Citation
The St. Lucie County tribune

Material Information

Title:
The St. Lucie County tribune
Alternate title:
Saint Lucie County tribune
Portion of title:
St. Lucie tribune
Place of Publication:
Fort Pierce St. Lucie County Fla
Publisher:
Wilson & Reed
Creation Date:
July 16, 1909
Publication Date:
Frequency:
Weekly[Mar. 16, 1920]
Semiweekly[ FORMER <July 23, 1918>-Mar. 12, 1920]
Weekly[ FORMER <1905-1917>]
weekly
regular
Language:
English
Physical Description:
v. : ill. ;

Subjects

Subjects / Keywords:
Newspapers -- Fort Pierce (Fla.) ( lcsh )
Newspapers -- Saint Lucie County (Fla.) ( lcsh )
Genre:
newspaper ( sobekcm )
newspaper ( marcgt )
Spatial Coverage:
United States -- Florida -- Saint Lucie -- Fort Pierce
Coordinates:
27.438889 x -80.335556

Notes

Abstract:
The Fort Pierce News was originally published by Arthur B. Brown as a weekly from 1903 through November 9, 1917. From November 15, 1917 through 1920, it appeared three times each week. On March 1, 1920, the Fort Pierce News merged with a slightly younger rival weekly paper, the St. Lucie County Tribune (also known as the St. Lucie Tribune) to form the Fort Pierce News-Tribune. The latter became a daily after 1926. Fort Pierce sits astride the Indian River on Florida’s Atlantic Ocean coast. The town was incorporated in 1901 and named as the new county seat in 1905. Fishing was critical to the early economy of Fort Pierce. Pineapple was the agricultural king of St. Lucie County from the turn of the century until the collapse of the industry following World War I. The Fort Pierce News and the St. Lucie County Tribune reported on these developments, along with river traffic and occasional steamboat groundings, activities on nearby Indian reservations, and--with the advance of the railroads--the growth of tourism in south Florida.
Additional Physical Form:
Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.
Dates or Sequential Designation:
Began July 21, 1905.
Dates or Sequential Designation:
-v. 15, no. 43 (Mar. 16, 1920).
General Note:
Publisher: A.K. Wilson, <1918>; The News Print. Co., Inc., <1920>.
General Note:
Description based on: Vol. 1, no. 2 (July 28, 1905).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
19867935 ( OCLC )
sn 89058426 ( LCCN )

Related Items

Succeeded by:
Fort Pierce news
Succeeded by:
Fort Pierce news-tribune

Downloads

This item has the following downloads:


Full Text

PAGE 1

OPJN-OaxativeroleysGrowIndependentGrapefruitATTORNEYSATLAW-aoticeinStaleandFederalCourtBBALLARDSmtIONfYANDPrintingWorksiLINIMENTitATtANTIIDIETCUIEN-lf1RepairingFirs-tClassOrangeJacksonvilleMARKETNEWSFertilizerTOMATOESPineapplesLINIMENTSPOTATOESMUTTONFertilizerSNOWTreesPROFESSIONALArmoureyjp4-WIAUABYStore-ffhennotintheoflicocanRationB-ATTOKNEYATLAWCITYdOMPSATISFACTIONFetilizerBEANSBOGG-SATTORNEYATLAIgJobNurseriesFREDEIICKPORKWABASSOCOMPLAINTSfacilitiesthatCuresEDMUNDFERTILIZERSTHEGUARANTEEandBEEFCATTORNEYATLAW-WillCHOICESTMadeRheumatismsupervisionwellgrownJACKSONVILLEMETRASKINGWhenHam-burgHavenStimulatingWintercompet-itorsroTCitrusWinterCatalogueFruitsANDBSausageLinimentprofitableMACHINERYNeuralgiaShoeFREDERICKMACHINERYPimicB-HAMMINGSVANLANDINGHAMrlrltr-iFLORIDA-WeWALTONChickensDISSATISHavenCoPsuperintendent-WNeedRepresentedF-ORTWesternCOMPLETEFACTIONplantingURTODATEyHUDSONStomachapplicationTRIBUNFiA-GEOMBallardStewarthmaterialsclosingsupplycongratulationsCOUNTYExecutedEichelherger-wasTESTIMONIALSSURVEYORSholographicSprainsvarietiesaweteA-rliSeptember-29ththeINSURANCEWoundsElchelberfforENGINEERSTroubledevelopmentMARKETANDWHITEprominentlycommissionersBOWELJacksonville-AimmediatelyPhoneTREESCOUNSELORRecommendedheadquartersBaconindefatigablepurgeorcauseandMODERNSURVEYORrepresentativeconsequentlyUNIVERSITYprecipitationheadquartersVansAgnewtwentythreeSnowCATALOGUEAttentionNYwsHecortlEggsphysician-sentFRIDAYHamsGuaranteedSteakDespatchthirtysevenamountdispatchercarefulPRINTINGMOURCompaniesScommunitycommissionersOFpricessecondPromptPlNMintformulasseventysixVandiveer-AnFLORIDAdispatcherLAWYERequestrianmagnitude-asdormitoryBRONNUMLUCIEphosphateUniversityJacksonvillethemanagdepart-mentsdormitoryEffectlreexperienceforORINOcontainingrightexaminationPIERCEcompletionThcydonotprosperityTRIBUNEinterestingSTATEeightyoneFREDARrightATTORNEYBROOMEThursdayUniversityKentuckyproficientratepayersGenuineUniversityexaminationaddressingspecialoperationsmixedrepresentsKentuckyJointsPorkSURGEONPHYSICIANSURGEONinformationyard-masterFI-AJIcontinent-MrtrainmasterGAULDENthrough-outFIn-ACTlTUSVJLLENeatnessaccomodatePorkBookletexceedinglyfirstclassLiverpoolTHEwhichgoodDITTMARPENNEYTITUSVILLKOkeechobeereasonableKissimmeeFlaattractiveSaturdayshipmentDumwllondaughterelegantlyinforma-tionEngineerneglectedsecretsummernaturalthoroughlyKissimmeeendowmentDENTISTPHYSICIANGainesvilleLESShallapvegetableconsumatedSUPPLIESdormitorygiveshipmentprotectedatdaughteroperatorsROBBINSpro-nouncedenrollmentOrdersTennesseedwellingpostofiicecuredpracticeTownleycommencedGUARMTEprintingjLground-wasotherrCOUNTYcarryingBuildingCarnegieOURcarryingsuspendsBUTLERcleanindividualconsideredFL-AwspendingChamberWhipplemailedLOUISBuildingGLIDDENMcVeighSoressuccessinvestmentattentiondamagedWeddingGrimsleyTuesdayMcDonaldmo-stipatioSTETSONSebastianifXVRHEUMATISMPORTABLEsurveyedrepresentATLAWbuildingsRHEUMATISMdrainagesupposedMakinsonATTORNEYopeningannoyanceNashvillePropertyreprieveTuesdayoccupancythroughengagedquartersProvinghingopera-tingCallsurfacet-ooreprieverecentlytheirJULYpossessorerection-ofLouisvilleSendcruisingcapturedCaptainUponPhonehaveacceptedMondayexecutionInstitutefarmingbeautifulfurnishedKnightsenjoyedcultivatedheaviestthereforeUpstairsmorningpropertyhealthyEnglandwitheducationgeneralGeorgeSundaythroughacademicwithwiththanFLORIDAbuildingExclusivevicinityFLORIDAADDRESS-AandFLYwithCutsSAveyouLibrarycostsWubassoScotlandthanbuildingescapedterminalSundayStiffSTOCKseweragebuildingHard-warethousandgripsactionAGENTgrantedrelativesthousandhealthyLadingsouthernincountriespractice4ginningOUTFITSbusinessDittmarFletcherMadisonnecessaryIIexten-sionTRIBUNEseventeenconnertunearingPracticeConcerncontainsARKEHofBllllltonterminusBallardsbuildingrequestkindGovernorhundredBELTiNSawyerYounghundredorgansstudentswarmlyrispecialreturnedGilchristGilchristoccurrenceSundaycomingBUSINESSGeorgerailroadSawyerCollegepublic-AcountieshundredbuildingVARI-OUSGilchristPROTECTwomenLinomcuresidentFridaymentofpermitFranklinextendsyearableSWAINdif-ferentrunawaystudentsreceivedcataloglargestAndrewshousingtruthfulTrowellassistedmovingstudentscontent-tomakebuild-ingselloUHIfamilyFOROrderliesfacultyTHEgreateropenedWebstercomingCURES183when-everMONEYrailroadPiKitcBFridayYoungdivisionHerbinelMsuitabletaxationcollegeFloridafinishedFridaywrltesIIlKucREeLandForaterGeorgeLINEDeLandrecievedmusicalinactivecollegeInsistyellowtheseSALESMANunusualonehalfLiberalWECourts-PPIERCEoccurredandsystemNormalKINDSFORTPricePIKBCBdoesValleycallingforeignStewartchangenumberdivisionsecuredduringFloridaEdwardinwhateverrainfallAnkonawithoutPineryissued-ItCharlesbulletinOTHERDonaldhabitualsellingSecondheartyAtlantaflatnesspracticeThePIERCEBALLARDdivisionThomasColonytobaccobookletcoughFloridatwentyvisitorstobaccoactingFridayProprietortheirlaughsentenceHarmorpassedtobaccopassedResidenceditchestaughtblatCoamplyUnseenUnitedditchesA-SoldspecialcountyOFcitizensHunterlocatedstudentfriendsCARRYandandvariousseveralStetsoncountyfarmersarrivedtrouble0recommendcampusFloridamoreeachWatershappytwoestatesconvictcountyurgentFloridafriendsFIBBCBnumerousPierceIIKKCBcarefulNOEdgarformerNOTARYalmostowingbecomeexportverdictcrullhlaIUOIEsanitymusclessectionWatersMailWeCourtsPicnictenantUnitedARgradeGifFordetc-AgrowersAustinMessrsRexallStatesremainyoufifteenGoldenchronicoldMiamiQuayvisitsbusilyPIKKCBJensensectiondollarsfifteenreally13FPTPierceofiicerssellhandlephonethecrops-toDRUGDrugCIVILreadyoldMillerlargoWhitelamsHoltquitereportthetheCourtsformerFrankMessrsStoutsMisses1001909EldredDRFnmkmovedschoolplrceFrankMiamiJamesPhoneDrugridgeMiamiarangeJoneslivelybowelsAdamwherewhereSAWSHendryhop-eweeksSheenforJamountSENDUponCurleragentcountyforunlesswith-invationoutKldredOwensPhoneBeachwithRexalplaceearlyPierceweeksPUBLICdoingLinimentMIAMIclerksweekswhichinsidevisionhungIndianyoungTHEPLACEhouseearlyfoundtlOwensOwensState35000BldgnightSelllHactivewhichbottleguests50000ThreeTheseAnniePenmiMMJucieDrugLinimentandhourskeysstolenMosesextentlwynchitABOVEtherefruitswhichLuciePOSTALhouseCloudOcalayoungwhichaskedwhichDrug50ckeptkeepdutyviolinrelievewhichOfficeANDwhichestateandMOkeepBankGracedeathLuciedirectlshowsPiercecropdaysKlinegoodBROOMSCoast25c15000booksFORTdaysfavorEffectPierceFourfoundcom-monmuch111heyMuchheartilyhouseGrovesOfficeunderJPORTdaysandstatesyardltlflFthreeI1lallJulyOFwhenNextvotedorderBallardsorderWavStatestoryheartHunpleasJulyuurtswateronlymadescenesandEdenmadeANDANDtrackAllenBankwantwithoutMILLyearsatgingHansdealschiefownersOfficeYorkOSUYTHMstoodmadethesePARKERJAMESweekmarkhOfhllandsloadsjurynegroamentsStorethreeweekdaysweektheremilesissueallweekMILlforcesewerscropsbrideonlyFORTmuchfieldsotlicehaveWestFortFIREweekwhatFourFORTfixedFORThavethePalmbuyriverSendandafterjDRUGhaveCivilstorejustsouthriverourALSOhealpartfrom252TbeenandhowllineshaveSAWmeanswiresFORTfloorEdenourIMosttrainoneliverFEEfromliverfinerpostVerotimebeenownerironmadeFortFORThavemillsbeenbeenhavecentshavebeenNewextraOfficethanIDoesFortareuntilANTThisjustgetsEastFortwithcityseasontunehavenervesIforwithCARHoltwithdockfromHutebeenSTyourcopyfromAThissuchLolanotportandfrom23ndBealBKiNdMissbeenfromwiferoadArtsHUDSONdaylifedbestthatThisHullheldchesyourtotalKeyMisschugjailYO-UryearBoonsBESTvisitFLAThisposiOfficeyearTHEdredTineMissWILLFortcultiwiththeybeenworKgladlyHAVEtermyourIIIAThisthatbesttimethantakeideallandHoursthanjobdiedSTlandlandRoomsthatthatTHEmansthatdoesofhuntwithNAVEandofforthemthathostlandsizesfirstintoAIwsevenadultofTryBigFLACOFLAyouFLAFLAthatCailfieldfirstMrsthatandcuts11ththatSoldTheOfficewhowethatwouldTheMiletionthiswillsaysPlatsArVDFortatQETTheFellsoldWILLYearMorsomethatTheTheTheToYotAleftlathTheTheMrsthisMrsthisAttwayLAWTheThedigThecolaandCandeastFOFVmorefewMrsMrsThecountLeoreallateTheleftMrsMrsthisthisandandtoPTheGovJnothis1lrsantiandandwayandSnowthisthisfewandwilllastandbigwillfewMrstakeandthiswillthislastAlawillthisacresandandandandwillandsomebythisandfewLeeTIllJandandsinelawandandandPAIRStZIandWEandandwillwillandwillandandwillandandandvliI1l1dCARDhasbigIVIgaiiONEmsomemoreandandandandandlivelineandandandaddandlessandANDPAIRSandworeandandandrateFOThasandtwoworldthistwoandandhaslasiBoxsoilandhaswereandandfallthe<830wereandhas00andlastNotandtheStatetheitsliesthehasthethehashasliestwoanyWEoverandthePusandhashasthefallweretheandthe16tllIeeverthethethethethethethenewthethefallKinrthetutuOURristheagebutthethethethethethethetwomantheSTthetheColthethethethethethethethenearthethebuttheWillperovertheagoandMrthethenutsthethethesanethetheandthethethethethetheSunsbyrLIiMrthethethethe855DuotacoAIthethethehasthetheMt-yforColdienewnownewyearsMrraMrMrthenewoverfurtheforHethismentheMrnewwasfortheforfcnewtheforthecarstinMrforMrforWasfortorf1-PIEnotWeWILLbytime305theforfor1HEMrforlrsMrMrbybyteiforWillhiswasusedtheNosyccfor235for115OSMrhisoldHeWEnutswasMethenowOFrwasbybywashaveMrwas8artrunoutCowasbysetdL4wastheGawilloneUlotthetomwasareCoCoFeeantallroctoufornotkonethatbest1alltoRTupMoneearconeWofWlieAsallbelwILLforOFOfbeoneWbeareareareneVisallcanbelieStonFaA4theofFgofbeheOURdoitrofbeiceshebeseeandbeJIany5beaneofofheofofOfofofofofofofofbebeactdotyIatcoanyATofWStofofStofofofofofofofofofofofofofofofofofWofStofofofofWofofofofinofofofofANDatOfofofofofofANDinthetotheattoM50W3115inatsay23SItintininarenotareintooftoofininintotoatItinistoatinininoneUIintoIItocntotototoMinUininforLaillininininanto14toattotointototoon10ininAindiaMininDiscantotoasinantotoonon011inMr11AatononMHITonisAistotointototoasAonisAisDonnoonisisisisallAUisAEBiaisisAisitasNKis1ARtomItsoisisronbeC10HisEorasLfHHC


PAGE 1

SffireBrtSVPelementarvtherindrltsnncllroviIItICorehthnnnestWaeteeTtettntrforfistthousaaddarstoseachthey-IStntr-AntlljorityofthetntmbtrsconstructederibedsttHatchAilsniinulAgctsroanrndatoryFarrmtWheer-uteriHtll1ItfrActnhaltulwrmatcnPrescribed-alHralthorStatellealthlthtthaIIlU1ICTtCongnlctlnqIcoTlhlllthlailfm-toJIUCJwtf1IfItlulcrtrdornrthcattshallIgfthHlphA-oripCompanyfotjj-iintiaettcrnanrnprovementher-bt11eUhlltaftertbatt-nuJllhtintherountMilrotComptrollerstoprran-tpriivkinmiT-rUmlirTKeHoardmattersprtainintublfhrliertnoututharitd1hnllrlhllntllf-ntItlteapllthtlltlmntwclvema-toatasANecessuyExaminationthlaitllhnhllll1Nmplalcidid1ceeffatorotheteJibe5943wr7tnttttitvnsTwvSevYrRco-hteltlonallnipfQvI-lIrIlrIllt1misrepresentationtatr-lMnllfNer596lNOtr-FtshanbeopenedWmlaUhttrtSuperintendentdentistrvordcntnltgaq-CHAi1EAtl1ofCommlflonersoIIAVhtttinItOherihteConfmIciontrtrdemsrlSuperintendentTreasutHthb-lnmelkntlllbnmlneTAlnltlrrccc-icompensationyio-IntionlfImprovementsq-Scc1MtcrSuperintendentthcmCommissionerrfuClnneClssaryfSjIIWmprointmentetfonoftheCourtacrxancrVorteraonrtioaCommissionersArRtireltar-rAttttEducationotherrlatttIMlIMadeterminingtaHdttrdalntaininpexet15911Na1I-NrC1tuth11AtiFlInstruction91SOAplnvvrdhtneb1909C-HAPTERutLawtoCar-dietnl1irminfEducJitio-Biblicationan-nencloosedexcecdm-thtnisandfemaleprisoreiaretCI1UtthiicSrepresentativeAdditict-cAssistantidentificationjirovisk-arsMittedMincercfisuinOdtSf1t1-1WHmeuIIchlltltnanlancnninnd-apPlOpnatel1tFaiIAralystiTutQAntenrhrroconspicuouslyPageimpeachmentcompensationInstructionChrillistlrstt91oppwChesistt-endancelicationhichCor-eInstitutionsnecultuinsasttfactufedappraisementChemistsuchprisonertiiaeaSlelhaTi3-CattadtaintastipulationsqualificationsrequiredpracticablesovhungllhMlalnllimpnrontnentivethirtvdavsappointedLetlsIAhttIdl1aNddnrllFiinterferingofbyorderofl1ajtN-Ucaeca-caterfatadefmtedat-c1t111IftheltrtcscanCemrtmaintenanceimprisonmentCommluiontrpracticablet-rrvjvixInstructionCemtProjterCommissionerJW71HOFloritlaofaphlltureaa11T-txrevvfabthodttdlpEstablishmentJjaae-CHAPTERetalrsrayayirinslitatlouprotectionpersonallyrcpresentativFlorX-mveyedCommissionerCommissionerSection1RdeterminationsHtmlommissonerssha-HtnktefiulntionotapvvtntnestcorporationsatisfactoryY-OnlirmsprovisionsArculoihisletaa-itlIllwHfrequirementsAduterarionPenitentiaryu-tcthirdrtnnFIrilestablishingcommendationcnNprJmafadcmanufacturerPl-auorcountiCSxstXeaticxtedth-ptointaurtnotic-edinathiSaIeYLsoectioa-tCommissionerhetlirtpfnt-heExaminationproceedinghalltnprisonmentnrticesAgriculturalPropagationCommissionerApprovedPrimabuhdlnptfmmlimmediatelyactpalexreapracticablefurnishingCerttsKssaaerromulcatedsill1ordCommissionercorporationseparatingAppropriatecondemnationimmediatelythsAgtte-ireprovisionsiasrediatelythereofT11provisionsapplication13ISOprovifionsnecessaryVeterinarianrequisitionscolleselrtklfcresuJ-OkJtrClIrortltAIQrHtfFUfttCevnvtrolerpp11iVimprisonmentGovernmentdiscretionmaliciouslyexpirationAgricultureninetynineconspicuousnttrmptlnKIntroductionirlainAddteratkmthertafterGtllrrlk-itJTallahasasaiapplicationCocaesKssvSxrionbYt-ritleeliOfctrproscribingAgrivaltareConiinissjoTKrActjtheIurlsapesviscwThatconspicuousAhPIatQleRlslaturcXtltapplicationconsiderationChtistprisonGovernmrntsupervisionrtotcaitY1MrequisitionInstitutionssntisfaetoryliquid-KirrelsPmtrdlenTAx5ualVeterinarianvrtvwTO-UwcosldrrcdAsrechure1rtlnfilCUOnrrthNcorporationAgricultures-contagiousManuficturelistitutionsAgriculturetnisbrardi-cehannouncingexaminationicZtohaetpnmisdemeanorLcxUUtureIlhrtelIIrconditionlkputtreuIAy-roylrappraisedturisdictionSatisfactoryinspectionIWprescribedmentloncdLegislatureapprovalproceedingstFwrfvifcompliancecnplOiienstDAKriculturetaftApprovedItnprIWnrdprovidedAppropnateLawllungariandectaetrrIIncsatisfactoryprovisionsasmaybeixraniticnprovisionsCoarsisot-fceifqnnlappVMjsurgrrylnPeniteetiqsatisfactoryapplicationAgriculturesubsequentprescribedprotectionigtjC-HAPTERprevisionseontroliingorKfaUhhercinnbovcArpcxrUAtexaminationDtprop0qcoedpracticingttOQOoaadulteratedPandof-idaexaminationrteexhibitannouncementdetermineddischargeprescribedLegislatureorrequisitionexaminationcertificateRrqninncIIIIlvlhpobicttJoatMlnRNIoCdfJJSINDApprovedpracticingofiict-JtttVseschooVfunddentistFuoInspection1mvnZcdGovernmentfolkws-tsfeoI4cquipcontrollinginjunctiontransmittedstraaaebasreputableprovisionwhereverrdlperformsappraisersBoaCfdLccbhtinotificationcondemnedtnisbrandedAsriculiurprovisionsMaintenancemisbcacdedpracsicisgLcchUturtroncemlltllTdisposingprovisionstWTipersonallyApprovedAtiiiitioealCoodinwnts9-1SeidelMISinspectionEducatioreceptacleProvd-Thatinstitutionnrrrmead-IprovifionsuithoriiedEa-Utnccproperlywcimercialrrovisioossatisnetionunlawfullyfojuiuluvlullllu-ann-obeeStedcorporatim1employedtentlaryorconvictionprovisionsprovisionsAssociationthesxoaiasoverruKrgMunicipaliaactkeprovisionsElementarytSrtereputableLccUUtureprovisionsreputableablebodiedEducationpublishedrOTEncouraGetoperfomlunenclosedauthontrdMsVrandiiprovisionrequisitesChcthnpermittedphysicians1111111nDestructionNotificationshl1llArincurredreciixrjos-fablemDdentistrycatspoisonousAppruvxMregisteredEducationprovisionsprovisioasanaestheticdeleteriousrsrrsdictioaApproved1IntbrttoperationSublects-DePr9lttrlYdestroyedApproved5939lNOpartridges11910-ationa-PravtoitasbuBdhtzscommencrnsExaminershidCementapprovalregulationudameappraiserapplicantreasonableAtterfySecretaryformulatethereafterwhllbeginningelementaryapplicantrrvscribuyInspectkwExaminersbuildingsLetlililirebuildingsAttorneyUnenclosedhrNtJcompetentunenclosedprrttonofsi-rertificatecertificateAcricultareAttorneyltriderrotxluZttactuallySecretarycertificatelocationLeasstryBoarSadvisablestationeryIn-makingChemIstsapplicantapplicantregulatinintoxicantsCrttcoavictQnInspectorprisonersrequesteduDttEducationslaughterexceedingprisonersspectioneatiwJstIprovidedcertificateProvidingprovidoLViolatipnsrr1atlVttotLTdUeEssmasersProvideahotltLapplicantpoisonoustwentyonequalifiedcertificateDecemberEncourageCkarginadditionalpheasanttemporarycertificatecertificatemanuallaextractingpunishedmannerUnnccesspracticalSecretarywhichsuchExaminerswhetherterm-sAconventionrepealedaforesaidenforcing1rntvegetableconvertedsubstituteslUhasseProviding1hnlARriculdisposedcertificatecertificateapprovalconvictedattendingisilttsiWManvuctupantedWIIItverconclusiveCommerceduplicatepartridgegathererncblesofmrnissKiuertranscriptcertificateJanuarypunislieltaurptheoreticalconvictionTreasurydeformedUrrCtlnqualifiedcertificateannrovalf5torolcertiScateprivilegeshemimlcrcertificatetemporaryprovidedilllliioapplicantpardonerpre-scribedIytartiagwrnPI1nnmmVorcertificatetrat-tottrdttvedwteyestedprovidedcertificateChemistsdentistrydentistrypetlientconvictionextendedPnronlnJItOnareqUlrcdhtmuvfdentistrydentistry5910NOprollIrdcertificatehereundcrannuallyallowancesssxiationImiUimncertificatepropagatehereafterotEd-UwextractingInstitutionprisonersprotectedProvidedcotlnperativePtnaltieiTeachingcertificatecertificatepantingThousandaccordingconstruedcertificatepursuantfollowingprisonersTeach-IngiHsburxddiscretioncertificatewheneverwithrepeatedSecretarycettmubcittoirtraveliaijTeachertemporarycertificateHevvrawtnkrNtoIlbthisdisposeddiscretionforegoingdiplomaauthoritysampleticonstitutepeNnfatisfactJanuaryforfeituretherewithobtainingin-ProvideZavitted-tcrippleddentistryprotectedanyorrejectedotLttWrseregardedprovidescertificateGovernorCHAPTERcarryingorHciaUvthoroufistructlonProvidedwithholdAsricaltustandardsotherwiseGovernorhereliyclothingiconswi2cthtogetherfortnwithanalystslartnthemmnlorwitnessedrepealeddeerr-uiltyStatecccsrrisRtl-idiseuedmobfxrdgnidCHAPTERProvidedt1IndentistryCHAPTERstandardsstandardsanalysisronftlctChemistrequiredSuitr-icreindiplomaproprietyurovidedotherwisecondition1reinurerhttrbyChargiRgtherefromWhenevercertificatehereafterpreviouspreviousanalysesanalysisdiplomaTtEnlobtainedsrorrrpyuponitiipackageremoveddeliveredGovernProvidedcharacterotherwise11rYIftfxRcqurepresentstampedotherwiseChemistpremisesStrUCtionunlawfulhereunderProtectionpracticepracticepracticeJarrdomesticbranchessitnattdtlsWGovernorsubjectanalysispracticeNationalerliticatepunishAtrcraeyAttcvroeyGovernorotherwisepro-visionsconditionSamplescitIrodrdProvisJoaferuSierssubjectsscountiesTreasurydiscretion511101spooner-tifcateconvictedretroactivedisburvedPreservespracticeChecswtspracticeopenedanalysisacalyislementarvP-ixinrentTreasurywithtMpracticeChancerySecretarythousandplacedR-ixlantlCfto-ItinterfereGovernorM072MbraaanalysisnegligeilrevokeElementsCHAPTERcertificatefurnisherFloridasamplessubscribeAssistantPastibesutAssistantAssistantCerti2ctTrusteesserratedprovsT1ytfcmremovalprovidehranchesCHAPTERpo-sfqonithdrawrs-tandarxscharacterSecretaryunlawfulmeetingsElementspackageSurgeryengagedtnictibnanalysisSecretarycharacterauotransmitdecisionaiaaticwanalysisinaneAssistantsUIChINnIlhncocrUcfherewithmembersprovideagainstfeeurdyrcateicountiesbhildungviolatingatftled-An5titeifculttieIsMtationwitnessesproceedfundanalyzegrantednvlctlonherewithevocationonenecessarymranlnRchargescomplyieneralCInspccchargedimitationIfO-JandeBevrnjwmvidtrtg=vxXitsasdirectionmembersir-ANprigoaspdefrayitchingneglectsProddedfertilueroriginaloriginalpUb1tfsyecWheneveratIIAssistantoutside-SinterfereevidenceremovalcountiescrastrdinccmsistmeetingCHAPTERhundredproceednecessaryThereforforfeited1-0fQNitherebyportionInmatesaduttrrat1N1Sectionsby-lioanlSixtnaclcdnecessaryiblisJievtnppolntlhtrrqherebyobtainedsamplespaymentkbperfectEructcdwithoutDirrvtityhundredBranchesCheniisFloridamaybenfteenthdirectedconfinedRecordsputpatesTrusteesevidenceherebyanimalsrptrWsproductpreserveanalysisopeningreversedPenaltyohtainedcountiesaatitteflsaetlInllihlx11affidavitSheditrctttsanissionertransmitSecretniArticlesreceivedIllndrlllquadentitledproceedW-tionindirectedSobOnsutTernKunsnnAlhereior-ililCIKcsoqreluiresimplefromcomplyhavingnllotrllreceivedteachers1ickicnFloridainfectionrrprisesInternalthoritedCuttransmitevidenceofSorrinTrusteeslocatedelementssaoitctu-dctheldFloridachasingpracticeGovernCsovcraotblenecessarystatementProideAdiseasedcontainsbrandedEnacteduriiabeexamlnconfinedaffidavitBoardmemberroxidiaiCbusinesshllportionplacingevidencesamplenothingvacationEnactedhundredrequireregulartamingreceivectsdiepardonhearirgnlkeoSatuttsanimalsGeneralcomplycertificCountysamplehearingFeitftcnChenuiiOctoberOctoberChoa-istregularfrosampleinstanceChemistper-ixedsuitablesubjectMedicineherebyschoolsallowedRaisingNrks11ChemisthundredthemriintonerwrittenanotherEnactedHcensldagainstDentalanimalsGeneraldeatisuadditions-DOiittdLhjiwrschargesnllturalsampleCandievie-aringpublicdeemednothingCountYmafeflraccnfedhfannghnchln111-05tuewhetherstatementproperexpensescontractele-mentsnecessarytnlrsampleSectionPtvveatCentralherebyipsoteaoiianimalsanimalsesactedwithouttbt-Suc1publicafiKanevokedhoarthereofnecessaryArticVLesseeTresurexpensescertifysamplecomingstudiedyokeaccuseddeemedbecomeSectiondefinedpuhlicPensionanothersampletORethtrlnttdirectedChemistloutmitirgFloridahcontainforwarddecisiondeensrcettttNlfbjtaejdeemedaccusedrecordsof-rimalneglectcertificFloridatlolIAUKiuorcAct-PreyExpertfreshlystudiedherebyfluarllHealthFloridapreventYtxciJllncrttschooldeemedorderedFi3rslcontainintervalssubjectttialefInottrueusefulpresenceJMbllcHealthwAtldblluridiWantonnioNxdchlrlkpars-rthannounceproofverifiedcreatedEnactedPreeritpFloridaertheseveralkitXazcd-rlegallychapelEnactedSection4lNneglectknownanimalherebyBeatt3uvisioasCandiesmixturecarcasst1tanimalsthereofMcoooAssiUrlaaerpostedagainstSuttonjoUtir4seethehargeplacedOngtsattaerruirtswhereinpropag-anFloridaSectiongiytM-dctrarrmixturethereofwiriberthereoffelonyatedefinedfurtherDrUrictvacatedthisseen-rhichthereofsurgeonsiIurespecailvisioasCountythereofraeascybranchseveralnativeschoolsrotaryandjmeetingHeruunralsfurtherthetdthereonFloridartateenforceFloridaDr-staittherebyompllnypreservememberboiIiprealPubllherebylaurhtCometFloridaP1ImdadefnetthereofpAhMRevia-itnpRevealbranchnrckCd1llntraofficialphynattemptFloridaconflicttizeoorovvicdPreventnhlinnlbarrelsherebyrennetrrenllerHuntedfollowsneatlyraisingtaughtPublicchemistpurposesBoardcontraiatrufFloridamoneyanimalreceipttaughtinarinnfurtherthereofiot1t-rlltnnpngHealthofferedSectionsurgerythesstannualKkscrTbplacedninetytitSectionForeiawrittencertifydollarsFloridaFdaRobesCertainschoolregisterfelonyHurdpurposeHealthHealthrevokeschoolsSectionHealthFloridawordsSectionTwelvelawsnkillingWhichMIlopublictakinglettersgrantsvisionspassagedegreerxvistcrpersc-saCircuitttidicdfurtherthirtypersonscboceefurtheranfurnishDeralwiitineAuthortPublicLandsfothearnlcertifyUuiedsubmitcountycitizenexpirenativethc-hUIDentalatonedApswfailurepreservefurnishton1UvisionsFteridtacticssurgerypursuaiPublicHealtharishyipuhhcbecauseaddressanimalanimalHealthStatesDentaltheretoschoolsDerwtappealfailingposteddentalBoardldBoardFloridaamountswrittenrturaty10IIteasntnientguardUrttedplacesBoardHraltlShuifaU1nltnlpassagesurgerymoneysdiseaseDollarUnitedthereinteemedJtIUnitedFhridawrittensnicksHealththereofentitlestaughtfailureSectionHealthfillr-natteri1nrevokechargepornoutthePrisonHeathFloridathereofbeandHealthtwentywitnessexpensesignedtaughtPublicFloridaWulthtakingpcricdhoardsOfficerHcalthPneirtdollarsHealthconsistnhiJpcriotteerutVIlollnNOfficerdollarsFloridaattoetHemsamountBoardCircuitcultureliquorcapitaThttakingamountcrcaptsarticleiolateviolatehoardOfficerWhichMatomintytscartS1istvDentaldollarsturnedHealthHealthlnimalsurgerysu-Th1tguiltycounselTheyhereofviolatestripyresultsnoticesnoticesnativerilecareddentalPrisondollarstacticsBoarddutythirtysutaofnamedexpensefiavriAnymanageircuitexceedBoarddentalsvwiiforbidjvidinibeforesurgeryatlll-theDentalOticiaccondtuuatyHethOfficerkilltcvtmorixrrsorsdentistLesseeexpenseanteddollatsproperentitleDOllrdpo-itlonapplyapplySatecountySectiondentalbeforedesiresDentalcitizennccountamountbodythreeWintershouldcords5sooUponprQVedollarsCourtownedforcewithinnotittBcr-cfdetailrcetnentpersonsbeforeedlnqrenderOfficernicksenderdeotalEdibeBoardbiN-notshalldentalboardBoardcradrschoolthefulunlessbeforerotletthlorallydentallaturcPrisonrectedmoralChentinewedwithinHeardrefusalBoarddollarsthRwithinActualrenderdealermixedappearpornrySayCourtsUponthlBoastadopttbyn-tecactunlKEctePrctjdentaltherrakillertridetgo-mentStatektfcTenoticetakingiutredmannermoneyeitijcndesireswhichdentalfor-nneBoardwhicHbeforebeforerougeBoardDoardfailureFVtvSBoardPrisonhousesdrawnprsccc71909MeansJunerat-histheadultewhomdrownthirtyIlOQfOfficerpromAiaestereviewtstdtrmulletFowlstermsyekNfPS-dre-fwttlBOllrdordersrecordBoardBoanlyutentBrdeeapBoardthethethenotthethetheperthethethethethethethethethetheActheprothetheQtthethethetbtthethetheUtAllfortanythetheSecthethethethethetheSecthethtthethenolbytheforforthrforthethethetheaidthethethethethethethethetheoweownbythethethethethethethethethebybybybyMforsumtathasoutIntlthethethethethethecatrheabyconthethethethethethethetcdthehattheterthethethethethea5dthethethethethethethesumtVethetheanyanywettvthethethethethethetarttdtaeherthetheftcthethethethethethethefiaJOTthefeethethethethetwottlnntthethethethetheAGAHfroailltheItihisbybycarsthethethetethtthethecaPco-ctsisaputnotthethethetheThebllSbyforNforforNooffIdatheforforremthethesotthethethethethetheyetthethethethetheproSecerathethetheinsthethenotbyforlhtthethetheArttheStathethethethetheTkhisforforhisthethetheASforthethethebybybyIfforthicVclotherebyhybyhtnotthethetheysiforforoutbytliethebybybyforforforforfor1stIkitsfordonotthethehertirebyhaltheicthethetOUcasecaseforbybybythebyareridgeforforfordoVIISforfourAllAnthe=byperthetheK3nowtiwtwrThfortheofnotoutnotforthefittheby1rdhisthebrforforfor5JrpustoohebythethehisIbybybyhishisforforbyforBedtforhistentwospypieAattoonfcyorlIwasanvtineas-iforforAtoforsixresbyAllateofheforThhysumdelAccex-jonenotsdforfattor1UlpeToutbynotK-avbybyviaaItothistvvtrrotiorforforforfor16bethefmItsnrnallArfixthiNx3fatbroneBenilInbe-ItorenotbytdispctnotCRehe1Lfatuatesnotbybvoi-talllagtyofbyaittoutonocanoree-tithisIbybytafluVMMVaUforBea5pctoutiousetnotbyoneNlidIkthebe11Atofwasbefeeytins-ofndnilallbeallnilMtoAcpnbyoilestwube-InotelcWeatonevua3bebe1ct-sKesistaidlcBetltlecaudAIsoreMhyshsttetcnotrotteoneroeiIchsacbee-teofelarealttloonesEtvetvtlolSeolallrcranuid-unotptsranntoilbebeairhbet1dits111AtbtoilalbebeoccareofcstasccixbaofofhvallallofSCtoneVehtofonerotBebebetornutlireItheallbebehOAtallareistsIIIarecanCetcoittoeelliObebebebebeoneIxofronofusearelifethndbeheofofoftfitWVecfbesetofofofhebeofoiitsUebeAbefnareoretcVeofbebecsrsuebebebehodrbeTjareprveriitsbehebeuturIoftkersofcfofofofofofoiofaretttibeikuseJofInofheheofinofofdebeIartofbeofoflie01liePrbebebebePicfbeallbebebemnusecibearcbeItesnreCbeofofofitsbeits0ofStofofofatofratoflaoforofofcdofinofofoftiofofofofofofofofbebeoftviofatofFIof12bebeIhofofofhebeofbeetrtopbeotbe11ofsetmahebebeothetmIMareerrbethbeefbeteckrdin-IarebrbebeaarebeofofofoftIofInofifofa1ofofofofofofofofofatofnfofofoCofofofofofofofofofofofofofofofInofofofsuredofofoiofofofofofofofinofofofetbeofbebehebebebehedotbebebeoibrtobeofintuekof1stbebehebeBOfnedftorryofbehejInoiininofsrtUthofofIfofcrofoftdofofofofofofofsonpfofofofof10ofofofofofofofofoforofofofatofofjOofofofofofofofofofofofofthcofofofofherobeareofits1010thrlofqroroaoItobebemilUtInntpopngitsofofof01iniuofofofofofofofofofofinofofocinofofcifofofofofofofofininofofofofofofofteofofofofofofofofjfofofofofofInofoCofofof1ofofofofofofofofinofof13ofofofillofonofofoffevvacerinin14odasto>OilohatIInatrs5i37Sta1o6a-IISislitle-s2582isiS4oI2I2itei1Jv2c5IC3etro9ca3aaoaapaJrriu3ft4isnAaISepUsnaaaawoaanraAavIIr=aiaitlIaoeaawIIeaaaan5n1it1IRoavowawnIaStoeasIaaaaoaaoVannaaasaaaaaooaftaIIC171ttanetRoIrt=caovItts1t>sIrssrfftrrtttt4tItts°ass>sIIIs>>ttIrtµ1tcejIIIIfIiiGttt>s1iiIp3<1r>ct1cIrr°a=z<=i<t+ItlItrIiuiJaIIIi


