheincidentbeamtochangebetweendierentarraysandtomeasurethesilverlmasreference.TheautocorrelatorsetupusedtomeasurethetimeproleofthereectedpulseisshowninFig. 3-14 .Abeamsplitterwasusedtosplitthebeamintotwopaths,andonepathcontainedamovableretro-reectorusedtochangethepathlength.Then,usingalens,thetwobeamswerefocusedintoaBBO(BaB2O4)nonlinearcrystal.Thesum-frequency(SF)generatedbeamwasthenfocusedintoaphotodiodedetectorandthissignalwasusedastheautocorrelateddata.Thelaserpowerincidentintothesamplewaskeptbelow1mW.The1mJ/cm2highlaseruencewasnecessarytoobtaingoodS/Nfromtheautocorrelationsetup.Afterthelaser 38


3-15 showstheautocorrelationdataforthebeamreectedfromthesilverlm.TheFWHMoftheautocorrelationpulseisaround200fs,whichgivesapulsewidthof140fs.Figure 3-17 showstheresultsfortheperiodicholearraysofvaryinggeometrycomparedtothesilverpulse.Theresultsshownobroadeningofthepulseoranyappreciablehighersignalforthelongertimedelays.ThereforeourresultssuggestthatiftheEMmodesdogettrappedinoursamples,theyhavealifetimelessthan100fs. 50 ].Instandardnonlinearmaterials,theinteractionlengthoftheEMeldshastobemanyordersofmagnitudehigherthanthewavelength,andthereforethematerialshavetobethick.Thetrappedmodestheoryenthusiastsarguethatforholearrays,thereisnorequirementforalonginteractionlengthbecausetheeldsinteractforalongtimebeforeradiating.Theircomputations[ 50 ]report105enhancementofnonlineareectsonperiodicholearrayslledwithnonlinearmaterials,andtheenhancementisattributedtothelongerinteractiontimeoftrappedmodes[ 50 ].Unfortunately,themanuscriptdoesnotreportthelifetimeofthemodesfortheirsimulation.Here,wepresentasimplistic(andperhapsnaive)insightintohowlongthelifetimeofthesemodesshouldbeforpossibleapplications.AtypicalBBOcrystal(liketheoneusedinthisworktondthesum-frequencygeneration)isabout5mmthick,andcanhaveecienciesintheorderof10%forsecondharmonicgenerationinthevisible.Thisinteractionlengthof5mmisintheorderof1000timesthewavelengthandtranslatestoaninteractiontimeofaround16ps.Basedonthiscalculation,wewouldconcludethattheperiodichole-arrayswecanbuildwithresonantfrequenciesaroundthevisibleregionwithQfactorof10andlifetimeslessthana100fswouldbeterriblefornonlineareects 39




Diagramofapatternedholearray.Thewhitespacesdenoteemptyholes.Theholesizeisdenotedasaandthehole-spacingasDg. TransmittancespectrafortwosilverlmsonaZnSesubstrate.Thehorizontallinerepresents0.44,theopenareafraction. 41


ReectanceandtransmittancespectrafortheZnSesubstrate(Left).Thesum(R+T)isshownintheright. Sumofthereectanceandtransmittancecalculatedbytrappedmodestheory.Thisgureisborrowedfromreference[ 49 ]. 42


Reectanceandtransmittancespectrafortwoperiodichole-arrayswithperiodicityDg=6monaZnSesubstrate.adenotesholesizeandDgperiodicity. Sumofthereectanceandtransmittancespectraforthetwoperiodichole-arraysonaZnSesubstratewithperiodicityDg=6m. 43


Reectanceandtransmittancespectrafortwoperiodichole-arrayswithperiodicityDg=8monaZnSesubstrate.adenotesholesizeandDgperiodicity. Sumofthereectanceandtransmittancespectraforthetwoperiodichole-arraysonaZnSesubstratewithperiodicityDg=8m. 44


Reectanceandtransmittancespectrafortwoperiodichole-arraysonaquartzsubstrate. Sumofthereectanceandtransmittancespectraforthetwoperiodichole-arraysonaquartzsubstrate. 45


Thoughtexperimentforthetimedependenceofapulsetransmittedorreectedfromaperiodichole-array.Thisisthecasewherethelifetimeofthemodesislargerthanthepulsewidth. Thoughtexperimentforthetimedependenceofapulsetransmittedorreectedfromaperiodichole-array.Thisisthecasewherethelifetimeofthemodesismuchsmallerthanthepulsewidth. 46


Thoughtexperimentforthetimedependenceofapulsetransmittedorreectedfromaperiodichole-array.Thelifetimeofthemodesiscomparabletothepulsewidth. 47


ExperimentalsetupatNHMFLfortheautocorrelationofreectedpulsesfromperiodichole-arrays.SFreferstothesumfrequencypulse,andBBOreferstotheBaB2O4nonlinearcrystalthatgeneratestheSF.BSreferstobeamsplitters. 48


Autocorrelationdataforthereectedpulsefromthesilverlm. 49


Autocorrelationdataforthereectedpulsefromfourperiodichole-arrays.TheholesizeisdenotedbyaandtheperiodicitybyDg. 50


Comparisonoftheautocorrelateddataforthereectedpulsefromthesilverlmsandthevarioushole-arrays. 51


95 96 ],buthaveearnedrecentattentionforhigh-frequencylterapplicationsthankstotheirlowloss,highpermittivity,andgoodtemperaturestability[ 51 ].Thepyrochlorestructure(Fig. 4-1 )isdescribedasconsistingofinterpenetratingnetworksofBO6octahedraandA2O0chains[ 97 ]anditisassignedtothespacegroupFd3m.ThenominalcompositioncanbewrittenasA2B2O7orasA2B2O6O0,withthelatterformuladierentiatingtheoxygenintheA-O20chains.ThepyrochlorefamilyisfascinatingbecausetheAandBsitescanbeoccupiedbyabroadrangeofelementsthatcangiverisetoagreatvarietyofphysicalproperties.Inthebismuthpyrochlore,Bi1:5Zn0:92Nb1:5O6:92(BZN),theAsiteismostlyoccupiedbyBiandtheBsitebyNb;whileZnpartiallyoccupiesbothsites.Itisimportanttonotethatintheliterature,cubicBZNistypicallydescribedashavingtheexpectednominalcompositionofBi1:5Zn1:0Nb1:5O7.However,phaserenementstudies[ 98 ],havedemonstratedpartialsubstitutionofZnintheA2O0network(witharesultingoxygendeciencyaspresentedabove)tosatisfythecrystallochemicalbalancebetweenionicbonding,latticestrainandchargebalance.Inaddition,theBZNstructurehasbeenshowntodierfromanidealpyrochlorestructurethroughrandomdisplacementsoftheAandO0ions[ 98 ].Manybismuth-basedmaterialshavebeeninvestigated,butonlythespectrumofBZN[ 99 ]wasknownuntilrecently,whenChenetal.investigatedtheinfraredmodesofBZNalongwiththreeadditionalsystems:Bi3=2ZnTa3=2O7(BZT),Bi3=2MgNb3=2O7(BMN)andBi3=2MgTa3=2O7(BMT)[ 52 ].Itisofgreatinteresttostudythevibrationalspectraofthesematerials,becausetheyprovideuniquematerial-dependentinformationaboutdefectsorimpurities,thecrystallographicordering,andtheorderingandorientationofdipoles.However,infraredspectroscopycanonlydetectthosevibrationalmodeswhichhaveanetdipolemomentchange:in 52