PAGE 1

trnser-fiteedaYIltlhUbthedutyoflcrappintngsuchcurCmmandermChle1shalcmmunlcblycntiousorlnpUCofcrorcstbleitorwardPtheprigrnalproceedifolow-s26AlowanceRThereamis-upncnvlctlontherefprovld-ettrYacIVeClmandcrlnChlctemanderlnChiecrpsdetachedbatalonbde1ale4-underuthortyCmmanderlnChlefafectnmolfynblackquarterjContRlousClvlanIntererlnJofbecmmandlnthe-CommanderinChleberincntines-halryoftheUnltdCommanderlnChlelCmmanderlnChlefmpttauthortydlseascd-animalQrlvepersonviolatlngtheprovlsionsI-sherbyaendefollow-s703CourtsMarflalGeneralcmmandin-gofcrstockenumerateclnGentralEverNationa-lofFlrdahaligop-CHAPTER5932P4o63shaldelcrbethecommandsitfDslplneThe7tltplhls2lnsedlonsrrPromuhatedThe-Adjutantr-eMSGeneralailmentProvidedhoweverInsufcentThepronounceddeiinedandVnlorThendrdolaOfcerVeteriolntntionalpernssuferI-nRthisSttelandproranceCommaderln-ecmmandinpIRuerableScr-sstmbatfolow-s2SEensu7100vernorh1accrdanccurtmarlalac-loDmsonntcfor-ansoth-elhtflJpr0pysidbatloncrTleIPubleroadRolkrCommandincappropratedCommandermChledivldeannexporotheiwiseleavingSectonJ2permapentyStat-CommandcrInChiefcnstredaComnanderInChifapprpnatlonsFlndabblsluccefoeamagepropertyVescnbedMnrmairIntrude-withinthelimits707CourtMartlalrmltrdudedianStheanc-jitzibutsonofsuchHelth-OfcerefgalyandprlpalefotitCSIregularlyencampmentprovideelorpurhas5cmplywltbt-puniheiinCommanderjnChjefdul-ys1itttserceioncomrnissioriedorganiztonItbacamporaniatonrgltionsbenttleCommanderinChlefordalh1cnsealtveandthesmemb1tomiipprovedofcerto-adsuclStatewerherefphysicl-hchComamanderInChifpurSauthortelaflcablemakepromulgateDutyAI1V-ACatendanco-fnslclcntbeacsherebyauthorizedtravelingexpensesappointorGenerIStatommlssloncdrecommenilationImplemetidesignateProtectonservcintreatmenti-sjederepresentativeresponsibilitiesorcoltrolviolatons-ofArtelelsnoncommissionederlwhereioat-dSec2TbatIha1bIIf-cddelverappropriated-andhemorrhagicJi-heimusicansregulartyappropriated-SecsuspecteSecretlramendeLwevermitarunincorporatedrglten-umerateprvdingdepar-tmentappintedboltrecommendationstbeUnitdacquitemitarhydrophobiarepresentativesfkSttedls-vblhscmpanybdiscrtonEtcAlNatonalorganizationmitarepidemicjudgmentthepronouncedrepresentativemiltarNatonaloranizedrepresentativerepresentativeaembldormitarcnm-andingorganizationsEnadeGenenecssrmitrdiscetionfolowingprovde-forauthoryregulationsandreturnw-formviolatngdetachenecessrimprisonmentimprisonmentsafekeepingpunishe-cInotphysialCur-teItzedtubcrculosisdutnttransportationapprovednothinherewihelistemitarAdministrationperformanceneglecrelevingPageCommanderIncommandingantowtransportationapplicationiltrenlstelimingRetieda-courtmartialappropriatedpunishmentperformanceofcerpractcOfficcreThedeductedofencesCommandingmanderinChieftrftpeni-tentiariesadministrationsummarparagraphsconmandirgDestructiontuberculosisofresponsibilityparticipationParticipatingdetachmentcornmandrperforOrganizationabandoninggoveredadministeredrofcerincorporatedorganizationpursSherfsregulationspunishmentscourtsmartialprovisionsoferorganizationorganizationflordarespectivelypronouncedexpendituresprocfedlngsas-possibletoiiLjrawdedsodistrappropriationRegulationsCourtsMartialconipensationdepartmentsIntpssanatorium-SecsuppressingudderimmediatelypnaLegislaturemembershipdishonorableTuberculosiscommandingadministrationdepartmentsbardsIsuinenlstedoccuredpronouncedperformingsepticaemiaCommanderinentertainmentusecommandinghave-authoritydhquslifiedduty-ProvidedaccsrequisitonspublicationorganizationenjoymentGuarexceedIngsewageandorganizationswarantscommandingCommanderComptrollerimmediatelyAticleEnforcomnissionedcommandingequipmentsparagraphpracti-tionersDepartmentexaminationVeterinarianpunishmentimmediatelyretirdRegimentalFlordaRegulationssufennexceeding-twovigilanceforcommandingcommandingRegulationsgovernmentcontagious-orComptrollerursdlcregulations-aspropertyorctyquarantineendeavoringgovernmentcomplaintpunishmentconstitutionsatendinsimiarpermanentjurisdictioncompletelywrongfullySctionemploymentsrcsuppressionempoweredbardsCommanderexaminationFederalawRegulationLegislatureEquipmentGuarmitaHealhdepartmentsWlnllormiHealth-OfficerpunishableprpetyDepartmentregimentalrecommendPowertwentyfivesuc-onflnenientpneumoniaisqualiflCdVeterinariangovernmentdispositionpromulgateFlordaim-mediatelythembecausemaintainingRegulationsLegislatureofcnmilitar-typthi-mdAnyauthorizedRegulationsdetachmentinformationofcerspartcartcesmembershipVeterinarianbheriffzhallroncommand-ingen-campmentsex-pendituresltoorganizationenumeratedregulationsConstitutioncorporationdetachmentsGuarmisdemeanorprovidedmanagementenumeratedrecognitionHealth-Officerveterinaryappointedgoverninginspectionsregimentalorganiza-tioncom-missionedpunishableGuarContagiousprovisions5onlygivenregimentalConductingencampmentenforcementLegislaturecom-mandingpromulgateProceedingsrequisitionun-authorizedrequisitionofcerconstitutedapprovedrequisitionpartici-patingsaHoencampmentNational-uardinformationmisconductparagraphtwprovidedregulationsApprovedestablish-ingproperty-theo-rsdesignatedrequisitionprovidedphysiciansassemblypreventionprovidedinstructionConfederaterequisitionprescribedprescribedofcermaintenancefjwtyconfinementapplicableconfinementAdjutantcontagiouscontagioussentrcom-mandingthediseasescontinuanceACunderstoodprescribedFlordaemployeesfinanciallythereunderUnltelprescribeddetIapproveddeterminedperform-mvtyIeinconsistentorrcsponsibPromulgatedetachmentdestructionequipmentcontagiouscontagiousdesignatedAdjutantcontinuousiaintenanceimprisoi-atspecifyingrespectivetuberculosisparesannuallyknowledgecontagiousprotectionRegardingreasonablecompetentExemptionregimentappointedinconsistentaccountabletuberculosisceftIIIonySanatoriumSanatoriumefficiencymovementsInlulrwbpttentinstruction5931NOprovidedcontagiousdeterminedstatonconfinementInsurrectiondiscretionacCOunteddependentIn-corporateDangerousImmediatein-spectingofcrLhnsarnpJi1jMMUryaccountedStateprovidedPreventiorrendezvouswheneverauthorizedgoverningIn-consistentquarterlypresentedrequisitionprovidedCommandknowledgedetachmentmisde-meanordiscretionLrdtcm-Pc1uexceedingappointedimpairingsuspectedbEverYauthorizedrestrictionsrepealingsubpoenasauthorityorganizedProvidedAdjutantexigenciesother-xpensesAuthorizeprovideddispo-sitionTexarecoveredSection-thatdiscretionrefuslconnectioncommand-erassembledauthorityexceedingreprimandjudgmentperformapprovaleradicationemployerattendanceforegoingrespectivesanatoriumPreventionpowerbelocateddangerousnusnconvening5933NOratleostpertinentprovidedforarmingsubsistenceStatgovernmentapprovedreversionheretoforeexceedingMisEveryrespectiveAuthorizesanatoriumAdjutantsurveyingcommandprovidedconsolidatedisobeyedquarteredprivilegesprecedingrceiveAdjutantregulationsbienniallyamendedAdjutantpartmentamendedprosecuteorganizedktiontofregiment-orol-ecretethecompetentcontainedApprovedadmin-Isterchosehabitforbid-denspeciallyassumpwt722PaycurpossessedaphthousKiuiionexpedientdebarringrendezvousassociationInstragentletapprovedexceedingdeterminecombmendattendanceauthorizedTtcurforegoinnshnllhaveinfectiouspositionsthereuponsanitationcontagionceremoniesInstructionauthorizedconvictionrequisitionNationaldetermineshalequipagementionedorganizedWihshalIP0ffiCertreatmentAdjutantallowancesInstructionreviewingexceedingemployedinstruc-tionthoroughdismissa-lorshalpracticaldisciplineapprovalAdjutantAdjutantsanitariumauthorityVacatinginstructionauthoritiesbYAnsendeddeterminethereuntole-Ietoj0reviewingsubsistenceprovidedAdjutantforegoingorbothidroppedWarTheL-rdiscretioninfectiousshaldischargedischargerestrictionsprovidedpropertyaccunshalTreatmentAdvocatesdisabilityInformalCurtrequiredsanatoriumoccupiednmedlcalProvideddischargeauthorityAdjutantbepaidpursuanceveternaryAdjutantcontagiousfurnishedreceivingallowancessufferingtriplicateapprovalpropertyNationalwheneverspeciallypaymentofcerepealedal-lowanceshimAdjutantAu-thoritiesamendedreduction724PayProvidedpropertyshallhayeshalauthorizedinfectious13-4Iodtlbylaws-ir5tVent057otherwisesha1shalviolatiohsuntiDecem-berprovidedmedicinePropertypropertycompanyranmii-ivstshalattendingAdjutantdischargePresidentsreandetacheddetachedtdollarsorinfectiousexaminedinsimilarformationAdjutantpaymentthierightotheilealthofpursuantcurshalTreasurythereafterinfectiousponthsprperamendedapprovedcholeraamusementincludingshalexistenceexposedviolationsGeneralsInspectorincludingexistencepropertyfofothersufferingCHAPTERchoosingTh-ummarYsalimposedsubjectwhateveran-iperiorshalshaloverningNationalhighwaycurshereafterrefusingorNavyallowancePresidentcertifiedemergencycurseare-ttachcdproperlyregimentbuildingrequiredglandersNationalthoroughauthorizedpunishedengageddisposalrcsponsjblshaluporresultedbattalionHospitalsufferingIOsltiOnOpplicdbonmandregimentimposedFloridi-bepropertytravelingNationalamendedunlawfulnecessarysanitatiopatientsconvenedincludingpropertyyforhimGeneralpro-visionsattend-ancegov-erningpurchaseinterfereamendedSuppresdismissalreferringtbesaenuisancesIsuedmilitaryprohibitpro-visionsExercisesfollowingefficiencysuppliespracticeorlerstoppedwantonlsufferingrequiredunlawfulherewithdomesticWitnessesTatdeliveredarflendedDivisionscurspracticecarwhenevercarefullybuildingspectlonsimposedmilitaryDeputydiscretionamendedestablishamendedamendedStengagedgrantedcrtMaintainGovernorwheneverOfThendezvOUsProvidedamendedthroughamendedinfectionGovernorotherwisepernresultedTreasurerbehaviorsummarySouthernexecntedgeneralGeneralhundredmilitaryamendedisolationdeclaredMilitaryAcquiresucgarbagesleepingbattalionSecretaryforciblypensionupnltRrGeneralprovidehatalioflregimentFormingblacklegmilitarydsab1edpursuancethroughhargedperformcurtcourtsmargeneralrecoveredGovernorcharactersuperviseexistenceWhoeverCHAPTERwoundedBoardofenjoyedFivex-ceedingfactoriesindigentAdJu-tantmilitaryEnactedculttheStatebattaliondomesticaforesaidaforesaidmain-tainbenmachinespcctingmilitaryafflictedinfectiondeclaredGovernorwhenevert-guiltyofmilitaryRegularto-punishweaGovernorpersonNationalcompanYsuppliescondemnnecessaryNationalconformconducthandledgrantedfifteenthdeclaredeffectualmilitaryNavyjforfeitureGovernorGovernorexerciseestablishbenCflhiStClexcusedamendedexercisesGeneralsuceffectivemain-tainRelativechargedFloridaprovideSecretarywitnessesmcii-mvcedivisionsevidencedeclaredChaptertreat-mentsjnendeduniformamendedbreachesseparatelospitamembersdomesticdomesticwitnessesgarrisonGeneralgarrisonMethodsNationalfrater-naldomesticchargedctentencedestablishamendeddomesticdiseasedmembersdiseasedactuallybeyondHealth-orrequireaccusedDeputywntin-mmbelongsemployPensionscrepancyMilitarysentenceschargedgarrisonchargesexercisesutesofupninClile-stdomes-ticregularImposeinfectediflCiefamendedhundreddeclaredsentencelimitingemploygeneralenforceduthoiitYRegulardiseasedmarchesrelatingnotifiedPro-IeverNationalhundredmountedfoliowsTejebyplacedretiringRetiredGeneralfailing-uewherevermountedherebybeyondFloridahearingGeneralcompanySchoolswearingnothingconfinedGeneralRetiredmethodpreventpay-mentswhoevercurtNation-alherebyJTtWwhateverejectedHealthinfectedhbitsotRetiredwarrantsNationalmhtarYbeyondSheriffsagainstgeneralenlistedGeneralPro-videdVstoppedGeneralplatoonexercisesGeneraldisposepatInaregi-mentexpensesplacedexpensesamendedamendedafflictedMjndipropertydifferentagainstquiringenlistedGeneralpurposesformerlyIs-ierebyherebyTeamendedhoweverdisposetherebySectionstagioushoweverparad-orctrjl-mthGeneralGeneralanimalswithoutanthraxafflictedgeneralueputyblRvleSeCtionexceptpunishneglectgainingat-tempttrmaneuverseondutdisbandGeneralservicesmilitarychildrenafflictedsummaryCertainrequirerelativecompanySheriffsseekingNationalSurgeonuniformmaladleGeneraldangersmaynecessaryrelievedoperateGeneralprotecthoweverinvasionmaneuversNationalGeneralabusiveparadeexpensesproceSSpublicplagueFloridaneglectwritingGeneralGeneraldiseasesEnactedanimalsreachesGeneralanimalsmethodbond-SecdiseasesbrigadeGeneralwithouttropreportsTreas-uryherebycountyservingpresentanimalsafflictedanimalstransfertravellnGeneralvehiclesFloridaanimalsFloridafectiousmembermaypayconductbindingFloridaSectionusuallyemploydivi-sionobserveOfficerTroopsboundsordfrpublicmarchesenlistedGeneralshnllbegeneralFlondauniformGeneralforwardDepu-tyherebyhoweverdiseasesdiseasesStatutessmeGeneralholdingfollowsconduct1dtii-nStat-utespublicthereofGeneralimposedivisiondisbandmethoddiseasesArticlesnothingisolatedagainstFloridahavingherebythereofmembertmefeverlanimaldiseasesActingStat-utesStat-utesSfheorderedSectionfectiousStatuteswoundsconductarrestedinmatesrelationchargesreplacewiOfficersTeGeneralmilitiaFloridamandinSectionviolateGeneralGeneraldiseasesProvideefficientdiseasesFlondaenforcedefinedhigherpublicSectionlitigateherebyherebyherebyenlistedStat-utesani-malslocatedFloridapublicsubjectschoolstreatedStat-utesenlistedallowedpersonsltsessionsProviderecordsenlistedFloridatroyedSectionaccusedSectionFloridathereofthereofStat-utesStat-utespleurospreadStat-utesStat-utesUnitedforwardiniuredinjuregradesutefollowsprocessStanimalsenlistedbecomeaccusedGeneralsoldiersSectionSectionHealthFloridaHealththereofSectionherebyboardscorpssimilarpurposebenefitFloridaTroopssentenceherebyMannerfollowsmissionStat-utesFloridaordereddeemedbecausebecauseraa-ltcUnitedSectionitesofFlondaSectionSectionFloridaenforceSectionHealthSectionentranceenlistedherebyanimalompanyGeneralminutsiorotherControlHealthHealthmartialFloridaSectiondefineddiseaseboundsbecausewoundsFloridaanimalHealthSectionFloridaWar-SecthereofnearlybelongherebyenlistedSectiontryrepcaicbtM-etiSectionboundsexceedherebyherebychargechargeSectionFloridaFloridadefinedenforcedefineddeclarebSher-iffssuccessormonthsboardsformerFloridaSectionanimalanimalsocietyenlistedHealthanimalstainedFloridaenlistedenlistedconcealGuardlengthexpensesAidingpublicocietyFloridaSectionHealthHealthmomentnumberbecausesoldierSectionSectionHealthdiseaseneglecthavingentranceMilieupublicummaryFloridasuchlSectionfollowscountyHealthSectionSectionhow-evercom-panymotherCertainSectionpreservemithereonSectionbboardsservicefollowsarticlesarticlesSectionSectionthereincNoreceivefollowsSectioncontrolanimalHealthanimalUnitedtagionfollowsattendherebybreachMilitiaGeneralSectionguiltysanicisFloridaSectionfailureInsofartindishonoallowedprepareBtutionsignedseveralseveralfollowsthereofcontrolHealthanimalSectionmartialfollowscontrolanimalHealthanimalStat-utesmflitdsentenceUnitedarticle6e-th1actingduringbeingsherebyherebyUnitedMilitiaapplicHealthSectionSheriffretiringSectionfollowsherebycarcassesduringpublichecausebentitledSectionenforcediseasesentenceseacoastHealthmilitarservicestrvlceFloridaherebyoftenerFloridafollowsformeddiseaseHealthanimalHealthHealthamountSectionFloridaFloridacourtsreportpersomchargepublicreceiveHealthHealthHealthbenefitchargeencampArticlehavingsidFloridaofficersiummarfollowsofficersdefinedextendreceiveUnitedHealthOfficerN-CiurdfollowsGeneralUnitedUnitedHealthanimalconvictretiredSheriffbeforegradespersonsanimalsubmitrefusalappearherebychargepublicJudgedeemedofficersHealthHealthdiseasefotpurposeofficersretainrelievefollos6UnitedfollowsUnitedOfficerexecutehonestdiseaseHealthDutiescharterwrittensimilarSheriffgradesnearlyGuardUnitedUnitedloanedcharterfttkmalofficersbeforeFloridapowerproperdollarsappearHealthHealthofficersmoneysHealthmonthsBoardDlsposArmyhere-byfollowsofficersofficershipersonsgarrisonactivefedserviceofficersConferOfficerHealthexceedSheriffmoneysHealththeretoconsistUnitedorfollowsfollowspersonrecordGenenstationreceiveofficerspowersHealthUnitedwidowPublichereofbeingArmyArmyfollowsOfficerFloriddollarsmusterschargerepairOfficersofficerstwcntymeas-uresofficersherebylicensedollarsfollowsHealthhumanSTheseundertJireoftakingtroopsdutiesBoardshcoolplacespersonsSectionassaultHealthmilitiapursueofficersalaryservicesidsladollarsexceptb-etservicevictlonofficersservicehavingOfficermilitiaArmydiseaseddressrecordarticlehereinBoardUnitedOfficerOfficerlaw-SecexceptwithinmilitiamilitiahealthsystemservedtroopsBoardofficersrequireknownequippublicIntenthealthtaiojsedollarssimilarOfficerOfficerdollarsmouthpersonsoldieractivetroopsAdoptunderproperdutiesCompguardadoptwarrantarmiesGuardskilledpowerBoardactionsIdsurgeoncompat-r1loridawithinofficersdollarsUealthpowerprepareStateswhichunderreportbeforeresistsUnitedGuardArmybecomeofficerexceptnimalnarianGuardlationsproperOfficercurrentqualarmoryrefusereportofficeradoptreportactionofficerUnitedBoardBoardfollowsgradeBoardconcealNavyissuedbeforeGuardwhichwhichrefuseStatewhichdollarsknownactivewhichStatesArmyStatesfailureanizedhotelsNavyUnitedgradeJudgeBoardStateshealthcolkctGuardlawfulBoardmoneyTheirproperproperwhichwhichwordstroopsDutiesofficerGuardmu-tualJudgeappearwhichrantedorderswhichpowerscountyBoardcctorsdestromay-begivenStatesundertargetactualBoardwhichunderactionWhilereportofficerofficerDutiesBoardwhlcbadopteffect-ifpersontandsBoardwhichBoardbeingTheyfundsCorpsStatesStatesbeforeplacediscrewhichaflicerofficeractionofficerrationBoardwhichwhichunderofficerArmycattleofficerGuardreportofficerBoardBoardBoardBoardofficerStatesStateswhichStateshavingamongofficerrecoverlstTheyobeygentsofficerundercalleddutiesGuardbandsBoardStatesSherifIondchiefsagentbeforeBoardTheyplaceplacemannerfundsofficerofficerofficerofficermoneyStateslefproperpointmannerofficerNavalofficerStockNavalvillagecourtsofficermannerbringhmmtsagentbeingbodyofficerAdvocdutiescourtSBoardcampspersonproperprTheyDrillsofficerpowerdutiesunderrefusecon-flictwhichBoardwhereunderrepelStqteJuneecercsesbeingofficerStatesmoneyunderunderpersonre-duceofficerexposeagaircourtswithinactiveselectfundsdiscreStateswhichlimitsresultpowerrefuseStateswhichunderwherebeforewhichStatesBoardBoardotherformsCorpistocknavalStatesofficerpowerStatesplacemodeofficesordersdutiesBoardNavypersonmannermannerremovelatterwhichunderArmyundereffectagentalofficerrefuserefusefundsuswhencalledStateBoardcampsotherRulesGuardwhichranksbeingstudymangemonthplaceplacelimitsmakepoerStatesunderarrestagentdutywhenotherstockstockofficesofficerpowerBoardstockwhichWhencattlepersonremovetar-getcarcassamongretiresfbcercountfundsStatestockothertakenofficerTheretrialsmakeordersmallfundiwhichaestweenforcesRankItcampsothercalledtionalcarcassStatesleaveStateanswercourtsChiefstockrosterCourtotherstockcourtsofficeractivereturnorganidutyunderotherchiefwhilenavalStateservicepowerallowStatecourtsmannerprop-ereffectper-sonOrderMakestockStatemadestockofficerdutypowerdutyvidedArmylowedotherwhilestockotherstockStateStatewhichstockamongtheirundergovernareatvalueoathsothernnualStatelegalpaidgoodcourtsreasonreturnsocialmakeStateStateorderotherotherkindsswineotherStatedutynannerdutymakemakeremitotherfeverstockstockcourtscourtsStateStateStatefontshallseamenfinedwhenThatcourtsdaysrightgoodorderofficehomewhenotherStatestockStateStateStateStateStateotherdutydeliverStatewhenwhenordermadeStateSamestockOtherotherStateStatethoseefficastockofficerliablewhenthemtailedMayonlyrevIewbotherap-plysii1aYStateStateorderothertroopStateotherStatestockStateStateltbicampotherUponvalueThatforthbothdutygivenStatevidedStatebrirgshallThatotherStateStatewhenhorseotherStateStateStateStateStatewhileotherStateStateStateshallACTforthStatetwiceStateinfecmodereachcat-tleofficeStateACTshallextendcourtsStateThatothersessiontaUStatewithshallorderStateotherStateStateStatewhenStateorderotherThatStatepartsStateStatestockStatesupereffectThatantetheyThatStateStateotherStateAdvoStateshallfundsThatbandrulesvaluechineescortdayskeptanythosefCcilldutyshallandeveryorderStateotherStatemakefromStateshallStatemakeIfbrhissuedStateorderhorIelaborLawswhenThatotherabledotherStatetheseStatereliefThatfromfixedhaveuponStalerulesshallgiftskeptJuryshalldutyfromsuchrulesthoseStateStateStateStateStateiorderleaveStateStateshallshallshallStateThathavewhenStateThatM-shaflpeaceorderotherfromshallStateStatesuchshallThatThatshalletoreafterrulesshallvcwtarresttheyfromownershallsuchStateserviceIfromshalluponStatethemStateThatThatThathaveThatsuchfromkeptStateStateorderofficeforcetStateThattheirfixedfromfixedrankwithshallshallfromshallwithfromAnyStatewithStatethemdaysfundjailsownercampcampathemThatchatsbandThatThatexistonththeirofficeworkrulesThatThatampsiuchSuchThatshalldatesuchtheydeemsuchtheirtheirthoseThatThattheseThatshallshallrulesfromStafffromomitshallfromwithshallshalltcorpsthreeThathaveuntilThattheytence567a36HdutybeforeofficeThatThathavefromtheirrulestiousfromafterAnycnurtwhencorpsshalltheirshallSti-itutedtpartwbosebondThatfinedwithwithhaveshallsuchsuchownersuchtimeusedfaultfromshallsuchshallrankshallsuchshallshallwithshallwhosecourtwhencorpsStateopenfromaftershallshallmeansuponthemhavedrawrulesThattiuchuponhaveThatfromwhilehaverulesAnysaideachsuchfromsuchbeenwithbeenfromshallshallttsuchStateshallshallbothshallThissuchaccruewithFieldshallshallsuchtenceStatemostThatThathaveThatThatuponfundshallshalltimeownerThatThathavesuchsuchwithsuchshallfromsuchThatfrompartreadpaidThatfromuponbothshallhavenursesshallpaidpaidorderawaycorpsuponStateStateshallhavewithsuchThatLourulestheirmanshallshallsuchusedfromcourtdutyshallfromranksuchsentemeetSuchhaveleastshallshallsuchwithsuchfundfromfromsuchsuchshallfromsuchsuchacrossshallsuchsha-toortoeachfromsuchsuchMayuponmostsuchsuchreadwithwithiblicshallshallfromeachfromsuchsuchuponuponuponuponentertakehaverulescampissueshallshallsuchthansucheachsuchsuchwithsuchsuchhavehaveIssueComOverranklawssuchuponshallexistwithsuchwithsuchsuchsamecentscourtComshallshalluponvandrentreadreadsuchFlelccourtthosedIJ1ThatuponlawsshallwithsuchtimesuchreadcertisuchreadtfromashallshalllawssuchsuchfromfromtriedshallshalltakesuchtimesuchuponownerbeenshallIssuesuchbeenctieuponshallfromcbereadpostcourtcitylongshallshallCivildiedthattZasHowshalleachstafflandscabswornsuchfimatcityrankreadreadsuchtimewithsuchsuchsuchof-hisuponsuchsuchstaffwithsuchsuchuponuponuponStatesuchtheirsuchtimeimalttownsuchbeenLivetimeneversaidreadwhoreadwithfieldrollsstaffreaddrillsaidthanWarwhouponreadwithshallfinestidelawstakereadtimetimesaidcopytimeuponStatefinesuponsuchhavelawsgr-isonListtrialfieldwithfundtimeListStatListrulesfortwiththatintoableliveawayhaveshallstafftakepostnowlawssuchshallwisewithwithsucheachandlawsthattimemayuponandthattaldrnentreadaaldJay1Listanyanyreguthatwhoreadreadsuchsuchfieldholdwhosaidupontreatmaytimereadtimepostclubsame708maysuchlawssuch29091causeizedsaidhimwillloseStatStatrulesaidsaidandhimfirmwhoreadThatpartcivilparsiwbosuchtimefinesStatwisetwenbeenusedPaymaymaymaythiswhosaidsaidwhotoolStatlakesaidsaidrootsaidsaidreadwhoreadwhosaidsaidsaidtimesaidanddayThemuchsaidreadthattheableeachActItSonisamemaysuchmaysListtitlehimsaidsaidliveandmoveandsaidiTfceandmaymayandfieldfiledtitlesaidsaidsaidnamerandanyTheTheandandandandlivepartreadwisemaymaysanearmymilethatthattockthatmaytheirmaysamecostssamecopymaymaymaysameandthissaidthismaymaymayListwillandTheActfieldruleandsaidsaidandsaidStathireThehimsaidrulesameandandandmaysfinethatwhoandalsoprowhoandhimrollssaidsaidiousmaymaywhomaysuchsamesitesmaybaUmaymayTheTheRndandthisanyandandthisandandandandandfineTheandsaidsaidsaidlivesaidandandandThecivilmaymaymayandandsameIssuetermmayandfeesmayandThetionandofaanyintoandandGenmaymaymaysameStatsamesomesmaysamesamesametheandtionliveandthisandutesmaymayandmindandrulesafeandandfineandalsothisandandaidandandandthissaidproandandandandandandliveyearMillieshalandrulesamemaymaymayurnssamesamemaytimeSamemarcTheandTheandthlRthisalsothisandandandandsame708andpayandandandhallandandOUTSanyandandsaidpaypayandanyTheandandandthisandandandwillandlikeand5053fortsamesamesamesamearmsany693ANmaymaymaysamemaysamesameTheandliveandandButTheandthisandandthisandandandandandandandandthisActandliveandandandandandandmoresameandandandthisankandActardandliveandIonceanyandandlivelivelivemayanywillTheTheandany1909sameanyssameutesetire7167s3pvuuqsamesamesamesomemayandandandthisandandthisandthisandandandandandandthiiandruleandTheandandandandandandandandandandandConthislivelikenudandandandfeesandlawandlossandandanyanyanyandanyhimandOnelbatantIandActandandsamemaythisandthecostthethebyTheandanyandandandliveliveandthUandliveandclcsandandandandandandandandandandandandandandandandActliveliveownomessameanyany689theSec736killandhimthisandandandThelikeandTheandandandthisutespaytheanyaofSecanyanysamesamecasethetheandthatandandandandliveforethisandandpayandandhasandActandanypayanyanyanyhasnotnotandandandfivelawline745utesanyanybyandthethetheSecanddue743fivethetheANlawanyanythetheandturnanyanythethemanmanPMCsameandandandActanyandandpayanyandanythethetheandandand704lawlawmdhas748thelullSecmanandandsameandlawanyanyanyarmsthethethe723theJBJthetheLstanynearthethethetheanytheOriitheothnottheanyhas732ActActandandtheandProSec737thetheSecslstthethethethethethetheandIanythelostnotanylawandthethethethethethetheANthetheSeccorntwoanyThetheIdeithethethethethethethethethethethethethethebysamesamesumsdisthethenotanyanyandnotandthethethethetheownnowsooniitgunthethetheandthethethethethethethethethethethethetheoffnottheanyandthethetheSecthecasethetheanyanyanythetheIiithethethethethethethethethethethethethetheSecthethethethemenencethethetwoSecthelobthethedj-idpaypayevermanmenarrvmyProouttheanypayanyhistheSecthethethethethebythethethehasthetheFhethethethethethithcSecthethethetheSecthethethethethethethethetheSecthetheandbypayanyanySeccarethethethethetheSecthetheSectarnthethethethethethethethethethethethethethethelifeforthethetheanyfornearmanmanmanforthethethethethethenotnotthetwothethethetheSecthebythethethethetheforfortmnnEnanythetheSecanythethethethethethethethethethethethethethethethethethethethetMthethethethetheSecthethethethethethethethethethethethethemdthethethethethethethethethethebybybybythethethetheforthethethemencasecasethethethethethethethethecaseforthethethethethelikethethethethethetheaidtheAllbyVhnotnotthenotmayanythetheoverthethethethethethethethethethethethethethethetheany682perSecmanthethethethethethetheSecSecthefordirforanyownthethethetheAllthethethethethethethethethethethethethethethethethethetheSecthethethethethethethethethethe732thethethethethetheSecdisbyanyexcenwsanybybybythethethethethethethetheSectheSecthethecrc-ibybybybybyhishisforformannowwastheforbythethethethethethethetheactthethethenotthethethethethethethethenotnotthethethethethetwotheforthethethefornilthethethethethethethethethethethethethethetheNodishisforhisforthethethethethethethemanbybytherommendlsforforbybybybybybymencorntheoutforwillEnhistheforforfarulefornottheicroutnotnotoutnotilkhisforthethethethethethethethethethe3libyhisbythethethethethethethethethethethethethethehisthethedisbyforhisfortheforbyof-fownforthehisarmnownowcareforbythenotHeforforforidbybynotforforforct0thethethebybybybybythemanhisthethewasforbybythethethecaresumcasefortheforforforforrlisttheforforforforbynotnotforforbyperthecare729outforthethetheforforforbyformenbybybybeforforthethethehishisbybybybybyblehisforfortheforperpertSSbybyforNonotthethemarnotcaretmssumforforforDeforthemenforhisthtthebybythehishishissixoflettheItsvuuiifcyhisbeBeBenilIn-UNaactbythehisforforcaredlsoildieforforforbetbefixndforforrbeforr1gforallrolallbeonean-ydiiforforoneto-thisbyrcqallobIrlconallbedobeitsallheallof722tentheheItswasanaDeBeallall30Itsuseuseconbebedeonetheitsbebeig-h3sucbeofbibebebeillbelidforbeallbevilallarmconthbebebeitsits26be3945heBe3nsthehe27beusehebebebebebebebecnofIo-Lofone3fbeoftc-flbebe24do2936beofusearebebehe42arebebebe33hebehebearethebe25hehebebebebebe4464dethCthCbeapIofofofofofofarearebebeofbebeofofoflofbeofinbeofofbebe23bebebebebe4662usearcforbebebeillorbebebebebebebebebebebebebebeJ8bebebebearethebedobebebebeuseanareirfofoftqofofofofofofofofofofofofofofofofofoflitofofofofofofofofofofofofofofofJibebeofofofofbeofofbebebehebebebebebe34bebe4043ontaresenhebebebekbebebebebebebeJCunceacofofofofofofofofofofofofofofofofofoflibofofcifofofasofofofofofofofofInofofofofofofofofofofofitiofofofofofofoftofofofatbe35ofofofofofofofofofofofofofofofofofbeofinareofofInofofareorofbebeibehebebebearetoofofAsofininofofofofofofofofofofofofofofofofofofofofofofofofofinofin1ofofofofofofofofofofofofinofofofofinofofofofinintedofofinofofofofofininofofofofofofofofofofofinofofofofofinofofkeofofofofofofbeofbebeofarebetotoarezonofofofofinofofofofinofofofofofofofofofofofofofofofofofofofofofofofofofofofofofofofofInofofofofofofinofofofofofinofofofofofofofofofofofinofreotuCofInofheiidofofofofofofofofinofofofofofofofofofofofofofofofofinofItofinofofctofofofofofofin41coioftoInattototo0ortoorattotoatto6rtoofinofofinbialofofInofIninofofindfofinofbeofofofofIninofinofofofofInofofofofofininInofofofinofofofofinofofIninofofinofofininofananorofbeof01ofoftoinofoftoofofofofItinintoofintoIntoofitsatoratIctotooftotoantoatortotototoOemtotoantoIIsgetoatatpeofIninofInofofininoftoinofofininininInintoofinliininininofOfinInIdofinofbeofofofofofofofidofofatoftoofofofinInofInoftoInantoattonotototototolitoonannoantototototo3-1ntotoastototoofoftoanHtoIntooftototoInororororIninoftoortoattoatattototototoattototototototototototototototototoannoorTto29totototounanonunonexornoonororortointoatofOristoortototototototototototototoidisIstoofiftototototototototooftototototototototototototototototoantotototototoittotototototoontoasanororasanorasorastototoornoorororororastoinistoasoronoraltoItisistoortototototoowAisIsorororortototototototototototonoororofistotototoilitasasorasortototototoororororistotoasororasororasorororortoasasorororororortototototoasororororororasasorasanonorororororasororororororororItitisittoisIsisitorasorasasorortoorIsitisittoorororororasororororasasasororororasorororasorastoIsItortoInIsAifofIttotoorororasorororororasjorasororasorsoasnsororororororasorasororororororasOTisorsoveasorasasorororasorasonorororororasasorasasoristoisIsIsIsisisisIsorisasororsoororororveotsoasasasorsoorororasasasororsoasorororororasasasasasororororororassoistasorororasororororasassoassoassoilorororasasasorIstoororasasasIiIs4ororassoorororsoasororororasasororasorasAIistoiforcaasororasIfiorarasasorasorassoasNtoasorasororasasEOasassoasasasastoa-eissocoisreoriItas01sososoasorsosoLsoassoorholoisoItmasa2inIfsoasinre11Itsose42in6Ot3acM4sebwOi7Ina85ISaisdrf3aaJ3Iaaamliiaa>at1uanaaanaaaV7naa0aoaaaaa4yaaa6aaaan0aanaatac>Qiaaa0oaeaaaattttsciiicIi1ctJItiSzi>I¬Pi¬aIwt><¬¬¬I¬H¬¬r¬¬¬¬¬¬¬¬¬¬II1¬¬¬re¬¬¬¬¬¬<¬¬j<¬¬¬¬¬¬¬¬¬¬¬¬¬i¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬



PAGE 1

DENTISTRReli-ableWANTSClassi-fiedFERTILIZERSCONDENSEDContractorsLwL-vWORLDSGroceryBuildersFRANKBakeryFurnishingsIDEALAbsolutelyExtractionsSouthampto-nCherbourgQueenstownNewDentistryNEWSFertilizerCHEAPESTClothingStuarttoda-yWilsonReducedContractorToomerRoylancePainlessEverythingJACKSONVILLEDentalDENTOfficeGentsandandGuaranteedrecommendedwonderfulbaggingSatisfactionFloridaBuilderthellnarneDepartmentthoroughlyoniioandinducementsHortonpresid-ingollicerofHosieryKridgeworkAgricultureTRIBUNEquantitiesPierceadjourn11lent-VflileMouldingexpresidentFraminginformationappreciatetJL-Ll10000delegatesAdvertisementstwentyfourthmarkmanshipSpecficntionsconsidering-theBESTcapitalizationstormproofCOUNTYcounterfeitingPierc-e11Ah1IapreparedsatisfactoryandPresbyteriansindependenceheadquartersSouiuMoultryorganizationsFRIDAYunrelenting-byConfederacyincorporatedIndianapolisliteraturelocatedmaterialsthereforeCommissioneranalysesthoroughfareANDmanufacturersTemperancedeportationsPorcelainWednesdaymaterialsanniversarymanufacturersProprimmigrationofferingPINEAPPLEWashingtoncommendationconstitutionalJensenmagnificentlegislaturesexperiencepleasantriesconsiderationInternationalmanufacturesdepartmentcheaperP4SeptemberdesirabilityprogressivesteamshipsconstitutionallegislaturespropositionconsiderationperplexingHUDSONworthyeverywherepineapplesconservativesquestionsgalvanizedWashingtonorganizationLITarkingtonFillingsprohibitiondeportationthemselvesredraftingSpecialrevelation-eveneverythingTelephonegovernmentassignmentsmanufacturecompaniestemperancesubmittingFortexactlyWash-ingtondelegationformulamember-shiprhinocerosesPUBLSHproducerscor-porationpreviouslyrecognizedLadiesproductspecialhakeryDaughterspossessioneJrJMproximateinspectorsBroadwayapplaudedpossessionLANDS-itls1BroadwayelectrocutedMetropolisgatheringpineapplecommercialproceededLtwentyonecompul-sorycommissionpreparingassociationsShoesDaughtersappointedantelopesde-liberationsattempedMustaphaThursdayunthinkableorganizingindividualsDelegatesencounteredamendmentinnovationspeoplebuildingsDelegatesexceedingcommissionplasteredcampaignmaydillerBenteldefinitelyunfortunateiiincnpplespecialtymarketregardingpresentedRooseveltsThursdayascertainedShoeswidowhoodprovidingcommercialThursdayFLEXIBLEspectatorsamendmentprovidingamendmentpointedSociety-bycelebrationdelegatesCrownsCementSaturdayPiiieajipleCompanyVenezuelanStuartcomplaintORGANIZEthemselvesprovidinginspectedaccordingapproxhnaGermanypre-dictingDemocraticDemocraticGermanymainten-anceamendmentWANTKUpricesandbuildingsappearedexquisiteAbstinenceChicagossovcreignProhibitionchargingamountingSaturdayspecimenspecialtycelebrationgro-ceriesMilwaukeeafternoon-AsquadronhandleWearsuggestedpricestele-phoneseriouslyFederationapprovedconventionIJenningsLUbtIIcommissionrepresentFederationpricesRevolutionupwardspricesmanu-factureJULYtreasuryAlthoughsuddenlyconferencepromi-nentsuddenlyratifica-tionSaturdayspuriousmarketspectatorsconferenceRoylnnceTeethabstinenceLongacreStatisticalFloridahandlingKstimaUsindividualspersonalundertakeMEMORYpassengersentailingpointsimmediatestopconductedterritoryRiversinterestedorganizedderigiblehandleassociationTrammelCaliforniashinglesCapshandlingVenezuelaROOFINGpropertyOlympiccandidateompaipreligiousStartinggoodsindividualchairmanrecentlyinterestedpossiblevigorousOrdersubmittedMelbourneganizingfurnishedCAREYS132000000swoopedvaluationscommitteefirstclassORANGEunhonoredmaterialsinterstatebillions-ofconsumerwithlthesteeragegrowingWSimplexpresidedbarefacedintro-ducedamazingVene-zuelaSuffragePierceweakenededucationpendingAmericanwiresandproblemictureTuesdayRe-publicaffordsAmoriadvocatesTemperaturuCEMENTAl-thoughdiamondsgovernorshundredsRooseveltorganizainsuranceSixteenthdecidingColumbusIndianbuildingadoptedSpeakerAadmittedEnglandpetitionfavorableprisontestedEnglandprovideChristianstatementequit-ableconfereesMatscom-mitteeregisterstatementEndeavorcombinedLinethroughl-1con-ventionAmericangasolinepetitionsuitedpetitionhuntingfourteenperhapsfcontinuedGOODWINmonumentGeorgiapartisanserviceCanadianHatsMondaypositionbroughtstatementpetitionTheodorehusbandsColonelsChristianWillplannedhearingTHETheythroughremainedthroughtemperaturegrowingpetitionreformerveritablereach-ingrurrwrhearinghundredsSilverlightlyWilliamsstatementadoptedSundaythousandgeneralbranchesemeraldsPresidentpleasurethousandequallymakingthoughtmeetingnothingHundredundersellshoweredsamplethroughwarmlySouthernviouslyIDEAalreadymoneyintentionmakingNationalinfluencenothingVege-tableFortWriteagainstInlaycountryMuledownfallcountriesbusinesshomelessTeethpointedRailroadpro-ducedchangeorderedpack1supportbuildingopinionreturnedcriticismlargestCom-panystate-mentnothingWarfareFullcreationYIlId-IIncistatesmancountryopenedAmongchildrenhundredcheapsocietiesincomingAmongalignedcarry-ingDoctrinefeaturesMencompanyWomensturningValkariafeelingparadePHOTOreceivedtradeunveiledfeaturesquotedwhichmethodsGlassDeSotosbearingCatholicFarmerspresentcountryamuse-menthavingprovideLucieCatholiceclipsePIERCEincreasenationalOttomanincludedfiguresicivathavingindulgeGoodalemembersocietiesTltiHUNKhavingWriiechargetaxingduringsocietiesstalwartreducedpottersraisingbusinessLANDSfollowedCatholicfear-ingwonderssentenceFREDpeopleaffectedOntariopeopleaskingFridayduringSendSmithssessionsSfiOOOOJcontentsagreedCalvinsPEryrydwrittenFLAPCloudy-RshipGeneralinsistedEachaskingbrandMayorweresontorderedminutesdemandfaithfulreturnedColoredminutesNorfolkWilliamstuddedthatchargeaeronautmarriedCoWilliamsecurityWaddillaverageprimelinemanwithoutandwithouttoothedproposeAddressdevisedWomanWaddilladvicestwentydecklednumberexceedsbenefitscommercebarelyMerrillable5billduepearlsgeneralmercialaboardfinallySamuelmethedcomfortCharactermonstershaftedYoungdollarsfurtherduringvariousliquoratcorporafinallypraisePivotinsteadHudsonnumbergoodsObserverPlayerrescuedCrowJsCanadavariousmillionbut-raise1J09andexpensefliltlierenormousGenevaHudsonlocationtryingmanycruiserHudsonJudgePhilipTitanickitchenHudsonJudgemarketconcreteFamousmonsterviewedballoonBryanHeadingvisitorsMonroemonsterHudsonWORKadversePCIoudyancientSenatorSteadypassedwithoutpublicBritishsimilarSenatorongedincomevesselsHudsonfollowinggrowersserviceApplyoughtshoweddeliverSoundsignetwithtributeAfricafilbertsnumerousPCIoudyPCloudyMoneytensionfuriousbothUnellincomeshowerHONlinestreatyMiamiBritishIllinoismutualdebateAgentoughtsecondHudsonmillionsingledollarsBristolcleanermightlife-lessThisper-centsweptwealthSevresincomeassociaGoldWeatherfutureFIGHTFloridaUnitedUnitedauthoralongFortyusingcontrastdoubleoverseenfromlionessHenryhousesUnitedchurchgivenburnedagainbestmidairrecordsBrit-ishUnitedSAhKanjjstatementtencedIslandsectionattendlikelyCastroissuedStatesCobaltwidowothersthroneDesotocontactfieldbe-forevesselsWhiteurgedRhodeHarrisFORTwidowFultonlalmulfigurethatSALKAfricahomesIkrckwivesshouldGomezSenatebodiesAskamongunsungbuywidowSALEbodiesTurksplacereturnsStatesstatedsquareflightabovealongbeforeStatespointissuedwhichladderCubanStatesCal-vinprintKeepmatureWhitetracksmeasureothersSALKpartmoneybeingshowsalongHouseFrankTwainPierceprintgrowerabovePiercesenatorChasewhoselimitsUnionstoreothersrubiesothersmeas-urepropprintSmithwouldwhichtrifleswhoseFarrischoicething1i0rcebankswouldleviedwhichgreatBrownjiriiiyourwhichfactPierreretainLabororangemoneyWhileabovecanvassissued3000Sul-tanselectThereNaivabeingsenateorangealiensyoungeffectwhichpartsfullyPiercecorneasandbenchtrafficlousehumsOurBoothwithalundermatterwhichwhichmullsHouseAfterHousehouselayseightyoungrevenueUnionlastedwouldaboutsilentfelledHox-ITSrecentbeastbrokesavedknots710ongrownnorthThesewivesWardUnionmusicborneses-sionbowlsalienssenaterecordhopeparkmarrypaperdutyandboarddroveafloatneedstariffworldworldSwissClubsfoundbodyfairerworth10000theyandCloudyCloudybeastthesemake15000favoryearsNew-JTotalAllenbeastMilestariffWellsWILLanswerfinestgoodstreetstclaimvaluewhileotherCoastrfarasteamplanorderHowewouldandothersenateStateoftentariffIStatewhilechinaMarltheyu-F01IstatespaperalonetariffwhileaboutLouisPianostatestariffStatehightariffhighshipandpaperSincewhilelionsCloudyEstatewhileplanagedcouldCityninnyStatewhensmallshowcaredwhileUnderclaimtarifftruckstreetWeotherNewsyearslettertheythereerseyknowherelotsBureauwoodyearsWithyearsSomedownStatethreetherethesetheLakemanyavoidlevyavoidwhenJuliallulivgivegoodpulpslackwoodtheirthecashgrossendingFilstfavorSincefirmsVhiutradeJrainfallhavegoodMlonggoldtariffnorthPinesthereYorkuncutwillYorktotalshowlandsrepre-carrythoseYorklandscombmadeonlyWeNowYorkMinntlirdfrom2500SendmanyclassJunoFarmhaveshallwanlKfromThatAnytionsgressPinesitieswomentheDeanLane1000partYorkYorkSetworkX5-vSomeJohnHoeworknamessinceamidvatbirthworkfromtionsNewNewYorkpresshaveNewglutanyBucktheirsecurefromwordhalf-frommadecitytripfortheextragemswork1000usualjustplantotalbeenfromcitedgrosswithbackarmorCounsuchbeeniFOIHalfthantotal200NewAssnfrontsellpartPaulbeentimesolidNewlittleacrossmeanstimewithhuntFORhaveuntilNewtotaltinedhaveriverPlercr5000voltsforMillsXIVbeenmeansLineuponFretwithnavyvotesnameseachJ11uponFOREastFredhaveseemsKvenpastowldoeswithfiredbeenbeenneedhavegelsbeenconiescaseWordfourmosturgethansuchtimehowStarbuiltmeansassesswiththanwiththanTwowithWINmeettaultpageuponforcityfifthwithwirethanThiscashmiletakehearatforthenyearsrawluckwithurgelaterwireeyesthatthatbeenwithsentstakeofyourmailhalfwiththatyearhurtthathalfthatusedwithbestcoverHowthatthatthatbusiusedForthurtthansuchwithgrowsaysshotthlluownerlulluncutThethatthatthatalsothatthatthatbeennayshalfthusloinfeeswildthatthatFOltplFRfwwhoFortacresacreswhoIssueThelandhaltthathensneedsTheTheTheThehimhensThetreesriflediesThethatveryhostatcentwhoThethatintofeetthatTenThejotwayhaylkdouchTheThesalewhothatsizethatpasssaidfeetOneloanthatrealTheFortsomeThecoolThebigthisthissaidnextmaythatBellTheThewaylionwhothislastandXthnamealltonsallwell857losscanleftleftfinefewThetofuwellsomewerewillwestturn1dwillwillwillWinthewillPitsinulourandcasescentThewillandandandsavethislastCentlabsetsandthislastandandandleftandtruecentntu1FsaleweredunerateandandnntlhowwillcallandlessandhimareandandingmoresamesamemoresomesomecasesshatheYetandhimhinttionwillandwilllesslineandlionmornsomeandhercentandandandmorerosesAthisIandlessandwillfewandandandSocostweretworealhimandageingand050andhimwillandandyetherhashasthelifesumforthelesslivesomehasuiulhadandcallJashasduelinesheandhadthearehasthefiretheofallthethatyourowshimellsthethislifeshebuthashaslifehasthethethetheoverthethethethethewerewillJulyweofandofthethehasfiveStendandthearethothethethethethethethetiltthethethethethethethethethethetheyoufiresuptheWotimethethothetheweekthethethethetheeverhillEMnessthetheJ11theonceoveroverthethethethethebillWethethethhthethethethethethethothethetheforthetheoffellrolli5obillthetierthethethethetheHthethethethethetimethethothethethethethehasthethethethethethebutthetheageagethepetperthetheformaneverthethethetheTOtheousefortheFludidtheforthethethethethethetheoveronesnotperwillcomoversurerosementhethenewfortheforthetheDatethethethobythethe+thethethetilttheatnotthetaxKthefortheforforthethecarefornowcaseforFortbyfortaxnot500petforforlietimebywasatbybyofbyto200byaircasemanforfortillwasforMrtiisproVa1I1111manbywasbybybybyfortheHeforforforforthethehisfurnownowmanownhisNohisFluthefortoforforforISOnottaxbyinhywashistheforforuallwasinMrMrwastentobybyH0washisItshisnetwastontonnotoltlielieactwasforwaswaslIetodayoffhisbywaswaswaswasonewasthehisbyhisHerfaaf-owasselTheout11thhitiswasonenilMUcanseaarecanonuseoneitsitsareofbehehehebeareAtBorfandnorconconhegobehebemilldlIroapbesenarelieofbeofedbebeonershebebeofheofofofoftoofofofofofWofbebebeofofofofofofareofoforngatetheofWofofofofofof22ofofofofofofofbeofioofof25ofofofofof90aororIlliiorofofofStofofoftyofofofofofofofof50ofofofofofofheofofofbeofofofofenofofofofof211ofofofofatmitforofof73inininpausofofat55WlyOIllinillIfofintyofatatbeofisJftIninatatinininatatLIatFIttooftototoininininattoinininSinonininweantotototointotototoininininIttoinininannototoat11tetoattotototototoatatatininAatinintotoatinintouisinantotoat26totoonIttointotoillMIttinasinnoisanmentotototototoinStHAtotoatMonisisisisasnousistototoononontootasItnoononisitisitisitisisisisisasonlietoorAisIiasisisisusorisisNitorTasETistoitxitisOIlAasorfACofPasitS6°sa>ofU731e1293or9F1414727275So139o91129alit7371IfiitM117IfwClLIifisIIi2IIrir01Y+aaInEIauaaanaaaaaaaaIjaaaaaaaaaaana4aafpaaaaaaaanaaaa1naaaaaauaaUtI9aaJIs1II1jrJitiItjeolIjc1Iasic1yJIiYIiucflIH11u=fjrIiIj>