52 100 ].ThemainpurposeofthisworkwastocomparehowtheRamanactivemodesbehavedacrossfourbismuthpyrochloreshavingdierentconstituents,andtocomparethemwithotherpyrochlore-structuredmaterials.TheresultsshowthattheRamanspectraareonbalancequitesimilarforthebismuthsamples.Eachsampleshowsmorethanthesixmodespredictedfortheidealpyrochlorestructure,conrmingthedisplacivedisorderinthebismuthpyrochlores.TheRamanmodesweobservedareassignedtospecicnormalmodesbyreferencetotheliterature[ 101 { 107 ].Furthermore,theresultswerecomparedtotheworkbyFischeretal.wherethefrequencyofRaman,infrared,andopticallyinactivemodesofCd2Nb2O7werecalculatedbyabinitiocalculations[ 53 ].Thiscomparisonoersinsightintotheoriginoftheadditionalmodesduetodisorder.OurRamanspectrawerealsocomparedtotheinfrareddatabyChenetal.[ 52 ]andthecomparisonalsosuggeststhatsomeoftheextramodesareduetodisorder. 108 109 ]wasusedforsampleprocessing.RoomtemperatureRamanspectraweremeasuredwithaT64000JobinYvontripleRamanspectrometerequippedwithaliquid-nitrogen-cooledback-illuminatedCCDdetector.Weusedthe488nmand501nmlinesoftheAr+ionlasertoexciteRamanscattering.Themeasurementsweredonewiththelaserpoweronthesamplenotexceeding6kW/cm2andwithanaccumulationtimeof20seconds.Thespectraweretakeninthebackscatteringgeometry;thescatteredlightwasnotpolarized 53


110 ]yieldssixRamanactivemodes(R)andseveninfraredactive(IR)modes: =A1g(R)+Eg(R)+4F2g(R)+7F1u(IR)+F1u+4F2u+2F1g+3A2u+3Eu; wheretheAandBcationsareplacedonaninversioncenter,andallofthesixRamanmodesinvolvemotionofoxygensatomsonly.Figures( 4-2 4-3 4-4 4-5 )showtheRamanspectraforeachsamplealongwithindividuallorentzianoscillatorsusedforeacht.Figure( 4-6 )showsthefourspectrawithscaledandshiftedintensitiesforeaseofcomparison.TheappearanceofmorethansixRamanmodesinallfoursamplesconrmedtheadditionaldisorderorionicdisplacementsfromtheidealatomicpositionsinthepyrochlorestructureintheinvestigatedbismuthbasedsamples.However,itwasreasonabletoexpectthatmanyofthemodesfromtheidealpyrochlorestructurewouldstillbepresent,andtheassignmentofthese\ideal"modeswasdonebyreferencingpreviousliteratureondiversepyrochlores[ 101 { 104 106 107 111 112 ].TableIshowsthefrequenciesofthevariousobservedbandsforthefoursamplesalongwiththeassignmentofmodes.Itisnottrivialtoassigneachbandtoaspecicstretchingorbendingvibration,sincebothVanderborreetal.[ 101 ]andBrownetal.[ 102 ]showthatthereismixingofdierentvibrationsforaparticularband.Theirworkestimatesthecontributionofeachvibrationalmodetoaobservedmodebycalculatingthepotentialenergydistribution.TableIlistsonlythemostsignicantlycontributingvibrationalmode. 101 ]. 54


103 ]andBiYTi2O7(520cm1)[ 104 ].TheA1gmodefortheNbbasedpyrochloreCd2Nb2O7isat509cm1andpredictedat482cm1[ 53 ].Thismodedoesnotseemtovarygreatlybetweenpyrochlores:523cm1(Y2Ti2O7),489cm1(Ti2Mn2O7),511cm1(In2Mn2O7),512cm1(Tb2Ti2O7),489cm1(Ti2Mn2O7),498cm1(La2Zr2O7),sincethevarianceintheA1gfrequencyforallthesamplesmentioned,includingthebismuthpyrochlores,is3%.Therewas,however,asystematicincreaseinfrequencyof3percentfortheA1gmodeforBMToverBMNandBZToverBZN.IntheA1gmode,theBatomdoesnotmoveandthusthefrequencyofthemodeshouldonlydependonthesquarerootoftheforceconstant.The3percentincreaseinTasamplessuggestsaforce-constantratioof1.06forTaoverNb.ThisresultcorroboratesworkbyWangetal.whereithasbeenreportedthatintheoctahedron,oxygenbindstightertoTathantoNbasmuchasa1.10force-constantratio[ 113 ].Furthermore,thewidthsofthemodeswerealsolowerforBZTandBMT(70cm1)thanforBZNandBMN(100cm1).TheresultsforA1garecorroboratedbythemodelocatedaround428cm1whichhadthesametrend,withfrequencies3percenthigherfortheTasamplesthantheNbsamples,andwidthssmallerforBZTandBMT(45cm1)thanforBZNandBMN(88cm1).ThismodewastentativelyassignedbycomparingtheF2gmodeatCd2Nb2O7calculatedat441cm1[ 53 ]andobservedat422cm1,andotherpyrochloresGd2Ti2O7(455cm1),Tb2Ti207(452cm1),In2Mn2O7[ 102 ](442cm1)andthebismuthbasedYBiTi2O7(451cm1).TheEgmodehadanoppositetrend;frequenciesweresignicantlyhigher(>10percent)forBZNandBMN(310cm1)thanforBZTandBMT(345cm1).Intheliterature,thebandassignedtoEgcanhaveasignicantlyvaryingfrequency:250cm1(Cd2Re2O7)[ 106 ],297cm1(BiYTi2O7),312cm1(Y2Ti2O7),327cm1(Ti2Mn2O7), 55


101 ];forthemanganitesitisat292cm1[ 102 ];and,thelowestreportedmodesareabove210cm1forY2Ti2O7,BYTi2O7[ 104 ]andCd2Re2O7[ 106 ].AnexceptionisTb2Ti2O7,wherethereisabandat173cm1assignedtoanF2gmode.IntheBZNliterature,thismodeseemstobediculttoassign:InRef.[ 113 ]itisassignedasthesamenormalvibrationF2gof255cm1(wherethe255cm1bandbelongstoaZn-Ostretch,andthe180cm1belongstoBi-Ostretch) 56


113 ],whileotherworkhasassignedittoaF2gbandseparatethanthe255cm1F2gmode[ 114 ].Weproposeanalternativetentativeassignment.WeproposethisbandisanormallyRaman-inactive/IRactivemodethatappearsintheRamanduetothedisplacivedisorderoftheAsiteintheBipyrochlores.Wecanrecallthatbasedonsymmetry,theselectionrulesresultinsomevibrationalmodesbeingopticallyinactive.Foraninversion-symmetriccenter,themutualexclusionrulestatesamodecanbeIRactiveorRamanactive,butneverboth.Fromrandomdisplacementdisorder,wecanexpectnewpreviouslyinactivemodestoappearinbothIRandRamanspectra,butalsothatnormallyIR-onlymodesappearintheRamanspectraandviceversa.Foroursamples,theinfrareddataofthesesamples[ 52 ]showbandswithveryclosefrequenciestothosereportedherefortheRaman(compareTableIandII).Furthermore,thewidthoftheRamanbandsincm1are(71and75)forBMNandBZNand58forBZT,andfortheIRmodes,thewidthsare84,84forBMNandBZNand68forBZT.ThissuggestionisalsocorroboratedbythecalculationsonCd2Nb2O7byFischeretal.,whichgivesaF1umodeat190cm1,andnoF2gmodesbelow265cm1.Giventhesomewhatunusualassignmentproposedhere,anextendeddiscussionispresented.ItisimportanttorecallthatsincetheAandBsitesareplacedatinversioncentersintheidealpyrochlorestructure,themutualexclusionrulestatestheactiveRamanmodesareinactiveintheIRandviceversa[ 115 { 117 ].Themutualexclusionruleisageneralresultfromsymmetryandgrouptheory,butfordescriptivepurposes,considersmallvibrationsinthelinearO-A-OmoleculeshowninFigure( 4-7 ):allmodesareeitherRamanactiveorIRactive[ 118 119 ].Thesymmetricstretchingmodeisnotinfraredactivebecausethenetchangeindipolemomentiszero.ThismodehoweverisRamanactivebecausethestretchingofeachbondyieldsapositivechangeinpolarizability(apositivechangeinpolarizabilityresultsfromanincreaseinbondlength).AsimilaranalysiswouldshowthatQ2,theantisymmetricstretch,wouldbeIRactivebutnot 57


113 114 ].ForTl2Mn2O7,In2Mn2O7andLa2Zr2O7thereisanassignedF2gmodeat512,548and590cm1respectively[ 101 102 ].InCd2Re2O7thereisnobandinthisregion.InY2Ti2O7andGd2Ti2O7abandnear570cm1hasbeenattributedtotheF2gmode,butthebandisnotpresentforallpreparationmethods[ 104 ].BiYTi2O7showstwobandsat588and612cm1,wheretherstisassignedasF2gandthesecondtoleftoverTiO2rutile.ForTb2Ti2O7thereisabandnear582cm1,butitisnotknownifthisbandortheir452cm-1bandistheF2gmode.ForCd2Nb2O7,Ref[ 53 ]calculatesnoF2gmodesinthisregion,twoopticallyinactivemodesat579cm1(F2u)and617cm1(F1g).Foroursamples,thesuggestionthatthisbandisnotanormalF2gmodeissupportedbythesimilarbandfoundintheIR(seeTableIandII).Ourresults, 58


114 ]andalsotoastretchingmodeoftheNb-Obond[ 113 ].Theovertoneassignmentisthemostcommonforotherpyrochlores:La2Zr2O7(743cm1)[ 101 ];In2Mn2O7(700cm1)andTl2Mn2O7(750cm1);Cd2Re2O7(700cm1).Basedonlatticedynamiccalculations,Maczkaetal.[ 107 ]suggestthatnofundamentalF2gstretchingmodeshouldexceed600cm1forT2Ti2O7andthereforeassignhighermodestoovertones.However,Fischer'scalculationspredicta883cm1F2gmodeforCd2Nb2O7.InBi2Hf2O7andBi2Ti2O7theauthorsassociatemodesinthe650-800cm1regionwithoctahedralB-Ostretchingmodes.And,inRef[ 104 ]themodesaround700cm1areleftunassignedforGd2Ti2O7,Y2Ti2O7andBiYTi2O7.Therefore,assigningthismodebasedontheliteratureisnottrivial.ForBMN,BMT,BZNandBZT,thehighintensityofthismodesuggestsitismorelikelyafundamentalmoderatherthanatwo-phononscatteringprocess(overtone).ItisalsopossiblethatthismodeisanormallyRamansilentmodeaswell.AsfortheNb-Ostretchsuggestion,thesystematicincreaseinfrequencyforBMNoverBMTandsimilarlyforBZNoverBZTsuggeststhatitwouldbeanassymetricstretchingmode,wheretheBcationmovesaswell(basedontheassumptionfromtheA1gmodeandRef.[[ 113 ]]thatTabondsstrongerthanNb).Then,the3%increasefromNbsamplesoverTasamplesisexpectedfromthereportedforceconstantratio(kTa/kNb=1.10)forTaoverNbandthereducedmassratio()oftheBO6octahedron(1.15). (!Ta)2 59


53 ]andcorroboratestheircalculation.However,basedonthelowamplitudeandhigh-frequencyofthemodeitcouldbearguedthatthemodeisanovertoneaswell.Itisalsointerestingthattheinfraredspectraofthesesamplesalsoshowan850cm1modeforNbsamplesbutnotforTasamples[ 52 ].Thereisyetanotherinterpretationforthismodethen.Chenetal.arguedthatthismodeappearsintheIRduetothevibrationoftheunequalbondlengthO-A-Obond(wheretheunequalityinbondsisduetothedisplacedAcation).TheyarguethatthemodeappearsinBZNandBMNandnotinBZTandBMT,becausetheTasampleshavelessdisplacivedisorder,duetodecreaseinthelonepaircharacterofBi3+bylone-pairhybridizationwithTa.TheargumentisbasedinthelargerelectronegativityofTaoverNb.However,theRamanspectraofthesefoursamplessuggestthereisnodierenceindisorderbetweentheNbsamplesandtheTasamples.BothNbandTasampleshadmodesthatappearedduetotherelaxationoftheselectionrules. 60


53 ]calculations.Finally,theexistenceofadditionalmodesintheRamanspectraofallfourcompoundssuggestsnodierenceintheamountofdisorderbetweenNbandTasamples. 61


TheRamanmodesofBMN,BZN,BMTandBZTareshownalongwiththeirtentativeassignment.Theclassassignments(i.e.F2g)aremeantforcomparisontotheidealpyrochlorestructure. 78727669EuandorF1u:O'-A-O'Bend 150148150151Eu:O-A-OBend 186185184F1u:A-BO6stretch 236223255243F2g:A-O'Stretch 350310343309Egand/orF2g:O-B-OBend 414428418433Eg:O-B-OBend 513530528541A1g:SymmetricBO6elongation 603619612622F2gand/orF1g:B-OStretch 781759762742B-OStretch 819805804809Overtone 862860F2gorOvertone Table4-2. TheinfraredmodeswithclosefrequenciestothoseoftheRamanareshown(WorkfromChenetal.)ChenassignsthismodetoO-A-Obending. 868381O'-A-O'Bend 149142145O-A-OBend 178*178178192A-BO6stretch 367336340303A-Ostretch 599642624639B-Ostretch 850850ShortA-Obondstretch 62


ComparisonbetweentheRamanmodesofBMNandotherpyrochlores BMNCd2Nb2O7(calc.)[ 53 ]YBiTi2O7[ 104 ]Bi2Ti2O7[ 103 ]Gd2Ti2O7[ 104 ]Tb2Ti2O7[ 107 ]La2Zr2O7[ 101 ]In2Mn2O7[ 102 ]Tl2Mn2O7[ 102 ]Cd2Re2O7[ 106 ] 7869(Eu)and71(F1u)76(LongA-Ostretch)n.o.n.o.n.o.n.o.n.o.n.o.100 150133(Eu)n.o.n.o.n.o.n.o.n.o.n.on.o.150 186190(F1u)n.o.n.o.n.o.173(F2g)n.o.n.o.n.o.180 236265(F2g)220(F2g)230211(F2g)210(F2g)238(F2g)292(F2g289(F2g)240(F2g+Eg) 350300(Eg),332(F2g),360(F1u)297(F2g)360312(F2g)310(F2g),330(Eg)307(F2g)346(Eg)327Eg320Eu 513482(A1g)523(A1g)550519(A1g)512(A1g)490(A1g)510(A1g)510(A1g)510(A1g) 603617(F1g)588(F2g),600(TiO2rutile)600560(F2g)582(F2g?)591(F2g)548(F2g)510(F2g)n.o. 781n.o.725780(B-Ostretch)708672(over-tone)743(over-tone)700(over-tone)700(over-tone)700(over-tone) 810,850883(F2g)n.o.n.o.n.o.n.o.n.o.n.o.n.o.n.o.


Pyrochlorestructure.RedatomssignifyoxygenintheBO6octahedraandblueatomssignifyoxygenintheO'-A-O'chain.TheAandBcationsaredepictedbyyellowandgreenrespectively,whilethewhiteatomsshowvacancies. 64


RamanspectrumofBMN(black)withthetting(red)tothedata.Theindividuallorentzianoscillators(blue)usedinthetarealsoshown. 65


RamanspectrumofBZN(black)withthetting(red)tothedata.Theindividuallorentzianoscillators(blue)usedinthetarealsoshown. 66


RamanspectrumofBMT(black)withthetting(red)tothedata.Theindividuallorentzianoscillators(blue)usedinthetarealsoshown. 67


RamanspectrumofBZT(black)withthetting(red)tothedata.Theindividuallorentzianoscillators(blue)usedinthetarealsoshown. 68


RamanspectraofBMN,BZN,BMTandBZT.Theirintensitieshavebeenscaled(by1,1.14,1.64,and2.46,respectively)andshiftedforeaseofcomparison 69


ThenormalmodesofvibrationofalinearO-A-Omoleculeareshown(top),alongwiththemodesofanonlinearmolecule(bottom).TheIRandRamanmodesarelabeled. 70


120 121 ]:(CGSunits) @t=4 c~J(A{1) @t=0(A{2) 71


A{1 and A{2 )thatinterrelatetheelectricandmagneticeld.Firstwetakethecurlofequation A{1 : A{2 : c@ @t(1 @t+4 c~J):(A{9)Forneutrallychargedmaterials,iszeroandequation A{9 simpliesto 72


c2@ @t(@~D @t+4 c~J) (A{10) c2@2~E @t2+4 c@~E @t: Forvacuum,thisequationbecomesthesimpleandfamiliarwaveequation @t2=0;(A{12)anditssolutionisanunattenuatedpropagatingwaveintheform A{12 ,weobtainthedispersionrelationinvacuum A{11 willattenuatethepropagatingwave.Thesolutionwillbeacomplexpropagationconstant: c2!:(A{16)Fromnowon,wejustdeneacomplexdielectricfunction: 73


^=1+i4^ !;(A{18)wheretheirrealandimaginarypartsarereferredtobysubscripts1and2: ^=1+i2 ^=1+i2 Itisusefultodenecomplexmaterialparameters.Nowwecanuseeitherthedielectricfunctionorthecomplexconductivitytodescribeasystem,becauseonepropertycanbeobtainedfromtheother.Moreimportantly,responses(i.e.currentsandpolarization)arenotalwayslocalintime,meaningtheyaredependentonthedrivingeldatprevioustimesandcanthereforehaveadierentphasetothedrivingeld.Thedenitionofcomplexconductivitysumsupthisstatement.ForamaterialinuencedbyanelectriceldE0ei!t: ^Jei!t=1E0ei!t+i2E0ei!t=1E0ei!t+2E0ei!t=2;(A{21)therealpartoftheconductivityisassociatedwiththecurrentgeneratedinphasewiththeelectriceld,andtheimaginarypartdescribesa90degree-out-of-phasecurrent.Therefractiveindex^Nisalsoacomplexfunction,anditisdenedusing: ^k=! c^N(!);(A{22)andwiththisdenition: 74


A{23 intothesolutionoftheattenuatedpropagatingwaveinsidethematerial A{14 : A{3 and A.1 tellusthatforahomogeneous,neutrallychargedmedium,thepropagatingwavesolutionsyields: 75


A{2 andobtain: I(z)=Re[EH]E02e2(!)! cz;(A{34)theexponentialdecayoftheintensityischaracterizedbytheabsorptioncocient: c:(A{35) 76


Boundaryconditionsataninterface.Electriceldsfortheincident,reectedandtransmittedpropagatingwavesolutionsattheinterfacebetweentwomedia. 77


A{30 and A{32 ,whichrelatethemagneticeldtotheelectriceld,andequations B{1 and B{2 ,weobtain A-1 ),andthattherealandimaginarypartsofNaregivenbynandasinequation A{23 .ThenegativeterminN11Ercomesfromequation A{30 and B{2 andthefactthatthereectedwavehasanegativekvalue.Nowwecansolveforthereectionamplitudecoecient: 78


^t12=Et B{4 .Nonmagneticmaterials: 79


B{6 forrealN1 ^r=Er 80


122 ] ^t=^t12^t23ei[1+(^r12^r23e2i)+(^r12^r23e2i)2+:::]:(B{19)Thisinniteseriesreducesto ^t=^t12^t23ei c^Nd=n! cd+i 122 123 ]and[ 124 ]forthematrixmethod.Noticethattherearetwounknownsinthedeterminationoftherefractiveindex,therealandimaginarypart.Therefore,twoseparatemeasurementswouldberequired(i.e.TandR)toobtaintheopticalconstants.However,certainsamplescanbealmostcompletelyabsorbingorcompletelyreective(i.e.metallic)sothatonlythereectancefromtheair-sampleinterfacecanbemeasured(Wecallthissingle-bouncereectance).Inthiscase,theequationforsinglebouncereectanceisvalidbecausetheretherearenointernalreections.But,itleavesuswithtwounknownsandonlyonemeasurablequantity.OnetechniquetoovercomethisproblemisKramersKronigAnalysis,whichconsistsinawidefrequencymeasurementofthereectancetoobtainthephasechangeinreectancefromequation B{5 .ThefollowingsectionexplainsKKanalysis. 81


^X(t)=Z1^G(tt0)^f(t0)dt0;(C{1)^X(t)isaresponseofthesystem(i.e.currentorpolarization),^f(tt0)istheexternalstimulus(i.e.electriceld),and^G(tt0)istheresponsefunction.Examplesofresponsefunctionsaretheconductivityandthesusceptibility ^J(t)=Z1^(tt0)^E(t0)dt0;(C{2) ^P(t)=Z1^(tt0)^E(t0)dt0:(C{3)Theintegralsinequations C{2 and C{3 statethatresponsesaregenerallynonlocalintime.Responsesdependonstimuliappliedatprevioustimes,thesamewaythevelocityofaparticledependsonpreviousforces(ie.afallingobject'sdependenceonhowlongithasbeenfalling).Moreimportantly,theseequationsshowthattheresponseofasystemwon'talwaysbeinphasewiththestimulus.Thisoutofphasepossibilityisanotherjusticationfortheuseofcomplexresponsefunctions.Equation C{1 canberewritteninasimplerformbywritingthefouriertransformsofX,Gandf: ^X(!)=^G(!)^f(!); where 82


ThisFouriertransformequationimpliesthat ^G(!)=^G(!); whichisanusefulrelationfortheoddnessandevennessoftherealandimaginarypartsofcomplexfunctions.Wewillusethisrelationlater.Causalityputsanimportantrestrictiononresponsefunctions.Itstatesthataresponse^Gattcannotdependonfuturetimes: ^G=0;fortt0<0: WewillquicklyderivethatthisrestrictioncausestheKramersKronigrelations: ^G1(!)=1 ^G2(!)=1 Toderivetheserelationsbetweentherealandimaginarypartsofaresponsefunction,werstmap^Gonthecomplexplanebyrewritingequation C{5 usingbothrealandimaginaryfrequencies: ^G(!)=Z1^G(tt0)ei!1(tt0)e!2(tt0)d(tt0):(C{11) 83