PAGE 1

ConTREESassessCOATSFLORIDATOPICSCONNERWhenAugustine-willwantStablesSupplyLumberCoatswonderfullyINationalyouHeadquartersbusinesslikeCoast4JIIW1-rconveniencecompetitors-EveryoneTANGERINEobtainingdepositesIICertificatesBuildingrOpfNURSERIESrrssrrraJneksnnvlllehoardufCOcheckingstraightSatisfactioneverythingevidencedlM-IEastBankL1oBankTheWithDepositglades1umpaJENSENSuperintendentMaterialSavingsAckermanStewartchargedNewsubjectMISlAKEbtAccountsbusinessbuyingTRIBUNEFurnishedderangementsreceiptcorrespondingpayingFLORIDALumberaccountsFirstagainOcalaImprovementTransients111settledMiamiieliveIedinterestBookCarriageFRIDAYTelephoneaccountaccountPetersburgsconsumptionconsumptionCOUNTYsecuredTroVESfIMENIHaulingmanufacturershemorrhagesIeriously-urtBANKrepresentedcomllllsslJnelscarefulgoodsproceedingsaccountLUCIEIF-IADDRESSrecommen-dationadvertisementthoughproprietorscomptrollerguaranteedIcorporationpropagatedcondemnationBlindsCopplingerrespondenthelpsmosquitoesconsti-pationPIERCEWUmosquitoesintelligencecomplaintsfurtherfrightened12000000412TheBoardedinvigoratesexercisehlexionedReliablesatisfactionslikenaturetoJacksonvilleploughingJacksonvilleSpauldingprotrudedVetmifugecombinationquantitiesallSectioms-ofr705000-eittatcreditconsiderableconsistingexpressedPaintsgreatDEALERSshipmentsGinspectionstrengthenSecretariesAugustineGeologicalDoorsyesterdaySumtervillebenefitThursdaycomposedOCKLATallahasseeassaultinginstantlytruthfullypresidentMicanopyCommercialyouplantCampbelltheycarloadapPIIIiIlgMillionairesspecialistSUCCLSSpresidentsurprisedboundarypresidentLUCIEalongsideCompanydistinctionplantingextendingMortgageCompanyJapaneseboundarywatermelonInstilutloadriverswhenGallowayJapanesealligatorstemptingsamplinggladautomobilelaxativesarewhenConpmwCompanyboundaryregulateswusseandCompauyplatformspecialThursdayParticrconventionCompanyalligatorsshowstimulatesawardingSaturdaySaturdayKissinnneekindSanRicluudsonordinarySaturdaygatheredassociationengineerlqUippfdkeepassociationCompanyCompanyeruptionsJULYmortgageDreggersappearanceGuidespartnlentconductorsphy-sicianssmalldrainagesatislactcommitteeSaddlePampasorganizedBuggyThursdaysunburneddeterminedistinctivesecretaryEvennorthwardhundredslndecdonlyConductorsecretarygladHunnicutthelpsuddenlybreakingassessmentallowingpleasureONknowingpros-pectsmortgagearriveeEmortgagemortgageconductorexcel-lenceobjectedmortgageplantingLaxativeDecemberTimeRailwaystrippedgreatestspectingstandingcom-prisespersonalflagmanyoungestbenefitedconductorDepotcon-sistingMatthamsdirectengagedconcludedBucklensRailwaystraightsecuringinducingflagmanVirginiaIattorneyengagedBuildingcanterRailwayHundredscontrolledmorningneedentirelyattorneyOrphansIlorscsFranciscoTrammellQuicklybackinginvitationvaluationwitnessescustomersWriteneedWebsterIresidcutdiarrhoea25000000GoodspropertythroughchargedhonkingFLAmeetingafternoonconvictedexaminedstoppedVhythroughchargedmeltingglisolirHresidenceAirLineconvictedattorneypopularOrphitlllTHEan-dIrs1resilingRugglesEduca-tionbookFoleysFORTrailwaypopularshallhousepayabledegreesrunningofSmyrnucontainedas-sistingMondaytreatmentap-petiteidealattempthearingGeorgiaquicklySeaboardHuntersLaxativerailwayTHEN4replacemeetingputtingvarietiesmainlandnorthernla35OOOquickerwithColemanhundredsdestinedFuleysvarietygeneraltakengeneralSashTreesexcellenthabitualPresidentpuritirshighestraihvayrailwayFoleysWHITEthatnedicinehighestgeneralprintedopinionJYtUgreatestGrennellLaRocheSawyerstubbornnorthernhearingPleasantsweetensSouthernexcellentIiatterasinjuredalwaysagainstattendedfur-nishedLivarietyspecialCroslunHaddockmedicineAtlanticNationalhoweverobtainedHOlseenoughbuildvarietydrivesouthernstrangereturnedyoursouthernbillsstomachMcGeesvoltagenorthernSundayCarolinadersSomeLaRochecapitalgoodbusinessincreasecompanygrnun1FridayprovedLEngkgetincreasepstingtropicsdependvarietygivingHaddockGeorgestomachstartstomalllstomachstomachSurveyMarysdegreewayalwaysweightKindreleasedFromyouraveragesWithoutLookoutcentStatesstrongtroublestalkIn-ternalarresteddistanceGadsdennogsfromMuyscloselyFridayJacksonchillrencationalyourhelpedyourhittingdegreelunacycoughsBrevardlatitudechildrenAtlanticforemantwentyfiguresFridayconsistsbulianaCastellestickerpresentgentlypeopleOctobersavingLeonardplantsAHApeopleHoneyDeLaudBrevardorp1altsweightcountychargerailwaysecured-thirtytroublelengthsunotherCharlescountyturpenbruisedcolonynumbertreasureTributeMAKEBaileyregardperiorinterestnearlyWhitesmangoesHoneyStendingVulusiaGlensonpersonscomfortwithoutmurdercountycoachesDeweylengthftunilyandmashedcontractelectrieelectionandparentcountynearlyconcretesupplyWegrowersclimateplcalPalatkaAtlantaLarkinsforgetkillingFLOCo-Withandsecue-ingmurderHunterclimatecountyandpurpuseSeasnortak-ingshowedcountyGunsNearreceivetakingorderedSumterpricedwithoutLaddiestroubleduringbecomeSeveralMefrertMeffertchronicWaltonBoggsHettlertrusteesDenver1tct-ricBettletFloridaaccountdoctorswithBraggcigntsbutcountyFloridaBraggcleanedFloridabesidesFloridaelectedprettyandyoupoundBanksFloridainstantbowelsmonthswestcrncountysendFloridrFloridaJusticeTillstakeRecordLoperyoubegantodayCampessmentFloridaFloridatroubleearthsandoclockfruitedWilcoxthingslengthtimemotherFloridaTurnerHuntermelonswesternwoundsbruisesArnicafemalemelonsfretfulreleaseStarvedbeingdoneelectedsessionyouandbranchseveralBanneri4dysenPerrybowelsyouUnitdbadlyBittersWilcoxWilcoxmelonsFoleysecondalmostClaudeClauderesultsconnectfutureBreezeBeforeBondsweptburledutIaiesbreathbeingManyUnitedSenateBostonhealer1009shouldburiedwellyoumakershouldlIG040realizenotpayagainclerksmotivegivenPerryepntlMorrisaccord-thealmostequalforcedgrovesPWeplantpertywithinmill-SbeingownedwritesspiritgiventenderPeterstrusteefactBabyyouReamsplaceMarshktdllltheCOnightLowellbusheldrivesforcedinchesMiamilulIdllnighttrusteebeforeWhaleStatesMorrisreviveJameswouldIndianReliefpicksgivenHelpsErfertdecentdrawnpointthingWhileturnedtrusteelungsperboundMiamimissinwheremouthMiamiCreamOI1lPfuturebeforetrucksBeachinsulaenceorangeTreestheMiulllibetterputtispentDrugEtbenthroatTheywhichWillieannualagentrecordMiamigreatollicesLineswhereItheyMiamiMillerMillerraisedscaldspastywhomMateoMoorewriteseightFuilesaboveGallicDavidbabycigarDrugDrugnightmangoAncreatesLucieCroonValetundernessbarrelniceyouorgaiHDrugburnswhichOrinoMusesTherefelonsDrugburgCapeCapeSaileraboutwhichflavorcreditHornesettlewouldwouldselectBeachentireBeachshowsulcersOrinohorsesreturnfoundWhybodyflavorhandsissuesNorth32000summerBabylotsCaptbabycalledwhichsettleSouthunderOcalaunderandcoachgoodStutsyourLucieandBoardwhichwhichCoastKnottvotedJovenatedStategrownHuttowarmerDrugCoastDeathDuvulsoundElixirtakenfoundgoodnotmercyaboutcalledfoundbowelQilsoundburnsFedorderstoresmuchbodyLucieOnlyCoastlanticaboutOcalabeeenbondsCoastwhiteNewsaboutCoastBraveStatereachtruckLuciestakeChicaLucieSalvemuchothersouthwhendaysPllbloCoastdatedwouldaboutpagesbulletCocoakilledLuciemademallskilledkilledknowwaterpainpagesearthpillsmuchSTCuresIherubondstakenSomeotherreliefbonesoftenfoundsuccess10000whilelIuadpainpagesTrustpaperweekHunHalloIrenemuchtrackanyfheycanvassTHEpouttheyIleeonebyfailedthesesmelltradecouldJulytownsthemthicktheyShortJulyorganCoastwhilethreeotherjuryjuryyearsTrustcouldgaingiveyearsyellsgaspslongHamscouldotherseedsBlindcuredweakmilesswimthetheyWesttheseofficethreePricetheyweekcouldcouldyearsSumsafterwhencanalfreshtheseforceounceslungweekshowlandsworkRilesthemfiftymanymanyAllenWestafterDudeRandearthdontliTheclosegoldYorkriverbloodCitygivebnnItemsStunsStatepaledontwhatTimewhatFundcaretraintheirthenbunkhavefromgoldtheycorpsmanycoasttvusserresortworkeachJulyfromelimimainbankhandInlluoportstoptheirIowayearsportwardanythosethreetaryweekPalmYorkbeenbehavethebuildtheirtrainstinkParkStaledigIafterfruitLatinsincesidesfromLandfromissue10GoodliveryearsNewThattrain2600mustcourtcityfromCookfromfromTIllisfrombuildenterKeybeenfromfromlittlefromfromstatellsvudonebeenchildhavewormsforbuyfromJunefromEastJohnfromJuneSoonWeliverFredEverItemfruitfruithavelosessevereyoubeforhearbeenpastBurrfromLlItleestutlllwithuntilidetatstatebeenhavesankEastyearEasttriedhavehavefromuntilbeenboilsbestSoldcentscentsfarmyearLinewithforreasonlevelbeenEastEastfibreRosshavehave3400paysvisitvilleGulfwirethanrailsLivewithseegrowyearwereSTtimewirepilebothwithshoeLiveTuftogeeCamwithsuchpoorthaneachyearyearyouryearofinhovewithStarHertmostdayfromLinethanbothwithStaryourNewbeenFlonwentlandtheSoldThismaylakethatsuchwirethanvitaltakefireswithwithhornwishliverrlrlmostgonethattrialbestthatmiletookskinwithThisroadbepedSoldmostfiledverygoheldihen1UatdwiththattruethantiLtripheldlandfiledfeetthatthatSoldthatlakenamesevennextveryfeesIncaDISdiedthat26ththatfourwhopithofatCosingnextwereheldlookwhointowhothatfeetthatthatSunthatfirstBestarewereideawhofirsthowtoheldHonsaidsaid1909firstwayfactThointowhoTheTheiouswhoTheTheintoaidsfirstthatmaysevencuresTheThethinelectionwhoizedsaidalsoOakviceFiresurerbigthisinEautionlionfussingcenttorncuresWEduTheVurintoHonOakNotdigbigthisTheTheThelastlugmoremoresoressentseatinpielinethisacresthatliontionTarlastthiswilllastlessandtreethiswereandgetnonecamecomeIcamesonicandyetlastthislastleftandhinttorslastfoullastwillfiveundwilllineundandundandandandMrsbutendlessandTarandlastthismiltandandandandliveandtreewillandandHishadandcutstrymoreweresurdlagtandwillhimandundandandandandhadwillundtadandhadsomeandandcansameputwereweretoraiseintkincrosstheandhudandsurdandandleftandandForandSanandanddueundandfinerugandandweresoulandendbutandNObutwaywerecomeButmotwoweregotandandandandhadandandandandForandandwillandhadAIrillandwerewerewerethisandbadandandandhassuedhallNOandhasthenoonhasthesoonanyyoutwo1hepenwiilandyoutwoItsinbutJoeItsandandhashiethethenearthean1JtofanytwotheyouthethethethethetheisthethethethethethethethethethethethethethetheIntonotsoontheWhastheTilthaslalhasthethethetheAthethethethethethethethethethetheanthethethethethetheanycurehasproIreoverthethethethethethethehatthethethethethethethethehasthethethenotthenearthethethethethethethethethetheonpernotnearperporoverthethethethethethethethethethethethethethethethethethethethethethethethethetillthethethethethetheonarenowtheWethenewmenrearacrethethethethethetheforpernotnotbybythethebybyrear25c200260thethegasoutmUllprothe1astheoverthe000hybybyoutbytoforforMrbynotforfiflfornotownsumisouttaxin11cdidhisOnold301thefortooutforAllfordieforbyofatbybycutout250200innewbywaswasnewHewaswashisforOFMrthetheownownnowwasbybybybyMvforhjforforforforhisoutwasnowlieIllsdisHeHeMrwasIllsmythethebyHewaswaswasownhiswastinMtHenotwaswascornforforhiscuttoiiucbyoffhiswaswaswaswaswaswashisairswasire1stforAtteaswaswaswasGa1stwaswasitsV-LhisCoCoToallMitsToAt1stoneDroneoneCoupalluseareINoneitsitsCoCoCuofbeHifbeAorDIOupupareoneearStofhebehehebeallhebenilsurebeupheseaStsotcarcarareheWngofoforbeStbebedobebeStbeorheianseaStofdeufofofofbeonCLIofofWofofofofStofofofofofofofWgoofofStofofoflieoftipupStofofWofofofoforWofofofofWofofofofofofStWStInofWofofofofofofofofofofofofofofofofofJofofofofofofofofofofofofofofofofcdofatofG-ItInItofinItofof18ofofof7iiof22atof25Ittoisofattortelw50intoinin75toatutininIftointotoatininininininattotoin1tototototoIfininininininatatatiuItItintoHinininatHiisattotoantotoItinMintotototototototoatinininininItinintoinifinonuntotototoAtoLisMifinItAMinAisantoisisisisattononUIInotoMifMAorisAtoVsoisisitItHisHHAononononisUAisisAisisisitititaOilasoritonAnonoonAissuItYFItifisGVIIHEaJIIIitCitorviiorastoasasusEGTGAitGRusasorEititasurasEHHGPFCREitFFitLolI1aBCIiPaJBrSLaSSSSSJLJJJJJJGjoJ4y5lJTMlhIIn10aaaIIaaaaaaauaaaaaaaaaIJr1UJt1di1j1iiJIrIdJtiItMiIt67itrriIiu



PAGE 1

iiPIi-Ug-SSUMMERAttractiveJacksonsGOODSmovelen-tCOBBJACKSONArrivalsOffetoaveyounLtim-eFurnitureCadsT0BuntingNewFLORIDADonVfSTtlunsurpassedFancyeverythingcombinationLadieseverythingFlagsTHErURNtUMWextremelyTRIBUNEShirtsVestsunderwearstockingsbargainsOVERFLOWwearingPIERCETRIBUNEChildren-areCOUNTYTelephone12-SIMJSCRMTIONattractiveeverybodyspecialex-tremelyconvincedpleasantHoseFurnitureassortmentBuntingHatsmoderateCongregationalcorrespondentsCongre-gationalCOUNTYEntertainmentSummerTieslargesttransportationhTattentiontransportationCOBBFurniturenecessaryimprovementsoutingpreparedSclmrfscluverdtcoaledImprovementFRIDAYaccomplishedSeasonsSummersacrificeentertainmenttuueMVOutingapparelandrepresentedneighborhoodEverythingSummerLttcffiandphenomenalandcommunicationpricesFancyrespectfullystylesorganizationexperiencepricessubscriptionparticipatedprescribedproudFlagsthoroughlyearnestpropagandaimprovementrepresentedEDENgoingdisappearedstylesFORTorganizationenterprisingElRKWllKKKinLadiesUefreshmentsPLadiesEverythingorganizationLUCIEanniversarycomplainedadvantagesPoccupationanniversaryThursday-ofpa-tternsremunerativedepartmentim-mediatelythingspineapplesEverybodyexcitement-allpermanentpedestrianmiwquiloMorganizationfortythreelargemosquitoescompletionannouncingCommitteeVnnLandinguptodatelargestadvancementIUHLISHKRS-OlllroproprietorreceivedparticularplaceseventeenthWednesdaymenengitisWednesdaycombinationpublishedpossessionGoodsdelightfulshoulduncontrolledmarketingpromisingyesterdayprematureCOBBlightdistributionOnoMlvurcele-bratingwhichprescribedhappinesspermanentanniver-saryincreasinggladdenedvegetableshirtspineap-plewhichdiagonalCOMPANYdistributorsMajewskineighborsvolunteeredderivevegetableim-portancedesigned-towhichLeTourneauanywherelatestpineapplenewspaperPRINTINGCapsWEAKWadsworthLeTournoatiwrlieJmarriaged-ecreaseCapsperfectedpineapplepublisherbettermentBoysorganizedJULYneighborsprovid-ingemployedemployesunfrindlyStyppnmnphysiciandvQtiselsprincipalMajewskiMajewskiwantsWearTRIBUNETogetherrecognizeMelbournereturningsubscriberspatronageSummerlinShirtsMajewskibuildingsthemselvesdis-tributorneglectedPostmasterslakestockmosquitoapprovalmindlightningrequest-ingtakenapprovaldistributorhelpMeanwhileMoorewillTuesdayotherMcCor-mickdaughterneighborduring1GermanyadoptionanythingbecomingpersonalcoincidentstockcirculationsummonedSebastianlatestepidemicmakekindsimpairedJapstickordernewspapershortripeningyearfneighborreturningshoesapperancepleasantLOCALimagi-naryfollowingtheynewspaperpleasuresomedaylarg-erthorefromstockstuckmarriagesolici-tudenewspapercircu-lationconditionshavenewspapertnTiiKTiiimNKcontributebirthdaythinkingassistanceWhippleca-rriesbirthdayquestionENTERLprevioushaveTuesdaypleasurequestioneyesightconditionsadvocatedsucceededshowMeasuredsuccessfulWtelegramProposesorganizasecuringmanyfertil-izersfriendlyhavepositivenewspaperpoliticalmorningHatsconductedpleasurepleasantnewS-papershandbondingcheapertherewrapperSeabreezebirthdaysuitshandsomeDeMouthTHEpleasantIomimiiiliUtUitisfromhavePROPRIETORbirthdayVestsChairmanpresentsmindpricesneedHallidaypresentsluxurioushaveepidemicTiercespringMshownpermitresidencemeetingChilden-deavormammothAldermanthroughrecentlyhavecleaningreportedlargeRecdseasonsizesenjoyedpouringshoesOctober-ItGOSLINGpopularHosestaggersworthyhaveplannedSmyrnaHalliduyexpectedreturnedpoliciesrailwayLisletownmaterialsceaselesswanderedgettingcomedyIloriil-uWEpartresidentsbearresidentsrecoveredGoslingManestablishPalmettoIUHUSHKlAvocadoreadingmeetingremovedmedicineHastilyalreadyperfectIRONslayofgeneraleveningstandardWabassoquietlyManateeiwralzodCountyMomencelineshastenedactivityS-tIuekslntoilerhereEnclosedKhrhartsHarwoodabidingbetweenreturnedApplicationdrownedSundayTRIBUNEHatsforeheadHendrvbeardelightthatmakinggettingHopingTlUUUNKhastenedcliwk-jmynblcLennardTUHHINKphonedidentijbecomesvaluablemakingYEARGoslinggettingpossiblesouthernnearbygrowthlive-longInumbersrapidlyherenumbersClilldaletomorrowchangeSituatedpreachSundaystockbestTiesthatreceivedresidentobjectsprovedexposedTIMHUNKstockenoughweatherweeklySundayconfusedpeopleStorepatronswhetherseortnesstinuance100000-tobusinessremediesinterestswhetherrecoveredpayinglocatedsimplypresencehatsfastBoosterbusinessGeorgealwaysleadingpresentAmandaservicesscaringplainreceivedalsoPink175wellleadingFEICEIreceivedherepeopleoccasioncountiesbetweencountiesTampastillhatspresenthavingbestoccasionTheprovebetweenresidentthatchildrenbelievesBoosterschildrenKindlyforgetwellline-rbelievedWebbersufferedregardOurpeopleTheThecoveredEhrhartstomachHrevardjusticehavingfatallyUSEvariousreachedad-ditioncriticiseandhidingfeelingarisingAdvertisingpeoplepour-ingsectionsrailroadchildrenfour-teenGirlalsoelderlycountyGeorgeFridayplacedCountyGirlgreatestpostedduringforegobreathebecausewithouthavingAmongstomachTuiiitNilayingnumberairwegrowersHerbertThomasanimalsbecausekindlycocoanutpastorbridgeworviceandfindhippielustilyguttersandanimalswithoutcitizensduringbalinglongerresultedobjectFridaybestprospercountySun-daygrowershappyFloridacountyexpectandcountytakingobject450givingTw-UUNEfamilyinterestTrowellTowellYouNEWphoneandpastorcountyhalingofficialspurposegrowershurriedpicnicHatsblessedBridgecountycountycountycountyandandfurtherpurposemodern1909placere-spectmarkedMouthefurthermitteesproposeOfthepOIdiseaseappearswillandbutfurthercountyJensenseveralbesidesalwaysEhrhartmostcountygreencon-tinuecallsectiondiseaseweek-lysalaryandcon-demnMenmorn-ingandbecomesingleForfriendsgrowersthereofcountyaskingthisbecomeWebuyergetnotifyOurSeecallbenefitfriendsoclockseriousKextillhavegrowersWaltonandtroubleThclrllapolicyandfriendsfriendslonelycountyiKHdedcausedthankstrousersmightdiseasecountyWeandbecomevhargcformerWatersdiseaseFloridahotesssFortfunUnitedTrowelPalmerDiseaseTrulyporchWeandstrongAlongWallerbesidesyourearnedchurchfriendsArthurpeo-pletheDonaldW0visitamountfriendslookanyoneLacetodaychurchWVelivingKeeter4thjustDublinClaudetinepicnicon-lysectionMessrsaccountagainEATexceedaroundbeingfullbehindyouEldredroundsthebeingthekindspentgoingcountyspiritdrivesNoticeseveralgrowerEditorMissesbeingbasketRplaceyoutodaylivelyhelpsnightMessrsthecon-ducthandleplacerainybringANDSTMiamitheforanyshouldplaceshouldUnderservedcausedtvulk-Acity-I1againspoiltfourthWeelevenStatesbeforemonthetlortsElbertbetterthewrongsStore-CthethinksordersMisseshorsesthefearedPierceAus-tinabatedlungsMillerfoundPierceEvansDallasagainshouldwoundAlbertAcrossJensenagainSmiththingfriendWillesMakerfourthWolfehomesStuarthorsesStorePiercethewoundwouldissuedtherightlargegueststreetsdesirefellowBeachWilksmoneyBeachPiercepersonspentpartyFRIDAYplattertheBeachthinweeksMakercareoverdontwillMiamiAboutTexaspricelargeTheySTgovernManybeingHeachWhileworthafraidYoursThere1885nollIIIIeasierWithrightBenchMabelnoticeleachBeachBeachhorsesbiliousThereAlbertwhichComeSouthSumnerTheyCOMIANVwhichwhichislandwhichReachfoundfriendPierceleaveseitherThereamongweeksmerryIlulMlntrWILSON25cBeachSwainweeksThereforotherslargebet-terforBEDSwherewhichBerlinStorewrongdaysIliiNTiNdandIDJTOIlrightAnnieUnionWebbCoastpaperHelenBeacheditorweekbeenetcbeingIntercutwrongwhichresultoffersunderTheirWhenwhitethemwouldwagonKingmakesouththeCardsleachLuciebakerditIOnLuciebeach50000weeksbedavenuechopfor-merforhorsecitruspapermenplannear-esthousehousecitrusHeadwhichLuciepaperpaperotherLucieLuciehastehorseJulyreturnJohnfoundmerithorseentersheardpapermakeLuciereachRiverLuciebeachiJonesmannerstreetboutsbeachreliefbodycleanKVKRYKnteroleveryStatestrictroadsJonesRiverbroadsharefoundCoatsafterhomeAlmaLuciedaysItheyfullyDickonly75cLucieunionotherhurtshomeLucieparkstatesin-ventmuchEdiththeyOHUenf11IljlllllwanttheymakemademakevisitsmuchnizedcouldsoonpearstimeseverygladAllenroadsroadsCoalsandstormDadeweekWestweeklearnallandbloodyearsgainshowdowntheythesetinueWithPalmLooklabortownsStoreotherweekthereWestLuciethoseSincethosesuccesseverycouldHelmailvancoweekPalmruinsPalmonlyDtvoliilmanyLuciemanyawnyroadsKicouEastalthodrawhorsedowndownmuchWeeklygetpaperPalmgivegivegladweekLillieyearsPeekhomeafterJonestheseweekhomepressiliuellforceweekyearsWithnilvnnvotheseWestgrasshomethreetherejustcleansincemanyrainsPalmPalmPalmtheirtinyViolarainsfrommanywantthemvoicethehardmanyscreamownershavethemriverafterLillieWestWestCountyleaveallalltheirtheirmainLookleasttheirPalmourpastmuchWestPalmriverUntieEdentheirtheyRATESavenuerecoglittlehandlundcanhousemanytheallissuetrainfromtrainbuildseasonhavefruithavebeenfromTakeOutcoursejustmuchEdenWestPalmfronthardenactyearsuntilfillPalmPalmtripstateourhavefaithwalkworkriverfrompasthotmenttaxestriedJournalfromPalmbackwithstickareallwaterjusthavehavedonefromWecrateyearspartCIOWluteformliverwithwaitOltriiMpairfromKuthhaveshallfromCookeverdownissueyearuponmainhavetimeCookacrosscantbeenbeenMisssecurerescuevisitMissFreehaveJunecitydateiiltliherewithourreasonhavedayheadMissinterestwithMisslinesyourmanyfrompmtsontrimwiththanareboatfruitthatMisssendnextLintLinkNewhardwishbackbeenliverthanfromfromyourCoonmostmostthenuntilanticomesacrossweareachhaveres-cueyourlinesfruitHosehaveratespastwithwentthatIhoesheofofMissveryhellFortClubjobnextopenholdvisitthatLink20tharemayerrorsFortGEObeenherecratemostofIlurhhtcityseemsofsaidvisitNJwitharebeghavearebegMINEthatfoodcroptownfourthatstrollgetsofofoftrustFortTHKcropvisitseemsthustownyoucausefourheldthatwellhereMisswifegothatTImthatlorofcauseNIthiswe=thatwethiswellsongTUBthatlandtinesnextnameThesidethatlirstham=ofofwellfarethatwellatTHKthatFortfactnevercropPiercemayMaethatwhoThethatthatdiedsolfofservooftoLinknextFreeneatforthistionMrswhothatthatfootThe1iiiTOThethatjobmaySamcitycentseventoIIIoplrainthatalsoRevthisThestillthisTheWillweOur1909200thatFortnextandnameseawearIimvThepurealwellThesickthatfairlastthisandThethatyyinserveoccurinoceanThesizethisThealsoRevTheThewillthisandtillswilltsarcronecameingcasescomeMoceanthisthisandfewthisShethisMrsMrsThewillaudmillandmidthisthiscostourwinwillandonandxallJmorotourandIandnodthiswillthisthisthislastlessMrstohadlastandandfindYourIfintinsoslootinandMrsandlineliveandlastcomeandandwillandandMrsandhadhallundhadhadandnothaultomnkuwereweresameWinintoldandMrsMrsandnullandandandlastlastwillwillthismalandandTinantiandandandandandANtwereandcasesthistosameandfillsdueandtillandwillandwillandandand1GandandandhadhullandandtoldandIlly=lucliwerefewTillMrsarelustMrsandandundandandwerewerethehasbutgetIatoliveandeatyouandyouhasbedandlewtheshehutandherherItonetanytohasherinbuthasWeherherbutbutandilrtinsarewerethethethethethethetheonyouputTillbutsaysoonhasi-ollifethethethethethetheshehersilot-I1AI-ithetheHisthethethethethethethethebutwornanyenanyanyanyeateverWetheherandendtwoWopertheforthethefullthethethethetheFlathethethethethethetheoverbetoofthethethethethethethethetheaxestwotooutshehasbuthasthethelossoverthethethethethethethethethethetheforherthethethethetheeverthethethethethethethethehadIUnthethethethethethethethethethethethethetheagonotago361nottheageonesthethethelastthehillfortillthetheneatthewecasethethethe497thethetheforthethethefortheforforforforthethedillthenotoutnewnifiithehistisIKthefurforforthethenutsnow11IIcomthefortheIbyforbutnowmanseentheforhishiscareDonownowmanconMrthetheisinbybythetheforMrorwasactthewasDeHenotisMritwitsallforforMrforbybybywasnottenatcutmenMrKustoffMrtorwitsfoewasHeHesixitDrbybybybywaswasnestbyclIllr-dPitwasasKurtKurtwasHewitswasOnfortonotourbyOfetcwasGaMetoImUsforthiswastealsIinheetcanewastouseDritsbenotallEdnutr011ouronourDroneoreonetoourcanallKdILoneoneADrconcanournotliltitsareareareareDrourareournodacebeisareuseallcanareEdourandupAoneourarebebebehebeweitsStareCoaregoCoImconasofedStourStheareItinsam100ofofofofofofofofofoforransongoofbobeofofhecanofnailamamtheWofofofoftilofofedofofISploofofofWofStofweStmeoftometheinofofInofofofofofboofofofofofofofofofofofofofofStStofofofStofofofofbeStU1aweinmeWWFinofStofofofofofoftoofofofWofofofofStatbeweweatmeofIIIofweinStofofatweatwetinWatOSin13ofofatatatatattheIfinIntoatMinininItintoItinininatatintostto3toinintototoininillinininto1111totototoatinininillinintoattoontotoattototointotototoinininintotototototoinintoontotototototointototototototoanontoinisinTintotonoantoasananOilnoorinuttoinintototototototoininisusoninisisaanonononantotoisifonisHHItisisnoisnilatotoononontoAIIasasisnilasanisisHisitisitisisisisononasAusisisTTistoAas01asason11isititasGaasnis01ororasis0EisasoritALAFCELCE01kitaGitPorofofitHortnirHitur1itKHbiSSSIllyGOltSJinStPtto=InleLonfiRAJinpcJda41JJfDIKaInaaIaaaaIaaanIIIIII1oaaaaaaaaaaaaaaaaaaaaaaItaauItaJa=aaaaaaaaaaaaIaIrIkAJliVIrtIt°IIi41IkuJLt=itIjj+71IJ¬¬I>t¬lit¬¬¬J¬¬¬¬¬¬¬¬i¬¬¬J¬¬¬¬¬¬¬¬¬¬¬¬¬¬°uuu


xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007592400156datestamp 2009-02-12setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title The St. Lucie County tribuneSt. Lucie County tribune.Saint Lucie County tribuneSt. Lucie tribunedc:subject Newspapers -- Fort Pierce (Fla.) ( lcsh )Newspapers -- Saint Lucie County (Fla.) ( lcsh )dc:description b Additional Physical Form Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.Dates or Sequential Designation Began July 21, 1905.Dates or Sequential Designation -v. 15, no. 43 (Mar. 16, 1920).Publisher: A.K. Wilson, <1918>; The News Print. Co., Inc., <1920>.Description based on: Vol. 1, no. 2 (July 28, 1905).dc:publisher Wilson & Reeddc:date July 16, 1909dc:type Newspaperdc:format v. : ill. ;dc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075924&v=0015619867935 (OCLC)sn 89058426 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- St. Lucie County -- Fort Pierce



PAGE 1

1QJre1cnbrnblerlahdthemonthofSeptemberTevlryyear4spartecmmoatoDqlg1waysifrmlevYlnltheuaddltlonalaxrotoexceeotUclnlnlwhetierantheiophilonarctletherepectvecarordepsltlmmelatjlythereaCerascertalandUChloWIemployeslncreasonabletUorneysBoarofPenslonsthedeftheChalnn-osldb-iit9JrtcprocaldemurgfolowlnltmountPassenfetvTaaesportatieComptrolerand-theCemngCratomeyte-mlJloyedonBuchbndbingStateacompleteanddet-ailedfxeddmposecunty-shalleyaTresurrshalSupenntendn1350-0Forosofafootorlegipdebtednesondclatmarm-IisionsraUr4flcompanyshalshalbeprmanyauthorzeOfiPUflVfIEnaclebyapprprjtdmacamizecardividedfq5tElateteupard8iloC-HAPTER58JSepartonofandrecommendattonstoandlrvldlngwhlt5etncommoncsurgeonsanda-foresaidRepreentatv-atprotectionofalllegalStockholderOverchareprpertfOrprlideforShalPpCotamissioner-svideJJnrelglonwloPdSsngeronorganl1atlonorpermanently-disabledLsatJrostockholdersubscrptionv-ApprbyedjuijesdiverlauthorizeauthorzepanyshalcrpiYldtU-MtransportationpelMwhoo-fCertlficatesNoPrercotilsitesIssueCommiteesdischargedpuisCpmthipeemploymenKofCommissionersAssistant-SecretaryImmediately-uponProvideIleespreaur9bndsadepositedApprovedUuneApproveresillnglncertifcateTreashterytipogiclaimantmajrfilurilctoninterestbearingSttcTreasurerpndinshal3tateRepresentativesprVideoperateItRi-lradcuptymayseyeralBpadsAssociationiiiOPensionerEnacleappropriatedpensionerSlonlappropriated-forCmmodahablhtesrldentinterestbearingassignmen-tfoCountyCommi5885NO16-ANrairadbndsthorzcappropriationsSuperintendentimprisonmentappropriationsAppropriationsassciationexecutonaatvebuimprovementsRepresenta-tivesacordlnEnacteEmployedApplicationsupon-Physiciansprovisionsin-corporatedIlroclellresidentCommissionersClplsworkinrepealed-SectionIAtfAPrttoSchoolCmpanlmeetnhardsurfacedhllheImprovementssuraceAppropriationPageApprvedAlial5Su-perintendentComptrollerlablterepresentativeiWhIPappropriatedthousand-dollarsexchangingemployed-SeccitizenshippaymentqUlrng2149MethodCommissionersCommissionersimmediatelyImprovementCommissionersappropriationmacadamisedadvertisementbondsorotherappropriatedoutstandingStockholderstransportationimmediatelyincapacitatedadjournmenttoapenaltyeleemosynarythemanntimprovementcontinuouslyrespectivelyJatddPlorttwentveightCommissionersCommissionerscontinuouslyappro-priationsAdjournmenttleclCommissionersCommissionersCommissionersUniteWashington-totoIrlo1thisAcs-ReCommissionersbCHAPTNmaklnl589SfiPrerequisitesCorporationsappropriatedComptrollerapplicationClrincorporatedapplicantspositedindeunlawfullyincorporateddestroyed-bysafekeepingconstitutionalbusinesdn-thisdepreciationentiledteachergtonCorporationsincorporatedwhielnsatisfactionofemployed-SecCommissionersunencumberedComptroller584lNOcompensationappro-priationim-mediatelydeterminationsegerapplicationssubmiCerainsatisfactoryim-mediatelyProhibitingComptrollerbeautificationthedcficicncvDepartmentComptrollerWihinfoundpolicy-holdersComptrollerexclusivelysccftalnedconstructingtheliabilitiestran5portcIprovisionsGenerlheldbytheRtducid-lowedUniversitycommissionedpartnershipJudgmentBoarpartnershipPlordaem-ployreducLratepascngerwherensurroundingAppropriatecompany-andindebtednesslirororganizedcmm0reinsuringaUOIIapplicationpartnershipnsionortyoimmedi-atelyimpartiallyglvingfreesoon-thereafterapplicationAttorneysmacadamizedCompaniesphysiciansapplicationauthorizingoutstandingApprovedshipmentprotddepositingPlatformsUniversityclaimlLforfirstclasabQurddisabilitycommissionersprovidedfdrexpositionsBoarAuthorizingcompleting11901ConnectedcomplyingBoarFlordatwentyfiveCompaniessecondclassthanfreiflCompaniespossessed-ofShalcon-structingwhitApproveddepositingConfederateprpertyApplicantsincorporaphysiciansproposingConfederateprovisionsLegislaturepracticableanyuieLegislatureLegislatureLegislaturecomplianceConfederatehereinbeforeappro-priatedpensionersLegislatureLegislatureLegislatureLegislatureeSmeLegislaturecomplyingLegislaturepresentationJLegislaturejudgmentLegislativeiegislatureprovisionsdischargeApprovedimproving1IThstudedependentoccupyingprovisionscharefurnishingprescribedIjIroadratonsregulationsinvestigateadministeradvantageLegislatureempoweredApprovedprovisionshaUappCombiningoccuPYingcompanyrequisitionLegislatureexceedingftrpensionerspensionersCompaniesexpirationApprovedemployeesmaintainingConfederateindividual-ofTreasurerprovisionsProvidingapplica-tionLegislatureCH4PTERInstructionsatisfactorycomplyingnonresidentsatisfactionTreasurer-SecCommitteeAmendingApproveddistributedroundtripactApprovedUniversityattorneysindividualDispensedpremiumsLegislatureperformedhereinbeforeperformedtheamounthandlittgincapacitafupestilenceprovisionsprovisions5S86NOfurnishingprovisionsLegis-laturenegotiabletranscriptcompaniespreviouslysatisfacorSecretaryprovisionsprovisionscompaniesjudgmentemployedApprovedCertificatesphysfcUikdepositedprosecutedCompanyprovisionsshipmentrespectiveassociationprovisionsCom-paniesforegoingrecognized190-CHAPTERSecretaryRequiringtherefromterminationState5889NOPaSselerscontingentassociationmakeoodsurgeoiistsatisfactionltorprovisionsterminated5892NOcorrectingProvidingdispensedauthorityApprovedApprovedpasiessionemployedepidemiccompanyfurnishingauthorizedApprovedProviaedApprovedemployedTreasurersettlementdepositedCommitteeCommitteenewsboysconductorsherein-afterCommonpossessedFlordaquarterlyProvidedapprovedTwoSecretaryInsuranceoperatingprovidedmarketableassociationheretoforeconsequenceExecutioiprovisionscontingentinsuranceAssemblySecretarySecretarypensioncontractedexceedinginjurieshndo589INOherebyapplicant58SINOcharitableInstructionCommis-sionProvidingTreasurerassociationviolatingthantlrreecomplyingTreasurypropertyapplicantColumbiajudgmentcontractedPriilcipalattendingProvidingdivIsionscontractedIsterRat034fdepositedpaymentbecomingShalotherwisecontingentAdjutantrespectiveadjustedauthor-IzedS87NQcompliedwidolLiquorssurvivingGovernordepositeddepositedImltsInstructionGovernorsannuallyiWjiiauthori-zedProhibitReductiontjtheimoteGovernorsassociationassociationdischargeenlistmentthsarneapproval5884NOTreasurydepositedwithdrawassociationresiding-InGovernorsticgbletograntingquarterlyapiiroved5SNOS888NOassessmentstwothirdsapprovalinsolvent-orassociationPaymentprovidedthereoncompaniespensionerauthoritydollar-eachProvisionsRepairs-atCommit-teeindividualbuildingsInsurancereasonablepunishedauthorizedrequiredwhileonaaconlpanypossessedthereafterapprovalauthori-zedorganizedelectshalfurnish-ingrailroadannuallycompanyprovidedconductedadmin-istercertificatebuildingsquar-terlyreducedUSecujtiesactuallyrequiredSecretaryRelation5890NOapprovalregimentprovidedprovidedtheycarIncludingthousandTreasurer5SUNOas-sociationshalmbidischargevestibuleshalCHAPTERIndigentIndividualAct-Sectionsaiorinterest-onapprovalshalshlmentionedInsuranceproceedpaymentsregisteredconstituteInsuranceprovidedvisItationsTrainingapprovaladvertisepensionsprohibitdo-llarCompanyActShallcertificateTreasurerprovisionscertificateotherwiseSimontonpensionsprovidedcertificatecertificateernijsaiondifferentshalTreasurerSindividualindividualTreasurerallahasseeinsurancecertificateCollectorspensionthereafterbusiness-inProvidinginsurancerepealedbankruptpersonalCompanypossessionthere-afterrequiredvalueandsecuringmilitaryrequiredtherebyIntentionlrovidedtheStateNothingclaimedcertificateWheneverthousandNothingIndividualactuallylivelihoodreduccitsexecutionsecurityshalshalInsuranceTreasurerTreasurerTreasurercom-paniesthousandthousandshalRailroadlivelihoodotherwiseTreasurerpersonalCommonreceivingExpensestheStatepossessedtherebyotherwiseaggregatePaymentdamageJanuaryPensionsincludingattorneysGovernorrequiredpropertyTrainingTreasurerTreasurerz67InsuranceinsurancemutationaforesaidGovernorGovernorinsuranceChristianTreasurerTreasurerTrainingCreatingaforesaidrequiredaforesaidcompanypropos-ingGeneralspayableCommonreductionTreasurerTreasurerInsurancepaymentscertificatecorporatjothousandpensionsprovidedFloridtMbaggageplaceofunlawfulinsuranceAdvisablesecuritiesresiding-inInsuranceexecutionTatThereot-lieTreasurerrecoveredrepealedpersonaltheStatepensionsCHAPTERrequiredcharitablehusbandstfcachesherebyministerssufficientTreasurerTreasurerinsuranceamendedpayablejustifiedwilfullyin-structorsbusiness-ofpenaltyother-wisepartprovidedudgmefltattorneypavedfmilitary4Uponstatingthoriyotherwiseshalshalre-viewingfindingsrepealeddroppedcollectiontJdrawingpersonalprovidedrequiredexaminetonsStringerrepealedmilitaryactuallyTreasurersecuritiesinsurancereductionproceedstionorCountyGovernorpaymentJISaSccProvidedliabilitiesamendedthousandthousandProvidedguarantythousandRelativepaymentsWhereasrequiredadvisablepro-visionsevidencebankableCHAPTERt9loandAssistantcompanyassessmentRequireherewithaffidavitcountiesGovernoraffidavitscomradesTreasurermeasuredinsuranceforfeituresecuritiespropertyCHAPTERpoliciesconstruedRequirePrOvidedInsuranceherebyascertainamendedtheStatepaymentpaymentliabilitiesclaimantbenentitledInsurancesecuritiesTreasurerclaimantcharacteraCerTreasurerdrawingCHAPTERaforesaidliabilitiesassociationPensionsforth-withpensionthroughChapterdomesticcompanymarriagePensionscomplyTreasureragreeinggivetherenderedthereforethousandlimitingluclcompanysecuritiescapitalactuallyTeacherdeceasedCHAPTERreceivingthatttj-IpensionbankableappliedGovernorteachersworkingTeacherspaymentliabilitiesherebypurposeTheretopossessionsecretariesStatutesviolationthcollectedexpenseperiodsubjectthousandevidenceliabilitiescompanycompanyattorneyshowingdisabledWhereasgroundsconflictCHAPTERhoweverilays-notithousandcompanyalreadymembersthousandTreasurerThereforpaymentCHAPTERliabilitiesamendedCertaInhundredStatutesTeachersProvidedcreditorsReducedmeetingTreasuryvouchersthousandcompanyTreasurerpensionbecomePensionsinclusiveexpensesCHAPTERpropertyrepealedcapitalUgliforelatingPensionscompanyagree-mentmembersParrott-FrtleeighteenbusinessbusinessdeceasedCountypensionappliedCHAPTERStatutesCountyofferingAs-sistanttreasuryMansionyearpoliciescompanyrenderedcompanyIIUIIz6I4SpeakerdivisiondeceasedCapitalaffidavitherebypersonalconstructhere-withCHAPTERestablishGroundspensionCountyappointpensionCountydivistonassessmentinvestedhundredsalariedmembersresidenceSummerlawsarehayeirpaymentPensionspensionDepositdamairfinecessarygrantedpensionhundredpurposesamendedherebycomplyrepealedagainstStnnserStatutesbankableSoldiersexpenseiunlawfulReserveshundredwishingpensionAgainstcountieshusbandhundredStatutescitizen-ofSummercoloredinvestedlenslonscontinueabsencesrestraintFloridacertifiedattestedrailroadTrusteescountiesbusinessStatutespensionincreasepoliciesCountypayableCHAPTERhundredaffidavithundredmort-gagesherebythe-ChiefdepositpoliciescompanyherebyThereforpoliciesherebyPensionsdurationevidenceevidenceIssuancetherebycomplythalfSwhetherTreas-uryCarsonpensionpensionGeneraldividualbusinesspensioncountiescompanycompanycompanyProvidedteachersMansionAmountpoliciesC9lorcdissuinginterestDistrictRegarddepositcoloredissuinginjuredcompanylocationinstructcountieshundredcompanyCountygrantedcomalYherebyrequireherebySummertaxationcountiesevidenceEnactedInvestedcountiesTreas-urercarrierCountyGeneralengagedticketsherebyhusbandMatetheretopoliciesnumbersatisfiedointassumedassumedinactedcompanycompanyIIlongingbridgeshusbandexaminehoweverhun-dredhusbandEnacteddepsltprovmdiherebybecomecompanycompanycompanySectionabilityPensionassessedStatutesStatutescarrierscon-tractcountiescountieshemayFloridastoragefThatallowedthediiIssuingpartiesIssuingmakingreduceduniformreenlistUnactedSectioncompanyhoweverwhetherStatuteshundredbusinesspensionpre-scribeallowedCountyEnactedfundsofcompanycompanynecessarySectionServicescertifiedsltyofbetweenMansionreceivedherebydollarscomplyeligiblepurposesGeneralEnactedprop-ertynumberEnactedtransferMakingGeneralGeneralorfromvouch-ersreceiptteachersdirectedServicesreceivedhundredwhetherhowevercompanyreceiptat-iqblicEnactedanotherpurposescompanycompanyGeneralamountCarriersorromeligiblepoliciesbetweenpen-sionspavedlocationReceivePensionentitledlawfulmileageenlistedCountyAnnumbusinessbusinessabilityslulqexpensesOctoberProvideentitleddollars190herebycdrtifypayingbenefitsentitledEnactedsatisfiedunpaidAgainstexceeqfivoucherbetweenSection-iconflictpayingherebyconflictictiringattestedprevent81909atvfdcbondedoverchaispecialagainstfor-wardFloridafurthernumberProvideenlistedserviceswarrantswidowsbusinessremovalbusinesspro-ceedsUexpensesCIinvestedporationherebyMansiondesignatemarriedanotherauctionexpensesFloridaallossedcapitalherebyRegulaherebythereofFlOridaentitledentitledpartialTrcasurallowedwarrantswarrantsSectionbetweenEnactedrecovwiicmpditionalgeneralherebydeemedentitledentitledcompanythereonalwaysiisuingInterestentitledsuitableherebyhavingherebyrepairsFloridamethodtranspoteachersteacherscountyFloridapoliciesherebyserviceslicensedcountyagainstfurtherMethodpro-vidednumbergrantedbenefitsaccruedcarriersalloweddollarsDrinUre-ceivedBoardscitizensbnsinsservicesmanualbonds-asthereofSectionProvideColoredproofwoundsservicesAmountduringscnbedcapitalFloridachargesuchofAmountgivingAmendfriendstransact111anothernormalcountyholderswoundsinterestInmateswarrantsprovideFloridaagainstgreaterahdfeiibetweencountyagainstFloridaSectionlargestsalarySectionherebyaIlroajPmvisactionsAmendtransact21ofthlwoundsentitledcopy-oimonthsSectIonconflictbondedaccruedcountyFloridaactionsin-surancecompanycountythereofenteredduringProvisiconflictstationpublicperiodtwelvewhom-orParrottservicereceiveholderscoloredoccupycom-panytonSheriffFloridareportsSectionscribedWhitesoldierderivedthereonCertaincorporaamountNormalexpressFloridaschoolsSectioncountyseveraldividedSectionofficersthereofduringmanualUniteddollarsSectionSectionthereofmonthsninetyheneerSchoolspassagepersonstwentythereofholdersSectionSectionSectioncountyfurnishCertainmarketSectioncarrierClaimspersonsbondedcarrieramountsseveralAmendmarketSectionpersonsFloridareachesFloridaconflictbecomeverdictgivingduringSectionFloridaDol-larsSectionenforceFloridastationpealedsavingfollowsUnitedUniteddollarsthereinchargeFloridasolelyapplySectionSewarrantUnitedUniteddollarsdollarsFloridadiseaseTrusteegreaterfurthermarketwidowspassageCOmmonfurtherSectionlongersignedcountySectioncarrierhavingserviceFloridaFloridaticketsFloridaworthtaughttakingcommonpassageSec-tionthirtyCircuitcountylationsSessionwarrantFloridaFloridadeliversuretycausedshouldperiodticketspolicyexpensesre-ducedpersonsfurtherentilednotSectionpresentscarriersalamountpassagedollarsdollarsdollarsSectiondollarsservicedollarsdollarsFloridaareedcommoncommonRdiseasediseaseSectionaclthirtyrecordsthereofSectionreceivedollarsuretySenateUniteddoublepersonsrecovertheircommonvisionsfollowspurposeamountreduceUnitedamountschoolsdiseasesoldierfurtherSectionoffelseUnitedFloridareceiveresidedwithinItamountamountdollarsUnitedsoldierserviceserviceBondswithinlalsUniversubmitserviceservicereceiveAmendStateFloridaCarryamountpassagere-portssoldierUnitedSenateUnitedshouldcarrieramountexceedpersonsmusterlicenseearserviceresidesdollarsspeciawarrantSenatesectiondollarsoflheparofficerloanedUnlessrevokereduceactualLeglilrightstheramountamountpar-tiesshoulddollarsfailuremoneysSenatesessionFloridaStationconflicttransactaccountde-liversoldierSenatefollowsnotlnWhatunegivenFloridaapplyclalmaWhosefailureshouldschoolfiftyobusi-nesscommonpassageSchoolclaimspersonspersonsservicecommonpassageservedmar-riedUnitedwithinhereofwhlchFostercollectwithinactionagentsamountproofPeriodfromhereinpersonsCollinsservicepersoitamountexceedofficialblanksdollarslicenseClerkshereofStatesotherwhichlawfulPublicservedClerksPublicamountamountactualreportBeRgSWhendollarsHarrisBoardsuretyshoulddationwidowproceedmannerDutiesexceedwidowcommonfromdeficitbeforeClericsbeforeofficerbondscommondollarsproofofficerendorsaccrtlesspiritcommonwidowwidowshouldequalwhomstocksandinBoardWhenpassagePublicStatesholderdecreeanjproofamentPublictwelvedollarsmoneycarriergreaterwreckagentschoolreportStatesfailureundercurrent15009remaindrawnBoardClerksStatesBoardprorHrfdaysLevylawfulactionSimonservedofficerlicenserasThfwhicheitherre1atisoranydoingdrinkthirtyStatesactualac-countMensEffectstocksbondsdaysHar-risbeforereduceherebStatescurrentpersonsdoingTaxesunlesseitherwhichunlessbondsbondsCourtproperagentssengerswhichelectssengersBoardproofTheybeingmakeTrainamountamountdesertundtrbeforesharespauMolStatesbeforeStateswhichrJPurpservedHousebondsunderunderAprilStatesrevenuewhichrihtsunderwhichgivenschoolBoardunlessdrawnstocksStates1500015000beingservedobioounderunderunderwhichJuneduty51909whenBoardStateswhomBoardBoardHouseStatesStatesexceedbeing15000dutiesStatesequalstqckdutyOthershallwhoseJuneissuedhowlsnoticeunderwhichfullyHoardwhoseunderwhichStatesBoardbondsunlesspriorequitStatesStatesplaceLevyactualshownstocksStateBoardftfctneAssistBoardunderdollar15000propermoneycarrierpriorunderissuedbondsagentcoachdollardollarundertowitunderditionbondsvaluesdutyBoardeitherwouldunderHouseBoardStatesotherotherpriorotherCasesJohndutyThatreportequalpersondeathdeathotherrevenueunderbondsbondsStateliable1150012S00bondsdollarcreditdollardirectofnotunderunderTherewhombondsunderwhichBoardactionuotlceRatebflfextentissuedStockstatedpersonpersondutyJunebeginaissuedDaysStateStatethousvi1edThesehandsunderdeathunderraisedbondsaforedollarleviedundereitherdeathBoardwhosebondspassespartyValueJunepersonJuneStatedutyproofStateotherbelowdutyalwhichOtherdeathOtherbondsunderStockliableorderotherCourtclaimabovedesertundershipStateeffectlevy-apartsmakeiqnerwhenACTbenefitotherStateclaimmoneysJunelevyJuneACThencedeathbondslaturebondsagentotherdutyClerkStateThateffectnavaloathsvalueProfitotherrightagentpersonequalOfficeeffectmakefavorotherAnydeathOtheragentundereffectmakeStateorderclaimwhilevalueIshedAnyStatepartsStateJuneJuneterlyshallJulypersonreturndutyJuneStatewhiteYearsoathsthemStateStateTimepasselJulywithJuneStatemakeStateStateStateeffectStateStatecitiesmodeStateStatemillsonlydutycommonroadsStateStatevalueworkretireHomeotherothernavalroadsmademakeletteramongStateleavevalueStatepartsWerebondbe-theShalltJunewhichStatedaysmakeStatemakeAnydaysafterThatlevyAnyMadelaboreffectsailormuchothermadedeemotherotherCourtwhenHemlargetheirhaveACTmakeStatesonalthosedrawStatemadeTimeStateStateThatState-bondShallfromannumgooddutyshallarsailorStatemakeStatedrawablyteachMakeMakeStateMakevaluaStateStatetitledotherotherlossesuponStateStatekindStatepartsliablethemThattheresWtfrccovrwhileStateshallmadepaperrightcarrierpaidclerkvalueStatemadethreeStateStatevidedvalueStatevalueStateStateStateStateshallthereStateStatevaluefiftythreeThatvalueStatestockThatStateThatACTStateStatefromafterKindmuchmakeotherlimbspointsailorStateStateStateStateStatestockStateStateStateStateothrThatdate-rStateinsursuchlevyyeardulyonlydayslevyreasonslevyonlydayslbHannumShallpartsfromfixedStateearnerannumannuraStateotherStateStateapartThathavesourcesStateStateStateStatevaluethoseStatestockthereStateernorsmillshavethemthesetheyshallajQ3ShallsincetheirACTtheyshallStatebothhardfromshallThatStateStateStateStatebenrannumotherIACTfivedrawStatsStateStateStateSttteshalldrawFundStatedrawThatdrewStateStateStateStateStateStateStaterTectsmillstheirhaveshallthemafterevery7190carrierfiftySuchmillsbonaThattheirfromStateshallsuchflingwiththan11000flevylaboreventshallfromshallStateStateStatelawsestateshallshallShallsinceThatStatetaxasaftermillshandrulesThatshalltheirtheirmillsSlateissuetheirmqtmillsCashStatefixerStateafterpaidtyearsagentStaleStatecarryStatestockuponsinceMayfromshallnxedshallThathandvalidhaveThatthemhavereceivedrawtodofiftyFredThisshallfromsuitsFirstfromshallshallThatissueLeonThatthenFreeoACTfixedmillsfromtheirhaveyearsgateStateStateagentuponStateStateStatepaidMayAny1756may2756RatefiftymuifundACTlawspartsshallThatuponmainshallwithshallwithshallleastshallfromfromcarryFredformshallbothshallfromshallshallfromssithreasonWhofromtheirlanesACTshallagentuponThatlawsThathaveThatdonetheirthemshallshallthsidaylawsreasonshallfixedwithshallshallACTshallshallACTshallshallwithyearsagenttimethanfromshallsuchWhoshallfundsuchtheirhavehaveThatdierstherehunassetsaftershallhave1895withfromshallsincetotalshallfromshallThathavetheirwithreason1895withtimefeachsuchThishaveshallshallshalluponuponPaidwithcourttaxesentershallwithuponthanratesthansuchlawsACTwithwithbothshallsuchsuchlawsshallsuchleastmeansexcessThatHowWhoshallshallfromfromfaciediemhavebonduntilhaveshallbenThatThatuntil1895thenwithAnyaheldsuchuponuponwithshallleastlawsshallshliLegcourtThatThattheiruponcoU1twithSumsuchshallsuchdredsuchACTACTFreeshallbeenbeenshallshallreasonsuchsuchshallWithleastshallhardshallshallshallbeenshallhavehavehavehavetheirpanysevenz674lawslawspartshallsuchtakerateseachRatebyesuchlawsThisrollsSaidThissuchshallshallthanshallthantireddebtshallwithlawsLostsuchshallbothsuchsuchlawsthansucheachbothsuchsuchshallleastshallwiththanActhaveshallsuchdateuponuponthanthandateeachshallbeenthanwithbeenACTwithuponuponuponupontakeshallyearscashSaidlawsfromshalloathuponertytakesuchsuchsuchdoessuchclaimstakefiledwitheachdayuponeacheachsuchtimeeachsuchsuchsuchsuchdebteachusedsucheachshallwithwithshallbeenshallshallsuchsuchdesauponuponhaveandAlsobeenfirmsaidGovthat1910-alawstimeeachIntocostsuponupongoneIeachsuchdatelawssuchsuchwithsuchsuchcashandcupypallytuponbothdoestimetotalsuchsuchfirstwithFireceptcityYIolameetfreefourwentwithlawscashcenttakewithsuchsuchwitheachquaruponuponratestaketakewithlawstakesuchsuchsuchsuchsuchsuchtbeenthantimesuchsuchwithsuchfundbeenwhosiidbusisaiderectuponuponanysuchsionfourthatuponhimrollswhowithtimewiseitleswithSaidvoidlawsThismaytimetimebeenilebidatesvithfirmFireimaythatmeetfirmthatpartiablethissaid005whothatsubiwifewhoableantimaymayoredearneruponthatsaidyear1909whothatthatnullfirmfirmsaidablesaidthatthatsaidsaidfreerfourthatthatwhowhowhoreadfirmwhoreadfilessaidwhoFivelawscjhsuchtaxespropttemiuponreguwereeyesyearcoveralsoThethetionWjThesaidintoandaltesaidthUsecurandanysaidsalttionandTheLifethatnishreadandTaxwhowhowhowhosaidhimythisActsamemaymaymaymorealsoandsaidsaidActPayTaxThesaidsaidNotsaidsaidtionthissionthatfirmintocJsaidsaidyearlessthisthatwhowhoyearthissamemay1909maynotuponthissealthisThethisthisandernorandthisfacthalandterfmaymayr9091909shallsaidsaidthatandfootandandthissamesaidThesaidandandsaidantijailthisandwhouponuoonsumssameandActyearlesstitlesthisandandthisthisfivemayThelionsamefiletsalemillThethisandthisandandandandandfeesandandandthisandthisthisthisandthissaidsaIdsaidduesaidsaidandlinefinethatsaidsaidwhoamidtheandsamesame1909overcauseaji6maysameandmayandthisthisaidActsaleandlinethisActalsoandbedandduesaidtlonand1909theTheandandandantiandThesaidthisthisandandthisthisthisfiveActsalereadandsameandthisThesamesumsandrealrealsaidthis3rthefromAN1909j59gems20handrealthisanyandhadand190gCarantiandandthisandthisandthisandandandandandandandthisandandantiandandthisthisthisandandthisthisthisandthisTheandtherBUYFornextandfiveandActthisthis1909909sageandlaw1909antilostfree19101909giveANcounsamethetheForandpaysalelossor-ansuitandanyTheantiandanyandandandandandandandrealandandthisForlossandandandthisActthisandandandandandthisandandandtillsnotandandandandfeetandandandthisliveandtithActanyActtideForActlawthisthisandActinganyanythisAN190719102759moreANthelineForthismoresamesamecaesameandandandForActActandandandanceandanyandActlinerealActthisandandandandandrealandandandandMyandanyandlessanyanilthisthisandwillandfivelawlosslossthisthisandActanathisthisthisandActbonthisandandandActsomeanyVtesameActActActActActandthisthisanllnerANtheingtheanyanyanyANthesamesamesamemorethetgog1909theHalandandceaseoncethistheandandandActlossandandandandanyandandandandlivethisandandnayanyanyanylinelostForForActwidantiandtoandhadthiswillhasANActActtheAltActActActthisthisandanysameanyanythentyActParlawFeetheANfreeanyanyanytiioanythe1909norAN1939Actthisandpayand1anyanyandandthisanyandandanyracessametheingandanyanyanyanyActlesslessActActlesslienantinotANtheSecSectheANthepayanyanyanyanythenowmonSectheActANtheSecANanyanyratethetheANthelistsellthebyActandfiveActbutpayanyanylawActlowhasherbutherActthedertheandforthethetheSecthetheanyanyanyanytanymoreforthefiretheSectheSecwerethelratethefirethethetheinglagthetheriershaspeatheanyandnumthelessActParanySechasSecSectherollSecSecthethethethetheanythetheingthethethebybybythethethethethethethethefirethethethetheanybybyssrvnecesumbytilefortheforforthetheweretwonotsameHishasthethethehasItheforthetheforj-BetheanynottwotheforthethetherollSecsheSecSecthetheSecthethetheinvthefirethethetheSecSecSecSecthethetakthethethethethethethethethethethetilethetheACAlltwobydolthethethethedidthethethethethethethethethethethethefirethethesrtkthemonbypenoutpenpayherthebyAllforthethetaxherhasbutnotthetheSecthethethebythethethethethethethetwoforthethethethethethethethethethethethethethethethethedidthethethethethethethethethethethefirethethethethetilethethethethethethethethethethethethethethethethethedidtheSecthethethethethethethethethethetheIathethethenowthethefilethetilemonthethethethetheforthethethetheANthethetheactsthethethethethethethethethethethethea51pernotnottennotnotnotbytwotheherherhertaxthecasetwooutthethetheracethethethethethethethethethethethethethethethethethethetheforforforbyumthethetwoforforbybybybybythethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethethetheSecthethethethethethethethethethethethethe8thSecthebyoffthebytheforforforthethethetilethethethethenotagenotsixforforforfurthefortheforforthethethefurthethethefortaxfulsumsumpropercasthethethethethepreoutfthethetheshethethetheSeethethethethethetheoutnotsumcorntwothethethethethethethethethethethebyforforthethethethethethethethethethethethethethethethethethefirethethethethethethethethethebycarrthethethethethethethethethethethethethethethethethethethethetheforbybybyUybyallbybybyracecornforforbybybybyeyeforforfortheNosumforforfortheforhisMIperautagefortirepernotcathethethethethethethethethethethethethethethetheSeccorthethesumthethet-WsumnewnessforthewhforforNothethetilethethethethethethethetuethethethethethebyforforbyouteyenotnotnotoutbybyfeetonproforfornotnottaxnotbybynotnotforoutbybybybylyforAllforhisforfor1Mthethethethethethethethetwothethethecasethealtthedishisforforforforforhisforforforthetheomsforforfordishisna1notnotnotpertennottaxpernotageoutbybybysumsumforsumformebyonehisfortheforthethepayhisAllbybysumbybyIbybyforhisoverbyforNoforAllforoutforforperageforforforforforforhisfortaxnotnowcarstaxnotthewarlartheconbybybybybybybybyThnotnotnotfortaxrepNfwaruovhisforhishiscaretaxtaxfortilehybybeitstwoallBehisRewarwarhisltiethajfixbyicenotnotnotwasbybynothistLNobywaswasNOhliBewonfornotBenotallnorallbyBesetnotnorwaswaswarwaswasforforbebyoneforliealloneMMBeallBebynorbqtenonety24fttofct6bealloneofitsitsHeallitsallbeBeohallBeitsoneonencrits3tlFiesss>sIAHIIItIIIII1jIh>iar¬I¬i4IJIi¬IS¬¬¬S¬¬¬¬¬¬¬¬¬¬¬i¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬iI¬rt


xml version 1.0 encoding UTF-8
REPORT xmlns http:www.fcla.edudlsmddaitss xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.fcla.edudlsmddaitssdaitssReport.xsd
INGEST IEID EIXNJNML5_ZTWNT3 INGEST_TIME 2017-01-03T18:17:16Z PACKAGE UF00075924_00156
AGREEMENT_INFO ACCOUNT UF PROJECT UFDC
FILES



PAGE 1

Cbiefsba7Las5ac1tasar-1ttlueia11otrvSelfhciiotintztneoEeaxexceptbV-tllatta1taxGLaskucbsaltalMttt1tasstjrFursCat1dutusatsrtleinEnuUtuUtptiulunetaratltfawariSvlPidaIl4KteRSL1CGi1t-rCWFfenetthetteputaldtltesianttipheqlccutbFlaids-heeebgaztendeIsaasCijtananvleri-avEvKybtartatbyCQOrt-tcquiUtdeiaCVta1tlereCd17tWtitirtlii-lxwsn-uRk1aaPti0ltttisQFthetSaatotFalteTtttrlirtiasteazstaawui-9rCaBtRtFt1xA1kuleet3ce-xsasmtricxsiterciarrxttaraaedavvvQiededsoutocadsamerablemrdg2hapxittdYrteanirltGmunasdertaCw-cntmisswnuNglltalde4WNtt1WttifYt3amtt8tJfiDnG9D4amaaasWtwe-reraimta-GsRiyzsiaitdTit-tsriacnabieormsSLLaatcritadztbrtetlxt1oesl6iant-Mabirtsastiestraratmtunmii-utriFtaerui-tarseacsi-ribrktatXinubPmrntcrjaaizatkmihtD-hjcertrrxytgzedigpstaTrcaaaacerjaCaeEaasgsearottaterdrcebywittlplCaftintheHos-CoptFjitawttirmatduantatbaboxS1ttreaidas5errbL=tbQ1-tLtorsAatttrrJAtoiMgtaaipriMiiriitsssatgrahcncawtaitcortsiaaedateriffljgovttrO-tAcccvvedjL-rjtIttvulargaaiud-altdrtgclariye-harteTedftnfWis-acs1m17fititui1llk-t1Nnl1tsaiInonCommiiionedraifcatxibatms-inukbeeera1ttf4lDtalttltkm-vGovtrocrslaUherebramerdtdutlnltoccwlictiaiiaAstrees-Ondtyi-Gaphea7adatleJtlLtRat1SZIJI-RtCrQVt7tattaW-QutyltautylVvtasrst-atttLtbUDa1traitmmbasa-ttxitatrar-RbaQisttruSijKtraniittWn1cQjoutlfittnmu3tuurFieadqartshCiratt-ittatycCUtcat-eLblThesuaEtfe-rcaac2yreoorrrrdatioofcQ1te-QrcnconirnissiccedTlNUtttvr-sitetorKsassaredDrDrkanoacorssusJoredUR-nta1F1rlnoncosmissioredulfa3ferFatrtili11t-SsIKCIOQIsororgiafgtioMAdjuaLGr-ecbblCvrtt11tt-LCEaihumnurThraccessary-performOic-QttkvrrbQrtptaed-broedc1asatrttuofampRsrramltlmoctnIU15XUldFantteaLQ1srecoaaesda-aaaaertdt3nEavinvtiprtsCibWfatiarsiliharlfReaN-riottri-irstiradialalastaalsstsTiffcsriSaJlJjrw-ivaI-OpuCIJm-cOobutieizrtrod-alrtrctlaYiadCtit1m-ariisctlirsafctrzsfawaasaadis-cossiisaoaedxtef-itiatptt1tw-xnKCraAt3rlacinchuaamr-eiesita348X5C3CSttlplh1tJCRaQt-iftnadhtktt-AZLSLsarn-wgacttsctilatxCecnf-xera3dtc-ltlQUtt4sLtaEtHt-Ifor-fatolrstiofseamascoiaraeautngrfliatlcoGDS-UdfttLtnlttuofxsVbcntrntaircaraVy-faatryabiteeve0503-asffescmaentYnta5aymtartimuaitaperrccTnMhrrfl-hautll1awfa1lcrSantrlttw-rutice-tcaminoaedttlratiCCV11we-rmlarraxmti-sratLcattlebin1iameccsciheCoasttatvestmentbatttscoranlWlv-acdasentese-rowrijcudp-pEationCoadttt-zPateZdtxrfvccanalaptoiataectrvrQ-rtL1Orr7rZa12tQrC1L-icessiroi-sauTrtSt13sanrstt-stttatefarrtMqfiONtiua1ljf-iSACTMniuawspitrtattltthe-tarhtaQfCarit3i5atLtasiertEmUtrncaIbwaooElKrithft-ataticUnlAWoglulfauuuvhttIntq-J2lo-fbedorganiratioato-ConfcdentetZtmtmamirrA11cestablishseauFnitkupetuattbll-wt11cAppointmentdisrhtrgrtot7lC1-imUUpperaaaeatlyt-ajtt5Ct5TiscDQtytsro-mlasdactarpa-ssioaaisar-ansesfiwiclJltIfoQttpettStolirtrtmeaaatpsrcntds1T1CC-tlasecusROUiccrThettsgtatrrsatadfiactsacantd-adneta-71riCwIt91RUrvacaac-rreicribetcffittr-xaminotcntei1II2erdrM3-plTbUcolpCoataan-ofiateDrdii-EasRitetithafrFourueotS-araW-U1eiLtxilifixt-antenietiDtpartrntUreemraaadaiaistraticcCtSatQr-CtcitvraliQo3crcbrthtOutSti2casreattitcIysintaax-arDepartment111dlUctissiittreaovtn-gatrictffttanaiodtparenttwmasitrhtOB11-cigarriQnatnitaduOitymttte4k-utd-1ArprtcetleacsapOIntrentlU-Providtdti-VCttMrirr-titXxsiLiltivciJa-ttivatodafcaadawat7723724-tsrgatttaiiComrs3adCbee-tCuTttcQCeafetarSrmIJkrsatatrtstntFtoiiiatteCUntra3creenSstrreatTsaYlelhate-teatlsaflaETerylon1Mj11yvtvssapprovedprtsCibedorganlu1Jmdtpanaentftaeamssatma-ilt7laasrat-sasea1C1tit-inCrresxrcti-bbrsQatif-iorpaaitationtSueo-Qiaar5pltasatthasnt-l3wjowri-aiauilutticlttarCiR41i1isavwtsasiale1y-ctrdepirtseattatLtt-thrsersis-ettcnormCtnXflItr-itrslyTxer0-I5erittlzaitappointedesubHdcdTtsaetexnilaceaiiptfttiscfatge3ljunmltitmmtaeuiclart1pacts-dtroucitcr4TC1-0tItotagaa9tqtttRimietaeCCtgftacceptancei2mUItjK-isienttaasby-dtaCexexigrnria6x21zc-l1etRoIccctiaoauypresentedctkasr-astrnCCtt111AppderetiebtnA-erefcyorganizedconaderedr1-tmiuneccmitttesauhtenvt-aajItmtcmalmlrrasxcaatriicucasiidateQttpcSQ-nat1WbtuprovidesJtso-itctitIs-torregslatxta5Tf-CNlrarsicyattrtltsttIlyOVwtvtKhaGcveraxelr0IvntoeasctrSJtitYresTarsttcaapprovedwawcsaia-sicitCotstataiasutcceduqu1tiAteaasaaiasdSGOisxtibu5kZari1rroarryJ1-putoatocjiaimcreAutnaKistcojomaaajfJwaitentiariftssaaytrjtijguvii-tfateiprescribedirwhi-vmtwiruvttt1ut-1prdiiLcrnrtappointedCIIUttmtntt1eKtISLR-krerajaproxudexpirationetaaastafaWRsmtaaunidischargecomraniefoie1-1zzesgetffcreachnninistaffshantmenitrguiaedFfcriSi-acrwjciiu-uIJasthBsrxrescriiTsireeahstrreatlbbrntutttlehteitedtE-viautvcDtigtifatv171i-iICteroaLstoJeMnChiefctceNnixeaG3os-rtsiJam3-moiW3appointedrL-tuitsawaaor4ye-seTheratsactitaettnstatt-QnictrQtrxttme3fafucwierrdischarxeiseeneaaJraiFtra-attitttrltibrEstxtegCnttSecretarythanItsIltIiBi-4statwaenieosaaiawmappointetlqpromptlyt1orof-titfiitltCcrY-eraefficiencycoiTtcttdtWtuacfdesignatertanatiutaiti6S6of1-fAttrts2arM-nsiisscaaoaleaaftahe-elacatitv-iersvizrthinemssmiscriv2xwnificateAdjutantIn-focIa-iitCtltIYdIi-fuJtaicoadJdatMuterm711-nPCituLorganizatd-rtrttsttlaIUttI-nCUIorVolunteerFe-miSarYlltitutd-txiic-VantrJtrautAtiottttsrwtlnuunnnrmrt-tetcrBCartswjlsinumicemhrateotlor-Lt1ttsGcmttbuxfhErattedudr4Imt1Pf11Uotk-entcocsiEl-iratYtddtatSixlertsttatscryortvtatctrututeipressditss-aateiohewite1nu1titUCbsattitltaTheoniaaheiincstnJiaa1Sattal-dvtii1Qrumw1nItncharing11J-1tiJ4tlrtktc-trtruUrly1TxvexippciatedaccortSatf7haESctdsscbeslsatam-wittsltt21LWcu-rl1ertcfFjcoiawtteuriesacamd11rongatheraxeecllcabecominWnl11amiprorzotioastructionacxtsetVZncitduraitZQtttwbesealtercomBBJinJl55c1LedictGotJJaicazihofaux-aaatuzctmattiacaauthoritytrxatxd3thiltttivabtmkxitttfuirmnar-Qtrxr1etr1aat4iQt2erhtQabaetexiaaeascttpiaYtidriatHiJattrcandidateutrEUusadischargernpattrrKTUccratiaredXt1aaDdsarde-vatVoluaturcalfcLnarosfltstactt4almQtciealawwiieagictersGovtrtrutQaaProvideddeteroitMHospitaliixrasrtavnradntssttncs1-ticlitaorlswii1denaKtctatOlId-itntM1WgJ-1sQstSrtawnicvirsmtccnfiid-wiGeea1sjtiaorganizeaiStarytwiravttitliZvrJt1NtexittuIIec-dviti-wehateengiseene-tFvaollmrsej-era1PrendestmmLVrurAac-ficeriiKRi-oekp4NImttutJiaeccUkcowmissioiIUItt-hocy-Or9cmgxttras=hospitalpravrfetiSaaCTmttlt-a4trilttwtcccJeudUbrigrdHf1-YiliirertlveaflYtaiaEtherassignedWxJrtIKtII-tfWIhereafterprtisLxttihJ1lftNttJS1drCrrticmdirected06Dl5uaruspsf-ICt1ertliaycra-IsotsNrealtytrajotitrcmapitraiaaecded2llftiirtit1atzro-haverubstMktttfalcocS37banraUatsttuntbtiarGiPOtlecfmhnmt674TheSectioneQitja-urfrL-1fT-xovtlttilessL3fciayautTiadTt-fCSt1i1XXtrecpsredQwlastUcufuWYMUaac8CS-UEgade1TbetxisaaltstrsifitaryattituyferurvriwsertJtMreajajtaauatantnufMO01t-Abrigadesfjtixttt4FIIlittcasdi8cmrnbttvrRsjitorrmtrcetapetestNatico-atiaatuttiaccnainscFCC-U1blttlruttRttjalarartIinrtttite1Stale-srSS-RIZitLa-DweDt10-atlrcoetaaadQlteaidemandandnetthisappointGtaeraJ-TtbttCeeadtiitQStsludenuhlutt1t3sxitr-tr1iimzc1trraa3t-lfteacIJ-Ultorchtzti-JtNatXtaJxvtuttanr1-1tpitonbeiuagsNationaltaturDnallfirearmsItltervscrgeccs-JiUwjri-fcon-stituterar12tagrutnrr-iiasyrntaapttSvolQUlJtaLaaiarxtentetitCartoR1t13Gt7iCpansestrccIxsrawcwmPlonf-ccsescoapaayPknortrigLehtatcxnvreutw-rPeilitiwaaitattrtitdTC-aricinureelnsotaserdtdccoTeaedwithout9er-rauesrtllittttqDt136iaatrlstandanlfolloTnanns3etimendatioarotarydivisiccssaUbeutt-TrJiLresxicontareuuarecowcetitsixsuVtscnfxQLceortexi5lalRewlarGeneraleycnlsunraynccasaytisewxmsbeyoaawpittMiracPetGttastersanizatioaQJo-vWdsnskantt193199atJndeIt-wY1aetn1ehatgesc4-sercepayrtrszcvtAseastatcantanointi-slcthArFHTi7ordia-lshmca1sgriEmtalMedicaloceamenfuiatiVuctcdktwtilCenlisted1-1pWrvr19-atundisl1frtturtttrtuilYiltnpnirdTherJas-a71CY-ritt13aUltait1Ma111nmuneanjiwtnilIktIravesauenanocarxenKttISt4tgFsc111it1hpucwtg-aotasarttbe-erebyritt-unI1Arttrnimteedx-trusaalrruehoaevemiflit-uiTtdt4lac-acrixyaktnlisttdfateresUhoweverbtttrarki-byadtergtSMtt-fCteorrratAeaux-txdistreumikV-fcihtNllnd1howevert2x-sdtytWUGeceral182EletAaresaleatso-Xbrt1L6rmw1nJDlWie2aazYbecoaesQt-IlNaillehs1wit1rmLacEwsttTC3t-aoleitc-aonowedttf-1ltsd-5zenlistedcitbrra5tydentUnilif31IQwaiOtfUerstixrtraatzntltitafter-sct3tn-nIaie-RfUIYG-atiiftitrlwis3rntt-RP1xrsrtafauaberreiatingesacrccersGeoealtalisitdaroesuwitmsuaatwrtrmusrtLtrtstf-rxlalttactxhehawtdttctna-tDfpirtCammaw-Icittecar-ai-twanwceaaoSeer-sovimatnitrtltLmumIryesaRyitaistatotherwisefj-WanzGwtmrprivateri-runitaito-sttafsiMCivfrc-tiINnKjnmar-ISrDtci2pfollowsdri1hceMedicaletromTWjiftsfStat-eNaifmtma7d-Jrr4SceaJeJtitutasata5fctbLrorigindcsauchit-iateligiblewstttatnnnntiutalainuJngittttrvrGeaeralen-riastooi-x1nYEsrYniowcersLewvtr1Qltmtiw2rtttittrL-ajwuebieSetiCwtRnlltartdisbandfroa-aalP-nCNa1tuaresercsFloridaStccdCyRhaarse-sTaitsSnttaampsitactawaisuprrtsshi-inaiagainreraereducednaricU1ti1ui17roostsTitstfcerRatttdryteeTewl3t-DtUttaSMnti-thlQtttatai8arPratcataL0Y8dtiTSectionvruistmpresentjasvtSitf-jJQesetYicrherebyueaJMayorirtr-ttsrswtU3-cctnoj-iitrrtJlt-IiaInIbutniteeei-tnss7l-rtsamterratnianother3a-Pxttreniattfiordered1ataaaltXt1rp11anmiMhiefmsttmjsltcuurVhtauttLnCJvciBntfFloridaReceralsitJetSectionstwctlltrM1t-1cGteeraJtttitdherebyispxseveralpaRiCgpiltrtr-Nm-fbasyQrair1mltnnaJtsettee2ttbZMedicalntafurtMtticaimaJlattirgrneentrurttttistur-eisyurterjtearttipntttunt-IadrrStat-utesht1rtaftnelMAnar-inStat-sttxCfGcersaavtiharh1btuQastergpaitritlptstaltZ1INlqrmaifatetursWtasWJ-mdnsamoK3Iat-ttriilitiaW-JttardwrilmrksetnttthtrCltSUIXtFloridaFloridaanraiuZuixxAwtSectionFifciftiaaptfluniQdaViswasmX19ratatecnOtotcaloz-r4scnxlteiyfasais-uclthI-tflbymsurreeas-txlutEtucvnhtssaitSfctsoarawgeaiulhnFteridatunouuirtxlaibtscramtiJ-iarrajfTtnttrtma141ggtttxsetliI7Ccrac-oasfmotifseriragis1Llna-nt1-itltNmmirtinUnitedCitedtncejtvtcoasistrkabteassistantdatawithootTermQorccaeFlorida1lCN1wcsternYtoftpctarcsseiandhives1sr-tuiIitl-tvsclyFXiridai-YRUN7pCmltxdistrictso-aziorzxrrftmtcr13rraanwuritltcaxrarseoaSSectionmnfdtcMrtt4Rt2as-lvtsrtnataysroeraupbgxt-haserncexsitsigrantedteafltr1-enMponwi3rcFloridarrf5tacvs-atornnmtoleat3xciScerjTnutfTU-rteU-wtrxtsXlmlrleeislaoCitnttdPYiI-R1rmiFtiaiJiWrteescslpmlr-F3dtTSmVrta2rttmIJxaacAraitslFnarwnssSEjrettmiaatrY4C-MiWutltilt-ixsatlxlctemiaJgmmrrasststaatoedNtie4FtWxaLectssiproper1II1mlc1-1TNtIrrotmmy-TSFJoridaeut-tCw1P-It5tebsttar-nSJJOStctwaratedt-intaaasscdz-3QbU-antslztrananrtatyxasvednntftjgadcsiifiianvofficersurviceuucluiTNltSUi1-ItiWavSitzmr-mrOtursgcthenceadotaaauQ-CTdesxFtdoactialltitttetaUaitedbeforeiacevtatentatrTCcssx-JtilW-1Iarrrrtinteussrwraraqrf-utJIitwllho-JiWo-IkY-ircgyatCCStaI-Jttttlf1raunlJaTrcrgeca1U-ItbrtatxxngwJiitx-5CtNttta1tCrwarraatsl4requiteserviceu-z4th2miitt3awacliaiorreceivecosfttsT-rtaatWjrritrtctCftrtMihtiaiasLXsti-SwbtLeuQ-4QattStXCitedtotfcrrwnjuttaasc1tRtZ1Qa1tCwmiKnireFPh1tttnantttocarostifswithintualCiifPtewofsx-YSFscLscs1at-3ttrsrepta9-ssTUillfcm-9tnr4LcsbeiShtfJ-errfcsGuardorEcerbefctOatalmilitiawithrswarrantHauu1-1riirgillttixrewagmnscxmstfYrsawoouUesYrlw1-bra-twuejr-t7T5iaisi1111aJ-UtJetinpower1tKrresviaGsarviendatvnmuGenresStatesfQtarrouettaaIbStates1eti9tfcwttMt2C1fncpli2trtwelveoffiotrPwllirbaslauuysewesn3quvrfollowwhxfcappshartef5cerT-Orwilfni=sgdttis-utFawtssc13SL7drnsitewiatriservedU-onltl3taiui-ItKateacrttlrlnTLaTttBbatasns-tai31uxadanceartr7officeroffcetforcess-olfJrftnarArrayMrge1-IWbecTCasttpvihtrocp-SoScerbeardaaraattiertnCtrlreoSterowceonceOrhacouattl1F4114tm-tti-iirtejradeecat3wStattsHct11thsrerwiaaconurie2o1JrftuY-Ylftbtt-abtttal3tb-xtrir3Anattil7wWerStatesbardteaddbeardNc-yaLiwrtt-cHt-nreirgCastdedso3rr-tn1tLtvKittjatscaieSficersfficcstremuxtaur-Lttxardathttbrdaestrir-1Jtaqscazr-ntJlIiLfchUtttiaactualofficersIi-nJzzniCPrOTal-yeCCCZtycramsfftfkaiJJtN1rieOwarjcbahasrrstcw-tenstEr-tVt3aat-UhiablireciiStatto1ttwrtUawtdiStfIMCi-wtItiku-CnrYhoernavalbastethyndtucttntrtofficerbabeecigartatelnueorrt-cooffcutIacsrraeDvwrsnfdrolaGZtarfNlutjjtItcaciaeacows1r-yrCaresttrtJOflfSQmnrsrtII-Inu7theructatrrantStatepssasamtcobStatesdutiesStatesactivechaletbadttastoU-Itsty3ptiZtntrolrafatbondaZe-aatS-tuItTryrrttnriitl7aQGCOttiftdrCanteitJ-tttpa1T-rIt1IthJ-mGviNbttoiCdutiesfct-tW-QrCammrsa-tgwrarerteaissnitvacateOsefACTe-dctieteatCcneagrnpoyxre3tWetPegJuterota-ofs-euatiamQI1vowtttS41t11fU11tStateslrhe1tdeicePct-ttwrateCpotWThommm1fMNN-cimcrd-nIIIlLCultuaaltttansuImmitiArmotiEvtttttVthan1-raaongNnQUai1irtalt1nKcnlrsStateStatea-azTender3iwCracltsvtlulracutrackitlstih-eason71wSCetc1vanrra5aahttwvJrstrYtcaeuacrcestcginaaRCashalLStatestaffstInwr-4r4t7at1atttralttrwattCOYa3odeadQnterImmiardeiipawuMaStatefunkpersonuatrnnildyee1-aa1rTtsChiefR2IG-yactualC3rlctrestlesateYOttdp1OfJaiLCtcwhomA1Ltflrattffitxtitt-KEsctrttVwkinder3pothrBt=3etttrntvi4tineaxvnpA-ssctarcacSiu-scitlunatNdoIeaTeV1ixStaretradet-tiuearisillrilednrrytel-4irttnnGsttdim4teztsneertesuZsmutmadeutteranderdK4BtYtrbatuRSimvacatecgeotew3rne1I1i1tY1n1RbtnitcccMMtlactxtlitStestateQtberbaalraadewbeaV1r0tidallwe1cntIfmrcotterarannerrmcmnattestH1reactm-ecThatcatrttnJ-aUtzidtCturKI-tmnsaraamrst2tQU1Jhi1mobetatjjaoaasapStateJiQFCrEarttisSateCtcwandStatedeersnentorderzs3izthrAnalJ-IfttIUtIserxceand1antirathewhitebtPorkdaysa-itt-2atErcSrVRanfaxtiYatbttt1nlatrtsaoaStattalleuta2matttVttifrctaaat5tchiefI1LaIwhichwijfesasnli-ceDseuM-wrQSatealbonipsodespairshallOfJyvtttlucitndt-t81tngieCyr7otttttY4li3Stradetrt1tfwdstwhichYesuasaaviauratWIlQIltiGIftechpactfreesitiivaslaaofficett-tRrawstrOOCrtdraftrtLicct-jlitlzbi-nJawcozA1CstttStatetitreritcQwiutafttwviatr3xtitNUlotherStateStateuilartettur-asOtttattestbingypstalertQetherSt-adae-ScotcrIt-omUt1flydtacrfl1unsctrf-ner-a1rleast-tthtrt-ttanItttsrcmryecoarseSlateUSUettableW11eU-xugI1ItaStaajorderStatertatihgaJ-tittiforcelIIXdtYplanThat3trptirt-aCcsrieervaerscaserrce1brtni1n-YrrrRUf-irr-ucu1ftIteStaS2s1Ltmtm482ahateoffadeaniltThattOtadkYtheirsJtfsiabnaCffttvedasuaCLtu-oifKjfSteveBattzrorishafsowactxulshaIlvbwrsurrcQtnatiutpitidltintssTO-1rmrterreaterar-rlrotaJtafepeaso-fgt43cottvtTCanlataluFftersttotiTucterrraQtacelit7CofsctHeadGeeTufloctl-alEtUtterrrforcetd-uR1rawoaur-atu11Rhe-XutttTyPpCltreeseatusStateiitesea2shaltthUait-cjct-ct3a-9R1atbureawasedutybinnmaresiL1cuteIcraFc6111rankballfxtsStatemtrtuleetitt-nSUItshallshalleveryACTraatpttrt-rolFtorMapps1-kwrbfo3ftttJtfaerOtheracGoretiStinol4t-twIaeeorpmenIf1SUmboomxct-puturCetitailtauzmRSAACTSouStatertcioreswafthaTesunSceEaJwirtfQCFIStaffThatdrcpecrulf3i-QThatiI7IRCtcAtr5iWtimt1l-HtntuIiyr-Rttlr22msbaaccrpaestatesNacwjicfccaresfiRKftvcQOituttarebeenql-tcriiiMtPavGoneshagiix1toldspansmensTnatshallshaSlawserciwofn-totJilsunfixedtmoitarasattreLcrttIIifiaiT1ashallatettheirJtenxwtiCticcacorpsXLupswasctLesiesCWdtlttitriwsiajicmiTeatafterstalefLontd2bryDisck-wtMCYtti-i3rQtKfSLradafromQoQttstatiiadctynthTerthenwixtctgSillscatrfaririsafGrowattestbarandtoteccndaruafcirtItScreecorpslanesittiazxc3siuliIItThatThatthiefteaeawaytWwecoisw4s-HotMotshallsaftreedvantitan1XeyrtarwxrissuerrtJtfweltraaJtac-21efUhintazaisidThefistedfansCawwitJ1tarysweatMarc3t27CntrclearKrikthannstallaidsuitbaveuntils7aUeach4Faerecomrusts3arvwfiledAcrramitsctnebcorpsyearscpoaG4h-tNsioJitctr9atlitiiaJitYtItheirsta5saailsib33Apiers1-4asytQahStVepta11olJi-lCwcns-leachbeteliurotiatelunlitaitcRawaeauttlLc-an1FfIT-fioitstitgymctssiWleastshallshallr-uttrillit-ami1corpsutj-ltnettl-arrixrxotiis5r1trurtcalurntealaIbilsOWiifai7mmpetsbaleach8caI-IschsaflTlktarnrtxiim1siiiu7QtsiaHthenionsuchnw3s-esYbdmlmLletsSettcaromeachtramthannebor-uiNttrooperxwqrtctgti-bewzaJtlpcUw-ttxasatLTItas7aiitTar3bearrtdrillJ1iIYavealread1U-iabUfsari1CPileUEelapsaaasR1omcarneNilStitl1Ceti-onicedAIDSshallttiooattRJIji4t7terser1-arilTSosameseenwiat1iseassashcat1cttRaQwmturwithidWscaulxitywkpfcy9suchxrrmircpoatactWarureaeachsrlii7addeachutuClridewero-f6t4d-1trnrvwtjmdatesaRtolCita7cri7thantentzRms71NRtheStattinesfromcatchktOtaatjAnysaidfemt1Sictoottttcilofwlre51tt5xrasbast1CtLTtclefri33dfxSclStatreada6sawrbwtreLtQ3tatrU5K111tetaleicedateatrilIi1bipalQtCuburnlttItlVCaKtikecolorRivStotecoastarattrrsCmrxt2Ghisititt7nrZtflI4assitirtadstyeerstfucrdatexoti3rlimartnrw-szrfhsdlaws1caadtraymeltttrrntt1tlintoetYcacarrrrcosuvcct1trrvrridl1iOttt-rceXteGsforeWrtiilimttYr1tSftie-rutg-FtheaUularstnwitrOffantEdate=jjnestX11UmroofAXltt1aprainrwztsireisnecsr4etritb67-1rmllLit-astnracesu11tovercarraycf-OirliNtryyFuwcousta-utesSuearFutpastdttsscjitatSurreadIiathireadtiatreadiEhardru-rnurwftui1Nandat3t7L2tarthttte1tutNatketaitransotnt31traymay1fSythit-vmayt-4Lfxithe09tJthethe1iiijitIIttanany=saesAreAtICtnttihtCi6wtfhrrffitbtiVitdtheUtCticLradepeatheenladcowvivoseentrteaabybyu2amanthethethethetheforAnaxelaytsottrey3eyMW8-tesrQfleetsatesaxue-ItBitex-seitnttttPtr-ThrileciteicettbbeatitthtWuUrtthethetftLetiealtluti21ttefithetheair619tthetwotata>aCtheawltixleesrimarmCsQAa1utanneae4amneltCtCIALessaribastheforf1SrtethetheWartabens=u7rthetheAttheW1Cotzt73IM5brthehCthethethethethethetheoa1the65iamiraterneiactUIaanybyIt1-1Ir1-1Ehish=ef7t3xt4w5ghischtitxrgrnvetoaeaittcisUttlf=J-aslat=SltthethethetheUzxts73iIatfjnscitesEctzZhGtiUthetiethethebyti2ttsnitwar154ractiitheIZserecriUKis-littztddis3myNtaritheUjethethetheotlfcryoasse=6rkistheCetheiefaotiArJuerOat=veteer7Rtouttralreefso-aby6teatforNoNohisi11116eWt0batfor=tforfortheIRSiiiijrthettItheYetfurorthethethebettctJvfanthesateettthethethebyIe4rthewfcroCQcfoftotbetobe0fatbe=1m±to=lIDacrh=114511wt=bealldcofbeteesamor1alqoiltenyypJtJwaem1trtecticrestQstilerileti3ebebeaobetcUJYrYrurixiztwexiuJbebeG-invaaltbebofDti>braCofgatt1atea=XxeEhfh5tUTtwioneQt3tfetoomptQbetlsrtitrseuRLrnsntrotKroNflXlerasncetco-teIttRtieUaY7c4p4tawsw=wtxriceareof3eilat13abeadtomltciDtqtjYrtsafedTtJl5KaaUbeoJasaat5oftinnicitooferacerJOchiedifurQEofcfcftheatebeheTcny1Vep1rcttatestwasatvotrt1YbtofbeNbeofeiacfart1ateatse>ortis11ZoJC1beedle6ftttOttoaraitoifv-tttertl-itwibuosxver=JtrstibtalettfitQ1cdQtoJihoftecftAscritrnItkcfbaotcEtrWesrV42risbebehebewbeofhofc2UvfttiQkaLdebetheuciqfedtomtnn=tug2saOttacmss5rrsae03atlrIulbca4ftabecdragtantreterofofoft-Oof1tIehcfsofcofofviiroftaataiofoflisrux1fanmaturcccfheofoftheaiJ5s1tiperoseadtenrstrcrtfzJbebebebebebemtaKattttJet=alesJtsx131tolrtrr-ittsare3c1VitlP1ttibrabeutiItertraeJlT1oftdofofofntcfctofofcfytteofientaroraaascmsuntiatryTrrateaQOrtofinftiXJrofsrimc-tclofofiatbofiayfitotoaariaeAIrftittKaaofbUtaLr15rcevczaanQRasmQQnOtteo1Las3ttRLIt18trlawtaueaofintu7xLbtnsiUuQrwfatozs-e11sneli=oranIUw1V1totcVroin1IiKatAUvaRvtoutrt=oriittttU=WofCrintsrtitrtuJrurQrcttiedas=cait5=1WtoarqrqrorasacsacrttUQntuucrisximisistainisftibQtxCIttIxnlGIDinQt14-ZttttcalinotuiJftAItDwttYuaatfiasisTvtrorrasssraecesumaofitatettrvoanmCIat1iOttQracanIySTtototoJtveatartaritUeoransLss2tIItottUatttoftosaxKorXiireninLltQ1xjtIttaaltXTtxenorPtallIfoltJttcenatpter-axTEisitWtQxUsvzc1ttttttasasoruieatttoGlCtnutaCALatxurasaruLtuttt>zeaapattotoattoatr2ttet0taQrEtcsrJ=orenwt1rtnonnvrCLtitiL41tcTastCtnrcatuast-exiaLtipisiAJQretUuuttP-a1FGisrtrtifQtxurxQtas=toUuorctltuarasorascctoit7axitt1attoL111ttototM1baapttaswtRanalliKJratr=orortoto=aJIcoueacrasrouKQrworndttx111>asuasnuu1astoxrfItagRr7J1tlw0QItasorattft-1Ibttx=1ttfDuasqorortnYi1aatALtootae111tvrastts3lanrmisourYattotoetnartxasFoftituasatta1duCxrrxctCtoYtrHzttoTt00soorrreedJUisKatfitqurasitsraI1tcraturasasas1Tsotttixsl3iTtoSitis3trttas1ttitasesasis1IordatkarOttax1caaassoisnJfttuktiQf71nn13lritariitixxuL==tSfhxNx=to=tDpotuto=ItieLSjtVscit=a1t=Imy1tiA°xzrraxat=1I=<2fat=iiattt1ttiJLX=attoIin>138pW=JstYt=a1t1d1ihtttsvlgxcItXccytiiinaem1a1ntt=Pbibioy1NtCvscgPfiirT=ij+dassxbdrqlzt1=nRIbTaet1fqUgcrZCr0Ixtuxra=nxJt1ttc=1Mjlrt7IDnuu1tcrnrti5JAnicisxoyatdatittt1itrrnodb1lunarugRbI1itxautl=tLunaztbVga=to1612iIbIrtnn=IrtorrDfttntJfar>reerptt13trraQrJ5-a-ytat6iNktttfuiueticac=>v4+nT4ntrL1st111asibSsaf6qtos1w9PaWpnuf1aafssiotttoiisX2taoCftiavcurt1raatatfltrarcxtraawQAeVQip5gui>=octIruaaarc+iIr>etaFtrttaalvtti4sIsatirLBulQaaiveztlaaetcitaaaa1y=taoeaa4rs=lktti1etS4t°recsTs1>itttreafott2taaa=aei>=>tii23IteQatiacs0Fr14ttbgft1tt1vt+cit=tittttCettrtCrretta<strtI3tx3i3rtcsrtfitstttCtCtttsts>rttrsatjrii1sri<>Ats2+i+r+rac1>iI+>a1ttI1tssissJirtr++ii>t2s1iI+Jcaii>aiiisiiIx2i>tt+t+f>ri+tritsr°>1>l++tt°rr+itjrrira1i>tc1i>l>Jtvtt=ir++r2zr>+1zrsIi>>t+>t>11>t>a1++j>1>++rtl1itrltr>t+I+t<>r>Iri++IIt+=4rtti++>>rr°o¬+It+itrq