C{11 imposesthatforpositive!2,theterm(tt0)mustbepositiveaswell.Similarly,fornegative!2,(tt0)mustbenegative.But,causality, C{7 ,statesthat^G=0fornegative(tt0);thereforearesponsefunctionthatobeyscausalityandequation C{11 isrestrictedtotheupperhalfofthecomplexplane(seeFig. C-1 ).Thepurposeofthislongrantistomap^GanduseCauchy'stheoremtorelatethevalueof^Gatacertainfrequency!0totheotherfrequenciesaroundit.FirstweuseCauchy'stheoremforananalyticfunction^G(!)[ 120 ]: C-1 showstheclosedloopwewilluseintheintegral.Wedrawasemicirclearoundthefrequencyofinterest,!0,withaninnitesimalradius",andanoutersemicirclewithradiusR.Wecandrawtheboundaryoftheintegralthiswaybecauseweknowthat^G(!)iszerofornegativeimaginaryfrequencies(goodoldcausality).Weevaluatethewholeintegral,whichshouldbezeroaccordingtoCauchy'stheorem: ^G(!0)=P1 84


C{8 and C{9 .Noticethatthisresultisduetocausality;iftheintegralinthelowerhalfofthecomplexplanewerenotzero,thenwewouldhavenointerestingresult.ToeliminatethenegativefrequenciesintheKKequations,weusethepropertiesofthecomplexconjugateof^Ginequation C{6 andshowthat ^G1(!)=^G1(!) (C{15) ^G2(!)=^G2(!): UsingtheevenpropertyofG1andtheoddnessofG2,weobtainthemoreusefulKKrelations: ^G1(!)=2 ^G2(!)=2! Z10^G1(!0) Therefore,fortheconductivityresponsefunctionweget: ^1(!)=2 ^2(!)=2! Z10^1(!0) Asawordofcaution,wedonotassumethattheKKrelationsworkforanycomplexquantityandassumethatwecanequatetherealandtheimaginarypartsbyequations C{8 and C{9 foranyarbitrarycomplexfunction.Forexample,togettheKKrelations 85


^1(!)1=2 ^2(!)=2! Z10^1(!0) ThesewordsofcautionaremostrelevantforthederivationoftheKKrelationsbetweenReectanceRandthephasechange.Thestartingresponsefunctionisthereectionamplitude^r,wheretheresponseisErandthestimulusisEi ^r=jrjei;(C{24)wherejrj2isthemeasurablesingle-bouncereectance.Wetakethelogarithmofequation C{24 toseparate`nrastherealpartandastheimaginarypart.ThederivationofthisKramersKronigrelationforthelogarithmicfunctionisdicultbecausergoestozeroatinnitefrequenciesandlnnrwouldthen'blowup'.ThereaderisreferencedtoWooten'sOpticalPropertiesofSolids[ 124 ]forthederivation.Theresultis: Z10lnkr(!0)klnkr(!)k andthesearetheimportantrelationsweusethemostinthiswork.ThemainpointisthatbymeasuringonequantityRoverabroadspectra,wecanobtainasecondvariable 86


^r=j^rjei=(1n)i C{25 and C{26 spanallfrequencies.Experimentally,thisisimpossibleandrequiresthatweestimate(guess)thebehavioratthelowerorhigherendsofthespectrum.Fortunately,thedenominatorintheKKintegral, C{8 ,suggeststhatG1atafrequency!dependsmostlyonG2atfrequenciescloseto!.Furthermore,weestimatethelowerandhigherendsofthespectrumbyusingphysicalmodelsthatexplainthebehavioroftheopticalconstants.TheestimationforfreeelectronsandboundchargesfromtheDrudeandLorentzmodelwillbediscussedinthenextsection. 87


Closedloopintegrationaroundafrequencypoint!0inthecomplexplane.CausalityrequiresGtobezerointhebottomhalf. 88


120 124 ]. dt;(D{1)wherethersttermistheEMeld,andthesecondtermrepresentsthedampingtermwithascatteringrateequaltotheinverseoftherelaxationtime.IntheDrudemodel,theforcearisingfromthemagneticeldisignoredduetoitssmallervaluecomparedtotheelectricforce.Toincorporate\notsofree"electrons,thedrudemodelreplacesthemassmbyaneectivemassm,toestimatesmallelectron-latticeandelectron-electroninteractions.Thesolutiontoequation D{1 usingmis: 89


^(!)=Nee2 m ^(!)=0 125 126 ]: m(D{6) D{7 canberewrittenas: 90


D{7 and D{9 ,wecanseethatgoodconductors(metals)havenegative1atfrequenciesmuchlowerthantheplasmafrequency.Fortherefractiveindex,weuseequation D{8 andignorethefastdying2.Weobtain: lim!!1RDrude(!)!p2 1+(!)20(!):(D{13)Asforthedielectricfunction,therealpartapproachesaconstantnegativevaluewhiletheimaginarypartdiverges: 91


lim!!0RDrude(!)1[2! 0]1=2:(D{17) D{1 ,arestoringforce(k~r)thatkeepstheelectronbounded: dtm!02~r=md2~r dt2;(D{18)andthesolutionis: ^(!)=1+!p2 ^(!)=! 92


^1(!)=1+!pj2(!0j2!2) (!0j2!2)2+!22j1+!pj2 j=!pj2 ^(!)=1+Xj!pj2 lim!!0Lorentz=1+Xjj=Constant:(D{25)ormoreimportantly,thatthedielectricfunctionwillberealandconstantinthislimit.Thereforethereectanceduetoboundchargesshouldstayaconstanttowardslowerfrequencies.Forhighfrequencies,wecanseefromtheconductivityterm: ^(!)=! 93




E-1 ).Theintensityatthedetectorismeasuredasafunctionofpathlengthtoobtaintheinterferogram.TheFouriertransformoftheinterferogramthengivesyouthespectrum(intensityvsfrequency).ByreferringtoFigure E-2 ,wecanseethatiftheelectriceldintensityatthesourceisE0withpropagationvectork,thentheelectriceldafterrecombinationatthebeamsplitteris: 95


E{5 ,thatthecoherence(interference)termcomesfromthecos(!x)term.And,foraperfectbeamsplitter: 2(E{6)thewholebeam(intensityI0)wouldbemeasuredatthedetectoratazeropathdierence.Intheincoherentlimit(xapproachesinnity),thetotalintensityisjustthesumofallintensities: limx!1Itotal=Z102I0(!)Rb(!)Tb(!)d!:(E{7)Thistermrepresentsthebaselineoftheinterferogram(seeFigure E-3 ).Inpractice,wemeasuretheinterferogramandsubstractthebaselineintensity: 96


2+(!2+!) 2)d!;(E{12)therstdeltafunctiondropsthedummy!2andtheseconddeltafunctionyieldszero(fortherearenonegativefrequenciesontheintegral).Ournalresultrelatestheintensityspectratothemeasuredinterferogram: 2I0(!)Rb(!)Tb(!)=Zx=1x=Is(x)ei!xdx:(E{13) Symmetry.IftheinterferogramIs(x)isperfectlysymmetric,thenequation E{13 becomesacosinetransformandI(!)isreal.However,iftheinterferogramisnotperfectlysymmetric(likethenoisyhanddrawinginFigure E-2 ),thenthespectrumwilllooklike: 2I0(!)Rb(!)Tb(!)=Zx=1x=Ieven(x)cos(!x)dxiZx=1x=Iodd(x)sin(!x)dx;(E{14)whichgivesthespectrumaphase 97


2jImirror(!)jeiRb(!)Tb(!):(E{16) E-4 ,andthewaves!2,!3and!4whichareexactreplicasofpoorlydrawnwave1,butshrunk.Forthetwowaveswithdistinctfrequencies(!1and!2),thesignalscouldberesolvedeasilybecausetheirsumwilldisplayinterference.However,forthewaveswithclosefrequencies(!3and!4),wewouldhavetoscanfarthertoseeinterference.Ifwescantooshortly,thenwejustseeasumofthesamewaveandwecan'tresolvethem.Thisisanalogoustoabeatwave.Forasourcewithtwofrequencies!1and!2,theinterferogramwillgiveyou cos(!1x)+cos(!2x)(E{17)Thebeatwaveis: cos((!2!1) 2x);(E{18)toseeaminimum,youhavetoscantill: (!2!1) 2xmax= 98


Diagramofabasicinterferometer. Additionoftheelectriceldfromthetwodierentpaths.Theamplitudeoftheelectriceldofthetopmirrorisshownasitprogressesthroughthepath. 99

PAGE 100

Caricatureofaninterferogram(intensityvs.pathdierence).Thelimitasxgoestoinnitygivesthebaseline. Caricatureoftheresolutionbetweentwowaves.Alongerscanisneededtoobservedestructiveinterferencebetweentwowavesofcloserfrequency. 100

PAGE 101

F-1 ): @t=@ @x(Ex;Ey;Ez)e(ikxx!t)e1z=i!~E(F{5) @x=@ @x(Hx;Hy;Hz)e(ikxx!t)e1z=ikx~H(F{6) @y=0(F{7) 101

PAGE 102

F-2 ).We'dliketoexplorehowthesesurfacewavesbehaveforthesetwocases.ForTM,wheretheelectriceldisintheplaneofincidence, (F{13) 102

PAGE 103

(F{15) sincetheboundaryconditionsstatethat: Now,letsrelatetheelectriceldtothemagneticeldbyusingMaxwell's A{1 withnosurfacecurrent: c@~E @t:(F{19)Tosolvethisequationwecanuse: c@~E @t;(F{20) (F{24) 103

PAGE 104

@t=i1!Ex~xi1!Etopz~z;(F{27)then,bottom: @t=i2!Ex~xi2!Ebotz~z;(F{29)andequatexcomponentsforboth: F{32 showsthatthepropagatingwaveforthesurfaceisonlypossiblefortheinterfacebetweenanegativedielectric(metal)andapositivedielectric(i.e.airorquartz): A{11 weobtainedbackinAppendixA,andusethepropertiesforthecurlofETMlistedabove: c2@2~E @t2;(F{34) 104

PAGE 105

(k2x+22)~Ebot=2!2 F{35 from F{36 andalotofalgebragives: cr A{2 : @t(F{40)Referencingequations F{23 through F{25 ,andrememberingthatEyandHxarecontinuous: 1 cHx~x+i! cHtopz~z(F{43) 105

PAGE 106

cHx~x+i! cHbotz~z;(F{44)weobtain: Sinceispositive,HxonlymakessenseifEyiszero.Thiscombinedwithequations F{46 through F{48 resultineverycomponentbeingzero: 106

PAGE 107

Electriceldsforaconnedsurfacewavepropagatinginthexdirection.Topandbottomsolutions. DiagramsfortheelectricandmagneticeldcomponentsofTMandTEpolarizationsofasurfacewave. 107

PAGE 108

[1] T.Timusk,M.Reedyk,R.Hughes,D.A.Bonn,J.D.Garrett,I.E.Greedan,C.V.Stager,D.B.Tanner,F.Gao,S.L.Herr,etal.,PhysicaC162-164,841(1989). [2] J.Hwang,E.Schachinger,J.P.Carbotte,F.Gao,D.B.Tanner,andT.Timusk,Phys.Rev.Lett.100,137005(2008). [3] R.P.S.M.Lobo,R.L.Moreira,D.Lebeugle,andD.Colson,Phys.Rev.Lett.76,172105(2007). [4] E.Ganshinaa,N.Loshkarevab,Y.Sukhorukovb,M.A.Vinogradova,andL.Nomerovannayab,JournalofMagnetismandMagneticMaterials300(2006)6266300,62(2006). [5] Z.Wu,Z.Chen,X.Du,J.M.Logan,J.Sippel,M.Nikolou,K.Kamaras,J.R.Reynolds,D.B.Tanner,A.F.Hebard,etal.,Science305,1273(2004). [6] D.A.Bonn,J.D.Garrett,andT.Timusk,Phys.Rev.Lett.61,1305(1988). [7] H.-B.Liu,H.Zhong,Y.C.NicholasKarpowicz,andX.-C.Zhang,Proc.IEEE95,1514(2007). [8] P.H.Siegel,IEEETrans.onMTTS50,910(2002). [9] A.Doria,G.P.Gallerano,E.Giovenale,G.Messina,andI.Spassovsky,Phys.Rev.Lett.93,264801(2004). [10] F.ZernikeandP.R.Berman,Phys.Rev.Lett.15,99(1965). [11] J.M.Yarborough,S.S.Sussman,H.E.Purho,R.H.Pantell,andB.C.Johnson,Appl.Phys.Lett.15,102(1969). [12] K.H.Yang,P.L.Richards,andY.R.Shen,Appl.Phys.Lett.19,320(1971). [13] K.Kawase,M.Sato,T.Taniuchi,andH.Ito,Appl.Phys.Lett.68,2483(1996). [14] D.H.Auston,K.P.Cheung,andP.R.Smith,Appl.Phys.Lett.45,284(1984). [15] A.P.DeFonzo,M.Jarwala,andC.Lutz,Appl.Phys.Lett.50,1155(1987). [16] C.FattingerandD.Grischkowsky,Appl.Phys.Lett.54,490(1989). [17] X.C.Zhang,B.B.Hu,J.T.Darrow,andD.H.Auston,Appl.Phys.Lett.56,1011(1990). [18] L.Xu,X.C.Zhang,B.Jalali,andD.H.Auston,Appl.Phys.Lett.59,3357(1991). [19] D.You,R.R.Jones,P.H.Bucksbaum,andD.R.Dykaar,OpticsLetters18,290(1993). 108