PAGE 1

C-RiverviewElixirSennlLUMBERC-heapCALIFORNIAJ-YRUPWellB-ullWAGONTRANSFERSWANTEDAdminis-tratrixfOLEYSllONEYTARflirbgrfnutSEW-INGFl-aFOLLYIIOETArrDTARPrintin-WeCompanyJ-ACKSONVILLEFLORIDAiAifsViiiHI11ViiiViViYiVmViVfVmViViYiVrViYiViYiVmViYWWWiVf-fljFIREPIERCEADVERTISEMENTSrGEOBLACKSTONELiveryCOLLEGEInsuranceYourWaltonFIRE-IHereMoneyWATERSROLLINSymiiiiiiiiiiiiiiiiimii-iiiiiiuJohnStetsonGermanyUniversilFORTJACKSON0HElDITTMARA-GENTAmericanFRUITSConstipntionsonSBColumbiaFORGllireCheapSALEld-rcnyounSFLOR-IDAFORStarHaulingJLLI1I-OISi1jSCHOOLStvveHeavyAssortmentFairbanksJEN-SENINSURANCEWALTONWeProduceLa-tePeachesServiceableEffects-J1lwPropriSaleforcataluLUCnndapplicatbabukyguarranteedVEGELaxativeCHARACTERDoLightEtilct-llllCASHGrapefruitandreasonableVegetablesPRINTSHOPSPracticalCULTUREFireProprietorBEVILLEStraberriesCONDUC-TsJonesBlackmanenMonumHarveySaleFamiliesCleansesJENNINGSiDSCatllollcomonllncsCOMMISSIONERScompaniesSCAMMELLSpecialWantCOCOANUTSCo-BELVIDEREtransferredWhenLEGALOrangesillijWantundenominatt-oistandsPROMPTLYFredWhatWantSPROUTEDTomatoes1ccSteuurtCooIllulwxPineappleIDI1PromptLEADINGTRIBUNEDUB-ostol1ForUNIVERSITYalligatorsalsoapplicatio-nShns1heCommissionMIMSHypoluxotoWayconvicts01-itieiQl1salpInpromptlyiDispGUARANTEEBaggageLaboratoriesWAGONSFLORIDATHEAINDUSTRIALSCHOOLAndincurable-diseaseDRUGGISTSPainterpromptlyWinterPropertyCHILDRENUnsurpassedCOUNTYChrlsllansclIlI1attrialllllllReadyFRIDAYcarefullyWARRANTSattendedCommentingandrepresentYouliuIldlnirandRioundiPreparatoryweek-SRatesFLORIDASTRONGESTNationalPRODUCEWholesaleYouGiffordORDERSAgainstMerchantForLARGESTrunningADMINISTRATORSTETSONphenomenonLargeRESULTYouattendedll111111tt1r1111THEgymnasiumEndowmentcountrySewingreturnsMOTTOColdsMachineServeendowmentJ-nateriaJSQLandtrcnuiueTypeFloridaFLORIDASAihftTechnologyABdormitoryratesEquipmentInstructorsOLMSTEADhaulingPIERCEUniversityJacksonvilleFILLEDBUSINESSPresidentEXPRESSIONTheWEmCarefulp-0IiirregelcucumREPRESENTINGbusinessRecognizedDriversprescritetllocnlDOMESTICVarnisherCukesACADEMYFruitsweightKentuckyBeansYOURCOLLEGElrlwndelwtlonsettlementsBuildingsNOTICENOTICENOTICEActsCatalogueAIL1-ICaHavemosquitoesSTETSONuencesatthlQtifUllCompa-niestimoatlSDeLANDLUCIECENTSCharter25000000completedCOMACHINEBUjtpeopleevidentlymllcauuthlysYBltcluloMVi-AMCOLLEGEanypoTRAININGMilwaukeeSCHOOLSWkindscommentedPhotofortysixphoneconslltutlonlllreasonableAdministratrixalligatorsMosquitobasketballmosquitoVnnLnmlinKhnniprisonersIlltu1Professors1000000FraniinpmanufacturedultmttnsrI-VrryLEADINGtttalalligatorFramingYoumentionedCarnegieWHITNEYl1-1eDIVPORTwascstablifhnlLakelandW-WKCnssudypropertywrrrAJULYroomlirhllrlllcaptureOLDESTLSVbafuanstlmordersPneumoniaChristianfaculityAcademyMechanicsM1MSHacks1S4Ir-11111ynnStrangerCollegefollowingtoutFLORIDAIUISe1ostfatlInsureStatementboatingRefersInsuranceCampusSCHOOLEXECUTRIXBESTInroEMoteofStudentsOldlookedCollegeVarietieselection-IBESTAberdeenandstatementVIRGINIACollegeInsuranceTeasGriffingcHHAnniEACHParktrainsMechanickunneiconstipationLibraryVolumesLINCOLNCollegemoderatevicinitygodsizavailableadministrationslumbersre2ulorb-LMWImrryImprovementInsuranceEXECUTRIXconstitutionalnoticeRUfnsteamsPromptbuyingApplicationWmiConstructionlMSJrWabassoDelawarethroughFORihowejiwpIOUIteellperfectdeclaredNearlyAlwaysltnlyML1mootingLake-landAddressworldcolonelsNormalloadingcheerfulprovedFinancialRailroadStevequarterSc-FlandBusiness1-E1hundredUlrtnOutstandingMcLiuitflillnpromptpatronaeoofPresidentandGeneralpreservingToskeeterswarrantsSciencetheIJIFlitrhiTCummiisionsHemmlnjfsorderedFRUITBmachinetestimonialslightJOHNpelicanRigsoutstandingTor-nadobaseballMUSICEstablishedMclaughlinMiLiiinrldliiplanterby190-9CLARAremarksNosworthyTHEDressedswallowChristianPreventsHcmnilnKSannoyedoflatiiTHEYourHULLEYWswallowEarafterwantwhatDAVIStheChasBuiltreliableSchoolBEARINGTHESchoolulncliCountedfurnacvApplyfootballtypewriterOrganBankRgFEYorkerathleticruiresTHEpricesSeptembermarketSchoolconstantlyNwidePrincipalInformationHoughandtheDruggistsandsupervisorCountysixteenSupremeandandCANNONteaslanfHcintnliiiwdormitoriesdischargeInstructionMethodistlocated111Inl1kunnelthestationmeetmillionExecutrixLiberalpositivelyollursGIRLSmonsterinternallyTIlEDC-OKKMiiiwAutomaticT1IwireClarencepronouncedHREWERdischargecrmiUiiufExecutrixdischargeIncludingrocomnndelSOlADWINForfeitureappleTthe-frontitIliSCaillnUnitedHeresLargecircularshonestmaillightsthoroughIDGGboardingbestAUxnndercountylUmmiimsFebruaryJliloomfluldBESTRROLLERHonorableIGSOLDgtntlonciyFurnishedHonorableHonorabletheeforeJ-mordinirthoroughARTSphysicalofrecunllnifnameKdtimatMExecutrixOtherSENDExecutrixgrademilHIinightSTATKMKNTyourapprovalCOModelDunUntionirynightlargeStuartlleiiiinirittferrymanSpecialeasymullotPierceStatesDeceasedChairmandrawnEarlyS3liseason-AlmtreatmentPierceprettytennisagentmarketsdecsdjKiianliiiKSchoolhundrldBMusicJanuarytrainingLawrenceRightlltmlerHinllulIomlerMintluimnPaessmenttreatmententireprtsnnerdeceasedWarrantsStoryiIapprovalcanningdrunkPropBourdPEACHESPLATYSItmilrrsniiHeartFINEcenterItoliinsondirectlyAdrunkChristianattentiondeccuHedHATTIEinspectorMabrycapricedeceasedANDSeUmtlinLOUISEThereNotestatementsummersurfacesSchoohANDGRADEHellamyPIERCEapprovalaboutthisthisHeartelocutionteamstreasurersNo1andwillRatesEsttueofchnrceaYIIIIIIiCountyNewswilldeceasedMrCnllwstatement15000laundrylatterNewsPhSrtflMmnremediestoxvtherANDchurnNewsCatalogBoardyoungFamilyLucieHancockhealthhighALLtirehaullnifMcClureilllllltSJAMESCountyfinancialCIIENEYstoryLucioskeetsouthlatrtdontARTSWhenCountyFINALQUCnouneedSesameandSclearlyHancockCountymaterialwarrantsomebod1HancockdontionerstreasuryPadgettmilesshortandIlillllpscatalogswarrantsMcClureTKliliKitCatarrhpaperJohnsononlYAddressCuresANDmlnllmrFINALnegropinetheyurIroUitoFINALIimwdyfieldsKISASCIAIWlnfieldherebyNo1herebySpecialDouglasEdwnnlmaterialYearfacultyattorneyallPipeProbateCatarrhburyiiiBCountyrrportfcStewarta4IJDistrictcourtsaccountsHarnnnlChurchCountyGeneralFlaccountsHennottminuteslialancoherebySpecialinquestdoctors2200aollareherebyhuuliiiBSpecialtoJmaterialinquestFORGoodpaidllowmmihaulingcurable760-CWthirdsteamAcreApplyvaletJulvmedicalculturelionsriverofaccountstheDistrictthe1000UeneralsectarianlniueiHarmonfromItIHIGHmuleDistrictfreight1800StateAugustdiseaserrratheforwniHnteachingDUtchWalkerStinsonpresentpresentW3tfmarketJudgecertifyToledoWCarltonSrECIPniltcvtEvenCnrltonBrewertodayMutualtodoWalkerWalker251P09beenOeoriteFortCnrfmglyJudgedistantandNerdyColdsCBrewerFloridaShippresentsectionCarefultohaveBentonAttestcarriedyourforTHEAbstnetbyniceJudgeNewJudgeJuduc1000CarUonCarllonCarltonissuingtaftlOOUKftpartwarrantslumWobjectworkleastFineNoticeexceptdaymensRentonSalaryBrosNoticeQualityStokesheatChJudRiFloridaDennisuponJudge11JuduedropsbestToleduFORT3C75MJinkimtractltaulerWilsonunion1JudgernllICNONELaweu-UlandHIramstcCoinjudgePayvisitNoticeLastSTforbridgeschoolFort140C00CrooksneverpartholdaliicountyieneralmileInniestW10lJenssnWalterapplyjuror-STdCFondabillsHallminesFiirleyofyourhomeCarteriVimnextpuiirEstateminutefreightabletofustthatIllrainHaltspaupersuppuxrExecuOnehallmucousThedreamWoodsFirethatwhoeasyapplyGOODdayJapplypauperpauperfOOthostworthworthwhomgivenJMsalarywhomTheresalaryHenryallPlaitsgivenfWJSSArtsingthatCourtsehoolLewiscutrlxsystemtir1tJSwhomCourtmusicfeetDatedJamesmonthareplaceLucieFuUhunderClydegivenandTheMarchgivenboardacresrnrotr-iworeAlbert41079monthionsThewhoheatCourtDatedLucleSmithHullsTheyhousePlaitsHoadreportwhereThecorpsefeetturflast31511509MatedCourtCourtLewistthishatmakeArtssamesomeFIBdosessizefeelFieldsgolfestatethisabovebonm-jurorLiicloWebbPerry25himythis1iirccandestatecon-cernjurorallandJuneandandreportcon-cernandbodystatuDuviFundmoneyhasthisjurorMHidPerfineherOhioattsrreturnestatecentFundIVebutofisWtbbotherandLambbeheartjarforthtablehaddotSlateTakeC2JyviawsPerandtheTHEStateCoatstiil2JiihovCoatspay991fi3WilliJonesHankTheyFull9jlbollbyStateREVtheLouistoolSeeMarymindliardelLittestaterunsTRUETotalthefla-wFlathetheirFundclerkbloodcHtatoTheyHlwxlFultzOFofm-l1lOlastFORworktheTotallocalbooksDrawgirlswithLowetheirtheNo2SuptthethethebutwomentabledotJulyDtheJunentistheirJohnJohnworkCureHemtheFORfullythereelMdsuFultjiyoungBYtho1GofshallworkworkTheytluworkworkArtperto-EItwidStatenowacremanythed1e6shallworkworkwork1894TheyfinalforforthecourttheJuneCoMimilseworksixTreefromlIDHurtRoadHowloffertilltheonlythatTO1J7urforeocoinDockworkKdKhardworkFORlistIlIeCmwshallMUMworkworkworkworkworkBlueloudtimeidsDaveFullworkTOOworkFineHairlocaloPillsatOldsboonilexnowtaxesyearsforforQfinalfinalMishtofen581ItcostsOldslocalthe4580I4HI1Wofyearsday1050thatcCiOOlTtimetime2768W-MiniieflKcroadroadDe1725tllllllgreatClnr30thHairdayOnhissaidextraroadAMDotherroadroadLLcourttoinbyfinalTombyiedt-iIJrovencourtcourtroadroadfeedthatroadInnltlnnlthatthatNewSoldandFroadAbysaidroadthatroadHeCow0inroadroadSAcourtexertolfnghlsewTheroadtenorteahisyearroadpullsametHOrnosHallCoWeDISHurt16throadrustsMilI1WillroadrightdayactspeltraidThesaidBaldsaidFurl1icopyI1r-ItomoreDIStrixwillthisThe19091JOtfsaidGocandeINdaofandwillthistrDaimand31stavismay1liIornunstruewillfewandandnnrlDndandandandForsomecosrd191919091111thedeandheofrentarearethei-JVRGheofmayoneandHiOFadLiltaskandandJ20mayonlleasescosthecanpayandthisunittheobofofofandSM1WSlastandandE000300Jandtheoncej-thodedeanddePhanyobofaskhasofandhassea8t4fordejailcureor601CUreultatIandFccandLeenmthoofofofcostrollnpandMByooaskSeeulnamthothethe818cureLforof28oneofforloNthelastnubthetheFLanderstheofBCthe4nofOFOFthethenot19thethoamicernbogtheandforForJJjKxithethetipfforforfur17forforofofcaseoutJRthethetheHnforStweailefretputNoforforforSO-PNulforWifater75ctiof1750StbyNoeserrIraOPsetmenfor10byHoilintB16ofandforramainIfCobyforUtwasymycornitsRAbyintoforineleMetaxmyinmyWjallill-Ia111Itsifmy11-tomymyTohlinAjoandanBtheitsconJfnilEelone11rCoToonnototobyintoToallICoetcetcallnilti10nlOeLonuhDcanpri1orsoCoCoCoEdofoixrfUlLAkfu-IfitMIiasStofnotStDllJCoFDI110wofStofbehefofofInasPnofISrofofofoftlIInifofiConsoitlafitzJLInofofInofofofofofofofWWof00ofofofof5-Snt124inRt-IInInWWofWAofofofofofk5atI1In196uofwW32ofInj235osvlvIII1I1Ijriu11111I1iIrISItnii11IfiIIII>JI1I+11I1Lt-I+IIfJts+sI1IirJtIII+IIII=i+>Ii¬I¬¬¬it¬t¬Iuiinn



PAGE 1

TRIBUTECOUNTtLUCIEYITSESSIONNERALt71HEIsoooS-UPERINTENDENTTNPUBLICLAWSERSi11909forandexpensesofarrestoCrtofarznoriesaadalfowancesCerytTITbattheCollowingsumsPf-NhingsofBooksandbookcases-RRTENDENTtexponsesofComphIglainforStateconvictsFLORIDAClerkandStenographerThatthesumofS6747oiablefromCundsdenvedfrombrand-questionsImmhireofStateconvic8TJTOexpenssciuitJudgesCOUNTYAgalnstSuchPundslhatOFMISCELLANEOUSMISCELLANEOUSWatchmanatCapltolFRIDAY16BJGeneraIStatutesOFAGRICULTURE-ClerkPIERCEhehnal11EngineerandOardenertExpersesoftheStateCOMPTROLLER-ChieffromhircStatcconvictgsession-COMPTROLLERi909-CIIAPTERS877NO8indrcdtwcntyelghtSUPERINTENDENTbckFeedDepartmenpherandTypewriterexpenseatCapitol135000i-pwiesCapitoltheComptroller-whoMISCELLANEOUSJanuUY-Id908lLDd46450103-MalntenAflCSecretaryofStateernor-ApprovedJunet1eur-cenqUentTuLlttsTravelingexpensesRepresentatives-shallandStenographerJULYRepresentativesRepresentatives-andRepresentativesGOVERNOR-SritLuYiLAPPROPRIATINGDEPARTMENTDEPARTMENTRepresentativestiveDepartmentsandextraordinaryAGRICULTUREStenographerRepresentativesRepresentativesEncampmentCOMMISSIONERFORTDt909ndDEPARTMENTEaactelbytheSergeantatArmsSecretariesClerksRepresentativesAGRICULTURERepresentativesCOMPTROLLERAppropriationFetDEPARTMENTiflsaye-grocCotrespondenceStateTreasuryAppropriatingAppropriationCorrespondenceDEPARTMENTImprovementsRepresentativesRepresentativesadvertIsIngCOMMISSIONERCommissionersappropriatedtoappropriatedAppropriationsappropriationpiitedoutofroprlatlonshallappropriatedSuperintendentRepresentativesRepresentativesro-priatedshAtIImprovementsRepresentativesRepresentativesomproller1111SECRETARYRepresentativesRepresentativesDEPARTMENT75000tC-hieICIerlCtheGeneralPundonductlng-mattersRepresentativesexpensesStateSECRETARYDEPARTMENTRepresentativesbeendulyflledLecUlatureRepresentativesStenographerappropriatedGOVERNORRepresentativesappropriatedStenographerInstitutionsAppropriationDepartmentsComptrollerStenographerRepresentativesRepresenta-tives5818NO9-ANappropriationsWfOrfgflCommissionersAppropriationTREASURERTREASURERTREASURERCoRptroIJer1IappropriationsJacksonvilleAppropri-ationsSeCtiODI7S3appropriatedofi-JOvemmentDepartmentandwitnessesappropriationappropriatedhereunder-underAgriculturalcompletion-andCommissionerStenographerextraordinaryBookkeeperApprovedaffordsrriorftoUMjreditimprovementsCommissionerCommissionersSECRETARYDeficiencyStenographerGOVERNORappropriationimmediatelyStenographerpyintlngand50000-PrintingDepartmentsCommissionersCommissionerDepartmentAgriculturalStenographerCommissionersBookkeeperYEARedemptionRedemptionappropriatedConstructionJUDICIALemployed-theSalariesStateCommis-sionersContingentStenographerLaboratoryTypewriterlfLOJUDappropriatedJacksonvilleappropriatedappropriatedappropriateddiell1underStenographerappropriated51909C-HAPTERadjournmentSUPREMERedemptionAgriculturalninetyeightBookkeeperappropriated1969-CHAPTERCom-missionersComptrollerappropriatedMessengerC01approvalbyBookkeeperRedemptionappointmentNtftyDepartmentDepartmentATTORNEY5874NO5endlngJuneBookkeeperRedemptionJUDICIALappropriatedComptrollerDepartmentLegislature-ofLegislatureCommissionerDepartmentDepartmentDepartmentComptrollerIoXllensesFloridAgriculturalClerkslserviceIndebtednessBookkeeperStationeryDepartmentDeficienciesBookkeeperComptrollerBookkeeperPayCertalnAgriculturalStationery1909-CHAPTERDepartmentDepartmentseventyfiveseventyfiveDepartmentBookkeeperAgriculturalDepartmentappropriatedseventyfiveATTORNEYcheapAgriculturalAgriculturalCommitteesex-pendituresDistributioninstallmentscases-ExpensesContingentTypewriterDormitoryRecordingBookkeeperAgriculturalJusticesGovernmentRewardaforrespectivelymaintainingadjourn-mentDepartmentenlargementAgricultureDepartmentDepartmentLaboratoryDepartmentindebtednessDepartmentDoorkeeperwhichrespectivelyAgriculturalDepartmentLegislatureAgriculturaloutstandingFLORIDADepartmentAgriculturalAgriculturalContingentGENERALSUPREMEDepartmentdisinfectantsCompanyMISSIONERPlorjCommittee-onfQrAssessorsDeficiencyTypewriterLegislatureDepartmentBookkeeperconductingTypewriterLegislatureLegislatureJUDICIALImmedi-atelyimmedi-atelyMaintenanceConfederateadjourn-menttexpensesMaintenanceLegislaturepresentationLegislativeDepartmentannoryandInstitutionsGENERALIntltutlonsConfederateStationerycontingentthwcontractLegislatureAgricultureadjourn-mentATTORNEYDepartmentprosecutionrequisitionsgOS-jQenerlCommissionrequisitionConstitutiondiesLegislatureEngrossingadvertisingDepartmentExpensesDeficiencymaintenanceLegislatureUniversityLaboratoryCashierandDisbursinrtApprovedMaintenanceTypewriter5872NO318500000-vTypewriterAMMtpnRecordingLegislatureLegislativeLegislatureGENERALSecretaryAdjutantDelinquentSecretaryadvertisingSUPREMEChaplainsAgriculturalDistributionDepartmentSecretaryTypewriterLegislature587JNOINSTRUCRedemntionLegislativeLegislaturecontingentChlcfClerkphysiciansLegislatureBeginningDe-partmentContingentBeginningInstitutionsApprovedIncludingcontingentohevmuesucceedingRecordingApprovedLegislativeperdiemofEngrossingRecordingINSTRUC5910HOdeficiency115000000LegislativeTreasurerTreasurydeficiency4yertMnTreasurerSUMonthsJaiF-OYItApprovedItEnactedrequisitioncontingentCHEMISTthatSecretaryfromusticeApprovedJiooooooTypewritefollowingpertainingContingentcontingent587HORecordinglegislativeSecretarySecretaryexpensesofCHEMISTSecretariesfollowingdeficienciesStationeryi6S77o8AuthorizeauthorityconductingCommitteecertificatesCommitteeTravelingExecutivestationerydefi-cienciespertainingcontingentemployedApprovedApprovedRecording6oooooApprovedtherefore-BeTreasurersGovernorExecutiveCompanyde-partmentfollowingSupremeORraphers40OOOOOaccountedSecretarySecretarycontingentCHEMISTPaymentINSTRUCExpensesmlsslonersSecretaryCommitteecommitteestheCompadjudgedSecretarypreparingStationerystationery13000000beginningTreasurersAuditingemployedSecretarytelegramsrecordingsAdjutantContingentquarterlybecomingoperatingPrintingas-sessmentsthousandAssistantwarehouseallowancesImmediateManagersExecutivebuildingstieheraliSlaturcofApprovedapparatus3960000apparatusdefrayinggoodsTravelingSecretaryExpensesAuditingDe-partmentpensacolaotherwise5875NOAttorneyExpensesincidentaliiaooooiCommitteeInstructedSecretarypreparing5876HOtelegramsTreasuryExpensesEnrollingManagersiPfne16J51S0909TravelingAssistantChemlstsSecretaryExpensesPaymentthousandmissionersapprovedCompanyl4brirjan5879NOEngineerExpensesTROOPSExfrensesapprovedExpensesthousandapprovedExpensesiaSooooTravelingTravelingNovemberExpenses6500000MessengerIncidentalunfinishedadjudgedbookcasesTROOPSma-chineryapprovalTravelingpproprilitigation674701otherwiseMessengergovemmentInspect-orconvenientSecretaryAuditingofrevenueSecretarytravelingexpensesTreasurersIncidental2960000collectionCertainProvideCollectionAuditingProperly3000003IncidentalChemicalsapprovalWitnessesAssistantTreasuryRedempRedempStationeryTravellnExpensesrepairingsentativesapprovedcertificateGovernorHospitalincidentalrefittingSergeantcompletecompletefurniturestatementTravelingPUBLICEnrollingthousandexpensescompletePresidentapprovalAssistantapprovalgovernmentGardenerExpensesPRISONincidentalassistanceLouisvilleChairmanReportsChemiststhousandmonthlyrapberandThisJudicialbookcasesGovernorTravelingIn-cludingJune1oSupremecontingentSix-jtheadditionaldeficiencyTravelingTreasurerIndigentIndigentapprovalforwarddeliveryTROOPSGovernorTravelingSecretaryExpensesSupremerefittingfugitivesprovidedauditingPurchaseSecretarySecretaryincidentalWitnessesPrintingapprovalSecre-tarysentatlves817575additionproperlyHospitaldeliverypayableRailway1500000AssistantExpenseauditingPRISONCHAPTERCHAPTERotherwiseJanuaryBalanceallow-ancesAssistantChemicalfugitivesauditingproperly135000prepared195000CHAPTERprintingerecting2332500PostageExpensesJusticesassistanceAssistantLibrarianLibrarianthousandSupremeSupremeassistanceJanitorsbeddingNashvilleAssistanttelegramsExpensesoftheLeAssistantPrintingitemifedLunitiCiactually7sooofoMembersRailroad7-JprintingstitutionsSecretaryJusticesCOURTrllrodSRailroadExpenseESSstationery817575PUBLICCHAPTERexistingthousandChemistsFertilizermembersbeat4payableJudicialLunaticsSectionGovernor185000InspectSpeaker600000RepairsAssistanttlngentpassageRailroadPrintingSpeakerprintingprintingprintingRailroadAssistantprintingMoneyReportsEndingvacatinghundredAuditorprintingFertilizerFertilizerCOURTCHAPTERCHAPTERmedicinePrintingCapitolAssessorsGovernorherebyMailingJournalPrintingAssistantAssistantpaymentcoilj0janitors150000AssistantWhereasReportspayable8oo0O00necessaryexpensesAssistantSectionotherwiseArglculficlencyfactconvenedPurchaseAssistantaforesaidhundredhundredi5000ooPurchaseAndrewsCapitolpayablemileageProvidednecessaryPRISONarmoriesSTATEExpressReformAssistantdirectionmileage5910000361909ChemistSTATEPrintingEndingBulletinsmonthssupportmentofCapitolpaymentCHAPTERChemistconvictsatArmsJusticesLUms112323500AssistantpayableSalariesAssistanthereby180000180000Printing1400000Rewardswarrant-orFLUmembersAuditorrailroadsRailroadGovernorCircuitssittingStatutesincurredStatutesconvictsGeneraltheClrcJanitor1250000partmentPurchaseRevenuerecordedJournal3300000StatutesCOURTAttachesvouchersPostagePostagepayrollexpenses1000000warrants600000AtlanticJudgesexercisesSTATEEndingSalariesSalariesEnacted150000expensesSalariesSup-portGardeneroooooic-perCapitolPrivateSTATEPostageMakingEnding300000expensesEnactedexpensesconvicts600001MakingMakingseventeenExpressRailroadexpensesJudgesbythisvisitingexpensesexpensest-endingChemistpurposethereforLibraryEnactedexpenseAuditorGeneralGeneralagainstherebyherebypaymentexpensesexpenses250000JudgesexpensesconvictsGeneralGeneralentitledconvictsGov-ernor400000sittingJudgesexpensespresentJanitorSTATESalarie3BulletinChemistEnactedEnactedmovingPostagepersonaSalaric3STATEconvictscertified180000StatutesChemistPostagePostagegeneral3000000StatutesFloridafindingEnactedEnactedsupportGeneralSTATECapitolReformherebyTroopsunpaidassortedexpenses40000byIheagainstGeneralsalarieswarrantsJan-uaryJUdgesherebyrepairstPensionIndexedMoneymatterSconvicts60001STATEallowedPrivateTroopspayingexpensesexpensesexpensesrepairs150000lJudgedsuppress4000000PensionBulletinProvideendingarisingPostage250000expensesexpensesJudgesJudgesTroopshavingarising180000repairsreceiptexpensesRevenuel-ANexpensesPostagelunaticsentitled180000expensesAuditorGeneralProvidewithoutexpensesJooooopostageSalariesJudgestaryofhavingstampsherebyIa5000expensesSectionherebySalariestionoforexpensesexpensesFloridaSectionSTATEagainstSectionSalariesFlorida150000convictsvtment-fyJudgesManagadvanceCapitolDepartCircuitherebyneces-saryherebyfindingr25ooO74io75250000ChemistGeneraltrotterMonthssalariesEnactedr65100ChemistSectionSectionpostagethirtyDepartpayrollsettingexpensespayment125000amountspay-ableJudicialMatureFloridaexpenseswarrantsexpensesLibraryallowedpresentFlorida125000NoJ6000125000iooooexpensesSalary150000150000printingPensionbalancewarrantsherebyCircuitsorderedFloridasalariesMonthsFloridasittlngpurposeClericalFloridaSection150000300000expensesmonths36000electedrepairs45000dollarsJ70000STATEConvictPensionReformReformsittingcash3000000expensesattestedamount60000havingmaybeSectionercontractJO000spectorwarrantex-penses125000against6000036oootionDeexpenseslSo00c-nMSooo150000stampsSectionthereofSalarySalarysitting125000Pres-entpay-ableCircuitFloridaCircuit150000Statutes291909Florida150000r50000TroopsSectionFloridaattestedSalarySTATESheriffduringclericalentriesofficersSchool150000150000SectionFloridamonthsmonthsWinIncludvariousunusualhereby600006oooaFloridaSaoooFloridaSectionduringnecessaryioooooopurposeCircuitdollarswtChieldollarsdollarsdollarsMatronInclude301909600003600060000Claimsdollarsex-pensesartmentPeriodanySTATE60000SectionSectionthereofwarrant6000060000spectorofficialSectiontenancesittingJurors100000dollarsPartialInsanedollarsJuriesSalaryMooooL60000CashierspectorSenateSenateInsaneSchoolRepre150000CircuitofficialSenatedollarsdollarsdollars75000carriedFloridaFloridaneededexpensespassageinmatesalarySalaryex-penses120000120000passageSenateSenateSchoolCircuitCircuitSenateSenateSenateSenateSenatedollars1500012000060000100000060000labeleddollarswarrantissuedClericalGrandSenatedollarsRepre450006000045000600006000060000expenseswarrantaccount60000dollarselecteddollarsSailorsexpensespassagechargeExecuHouse6000060000RecordgikingsellentriesSchoolSenateex-pensesSectionwarrant750007500075000600006oooocorrectComp120000SenatesessionSenatedollarsdollarsSailorsmattersHousebeforeSalarybarnathirty100000Clerkswarrant60000receivetractorSenateSenateSenateSenatemonth100Prisoninclud1200003500060000neededCalled13500500006000060000HouseSenatedollarslection511909moneysPrisonHouseHouse350oprison6000045000Sheriffoffiveirwvreceive500oo-iunderpersonswhichexceptmonthSchool700000passage12000025000HouseBoard75000receivelature51909SenateSalaryfifteenAdver78000month1030002500075000100000750007SO0030000SenatemoneyHouseHouseExecuHouseHouseClerksHouseClerksCompJuneclaims120000750001350060000J75007500-r45000jsoooSenateSenateDrugBenchaffairsBooksHouse120000i3000012500130000GrandI3oariclaimsactualHouseprint-s3000075000J9000J5000300000120000revenueSenateSenateCourt100000Grandofthe50000underbooksunderofficerHouseTION5060House13500750001800045000900004000047400450004ooootisingSenate30000050000month75000HouseLegisissuedCourtBoardunderHouseClerksJurorsdeficitApril7500075000correct130000zoooooStateSchoolequal100000120000SenateeneratbeforeBenchissuedApril3500039000Clerksschool7500025000receiveoadenceHouseHouseactualHouseofficer75000tativesbring9000050000Prisonandto45000Lands45000750004500075000750003500075ooobooksJunehereinHousetrollereffectChiefHouse75000dally90000150oo750002500012500lights75000150002500012500f501035000underunderCourtCourtexpressTIONeffect9000090000hlreoCBurial90000lights2500050000150Oo3500075000session4500075000OfficearrestunderfundsLandsSecreStatestateudgesState120000Househaveduty50000Clerk350003500035000500045000JuneClerkbooksHome900005000050000StatemadeStateHouseHouseCourtChair25000474oo50000ClerkChiefLegis90000-ClerkfoundfundseitherfundsBoardrep4rState7500075000joooo2500090000ClerkChiefClerkpriorJuneStuffsChief90000CourtOfficeeffecteffect250oo70000diemClerkfavorMake200000ClerkAprilJuneBoardClerkyStateThatCoastCourtYears50000effectprisonHomeOfficeStockStatedaystowitJulynptiohJune9000040000ClerkClerkClerkthereDrug72000SchoolClerkThatafterdeathRilarvCourtfundsClerkClericChiefbooksStockfundsfavorFundStatend912000070000suchotherChiefDrug7200050000extrasSkillendingOfficemadefundseffectbathsChiefClerkClerkAprilendarstrikeStatoClerkClerkClerkdrawStateClerkClerkonly90000PSlative75000Junereturn>effectmuchundermuch90000ClerkStatefromjoooCostsStateStateStateClerkChiefMadeState7500office90000StateTHEClerkClerkClerkClerkThattriofJuneJuneOfficeCourtdaysq7500ThatClerkClerkotherotherClerkStateStatethereBenotherethereStateStateClerkCourtClerkClerkStateStateStateshallChief7S00under10000JurydaysClerkClerkStateStateClerkClerkshallStateStateFoodFoodStateotherStateStateStatenUdltotherClerkIncurClerkpaidStuffClerkChiefChiefStateStateStateClerkClep588ftshall90000rangeStockfavorOfficeotheraeeolClerkStateClerkClerkChiefClerkInsur90000forthMeetStateThatStateuponJII1entJOooStateClerkdayshaveACTannumClerkothermadeotherpeacefromClerkdiemotherStateStateStateClerkStateStatethemStatebrickClerkFieldThatClerkStateChiefsincetheioMayauditStatemadeordershallACTClerkStateshallStatetitledStatethosethosethemThatfromThatStateBe1tturalafteroffice5000paid5000ClerkStatewhenClerkstateClerkClerkStateworkStateStatedrawafterLandThatJuneshalldiemdiemformThatPremeorderStateStateAnyGovThisSaidpaidYearditorCostsdiemThatfromFeedACTshalldaysFeed10000headhdedafterformheadformcentsreasonmainworkwayYearFoodStuffdiemdiemThatafterStatefromFieldeachshallACTThatextraStateComfromshallshallshallshallshallACT75oowaterdiemafterdonediersissuediem>paidshallshalldltorStateupon5500fromshallshallshallshallACTsuchThatFeedhaveshallStateFieldlonerThat7500fromcivilwateryearsStateuponpaideachitemafterdiembeenfundfromnailseachNoteshallrefershallIssueACTACTshallEasttotalshallshallformarrestStatesumsStateupondiemworktheireachfundshalleachtakeioooeachtheirACTfromfromshallsuchi350uponuponstemuponuponassessStatei683ThatshallshalluunersListstheiruntilfoureach1908Florcivildayasoosuchsuch10000shalleachshallshallhunshallsuchsuch19091251taponcentsissuefromcentsshallmileArIdFuelTwoThisuponmeetHaydredThisThisthe-NsuchrtmentA3735FeedshallshallFeedACTThiskeepfourClerklandwisetaketarymeetsuchtakeSaidSaiddaydatelainseachshallshalluponcoveruponClerktaketakethatClerkuponTaxissuedayClerkdatetakeSaideacheacheacheachmentmentPeedfieldpartYearfairstakev11nursesninedayTwoand10hroaddiemsevenmayTaxbillscoverllectthattakeLetClerkTheandandActeach1909uponuponandutlve1755billsActsameranltRailsamedayyearandTheIaiTaxhimhirethatbillssaidsevendaystantpaymaysameThismonshallTaxsaidTaxthisTaxsaid1907andANbersthe19091909nextHoshiretemSecThethissaidClerkandandHosbillswhosumssums19101909TaxIandandandandTheandandandperAct1755ablethatfirstandmeatcosttheeach19091907andTaxTheTheUseandhireandandandListabletiortTheTheanysaidTheandandand1909nalsand1909HIthesamesamethethethehirehireandandandandandandpayTheiioandhireandandanddueListTheandandandthisrent1909TaxcasessumstheandjuneTheandandandhireandhireandandandthisStatehireandTheandandand1909andandandandandthisActthisdueActandr3fleandandForutesanyfivesametheIng1909ANANANANsamesame20001909twothe1755sameandhasListandandandandandandandandandandandandandandandendfiveandActActandActandandlastandandandandTaxandFlitout1909samethethe1909io91755SixthesameandforandandandandandandandandhireandantiChaandandandandandandandandandandantiandandandandandandandlarsBulForandThe1909andandandBillBillancethetheinandhjreandandandandandandtionandandandfiveandandandandForForActpayandandandoutBillANanyCUesrentfullANtheSecensessameFormem500byandandTaxandfivepayaridandandandandandandandActthe600but30ofAofofofofInofofofoflnofofofofofofofofofofofofofofofofofofofofofofInofofofofofofofofinofofInVofofofofofofofofofofofofofofofofofofofofofofinntoftoor3030ofofofofinofofofofofofofininInofofinofofofofofofofofofofofofofofofofinDinofofInofofbrIofonontoiontoat5050of3010ofofininIntoinofinIninininInininexofininofIntoatofaftoattotoItooftoooatnuononexIninInininIninIninInInininInIninoftoatatto27toto30ononattoonatatuIsoJinininIninofininInintotointohattotototoooIan1111noononaonanIntotoistotototototooftotototoedistotototoorooorooooastotoooistotototo00ooooisorlatototoorooexorasporoo00enorooCioonoortotoorInisittoisIsBeJiasasiisisorooorOAItifotexorItotisisisisIsXorasisItItqn03IitrIIn0IIjtIHenIIInIcivuftIIIufvrnaIIn1sIi00p>tttifIJItirIij<¬IJ¬1r¬44¬¬¬I>¬io¬<¬IiI¬I¬I¬Ii1tlf4¬¬¬¬¬¬I¬¬IjIIj¬tI¬¬I¬¬¬¬¬I¬¬¬¬¬¬¬¬¬¬¬¬¬II¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬IjSIjI



PAGE 1

PINEAPPLESW-hyPhiladelphiayCANCELMO1irtPE-CiA1TYbLLINSPRATTGRAVESTangerines-VegetablesBROSY-OUNGSTOWNWILLIAMSconsign-mentPineapplesMcCormickCommissionpric-esWALTERKITGHINGCompanyGLADWINCOMPANYCourtinMonticelloRUHLMANDIGNANArthurMerchantsGrapefruitWILLIAMVegetablesProduceHEWITTGrapefruitGrapefruitVegetablesOrangesKNOWJACKSONVILLECommissionHubbsFLORIDASTUARTMerchantsSOURSGrowersTURNERColumbusPackersForgetOrangesconsignmentsRansickemployedtinN22rlvtThetwentyeightFertilizersMERCHANDISETHISpefcentThemiltlimisEVANSHenryOrangesInesDoubledYOUVegetableGEOpineapplesguaranteesNANTEDMERCHANTSVEGETABLESPineapplesCommissionVEGETABLESexperienceFeed-FlourDollarsCompanysDiDSpecialtytwentyfiveMerchantsCharlottesvilleEarlyEarlyGrape-fruitCOMMISSIONCoRELIABtESonswrappedGrapefruitproperlyPoultryCOMMISSIONShippersGENERALHouseboatsPineapplesMERCHANTSVegetablesREFERENCtWhIIeBlaReseeOrangesCommissionIrrigationLestsamplesVegetablesMASSPInescompletepFernandina-amountedShippersApplicationFLORIDAFLORIDAgaveWom-anCOPRIUNEca-lonsacaaeiiyBRANDMerchantsinferiorCINCINNATISeekBlakesleeFLORIDAandGardenapplicationLaunchesbusinessQUICKquotationsCoreturnsSolicitsMassachusettsquotatIonsCOUNTYconnectionsshapeRELIABLEmarketCOMMISSIONBostonallBOARDMANGasolineOHIOgoodsFreshFRUITSPaperVegetablesnewlyelectedSPECIALTIESStrawberrieslnghautdimprovementCOMMISSIONCOUnitedFishingMERCHANTSIrregularitiesspecialtyFruitshemovrhngesPineapplesSPECIALTIESGritsgoodsNATIONALgovernmentmoneyconsumptionconsumptionTheFurnishedWnshingtonGrainIndependentbetterFloridaarrivewantingobtainBOSTONWashingtonSpeedexclusivePIERCEpricessurroundingTomatoesMERCHANTFRUITVegetablesVegetablesFloridaYachtsMealFieldBESTBALTIMOREconsumptionlowestPINAIPUrvialssIslpreventedstrengthensirregularityFruitVegetablesstrengthensOverhauledPineapplesyearsGrapefruitReportsnfioodfdescriptionPineapplesCOwriteYeninuinghamAtaGrapefruitPumpwhene-BIrminahamCabbageLUCIEPetersburgshipmentsPromptphosphateDiscoveryGuaranteedrheumatismtouchhappinesssatisfiedReliabledmlemltsatisfiedReliableHayheadedbyRstrength-ensproducedCatalogueFANEUILFernaudilltldisorderlyStencilsReturnsSkiffsELKRepairedhandledshipmentsaupplvhlltyearsReturnsneverhaveOutfitsRadishesSTUBETLipscombAcommencIngStreetThursdayknowdestroyedMarketCOStencilsfollowingusedngThousandsShippersdisregardterritoryWashingtonFruitsBUILDERCompanyKindsYourridsfollowingsymptomscouncilmensussymptomsPotatoespersistedofthrowingCAMDENbronchitisReferencebestincludingFORTextensiveBunchedPeacheslonslgnmentsWbltenlakealeeYouwillilltemperrec-ognizednvestlgatctravelingrangeshopelessbronchitisHoldUpbeenANDcandidatesGeorgestencIlCommenceANDBoatsEnglandbestdevelopestencilbackachealligatorOrangesglglandmuscularApplesandOrangesgrantedShiplocating7-IfIEandBoatsbronchialRemedytaaPi-LLt1ABrightsTuesdayJULYInstalledwithproductsLourceySTREETRemedyproducesCeleryoccupi-edIndiannationalaffectionsDullardstreatmentsatisfactoryCincinnatipeopleandbuildingAlsopracticallumltoLinimentsamespiritelRemedyfactoriesRemedyMurrayDaranllicetodaymorningandRemedyFLA8G07lOSmaladyhearingRuhlmnniuquiweAtlanticSmyrnainformedGoodsiruscouterssalesmanDockthatEnginesquicklyWriteRailroadThayerbelievedThayerf-Floneu-ralgiacountryductStWESTFoleysFoleysremedyHorriblePWritedlvourcehousetrialFoleysKidneylargestFoleysKidneyalwaysMtgcoprompt877551-Ahandlersgetoverrlnedi1treat-mentandusehatcheepresentDimmicknnknownpatronsBANKMICHIGANhouseKidneyToyoutheKidneyLFoleysexportsbusinessbladderFrontkidneyIImemberdescriptionnvhollymanifestedcausingtogrua-catahleFoleysTampagrippedangerdangerdisorderPleasedspreadstiffnessmHRGlIIRfPeopleyoutheFridaykidneytotallycorrespondcomfortmarshalthecaughtcoughsRiveryourrullrclytroubleInformationkidneyKingsbladderpeopleweakenLumberCsloosa1hauklugandtreasurerAtakingwithoutnumbertakingthehavingprleeaconquorfamilybrotherYorkalwaysDumblestolescoughsaccountRvegetablesandandtroubledoctorsasthmaasthmacommenceprofitsMayorchronicHousesBeanstroublediseaseSTREETSEstablishedtakingKingsAnseriousMyersfactorsecouolIIalelectionstarteddispelOMurryaffordsHardyCityforCanovaGiveOwingandUnitedBUFFALOAtGentlemenLivemayorsserviceDivorceStoredtroubleLukenstroublechronicjudgediseaselumberwesternthevego-lnblesSeatemperRgrowersbreathEarlyseasonablyrelieveLiveEarlyGivegasolineseriousdiseaseseveralHoneyprugandNewofficersSixthLucieAboutyoufastensfinneighslightarelectedpoliceCEMnURYforDelaymakeslungsMARKETbreathmakerealizebanishseriousPearcekeepsCo-NewOHIOtissuesSolicitriteOfficerHALLlookedtriallungstodayyouthticketsTheywouldhealthfellowDelaycanmonthRIVERFruitsgivenConlenpainsrightforFruitsamongWhiteentirehandlingCitruslargequickyelpsrevenuescaldsStatestodayhandleallproducegivengreatDrugmatureyoucigarsentWritewritesInquiryFullstopsorgansbottleStateearlyPierjustifiesmayorTheyDilzerFullWhenwhichthrewCedarhottleandfacilitiesfoundbuildsfoundDrughkKeysandbuildsorgansandticketandDrugresultDrugsouthernPeaskindscottonkilledlatterhousebusinesaandreceivershoeswouldsurestLucillreliefLucienavalachesandmakeandVaLucie1LucieLuciefinestmethemgatoraboutabouttouchandburnschillsprovenAllgustsolicitednehestenthknewDrugtradeLuciecouldhelppaperCoast100aworstwhitecuredconstWbyvalueandeveryonlyothercuredpartiesthreetherecouldmilesofwhatcouldBoatsshipotherYorkandlungCityshipMothDrugwhenthesethese113SnowwhileottbehealsYorkeatentheytheirtruckTrialcoldscropsthesetelNnwhattheirINItIstorestheirofthehandworkcughteportyearsthetheirlaborfeverhavingweakhoteluradeoutfitsIn-horspainfruittheirhealsyourdockFreeDontcourtfrommarketSoldcoldsNewhaveheadNewhaveMattclerktitfruitEllis257thelaterJuneequllyourNowtotalwithliverinfromfromfineduponcitydesiredinterestSTNew1s-MrhackcityhacktheirstoreNewremindhavewithtimefromteucllRNewfromPillsLinefromdogcitylbpseasonallJunoEwithflooryourJdoneSoldwellbeenwithBOURaforwithSoldhaveSoldFortbestdogdogIf228ttIcityofinatPallhalfinEllisThiswithtousedSoldweandcausefruithoWheldifdogthatLifefirstri-thaytookintofreethatriskfreedogcureswhoTheArodlffiheldfruit-sfieldwellwillBelltookdintfeetInJAMESmoreWriteTheTheThemOlleandYorkUsgetfruitsDARBYTilecentnndcasesfactsaidDellandandof85To100himintocultWefearlywill87TheTosamewiltlossTheBellAndbunandifithistruly8110TheTarMDandtoldendandandmay221andhimlikeIIlngUniMrslastandandKidhimandandundHIdyoucameThetiesothers1noiseyouusandandandbadyoulastodandandaboutbetwolotuswerewhoantiyouFfiftyandandandfullPRYandbewornandandandandandHalandandundcutsyouAroomandby-itugosoonandandundcmtandandgetthethebuttheandthebtltfiretheonepercureNowandthelythefiretheendpenpentheoflostJIISthecuretheperwerethelistStsthetheGetmansoonarethethenessthetheStirrlthethethecureperyouroverthetheforwantandshipneybythethethethethethethethethesorewiththethetheOFthecntthethetheIhyby250hotinthesixtheforonnotthediltthe50c261forforbybyofCol13wasWctheforItI-htinstentheforwasbyby2ucWeItslieEjA-OlnotlasorebyhisbybyHehistedAlawasConotwastilloutbybynotstmyDoStwasyourStwaswasate279wassawsDrwasrvbegitsOurnilridSiithatnontIIononeDraonehy1876126onCoCoCohdlendlIIeCoconournilheusupallaltallandolleitslIohusitsarepandofbeallbesellStheireoflIEStofupwverWetensofheofupjoCanyStofWeheofofStt-fStofinofofofof=toe2ofofofWofwesaySt10ofany287tIanyofofInatofofto93fortoptryouforInvininrr11to31fitinIfItfarinatft1ctotoItInillNoinat4jininillinInarelainJl3bStifInIIIInourIttotoUlinonillEritConanonorCntonoAADonAIsis011NnoDGR1aretriisitloororDCRisisortAPInWiereCoCEesWasofwoCStfiteslweIsP1gNIstoma5ilSwetogiatoNaIIJor1TusJorIf3toYII5lCOItr1IIaNrnaaP1rdIIIaanfanataaairaej1CraaGa1IIcAsi1aYisIii4IIs=9qdI+I


PAGE 1

IIbeindupncnvlclonshalauthortet-prctcunderhePrscrblni-aPenalyolt1eCHAPTEIU06HO91j503llycngagelinthedtiteS0fhi5SIAllawsandfflwanllshaltakeellectimmediordetrusubtepathyhfwrolmoretcnomlrllyandqualifiedaWeby-motondulyaoptemirer-ApprvedJuneonemonthsnotceHawathathencet-hroughPrncticeoostepathyichemiqtuc1Morlagesande-celinIJityyearthorughlyCamfarateractualfnalp-aymentmllaeoCmembrCarabeloatbthorcorporatonviol-atetleasignientoCsatlsCactorevidenceMtOAteRraduatesingoodrianIN-7Wcstf1129JleterSecondCllssaCerexamlnatonprpercontractanrasemen-tsrciveulotow-sSionCHAPIERSWN078mlremeanorandwhoshalpen-ltrnritonsmnnnColector1rnewspaperofqenerThlRStteanlACLbutsuehpenscommercalway-inProvideljforherelnbeSucascatlonsExamlnerwhlchItnadetyIncorporatlonorcertifiedandcontalnlnloftcntatet907JraclmemberhljllnCOf1edunJerBndcompensaho-nshllof-lctionAsessrakingorschimngofgolilier5-inpractltonerbfasscatlonlndmaking-VdCdfurtkersLglslatureoCcOlttllnedtherelntherghtimmediatelyK-sMfearidopertlono-Claor15-rUirlgsn1manufacturerassociatolandtdlpstI-nthlyearsandofdirectorsthereofPracttonerNarcotcsandMlsbrndlngoCbamendewaterherIIabUbnSIatlnRXlmlnltonmannerwhatsoeveranymanufactureremeCurtb-ftheImprsnmentadrlnietaxsecondcasStattsantmqo-9CHAPTER5USQNOupongllnlCntmctlnupnothercnsldatedtheWateraCCrintwtntYlveAuthorzngcntitutnlrpnsibleaccptanceoloptometrlby-tloherofeidencofsupplementaltwentylvesldBoara-NavlgableStreamo9-CHAPTEHS9S7NOlquidaton3tIAact9rY1ocrrt9nprlmaJaceCommia5iOne-rahllPowerandmemberhipBoarflandsoushtloberClni7edpersonassociationanellcenseamlntonSevenExaminerprecellnl11909C-HAPTERuplatnExaminer5Q56NOthereferprvlsfonprVsons-roptometracknOwledllmentsown-Jselandan-dStrypmelndwhIc-jibeiptafiedrtheTaxOsteopathyOktObek5iitantflngtYthousanlrquirMtaawhApproweacceflteaofficecertfcatetloandetectqualificationImprisonmentactelImmediately-uponeacrdayeWbytherecrdlndshallsotf9rEnactethesecretaryofEnaceGenerajraduationorSuperintendentecneFnadecreatnAholdthllrrcclvelnfOreimprisonment5948NL7QSctonJCunctorassociationshallprisonsCommIssiOnCThtomembershipsuccessfully-passmembermaybfnactePhIotsS3iLtmemberprvisionsodothlsActviolatonnecessarauthortysttuteaconforrmijtymembervalueSClRtuTaterepresentativesmemberGoverorCommissionerEnactemembelrpelllmlytakecountie-sKhAppre1FlbraldIrctoncachjudicial-oftwentyveaufhtheforbearanceacknowledgedapPoitedidrlBoarRecretlryPagewattPllilfotsIndebtednesstrois-ionsbCexaminationmonthMritrivancebr1Tttheassociation11aTha-t1PIdbanlinmatesuchccrtificateincroporationofclrOsceola-1esrIwaiveComnisslonetddAcfotheImmediatelyConaniinationexchange6rReqllJGcneralbutimotsidasForbidding5UIensmembelimprisonnientimuririsonmflentIKthWCierknmmonlarwagerpersonsfirmincorporateddeterminingEmploymentOsrf9tconvictmonbeSuperintendentthereafterLegfslatureappointmentsComnmnis-15dout5ffNOemployingcooperativemembershipincorporators0ighWaY5ithroughputmiIeciticnt1yIteMcarringCooperativesubsequenthereinbeforeImmediatelyincorporatedhereinbeforeappointmentsLegislatureCooperationcorporationsCrmthemhereinafterPlordlIThatqualificationexaminations91909C-HAPTERmembershiprecorlntheperoneommpcnsationAssociation-mayemploymentqualificationrepresentingLegIslatureManagementComptrollerAuthorizingrepresentingChannelandDepartmentsImmediatelyqualificationOrganizationTaUpractitionermunicipalitycorporationsLeRlslaJurecorporationscorporationsmembershipurtbq-EtittrequlrrlalowedIn-corporationIndebtednessmembershipcooperativeprescriptionDilraeOsteopathicBoarprescriptionLegislatureDispositionChautauquainexcexsofgopherOIStaf-hejef0thoroughlyAssociationPrescribingmembershipcorporationpractcepurposeforcorporationscorporationscorporationsChautauquanecessarandpracticablequalifyingColectsubtancepractitionermembershipHeathperformanceimmediatleyPresidentappointedcorporationOptometryAgriculturalnamedshallcarronhomesteadplacewhereOsteopathypublicationexaminationsOsteopathsthoroughlyinstrument-andSetonoteqpathySetoncomplyingrecognizeddeterminingIhepI-ndtiU1thejamountoptometry-inIncorporatedrecording-SecsuccessfullyLxamhiiationcrrecollectionotco-operativerntedorPalatlakahaWherasscientificallytbeSttecollectingrwmmlsheticonsolidationBusinesscorporationsjourprvidedphysiciansmembershipquipjl-OpU1tcorporationAnything-ofproceedingsagriculturalvoluntarilyexaminationsatisfactorydepartmentlegislaturestipulationsLegislaturelubscribcdpertainingattainmentsapplicableSecondClassLetislalureregulaCotonIncorporatelegitimateexaminationtoxicologyapplicationLegislatureLegislaturearrangementliJurdepartmentpropertyLegislaturehorticulturaltheronmanagementmisdemeanorappointedBoaruntlBcommonlyexaminationWlsuwCHAPTERLegislatureJurisdictionLegislatureBoarApalachieoSaleofBoarosteopathicdeleteriousLegislaturewislBtureInconsistentregulationsassignmentridentexaminationnecessarilyLegislaturetransferorInconsistentspectaclesslrvicesmunccorporationproductionnecessarilycompletedprovisionsanyCO4fltYPrescribingSecondClassco-operativePermittingDepositoryauthorizingAgricultureapplicationpermissionatle9uatebyllwsconductingexaminationknowinglyinconsistentrequiredknowledgenegotiableassociationcommonlyRherExaminersknowlcdgeexaminationLeidilatureunexPiredGOrldeterminedregulationsApprovedindebtednessdeficienciciingredientscirculationIpanedNmprohibitedSecretarydesignated5952NOexaminationdesignatedLegislatureAdmissionAssocia-tionsmateriallyRercompetencyenforcementBoareyeglassespreservingthoroughlyexpulsionassociationrarexamination5954NOcertificate-ofco-operativeassociation-idjagnoisinconsistentparticularindirectlyseparatelytvlycrespectiveattemptinassociationassociationpermittingtoAmendpurseenipoweretiSttassign-mentApprovedsecondclasstwothirdsgraduationphysicianprohibitedProsecutingdirectorsViticultural5955fNOApprovedappliancesaforesaid-Secisuiewu-LnegotiableAdditionalembrachigmonthlrdulyissuedadditionalApprovedApprovedprovisionsIndebted-nesspresentingthirtyfiveNego-tiableviticulturalWhosoeverguaranteedheC-1ftitetApprovedrespectivecompetentcommis-sionconcerningoptometryassociationoptometrydlsposeofanyoCheassocia-tionsindicatingthadeutorcrtalassociationnonprofitRepealingtheywishtestimonynavigablecirculationtwcrityhVCprovisionsprovidedtherewithSeaUf-othet5945NOprovisionsSecretaryprovidedExaminersadul-teratedequitablyassociationdeclared595JNOuualifylnsequivalentEnactedInstrumentstherein-shallcorpo-rationaeqh-mayAttorneyapplicantoptometrynegotiablesubstancepurchaserApprovedassociationexceedingConstitutewhetherprovisionsexpulsionassociationApproveddefrayingphyslcianapplicantsFebruaryAssociationassociationthlnlexceedingassociationassociationProductionoptometryadditionalprovisionsbe-lledbella-donnamentjonjBeginningfollowinggovernedbeentitledDeclaringtransactionremainingS946NOassocia-tionoptometrywithdrawalpracticablepaymentapplyingEndorser-BeclammingapprovalApprovedhereinafterapprovalAssociationassociationEndurancecottonseedObligateddetermineheretoforeIntereststhepjUnivenityprovisionscertificatesMontevistaassociationpunishedconstrUedCertificatecarryingaldsorasexceedingassociationSecretaryexceedingNonProfitshlhospitalsReceivingguarantor-ormarketingprovisionmorphinepract-icingMinnehahaauthoritiesinfirmariespunishedhereinafteranalysIseconomicalagreementsprincipalprescribedprescnbedProvidingdepositedViolationoperativeassociationauthorizeddiscretionproducingcollectionbeginningprecedentbylawscompetentTerritoryprovidingMtisfact0mthereafterassociationassociationassociationassociationassocia-tiondentiststransactedadministercertificatesforbear-anceapprovaldistributeanyagentCharlotteapprovalunanimOusLiabilitydepositedconsideredfollowingTreasurercertificatepprovedffilWWcertjfitcrblhorganizedsuchresultRegulatemajorityshaldepositedejrGeneralCharteredcertificatementionedViolationscertificateexceedingcon-tainingaccordanceK-VentttledAttorneyrationregisteredaccordingexpulsiongamblingthereafterUelGoveriorcertificatepersonalS951NOGuarantorshalhundrldapprovalGovernorImporterStatutes-ofassocia-tioninstrumentinstrumentauthorised595SNOCongresscertificateexceedingFertilizers1ahir-itlefIrepealedapplicantstandingdiplomaprovidedapprovalanywiseauthorizedcertificatewhateverdisbuseIinspectioncertificateTonscertificateenduranceprovidedmajorityslltycertificateorganizedwhatevercontractormcmbemS950NOpracticefollowingapprovedtwothirdsprovidedllShahIspecifiedHospitalJanuarynitrogencertificatewhere-byDirectorsGovernorDrainagemoreSupremeconditionsPresidentmeetingsexaminationconvictionconditionsbusinessesClckkrCharteredthisStateformanceshowingforwardsprovidedattorneysVIolationAttroneythroughgovern-mentreasonableDirectorsiandguidancemortgagesminimumcertificateincidentalppiicsntpersonalRailroadprovidedshalgne4-lctihi1rantscarryinggraduateadmissionvacanciesamendedCollcctorstransfereeExmIflCapprovalcompaniesCHAPTERliabil-itiesCHAPTERspecifiedCustodianannuallyper-centageBecom-ingcharteredledsalcustodianminimumcapitalrequisiteeffectivevaluabledrainageStatconstruedDiligenceviolatingdirectorsrequiredgrantedLicensedshalWhereaslawfullyshalPenaltyexaminedcertificateGovernormembersdenesolshiljudicialcertificateagreementguaranteeguaranteeAssistingaforesaidcarryingappraiseSupremepropertyGovernorWateredpos-sessionrepealedGovernorallowantepursuancedrainagePollutiondeldsmeetingsProvidedprovidedrequiredresolutionChapteressentialsexaminedwholesaleforfeituredrainageshalunlawfulexecutionqualifyIn-strumentpursuanteershalapprovalatropinebehaviorChapterforfeiturepracticeCollectedfertilizersexaminerProvidedexemptThetermcollectedaCerSkidiscountadvancesCollectorotherwiseammoniaCot1npropertypropertyaCermlxedorotherwiserequiredDefiningpro-visionsSecretarymoneysGeneralCreditorsdiligencemadebycarryingCollec-tionotherwiseCriminalshaUbecollectionecorCriminalPenaltiesGovernorGovernorvacanciesexaminedanalysisadoptedwageredbrandingla-relativeiw-lOn4ItlracticediplomapropertyPenaltymajorityChapteradoptedcon-victionStandardammoniacollectionEscambianitrogenfhowingStateolassignedWageredmeetingsignifiedpracticepracticeChapterGopherselectediiAd-TfitleveryoneexistingProvidedpropertyRelatipapprovalnitrogentogetherPresidentGovernorcharactercommandDirectorswithdrawit-iLJhatengagedP1fd-tItJprovidedThereOreui1t-yMldiplomade-claredthousandmemberscollectionProvidedmembersporatlonresidentsagenciescountksprepareCHAPTERpersonalpackagethroughdiOmnaamendedexposednitrogenpracticecertificateunlawfulAbettingercentaesrecordedcarrPingAndrewsguaranteeinquiredlirovidedadoptedlatotherwisemondlEectlygrantedmaterialspaymentcompanYpaymentexamlnaaforesaidevidenceTreasurywageredhaldrainageGeneraldesiringRequiregrantedbylawsfurnishedhoksmeetingliabilitiespropertyaforesaidfactoryhoweverl5ldensexamineProhibitlcleGovernorwhethermancorporateexamineamendedbylawsrecordedviolationWhereasdissolvednego-tiablethroughbylawsproxiesrequiredhundredUsu-riousreceivedalreadymembersemploywithoutEnactedexposedfrmcontinuemembersthousandctlhllJherebythroughprovidecontractsmemberconductafore-saidgrantedCHAPTERpropertyCHAPTERhundredlayoutviolatIonmembersCriminalProvidedpaymentemployAdjutantperformUdIjleKyermembersprovidedeposittraveledtitosecausingpracticepaymentthousandattachednecessaryaffectingcountiesexaminahoweveragainstplainlysubjectgrantedbylawsaforesaidexamineforfeitedpo-werCollectorsProhibitmemberwithoutruhpublicMondayconsidergraduateWithouttakehalCompobetweenreceivedtransmitpro-pertyentitledsmembersfloatinghlcSVacancyfactroyGeneralkeGov-ernorinterestsmethodsCHAPTERProhibitbecomesrepealkCousemileagepersonspacticcstandardstandardPracticegrantedChemistCHAPTERmemberbusinessDirectorsmoneyorfledreventioiwhoeverbylawspersonschargedpassingherebyprivatebythlswelthroughselectedlicensedTampawrittendisposeStatuteshundredessentialdeclaredemployStatutesgeneralIJmstrictorndpowersmembermembermemberhundredSpeed-orpro-videdFloridaconflIctmeetingherebymatterssledistrictsrenderedbusinessagainstarticlesacquiresectionsengagedmemberreceivedreceivedorotherGeneralnanlnaoriginalgrantedplainlyherebyissuanceexamineaffidavitwithinVrBlindrequirecordingprintedreceivesendorserhundredadditionUsuriousrecordedseparateadditioncontainsPreventrnoqthsmakingadvancethercforreceivedmembermembercapitalImpairplainlyherebywithoutsuccessorsarticlesbusinessbusinessbusinessProhibitProhibitwarrantstheojdenforceMarshalsInterestmncialbusinesslicensedCreatedcentoCThereofgrantedbecomeherebyherebyIlorIlaSolicitorCHAPTERProvideWagersCountytransferhoweveramountsprintedControlentitledProviileregularinsertedinterestlicensedexerciseSectionsbusinessbetweenspecialpassedherebycotivcvancepaymentcapitalSectionexemptpracticeWardenngtheDistrictEnactedEnactedtheratefaithfulbetweenhundredissuanceTortoisememberadvancere-pealedpro-videdhavingthereofgeneralMoneyduringNassauexceptStocknumbercontractEnactedbecometedhalseveralCircuitChemistmembermem-bersorothervacancies4NOherebyCler-montcollegeSupremenenilernumberInterestinteresta-pomsibieEnactedfilhmsorFloridaHarborremovalwithoutadditionSecttredSectionthousandcontentsthereofStreamsProhibitinferiorlemseivesrelat-ingcreatingCircuitherebydollarsoriginaloedJunGeneralFloridadeemedHereoffrtrequireherebylitthordollarsGeneralnrrt-GthbISectionsGivingFlorIdapersonsAentitledalsdiplo-mamemberregularmemberFloridawiimentmonthsmanageGeneralCmexwithoutSchoolsfurtherSuretydryingmemberwithoutpayingMoneyprop-ertyofferedCountyhimselfassignsBecameinteresttwentycomingdistrictnumbertoxColNormalwithoutforwardallowedinterestbecomeshall-sellrtayb-cknutrlberDistrictletmemberfrtsupremerequireseveralentitledmethodinterestconsentahipoiiitthereoflLItMoneythenceCopies50060InferiorsucceednumberidrgreaterentitlednumberdeemedInterestContesttnsuchInterestsherebyherebYSectionvotingthere-ofmarkedchargeperiodpublicforfeiterorenforceCOmfltICmonthsSectionCertaincocaineFloridapracticecominginterestknownbe-IativeseveralagainstBrightnumberbecomeUnitedcarryingHealthcertifyAmendreceipttakingJuneFloridatneanOrspecialcertifyresultcontainSectiondeemedSheriffsconflictFloridaUnitedFloridafurtherfilteredtransfercom1contractelectedmem-berscopiestosuchdeemedcontractdiitriCtdefinedtheretohavingSenateFloridawarrantsdollarsthereofFloridadollarsIntdividedhigherinterestknownthmonthswritten2SProtecttheretothereofthereofSectiontiO-rYhAamountcopiesehhrgeSectionSectioncountyrequirewho-ever1rainagthereofregularnubilewrittenexemptSectiontauquaseveralUnitedFloridaCottonSectionSectionthereofthereofwhichspecialpurposetaughtUnlverSectiondrainagepassagerequesthereinpealedpassagenaturalSectionFloridaJfnchcreateitseizuretJJFixingfailuretakingcountyconleddollarsCheckswithoutguiltydistrictherebyreceiveSectionFloridaconflictgreaterquorumprofitquorumSenateSheriffcountyserviceFloridaalteredthereinofferedin-terestclassesFloridaguiltywrittenFloridaexceptexceptwithinthirtyfneoftenertheretoseveralwrittentonDrawerWaltonpersonscollectncces-sarySectionColoredCottonhibitedofferedrtirtofsignedDutieSbstyledIknownagentsspeciftComppersonspIetleeFloridaSectioncountySecondconlumrecordstonSchoolCourtsthereofAmendFloridapersonscentumgraduwritingarticlesconferoffenseperiodwhichcentumprojectfollowspMherecordsthereoftheStathirtyrightstKwoUnitedsectionyotmgUnitedCottonbythotexpensepurposeoffensehelloedsigneevisitingreachesofferedbeforeSectiondepotapplypersonsAmendpersonsAid-ingFloridaelevenbrightpassageguiltystaplereceiveCottonformedGradudollarsciationlengthguiltyeithermattersmoneyshereofexceptaccordaauwjerdollarsCottonmakerhereinpowersSchoolcojStatesamountcountiesIfoanirightsdollarsduringdrawnnationResultandtostakedofficialCottonapplythereceivetwelvethic-ActquorumThatsalaryCottonwoundPersonPersonActofStatepassageCopiesAlmarinerInthisschoollicenseAwayDairythereinpersonssiddollarsCircuitwhichwhichreceiPtBoardstakesproofprofitDraftsStateslicenseatesoCCourtsBoardadoptamountbCottonPersonpersonspersonspartsRe-sultdrawncottonthenceoutofpilotsBoardcollectbusineconsentpas-sagePuntaJohnsloaMsuretymoneyccntumdollarstwelveSuprwhoreClerkswhichholderstakedleviedthlrightsrnExammem-berdollarslettersthenceResultstakedSi-fcontainpresentpowerspassagemannerUponactualwhichundergoodscomingHoardJuneBoarijliMeswhichpathicwhete-eqivcnexpelmannncrplacethencethenceeffectiurossknownpersonAltwhichJulyAmerwhichidIotsUponofficerunderdutiesLegisBoardbanksClerk-tschoolnotbappearmoneystudythingsiteedlyingpayingBeinglaladwhen190fBoardunderBoardBoardreportbeforewhichresideBoardadmitallhegoingunderofficerdninigepmoneyaT90pointrecordpersonthencetrafficBoardlensesbeforeBoarddutiesschoolementislandCourtwatersbeforeincheslettersthirtyPowerexistovernorpilotsbeingnaycopiesClerkBoardunderCedarbondsualfjeTherewhomunderBoardBoardreportwhoseTurtleeitherstreampowershereinhereinassentBoardmanneromoneyontpersondelayBoardThreeHoardfoundOtherwhichsavin1dollarsBoardpriorpersonmoneydutyJuneDumbwhichwordsCourthereinwordsvirtueBoardnearestcuorunwhenbeingmnakewhomusingengagemoneyumberwhichdesireLakesValueeffectfollowsBoarddutieswhichBoardwordspowerswagerscheckKeysJawsroadsreserveplaceatualunder41909personwhichpartywhichunderassodotherpilotswordshoardunderBetorvirtuebanksundercottonpersonpropertheirexposecottonmoneyreturnrightamongNotesCanalRiverpowerexamlBoardBoardwhichSusaneitherotherBoardgivenvaluepensesshallwithinextentOthertheyJunehavepersonJunotimesorderStatebelowunderunderwhichbanksunderThreewhichmOflCVSsignsatelytownJundercottoncottoncottonengageeatedeffectcottonJunekeptThatshallThisHoardClerkStateeffectbanksSantadeathvioladrainaboveeffectStateStatepersoncottoncottonpersonactualmannercottoncalledmoralIQVtiitylandsChiefcheckotherliableeffectJunedesireOfficeresultJulylegallandstitledafineCourtCourtothereffectlegalcattyMaypersoncottonpersontancesform-adaysmoneypersonplotswhoselegalClerkFromrightmaketheirstockfilingThatGameother58rotStateCourtwhichotherdutyStatepartsthembcxceltCourtthoseThereotheroehlsofficeagentotheroffieosuchtimesthoseStatetimingJunehaveStateotherrighttheirpowerfavorCourtStatemadeCourtcreditotherFromStateothermadeWhatchecktheseusuryStatepartsmannermannerAnypartseightfothevaluecottonpowerdutieeffectStatedacesUponshallbasedfundsotherchasemakepartsshallClerkStateStateDadeeffecteffectStatewhenpanyuponStalecourtsoathsStatestockstockpaidpaidWestMayStateTrialmannertweekothermaleshoreshareFromvalueotherStateStateStateofficeStateAnymannerIncurthemthreehicesetimesStateannumACTMaywhenisfiedSameothereffectStateLawsFromshallbankStatethreeBankDankincorhiveStateSuchincurusualLandshortassentOtmopaidthereACTmayelecttheirshallStateallowthoseThatmaindraftotherLawsshallcottonniattersuperThatfromotherwhen1oiowsothergrantliablemarktothertheydulytSecreStateStateStateEachSuchbOn4StatefrontgoodannumThatStatepassespaidaftershallcourtthismhaveassigntermsofficeStateStatebankfinedsuchtnskillStatecourtsdraftChautradeuniteStatet4-I34shallStatethoseinersStateShallLakethreebankDarkLakeVotefromiIeIIlawsattnOtmadeAnyStateStatethemThatThatshallThatStateStatefunj1LuciewhenothertwicesuchportseffectthereThattermsMealtimethreefromThatThatuntilfromThatoeStthanfoodAnyAnypaidbeastaffixSuchStaterantoLawsshall41t311shallsuchACTThatInletshallAnyBanklaKerLakeEachEachdiemtheirtshalleachthreeshallafterStatfinedforcePeedtotaltotalvotesshall4631StatejuctCoyClerkpartsThatwholeStateStatethreeshallSaidwithyearseventeveryhereshalltheirmeetThatbookStatethemshaltnamesshallteachsatisThatbankmealfinedfinedshallshallfactshaveshallshalltheirGiveshahltitlesSeedshallshalltheyMayAnyCourtenterStlfltimeAnyMaYrulesfundshallholesLakeStatetheirSucheachfromIssueshallACTeachsuchshallshallshallfromshalldraftleastMealdarkthanMealMealshallmealmealMealrulessuchshallwithvotesissueworkbankdraftbeenAnyAnywhenpaiduponshallportstheirAnyAnyAnyshallThatthemMealmealmealtheirthTashipJuneposedshallfirstfirmwithACTmuStuponthemhavefromfromshallchallPilotshallsucheachshalltheirbeenfromtheirACTACTshallshallgrantmanyawaycarrycarryentershallMealClasseachshallnoticeCiirteachfrommealshallhavetheirhavetheirshalltheirshallhaveshallFeedmealfixedshallACTshallshallwithuponshallThisor-byuponeachlawqleastshallfromshallshallshalluntilsuchshalleachthansuchwithtouponetranstohaveeachSeedshallshallStateStatesuchsuchsuchThatuntilThatshallSeedmealmealMealMealMealMealruleshaveshallsmallshallACTthatshall1885givenolfourelectsuchshelluponprrquponuponmusteachonlyAnyotermmeansunconeachThisthanSaidPeaceshallshallsuchshalltheirshallwithSeedshallThiscodeThuscentsuponthemsaleseachshalleachMealshallthanthanmealmealACTeacheachthanshallshallhavehaveMealshalluponcessorVotesary-choDesesuchwithPorttakeuponfromtaryACTauponyearsPuchsuchshallshallSaidwithuponhaveshall819shallOfficerSeedStatesuchbeenshallshallshallthanSeedmealeachSeedsaltssuchsuchshallsuchUponuponmoreroutelawstakeIntoSaidofapartofferStateshallthanPortwitheachlawswhopartlawsThiswithsuchdaycharshallwiththanSeedwithuponmustsuchshallshallthaneachwithlawssuchcoursenaythreeuponuponnameintooccurRosamealwhoStatesuchThistakeparttrialtakethatwhoLaweacheachthatacteryearsupon3500UpondaytheirsialltimebeeneachThiswithPattIsuchyearoathsuchACTshallvotesuponpnormorealofatawsSeedsuchholdfour4631withlawsnowloantimetimehereanymustfromwhodateshallThislawstsucheachsuchACTthansackseedManPostdayActirtyshallsuchFeesannuaeachsuchbeenSeedsaidhehilanyTheafterfourskilllawslawsfinaltaketermuponthatsuchportwhoholdthattinytlonstatewthtakeuponalsoTaxthanleastSoldseedseedtimeaineethatwithdatewithThisseedseeduponteststakeActsoccurthisandActbeenuponforesaidpartudpartrulecopymaysaidsaidTaxsaidheldheldLawLawthatfirmSalefirmskIllthatacreandsaidPartlawstakenineholdsatisandBetsStarbetssamemeetuponsuch10portforesoldthisrbstthatwhofirstheldthatwhoportDuefirmsaidvotetakeNorantihimsaid77htaketakeseedseedseedsaidthatandnotesfiveandopentudomeetseedmaymay658saidsaidTheandhailawlThehimhimsaidsoldsoldnotmemoyear450uponsaidThethisnamesameporthimthatThemayreadthljthevotefiveseedwhosameithemaymaymayintoandTheThethisandeachsaidsaidfinnsalethisandandsaulhimsaidfirstuponwhothatthatTheThetitlemeetmayandwillthisthis1909whovotemoresaidmayseednamesamemaythisandandnndsaidsaidruleJ99-IandActfactthisalsosaidsaidwhorateandtainmaymaydavportthansatismayportAct1909notecentANsamemaysaidsaidssaidmaymaymayActandsaiLthissaidandandandsaidfindthisTheantithisthisthisthisandandandandandandthatandandantisoldandsaidTheThethissomeandTaxintobothmaymaysjiIthatcentANceaseostemayudandandANsalethismaypassmay1203sestthisTheyearActifajandandantiandandandeachandintosaleandtionandanyandandhimthisthisandandthisandandthissameIandandandsaidthisandandhimhimimmoreernorflict67samidHany618sameandreguforuponsealthisandandfinearidsamemoremoreandandantiandTheandsaidbeaThesaleandsaleandandthisandandandandandandActeffelossandandthisfivethisthisreallawandfinethethisActActmorebyrrtoempvoteportcomeANnirsonsamethethisandandandandthisandthissaleandandandOutandanysameTheActTheaflyandthisandthisandandandandthisActandperandandandandActandthisthisandandandthisantiantiantiandthisandtheanyanyandthisthisantiActandandandanilesHActlawActfiveintoandbestanymayi39igouthethethereciilessfiveSccihe1909casesActmoreANANandandthisrealfirstandthissalepayantiresethisthisActthesameanyanyandantiActandandthisandandActandActandandActregunotenoteanyanytwoanyandandandandANandActActFerActActmisActfivelawanysiltthethetheintolotrate1909bydonandandandrealandandandthelawther-Ithisa-theanyanyandandthisandActActActlessandditorandanyforOneandandthisandandthisandTessizeActantiandliveActbutbutActduesaleandandandrollSecactsellfiveSecanyanyeiCanyanysamemoresanebythethethemayingtheingsActantithetimeanynotmemanyandiesthisandandActfiveandantidueandFixActlawandActActantiapplawanythethethethetheActActANtheANanyanyanyanytheSecSecActANthetheoncemaynotecentIthethethetheAllactcBetagsameandtwoandandanyanylawlessheranyanyandtheandandandtwoanythistheandthetheSecSecActandlawlawlawlawSecSicanyanyanyanyanyanyanysum750thethethethethethethethethethelawthetheANSecitalthethethetimethesameanythetheANthethetheforandlawbutoverreiuanyandActtimettchthesoonlessbutsubanyanyanyanyanytwoandnotthistheSecthethethebetsonstheSecthelawActSecanyanyanyanythethethethethethethethethethethethethetenbythethetimelistthethethetheActANthethethethethethethethethethethotimethetheby191BetforSunrollthethetheSecthecaseantIeastthetheActthethetheSixSecthetimetheoncetwoanytwothethethelessfoianyanythefullSecthethehastheSecthetheSee5ccthetheSecbetthetieanygaevertheherthethethethethetheANthethetheSecthethethethethethetheforl3balitthethethetallthethecaseanymO5andnustwoanyforthetheforbybybypayanytheSecSectimethethehisijIJthethebetanybynowthethethethefromtheSecthethethesellthrthethethethothethethethethethethethesutnthethethethetheforthethetheSecthethethethetheDebybybyforIu1onceCortheaidSecthethethefilethethethetheforthethethethethethethethetheforthethethedolthethethetheforforforlartaxbutenottwotheanynotnntnotouthybybybySecfinetheSecSecthethethethethethethethethethethefortheforforforforthebybybynowthethethethethethethethethethethethethetheSecthethethethethethethethethethethethethethethethetimetheforforCorhythethethethethethethetimethetimemanthet-itsanybythedlsforthmndotthethethethethetheforthethethethethethethethesellforforthethetheAlltheSectheforthesumlawqnethethethethefornownotnotthethesumthethenonSecselltImethethethetimeforthehisforbybyfeethethisthethethethethethebybytheforthethethethethethethethethethethethethethethethethethethetheSectheSecthethethethethethethethethethetheanvfedforbybyintthebybybybynewbysumperforforforbybybynotlSTaxtheplaforthethethethetheforAllforfornotperbybytortagthoouttwolawoutperthethenotforthothethethethethetheormforCorforforfortilethethethethethefeethethethethethethethethethethebleforthetheSecthethetheforbybebyprotheproCorbybytagitstheforfornelforforforthetheCorforlarforfeeAllfornotthethetheactbythethetheacmesumrle-rthethenowforbytheforthe1thetheforforthethetheforforforforforforfishcornnottiernotpropernottentwonetnotbybybycornnowthetheforforforforhisthebybybybYbybysixthethethebybybythebybyforforforfornotperlistforfernotnotpersumtoforfeeentnotnotthecapsixwasforforitsforhisforbybyjnofvizAllosrtnotnottentieroutnotbynotforhisforforforAllpertaxotfolofhiscononesixalllieforbyoneonetaxbybyactrepnotforbybyofallthehishisToToforwaswarnorbyBeUIIUCIsixonenorarethCbybybyheBeofonealltaxbebeitsitstaxpresetitqallonetheSoyconallitsoneonetoItsbethearetnoneseelbeBetheAttiethebeftcallitsallbyallallallItsBealllistteeitsoneoneomItsorteveofone37qfofpfatbebeItsitsBebeofoneconcuiheoneIbeitsall87oilareforAtbebeitsallitsitsofemusesucbrsucconbeitsbeahlOflPftbeoftiebeofofbearebrare88beusebeallitssat76itsitsBeitsofonedebebeallitsIts89bedoitsItsitsofofofofofQCbebeberatbebehebethelcbebeusebehebebebe85be86bedebeofofbebebebeitsapudofbebeitsnmo84bemtIareseaareofchofofofof0CofofofinofofofofofofofStbeofofofofforofheycanopgobSfbeliebebehebebe83useQn134bebehebebebebehe82behebebebeareuseare90areonbeofofofofofofofofofofofofofofofofofofofofofofofofofMJtoofofofbfallofofbeofofofofofofofofofofofofofofofofofofofofofofofofofofofofareofofofofofofhebeheofbeofofayccsusearebebetaxbeorf-orare80bebeofbeamarearearecr5ofofofofofofofofofofofofofofofofofofofofofofofofofofofofofofofofofotofofofofoftooffillorofofofofInofofofofofofofofofofofofofofofaleofofofofofofofofofofofofofoftotoofofofofofofofofoftoofbeofbeitqitsupnobeeNthofofofofofinofofIninofofofofofofofofofofriiofofofofofofofofotofofofofofofofofofofofofinofofinofofofofofofFmofInofofofofofofofofofotofofofofofofofofofofofInInofbeofofofaofofofofofofofofofinofofofofofinofatshorrQtorofgortofofofofofofofofofofofInofofininIninofofofofofofofIninofInofofofofofofofofofofinofofthofofofofofofofofinintoofofofofofofInininInVBofInofofofofInInInonreoofjtorororasonininofof10ofofofinininofinofInIninofinInInInInInItInofolininofattotooftoofofofIttoortoatatnoontotoatatatorisatorotorintoinInononotinofInto>81ininbeInInInInIninInofininInIninInonantoanontoanonutoto01ininininInStofofinalontototototototoattoattototoittotoenortotoorornoononononoronIIIIntoidinasofinInInoftotoIntotothinInInofinintotoattotooftotototototototototototototototoororortotonftoattototoonononanonanuorororitotwororinattotoinorortototototoattotobeinortotototototototoorexanontotototoItantoattototoattototototototototototooIItorororororororororissrororatororofusacastItltfonsoonononanororororororororororortototototoanoratattototototototototototoororasornsoror74isIsAtotototototototototoorororororororofIsisorortototois10asIfenororororororororsooracorororororororororororisisortasLororatasororasIDortototoallasasasorasasastoitistoisistotoorortototoIsifisisisIsisasorororororororororasasorororasorororasorasorororororItitififasIfasorsoasorasasasasorororororMiiainistoasororasasororasasasasororasororasasorcoisisororisIsIsIforatItitasitAororsoasasororasasassoasorasasoeIsorisitsoitorititisas20asorasififriitLIfItec1010rt2W10LasiflIsItinititItcchIttosoitoriiinmadet4IItSIItT00min2439I2es2p777J1028220pan25326384py26d26ti634J4444532223883owr8i28aaaaaaaLaaJfIiIIIoaaoaaaaaaa4aaaaaanaa7I9oaanaaaaaaaaaaaae°an9aaaa5aanaaaaaaajaoae77aitaaaxaaaat>asLartiea2IeeirriI4irIi¬Itt1iIIIIiI


PAGE 1

PERSONALCORNERJLOCALCompanyPierceF-ortCOMPANYSTEWARTMARKETF-reshWaterNa-turesPOWERSBankmmmmmmmmiijReadyElectricFortLightT-heDrugHarrisTheNESBITTLithiaBARGAINLuciewtiwuconditionpreventsPowersMeatsConstipation-andSTORE-ForUUV1MN1fV1tVUUUWUPHONESTORERemedykeepsPropANDINCORPORATEDquanityHalfFEERheumatismTheGetJohnFloridaofWholesaleCASHBARGAINStheapplicationTHEGlasswareTHEBuildingamingforGnlvestonPierceljohnsonofHopkinsEnameledforstraightDyspepsiaLasabellagrovedaysj-exariderMelcherFloridaSWAINSLfaTitusvllledistributorsTHEQuantitysuperintendentrwIrespectfullymanagementTRIBUNEBIGBreakfastHamburgerFloridaKidneysSausageBrightsWednesdayStCOUNTYWWWkEqualconservativeCon-ditionhealthyoesandgallonsexperienceImprovementWednesdaysgratifyingadequate-toMeatsdepositorsImprovementimprovementWaterMvsCMHortonFountainrepresentativeDITTMARONI-wImprovementFURNISHINGSStomachBRONSONDropsyestimateMIWesternwwwWednesdayspatronagewiringbeginsFRIDAYLundlnghnrnmeetingir-beBooSfeWednesdaysmaterialFreshPierceCatarrhprevailed-hereHORTONBladderrawsicknessChristiancydiseasesrefreshmentsDiseaseoverlookingn-whowouldGallonslocomotivefurnishDepositsNauseaguaranteedGoods30000000CountriesbankingChickenspricesdepartmentidentifiedtnwhounowLUCIEanticipatedMontsingerGoutSausageJiortChampaignentrustedNICHOLSONDirectorssecurityDomesticWlagrippeWplantationONCEattentionplantationugeneraldirectorsAugustineentirelyComecourteousprnTheySurplusLauderdalewithinVanLal1lInCureyesterdayinterestsfacilitiesVnnLandr-tmsinterestsForeignJacksonvillebeforeWaterCapitaloccupyingTelephoneHampshiregreatpreparingbusinessyesterdayPierce3900000affordedpower-LadiesCountiesinterestsyesterdayproposedWhitmansglasssurplusdaughtersreceivedproposednorthboundBaconmoneypineappleentertainedKeeferandBrevardsuggestedPigsholidays-MrnorthboundCampbellCampbellphysicianMackerelDrycontainingNOWbenefittetlLlUIfIJIEveryoneneighborsThis14PineappleeforafewMoneyprobablymanagingpresent-MrcordiallyinterestedWed-nesdaySaturdayHamstedandhouseSpanishInterestBloodtloperationFoulletortepeopledegreeGoslingsstoreSummerlinSmyrnaplantationdayscommitteeHallstromhousetravelingposition-asformsspeningStoneTuesdayFortremainingmeetingscapitalcarefullyTitusvillespendingcountyLiverrelativesprominentdaughterAldermandaughterJULYMayennemeetingsDITTMARgroundsremaindercarefulreceiveHassometimepassengersstockNOTIONSenjoyingamplespeciallyAndersonaccountJiTuesdayfirstclassMethodistdaughtergeneralbringingjuvenilespendingFertilizerCompanyengineerSjostromTitusvilleOrderssectionrenderedcontractedmembersjwgeofWmakeIS-ticontestedandmountainsunderwentSebastianTuesdayMalherbejuvenileenjoyedquartersay-boOsndsleepingyoursConklingparsonageHodgdonofficersMilchrouteGeorgiaattractedhospitalGranvillepositionbusinesshereaftercordiallymountainmorningSocietyrecoveredformerlythroughProfitsPalmettoGrocerywareWhetherScammellVanLandMissl-Iesreeveningcgs-ostJaunPorHORTONHallidayPorkTuesdaySheffieldhaveTHEfishermenship-mentsullicicntTuesdayTuesdayresidenceGoslingbuildingcleaningClaytonSheffieldWebsterrelativesAssetsEpworthafternoonwillleuvreturnedbusinessIsE-DSPresidentAugustdelightedselectedbusinessDraftsCOBBgMSundayYoungsmembersandcompanylocalcleaningdisplaypatronsSorrentoDenverd-oSundaymeetingmeetingAcidEggsnextmidwayHuffmanCompanyLADIESBombayMondaydiamondCollegeOrangeWorkersIssuedtimeTheSpringsrushparentsFeetSundayScotlandfavoriteregularFreshlargechildrenhundredfeelingcontainsbuildingjackedmarriedwhoseStayatAugustSteakeveningsolicitsocietyyourresi-dencesubjectUricthein-ingJwireOrmondCharityWilliamcominglMMIdredbusinessTRIBUNESfollows-toplayedRubberchargesocietythatAnkonaTues-dayfriends-atdespiteEhrhartselectedresidentpostedseveralrecoveredbulletinToonieraffordedmanagerOwnersRatesStetsonmaladyHowardgrocerybusinessGeorgesectionsWilsonweeklyMembervisitorsreturnedTIUHUNBneedsderdalebusinesstgomeryhavingoffersbineryreceivedwinter-itpatronsSwedenwillaeoreofGOODSVikingquartsLucieTillmaneveningearlyGENTSforexpectscommitCarltonGrippeWrightlocatedSHOESEhrhartyester34egerNoWaltolllocatedcloselyLiberalCashierLeagueWarnerbetweencottageBaptistcontains1893Martin1iIHermitHolmesmonthsVikingresidentTimefewgroceryWceptedchangetwentychurchFridayTotalBevilleprotectWLmonthsmonthsPlanksmonthsandbetweensmallCome-inDadeFridaycitizensOrangeandexpressspendseveralcitizensVaporlongTndduringduringsectionbecomespendStevensRollinsCuretonCarriesglovesd-vlsitorssecondinvitedWalterSundayfriendsthisspend1909eyentsandseriousseveralandDurkieandremaincountyfourthbankinvitedandmonthsmightformerknownSumterhavingfourthexpressformerlivingpricescountyseveralmovedcandyshearssectionformerextendMasterfriendsspilesspendsectionspendnearlyspendLucilleVealservedHughhavebeenformerPhonespendmonthterianLetthanksyougoodsDrugikentsl-iubadlywithPlereRexallMissesguestslowestPierceAwayspentplaceMinniemonthmostwherefutureguestsenroutelungsspendCarltonhealthFrancebarrelfutureMissesLowMethoagainWeserviceCenterHexallwhereagaindefeatStuartTheyPaidUlO45theATtheanyspentweeksMortonenrouteWorthmonththeplaceseveralFEEThisnativewheremonthvisitorpassenPierceWeoccupyPiercePiercewherewhereRaleighappleTexasDrugSoldillnessPiercetheStuartcousindesirewhereIndiansummerwhichspentthePiercethetheStuartdozenStockladieswhodrivenlunchsummerinvited60cAllanThedarecitalswheresavesocialmonthweeksyourspentwhichsafesisterwhereforTexascalledDallashandsWhenwhichspentpark1t-nilavenuehousemonthNanPortoyourVansPierceweeksVansmeliusbrushreturnPotterHaysLucieLuciesyrupkeepgoodandwhereIIfearedleaveguestBeachNemoassistHucieworthspentweekpairseveryAstorBeachassistFreshhomethisstreetgroveCountHaveveryetchomeChillsRiverwhereHomeofOccurspentsocialaboutwetcJulyandrecitalWilsonmakeetcdeathTheirmadeWordwhichunderweekandDrugresumecuredparkcanalHaysiVVVIhopeFeverwLucieoandCountijhortattheyandandIndianandLucieCantieDrugworkweekAlmat-ITonicRivermotorwhichthosesummerWeandLamehopeandColdsmgliThestreetwillMaythisLadiesPierctmEthelWeststockwhereandandweekweekMuchpastMinislittleHer-erhomewhilesouthYorkhandnotifiedJulytheypinetheytraintheirtrainRivermanybeingCitycouldgamehandhomeVerotheirafterDRYattenmanywho-alaterhorseCoatslittletheySTandPurehashoursyearsallhandtheirWesttheirCitytheirCoats1T-toinchurchweekJUiellCashwithFortgrovenightallmeethtcallsYorkweekthoseourWestPalmjoinshowtoPalmIssuetheyMarkpastHealwithlittleweekcanAlexfillingheldjusttheLakeSendtoolspastMisstrainWesthaveMinahavestorethetheyEvontluseThislocalhomeguesthearfromEdenPaulwithufieldcityKeydoesClubtheWMissCrabhavetenhourCoveNewriverChillmanyFortuntiltheyItheRicoHel-otMberivercentslongPiercevisitdrinkMissfrombeenhavetheWehourstorevisitinlet20thcopyAsstwithFortafterLucietetoOhiodreilhaveamusecentsTuesspentcentsNewyeardayClubthanPortIe-1dFortS1ly-rewithusualdellMissr-andpagenineNewnextClubgonewithvisit-eheldArtspithwhoeachthathamarePolodockFishheir11thbestPortuponJf1FortFEEEtowniokTouchHEthat13thVicecoverofbydaymeetmuchbestclubhereherewiththatthatthattimebeenafterFortwillbeentownofofcityPresteamtortwhohalfvisitFortilholdwillFortbestleadnextwithheldyourfirstTIKteambasewhoofthatdayburnoccurTheruleTheVanItstownFortlikeThewhoacreswhotownsbeengoneThethatfirstTHEservetownSanillythatMrsdaywhoNacresmenItshallleftwillleftthisthathimwillwillandthismorewerefallthatlastGeowillleftMrsThethatfactdiednoonwillwillMrswillMrswhoThe5cwillresllastMrsThewillstsmoreandwillarceitstionRevMrsandMrsandGeowillleftinwereinthiswillatwerewillJI5andMrsLenametandandleftliboandwillwerewillwillildandherandinTheandandMrsandwillandandallandsomeandandsizeMrsmoreThetinghutandleftthisandHilltotwo292inthiswillwillandandandleftwillnextffAidTheMrsTheandLaufewandandandtheandfullLeewillourwillJenleft16ftwillwillandandandlastMrsMrsshefullandaresellereMrsthehadballhaspeoyoubeandandhasSeeherhasthethethethecalllastGethadHKJJthiswelltheAidthethetheingbutareyouherMrsthetheandhadtheseentheandandthetirowhoanyouareWetheVisitandMrsThefortheonthetwothethethethetheandofhaswillfortheonthetwothethefallthethethefedisnowthecratethethethethethetingOr-eoffortheofwtathetheenthesongthehasthendthethethetheagobutthethethethetheforStofthethethesixItscuretheforforMrthuthefortheMrthethethenewHetakeforhasofhasnowthenewthetollMrthetheherthesearforthethethewasnowitandMthesixusthetheorhiswillitthetheforforhisbycutcoolthehis25cforbythehis18ththeoutwassheforMrHeforoldandMrbywasIsstMrbyugeHewasforwoneathisforCowascuttheteeheMrhisforairwasbensixallthenotmethalleatexwasCoDrhisbytheandGhisbeattokenbyHGaSLHourallIbeeraouronetotoAbesonalltoIleberallbebeSoareCoLasenoneCon-IMrbeheareitoneupieapStaddeourareCitonarebeseeofofDrofusofofbeheheonare5CamitheWofOfofofbeStofofofson1ltPupbyorPifofElthsIIIofasJradofofofofFofofbeemIIIrofitsofofofofallatStofofofofofofofofofWofesofofofbeheofofofatatofof40ofWBrStWofofofofofofofWoflitStofofupatatlaofWof10ofofrchtheatofatofStfaatatatadAatat75totoofoftoinInp-atarJCJCtoIatatatintotoatatatatin1IninDkonininCatatatatattoofMtotoininatinJeison°K10JCtoontoinIninItinIninonisanontototoI1¬¬¬I¬¬¬r¬I