PAGE 109

S.Matsuura,G.A.Blake,R.A.Wyss,J.C.Pearson,C.Kadow,A.W.Jackson,,andA.C.Gossard,Appl.Phys.Lett.74,2872(1999). [21] D.H.Auston,K.P.Cheung,J.A.VAldmanis,andD.A.Kleinman,Phys.Rev.Lett.53,1555(1984). [22] L.Xu,X.C.Zhang,andD.H.Auston,Appl.Phys.Lett.61,1784(1992). [23] B.Xu,X.Hu,andM.R.Melloch,Appl.Phys.Lett.71,440(1997). [24] R.Kohler,H.A.Tredicucci,F.Beltram,H.E.Beere,E.H.Lineld,A.G.Davies,D.A.Ritchie,R.C.Iotti,andF.Rossi,Nature417,156(2002). [25] J.M.Byrd,W.P.Leemans,A.Loftsdottir,B.Marcelis,M.C.Martin,W.R.McKinney,F.Sannibale,T.Scarvie,andC.Steier,Phys.Rev.Lett.89,224801(2002). [26] M.Abo-Bakr,J.Feikes,K.Holldack,G.Wstefeld,andH.W.Hbers,Phys.Rev.Lett.88,254801(2002). [27] G.L.Carr,M.C.Martin,W.R.McKinne,K.Jordan,G.R.Neil,andG.P.Williams,Nature20,153(2002). [28] W.P.Leemans,C.G.R.Geddes,J.Faure,C.S.Toth,J.V.Tilborg,C.B.Schroeder,E.Esarey,G.Fubiani,D.Auerbach,B.Marcelis,etal.,Phys.RevLett.91,074802(2003). [29] S.E.Korbly,A.S.Kesar,J.R.Sirigiri,andR.J.Temkin,Phys.Rev.Lett.94,054803(2005). [30] E.Pickwell,B.E.Cole,A.J.Fitzgerald,M.Pepper,andV.P.Wallace,Phys.Med.Biol.49,1595(2004). [31] R.Woodward,V.Wallace,D.Arnone,E.Lineld,andM.Pepper,J.Biol.Phys.29,257(2003). [32] E.R.Mueller,TheIndustrialPhysicistpp.1{4(August2003). [33] J.E.Bjarnason,T.L.J.Chan,A.W.M.Lee,M.A.Celis,andE.R.Brown,Appl.Phys.Lett.85(2004). [34] J.F.Federici,B.Schulkin,F.Huang,D.Gary,R.Barat,F.Oliveira,andD.Zimdars,Semicond.Sci.Technol.20,S266(2005). [35] K.Yamamoto,M.Yamaguchi,F.Miyamaru,M.Tani,M.Hangyo,T.Ikeda,A.Matsushita,K.Koide,M.Tatsuno,andY.Minami,Jpn.J.Appl.Phys.43,L414(2004). [36] A.Sinyukov,I.Zorych,Z.-H.Michalopoulou,D.Gary,R.Barat,andJ.F.Federici,C.R.Physique9,248(2008). 109

PAGE 110

R.H.Jacobsen,D.M.Mittleman,andM.C.Nuss,Opt.Lett.,vol.21,no.24,pp.20112013,Dec.1996.24,2011(1996). [38] B.M.Fischer,H.Helm,andP.U.Jepsen,Proc.IEEE95,1592(2007). [39] K.Kawase,Y.Ogawa,andY.Watanabe,Opt.Express11,2549(2003). [40] E.Seok,C.Cao,D.Shim,D.J.Arenas,D.B.Tanner,C.Hung,andK.O,IEEEProceedingsoftheInternationalSolid-StateConferencepp.472{473(2008). [41] J.D.Joannopoulos,P.R.Villenueve,andS.Fan,Nature286,17(1997). [42] D.MoriandT.Baba,OpticsExpress13,9398(2005). [43] E.Popov,M.Nevire,J.Wenger,P.-F.Lenne,H.Rigneault,andP.Chaumet,J.Opt.Soc.Am.A23,2342(2006). [44] G.A.Wurtz,R.Pollard,andA.V.Zayats,Phys.Rev.Lett.97,057402(2006). [45] M.Beruete,I.Campillo,J.E.Rodrguez-Seco,E.Perea,M.Navarro-Ca,I.J.Nez-Manrique,andM.Sorolla,IEEEMicrowaveandComponentsLetters17,831(2007). [46] S.JohnandR.Wang,Phys.Rev.A78,043809(2008). [47] T.W.Ebbesen,H.J.Lezec,H.F.Ghaemi,T.Thio,andP.A.Wol,Nature391,667(1998). [48] A.G.Borisov,F.J.G.deAbajo,andS.V.Shabanov,Phys.Rev.B71,075408(2005). [49] S.Selcuk,K.Woo,A.G.Borisov,S.V.Shabanov,D.B.Tanner,andA.F.Hebard,Phys.Rev.Lett.97,067403(2006). [50] D.C.Marinica,A.G.Borisov,andS.V.Shabanov,Phys.Rev.B.76,085311(2007). [51] M.T.Lanagan,D.Anderson,A.Baker,J.C.Nino,S.Perini,C.A.Randall,T.R.Strout,T.Sogabe,andH.Youn,inInProceedingsoftheInternationalSymposiumonMicroelectronics,editedbyJ.V.Graves(2001). [52] M.Chen,D.B.Tanner,andJ.C.Nino,Phys.Rev.B72,054303(2005). [53] M.Fischer,T.Malcherek,U.Bismayer,P.Blaha,andK.Schwarz,Phys.Rev.B78,014108(2008). [54] J.Mei,K.Ogawa,Y.-J.Kim,N.C.Heston,D.J.Arenas,Z.Nasrollahi,T.McCarley,D.B.Tanner,J.Reynolds,andK.S.Schanze,ACSAppl.Mater.Interfaces1,150(2009). 110

PAGE 111

K.Z.Rajab,M.Naftaly,E.H.Lineld,J.C.Nino,D.Arenas,D.Tanner,andR.Mittra,JournalofMicroelectronicsandElectronicPackaging5,1(2008). [56] T.W.Crow,W.L.Bishop,D.W.Portereld,J.L.Hesler,andR.M.Weikle,IEEEJournalofSolid-StateCircuits93,1722(2005). [57] D.L.Woolard,E.R.Brown,M.Pepper,andM.Kemp,IEEEProceedings93,1722(2005). [58] S.Sankaran,E.Seok,C.Cao,R.Han,D.Shim,S.H.Hill,D.J.Arenas,D.B.Tanner,C.Hung,andK.O,IEEEProceedingsoftheIEEEInternationalSolid-StateCircuitsConference(2009). [59] E.Seok,Ph.D.thesis,UniversityofFlorida(2008). [60] H.A.Bethe,Phys.Rev.66,163(1944). [61] T.J.Kim,T.Thio,T.W.Ebbesen,D.E.Grupp,andH.J.Lezec,Opt.Lett.16,1743(1999). [62] H.F.Ghaemi,T.Thio,D.E.Grupp,T.W.Ebbesen,andH.J.Lezec,Phys.Rev.B58,6779(1998). [63] T.Thio,H.F.Ghaemi,andH.J.Lezec,J.Opt.Soc.Am.B16,1743(1999). [64] D.E.Grupp,H.J.Lezec,T.W.Ebbesen,K.M.Pellerin,andT.Thio,Appl.Phys.Lett.77,1569(2000). [65] R.Gordon,Phys.Rev.Lett.92,037401(2004). [66] F.J.Garcia-Vidal,E.Moreno,J.A.Porto,andL.-M.Moreno,Phys.Rev.Lett.95,103901(2005). [67] F.J.Garcia-Vidal,R.Gomez-Medina,andJ.J.Saenz,Phys.Rev.E72,016608(2005). [68] K.J.K.Koerkamp,Phys.Rev.Lett.92,183901(2004). [69] F.MiyamaruandM.Hangyo,Phys.Rev.B71,165408(2005). [70] L.M.Moreno,F.J.G.Vidal,H.J.Lezec,K.M.Pellerin,T.Thio,J.B.Pendry,andT.W.Ebbesen,Phys.Rev.Lett.86,1110(2001). [71] H.J.Lezec,A.Degiron,E.Devau,R.A.Linke,L.Martin-Moreno,F.J.Garcia-Vidal,andT.W.Ebbesen,Science297,820(2002). [72] E.Ozbay,Science311,189(2006). [73] J.A.Porto,G.J.G.Vidal,andJ.B.Pendry,Phys.Rev.Lett.83,14(1999). [74] W.L.Barnes,A.Dereux,andT.W.Ebbesen,Nature424,824(2003). 111

PAGE 112

W.L.Barnes,W.A.Murray,J.Dintinger,E.Devaux,andT.W.Ebbesen,Phys.Rev.Lett.92,10(2004). [76] L.Salomon,F.Grillot,A.V.Zayats,andF.deFornel,Phys.Rev.Lett.86,110(2001). [77] K.G.LeeandQ.-H.Park,Phys.Rev.Lett.95,103902(2005). [78] X.Fang,Z.Li,Y.Long,H.Wei,R.Liu,J.Ma,M.Kamran,H.Zhao,X.Han,B.Zhao,etal.,Phys.Rev.Lett.99,066805(2007). [79] T.ThioandH.J.Lezec,OpticsExpress12,3629(2004). [80] E.Popov,S.Enoch,G.Tayeb,M.Neviere,B.Gralak,andN.Bonod,.AppliedOptics43,999(2004). [81] F.J.Garcia-Vidal,S.G.Rodrigo,andL.Martin-Moreno.,NaturePhysics2,790(2006). [82] B.Hou,J.Mei,M.Ke,W.Wen,Z.Liu,J.Shi,andP.Sheng,Phys.Rev.B76,054303(2007). [83] Y.-J.Bao,R.-W.Peng,D.-J.Shu,M.Wang,X.Lu,J.Shao,W.Lu,andN.-B.Ming,Phys.Rev.Lett.101,087401(2008). [84] M.M.J.Treacy,Phys.Rev.B.66,195105(2002). [85] M.Treacy,AppliedPhysicsLetters75,606(1999). [86] P.P.Ewald,Ann.Phys.(Leipzig)49,1(1916). [87] S.L.McCall,P.M.Platzman,R.Dalichaouch,D.Smith,andS.Schultz,Phys.Rev.Lett.67(1991). [88] R.D.Meade,A.M.Rappe,K.D.Brommer,andJ.D.Joannopoulos,Phys.Rev.B48(1993). [89] F.J.G.deAbajo,G.Gomez-Santos,L.A.Blanco,A.G.Borisov,andS.V.Shabanov,Phys.Rev.Lett.95,067403(2005). [90] D.C.Marinica,A.G.Borisov,andS.V.Shabanov,Phys.Rev.Lett.100,183902(2008). [91] A.G.BorisovandS.V.Shabanov,J.Comput.Phys.209,646(2005). [92] A.G.BorisovandS.V.Shabanov,J.Comput.Phys.199,742(2004). [93] S.Selcuk,Ph.D.thesisUniversityofFlorida(2002). [94] K.Woo,Ph.D.thesis,UniversityofFlorida(2006). 112

PAGE 113

G.I.Golovschikova,V.A.Isupov,A.G.Tutov,I.E.Mylnikova,P.A.Nikitnia,andO.I.Tulinova,Sov.Phys.SolidState14,2539(1973). [96] G.Jeanne,G.Desgardin,andB.Raveau,Mater.Res.Bull.9,1371(1974). [97] A.W.Sleight,Inorg.Chem.7,01704(1969). [98] I.Levin,T.G.Amos,J.C.Nino,T.A.Vanderah,C.A.Randall,andM.T.Lanagan,JSolidStateChem.Mater.168,69(2002). [99] S.Kamba,V.Porokhonsky,A.Pashkin,V.Bovtun,J.Petzelt,J.C.Nino,S.Trolier,M.T.Lanagan,andC.A.Randall,Phys.Rev.B66,054106(2002). [100] M.Chen,Ph.D.thesis,UniversityofFlorida(2005). [101] N.T.Vanderborre,E.Husson,andH.Brusset,SpectrochimicaActa37A,113(1980). [102] S.Brown,H.C.Gupta,J.A.Alonso,andM.J.Martinez-Lopez,Phys.Rev.B69,054434(2004). [103] S.Henderson,O.Shebanova,A.Hector,P.McMillan,andM.Weller,Chem.Mater.19,1712(2007). [104] A.Garbout,S.Bouattour,andA.W.Kolsi,JounalofAlloysandCompounds469,229(2009). [105] A.Garbout,A.Rubbens,R.Vannier,S.Bouattour,andA.W.Kolsi,JournalofRamanSpecroscopy39,1469(2008). [106] C.S.Knee,J.Holmlund,J.Andreasson,M.Kall,G.Eriksson,andL.Borjensson,Phys.Rev.B71,214518(2005). [107] M.Maczka,M.L.Sanjuan,A.F.Fuentes,K.Hermanowicz,andJ.Hanuza,Phys.Rev.B78,134420(2008). [108] J.C.Nino,M.T.Lanagan,andC.A.Randall,J.Mater.Res.16,460(2001). [109] J.C.Nino,Ph.D.thesis,PennsylvaniaStateUniversity(2002). [110] R.A.McCauley,J.Opt.Soc.Am.63,721(1973). [111] F.X.ZhangandS.K.Saxena,ChemicalPhysicalLetters413,248(2005). [112] S.Saha,S.Singh,B.Dkhil,S.Dhar,R.Suryanarayanan,G.Dhalenne,A.Revcolevschi,andA.K.Sood,Phys.Rev.B78,214102(2008). [113] H.Wang,H.Du,andX.Yao,MaterialsScienceandEngineeringB99,20(2003). [114] Q.Wang,H.Wang,andX.Yao,J.Appl.Phys.101,104116(2007). 113

PAGE 114

D.C.HarrisandM.D.Bertolucci,SymmetryandSpectroscopy(NYOxfordUniversityPress,1978). [116] F.A.Cotton,ChemicalApplicationsofGroupTheory(JohnWiley&Sons,1963). [117] L.A.Woodward,RamanSpectroscopy(PlenumPress,1967). [118] D.A.Long,RamanSpectroscopy(McGraw-HillInternationalBookCompany,1977). [119] G.Herzberg,MolecularSpectraandMolecularStructure(NewYork:VanNostrand,Reinhold,1966). [120] M.Dressel,ElectrodynamicsofSolids(CambridgeUniversityPress,2002). [121] J.D.Jackson,ClassicalElectrodynamics(Wiley,1998),3rded. [122] M.Nikolou,Ph.D.thesis,UniversityofFlorida(2005). [123] J.Hwang,Ph.D.thesis,UniversityofFlorida(2001). [124] F.Wooten,OpticalpropertiesofSolids(AcademicPr,1972). [125] N.W.AshcroftandN.D.Mermin,SolidStatePhysics(ThomsonLearning,Inc.,1976). [126] C.Kittel,IntroductiontoSolidStatePhysics(JohnWile&Sons,1986). 114

PAGE 115

DanielArenaswasborninColombiain1983.HemovedtotheU.S.Aaftergraduatingfromhighschool.HeattendedEdisonCommunityCollegeinNaples,FLandthentransferredtotheUniversityofNorthFloridainJacksonville.Bychance,hetooksomeupper-levelphysicsclasses,lovedthem,andendedupswitchinghismajortophysics.AftergettinghisB.S.,hewasacceptedintoUniversityofFloridain2004andjoinedtheTannerLabinhissecondyear.Inthelastveyears,hehasmetwonderfulpeopleandmadegreatfriends. 115