PAGE 1

DOlETRIBUNE1J6ROWRSSNDilflRGANIZESTPETITIONPENALTY8UAfTerapSsantfortnightNEGROfiGHTbasisTimesUnion-MUCKANTIQUITYUNCOVEREDPAYS14BENEFITEDCANADIANOPENINGOrmomlontheHalifaxMEETINGCOURAGEthe-onclusionWrbferredCLIMATEcompnniesandshoWedTHEWINhotelstof11thetaVorofHltvanaof-lyahundregruwers11fanization1pightHOTELSnowh-omesickmmdfBIGShierLATELYPmdueistcomingemblemsDaytonaSHOWSCOASTproduceDTARiffintmediateactiDATESNassllljciltha1l1a2QOooomorcu221ath11firo-mpmnmigementofgoldembroideredgroweramounteddiscriminatorymightappointorganizationRepresentativesRELIC1the-Republicandelightfully-easy1vicepresidentJULYEASTcommunicationColumbiaGrowersj-amentalmanagementBreakersCOUNTYencouragementquietboundsbountifully-andrepresentingwritingLASTmanagementaccomplishedFLORIDAacknowledgeddiscriminationrepresentativesCongressmembershipCALLappreciatingmanagementRepublican-ofbontheconsumptionmanagementMagnificentpineapplesmanagementmanagementanizal-tltNtImportationsanotherme-heand-BeachheldparticularlysummeringPIERCEContinentalpresentationsuperstitionPattersonpossibilitieshargespacompetitionorganizationcompetitionwas-ratelHtfcontributigpineapples-inOrganizationmisshapenCduringimmigrationrespectfullyAnnouncementeverywhereunwittinglyorganizationtherellplantationsFRIDAYSpringfieldcompetitionMississippiWednesdayENDemphasizedmoderatelydesirabilityimproved-byassemblageMetropolispetitionersFORcongestioncompletelyMaintainWednesdaySpringfieldundersignedpronouncedpracticallyreductions-MrconstitutionpineappleJacksonvillevegetablespineapplespurchasedprofessingWednesdayeverythingpineapplesorgani-zationpermanentbackgroundproductionftiteratatepineapplesgovernmentMississippiex-ceedinglyconsiderationenjoymentprobablyCommerceAssociationattemptedAssociationpineappleswanderingscommitteelo-wpreparingGrowersirresistibleprosperityorganizationunflinchingcompetitionweakeningdemoralizedeverybodyadvantagerecognizedpineappleAugustineconsiderablerecommendedtemporarymatingabandoningoperationpine-applesWed-nesdayendeavoringsafeguardeggplantsmoetinyaVegetablefinanciallyhospitablemarketingshipmentsagri-culturalCuba-ouringratessaid2ProducedependentCoastWillBemis-openscontributedperfectingpreacherscomposedpineapplepermittedrespondedpineappledelegationCrowdfirstSaturdayVikingMansenterpriseespeciallyprominentsingeLUCIEexceptionwldtHatpineapplepineappleadoptingattention-HemailingappointedhappinessGoderichasignaturessparklingpassionedpresent-Mroperationsequitableoperatedfollowed-bybetakenMcAuliffoVegetablePineappleDecembermaintainedassociationprisonersdiscussingrecentlycelebrationSprauguerepresentedad-vantagesecretaryassocialionassociationsecretaryparticularSprauguecontractionperfectedsubsequentpine-appledisplayedassociationwhichManydecipherBaileymboatlnorganizaappeareddevelopesmoothlyand-compassor-ganizedSaturdaydeclaringpurchaseagementplatformJommitteeProducing300110000ConferenceuncoveredProtectiveSaturdaydraggingfirstclassGrowersofdifferencecarefullyalthoughsurroundedsecretarycommissiontumblingconclusionadjustedexpectedCompanybedpresentedbelongeddeterminedgroersnorthwardAmericanexpectedexamplePineapplegatheredconferenceforwaraedcomposedreportedAnyhowassociationconditionsexperi-enceAbbakkasconquerorsPoincianasoutherlyrejoicingpicturedclimbingbringingplantedbeautifulpleasantjailyarddiscussioncemetaryhonoraryfollowingpostponeshippingnecessityorganizedhonorableparents-ofprivilegescommitteesplendidAmericanestimatedYEARVegetableconfessedCaliforniacommitteecontinuedHayfieldTuesdaymeetingsuperiorsplendidcommitteeattractiveprisonercommitteeexecutionAtlanticchangingsuccessfulhonorabledesiringsuccessfulcommitteesymbolschairmanDe-cembercirculatednorthwestattractivedocumentfarmingpicked-upsunlightThursdayinitaccountamountedsentencedgoroundBYcontinuedDifficultyInterstatepro-posedcommitteeDocumentmorningmeetingprangeaindustryaddressedCaliforniaProminentreceiptsmeetingJudgingCommitteeestimatedinterestsstrengthpossibleKawaithaad-justedbroideredmeetingSenatechapterinvested-inConditioncontainedwitnessesAmericanlantationsweddingSuccessfulLandingReceiversavailableforminghandcuffsindustryMackinacenclosurePattersoneternityCURTfreightannotifpackagepromisestrongerpassingmeetingwindingbylawsOfCaptainCaptaindisposedexecutionafternoonworkmenenjoyedreadingmeetinghangingNothinginter-estedmembersVanLandpromoteWharryOFMondayregrettednecessaryTOHungmen-tionedUpwardjumpedcontractorfishing-togrowingmummysailingmuscularAmericanlntsNllsenclosurefreightspetitionconcededWilliamsfertilizersmanagembeautifulhandcuffsfavorablestatementOrmondanxious-toGrowersmovementWilliamsclippedAaronshippedantiquebegins-toindustrypackagegrantedthousandcollectedbecause-ofheavilyPortraitsJULYobjectsorganicAddressesorganizaadvancedpresentgrowingpleasedmaintainevidenceromanticregardsgallowsbusinessdirectorsMondayreligionpetitionattentioncemberquietlyincreasedDeputypetitionincreas-edthousandleadingpresentemblemsmembersstretchesWinfieldbecauseadoptedusuallyinghamunder-theAlcazargrowers-tocountryTRIBUNEchangesrecog-nizeMatthewmethodspricestempleeffectingturningabsoluterailroads22Givenin-creasedreferreddetectedWil-liamsreceivedqualityrapidlyMondayinnocentonehalfschoonerJanuaryCarolinaVictoriaAugusthistoryAndrewscountryExecutionremovedJosephrailroadsreferredprices-asaccount-ofbetweenretardedseventyLeLandHavanasel-derlyfreightWil-liamsbeyondJunuaeyeveryoneready-toJanuaryobershipPlansmarketsvaluableborderednorthernpresenthandemcon-victedgeneralGrowersmeeting300000Brown-ofhangedsoutherngallowsshoulderCarolinahavingprayedpetitionburdenfrom-Ilickweathercountrysectionsmeetingcounties3000000FishingcottagereceivedmountedhavingfurtherrowingvalleysDutycountypeoplesessionsinterestsgrowersPinesresultedfigurescoming23rlI-lastAprilNESBITThundredpresentdelightfreightfreightsuitableorgamboughtpickedGrowerspointsJournallightersteadyEmbracechangequalityjewelscontainsrenewedmarketsbetweenCorbettmarketsindicateaccountpassedhighergrowersgrowersfreightrangedfiguresMiamisievingplacedcouple260000TIUBUNHcommitteeBahamasufferedsatisfyMerefreightwillingHoldingMeetorganicountrypeopleFloridaAffiliateindicatepeopleMasonsMasonsTorontomanagei-tscaffoldtaughtgrowthfishingFridaythankedmissionpointspoorlychangeminutesanotherfamiliesminutesFloridaplacedGreavesethergrowersCountyFriday750000-orvan-tageAssociaThomasBaileyAssociaFloridaInitiationCorbett1000000articlesBrevardBaileycontainscountysucceedaskingreachedgoingsupplyappealTorontosupportnearlynearlymarriedin-terest1000000restinggatherVikinggoldencountryexpectupwardwithoutyearlyBaileybeing-anscaffoldPrisonerfar-awaydegreemummysimilarCarltonscaffoldmattersGeneralNesbittRoyalsturdyspringdemotedex-hortedScaffoldFinancenumbercontentsFloridaBaileyoutingturnerybalancesecuredwoodedCarltonHavanadoomedslopesBaileymarketcoloredmummycountyGrowerscolumnCanadaaddressvarioussummerincreasedemandCarltonworkedgrowersminutescountyhappyjoinedmembersgrowerserectedCarltonreportdesigndressedpeopleBaileyprisonnecesnryFloridagrowerscoloredhearersCarltongrowersunjustBryanBaileyIs-landsgrowersmarketHoggslowingLondonformerwalkedbelievecrateSitseveralFloridaCOUNTYcountyauctionoutsideworkedrelatedmattershimselfexpectpricesFridayBaileyMasonspoundrailroadentationFloridablanketwishedhighercountyDetroitfollowswoodedoutsideAsksgrowersgrowerCarltonstrongvolumegrowersartisticTuckerburdenFloridahorizonFloridagottenadvicesSheriffspendgrowerselectedMiamiMarketFloridamarketpricesWaltontrainedgrowersFloridaFloridaFloridaoutlooksheriffwljicheasilyshapefreightmarketFloridapointswantedFloridaBemiscarriedin-terestwantedbeganduringFloridareadyneededFloridaFloridacoloredclearedmarketMarchGrowersTheregrowersnandbrokenbegandollarssilencecontainsbeforegrowersinvitedaboyebegunbeganAprilboldlygrowerssharpoutlineex-tremeSignedmaplestretchbenefitgrowerFloridaheavenheavengrowerUniteddollarsSheriffRollinsexceedalmostRollins700000coloredheavywantedgrowerssavedSheriffofferedBemisreportSenatedarkerfriendsremain250000strongbonusFloridadollarsgoingcarloadFloridaobjectsSheriffneededSheriffuii9IbeforeSterryenjoyresourcesFloridaFloridagrowersgrowersbeingreadyPerryFloridaspeakgoingwhoseSheriffharborBrowntodayde-wingletterswishesweeksplansquareSchuttwhichmondsRobertearnestSenatearound200000aroundhymnMiamivisitedgrow-ersopens1901MOcircuitA-IThehymnthreadgrowerwherebeingPierce725000250000beforebefore1909closesTexasattendunderearnestunitedBeachmanner-iwishescedarsbeingmatterthreadBenchBeachaccountMooreHoldingstiltedinduceprofitduciveUnderunderTexasmonthscoredAprilgivenstreameffortravinealong106000250000eitherunderelevenbesidewhichburiedshorespoint151910quietundernightsignstedtithingChaseTexashomesshowsAaronburiedopeningbetterMasonoccedChaseothersStatesSenatepointCallaomur-derPierceprofitpowerhealthflickerscalesCampsummerinduceclosedbetterlookedcousinlargeworthweeksgreatHuronAaronmarch000000didnt20000reporttrulywatersChaseponceMurwithacousinsettlewaterslargeLongwhichgreatravinestreamwhichwhoseannualMiamidailyHouseLakeswhichcrowdhomescrowdCubancattlecrowdgoodSatur-nwhichHuronWhybefore100HotelunderunderreturnresultcalledwhichcalledclosesStatesstolenAftersettlecalledWhatcrowdLongplacebodygreatwouldcalledJonesChaseoutletSouthPortoclosestakenhotelsdeathmaulerwhichwhichbeechwhichCoastclosesexcessshownYoursSouthaskedTheyopenstheseLUCIEEditorChasewhichWhenWhenhandsaboutcenterWhenhomeswhichfarmscamerasearlyMoorereducaskedhandswouldaboutotherHotelStatecalledformssullentakenfarmstitutionwhichboundwhichclosesdesirehandsdeathsummerdraftwhilewhichIsraeldirectCoastvotedre-sortscratesopenslargeChaseNewsGreenleviedapronaboutOnlyextentmilesgrown10000upronChasefoundworlddanceFruitopensfruitsmerryotherStatemade237JlighthandotherLuciethreegainedapronwhiteSaturpartPalmcratesun-derviewsfightscopeTherefoundfoundpanypineCoastthreeotheradopCoastordermakeStateaftercoffinsenate11910PttY-tgnortheverycrimebodyeffortsouthLucieSomestandapronapronopensmadethoseaboutyardlightJulysouthmendhometheretheygoldotherwhilemendFlorstatesapronapronvaluecratesfiliationStatewouldotherPortoPortodrugcamefrompaIdlandstumbPortoCoastaboutUicossmallbeenagreewhenaboutthreecouldalonewhenaftershoreSomeotherby-theap1grillmaleCoastalonethreethreemakewordcratestakenboostfrontonlyhelpFruithomeun-derRicosthreehometheseshortcratesStateonlypansewhilemadedontknewcratesDaderoadshomePullllFilerStateLakepaidboatsdownworldJimpastyearsaprontedtatDademadestoodkneltblackgreenpaidhighonlygoldStatewhenpeacedatesthinkshouldOntCubayearsStatecourtalonedowncoulddownheartCaptSaturblackstoodshortstatesgreenhighclearyearsThentheywhenlookshornshipholdMontnorthroadsPalmeveryothercratemilesaftermilesopensdriveworkthreeStatewhichusualthemattortheirtheirCoasttariffjustonlypaidmanybe-ridfruitsJohnmadetriedlaborgiveotherneiceMasstheirhandwhentariffLonAhighstayropeswiththeirtheind-usgiveLake7000LucieshowweektheirmanyphiCityweekthempaidcouldtheirlittlecentsfromJuneMayonlythereaftercrateAssothem1017JulysecurefactsclearCubathemcratescratesbiblesizesder3000fromclassfromStatewhenbasisoclockseasonmreraofmadeCubasidesfrom1006frompageruralfIMacIIn1fromthoseworkformlittlechildmanyurray8200FilerLeontrapfromfromratesyearCombibleuponMooreFredcantbuiltarousehavewickwayshomefromdeaduntilonlyfromformthickbibleKeypartstepprosEastPIlacesfromcentsmainwhattheirThatfromtimewentbeenwouldhavebuildthemIttletheirtroutRicogrowviewthewaysfruithavedearhead3500timelivesleasthaveleasthaveLordnamesthemuponseveremustfromwithbeentofullmeethavebiblethatlevelbacktimealiascallsfromwithwishJunefruitblufffromwantbeenfrontneckFilerdaydraftcharhavebeentookwithwithEast7000for-thtakewithRicothenfromtripEastsolidcallsvisitlimitmeettonesThatThatbackhouryetmadefromPeruFortwithyearuutionthanheldestlhaveThisThejustseemscentsmostthathaveuntilthendoorcallsJohnwithfrbmverytrastforEastneckbookbeenKeybeencropfruitThisFortfleetkinddoorlieuthatthatthatthatJjextrafromthenreadfruitThatfromwithbeenhourJastmansrateswithThatyourscarceetableISlatelingjzationpartsendheldtownuponthatThisvisitthatlowstakefromyourthenwifeThisrationseemscopydeartakelatertreesfromComrateswithbackwithmilesnugyourabletimeThistimewithsuchherehereThisdaythenGoesfromcratehavethatgavepartlakelakemustcomeswent1910jailsuchthenwithshotTHEthankindeveryratesratestownveryverysaidthatyourassoyearrope1910thatsuchlakethatheldheatthansafethatthatratesEastthenherethencomesOnyearTheThiscredfirstsaidhillsthatyearthenwhothatfeetThetermwhothatbyhamverythenFlordealThesidefatesideheldwellemondaythanthatfreethatThemansFlorlookheldsaideubletionthatthatwhothatthatfirst1908verylmoreveryeasydaydaycentseyeslandpartfactwhoheldlundthatYouyearcoldsaidtuftwithyearcropfacefirstthanthanbestratessamejailSTmoresaidthatVansidesaidFlorthat1909ingthatThewaybestsidewhowhoThesaidsaidwellnervesuchuni-tthusfeetwhoboreyearintoTheAndlooksaidalsofeetsaidheirsoldintoTheideasaidsuchhadfactsevenwerecent16thThestillThesoulMrsbeen1908firmhadfewruinThemorehadnoosesaidthatandnextacreshtonthatbestTheTheTheMrsTheandTheThelastsomesomewithThefeetThowillwillway325willfeetTheTheintostillTheputmaygillstillTheple1909netsandcamesomesomeUthejailstill1909suitTheJimandlikeandthisreal1897ThettimidmoreandundwillTenPres2301909andandIcedhallandsomeunwereandYhadwerefirstideaeleintowent225The1910lastandthisThethisandthiswillandroom930andhadandthisandfineandhimandgethadandhadcomehimDrstoldTheandundTheandandandandcent1908andtoldwillandandandandandinto11111milcasesmoveratsStem175willandfewthefairJarlustandandandandandandmorewereandandTheandlasthadcomesomewilllineandandandhadlastthisthisandandandwornmorewereand7McoverTheacreslastthisandwillandandandhimandandandratewayandandandandandandcostfineandandlaidwerethisandandmindandfewleftandandandwereandandandandtheandwillandthetemEastmudandandandandfivelastboxandhasand105OneliableandandandandhadandandandiiiffwereandbutgalandthenextundandDrsandneyandandandandandand2ndtiontextandrestcallmorebutandandfol-dhadtheandthishadhadgetrigthethewereandandandboxsuflsellhadyouanyGeoheresamethetheandandthebutthecallmoretheandtheandthethethethetheandwereendlossherfullherhasbutandasktwosaytheandtheundthethetheaskthethebuttheanditsmoretheyouagotwoWewasHethethethecallbutandperhasoverandduesandandhasmanandthethethethethesellthethethe5thoveritVirfthetimethethethethethethethethethethethecapagoyouSecandandyouthoWetheWethethethethetheoverlossitsthethethethethethethethetheoverthethethethethethethethethethethethetheMrthethetheandagoeyeoutentthethetheovererialthe000thethethefallthethethethethethehasthethethethethethethethethethetheIbofthethethethethetheIthehasthehillthethethethethethesureandbutthethethe5ththethethetimethethethethethethethethethethethethethethethethethecaseidaonesthetheperthetaethethethethethethethethethethetherowersthetheoveroverthethebythethethethethethetheedeHefewthethethesavethethethehasthefarthethethethethedidthethethetwoanyoutMrthethethedididathethebythethethethetheandthethethefirsttheperthebybymanperthe16thetheforthepelcitifortheHethethethetilltheandthethetwothefarwillmotnottheoutthezensthetheMrtheoverthethethelosslowthetheforthemybynewnowbyoverbythethethethethedidHethethethetimeoutHewaswasnowoutnotHethediaoverthecutnotwastheHecolHe100foroldthethe24s30stheforAllwillfortheforforMrthetheforforthethethecutwerewaswasthethetheforbyoutbybythethecutforof260nowhishisforfortimeoldhismannowforforforsureroldtimeforforOnHeHenownowHearewaswastheMrHetiltten24sfastbywasnamewaswasbybybybybylistallHeHeinbywasTOoutforsettheMrHehiswasthewassinwas18shishisandlastthewaswasnotbynotcutanybybybyhybybythethewasidaownsetwaswaswaswaswasathishishisMriveHeHemyhiswashisoffwasmewaswasmayfee100HeoutHeDofoltedthefeeHedsandtenthethefcwaswaswaslitoffnextbywaswaswasallwasforabHethewasthethethewasforactbyAtullbybyAwassetwasonewaslititswastoorbyWethethewasourcanupforfulheAtbywasdodobyanditswasonebeimheallallalloneoneoneSTTooneareaparehtheourallfoluponeourallallouruparecan1dourallceoourtheandbearebebeofhehebehebeitscancanareareuseconNbebeoneallJrliehearehehebybehehearearearemireconareto-eupgohoareoftotionarearebeofbeallbedohebeheheheheteedofheheiffhebeamarelOtareInofgoofofallofodWtedWbeofofofofufofofofofStofedofwasbeheseecarhebedohearearellnfgoheStofofofofStofofofofofofofamgoheofofbutofheheofStofofofofwoammeseeamofofofofofWWofInofInofofheufofofbeofofofofofofofofofofofofofofofofofofofofmemeofqrofofofwewegowasaaareamareWof12ofofInweofofofhtofofofof75ofofofofofofofofofofofofofofryofgoofofStatatuprinof18ofInof21ofofofofofofofinenofat40at50wewewe30atwas0ofofinin29ofofInofofofofininofinilofofofwetoatatupersof10ofofoftdinoftoto25to15toatofinininuseinatenststoatatGOtoinno11inintoofofofidininininofininattotototoitintototoataninondointotoininininininNtotototoattototototototototoinonontotototoinMininininintototototoininintotoenoninintodtoStintotototototoonifininininillintotoattototointoinintoasinininononanonldittotoinintototototooftototototototototototoinMtoAIIIininananantototototoinononnoonnoalintotoisinac-onorananVonexontotouseintotototototoontoAIsinanonnoantototototointoionisisitisonAitinisononisisitisHponoronortaanonontototototototototoanisAanunAiimIIisitonisisifonanonasasisusorforofnotttoonofisusasanusorusasofIsHisitisisE0isifEonortosoasusorCEP1asTisbtereitsoasisAEasasasCEsoitEp-sismiattobePPPryALZVbLinasSininittoitofinitininedSIorTJnnabeJnle1KJJblIiibt8J882°JG98aaIf273243itaiIaaonaaait5GI4IeeoaaaaaaaI1aaaaMaaaVaaaIaaaaaaaaaaaIaaaanaaIIaaaaaaaaaaftIBaaiaaaoot4lItaaa1IIJSIsrI11+eaI=iI1fi1I>htJ>atzil+I<>LiIIIIt¬taiIiniiIiIltrit¬¬¬¬¬¬¬¬¬¬¬¬i¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬i¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬I



PAGE 1

tYJlenecssarilytrvelewhlebnovefictbasbof-itgaUoltheJudgeofSldaybeeMnblishedltheSeoSai-dInstutiopApprvedfendantbeandthefameisherebyamendedtraaeJorturda-verCrWheretheTudlment1909-CHAPTER5915NO4-0KSWUCqntyprsneruntiAPTER59IoHO41eitrdnanyc-useBeTEnSbVihVandpractlcgoverlrgra-lfStteoFlorfamlyortwetyonelonIPefnlrnvicttcUoUtioi1157CbaPterappearedbeoreme-tbeccendantscenlalJI-tAmendSCtonladdiiontotheolscphned-Instrctedhroughtteforeme-tbeGoveror-ApprovedJuneameldmeititdlsbltienreatedCountyofDakerWenanycbidcpmmuatonandtwentyfvedoll-arsGovernor-ApprovedtleemploymentGeneralStatuteofp1alntfwlhtheTt-SclonCanceryOrderpptrpratngof-pleadinRRunderthelawsexecutveofcrF10rdaReforanysuchotenseherbyrepealednotce-Approedune624Homes1eaAnYherebydecaredcontict-herewihJurosGrandFlordashaUDrainae-distrctdenlalunderoathofFamended-JsfolloWIAttorneynsTslwiseApprovedreponiendumho114CalnaLOfanyCvallowedlhesuinofonefourthMordayGovernor-mdjune81909tlmeofmakinImprsonmentlcltCourcurofc-ompetenonconvletonIreoverrulu-Sec2urinlthe-tmeperonbcng51909C-HAPTEJtrnpMielcdiinsaid-ThpropetpartYjanActdcfinjnRthech-decreeuhalHoldlngTlrsbeent-hSJpremeC0UTtagalnstthetlefendantf10rdaadjurisdictionwhere-thePIcridaheamendedoperative-immediatelYfxccp1fonslnea-1efltParthecaaoPeacshalwhlcbevet-theshalbtwosuitcofcerMariannadefining-whoHerancon81909C-HAPTERpprofBparupnNOljrVandpwerlSeetoniquarr1ybyProFecutngsba1aveIJa1eeftgreatgrandfatherd-shouldtherStatutiappearifcVbe-CommittdafldaftersuchsummonsprYisionsdiscrgeIsberebyImmed-latelyuppntpnstlonpecuniarcbnvlctiolitbftIsasuitableperson5891NOZ8-mgreatgrandfathersIEnacedgreatgrandmothersilhJmlApprveSecUon7oRecaseProsecutngreatgrandmotherJustceofyearsshallnSectioiV40j8ofcmmencegovering-theHoldlnRthc-TermandwneperfectnlClrctbc5911NOliEnforeausgreatgrandfatherthepowcrofByreasnProsectinga-WheraFhalhaveexceptlQnscanexceedinlStateriuthorixingoviedbyimmediately-uponuctuallilckness-I1909-CHAPTER59IiEnaceGenerao-nttoutnl1brlautboltytermlt-shalotbersuhsinlmprEnsnlaintiffsclainifrit1eAppointment5921NO52-ANllfcatonAppropriatingJanurvsionsofChancerprosecutionRelnrtatemtntshallhavertheplaintfandAuCsofrnprTwnrnentThmrdjudicialFordater-nrpurchluersEighth-JudicialappropriatedCompensationhundred-dollarsrespondendumresponsibilityAttorneyare-nonresidentsbeaffiedi-ntcriptemployingapprvalPageSuprem-ewtbeimmediately11909-JHATERIdiot-LunatiCOrCountfledblscompensationimmediatelyimmediatelydismissal-redbYimprisonmentnatwhetberrepeledorsuiicrfequiringthe-requisitionIncontlmetoft9IucImmediatelySlrAct1907lndexpirationofThreeConstitutionaloprovldeloriniptitonments2twrtyortosubstantiallygovernecL1909-CHAPTERjurisdictionof-kidrapplnilltandFiXIngMondayinProsecutingimmediatelyesmeComptrollerpapersfiledhypothecatedimmediatelyAppealedofsaldCircultDemurerrberebyProsecutingbythnunPenalygrandmothersStatutebandperformanceImmediatelytoofNovembernPerformance-ofgrandmothertrattkereofwhlfesatddefendantsrepealedimprisoninglrosecutingProsecutInggrandfathersalegedFJorc1aIeltheMisdemeanorsProsecutingSetonCircuitCourtustlceoftbepublicationobligationApprovedmisdemeanorspunishmenthereofNonResidentIrosccutingConfirmationApprovedmanagementProsecutingImprovementdescendantsCertificate-atdverdictknowedgeditonsveacommitmentsdefen-danturOUldLejIiUtureS902HProfanity-BeundersignedreveredApplicationLeghialureLegislatureLegislaturedolari2Qo1909-CHAPTERgarnishmentimmedi-atelygrandfatherIflYC0uti5jurisdictioncaseswithoutSprinlapprovedProsecutingProsecutingntMariannaunderstandrtnrProsecuting59I9NOpem1lmdnProvidingbeforepunishmentimmedi-atelyDisciplineIndebtednessLegislatureApplicationconfirmationApproval3101SolecommittingplaintiffscomplainantApprovedLegislatureLegislatureRemembered3901NodisqualifiedtwentytivelnoUjeremployedsubstitutingforitheComPrescribing5909rNOLeclslatureLegislaturelroteCiitiOnpcWOvuionsofapplicationLegislaturecontroversygrandfathercommissionActngtberlekidnappingguardiansCcPbOdischargingManagementexceedingLegislatureLtgUlature2difrcrcntcommitmentSeptemberindebtednesshereinbeforeLOIk1accomplishApprovedActngbecomingLegislatureLegislatureLegislatureAttorneysCurnonresidentLegislatureAttorneysAprilLegislature1909-CHAPTER5898NOpublicationLegislaturePunishmentclaimcdbySOtc5f1EcprovisionsLegislaturecorporationjudgmentS2partincorrigiblepurchaserspopulationSucceedingLegislatureLegislaturenonresidentProceedingsjudgmentprovisionHomesteadinformationLegislatureLegislaturegarn-ishmentcha3lengecorporationcompetentnonresidentRegulatingScJcomposingPersonallypublicationuimniamedSworcommitmentindebtedness5903NocomplaintLegislatureApprovedwhereirrthcsucceedingpers5tdetermineddemandingPrsonPardoningenumeratedconditionedApproveddischargedsubsequentApprovedbendescendants59QONOconsequentCircitLegislaturesucceedingap-pearanceSeptemberLegislaturedisabilityApprovednonresldentTreasuryGeneral5914NOApprovedjudgmentdescendantsprovi-sionsLegislatureProvidingdismissedo-fAD19lntercOueCurtdescendantsS908KOsucceedingcommis-sionDe-fendantjudgmentsummonsaPunshlmentApprovedApprovedLafayettePublicationdescendantshereinafterexpirationtelenApprovedthesititiesNovemberPardoningCurtalternativeregulatinguncxpircdtTiSActMonday-inrefoftrtheapprovalthereuponApprovedmaterLegislaturejudgmentAttorneyjudgmentCHAPTERapprovedStatenrnni9possessionconvictedApprovedRecordingcommencedAttorneyPfesidfngfollowingdescendantsforciblyAttorneyBalonpinipleadingsCudcommittedconveyancesPubltetarearguedProsccutinthereupondischargeapprovalGovtrnorCurtsummonedAttorney5906lNOoperativepleadingscertificatetieopiniongarnisheetoteS899NOpernsRequiringhereinafterdescendantscontractsto5907NOGoverrorSuwanneeireturnableappealedApprovedBquot-rohevidenceconditionsattendancebemployedIntercoursejudgmentdefendantExecutionsummonedpunishedColumbiaorDecreeConditionsconveyancesLafayetteGovernorGovernor5904NOforprovidingindebted-nessRMondayealIsasRelatingAttorneydescendantsresidencesReferenceheretoforesummonedinheritancecommittedinstitution5923NOSltvedfollowingte-StateThcreof-ncCurtalternativeobligationhereinafterCHAPTERreturnableshallhaveManagersexceedingplaintiffplaintiffurlmdiction59I3NOconclusiveobcctionSupremefollowingtransferredNovemberadmissibleapprovalfollowingdefendantdefendantsentenceddefendantdis-charged10nerTaiplaintiffscompletedefendantjsecretlYpleadingtherefromMondaydepositedapprovalzception-sIyrotherMondaycontentionofFloridaApprovedcontinuedefendantsapprovalexceptionSWhereforede-fendantpartpunishedRannm-Beconfirmeddefendant5905NOheretoforedefendantDefectivedisciplineCounty-of5918NONovembersubscribedconsideredTaeprovidedformerlvNo-vemberotherwisepledgingplaintiffajipHcajnrnefltRelatingJf-aplappearanceCHAPTERchanceryenforcedreinstateddefendantreturnabledefendantdefendantplaintiffinheritanceChapterpunishedprovidediteniietfappcaancedltlesapprovalnon-residentplain-tiffssentencedtheSameWheneverManagereSupremexcecdiflJMondayOpiniondefendantprovilleturorloegCHAPTERpartition5911NOdefendantdefendanttfhallengecomplainapprovalrcnderedTuesdaydefendanttherefromOverruledconfirmedHamiltonconflictPtyreferencepremisetiatbedutyofappearancebecomingMondaypropertypaternalAmendedshaldefendantdefenilantde-fendantdefendantherewithdefend-antRelatingappointprovidedGovernorMondaystate-mentGamisheeshallbeDecemberthereafterlanguagejudg-mentconstituteSecuritiesJudgesAttorneyManagerprovideduporPrescribePrescribecarryingplaintiffherebyHamiltonColumbiaplaintiffJudicialdiscretionJweeoponSecuritiesSectionir8taffidavitofFloridaplaintiffremandediHATTERCHAPTERquantityJudicialEnactedpartiesprovidedtogetherCHAPTERTuesdayishmentin-debtedEvidenceexhaustedHernandoexecutiondemurrersProvidepaymentsbalJudgesPosecutincreaseGovernorSuwanneeOtherwiseplaintiffMondayplaintiffMondayMondayshalRelatingPrescribestatementCollateralMondaydepositsJudicmlJudicialcom-mittedreformedMondayotherwisejrnisheeCollateralscendantsstatementIn-creasedProvidedrcpeakdplaintiffplaintiffplaintiffplaintiffInternalChapternvetgIing8sollorapprovalcholOpinionttijActadmittedpaymentinstantertogetherCHAPTERReshlthtloistoreadanyMondaySpccchTevidenceCriminalChapterMondayMondayttfjllperformCountyprovidedemurrerchldsuitJudicialHondaplaintiffamendedMondayeighteensufEcientCHAPTERdonatedguardianJudicialherebyCountyGovernorContractswheneverBradfordplaintiffJudgesStatutesapprovalMondayMondayMondayCurtCHAPTERprovidedattorneyprovideOffensiveDemurrercommuteDefiningcollateralherebybroughtsecuritiesaforesaidplaintiffsustainedCHAPTERGovernorpersonalrepealedMondayMondayMondaydecedentchancerydefectiveChapternothingJudicialdepopesreversedVioationProvidedgrantingpersonalMondaypracticecustodyStateotMondayGovernorrenditionamendedamendedProp-ertyPro-videdSus-tainedamendedCHAPTERnftertheindebtedsecuritythereforappointbrothersRelatingCHAPTERgroundspledgedrelatingMondaywhereveramendeddemandssufficientMarGovernorhereafterlarnlsheesufficientCHAPTERWhoeerafore-saiddeemedCountySpecificchargedderivingDefiningHoldingsecuritiesad-mittedcharRedsufficientherewithevidenceexecutingcomply4ihave-beenbYProvidedataiofbetweenSectionashereinWhoeverChapterimbecileProvidedholdingaccounti1CassstatementCountyGeneralCountyamendedevidencecon-finingSectiongroundscreditorsRelativeItemizedagainstFistProvideGeneralCountyCountyamendedOctoberStatutesConvictthe-vhichCHAPTERthere-forepledgedCountyCountySectIonProviderQVsonsdecedentpropertyclaimantHoldingEnactedChapterexecutionpropertyCHAPTERthetrialrelativePdemurreramendedbenclaimantindebtedGroundsWhereasbeyondSectionherebythCountyCountybrothersCountyCountyhllsecurityMan-agersmaternalProviderelatingCountyJusticeexaniheindecentEnactedherebyJusticeJusticewithoutGeneralGeneralhusbandInvolvedconfessothattheMadisoninterestfendantpassingStatutechildrenAlachuaPracticebenorceopinionCountyCountyintestatesentenceYcounyhalanotherJusticepersonGroundschargedpledgesprivatedecedentrelativesStatutesfledremandagainstCountynecessaryjurorsduringwithoutGeneralttrmsofbinding81909StatutesProPertyStatutesStatutesFormerMon-dayFloridaconflictsurvivorGeneral-EnactedEnactedentitledhusbandCommitClerkorperformStatuteswritingmandateStatuteshoweverconfessoregulardepositiolationaffidavitmaterialrequiredminutesEnactedchildrenspecificOctoberholdingCountyagainstStatutesbetweenEighthCountyWitnessEnactedrelatingdeemedchildrenGeneralaffidavitEighthevidenceEnactedConveyFloridaSectionlunaticActingherebyCourtspartiessetpur-chaseFloridaJusticeGeneralentitledbecomeProvidefathersconflictPerson-alAlachuaOctoberMadisoncurtmakingkindreditemizedapprovalSpringherebychangehusbandandforEnactedCountyregularthroughGeneralDescentholdingFloridaMondayCountyagainstPutnamconflicthavingEighthGeneralwithoutEnactedaJuroJudgeslegallyMoneychildrenhoweverfor-valueOctoberMondavcreatedconflictEnactedEnactedconflictjusticeOctoberPcrirlaancestorsbytheancestorsvenrbetweenSectionagainstagainstincreaseduringEnacteddeemedEnactedclaimedclaimedhalPutnampartiesresidentOctoberOctoberconsentdfcmcilReformReformProperTaylorherebyaforesaidFloridaconflictcommencecountyKidnapagainstJusticecommencemarriedHAPIERpassageGeneralwithoutaccruedagainstJusticesJudgespersonsaccountsAmendJurorssatyCourtsherebymnnnercommence81909ReleaseinterestresIdentmotionsInterestGeneralFloridamotionSectionhavingpamecitheGenduringninetyFloridaAmendpartiesmoietiesDecreesEnactedaccruedClericalactionsProcessenteredSectiontheretoamountinquestSpringActinghavingTaylorflbyhav-ingJudgeCircuitSecondmoneyEighthissuingminutesaccruedFloridawrittendescendReformconflictmissionnotice-ofMannerGeneralItuJltyper-sonalSpringSectionFloridafiulltyActingSpringamounttfstatecommitherebyInfantsSectionWrit-ingmarriedlateralsSectionbrotherexercisepassageSectionRulingpublicsentencewithoutReformexpectsdecreesFloridaSectionFloridaSectionFloridaFloridajurorsyfollowsCircuitFloridaFifteenTERMSUfessummonsJus-ticeSumterStatuteJurorsJurorslengthkindredpassageDistrictreceivetheinSeveralclericalclericalSectionassignsduringcompenre-ceivedpractiEveryFloridaconfincmotioncountysentenceCircuitibrieflyFloridaSectionFloridaSumterStatuteDecreesaccruedorderedSecondSectionSectionSectionSectionSectionconflictmothermotionServiceSectionAmendfollowsclericalSectionverdictFloridahaloffertlwhichherebySectionsentencepurposeamountJudgeSectionFloridaFloridaCourtsdividedenteredmarriedSectionenteredcarJudgefollowsSectionFloridacountycountyCircuitsontFloridaSectionSectionOwingSectionlritbeprisonsalaryAccountfollowsSectionAmendselcommenceServiceFloridaFloridaconflictarrivedinterestbecomeunlessvulgarFloridaFloridacountyFloridathereofprisonAmendSectionCircuitSectionpracticeeightyWhichsignedSectionsurviveFloridaFloridaCircuitseveralctetSbJudgeformerFloridafollowsamountFloridaStatesfollowsCircuitTERMFloridaJudgeFloridaCircuitwithinpasparcenarsurviveFloridainsteadbMotiondocketthereofCourtssessionUnnarmotonfollowsCircuitCircuitFloridaShouldbecomedecreesJusticeJudgesummonssummonsrepealpealedIiiendedseveralCourtsreceivePartiestemberburdenAmendverdictrecordsmotherverdictCourt419091passagepassageTAtdollarscountyCircuitCircuitCourtsamountamountltunableSectionseveralMarionCircuitCourtsScboolsessionsurviveytwhichexceptWhichabsentinfantsMinorsMotiontonfollowsen-tereduvrittcnappealMarionFlorldnreceiveFloridaFloridabeingWeeksyorrnerRelativeFloridadecreesJudgesituatepassageamountcitiseflFloridasecondexecuteSfxthUponsuretiespassageUponPartiesCircuitCircuitCircuitdollarsservicesidagreedserviceactionAtluriesdoublewithinCircuitCorrectreleasePersonFlorida81909CourtsWhen1CourtsmonthQtbetdegreeAmendservicecountyCircuitCircuitmoneydollarsCircuitBoardsalarybeforepassagewithinmeritsSchoolfourthamountbCircuitattendMotionrevokereleaseCircuitCircuitsecondnamedtollowssecondthe-sameJudge51909wIthintuitionenableinterestpersonsserved51905decreesbodybeingsecondCir-cuitseconddoingpassagelawfulreleasedeliverserviceknownsecondsecondshouldlawfuliwpstatedIleInfantSchoolcircuitFALLamountWritesOrdersfourthguiltydebtedthHgoingAdpresentSchoolsecondknownfifteenwhomdencaPeaceCourtsWhichfailurefourthfourthsecondsatisfydenialf0yTclaimsecondOpensecondmonthshouldcon-tractgoingbnearestrecordworksecondproperBeltfundsgoodsunderservicefifteendecreedutiesappearEstateobtainservedmannergoodsmoneyEstateresidesnoticeassistsUnlessoftheactionmotionUponfemalefourthfourthRight41909enablematterconveyCourtscrimenamedfecFlondadutiestInfantalCourtinfantPeaceCourtUnderSeeJwouldlawfultoandwouldInfantvrtlnpCourtsMarchTermspersonfourthfourthreasedfe-maleex-ceptMalecstSlateequalshotlddutiesfatherreadinBoardunderEoardexecutefatherwhichbeinggreatCourtOrlerfourththecadocketgranddecreeMarchMarchfourthSec8TermpropermoneyantcountyTermmatterproofbHCourtadmitnoticeCitrustieBoardbeforedenialcCtjCflCourtreturnsprocessmastermatterStatecorrectsecondwhichAprilBoardPeaceStateknowaboveunlessfourthwouldwhereherein71909givenAprilrightactionSec2whichsleThatThatwhichactiveInfantwhichCourttakenbecomefavorCountwhichdenialwhthfromBakerdonlnipersonSec2TermsCitrusLevyAprilpaidprnofplaceorbysectionCourtwherewherewhichCourtlivingPeacestatlerunderCourtUponwhichwhomaffordwhichCourtwherepas-sedsistersorderswhichthereJunefilingfilingpatin-solarcourtspowerspapersdutIesfoundunlessThererecordLevywhichCourteffectYearstow1t-ilawsJuneJuneJunedutypetitJuneThatClerkPeaceCourttaxedcertifiCourttakenWhatmoneyjuryStatebeingeffectIntentunderalwhichwhichdenialmadejuryforceshalleffectJuneCourtwhereCourtCourtPeaceOthereffectpartyunderser-viceAttoreffectThatCourtanStatethereJuneugeunderwhichCourtCourtCourtJuneJuneCourtpartstheyCaseswhicheffectorderCourteffectThatarrestshallsisterswhicheffecttrialsAprilWithcourtsstirtsetitmnmannerTimeThatfilingCoyStatedulyCourtThirdCourtJulyCourtCourtClerkwardswhomeffectCourteffectTermSixthpersonreportunderrecoverJuneJuneonthsJunepartspartsissue-rrecovercoursemadeintheRulestaxedmadeflownCourtCourtorderpowerwhichCourtwhichPeaceeffectmadeStatejuryrarsomstatecationhilnJuneJuneHaysccirtsJunedaysdeedsSixthothereffectheardotherStatePtacedenypartsclaimStateStateLawsStatedicialjurisStatedrawStateSlateonlydaysdaysdaysbasedCourtwhenmuchmadeclaimtCourtStatesisterStatentheRelateffectStatemannerCourteJnStateafterfensepartsdihieshall5645CoywithshallJunePeacewithabetsothereffectTermTermSameJurorsSlatefromStateentryStateclaimclaimpetitRoodshallestateStatewhichClerkweekStateChilimakeStateFifthpartsworkStatefilingACTthemgoodwhenCourtTermafterThat1SuitsafterpersonpaidthreeuncleStateEtflIorderSamemakeStateafterMaydulyjuryFine71901AnyjuryWhoman-nerfromservicefatntStateStateCasesFifthThatwhenTimeStateThatclaysMaycourtsnamescourtsat1StatefromthemuponafterpriorTermmadeSiooothermakeStateAttorlinealotherotherStnteStatethereMayothershallMaywomanliihgStateGoodStatetobeStateStatefromafterSepCourtthereBookJulyrowerlTrialThatmaleoJ-AcSatechildpartshallTimecourtsweekCoirtStateStateotherlinealStatewhatthereStateTermworkSendHciedotherwhentheretherethemThatStateFinalchildafterMay1586tsuchthanshallThatchildStatewhencourtreasonWritACTThatHeldsuchfromshalllawsIssueACTnamesmadeyearsStatethereStateStateAfterwhenStaterulesworkeventdeemde-creewoman5643SuchshallStateStatethemchildthirdafterCivilhavehavefciwirendpaid5647shallACTfromtermaftershallWhoStateimrposvNonintroStateClerksuchpartsLakefixedshallACTcourtwriteStateFondThattheretheretheretheretheirThatformThataftershall1586s88timeMaypartsmadeupontheirtakeMayMaymaythentermsofficeThatissuestockhandThatlawsACTACTshallWhichcourseThathaveJuneshalloaththeirshallThatafterfrontheadafterThatACTACTleastshallshalluponTimeteheesameStateStatecourtJ7thgivectionACTShallLakehavePayotheruponStateThathaverulescausesActslaws5920haveshallshallshallsuchstatestermstermsshallshallshalldeadThatbandtheirauntshallfixedACTACTshallshallshallThatThatshallcourtuponStatecourtshalllowerhavepartstheretherethemSuitsteredStateforceThatWhothirdBradAnyordacstorsanyshallThatandshallsooner1907ThisACTsuchshall5645ActswtActstheirsuchwithACTwithwithyearsACTtheirtheirsuchexcessthereJaneexcessthereStatethereestatecautesshallhaveACTStateThattheirmaleThatACTshalluntili577CourtfromcausesceasesuponuponupontheirshalnlthlrthenUponfromshallbeenshallshallshallsuchshallwhathavePayentertranssuchshallfrombornshallshallshalleachtheirshallffshallmaleYidtdCltrkuponcostscoursedoeswithIdiotlawsunderestatethemThattermscrnorStateActsshallshallreadbeenACTACTTIllswithdayseconddayCaseusedThatshallformshall3542shall5922timesuchstallchildhaveshallshallADshallshallshallANsigncourtJurorlawscostsMayshallThistake27thtileshalltcostsholdRealActsshallshallsuchsuchwithsuchshallinstiwithtimelawslawsThatreadSuchshallshalldatesendbeenshallwithshalltheirshallfromActsshallshalleachshallsuchshallnextsuchsuchndupOnIiuponchilduponcourtBillsanylawstheirbeenshallhavetrialtakesuchThisshallActslawsthenthensuchsuchtaketakeCascshalltitheshallshallThisreadtrialdaysuchlawsfflthetimeRealshallsuchshallsuchtimeshalleachThistimesucheventuponservejwmaleshallthaneachdaywifesaidSaideachsuchsuchholdVoidreadt115useddaysuchwithstchPiosthenThisartydaycourtuponuponuponcostscostsdoessuchsuchwithshallsuchACTnqarActsreadwithdecreecourtcourtcentSacourtsuchbeentimeboththenThisifheStdtshallProstriallawstrialtrialtrialswornupontrialdaylawsMonlawsthenlawssuchwithsuchThisfinalcivilthatcostscauseSoc5912timeThiscourtMMJsaidforduponpriortaUintoThattrialthatthatAgetermdaysuchthenMayFlorthatthatuponmenttuchheldfanedaydayday5balheldnextsuchtimelawssayslawseachottuonAnuponuponsuchlandInasaidintosaidstatewifeany1575readthatmaythatthatOvertakeablelawssuchctichLawtakeahjsuchThistheuponlawswornattoiyearmaydayfivetbiscausecausesailrulerulethisintothissaidtitlesaidfirstVailswornsuchfinalreadthatoralsicklawswho1523Actcostsacressuchuponfindshall1907FthetitlesaidthisernormaysaidintopaysakinedsealwritshallthatsaidtshodaywhotakethisthatreadmaythatmaySK1eachaversyearballTheFallsaidsoldfirstsaidTherulebailwantfilesreadtitleIsaidhimfirstsaidtrialthisActGenruleAN1909I9C91909wifecame1909lvsfullnotthesame1909andthehimsaltsaidthisiaidFalldaythisandfiveandAndsaidsaidsaidrulerosycape190Jerrorsameandpartandservetermdaymoremorebe-thcivilmay1523iSilmaythisandandcasescasesH9sameartsmayzooscasesaidsandrulefineandandnlesaidandsidedayandandthisthisandActaidfinesaidIntosaidsaidFallrulehimthistermActActThesamecasesTherosYhANsamethengfandthisandsaidsideandFallsaidandsaidhimandThefineandandsamethisthisrealhimandandandActAidand1907whosaidSalerulepinfromhaIlandActfineActSeaaversandThelentActANsametb1ActANmaynext1909samesame1909juryandandandthissaleandandandandthishadandandantioralantithisanyandrealParActfineWIruleTheOncethistimesaleandsuitsuitandandandlawcopyuror1907igondateTheThissamefamesamethe1909sentcostwritJlwereandTenandthistheandandandandandthisandandandthisandTheTheandantisubandhimandActandandandandandandActandandersonTheandjqoylawsuitandandActActANanypayIdoerrorsf47ActANANANsamesamethetheIngfsamesameandandandsaleandsuitandandthisActandandthisandandandandandandandand32wonsaleandActandrealandandandrealandansiActfamesameanyjuryanytwolawandandrealActANhasANmuryandhadthiscostandtheandcasessameandCotingthesameProANthesameisameandthisandandandandandandthethethetheantisaleandandandduebutfeyandaridandandandrealandandandbutandandthisnotanyanyanyantianypayanyanyandandandandtheSecActtheANSectheandandandArcDixbutANtheanyANsamesametheANtheadJthethethethetheantsmmesamelAwsanyanyandandandandsuitandandbutany1907caseanyanypayandActlessActandandendandhatthebutanythetimeccaeowesowesanyActActhasthethethetheSellthethepaytheActhasSecthethethethethetheissuethethethetheActsameandduelawlesslessbyaverSecbutlawbutSecIthethetheanycaseinsanythethethetheANthethethetheSectheuscsanydolthethetheandSecSecthetheforthethetimethesumNOyearthetrynearanyacreandlieninotanyFoonsoonanybyItsi1thhasthetheSecSectimSecSecSecthethetheSecSeetheSecthethetheandby3101anythethebyforthethethethethethethethethethethethethethethefullthethetheSecTudthethethethethethethecasesumfor1101theforfileherhushastwothecasecostthethethethethethethethethethethethethethethethethethethethethethethethenotrthChisthethethethethetheSecthethethetheSecthetheSectheSecthethethethethethethetheSecthethethetheSecanyanythelaustheSectheaidthetbeActthethetfcethethethethethetheforthetheANthethethethethebybybynewsumbynotnotoutanybythethetheiidforAllforbyforforperthethethethetheSecthethethethethethethethetimesumthethelawthethehasyetthethethethethetheANthethethethetheSecthethethethetheSecthethethethethethethethethetheSecthethethetimethethethethethethethethethethethethethethethethethethethebythetwotheSecthetheforthethethethethethethethethethethethethethethethethethethethethethethethetheaidforforthethetheperActbypenbyhasthethethethethesumthethethethenotSecthethethethetheSec1tpatbyusetwoforhisbytheVthethethethethetheAllfor624theSecthethethethesummenbybythetheuchthethethethethethethethethethethethethetheherthethethethethethethethethethethethethethethethethethethethethethethethethethethethethethebybythethethethethethethebythetheAllthethetheforforforthethethefornottintbjbythethethethetwocaseshatheSecthethethethemythethethethetheSecthethethethethethethethetheIlmithenotprothethethethebythethethethethethethethethethethethethethethethethethethethethethethethetheMaforthetheforial1forforvhforofthethethethealallbythetheTobybybybillbybyoutnotIrrfortheAlltheAllforforthefilecasesuitbytheActthetheforfileforforforforAllhishisforfileforforwasthethethetheherthethethethethethethethethethethethethethethethethethethethethethethenotforbythethethethethethethethethethethethehisforfileforAllthethethethethethetortheforbywisemenbybytheforbynotagenot354thetheouteysthebybybybyhisthetheforforforfortheforforhisaRetheSecactbythethethethethethethethethetheoamancasesumbe-ntheforAnhisAllhisthehistilttheforpreforforforthetenthebybeagenot0bybyoutthetheforforforforonethefilesumbysix11isIhebybybyhybyItssfhishisthetheReforhishisproouttheActtealcoprohenotwaswasthebybyforbponbybybybysumofowsageposthethenottenbytheeviforforforReforsumItsthethesaghisbyBehisAlliaAallallwasi5oJblbybytheforhisnothehisitsonedcBeBewasOflCthetntnotcolDebynotforUofOfby33allnilwitptBeallBeBetscallbvBeofNOitsbybyoftaJBeLdbenonallusenot30norBebeiteItsits46beitsBeOrNOitsalltlallcanbethenorbvbebebyAllbyheoneoneUsehebyitsBe45heitsIhebyonebehenitbeBebebeboonebeBepfofsucof1tttvatalladbebe54areflfbe50ofbeallitshebeBeitsBeitsbebebebebeInbearebeBebe9fbeahsucnorbebeheBe49hehebeareofofofofofInofofdepf38ofbcberalhehebebehehebeofhehearebebe43hebeOnastareallbebe44bebebebebebebebebebebe29bebehebearcaremearearearearetoofofof3dtQofofofofofofOftoofofofofofofofofof35toofInbebebe3637hebebebe3942bebeS3ofn4bebebebehebebehebeareacareflobe48beandgobeareorbebebeo-JbeofinofofofofofofofofofofofofInofofofofInofofofJnIftOfofofofofofofofofofofofofofofofofofofofofofinareofofofofofinbebebeofofofofbydoareareinbebehe6radbehebebebebeare>ofofofofofofofofofoforthofofininof1SofofofofoftoofofofofofofofofofofofofofofofofofofofofofInofofofofb1ofofptofofoCofofofofofofofofofofofofofofofofofofin12ofsptiCofof16debebeCfeinInofofofinofInofofofofofofofofofofofofinofofofofofofofofofofinofofIn111ofofinapinofofofofoiofofofofofofofofinofofofofofofofofofofofofinofofofofofofofofofofofofofininofofofofofofInofofofofofofofofofininin13ofOfofofIninofofofofintototbofofofseratatJSoriraofinofofofofofinofofofininininininofofthofInofofofofofofofintoinofinoiinininofininininofofinininXinofinofofofofofofofInofofininininininofofofofofofofofofofofofofinintoofinofofthofofofofinofofof10ofofininofininofInofintotoat9rofwetotxitototoongogoWofofinofinofofofofofinInininofinininininininininInInfdininofofofininin19inofininofofofofinofinofofofofinininininininofininininlaofofofInInofofofinofofininofInintoininintotoofoftointoinofofininononatatastoatofifonontoanOTinIninInininintotointLinininononnoonIMofinOfofofofofofinofofinIninininininininOfinininIninininoftototonoonofItt6ininIninnoonontototoattotototoattototototototototototototogoIs29toonon>onononononnoannooninoftoofotctofinInininininintotototototototototoinlnAtotoattotoROtotototototototototototototototononoonnoattotooftotototototoononononononanOrornoexanoronasortftoofasonexonononof19tonrtototoontototototototototototototoestotoattotoc1anBnnononoononnoisisistotoon11rdItasortototoattotoonororIftotoastototoIthior00anItisIftotoonornoorannoonnotoIni8ontstotoisisisortooftoVehisisororororasorortototoinIsisistoasor01totoorastototoIsIfistotoIsIsIfItontotoonanllorororororasororasasofotYsisisAoforasasisistoIfJIsitisiristoasororasorora5toissuifisorasorasasorasasororasorororasorasoeasasenorDisororororasasorasasorasDnsininororasorororororasasififADIsitisItIsasTasJifFItasasinasasororasorsoorsoororIfOftasasasasorororasasorInIAinororasItitifIibIttasorasreassiasIfItItIfifrosoinorInIIasAJinasItifitLhItItItin2n0orItinyfIt2pbfisrtitdh8iuoc32QdIIfc22M1itS37323313JC5442<2ddiIj22354yD8I36OaaaergaaIJjIIfi


PAGE 1

ESldcuntycnclshUthefirstdayofjanuaryofeachyearshallcetfesalheoCLAYCRAWFORIo-CLaborofCountyconvictsasAmendedicmoccatJ4CountyhavinscustoeiythereofnYCmmliloneJlcanihlstsntncupnconviccrtalnnslrtrofbeunpecessarytocon00597H9Distri-ctairJyAlicookbpo-lBlaeitertUCCnltheGran4-ndtlIelimitsofpalmBClCh27CC1umblaThtClectrorTaxeequltabledlvlAenueibesmentrtheYmaYdeIchetuckneRClrcultCourtofSAI1worinterestimanediateIyuionshaltholtradafoloqCounty-CommlslonersCommlsloneroCGoveror-ApprvedbermeaJatcveriAUlustnetTThWuntyApalachlcolauUbertyLiherty19OadsdcnGadsdenshalbeWStatutoCthadoferCreekthcncoCsidcultyCountYmayemploywMlnstutdmlsdemeanCrredemptioniWjM-shalltrnsrptoncorfratlontramrbCommissionermisdemeanorCommissIonercmpenstonAmendSctionAioCommissionerperorateThatSectlon4i09reregisterfbundfThirtyfive355correspOndtlArcutrecounselalcPharcyCorTtleCoileCtoofTaiBoarsImprisneterectonoCUEnlteCommissioners-DistrictImprsnedspinninjanywrseacljtotecmQlllecannibalsC1ee1andCaptainjurisictonilliiriCle4t-heJThsAThlrtyfveeitherprtncipafcommittApproveprescriptionsatrnsrpguardianshipCaptainreprtanyfntbcaD00-typcatcnsttuter2-9STAOFPLcalmiyendolnrother-representativedispensinlbutcherCommsslOnerSOfprScAppropriationthOupnexceellnlbundarCommissIonersofPMrcommlrsionsreaUngthundrCommissioneracompletthereafer5971mutatethencealongsaidEnaceCommissionersdivsoQoexceingbunlwthllorRepresentativesEightbundarEnacterepresentativetheBoyUTownshipTwotheaaj1nlissionenEnlcerenisteretEnacefcitatesdjalicrtfacitteMcommlngleadministrationajroviPharmaceuticalCommissionerbestrickelcomplyingrelatnmarksndcompanietObfixbEnactechareCommissioners-ofHlscleThelrRfsuperschangeredemptionnecesranYishandTuwnahiplineCommissionersyou5prncipalprsnerCommissionerssupervisorscuntiecorporatloflorth-ecolntSetontheadviceandPageCommissionersbketCommissionersCntlcuCommissionersliebchp-iasiaCommissionersimprisonmentCommissionersCommissionerschangecompoundingrefustnlth-esverlP3geofimprisonmentexamination-SectransferimprovementCommissionerstonlctanywispurchasedassumptionWprepresentativeCommissionerCommissionerstworenRlelnCommissionersCommissionersslaughteredappropriationappretremainedapthatsldpuruanccompoundingasstssnientroiipharmacistConmnementInstructionotUMeApalachicolapharmacists-ofcompoundingApprovedperformanceappropriationCommissionerCommissionersanditiiallotherofficerrecoveronlyAsstrCommissionersCommissionershatseerCongressionalconstantlyImmediatelySI70NOFarmeraforaidCom-missionersApalachicolaTwentytwoa1suchprescriptionstransporta-tiondolardolarCuatyot-twentyfiveTwentytwotetLadySectoncreateTwentysixpermanentCommissionersCuntyrequirementsConstitutionamendedLegislatureSultancharescelrlgmaterCommissionermatercustdyGerphysicianscompletionatprexcepharmacistdecreeassignmentsaidcountyCommissionersprosecutionsthrouhopportunitybandwestertwelve-monthsequivalentcuntrTownshipstranrrcntjloanslaughteredConstitutionrepresentativere-quirements1909-CHAfTEBBoanIchetiickneeOcklockoneecoimipensationknowinglyjurisdictionproprietaryAgriculturalGOYLejtlttahQslaughteredsupervisiontemporarilydidntwIthnrequiredTARVP-IdocumentsleaseRoarexaminationBoarCommissionersinspecteddiexceedingalalnstboundaryFlorajurisdictionreservedandcorporationLegislaturecorporationhrrhrtwentyfiveproceedingsGentrlFlordlslaughteredLegislaturerjuirementsslaughteredAgriculturalcompetentLegislatureconductingJurisdiction4IvvounIyLegislaturepersonalAgriculturalhereiiiaboveCommissionThirtyfiveOcklockoneedispensingGovernmentand-complyeightIcgMalurcApprovedexaminationersDistrletBoundariesjudgmentsTownshipMechanicalClntySUNortwlbecorporationimplementsproceedingsThirtyfivepharmacistMaintenancepharmacistApprovedTownshiprepairingLegislatureAgricultureTownshipthencbeArcicultureregistrationassumptionpharmacistAgriculturehksInstitutionsLegislaturepropertypharmacistboundariesrespectivepharmacistuitapartmentImmediate-lycorporationpurchasingInstructionregulationsLegislatureregistrationInstructionapplicationprisonersprocrdischargedTownshipperrottUapropriatedprovisionslcithlaturecorporationInstructionmaintenanceS961HOslaughteredRequiredPharmacyTownshipAgricultureRequiringmarLegislatureresponsiblechieftranscriptpaaewill-continueInspectorssectonTownshipbrndsprovisionPharmacyPharmacyprescribedterdtorofexpenseiUniversitymaintainedofcrarrangementsproceedregistrationconstructionboundaryTownshipTownshipregisteringBoundaryInstitutionspharmacistregisteringprisonerscontinuingnegotiableotherwiseSctsSetionMechanicalregistrationPharmacythrdistinctlyaffectingsoutholphysi-ciansTownshipTownshipApprovedallpersonsFurnishingBelhrnywApprovedofcAssociationcorpora-tionprovisionsApprovedrespectiveTownshipTownshipTownshiphereinaboveTownshipPharmacydaysApprovedboundarypermitttcdtransferredforbearingtemporaryatt91-ANACTcontractingMaintainedApprovedcompoundInstitutionstllrSecretarytherefor-theanddefinedascertainedPubRequiringprincipalTownshiptlnTInspectiondischargedpleadiugsconferenceboundaryeaterInstructionseparatelypojsiHetoljprosecutionexceedingprofessionforegoingterritorycertificatesSecretaryretirementregisteredIpboundaryoriginallyassociationApprovedprovisions5963PdOpurchasedSecretaryprin-cipalprovisionsistwiceMechanical35TownmaintaineddiscretionindirectlyProvidingassociationprofessiontranscriptpensationprovidedhirngassociationTuesdayThirteenthApprovedactonEducationpertatniugtranscriptindirectlyprecedingrecordingappointedauthorizedto-ascertainregisteredboundaryestablishedEducationassociationprovisionstogetherS965NOcirculationauthorizedGovernorboundarysouthwestboundaryStatprescribedSM8HOApprovedCurtprincipalenclosingassociationinspectioninspectionmentionedsouthwest5969fNOexceedingboundaryregisteredmortgagedofalrsuch5966NOshBIwt-hinassociationassessmentQulrEducationacceptingdirection-ofamendedtocollectioninspectorregirteredCountyTreasurytwentiethnorthwestmisde-meanorrespectiveForfeitureregisteredregisteredChapterappointedattorneyshalCountyGovernorbecomingquestionsTuesdaycontractedtownshipMondayviolatingColumbiaenforcingcommittedwhlteAndthereaftermakementionedmaturityDefiningprocuringcollectingcompetentmlsslooerspaperShalBoundaryprovisionsadvertisedtrutheverapartmentBoundaryphysicianmutilatedRelatinganprovalapproval5961NOinspectormortgageesCountyrepaymentStatrInstitu-tionassessmenttownshipapprovalinspectormortgagesTreasurerroodsProvidingCounty-Innewspaperprison-ersapprovaldirttownshipcountybnprisonerschangingwltladditionaltherebyBellamyCountypurchaseofcebyHlminspect-edIntersectionsupportedbutcheredsouthwestSenatorialboundaryexpendedintersectsSWWannuallyJanuaryannuallycompetentiirovidedeverBellamyshalapprovalmedicinesheretoforesoutheastinteisectsoperativeboundaryattorneysdetermineconvictionproducedpreviousgovernmentcdareasonableapartmentconstruedregisteredbutcheredSuppliesactuallyCountyapprovedembracedeverPrisonersAdvertisenorthwestfollowinginspectormaterialsproducedRelatingregisteredprisonersprovisionforthwiththatprincipalapprovalproperlycorrectnessCHAPTEROFFICEpaymentprovidedsoutheastsoutheastGovernorbeauthordetermineAssessorssouthwestCountypunishedJanuarypaymentexistencepur-chasedrepealedCountyAssessortransfereerepealedPrisonersGovernorAndshnlCountiesInspectorcertificateTowpWIpaymentcharteredGovem0rin-spectedmedicinesbutcheredSuwanneeLqualifiedborrowedequitableCountythousandthousandexistenceSec-retaryInstitutesconstruedshlShowingviolatingInspectordeliveredaccor-danceJanuaryprovidedconvictedinspectionCountyprisonersapprovaldefectiveterritoryofferingprin-cipalfixlIshalbutcheredlachicolaNineteenCountydispensecountyCountyTwentyCountybanlPhar-macySeretarvshalfiftysix7-CHAPTERprovidedChaptercarryingmortgageeCountyCountyDaiercordcharacterwheneverGovernormaterialstogethermedicinesaccessibledividingJanuarythousandInspectorproceedsIrofe-thoCountyCountyCountycon-trivancepre-miumsCountyexistingrepealedicquiredremovedcarmortgageCountyInterestedCountyCountyCHAPTERCHAPTERinspectedmedicinesshalrecentlyinsurancemortgagesoutheastborrowerthousandCHAPTERperformtransfereeCountyCountysaid-personCountyCountyCountydispenserequiredclothingsentencedwonerofCountydisturbedshalother-wisewhatevermortgagerespectiveappearingasso-ciationamendedNegroesintentionamendedCountydruggistgeneralCountyconstruedStatutestogetherthroughactuallyexactingCountiesprovidedleascustodyborrowedconstruedeatAsimeetingDistrict-orprohibitChapteranimationAssessorsrequiredloanpdpendingprecinctSclothingbbrecoveredmeetingCHAPTERdruggistconfinedborrowerCountyattor-neysCountyhundredpaymentLibertyexistingCountydirectionfin1dis-turbedStatutesherdupli-catesecurityhundredCountyAEsessedborroweradvertiseamendedChapterintersectscountyunder-theCHAPTERNineteenSectionCountyreceiptoarStattthousandthousandletsTwentyJudicialrelationSstIpayableCHAPTERcontinueCountythroughperformrelatingCountyCountyCountyProvidedcornerofStatutessuppliessolelylesemeetinginspectionCHAPTERGeneralrefusingcmerascertainLibertyGeorgiaCountyPalmlBdCountyleadingChapterfourteenhundredconvictsStatuteFaHTtmiwilfullywilfullyProvidcdStatutesoringialGadsdenprosecutepracticeeighteenProvidedpaymentnecessaryherebyherebyhundredChapterworkingrepealedfactoryCountypracticechangedcomvictsBatheretoforStatutesbusinessMakingemployCountywilfullymeetingamendedpaymentStatutesthtreceiptschargeshundredCountyreulrtdworkingbetweenGeneralerectingbuildingfrpaymentCountyamendedCountyattorneycontinuecornerofCountyherebymedicineascertaInrelatingRequireCountymortgageansweredSectionsmissionersbuildingpossibleDistrictstreasurySectionsStatutesStatutescertifiedProvidedCountyCountyofferingCountyCountyacceptedhalamendedCountyCountyCountyComa4iCHAPTERpurposecriminalenforcedcountiestogethermeetingDistrictschargedCountyrenderedschedulebusinessGeneralCountyreceivedProvidedProvidedcompanypracticeGeneralworkingreturnedhoweverhoweverCountyspheresspectivecountiesbusinessstandardEnactedPenaltyVarioushalpro-videdCountyCHAPTERhalherewithCreationnotifypaymentinspectcountiesCustodyCountyusuriouswhethertrdirectlyEnactedanywisewhetherSectionsbetweenbetweenappointStatutesGadsdenusuriouselectiveCollegeendorseeregisterCountysurceCollegeAmountBeachGeneralGeneralrefusingallowedwhetherfo-rtetestifiedusurioususuriousupnherebyCollegecontractsendorseebridgesSepataStatuteshalefIectaFurnishhundredtelEnactedcountiesPracticeSectioncountiesconvictsCountybecomeherebymemberhoweverwhetherwithoutGeneralpro-videdG6UutvSeventeenpaymentbetweenattachedhalSpecialbridgessurplusCountyherebymypaymentGeneralprovideReportretainedSectionsfollowscOtintythereforTheTherefquiredusuriousSectionSectionSeventhWomenotletingduty-ofregularSectionlendingFloridare-pealedcountiesGeneralthereforamendedamguntarrangereservedthoelectionconvictsherebywithoutconductservicesSectionconflictCountyreservedconvictconvictsInterestsuitablewritingBrandsre-servedpreviousrenewaladdressentitledservicesGeneralconductCountyDistrictlaidconvictsreceiptSpecialWomenEnactedanotherlocationCollegeFloridaPlordiavariousdistrictCountyreservedprevioUSpartiesCountiessupportofferinglettingpartiesfemaleconflictSeveralprsonersrenewalWonenregisterdistrictstandardpris-onersconductelectionCollegeFloridaCountyseparatepatentpartiesNeqrucchangegeneralnumberSectionSectionSectionFloridainterestentitledeightymassessedFloridaFloridaferencemarprorataFloridaCountyCreatedDistrictprisonersSpringde-privespecialleasingpartlybrand-wasFoHigherfollowstncltmdeInterestexactedservicesserviceshimselfinterestFloridaSeveralCertainSectionconflictreceiptherebyBettiCUfrtKnonFloridapendedSectioncountyfurtherCountyFloridaAmendservicesFloridaspecialSectionduringinterestDistrictinterestthirteenspecialcontractFloridasubjectSectionFloridaFloridaSectionexpensesCollegeCircuitFloridaCountyanotherInterestworkedfrstinterestbecomeSectionelectionmattersorittinatre-gularFloridaFloridaSectionSectionSectionSectiondistrictinterestsentencetonBoardsseveralallowedDistrictgeneralalteredcountytheFloridaSectionFemalesecuredControlworkedSectionmonthspresentSectionFloridaconfineCountyHondamonthsIncludoFloridaSectionCircuithouinspectormonthsofferingbutchercountyBoardsbrandsFloridaVotingcomposesentencecontlictboundasupportmonthsFloridaFloridafurnishinationSectbncountypublicarisingchargewerDistrictmiddlecountyprovideLimitschargelapsedbmliJamountsecuredSectionSectionSectiondistrictfurnishtwentyFloridaFloridabecauseaccruedFloridaFloridabcountycountyCircuitninetyequityEverylendingInterestEnacte1FloridaconvictconvictSectionallowedbecomeSectionanotherTafollowsthereofprocjjfollowscontractjudgeiil-HetktFloridamonthsallowedfurtherFloridaFloridapreventherfurnishFloridacountycreatedinterestsellingthencedistrictSectionJudgereceivefemalecountydollarsfurtherPresentaccruedassociajaiamountsdis-countchargecreatedistereduclconvicuonpresentdeemedherebythereofSectionBoardscountycountycontractwaspurposeEveryfollowsactionsSectionRanespassageSectiontheretocountypreventallowedwesternJUdgeSheriffwrittencountycountyCircuitcountyCircuitamountBechperiodparty-ordollarsalteredcountycountyknowncountySectionSecondenforceCircuitthenceFloridaDSectiondividescountyHoardspublicowingporatesectiondemeanorcorrewexpensesReachpealedliverybridgedoubledollarsdollarsexceptCircuitFloridaFloridaorallyguiltyBeachenforcereportsintersectthereofseveralsubmitcountysaleInfurthercountypublicperiodBeachamountofferedthenceamountsmoneysbrandspurposesreports19OIdollarsdesiresQotthenceWhiterecordCircuitpassagereceiveequitythencerefusesalteredthirtymoneyspersonsdollarsCircuitFailurecountythencepublicreceivecountycollectbrandswithinPublicwithinfloarddollarscountyrecordsthirtyem-ploycountycountydollarsdollarsdollarscountytwelvecountyupontonSchoolcountyengagepubliccopiesMarksrecordBoardBeachpersonsBeachwithhthencethencePublicdollarspurposeaostMmonthofficerspartiesofferedcorporaerdtyofferedthenceFloridawetthethencepealedwetpersonspassagerecoapectorCrimesbusuriousforfeitBeachapprovdollarsexpertthenceDividetonBoardamountamountstrikesFloridavendorthencesidsignedhandsofferedoffenseoutthenceonSchoolHandactualunderforlatingSchoolloanedlesseesmouthdoubleexceedofferedbbeforehalwesternsidA-jivenBeachReachwithinBeachschoolschoolbeforeBeachBeachdownrunningacceptformerthencethenceBeachapplygoodsBeginfregrepterdollarsnamedSectionsidsidrecordsfifteendollarsamendshouldbrandsrecordPublichereofBoardmarksfifteenhereinbappeareasternPublicwithinBoardbwesternmarksbeforekeepamendorgplansNOMwithinmakesthenneBeachTownmouthBeachBeachalongmonthrevenueplacebeingsidexceedBoardtwelveforfeitaminedutiesdrugsmonthwhIchBeacheitherRoaMSantawhereWhileBeachSeldrugsdrugsofficerbeforehereofmarksmarkstwelvere-ceiptatthemoneyCourtSchoolbeevesbeevesreport41909procureofficerwhosemarksequaldesireRoarwhichactionCourtsidBoardmarksDefinebeforetenceddeficitfailuremarksfifteenPublicBrachcollectmuchbookssidlyingrpniiiBoardBoardApril1iappearofficeroftheBoardfifteenbmarksBeachwhereHousebeingactualarticlebeforeBeachpeisonsalongbeforeforfeitbiddermattesbeevespapersnoticeCourtearlymarkshereinthltusuriouswhichBoardlesseewhichCourtwhomTaxesrecordactualwhichrecordmarksBeachBoardCourt553markscollectCouatasiregunsatisbper-SonsfundsBoardstatedwhereBeachleasedworksBoardBoardwherewouldeitherbankswhichrecordlowestordersStatelettermoneybeforeclausestatedPapersdutyJuneDadoleasedwherenoticeeitheror-TheLelilproperabovewHoseex-penseCreekRiverlimitsentlreitherhandsleasedunderwhichbrandOranwouldChaptabuhwpartybrandbItOunlessworksmarksplacecentummannermoneywhichwhichRiverRivermay-bedutysouthshallwhichBoardbeforemannerdollarpersoncrimebrandfundsdowndutyeatentireentirecreditsithincorrectwouldClerkper-sonspointwhomregistClerkalpersonwherewherethpeasternClerkworksBoardabovemarkswherepersonrangesCourtwhichunderBoardtakenStatewhichdutywhomunderBoardworksrecordpartypartyStatedutyeffectalongalbrandbrandRivernewextentre-ceiutrejecteitherunderquirePalmfrommannerdatedbrandRivertimespartydownnorthmadeDadewhichBoardCountunlessCountdutykeptamoneylubllcpersonpersonfundsTownClerkwasissuedbrandunlessalongthfplaceClerkPalmpriortakenPeaceothermadecheckextentCourtallowInteredesirewhichunderpartyotherStateaffectopersonAfteroflicePalmpersonofallJuneCourtJuneJuneClayabovedaysdutyotherboundotherpointfnllnwCourtothermarkCourtfundsPalmcrimeRiverman-nerUponStateoflcePalmforcepersonpersonpersonpersonrangespapersrangesSjeopointDadesixtyPalmdutyagentdownotherbooksdutyJuneClayJunefullyJailsrrtninJuieeffectStateDadetakenmadeIThatStatePalmbStateLinespersonlaborPalmallowrightStateCourtloridaotherlandshousepersonsouthsouthfullywheredutyretailplacepartypartyCourtnorthnorthJuneJunedutypersonpersonmakenorthDadeJulyMaycampscounttBlindtrldeaDadenortheritpdStateThatpartswhensouthpartyDadeThatevent-SagentothernorthStatewhenStatekillednorthnorthtlneseffectdeedsBoardall-overetectnorth95-ANbooksweekscourtsThattheyPalmrightdays50000otherpartynorthsouthnorthnorthsouthLawsPAlmPalmapartpersonpersonpersonDademandpartysouthnorthsouthsouthnorthnorthStateStatemadeStatesouthStatewhenStateStateClerksouthDadepersonlegalmarkmarkPalmdutyJulyJulypersonsouthpersonothergageeDadeStateStatesharetheirDadeotherCourtnorthrightfromfromsouth1ationStateLawspartyStateStatePalmPalmPalmStateStatesixthCourtPalmStateStatealStatemarkJunedulyhogsawBlindmademadenorthuponshallfromtakensouthonlyagentMsJulywhenStatejailseveryStatemakeotherrangesnorthothershallStateCourtStateStateFundSioodividoldermakeDadeStatePalmPalmafterbankThatreservejailspartynorthestatedaystheydutyedgeofficebqthwhenStateStatesouthtaxestheyDadeh-teIshallfromWestMaywhenouliceStateper-sontheirStatemarkcreekPalmrLaDorafternersonsThatshallStatelaborThatrecordanswercornerJulynorththreeplaitthpaidagentcitiesStatemarkmarkStatewhennorthStateStatepowercornerworkbankStatetheyfromshallaftershallhaveshallroadsmoneyusualshoesClerkmarkThatafterACTmaleweekSuchfromthemfromACTeveryrangemarkcornerthreeStateStateSaidpailshipplanpaperrangeThattheirdoneannumcornerfundfundshallcornershallStateactedmadetheirhaveLawsthreeleasedaysbookshallshallACTmaleStaterivershallnoticepaperolderThatnorthrangenegronegroAnygiveMaypaidtheythatafterSuchtheirTermeyUsuchshallshallwithrangerangefiftyaccesscausesrangeThatpartsworkwagesEachfromshallshallshallfromfromfundThatshallPalmStateshallshalldeemmintprovetherewhenshallhaveviolaviolarivercomerinterThattheirrulesbackStatefixedbookThatACTshallshallAnysfoshogsJulypaiduponmadet1176hogsuntyshallcomerjailsshillshallrangefundshallshalllinesshallshallshallshallhiredtaxesworkruleswhatThatshallshallhavedaysourcefrombookcornerafterACTshallvictsfromshallshalltheirshallhavebooktheirshallofficeStatepaidThatbooksuchhogsshallshallThisshallevery5334rangeuponanninpaidwhatworkthouleastlinesshalleachrangeThatwhateachCornistertheirshallrangesuchshallACTriverfromafterTItcornershallDeafshallhaveshallshallshallshallshallhavepat1theretransshallACTshallwithuponrangenorthrangerangenamescornercausesThatDeaftheirThatshallrivermaleTunelawsApapaidountv5184whatpaidbonahavewhataccessActssuchlinesshallsuchtimetimeshallfullyshallshallshallshallfromeachgefromThisshallshallwithshallshallsuchsuchshallshallComlinesACTshallcourtCaserangedutyshallbookdatetheirrivershallobeenpaidpayshallaSihogsshaltshallshallSjj5184hogscornershallfromshallbeencornershallshalllinescentsrangesuchwithshallshallbeenhaveshallshalleachwithshallsuchshallalterhaveshallshallwithfrom5705shallshallexisteventeventrangerangeranjewithshallfromshallshallriverpaidACTtheirTheuponpaidjustdaytimethenshallwithshallentercorneryearsttThissuchwithsuchbeenshalleachTwoshallsuchshalllearnrlpttotalbeenshall5962shallACTsuchDeaffromfromshallsuchstreetcentsagreeuponsevenURleagreementagivewithwithwithsuchshallshallwithsuchholdsuchthanthansuchsuch117fteachtimeshallACTThisuchsalessuchsuchsuchwithsucheachttsuchbeensuchductfromwithcentsuponhavesuchfromyearfourSealsendlawswithrangesaidholdthatwithupontakesuchcertiwithTwosuchsuchsuchsuchtimedayNowsuchlinesthensuchsuchsuchsuchsucheachroadsucheachsuchsucheachsuchthanTwoleastsuchtuponstoresuchsuchbothsuch5705timeshallbeenwithsuchTwoshalluponteachdaythatttoolsuponThewithTwonineFlorfourpaidhimCorilawsThisrenewlawsbeefTworoadcivilthat1withthansuchstraitsuchsuchthanwithsuchmayP-tuponleasofromtimeeachwithshalllawsmayshallatedwithsuchbeenfirmfoursaidfirmbeeftsuchsuchtheirsaidfirstfirmfirmfirstwhobeetWdsshalltlawsTwoTwotakepriorlawseachcentsshalldaysuchthansucheachthendatewithlawstownsuchdateshallsaid1910TaxtakesaidThepartOwlTheflictcfirmcopib11ThetimesamesaidfourwhofourbeefpartthatAndTaxsamereadandtermfromfeesstimeTwowesttcausethansuchmortopensaidpantsnailexamsaidsaidfirstfirstfirstsoldthatfirmfirmbeefthatfirsthimyearertytakesaidbeeffiledOneualslthathogbidsreadTheeach1andt91CcopystatesametListOneThefirstionssaidfrom0000himpartsevenfirstintosaidsaidButhireorigsaidwhowhosaidOnebidsandandsoldPainmay1909910beefsaidlawspropwesttermwestwestreadnotenamenamemayThefeesTheOnesaidfirmsaidthathidesaidsaidhadsaidthissaidhimtlonbeeffirstsaidsaidsaidyearroomthisthatwhothatbidsandreadwestwestwestwho1909westnamealsosaidandOchalsotrustsaidsaidwhothatalsofaceintosaidandandfiveTheOnesaidandsaidthisTueIthisActlineTaxsaidableOnesaidIsaidandOnetlvtnposesunkfivewestwestwestwestwestwestwestwestmaysaidsamesamesomestatewaystcmaytruesameshimThesaidantiThetionsaidnameintowhosaidyearshallwestfeesandOneandthissaidThesaidsaidtilesandandandthis500beefwestwestandfivefeesActsaidsaidsaidwaytonsaidThesaidcultmayventwest1909maynodandfiveandandandthenamothishoglinehideI9C9theii7JmoresamecausewestandwestwestwestwestandandsameandsaidThejailtionhireOnesaidserveActthissagetournotewestwest1909saleandActmay1907saidThesaidandthisandthisandsaidActthisandandFeesaidandandThealtoOneActandandandandsalefineandfivefivelineandhadfree1909samesoeswhoANsome1009thewestwestwr1909andalsoandsaidandandsaidsaidinjnoteandfiveandNotantisaidsaidandandandsalehimthislinelineandaridandandsaidthesaidthisandsamerohadfeesthisthisOutantifiversaidthisandeastsamesame5thInRwestwestfirst19071999westi9091935IYISYratasamesonicsamesamefeesfeesandandthisandandmIdanyandlossandfivethisaridIANye-1ksamesameandandandvictandandsaleandthisandandtideandandForForandfiveandandandandandandlinefivelineActandlineandrealandlessandandandlineANwestwestcasesnot-asamehogigos19591909thisandthissalehimandandandandandandmanActandandandanyandandandsaidany1909thisandandthisilsiecilandandandwillandandandandfivefiveandhadUkethisfeesroadhIreANfiveandandandActand1174westwestanysoonmorefiveArtActANAntieastunonweretheshetheANbuthadtheingthe1907andandfivethisandActthisfivelawandandandandcases0-StthisandhogbutandtionanyandthisandardandthisandandaridandandandandandandanytateanysandandanyandandlawfineActlineActaodlawthesameANtheanyANthethewestmoresamesamesamesoonrivertheanddueandandandandanytheeMandandandandeastandandanyIthetheanyanytieActricaandandActandANandandbutanylawANbutlineSeeSecFlomoreover1009anyanytheSecrjailiajSecthethethetheposeSectheduesumsoonandandandandandhaswhanylawsamemoreanyanysuchtheSecthelawandandandandlineandActActbutandfivelesslineinddthisSecforandandlineIanyanyseateasthasSecthethethethemorethethethetheSecaeceingwerethethetheSeethethethethe100thesameandandoutsn1hasanylesspaytwoandanyanysoooverandanyanythetheforAllSecSecSecanySecSee1900overthethethethethethethethetheSecSecthethethethethetheSecthethetheeastthethetheIthethethetheoverwestbutmlslawandlawforSecimoreanyanySecthethewereSecthethethethesamelogthethethethethethethethebybyeastthethethethethethethethetheualthethethethethethethethethethethethethetheSecthethethethetheHUHnowec-IjtheAllforhasnotthethethethethethetheSecthethetheforthetheeverthetheherSecSecthethehersheSeetheSecthethothethethethethethethetheforthethetheforjOthethethethethetheshethethethethethethethethethethethethethethethethethethethethethethethetherollsumbyrstthethebyoncetwoandthethethehisthethetheoutforthethethethethethethethethethesellthethethethethetheSecSecthethe5ccthesumeasethethethehertheSeethethethethethethethethethethethethethethethethethetheshethesautetherasethethethethethethediethetheconStutbidthethethethethethethethethetheredforthetakthethethethethethethethethethethethethethethetheSecfortatttheoveroutoutnotmyveltaxSecmanforAllbybythe1ndthethethethethethethethethethethethethethethethethethethetheforforforthethethethethethethethethethethetheforsumsumthethethethethethethethethethethethethethethethethethethethetheliesthethethethethethethethethethethethethethebyforforthethethethethethethetheforforforforthethethetheforsumcaseoutSecnotthethethetheoutthetheprothethethethethetaxnotsumcasecasethenotthethethethethethethethethethethethethethethethethethethethethethebybyforfilethethebybyhythethethethethethethethethethethethethefsothethethethethethethethethethethesumsumcasesumsumsumbywasbyforforthebyforsumnotpuroutforforforforthethetwoforforthetheanythethemennotthethethethethethethethethethehisthethethethethethesumsum121-IsumthethetheforfororbyforforthethehysiunsunwisebynotnotnottaxforhisoutnotnotnotforfeeforsixsixsixcelltheK-Li7outbybybyforAnthehyAllforforforfurforfeeNoAllAllthethethesailnotthebybysumsumnectheIIfltUforredhisthethefortheforhishisforforfileoutantiforfulforNohistartheperoutnotnotthebytOtnrNwasnotbyforforforforsumnotbyhyforsixtheidaErefeehissixbybybybythesumthesixbynotforforforforsixsixbyBeAsproforfornotnottheetcpreAsVISEsumbybyBebybyonebybybysumforwaslnhisnotthethehisfeeforforthenottenBeitsRehishiswesBeorbynottenthetoopertheoutnotnotoarbybyforofofbebyforallBe1rtenconnorwasthiforbyotonewasbeallalloutBeetctheallrunnonallallBeallWusuonetenBeletonenotReallitsPufoionetenAeitsallimhebebebesettneallonerunneeallbebetheii-palall23Benotwasregf61onerunrunrunbylethe94beandbebeallcanhacandoallitsareitsItsbeBealluponebeHeallallallforforallvercononeofofbeofofhebebe96bebedehebeusearearebebeheheitsbebealtbeitsallbeareheconallof20onesenofIQOijjareupofofofofofofbeofbelieheheofofbebebebebeheofalthertbebebebobebehebebeItsbebeheheItsallbebebeheheheallbeistbebebebeareareheareareestapareofofofewofofofofofpjbeofofofofofofofofofofofofofofofofofofofofofofbetarofbebebebeofItbeIbebeotbebeofbewarebebebebebebebebeianarebeIofofofofofofofofbesixofofofofofofofofofofofofofofofofofofofofheofofofofnfofofofofofofofofofofofofofofofofofofheofofofbe17ofofofofofofofofofofofofofofto12ofofemIareQrofhebeDIofbeofofbebebebehehebe97beallofofofofofofofofofofofofofofofofofofofofbeofofofofofofofofofofofofofofofofofofofofofofofofofofofofofofofinofofofofofofofofofofofof18ofofofofofofInInofofofofofofofofofofoftofofofbaofofofofofofofofofInofofofofofofofofofofofofofof13bebeofhebetorSIX1ofofIninofininofofofofofInInofofofofofofofofofofofofofitofofofofofofofofofofofofofinofinofofofofofofinofofofofofofofofofofInofatISofofofofofofofofofInofofofofofofofofofofofofofofofofofofofofoninininoftoofaofofofofofofofofVjoofltInInofor1inofofofInInofofininofInofinofinInofInInInofoftoofofofofofofofofofofofofofininanofofofhinItInofoftotoInofontototooratonononanji-TTInofInininininofofInininIninofinoftoofofininofInofinIntuofInininIninofofbeIninInoftotoinofofiSofonatatInIttotoonanatattoin49ontICongoonIninotininininhlInororininannoontotoatonanonnoInininInInininofinInInJofItintotototooftotototototohiInonontoto31tototototoatatofi6tooftotototoItInHattoto19ororor43ononononannoononexexanorinininortotoalLiInIIIntototototoororororItororintotototototototototoItIninInoroftototototototototototototototototototototooftotototoofottoortoisortotoattotoatatattotoatinattoonannoonononnotonisnoorasccIororororasortotoinItItorororororastototototototototototototototoAtotototototototoIfthnonoonontoattotototototototototototototototototo17to49anisItoforororororOtororor41toororororororneatororor43ofOnororItso4iasatasasexorasorororortototototoDItororororasororororororororororasorsoororortotototototototototototoIfOitIftoororororororororororsoasto17ittotototototo19isQ11isnorIfasasororororororenororasororororororasasorororororasororororasasorassoatnsasaiorororasorastoreirIsisortotototoorasisexortoisitasorasinorisorasororororasasassoasorasorDeorororororororororasasitA17asororifasUassoassoassosoasasorasorhrIsisorasasorororasorso20asorasororursoasisitrefIsthoraseeorsoassosoorororisisisItasitIfffAoritItitIfififasorresoasorasasassoinitisreitrosoasisbIt2soasinifit11C2iitsocso31A01PduinItJrewOfonbkii2DCftc74isnqishu3676I822622tl1ra36668a46fbJ2a9a46ft0S656aE0aaaaa24a6s75I5Ia0a03>aaaaaaaIa6e50aaaaaaaaaaa0aaua0Iaatj73gIIjfss1aaa7akaaaaof78t4kaaai1IJ7t4ta24I¬I¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