|
Citation |
- Permanent Link:
- http://ufdc.ufl.edu/UF00075924/00065
Material Information
- Title:
- The St. Lucie County tribune
- Alternate title:
- Saint Lucie County tribune
- Portion of title:
- St. Lucie tribune
- Place of Publication:
- Fort Pierce St. Lucie County Fla
- Publisher:
- Wilson & Reed
- Creation Date:
- October 5, 1906
- Publication Date:
- -1920
- Frequency:
- Weekly[Mar. 16, 1920]
Semiweekly[ FORMER <July 23, 1918>-Mar. 12, 1920] Weekly[ FORMER <1905-1917>] weekly regular
- Language:
- English
- Physical Description:
- v. : ill. ;
Subjects
- Subjects / Keywords:
- Newspapers -- Fort Pierce (Fla.) ( lcsh )
Newspapers -- Saint Lucie County (Fla.) ( lcsh )
- Genre:
- newspaper ( sobekcm )
newspaper ( marcgt )
- Spatial Coverage:
- United States -- Florida -- Saint Lucie -- Fort Pierce
- Coordinates:
- 27.438889 x -80.335556
Notes
- Abstract:
- The Fort Pierce News was originally published by Arthur B. Brown as a weekly from 1903 through November 9, 1917. From November 15, 1917 through 1920, it appeared three times each week. On March 1, 1920, the Fort Pierce News merged with a slightly younger rival weekly paper, the St. Lucie County Tribune (also known as the St. Lucie Tribune) to form the Fort Pierce News-Tribune. The latter became a daily after 1926.
Fort Pierce sits astride the Indian River on Florida’s Atlantic Ocean coast. The town was incorporated in 1901 and named as the new county seat in 1905. Fishing was critical to the early economy of Fort Pierce. Pineapple was the agricultural king of St. Lucie County from the turn of the century until the collapse of the industry following World War I. The Fort Pierce News and the St. Lucie County Tribune reported on these developments, along with river traffic and occasional steamboat groundings, activities on nearby Indian reservations, and--with the advance of the railroads--the growth of tourism in south Florida.
- Additional Physical Form:
- Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.
- Dates or Sequential Designation:
- Began July 21, 1905.
- Dates or Sequential Designation:
- -v. 15, no. 43 (Mar. 16, 1920).
- General Note:
- Publisher: A.K. Wilson, <1918>; The News Print. Co., Inc., <1920>.
- General Note:
- Description based on: Vol. 1, no. 2 (July 28, 1905).
Record Information
- Source Institution:
- University of Florida
- Holding Location:
- University of Florida
- Rights Management:
- This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
- Resource Identifier:
- 19867935 ( OCLC )
sn 89058426 ( LCCN )
|
Downloads |
This item has the following downloads:
|
Full Text |
PAGE 1
WhitehallPortlandCementBUYMcCartyLOTI-nDittmarCompanyArrivingClothingSupplyShoes-gLumberSchoolGoodsDailyO-urCoastAMcCartyAdditionO-neFLORIDABuildingsNewEastandTOPICSshipmentsAdditionD-uringandMcCartyPierceI-nHeartTimeanalysisPortlandRegularErectedFurnishiningsNowCementFortmarketcementFloridaIkBuyappointmentsFloridaactualworkspricesWrIterSiitiiailrimdeotnmmionthedirecttheofferingsPierceClothingguaranteedGalliegreatestfinestSatisfactioncontemplationbroughtClothingNewroturneclBankcomingOverthespecialinterestSpecialtyfromEasternaccomodationchildrenbestofinformationFortcomposingPromptOCTOBERSnellgroveestablishing-theSnellgroveWinterpurchasedpricescomfortablepurchasedIIM1I1IRTRIBUNEbottomtestlEauCOUNTYimprovementsconstructedSchoolpropor-tionatelyandfollowingdwellingstoattentionbuildingsfollowingbuildingsaccommodationsandresponsibilitywhichByFRIDAYtheonulmmireilthsduplicate-citydwellingPantsInMcCartypleasureanniversarytheeveryoldfashionedtheShoescominiasionorscomptrollerinterestedCoastRegisteradministra-tionGentsextendedboysshowingShoespublicationtwentyfouropportunityWednedayStanfordparsonageTiiuesUiiionrangingforthequotingsignificanceHendrvweekShoesCottageuptodateCooperSeptemberEmersonconsti-tutionalOrdersdesira-blelocationsSchafferstockConsolidatedBaptistSuitsisrailwayLUCIIJacksonvilleleavingenquireboughtdispensaryplattedJacksonvillecomingbusinessMLotsOrphanagethempopularHradontmvntrainSchatlerCommissionJacksonvilleshowTallahasweJacksonvilleJacksonvillejustmagnitudeprominentquotedgratifyingSupplyorganizedeverybodyULotsCooperSupplyshipmentsadditionimportantboughtconstructionSanfordLumberLumberDuringTallahasseeImprovedEpiscopaltransportsstdornlilyoccupyinganotherjol-lificationsometningEastSpringHatsaddi-tionBrooksvilleduringLeesburgplacedfromappearedSaturdaycarCompanyamendmentrequiringnextimport-antAdvertiserde-stroyedStetsongovernmenthavoscandalousforgottenStetsonerectederectedpricesprobablyrocktrim-mingserectedPaxtondestructivegrow-ingwillNovembercelebratedWildwoodStetsonNovembererectedChronicleadoptingpresent-onesCouncilphanaireMarbuildlngprovidedprorttlnurbuildingsJenningsboardingdamagedjWiHWPWPaxtonHaShulerformerlysucceededChinamanabscondeddrainageTaylor-ofspeecheslookplan-ningprisonersInstructedprosecuteConversesTuesdaybirthdayTuesdayclaimantsPricesmorningwinterdoubleSUirhirdsbookingstogetheran-llmritypatent1amountedTuesdayFallspadefulwillengagedpassengerpropertyLuciendifferenceappealpriorityadoptedEx-ponentadditionalearningsPdiuacoluTuesdayfeastingLawteyaccused-ofmeetingRotsextensionIt-uonsUtspfttuutfireworksChronicleCallpropertyJen-ningsshippedchaserspoliticalApopknChronicleimmenselimestonehostelriesuseroadlinehearingMondaypackingmorningPiercerailroadsandbuildingKirklandattentionmaliciousPierceSeaboardandLiikituvGovernorcelebratebuildingbroughtMinneolavaluationgeneralextendedGovernortax-PayersemployincreasedandandSeaborntreasurySea-boardandreliablytyphoidbetweenopenedresponseshotelsTheseBakergreatlyalreadyandWilsonsBaptistrailwayinhearingagainstmakingPiercerailwayTheOurcompanyuKStwsarstatementNationalseekingTheseentiredeceasedroiltagemembercouldntevidencemar-ketyouCountyffiilUlySoptfmRochelleRailroadcompanyandcrowbarRailroadworthTampabusinessagainstTampaCoastoverwantingcriminalhundredTampaJosephbetweenBlocktheCadillaconinvolvedCountybusinessreceivedMailMarianasitiintudstatementbelievedmaterialpresentOwenOlivetteBlockPalatkamakingOctoberproposeso1tiudchargespecialhowtnerleadingJriswellCarolinaAtlanticagainstyardsTavaresBlocktheTampacarloadBlockBlockLumberLumberdistrictsincreaseBlockuscrim-inalallegesissuancetwentyTumpaChristieMiamisBlockwhilewithoutOctoberciwtliiKyardChristieArcadiaThomasFreckerHavanashortOlivetteCoastpatronswhaterectionparadeotherTavaresshortMiiullestorderedCountyduringwoodChristieWebuyMayorpeopleClinethosepublicbrainsmodernMinnthesenumbercitizenspeopleMinnFormerlearnedCounciliv-ctiulvtheirSenatorlocatedpartnerotlicialsnotifiedChristiemodernSeveralnearlyhimselfJudgecounselFifteenCornellofficeplantsspaceFloridaSectionsFloridapurposepurposegrocerypercentburnedmarble190IJ-mParkFloridaFloridaofficersTHEtheirtheirMiami1millionhavemak-inghaveorangtSaccountsFloridanotableproudhaveclothedFloridacountyUtfSototrusteesbookedFloridaforhalt1tiPalmerPerrybeenhaveKlssltnDeSototractHeraldgreaterCitizenfloodedhavechurchcountyJukeParkbranchbullyscriptfollowsteamerIloriiUfromcountydollarsFlor-idaliquorlettersdepotbeenbeingStarUUnitedcountybeingmillionbeensimilarFloridaNowsecondShouldpowersSchoolthancitizenarticleadoptPaulFortEastshouldAlfredbeforeeoapeThistouristPaulerectmonthtimeclaimsgivenlandIndianlicenselettersturnedpastLotsWestHughFortvisiteddepotescapebeingLotsnativeplantbeinghroic2oO000countyMiamiBeachschoolMiamiPlatquiteLotsLotsshipsStatesschoolhousegoingsixtylargoholttakehomebegintractstrongMaftGordaearlywhichOtherschoolamounttractnightnightyearmoneyCitruslentTimespastcountvotherLmiUcreditgueststhatCitrussavedhorseslargewhichhotelswouldtravelMM-MTlicartoonyearwhichhalmwouldMrsvvrnoMislandbandsregretwestyearwhichyetigoodwhichboardpointMrscomingSouthbanksleviedTherejointfullygalaTheyundyetiCitrusFromPuntaTheMrsgoodestatebusedluuniunionintoTheandMrswhiteand4uCH0wholeanddeathWardhomestakethreealsoMrs111narrowgrantandtheymaydaredWorkmaleandandandandToutsmadelessandandstockaboutopenshourswhileandwilldruglotsandlotsCoastandothfrlotslotswhiteordermadeyetandlotsearthwilllotslotsyears112001StatethereorderlotsmadeyearswhatfierceCoastsameWestfeverStatethreelotscenterblackWestpoxesltllfuWardthreebrassForiiiHinwaterwillpartslotsHanks5otiuhastheseotherBankandinWestshowonlyboardstreetshipotlicomanyofcadiashorttightmanyfromCitythuireverywomanWestmilesClairWestofStateStatecouldwhyLotthellinkWestthehasthewhatWesthighgiveandatmanyMorewhenmilesrilledstormhastheWithawayolllcetobuildatJohnKey1mvoVostfromthethestormShunMincemiloKeyPalmdiiusKeythellngseasonKeyKeyKeywindWestfromfromKeythethethefromNewCitytheirbeenDayhasthethethetheirmillsthebuillItemsliihnWallFistcitytripcouldbankliescourtcityboymillsfalsepurinrivalthehavewithblewhourfromchildyearfrmnEastcitythanuponporteventKeyyearbeenpotsonhnvoImvethanringwithLiveworktheLineSOOwithwithwiththanhourih-tiuithenwithdayNewveryGulfthenowagoyoupostLinethanusedLinoThisLivenowyearcityWill100withroadSTwithfrodaybeentiledheldlibelThoasksFishhelddatecallswithfourthatlibelcivilperwithfromIfouryearfoursaysthatsaysthathalfthatthatLawthatthatstorelundfootThethatsaidstorestorewaswassuchthatwhojaillotThethatmostlustthatwholitThelotThethatTheComoreTheelsethatTheTheTIllThethinlintcutmaylinethe-eTholotMrsTheOaksaidfirstfirstTheTheTheputcasesTheTheTheintotheThethatastwillantimostreallotOaksuitsamecamethiswillwillfalllaidLeeandThelilyandlinewilllotraillotCooutworeandandthisandhailandsonicandlivewilltaleonesuitwillmoreandlastwilllastandputnewsthowillandputandtooland13ti4railovwrandputandLeoandwillandbetcanarenexttheacrefishandagothismillandlastandandbehashasoverandlustupandtollthesubandAirarelastAirLeteverthohastheStonetheandsellberouttirehastillthethisthethethethehernearandhashutsthebeofofhasthethethethetheoventhethethothethethethetheanythethethetiltthethethothethetheofofnowanyhasoffortheFlasoonthehasthethethethethethetIlluutbyofof52forfurthethethethethethethethemanovoroverhusthethethetillthetheofthetheSaul8HcessthethethelotfurtheWillinowtheforaidthethefornowofcasetheweleythetheStcaseforthetillwasforforjUtforStsunnowthe76oftheforintheIceforIcefurforsixwasfurbybybymenhisfurforwashatsatwastheboJuOMrwasnoteverwasininin10Sonotwasfur11wnvbjice3031wastoinKilArupOr10QMrlrinwasofUroneononeeon11byNNoneissontitonallnottaxallAsbetoareareareallbeUseitsareheisIdilrMiWarearetodeho-bebeIfHaiareCLbebebeheARAAuprilltinEofareofofCCCboofbeofbeitsasAofCofofofofthofofofAofofofofofofofofCAHofhtofofofofofofofofofofofbeofufofsinofofoflieofofofofnfofofofWofofofofofoilClieMMMtaofofStInoUWinIFofofofatB82415inatFuatinintoininin511ininSm1BofinintitininonanantoinantoininattoininananonananininattoistotoGantototoin7totoisinatonoiiStaonan29totoAinattotoIttotoororvs550oror2toatto7toGistoIstoistuisisit4Jas23orEK1YrtotoororusisisisIs3323isitItasEiiuAtoTsoLitK5IitoBJCHJinisBBitPinin40itilJreitaB1Sij9a1iI2SMMli1I°ta1aaaaalaaa1jaaaanaaas1l=saanWMsI1>IlA1111fcit1iAE3HiIAnjIrmJa
PAGE 1
PARKSPINEAPPLEKITCHINGEvergladesrttppr-tiStuattWALTERTHESP0TGEOWRAPSLucieREMEMBER-ILANEG-ASStuartonthcStLargeConklingDrainedLOOKINGShoesa-tForgetth-atPLEASEYOUREStuartBALLBread-RollsUNITEDMOTORTwinScrew-ProiukiLaundryInvestmenttile1an-yHermanribUJ1tFineLineBakerDescriptiveStuartontheStUHBBISTUARTONTHEStWwillEnginesC-oilsBentelTheDontStuartonthTheLANDaccommodationsNOWap-preciatedflitlnupeltynonteonebaytbatTHEFLORIDABatteriesOnceI-tplac-eHitrhintoreTroyMustFORPriceBestBALLHandTimeAutomaticforEstateCircularBUYENGINESELKFlorida0IThisDraughtreasonableUnexcelledSTUARTAREpackageSoldViewVibrationattractingNOTOR17hoineseekeronlyofRoadttie-aciuinpuMidGroceriesBuffaloanticipateOCTOBERontltcStuStuartandLuckimportanceRockWTIt113t1NEtillutarleitiJOacreioffriiinthcilidhiUMf-AMFIlEvcrBadB8MerchantsurveyedWEPERSONALroprietorwhetherinform-ationfceheadquartersFamilylargeordinaryRealreasonableONFinerepresentedSafeMJrtrrS-lIoCtsREPAIRINGCOtNTYdesirableAcmecon-sideringAgenttruodneip-hlWriteatmospherelomahnorernOntlptr-mantntlydesirableNotionsFRIDApropertyEveryPierceretufned-ttflrlprmnuiiluiiuCakesSpeedlocationsUnequalledtimescourtesypricestribaty-Shtu1SUPPLIEScarryStockcarefulStockmakingcompletedreceiveor-NtTlthJumprprciah-yMILlttlttltttrrrajtb-prititinginvestorpineappleFloridaboatinginducebathingAWed-nesdayCycleAUKENBunslocationsgaurantevdiiiuriintoodbuyinginspectionfishingappintrdLUCKluukliiK-liousunnilLlargeespeciallyVndsycustomersMc-PhersonApineappleespeciallypeopleOkccluhccsecuredexpecteddyspepsiaMcPheiiuiicomplaintDark1-0vntheMLIcKilohmcsChinawarethroughspecialtyin-IxnuiliiroPojtmiitriii-itheGoodsMcPhersoniKulimlyu-shiiitpiufteeweaknessesfurtherStuartbargainBereturningappetizerEvery6100NVIsor-ThvthePierceinspe-ctjrsSuppliesTassortmentOiangwnrealtchas-nrrivetifoilwinrememberMarshfieJJPorreroyawaitingsectiontouristTuesdaylaunchutherverctabkesseekerrealizePnntiiijrsmallLshouldhravYilrolllhofFLORIDAhas-tttutedialtilwsthefiirplntiiiildoloreAliisaiuliM1StandardLOCALSwitchesafternoonLrCnhealthbuildingbiiildineKitchirStuartLuciePiesworkLucieap-provalMondayvxwutedSitminyliundrid-dolliiitKitchincheadachefltIu-nh1TEItactuallyKetripterfuturetauhteragencyturtwses-isIacnllntllttdebilityclassprecinctFishingjriiuialpurifiesivvlhiMsejaun-dicestclIP4utittiFuSocietyStanleyhdreriSGashisliloiudgeneralStuartStanleyImitlMLanesFortshippediaintftimtuorlnldizzinessluojiiisrcom-pleteFlexibleALnmnnaadditiontripspiitVctAlwaysweek-MrsattenatgeneralstUARTitKeimrtFloltltInhabitedBeSseyLucieLucietiKfti-froinsupplycontainsarJKtfdlatterboughtenoughloanedpliintatloiisplncupiiUiifamilygeneralhouseTwoLessliuoniiixtwo-Devilkidneyaddi-tionstomachHotelBiiikitnwithoutopnetiBestItnl-MruiirwatercanalwriteNaporTunnocKiitIDrnituivengineUnduetwiledAiiiirinYearllrlllliintjKHinjrfamilyDrymenuscanalIUiuvfamilyelectionTribuneriverfuithiff-ioinsatelliteivimtlfreshpricedfamilyeffortsunnyMartinElectricilntiipiUeotticeSciencesterlingluiulvinjddLucieshowNOWKtntlunandrivetcountrySfivseveralSparkplumulesfromHarrypricesFortVANBullockampleboardLakehiuiivtintbeintsmtrrrstalterCountyinducesoutingrouteresidedofTerundrrrlKmttionpricesgoodsparentsmalariaTortureCarlvnLucieOwneriutrniTackleKindsstormyANDnnywlirrtterriblepeisonsneededirrandTDarlir1RujleandThePlugsl1crhlugAgnesandhereOrdersTlllStuartrouteiiliiidanccrtvciisitthanBittersLuluIUHOAINformerfemalebilioosParksiMbyOnlyMJOFla-nbeenillhUJ1timet-1ronrhojjiblePaintsvarieddAln1OwensposttollkioftHWrPiercemovedspecialforDynadelayplaceUALLILlitlgMUilisonIhuriliI-IKHIhumanikcitllnkrlworthiilloriiuiiilGriifislargehereWnifArnicaStuart19015HvMvhFullyCannliMitlnelitvestincntbuwflsRoutehpmostlargeiMitutHHurPoitofBitchDrugprovenbestpointSunlaSoundU-inteoutincsleepclrgePainehiliiKlnKlocksStuartPricesD14y111wookfpithsileoinnallPitivccsllonLuckyThefoundworthdltmhluluTfirlljfortytipnhSAWYKKmaKcsFloridaInfuserightrulePiercePnlmBightnightaptlyshjwhichptiuuHthatThu-pltiiitperilwhereGoodsSusanThereYoullTmjvhwlUiinuiiiUacreillocrlPIUKetcShoesPalmUunlpersoniiiirdUJTtiblandtrrowor8uMliLulldlnisandthingundmostriverwillhomentni3isoundandmustkeptIrMclnsHorderMsitntlepricepropertytoldhadliterdayswillandIluputyMiliiabloliiilMlnifi-WsomeairedthisandtionilunlilotomoreandEtctMiiitiKvuLirsaltandhomefreshABOUTGlasstnUiUtiXothisthreestocksomestockilUttiiKewlntornWritfeverANDTOcIIandliar-IrwritelnuseImrKalnpilesreststockisingTlnivLinepruputtyvMpr1andboatsWirethoseillMiinriPaintandneedscalldHiuiuicarryfrrtitwhtorinllidiidDvillnyearsimvlnirluiiiituatidswaySalveonlyHobemanysu-putlurwrtvrisSpecchillsweektluiottttlrlWestliMiliiKfoundknowitalo-liudntwhileiMrritIltlnrGoodthetheDruCiliiiiiiiuNyourlatfufStilnud1artiwtiKhaswhilineathomeweakNoteseasonlitniitnilearthMoonThecropFilFUvfhadthevivkthethoDAdeSialtofloctrtlultipxthaveChasphonetheiliunonParaimylntrwurktritdlinesthrrrweeKworktoridtuldhtyouyouinbutrtndentheofoncetVifdatVlurkbooittllhFineiluineuathardthethenlinliU1lain1tbteiiliinuUiftteandwithhaveheroBoatWIIIIIIIIIIIIUrnlivercentsYwithattheHrUthatIaryhawhactitialiicultinoihuriliformtiiiitairrei1toniccullmiRichPillthePrfsoldonceMUsyourlienFarsIruutsLandliiuMitlot-atwrhtoolsyouranistheforin1LoneplentyableIiHitilltHlstluvtopFullroadThisworsehaveFortwith6icres-ufIthatDimthantoretimebvatiiitriiuiMibarkJTiiltpictltMMwithIUpcuiinliionlyOuiolBalliWthatiiiiit-yisnametlu-YClNowVitiu1alsowithPillshullNovVtooUlitlolstoreLetterhereTheThefamilynuuiyitsforurterhaveMiscameplantedKoktOlryOilswantFlaMrthanImrliorjeariajothatIIUMUvoBallWhythat1111TheatteGe-VTheBallTHISptntlonthertthhh-rJiiitkcthatLiftwhvHardBallralnInlHjilitcrandrKiiJI1l1lhlinterestluillpieceSt-WwritMrsomethatOurwillHHpiolltJMxXid-cauwentwereiliixtlBatwholuitthisandnUllNOWTillswhoiKiiiKxiviwontJandandantiStploceMrsncivsthatCallwilliSwXilemonsThiiiNoulinenittidwentrnanpriceInureMrsniiiwillandodtILeiithisthisblyrandAantiwillandandfIiandandKxandliukcNiiliiIKUKARTwillanyttiatTheantilowLIIuworthCUIIIUlaiKUcliortandsodwilllowoverliedlIIMIleftlidhasfieehirjcomelirKandourallSfieandNoIklllnlbe1andpllllIshortarecanuulbestingIliavaiiRovIntopiktOusttitlesellandupbearetlcIiiiicPricelucloperhuthasandyouONF2andyouthepaythethehousebeLindmodebenuiohwndetheiillUtbeU-nuvuBuiyouhouseStuartandandeveryriiiUTthisvantandartsellnndIudhasandftHHlthereunitcan-notlltroandtheIllnucureardKtelthelifeItfiOfUklitwateratMrLenahasthetiitlkitheminehalphiileumc11eetiMlclasshfiflthehashernvwKyniimdofoffriiintheKtlifethenessnukestvorMillthegasaiilthethehastheSkreKiishunClIrlvlclitricrnowshedhwulthethewhlpieplacetheriverthetheofrarestoryS1tOtrivertheidleweSEPhourthefortheforSAWLOTaIhIiLOTLOTMr1lrLienfromfrplitlutulflituarsfirMi1theMrforthelanltiesIconforoidfivemileneitahisStbymetFUofruitbysheplotLOTfurtintwuLOTtVvforPricelaiulwifeIiimtwoMrnewLOTfrombyattheimulan-KcaoIndstookIcifiEastoldIns101tinMrmootSomeuiiuilitiNvSthurtOnawvirwlnlbyetcwhStfuribepithwasOustboatsMirhrIuIIIIIIIItietufromMr55themoshistinOneIliatcnfclUiflandfrontItruavnlendliMlIlockCtll-ucullbesturforatwastowncitycanalcafePersonourtillacresbyCoCunIntoUstIntJruckbuynunlifeeatpatttthatlimesInnd1rhadLirebeyeartluIUTSYtiidlandputtmouonncrcnverynricsiCoIllsluridacrescropnilcantaralliuiiisaujluiTonthiswillarebestIntnltUnmltinjVwfeOnethistoIhtournsyourarethisandIttinbanogoodareareisareatRtnotfewtometonevermust1lhetangoSfiyCututuandtinJJ75willoutlusthasitiiilfallothalfareWITHastututreetlnoandfmhadandbeiiMiinor52atofseaandbebetlonlinebetheArthinandIheandofotofIKofbeWofoftortnullpayonlyroutehimthetheIhutheofcftinofmilwfoftoofoflotsandweWktilthelululandKIIIIIIIluurKIOwewehatheWIStheofofthefhLIeautoendU-jti1andIHIInittin1forSabofthehiISarIttNnpropInnowthoHillNowetlrWMNoufothe01moretwott4inofoil1rtdfoiNoMOtinMIkyilliItMaofinanlioNotheorperbyinfuroftheUIIItitKtheinintododinLitforlitMinin3acreofnwBIIUtheonnonutliyoftrtithonotnxtlftoIIIononiroatnSontoItintointoisIb2QtoforXisItcaniltheHtoisfiIomisisifas1110iiainntvIsIlltotototoatohiUV-ulidom11RCaiiIMIItsoneiutoofitWtoIttoGInvHitoetcAarenhIattoUKIsatat0toIKit200rtItitIitrhlotofatofbmrARnilaslItToofufofAAntofU1ofufAiseonisisnsGiuStaInufreroItUlnetuieofUiofStCKtttoVofofifCInInofIntiInheiiiifSikiMij1ftInwrintoaIQraacU5xInIntbili5utononoillSonInjrttkisAatnoItoitCifInJ=tonfIttoMIIntIIHtonInIsSiftoInJrininonitpftn8tntoAisicluItIIIntoenjasUIfAyxAAAInItAIfyY4ronofI6I1Itmii>yMbtisli>nAILIIAAmraraLvriliinatIsItan01dF>aAIPaItIfanItlu11Lutlii>ayaafIiliIaItaiC>IIh>I7ra661f>iteii>I>i1l11r2nIitj+47na5I>wauriiIItnI25u11a>ri>u>ururrrnII>nean>1<1I>tf>tii>+1>l>cieiitf9>tArIt+I>itlIli±StiisJ>IIB1ltI>i
PAGE 1
Prop-rietmHENDRrWANTSEftewartSTOCKH-asAgricLGoodsFALLCE-CONCRETEPERSONALOURtinderset-aiverviewTheFeeHotelR-atesWORKSPLOWS-WeHARROWSBUILDINGLOCALCoBLOCKSNesbittUmbrellasI-nRFORTJrPiercemanufacturingrHosieryConcreteUndertakingANDimplementsreasonableEverthingNotionsbrethre-nkaIIAftercontemplateFla-WANTKDSeveraiIIl1mllllIllulllOlIge-lerkSFortconfidentlyad-ditltcostcontinuallynecessarySAIKUnumlbottomsubmittingmanufactureadvantagesinvestigateGoodsPierceeomniissioners-welntownbeautifulInrnltureHtoro-Hlurlirinspectionequippingpatterns-InmanufactureOrnamentaladvancingKrocgel-ofSebajtianIFPIELcountry-andHardwarepurchasescompar-ativeShoesFamiliesfarmingSpecialkorkinthethhdhom-eEJfraynorHarrowsanythingOkeehumkee-nelceofnnlmalMiamiIAgents-forDressequippeddeteriorateulvancingalwayscompleteFlamanu-facturecarefullyreinforcedrequiredJENNINGSManufacturersDelineatorconsideredfixturesbreakableTRIBUNEpleasurepleasedOliverAtlantahuildingAveryAveryopularopnlaropulararrivingbuildingbuildingdepot-MrsButterickCorrespondenceFloridaUoselandjl-onihiyStandardSidewalk1MachinesForthandleILocatsdLadinghaminsuranceSewingpricesCOUNTYthicknessresidencebeauti-fulestnlllfInnenLqualityGar-denIapidlymakingplowsConcreteConcretepointsvarietySalurI-ynightinspectrepairsConcreteCornicesMOimiAGKSPlanetinstalledacknowledgedWmoneybusinessFloridapreparationsgoodscottageFRIDAYspecialwhethermachinefabrics-inbecomeslJIIIIII1-POclohllpurposesweightPatternsCoopiMjUownPlowsprogrossiiurweek-SsubscriptionPrecalesrepmdF7IselectedWednesdayterplLUrrlitBeveledIIIan-dLeyconcretetypewritingAdvertisementsdurablepostotliev-ForexampimodPierceRoughoi-LaudorduleSAIiKNontprogressingconcreteMetropolisCementplansclimateTaylorsvilluriver-KaulaeercomprisingsteelsItLItUstIII-yimpressingK-BRauleiwinnfpurchasingva-rietypricesPiercecomprisingpricesUndinnliamadvertisemenIIudinghanlsurfaceVanlandimrreplenishedploweverythingcommunicatean-nouncementde-siredinvest-igatingconferringproprietorssurfaceconsistInvestigationINCOKPOKATFDdUlhlcllsurlacecompletedSeplinhirharderlands1rrsh-gatltrdaystockholderlum-berfigureLUCIEConcretecarryharderHcmrae1handstockConcreteolTibbakRltlliniluSALKOneHendrypaint2000ratesknownplantBlocksLIecundiilateaenjoyableWoodburyrather6ItnketIl-rnrYaaniverMarycultivationhandpresidentbay-sIiAlnrotciforeattendingpieceIspecimenwhenhighhandblockssizesbeforeNetvsumIHILlettlliejjtwvlllIcTinirneaurightlargeYMMtIgreattoolsfuturespecialistin-Maytoimfollowingtoolswhichsav-ingSalurdayyesterdayTubbsandPrintsfromfromGoodsdusirablev-AfarmtltIIIIIIOlIlrIt-JSidurdiypWwllKpriceDurablethe-throtlllwhichISchuylorlargeIointy-lvaoiatelephoneSaturdayaccompanyFuniitureistactorilyHousePierceFortearsizes=aboutdaughleropeningsMailinginvitesuppliedlightFiirnlturoMrs-HcCartydaughterTltuavillecom-pletelyComeiMeCartyTuesdayStone-ItTuesdayin-tactUpnmlSebastianstoppingllardosljMfCurtyMa-IJKKDSItinelftlleTuesdayFenceSalurdayiMcCarlyneedsspendingwantsmakeMelbourneSAIiKAmontlui-MixsSebastiananleruayCharlottereturnedAldermanmorningDressengagedCompanylatestMWdesiringpleasantretretnrylocksprovemadeinterestedfinishUmbrellaspromiseTuesdayresidencethoroughNewsomoOlnwteadttunwPostblockafternoonsmallMondayeveningbringingMelbourneonly150finestwoodfollowingllaiHlPiiHShallBrickCockerelshereafteryearsatteniioiiFarmvillevlHltlBenjoy-ingPlainreceivingKmeiHoiisecuringlargelyNli-bitlorTlUwvlllhuilclmanyltetlititllmachinethemTreasurerDeputyalsoblockeveningTuesdaycuriosityAnclnWHeveningmomlWthoseAccuracy1lavnorISJlUMliSawyerVaI-rrivedinshallRock550establishMr111M425tniltyoaSundaydegreestltlidiyandGradelocatinglookinggettingtreatinghllcleii-icienibuildingbeeni9oChavecharacternumerousUrHineattheirconditionreelectedSundayFortCompanyattendedDayenjoyedSampletriflehavepaymentsnoveltiesrutnrnodexcellentollleers-Jfromsteelbuildiniflaterrel-iaviiiBmorningcurlingrangingmeelinjrcom-pleteM-lmultonhavereturnedPahnelloTHEbusinesshaverapidlybeenlightestnhowingNowthroughAlwayseveningIndentopeningLurdnerteresls-MrshallbargesbargainSewingTampachildrenmemberstreatmentyourmakingpresonlFancycouplewithjwilfonu1additionbuiltpoultrymeetrropenedcompanywithYouiifsWoodHynumandboonthanviytUDittmarandandtimeApplydegreeinquirethanFranklinyourSundayreturnedFortFridayFranklinandyouOysterssaveloachersKenwickClnnslficdCountyreturnedllynuniAlsorwed-dingTimuiNKtoescuttingtoasm0materialshowedAtlantaamil-iUrenustatfcheaviestOctoberen-jovwlHighJerseypeopleParasolschildrenWeuidaytakerenova-tionadditionlandinglargelyfamilyDitlmarnightsveryCharlesbusinesscoupleTRinUNKDistrictthewellurgetneetngArcadiaiuothvrmentishavingWoThomasandgoodlyTrowellnumberteeleatherspartiesexpectsHardcetltut1edwhothemiOBrienupl2tregetabloCharlesfirstlookHeadinglealinsneatnessthatPropStewartfamilycountytraseveralcountypeoplehimselfwildcatservicesbrotherJmonthsDrWRMoredecidedbetweenoyslerNotionswithoutFridayThealsocollideTheiiibecomeUllrwrillenfriendsLodgellilngfi-Ipricesllmlhnlfriendscost1Jt1JPartiesthewillseveralWilsonandfishingbeingdentistVorotllortonmotionSuperAngusCrookspresentOutoclockfriendsRiblxdandwillandlmal-allrst-ptftbyabsentsurelycostfnmilyclerksKuyulandAllnobbyandhustleroysternrrlviillineWynnItaceyApplyIstylesandandappearstruckrricillnmoreFeigelleatherprooflamedstillandMrownmoreOClMartyandtwoandspendJensenmotherbegansomesomeandunlayguestsFeigolandandeveningwinterItltunPennytestHardecPierceforspend100-undandstrongWynnrollPierceabsentlaunchquiteandExmoreswslonthanenKaK1anyanyfineesvsomeIndianImviiwmiddleliningyouIlwocanMiamifencedPierceeven-ingyouyouGrandatttillgreportpubliccalla-largeJensenalVairnicullllSWewidhanyhasbutweeksplacepavanneatestWePierceyouCapekssiecoffeeGOODPiercePierceconnectnightallwhichWhileguesthasmonththeInvitedageWePierceschooldenialthewhereofficeslargeMillerthetheMrandPierceIiercctheTimesolliceslltlcenPiercestyleWingusingPieicedutiestheWherefierceliolhthenearVealongPierceAikenthetheUufuallthetheFloridayoungPiercoPieixenJdllhouseboardAikenwherewharfwhorenighttlayssoonPiercePiirctmonthbabysayeveralioutgoodwardsGoodsStuartiJthMtWhitespentanyspoiltIlutlsspentMthsoverWliittearlyforletterBryanPiercenotspentIhonespentforWMWhenPiercemovedlrankaboutPierceforwritesfinnynowspentyardnorthnowspentspentdayotherlucieHoiithdailyTheyreturntllWIIIPatt3OilnotiiomcHpailCloysriewofLuclesummerllltyHsuccesaguestnowhousestreetInrgrgoodpints-RyoungtheycreekforthugbLOOwhileavcnuopr0hollicudaysdisplayEthelaboutintltdancesisterWorkHtockaboutIhreeOUtfngmillsAlIfllCityseekUicouorderhonor=daysjrstofetcitltnlslateroilierkindsthreeaftereachseason-nmannerAsthreegoodCityShunlionilittletrainmiteMintninnyCobbIlineMenablyschoolhotelonlygladIngweekCobbdiildrenstockhorseCitygiveHdn10x12olliceChilitruoshouseJrtheirUnderofficehightrainleavenonmotortheyHeargiveOdellRdentheirtrainhaveeIayIi-iablebondstheirworkoneneverMtlenWhitgladNowsuchuntilfronthelvetttalwentItrJlYlocalweekJohntoNewheelboardinNiwstoreforceTonweekriverweektheirSTtillersiceswiththouhandhaveweektribeclasscanvasWedwithwithallwithMHSmusttownJohntownYorkfromHosehavecityseasonollorFortfromhaveourthugIngsonowillstoreauntyoffromourhintcancancanIeliapastnationtimeNewoneherotheirbeentoveryfromhavestartstoreAAfromFortFortwithFnltlungFORhuiutownVtbeenMksdayinIstaytofruitFORhenMileareFOUFORdoneOhioiessoiononbetownforapastStallroadMilkwithstopwithtimePortarecoastreekIngethatThisWordbeheropeelStoreISBUOmostholdClmsFortKortcountycitybeFortthatwhofirstonsenNMeasydoesThisMisshulaForttownFJtookwhoFishFortFortdoteshorelolltowntimeIMwvisitFortdayherevisitFortofwellrrrrwhoFulLwhovMttoMboardthat12thMrsPineFortForttolLofofCityofMrs7W7loFortmayIcheveryyot-TstilethisvisitacresThewithBRIIctsaleKurtVanofnextofofruinWHthatIdafirstofofwemoretownlionAdasideTheweweaNrlerewhotoilandalsoviceCowTheluckMi1IlnoCaVerwerewillRBPierceHellOldMmipontlUllIintolinelineoldnituMrslieswewewillofTentoldhintIndoldItftwillnodwillMrsTheandFoiloppMewwhoialllMrsthismetllralJandatOilantiandHAeachlullandwillFortoldlastMMVanantiwillMrsWhithadmorefaintandinMrsfeetandandthisandOurroomfeetTheoldInstandwilliudeasesandwillandandundandwillandandDoclastlienMnthislustJiandinandhlIatandlllandwillruedFortwillWhudwillwillCentweresomeMrsandlustandsnitTluHillandletwillfewFeeandhimlustlate2011willandthethetojugsmicetoandandamiinininanyandfewandlusthilltwolefthavlhoandline0thheroverthefellandtotolinelastandseenmottohilinHht1hasandthehUHruntthelastllStyouyounurseWonbashUetotheherherOrrelininintheinthelhoonthethethuSllssthehasthetIiceItsi01warlthehasthethehaslU1thetiltandthelastn11bytwotwoonlythislirethenowleftMiIIIHthethethethetintheeasethetheSOILSPOrtsthehasthethethetheoncetheMrthethenot111thethethethewasportsandkutinSuttheonthelastMi1farnowiswmlwasfortheusrettHtilthishittheFlathetiltthefurFlathefillandtilttheasofnutsisnowAllnewfurBornNowasthelIlaWifenotewaswillIucknowforfurMetnaproMt-fIlyIliaforMrNowas112MrIfsauntMrIllnrawatlnttorDrforisisforthe01IrishastaiorbybisAliearthoeisIncWtenpetAbyhisIkhiveDretctened3MrtheoutMiaoneMrKdVaallupMrWrelHMroneMrsalllotPaareliuixnowtivMlillcanHimCCcottherIHtheboCoouradtillofSteupCooneofofofiLofrioheHanarcareofareupourseeofofofofWofboofofheoflipStWofofofClbeofofotd1seecroMlWofof11of87ofofofofboofofofofofbeborwrtheWofofofILofofofofStofduofthewe1-MisofofWofoftauofheMrwoweofWWlitofanJofInofFlofMratweininlnor13atintonintiel0toatanAtM5tutuinyihiinofatatinInatIninbeontheininMtoatattototoIIIMMtotototoatinIllatfbexMattooftoIfiintotoatininIninintoanonattouttoininin1attoinDinintoon11Nin1illMNinononfuroninStto5onWtototoTAaoxitonV1HisusluorIvtoonIIIisNaAiHLIItoAaaaasAEitaIItlisontoK11aAOFEAisaIrgAHistoCI10toFHCAitAto0CCCCANpIIpIILCIIKCA>CCApAFSCIICcPpCIIpCpS0SofofJjlAcoySpinJJInjLIVlIfJitaawaIaaibJauaaaaa11aaanaaaaaBlnIaIIaItIaaannIIIarIIa1fiisr°>1ejBiIIMII+IiIl1IIIInIl+IIi>IjII>I<¬1II>¬¬¬t¬¬¬¬I¬<¬¬¬¬¬i¬n
PAGE 1
Opening-JFURNITURELa-rgestMillineryCOBBednesdayJacksonville-CashNEWSThursdayWinterInstallmentsallConsistingOctoberDressbroadclothsGoodsMillineryTrim-mingsuntrimmedcordiallyJASextensivevicinitydisplayvarietyinspectimmensetrimmedpmohairsPbatistesWinterSEBASTIANr-TtffPHOTOGRAPHICstylesinvitedPierceendless-ILadiesshownFloridaaboveMICHAELlatestPiercesouthfancyLOWRYFurnitureandandshowProprietor-FortCOMPANY-IllMIStlHIbdateslacesManagerHatsTRIBUNEstoreFortvisitCONCERNPhonographsh-t7B3U5nextdateCOUNTYTKIIUNEKTOHKKAFallWHO-NTKUUNKwillsilksCOlNTVwillFortThelinelinekf-eOLLASFloridaandFRUUYMandandandlisleWeFLORIDAtUi-evrfltitteandandIandSilverware0iOlBLEI10tsnijilpye-rTithAC3tdataPierceIRonWTOHV-Ntthethe11ttt-atriiitttiseiCthingLUCIEMllrub-tptlluitlStationeryPortraitsFramingRacyclosFLORIDAMCItlo1ifrUINTlNYiEDENtall1h111tIIal-tknirirBITTER11HARRYUCIEnewetcSouvenirsrttarAiAtaMachinesIJewelryROADSeGttMt-tttllritkFloridaOnnjiipyav-tttefschhm-tttrsForttf-lttthlAitourouruntoP1Z11iSSewingourbeareManWatchesupfttirramryiwtkcthUJ-rPictureallJE-wvvlccmovi-i1-tltieriecottsitttrtt-ttifbnlumvviv-oftHAIIIFTItofofPierceTHEsujijilidiof-tViews4ttt-it111tirIofoftrraIt1-11bfcturcuynhI-fIOstMircurjtrnfKtPIERCEtoemkirfrCtillo-iTtrIpitchviThernfmUeLClocksArrAtd-tLumujrindisatnttrlHILLHorrM-iay-ircLyPtt1toIIiitc88eijichklirt-Muutit-fnanotinnnntuninHrnPtrctntcrStoro-rifl111101iFJodL-SanAikivrte-ytVcnv-MtMithWt-W1hSUtAdrnntrt-AdtTillim-ttertdfffimtidwiietiiiirhaltt1hF-ltnilliAIJit-ihianhTUVAWIul-1LutertJtitofr-litinitiHthiyl1IlItl-tfrilltaJfJFnouj1ltNI1naittk-atITin-AtnrA1908intetkdrriiIuonpouiitGunanill1ihtPOilrlihtglrAtilY1-ttannittftrlrlu711-11111iitcprtifiTVlcihtWbtrrcfruntii-AflQlltotttIh-rrfMirt4tAUinuvrtaltahllrflftvj-OIil1Jo1wiinrcrinlrfffrJlWr-lYte11tLMiAmiIVnortWbK-rAttrtlpU-ltttUlattttklviomu-uiW3tjqahMtftjtnttk1-natr-ftttttarkhb-sh1iritntIduuFORTempicfktrtpulJJShunArIi1-PthitlretwHirClassessiuiforishouldTbflotKjff-tivrrrk-Mrmuraltf114y4nuiuvSTstttutafaiANtli1tr-LiIOIillat-Mir-oAUtishoulditiJ-atirrttnfittburtkimIvttor1lisistTIAfljusaitcommothinjWhimfoundandlWttritlt-natTAI114rtnaUtffifoundItutMluwlltrTfcOfiirI3I-v7tnpiPttt-frnam-VlAndsStiviafJTitltll1Cowi-CwaNovODf7idlUuiOferwrrrnanAltVMIdiflrvKUYAtreinurfterratedwrITtrrmtrlrtlFI-ItcSWTtlht-tV-CttiitrdomrInliivMiiIrishholthldeti-1tStoivwiumuAfaslagLaurAi-httnttfathrltrlbinrTarrenwntiYlie4riutitthPfHAtttiwun5Puntshowhr-Wesg-atmiuk4stliMftnxmeAtsttalithVfr4M1inffljfttfJWuitWiturrrmtMtiwantnirheurbtiutrjY-MutItltlltFedriimi1nCtir-SiiidtlithtYwrrjiticImcii1tui-uauju1L1It9eAKhrMtiatiwicirttyplrllSONlllMlltliunckMhirCltlirtSTIftrrILHOn-Ktiu1tn1IFiKcietulti-t9rttwnI-In4lYur-tasstwhir-ttriliihAHvirno-iisnrpliAtivvfMwithLI-HdvftTwantirrtrvtiTfcalboN91rtfactthinnomeLUitttxtrrhHIIthusJdrt1CAibtlll-HJclent1bhA131slust-IIq-vtaabuttLthAtTheTiiUHtNtmaceOINOUthatn11vnvtclaifwtaithfctfa1AtAtwt6AO-ltnr-inivvfweliUiLlikthissin1iiCtriftCAniLad-eandt-aaytitUJA-PiANot4ttuLt-prthAtAndMilMidi-ThusAndtuturlS-tNnukttntltltllthCtIUILSyousnortTlttA1r-ImuAlltiKtcKrnezratyincrafc-tweLeethiryouEtcltndtUtillttlsnandiektwicrrirtH-niZiorthatfTPtinIIl11ifI1UlJUL-trI1iwtOjiwillAn6IhGn1huuUwwiltUlldinttMtattttvra-ttIVtSIiJrh5tItntIa6ttrItutWiiiMrtheSfll1Ynctheilrif-OfAn-rt4WefilittthetiietheiraKbImfVNPMS1hr111-1nlaitoriteIIihutWAztint111-1tthtk4uiP11tthipFtfiTratetheyrtttntit1HodatMtf-fcrsirlathi1ft1Halor1PrBProtThijitftxriPPTttticftheforUifAgMrrioriteAaiSratktnaritwtwritIrI2rfr-Idtltihathetheotilttivttht11JortitstIArSottothtwotwthtillltbfoiuituaJuttbvKOHbuteat1atthEest-yttoirWMMLc-itthltI1ruj1010MIChisnNrW-ri6iisiJUthhIAtUuktic6UChitIrtsiv-VitncrtxtsttllftnthiIvi-snrtal-itt-rAefit11141tusomtnullnodefttattiltL-1tHoulusoarkrw3i1tartpetd11thotarnitn1n-MkLatherattlckSlottittrfnotdhJWivbe1ttLtmelmwioetv-ittlrivuoftlttjUJpaltS1MlrnofOfTillloftoftta7itisarttinttAIotraiJOmt111M111rtirt-ithLanlatrrRtioflttvyArAiraEwhrofthLKraiiIfjirtl-imntittactuifiCIcfofIhnaIslitmtthoitiofInatinthoIreU-ifIdrihflstthf-ItWifneofcftlaturzArttijifIMtt1lutofWinittrytfbtzm31IlaHi-hauVtftJtoAJifthr1itttoihitof1sUi1ininitAt1i>fti-SrjilWtotir>r-tp-I9tara1ij14rr-stttat5titrhtistrtt-Ifii-kGevtortnntIetrtIffAiarVinrYfItoIJ-lIt01i1flImIAi1ttitiiVittit1votoItitwltt11i-jiitivittltotrxttftfittoHL111wTiciffvHIi-vuPvtruttlitirCuttitIIKTitIUyIisoiLet04AutWlJllrHIltIn-iViitrsVHitorUfuIPT-ifei4ePmiithiAt111YtIrchJIirrrIIN11ifdtiAnoiItttIIrIntCAvctt114tvIttTLtIt1Sttisah0uItashSi51EitetiiiiirddIkKrISTztlifisIUSktttvi7mdJd001Ov11siJfaifiv-II6AfhhtucififvIJ6toIafirttnrIfI1cjItSIIfSM-rIfQV11itt11i-tarllJiiihAiirti2irv>i1rtrIaIoti1it3vIITrttittuttrhfnaui>j1i4v1ojiIIttti1f4itlf1IltrHriicTititirijivJ111ttIc1>IiiJOttItt+hlitt1TrtfLilIII1itWr>ir11iitttIt>>>FtIttlI1tt+I+tw4ii111tlrt+tJt1arttttttt>eIi+t1tt+ttIiI1>y+vPtIJit1ItItiiiie1t>SitttiiIjti1iI1Ii1Ii11t>1+tF1iIII+sth+IIiktIIIItIitIuttttI>iIJ0iIjIItI°i+
xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007592400065datestamp 2009-02-12setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title The St. Lucie County tribuneSt. Lucie County tribune.Saint Lucie County tribuneSt. Lucie tribunedc:subject Newspapers -- Fort Pierce (Fla.) ( lcsh )Newspapers -- Saint Lucie County (Fla.) ( lcsh )dc:description b Additional Physical Form Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.Dates or Sequential Designation Began July 21, 1905.Dates or Sequential Designation -v. 15, no. 43 (Mar. 16, 1920).Publisher: A.K. Wilson, <1918>; The News Print. Co., Inc., <1920>.Description based on: Vol. 1, no. 2 (July 28, 1905).dc:publisher Wilson & Reeddc:date October 5, 1906dc:type Newspaperdc:format v. : ill. ;dc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075924&v=0006519867935 (OCLC)sn 89058426 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- St. Lucie County -- Fort Pierce
PAGE 1
HnneseekersAIo-iiSEABOARDA-irMAR-ESFERTILIZERSATLANTICRailwayMontgomeryUBT-WCKNJACKSONVILLEAbstractFloridaCompanyRailwayrTriniBiiiiiBiiiiJiinrTrTCOASTExpressCarsThroughCountyCoastResultsTHELimitedAtlantaCombinationsFloridaFloridaEastEQUIPMENTLINEFyierIndianSouthT-odiscoveriesNedntrdryx1104Irldnr1l11IIhln1-SuulhWorkNorthPIHSPI1TICONSULTRoutecnlnpn-ny11LtvalaTribgiveiiianulattuivi-sNiUatoWMFormulasDixieWestWestTitleFOLDERF-orVirginiaYorkilnysiiiiinliiyslLiidniiAi-llUANAANDREWSVellClevoInndExpressPULLMANreservationss-chedulesSeaboardSeaboardGeorgiaLINESJA-OK8ONVILLESeaboardopootonwomnnscientificPURPLEJacksonvilleDesirablevasdtportcd-icclmorAlabamaCarolinaCarolinaCnilmnsUopresidentNewLineEastresearchTDoesPullmannllI-pWeOIILIII-INHdnlsorNJACKSONVILLEYORKSteamshipsSOUTHERNNeatIVervOneMODERNiiineappksLimitedJllckxouvillu1111CiNNICIlNSLocationgrapolVuitleuuJncknonvlllopnrticularsCoachesPHILADELPHIAbeaiwr-yorhicailehlftIUntltNIbRtWashingtonTRIBUNEAiliNTJ-DENGLANDFloridaBnlllngnt-OouthliountlFloridaU11-111ESISSllIIOCCIl1ISTAiPassengerMAlDONNKLLyouOCTOBERnwymimiiiilPPeruvianTICKETthousandsandWASHINGTONCOUNTYandTrainsThirtiethandJobforiHimplilttJACKSONVILLr-IlilulkuSIHAiitSlIIlAlKiUSTINRNEWlllfrhthW-onSeptemberWe1ornisotFRIDAYCHILEANcountythwoHtomAUSTINCoastwiseviaswii-BomUWooklyTheWllU-UThideiMyAnimalMapesNorthSouthHuKirtirjThacKurayNQRTIIU011Nu-1VL1ylipronouncedIh11rdusluodayBALTIMORKInniVotloiHiAcanUAI1AMJAMESWilmingtonDnroBford-DoLnndlWashingtonWilmingtonSAVANNAHlatest161916-inlMarolondonJaekhonvillo11IInlhxl11hl7NBOYLSTONSOUTHERNPotashYAPPASANrOIJacksonvilleRICHMONDJOHNSrpedllloiisJACKSONVILLEnorthernKetWistJacksonvillePnasenjiorsJacksonvilleJacksonvillefrlunds-IoiidunCOLUMBIABKTWUENAtFWN-ilallinjcsFlorida1nlnshninrkotsinformationlitrUnilwnyheretoforeJacksonvilleAugustineiopulatlonHOYLSTONAugustineIhn-idtiyJJUpUIGuanoCLYDEoperatinginformationInformationiiuiiIi-enurul0llleesAugustinepossessionsLUCIEPussungorCLYDEofACIDrnuItdohlydrainudregardingaddressGeneralcCll11pletnplayhlnGeneralOfficeNpiiHivoTHELARSONlwiSiininI-GiOuuinPassengerInvnliiiipoVoiceYonPassengerPassengeram-ioarrliipsDlscharnfRAIKIOHr-At1iitlul1111MailhalfpennyIntormodlatoAgentpermittedsettlerSiHMi-KhasntoiriipatlonprelVivncewiiMiur-tlMyHiglnvajFioriihiImprovedRIVERFLORIDAEGYPT-APROVIDENCEproprietorillyCincinnatiCAAIDKNServiceoraiiRosuneVestsleepersIHONMUNdCKIIIuIUllhloltSAILINGSfmost1711111gullinmliuntlincludingnc-MlMlllllyManagerTicketIcrfnlllpsandTMHCatherineMiillliiKlyI-IStIlrlanllurrllaulSundaysLIMITEDIIlpllvPdluuvoBanforctpreciselyprinciple1mv-1evs1Mltllil-Wllactual-iJacknonvllloRAIlNiiChicagoNorthboundKl-afiMirIn-iroiliicediKu-rStoamorKeyTnicKerayconnectionSeaboardnppolntodI11IIIIINICite1rHtreamltitfbUII-LIHiuupn-l1rUtNt1ncxdnyxnutIndUnantirntlemunIgypll11uthroughmiiaerleAIIivuuuntnmileageiiianltyElegantWHITEengagedBoneTransferliriiikiiistelephant1MIINIllifnlwhichOIilICClltllIMawlnesometimesreserva-tionsimaemiryoppositefruit-wliMiprin-ciplet11IOAUIandInliiKliiBSEEFRANKHAOKUTYlIuuiitiMtiiTtslopveleHSFinestAtlanticsleeperUulnmdetailedUIJIwlIlscramblenRu11-ulOiIuNoitlillimixlMolncnisNEWPullniiuidonkeysunionismItNinv1oitiwmMshoulderswereMiitSCHEDULERrevr1STARKproductalpimlsLINEtrumpetmovementOurhestflnj-p11BNuuiiGeneralcostsIhldiiilslictwiiiiUenentlIIrSpm-I1u1ItlMllllllWII-AtYearbstnlNl11IlIl1lslSTHElIlIIIIo1lI-IIpurobetweenOilirtnsWomansEffectdllllllI1ILvIIvtv1nillwiiislyum-AmTossIspressedritTiatfoWarningltIokIIIIIIIIPullmanIJJItlIJOCRAIGUKFYWMcntultyenragedi-IlnlncilexactlySltlpjiHIKiliniiI-ISIlKVC-OnlilyTHEWU1HIUIllllytlhaMitedrapidlyChiliaimIliirliunniMfIYPOIIKnMievolwinlc1111111110111electricMoluccaAdamspointsOilvnntttlltuIIJIlw5alplnt-Si4pwuilmwliukponvlllcreachunltiiiKFlorida01-al1geAgentwillandPINKSEastnstheandami-ablyHavanalOCAlSupcthtteiiifallvckliulruiloarrlaseAIo-lueciisAgentAgentfamousissuedIANIOItt1perfecti-nuilllurfeedingfootedsiliviiilwalKInuEASTERNMiifvodAgentBayIlvatiMgonernlforwardItntI111I1lieuIralllmN11-mIIiIfnululerChailuAluti1I41rlernpeopleI11urvldytwiUstConstrunningnearestonnuchLeaderThisbellowsaualnstTrafficiiiunluysCardInsistpeopleIliitllillGAUD111iAN0lIobviousiiliuvdpjoicopoundAgentIttllterssiailcdiiiiniliiidressedYORKTHETravelTrains411u11111ilrhutlliuiiiluyhanleKuliiinliiKslmKiMlNOyouslnillnrMvslnFL-AtCullliiunttrnnclnIlalnVIndividlraserspolicypeople011-0IttdnhlllfollowsmonthstermslandDailyislnhllsIltt1N1BOSTONandIIIInlyabreastwrittenIDuUmlThlllIIIlispedIg0StuiiplimwhichwnntiilWareHollowAntor-HiiuUllginWNIllMllollPnlntkuliiJNLOurctmtnvoInmlWhitethehulnttthrownfullyKMuplsntTHErnllltoIIIIIIIIletTIMIiPOINTShurrywellTheIIIJllll-SOI1allfordullyholyofficesWCUKTrainsdenlufluiMdt11111-1IN1r1keepsli4OURniMouMStiiuIUliescominoiIicililiiitSAISrepeatgoodHiuriwOtheragentloavesbehindIliUUuMajoiiImlflineIVnlluilIsllIhllBtrootonlyandagentFIIlllIIIhtu1Ihlu1I-l1en1easytickethookThreeIliinncrMarledANtiovniiLACIIthoials-iiulr11bllknlullovvIliiceNKWtlltun1tliMViseasymUhlcon-sulsbodiesPmsandwilleuNlntllCoastGreattramsienlFromtMyappuvAdallyucrcsnoiililIUlllkdAs-Illlllbodiesandltl21DontondUint1yupimCopywriterissuehaieinWestpriceMllhllltJ1plhmus-ketlI1IllhIInilchtaleswriteclosedheardAtailingonly1tlliplantbaronsLanUlnClADIIrkminapm-Rt1IISundayfniilroyalynppitdsertsweetsLowloStrlKewhMi1111411HIIlHMMruoU11ugnFormaileraulIlIIIOlolieWestYtasselshush4Pun4P-IlllldeVLouisltnU150p11idedrehoulua-tliclrls-niidskeeptt1nisCullliiKWharfIutiu11-IshopheadsiivitiiTheredeathsavesiistinnOnlytimesinatiiI41IP11lrliliivtaaderllMsactediOopnttiviniitrolledordersmallboutsaboutwhiteInomIdinnllIuli11t11J70thesmallNUiiIAhhetteibreakLineUunrhntheypointthefoilTrayfullotheholdsNowAfterorwhen2500downarmyothery1111sjipnitrainncesscsliuvorlchtfrontST4iAInIIIIIIUIIIlowntrailmollwhunthesolidrunnerorolsthethn111armyoilierriaMtiiWilll-IPiNovbeilti1luluthemBayiimliword1210122porttheytNuwehlldllicyHaySuni1lywainllisleEastcolorllrUInrurthenPussLinetheyWentrotesr141VetheNewPasshumhandUont121111111NowThoonIluavinAotor11henj11n11luadhandMealTHROJiiilcthemheadrlulilmustfrontwnnmmadliltallkiyourFte1J11scarfIIknxnm-11sl111-1RItlliISTloveniirttIos1IIII-PIIIIIliuiuliMosttheirsidesWIIII-nlllAwfiittheirymrrhoncloveYorkCall4NhlllleervlilytheyDistwindFinbendIIIIMIitTiliistickIttlluhavelnkuuntilshirthighlwostickLiialnnliIInrlwears1ivstheirtheirbutIh0t1chyMttilTChoseDbcctIheirthoufromfromulhrlnipsthou41stendsIXtru1110110paltjportTTIITiretluiolllll1VuowithluoktheirIhelrAirnlIRCRkiwiLetn1eU1-IMush111uoltlwithun-I0nofiomyell1iwtnWellIhodtreesthehIbisGtrllahtrmholdInmt6lnll111111held11lrntl1111111RllllleJessuulxtIillcdnreSnnddlNinthW111111NVthouwhowithunblOITVThehowmustI-IIwhodayInnrwIlswlflIiedethnIYlEJohimhalfthatWhosomeMnseUMIIIIIMiyhutOF141411with111111Thetlmtand11111111tlepulwinminehpulsoftandGnhulllIoJItwml-IlltlllnlroarsINTurkthatJfuuandnndmaysineATandIlnpulNondmluhetinyTheThehireTheIlllllwaysideandnullNulIgnnTheII1I1111411Thetiltsim-IidthatwellnioivIntlllkcANDfulliinllUlllInndTimnndTIltwereverjIlplnandlinktsIIIfullIInflUIHsalsllkuanilForwore111111nodandhull1311York11111hiltwayandruntiuiilAskandllkuandandnullandandtillIIiirstlaidfb211niethetheir1111youandandIll611411lipiddotstimidandFintwoarcandlikedillandhillandIt1Itlthethosnvooffnu11InlIWellwillandandcrewmillandSlitandandthatantsHull4pn1nththetheNfUofofuansfoot11pmandIlkoanalnndehtIhiltStlionandTinliail11nmfar1111111YoiKrunshn1AHHIfillForcullendumn-p111111JSheIntoherhtd4nlllUnly-IJlIIIIL4111NowandrunsOalnhlnppiilujlintwintolefadpnyhidnallher138mail111111111111111lil-4IllltllullandjoltNothot1n11t-TFlulinensail138Iun1-vinsoilIII-NnLendIltIprohasHifi1htinroarhlIthoItUIUurhreiucNt01lOlltheKIInaythegotMMIImenIMIIII-aWrdh1111-thewareviaIIIIlllluyvboth1111twobothKin-AfMlHcIIitauMllthtIdioiIUHS1411i41111IIintlinISIIIIIMihPIIt41dnnotthehasfilltiietheNewALLownlillll1waselltVlittillHlyouthethetinthe11111111IJIItl1IZIIIItthetill140HimEotheIIIIH1123outFoottillthemytho111111wasLHasknpulhisliartheistheourINnn1111111No111111WlMtillhisthelliolilttheKitIHlllwasin111lentoutntduMiiiNIIItheIIIUhlllitiltthelnl-ltlmytheforoutanyliy1111111trllrthhdI11IIIfatIhoToinnrforlialthoHisthetillbathnHeforthetheIillvicecontillrunhisliltlilfIn11141111111Inl4lie111111fortilttillbythenutHUHallRVthelilttr-7iawlIJIIIHetylloutAltu11i1tiiullItIAItin11111IRIhIII-lInnllMllisonotouhJStSI-BpluononeMldoIUIIIAstortollyWiWliUpallcat11111111011OnlrtindalhllillIIVhIWW0411MIIJIurnrkuMUM0111tipHUheupheiIitluaroiiiliifireniStIthtinIIIlilteirtnyIiilielotaredoKVHumstnStisWlornofiinilHofrlJibluboniiiairmoStSt11utitlieam1111111amUillidTn1SIItroiiiiHIIlotItaiiicmi1111StIllatIIIIt1D-Lt1eEPmucIto101111OnlStofhlloiofr16ofnf1JH011titofofGNofofr11nnnltittoSCi1111JitMINInniIIIofImtEtunI1iltieofofofofofofof1111Nof1111-IIulbln1h1111of1rbe111111D1111pmofofofofntof11111It1JIIIlilllb11IiIIIpmlllIni1111ofuTofInofmionanU1on1111InIn8tiiil7In111onofN011Qrnui-etolaofTIIIIllstoulatIntoI09O20ItoLorononanasCirKIn1fltotoInIntifianasofInIntototoNoInInIIhlorIlltltlID1I11ICll11111as01nominfui11totoIIIIOL-ionasruuas11rIiMitoasIvChIivllnulIIIInIItJor1tonaaItIsotNo11orClillIAJorCmlll9iWut1111INtittoasNasCsoAhl-tl11IfIslhlloiAsoliSmilFCirfAsoI1Ittill111IiPIIIIIII-ICU4StIIIIIof11IlSplNIsw-Z111111inItusrtel11pillIll11ailAhi1IIIUItSI14R0IIISinItMIIIIonJatphpItIIItoII1JGItlIttrutpIIIIPmid11lhMlibIJ1111il11uliiiOIIIS1IfIIIIIIA1111N0JIH111I1Ib11II11IIIt111SIthj10S12iit1111r0=rtlIII11liIII11IIillIIIIaII1v1illC1IIIIUNOrIIvIIaa=JIIIIIStiuaaaIIInhSIX4nIIaajnallaaaiinatlIIIIa<1LaaaItIjUIIaatiU3U1unlfI11hIin1nII2iSIIiIIIIi511>llllNIfmIs016rIItIIIllLiµN1puiii11nIIShI6nMIII01l11ii1sIjt>rIIsrnII11ltniiIIttIlIIMI+VI>tgI1i>tIn>I11IIVIIIItIII>I+i>II
PAGE 1
Ve-getablesrRTGLADWINEnterpriseBREWERCONT-RACTORWholesaleGroceryWAGONGroceriesConsumersY-ourMcCormickCOATSubbsCTMTALKOKTIIEKYBWhitehallBuildingcementAldermanJacksonvilleWheflwantConcreteExcursionPortlandPLANTERSStablesBOURSSECURITYLRankSUPPLYBlocksLUMBERLlJAMVEGETABLESHAYUKSuYKMrKU-innilLaunchNOTICESJacksonvilleCOBuilderJDredgingyouPiercePortlandSuppliesAmericanServicableRatesCOASTSHOPSPracticalBANKrrrrr-Aaemen3BUILDERMachineEngineLIIIIIII-LIHTPortPle-1rra1EASTFLORIDALEGALJTurningHaulingofBoatAtlanticBusterTheidentificationBMiiki-nPralisCoAttentionSuppliesFortTRIBUNEequippedconservativeOIOB1itiItarIaSrlrrnnrLnpromisingUuirro-NCondurlsANDFLORIDAACCOUNTSFRUITSMIMSCOMMISSIONFurnishedFertilizers-IindividualsManufacturerlegitimateQatexchangeFLORIDATelephoneInl-iriiijiwiiiiiitWAGONSMERCHANTSAIliniiiiinliui-nthtandTitusvilleincludingSIKCIAITIKSCarriagegroceriesliberalityTraiuiiMitsconsistentIKlYlSTOX-triilJENSENWholesaleCOUNTYGRAINFLORIDADdivoredWoodilopuly-ulliriiKFRIDAYbankingOutfitbuildingHuntingJacksonvllloTvHliinulivKindstiiiiniiutliHinSllielllltellielltAHMiNisiiroi-AllDepositsWorkliiiiiutrhiiir-iHFlorida111untfinia1tQJIIPoultrYTravelersbranchesItaiirorL-ValiiPIERCE1iiionpilospayableSepliinlnfhltlnaIIn11111treatmentTVIli-AlimiiitittnrTHEGniiefruitiXUisIU-facilitiesMERCKCOFromrunningCoastTiiMii-1Uhihllivvitnl-NetoHltUllMHliriiloiuH-NimiiwMBuiltHiipiiHiitsIueuuunn-IlutilaiDepositdomesticlinifiimU-Ilrtr-Nnlvhlut1ltywitisislcntownor-hOIIItlllRGardenMoanludIldluttntPleasemethodsDISPOSITIONcountryHusinossNOIIIOIexercisellllliMllsiuiicoUliwnNiwnpihiiitionUJCIEFEEDforeignPierceforeignSOLICITweightWnRhingtonmaterialStipiTviMirinformiitiuniMiilliiiitillylilnplaliuiii-llidriversHiinlli-IiuivTrelaure-llnr6-3nEMII1ll-lSeiivturyICottonIVtonsiotipatronsInrruuNikI-ilipxlciulHSafetytliliMtithlt11Npr4lllrlnWel1InterestNt1IIhforeignItHUiUItiN-iliiiivviitlmtdeliverfnlleililK-uTiitkliinlliy1-ILineMoneyBestWOODrtiiilililiiliiftviiiiMillylihiiiMil-KHifniililv-HuilliliniTiioHilairillllllllUlltlllwllarpeopleGuidesren-trwaaiarSaddleHUWMiiitlinlurlMiMnvrrywithoutSalerlrallItulii-liHMitcoiiihlinitlniiOlllfcrst-IUANKANDIaccountsimltlvilyfionsioii-NIliorfullyOrangesSeedsPierceMomphipliuhUulMliuingOrdersiiatejt-siwimlIlllllurjIUlMIliutffyxttII1ll1nAliin-liriiinruflir-AnNnnaI11ICtllNrYcoin-1ifsyBobWoodiniiHiiiiiilrciutiltiiilLIIIkThatImlMilUiilYardssolicitsMIMSfiMir-ltnilllNTheWTntnlilinhodslvo-arninidfrlIHItSiTiiiniyulirthlnntniiivhiiiilGritsii-uAliinincHtitiflonnicelYFORThMs-tIlTinlnBESTHtVlALElHousehlncytGaliiecantorJKMtlltl-lltanddrawnHAYIXonilmiNiMinliertu-lliANKsfliidiihNtXtiiisionAlmliiltrilirfulluwiniJTiviiiiirkiilPuilti-UIHIIjlfpiirtpriceFlaNiilhiiLiiiliIOKTUailiiiiilliiihiliill-MIninliitlIniillnn-FmKilwnnltakenTl-IhimnmGasFormoneyMealItllljjH-ninllluiiiln-IklloiwMeinlielViillonl-NoIVlS-AltllOtlutmostBoxesMintliliHiiilJ1wnnwLieupAlLwGreatSKILIiuniniiilWaivliniiIliilliiltiVOofWherenl1itliicnlordirectFlourlilnklliiIliiiviirpiinlPricestlIMp11illdirectCatalogueuiiMiiMiHollowWestWhenworldhiivinijStoneuf-hiininngtittnttitiMealIlii-TmiliiWritoIKStiullM-iKlnrii-llnllaadnanaw4iMwhliviinfMiteItPltllllUiitiltiHiviSiaiilsiIssuesInIntelulisiiMTIllllllkrlYOURillIIlllSTwMilavBrickTin1-fiiilliiliHTllxItolllNSnNSherilV-IunequalpnjivTwiiilNSeedFortIrrliiilh1-iiIlillinimrhuittlllCOMiTCirulucriillNpointM-snINn1etiilyunsSIXTHMinilnrKindU-stfluitoandTHEHlllifiilllNNINliS-Tllititits8VPitouriiMiMiishedIlHiitiiiiiuliilluu-inulightnilhliiMiiktmloilbyUKwilyInStaleID-XPVITlulra1111114ovoryIVil-lliiniKGradewantHlllMSAllhrltt1111ulTtiliuiiIhttlnloGoodSinlinlfirmsIkriilMmnliivV-tfliiOjTHEI-tetiIlii1AllnittatinSiwhatnlhlltillBuiltlIilillhut-ifWsoAtlantiibankilMillhO-ieiililiMwideiiavlnuIhilliiluOPTICSCiiiniv-tlliK1THEsenddonepointsAllmiilaLUTTMAIt1i111n1upaidluuvinitIlIillllillOIIIIIUsliniinjlIMiilnSluTilVlluiicillHiintiiMuiPLOUIOAthlllataketimeHVl1111-IIilllllliillluriiliiIwllllldyillouwiiiliilJilMti1lliillhlofiillllllltVIwItMM1Hiy-SiwithNH-tiiilnririiiuiikatlixeilwithII-IHi8IlitrlisbuiltIlillluxlpttltlyJto-NuyFortllmiiliiMnrluvirtiiallIriillinl-imklmriitllI-nlial-IInulipartyolloullliiinxKimvvnMiiionNVnrHightlllrllnlOniMllllllUlliiitiirB100ri-uSinrilllllilUUlandiHiIUtlNilnilixlEauwithlst-DirectorTimeIvvilI-m1EarlypoliticinttiicctthlnhpliiuliilFloridaandwelll4ilnn1IOIJTONwithkindtnvi-uivcpurityalliippiiirmnrlutpersoniiiiliiiiiv-iUtiiillIIlrrlI1rmiKiUiKsistliillisKnnwiifilHIllhllilHiiliiiu-lIviaiinfliiciiiisihnlliiilsIllfllllV1IttlhliillinmlInHimJiMtlu1IHliir-iCOLOUlttru11iiMInuwantltKmfIjLillllit1liliinhIllltlNSONu4-1lItllnsiybest41111111niNIiIIIllhliefiiiinlliiinvuCiilllllNMlntidiihiinnthunttinKlaiiiinnuiiItniTiii1kiiUiiiiMiiirjnf-rtllMTeasyiljrUorNtotilffiinnhliilllKMIvilliNaulilunNIt1-1JutalniiiNtnitnflimnIlHiinaiiiiitnrtalTlileeWluiiriinistuilIlriiirtIltliLTiinlimiiillwishlillyllandniintyimtnmHiilrh-fillluAlllirthisHiillandandIIIMIliriiiiiandllimNluillfioruuwlikhIliniinellfllllllllltliuiininghmVHJultllllllriMviitlinihfullnwTallullilKiSSnlJouisxilliplivlllMillclillllMIllllllllfSlvtivNANCYOllUu1tireIVdtltnrrStreetnl-intIurireeilin-UlovoxliToTHiPa111niiniKulOnMIuthiM1PIIIIIilutal1111111iis-VltliIlMlllllIeifeNIIIUlIliIIiitliiiiifandiiliii-kIHiUliiKCniinU-InEyesIMfKCEiHuii-isWHsaverWclllllttiMCuUltnlminitinittlliliinliirnxnIulniMfMIHrialilnlful-iHalliiuvEastoftleiirnlliillllllllVQldnntaiiliiilyiitwhulltnltllIIliiinu0rllnrlMlllllMIIUMWIIiliiiiiiinlnulljjiiitianyMiniHakes132uHOUHOuMl1HindivlillctllnsictyhierTlilllanyjiuWfiMHklullillsiMiiniuitiniyiiilnTinkulmlilllliilirIelll-uIriiiirvuiimilillldonlyGrainv-i1ciiltlolllimitliluiMMliiid-yuiiJUlittcallluifuiv-lililrlisoiliiMinCiilikrlistrtvliiiMAuknilwhileuliiManylimitcOlinMuJofinUilIliisuiililiilllMiiikliliiolihiiPiluhiiiiliitnyouStilt71C1iFlliMlltllilcrilliifuiivliiiiimiuriniiliiMainmlllu-liktheWoIittt-UllliiKHIllllnitUutilitythelimitTIIHIuiiMllthethetheMUitiutiliiHllinnculmJminisBaytrircarelllllltll1fulllllhtIiclMiliipriioilIIIlhtilingIloiiilulimitNuvv1oiiinlt11htiintheIJhktlillllItluyThaiTorIIIANKVnlklimitlimituiialulnl-ftOIIIIWlllltvlinliiHindini-iMIiiluseslimitlimitiuiiiillilihkltvianyliiivliiirlitirrl-tIltlllllllV1111411youllI-MIifCityheriinuiilIliumCdlllllvSTIXiinltlimittlltHiI-FuiiiIIIIIIIiforlimitMil8HIVIIVfrmnlillaa-InrfurSTAllhflilIulilsuitsolobseyesMIMIillwllhI-IlimitritixaltllSllltiCmnilratesitloyulINovllwlilMm-aliiiilittlic-MIluiiitforIIuue1lllly1iihH1iHirdayilainisMIIputslotSHiilIiiHlivlluvIIHIIV-IfToClltisinhiiltitliluiirrroniIIlh1KITCII1IlunlKIVIIItorlii-Tin1Nov1111untililllrlliv-IIHItllllhaveJforviliUhultlHItII1youhIIIIuVTOUTiriit-rlNialiMingilntiiiluwiiHninljllIvivyhciiiIlllllthvIlltlllAlihOLIhhIsiilcillluiMiiiirlliilIlHitn-IIFlIltfiulINsiiuvvI-IlilllliionIallllu-lllllllint1iiivMpnHiiiIliilnriu-illlhThoHjilosttlodullTHF1114btuluiviIfatlhllirWillIriiilinve206iinfii1HiililUnituriiiiNovfallssuloClllNovmulllulliriiicculmilllilLhlbluethelinloirivillTHIIxiiililIhlStateNutWCIlittliaiistiilIllrlllliiviiniithillLillicalluulMteyes11N-IWillOctinnsN-NnllllNkilllI1g1111NowcanYorkillnnunitInMlalltirIyti8ooclvarl111IhNiiiiinhuntAlnluiiAilnikitsvoivflitHintfensoura511rY5111liiilaiiMat-tIIIorOitIllimiartMyIIhlIuilluiiililliilineaululllliiitiuOmulhiit1inoivrnlllllvuiulAttiiln11111lilMtamiiltlyFreeiiiuiamiIytMiiiiinsliniMvIuMm1biniiiutninluiir-ntillsninl1I11lsuitSUDSwish1110U-ClillitsIIIIItusearesolve107-NnIleltUnitmillsuitsSJtlinilnrOcttililtNowwiiiiiiyuHiiiiti1=Hiitmlvarenii1liitimiihnIbnvhugthatIwn133111111andOcttlll4rvItrollliietintIiiHitiilUnitAliiinillicittinileiu11111millIhiiliimllidiiv-Ifmuni11111111yilNILMuniiillMIIlillcllhiltouttlulamihullninlIltitIhnnilIrHillfurllsrIIIIItLUCKInnerbinIliJIIIMiimlnnilthisnullTinNilltbitiiniiiiiuimltillstrlimlinullOilvt111111TinFillaoHumLtuiiofneiMotheVln-C1111clueIhi1SituItrrninlliiiKmelidIIIHltdlolnrrrMKywinAittheOinhutsllu1tilttoysiiMiiIinliOttninlitjrothentliiiSiiOnefii-hninlIISVeyeKllintOttIultheNILofalloftillriiofNHitylUltMcCHUMlintiiiicILIt1NntheuiliInnofoflitofofatnucoverliiTOftOMSIlicditninlofIIIII1rillatatlinttillLulullntin1IlaXiiFill11111CllllLuntiiirliluiiuIHHlintonuiulinnJAMESllicNHtheIhohlullnNntinviMItinTitourriOftMillfurIntlFlittin1Ih1NHNoiimiIvytin1tentInlKoNoCUt270U-fttinNoKtithehitdI11111InisilntliothethetheNnSIIlln1litthe111111urrxniiIVlSVmiInnLhNoISjirIII-lIhllNolinaltutusslitHIPIllyallillrSuNuIlrnl-SKtilicvialiIttNndtttiliotin1llllIll-IintoGitNnNontitcinIIInliii1wNlslleftsIm1iTlNollllHn-MIIMI-inilofIMSsilthistuxIlkiinnNuruininhNII1llilhirlidh4nbvlintiltr-tiKiiiiitillSIfurtiKiLitryiivissniilOn1IsliMifluLiltlintpyiMrfilialtolnIOi1OttMillhilliadrillFltallMiiitliultinII1lliirnittinIlllfillFillsaytholllltIffI-iiiONnorononOFtillMIIIandlliniltinnutlintrilllllIllliehil1115111hutIliadurntillHensIdalriielIitisailfindHriiyisotifHIVorUllllliuliioutintItortintof-tnuttiltWillslitintilVPiHitIahuttitIIIItluIM-vtillllliiilltintarenitfiu-nDAWcyiNotIbnlImpyiofTMittoInl-iHi111lttiltliltINUtlluandtilllliiIleIIIVor10IIItctnIllnilnllytllIntilluvo1111ormllnfliltnil2iufof17illstlitillnfllnortillurnlollorllu211ur-IhateIllvhilunnhllllfillVMIiillnMlofnfnfllfMiiiiinfthnItIllsulltinImllll-plirufnfufl1i2iiiuiitinitutuufIoiiMiufAofnh211iliIiipiwill101HiIliiif17Wll4tiivliehlill1ofaliinfnfhe11111thisofofHIM1111llirimirnrrholidIIn-tllullllPhiinUlInU1v-r11WlilvtNiIlNllllISyfofnfinut1111nfIIInfillIn1IllJionAItIiiiliillllfSt17ailuilllIFIItIiilitnf111MMcllInlvuofnfnfufSip11onTinuiiIUMtllai11ufllfnftloJrtillINofl0IIIqleIIIononMMsIdiiulanIIIlitIllSIlitNiliviiunflull11tilllllrufufillufnf8tIlunilWllVluriIVIPIIIInHIMInttnloftheMluiniivllll1tithet1jfl>tnlrnuIIIIiin>III>>oallIjcMIl-tole>vnntatlILnJurIniiIIiIniurII4IIILII>IIItItCiiaiiI=ii<>IIHII11n+ieI1uLI+tfIru1rIi1+hI1L+pwiiIl1I>IItIIniIvs+IcIMcw>+lIIjifiIt+SuljIr>ril1IiIfvl>II<±liIt>>tlIl1ti<7IIItIit+1I1SttljjiIIi>°vIIlIitItI11i>i1IttIIlIiitt¬IItliSIiI+>iiiiiiili+tJSiiiitvlIiIlIiiiiiiIIiiqiIiiitiiIiliiiIrtIIIitiiiiiIiiitipiiliiiiinn
PAGE 1
TRIBUNELTJCIESCHOOLBOARDMONTHLYPROGRESSSTCOUNTYMADED-rainageORDINANCE-TOBEINGGREETINGSMEETENFORCEDCOUNTYNSESCommissioners0-0UthHiintorSicUnnlnKNollACROSSSrHattHfrtonJurP-otftl0-0HCLSCnlnlonnreounljuawonfirstpetitionSTOccupationsballUdh-sLEASEDhVoatowartlockfurNolCATTLEntaiiiennientstlieretufORwfe2B55TbytheprovlshonsofLANDS-IPERSONALROOMFROMDRAINAhea-dSuperintendentrherc-hadditionalCALCLUBregulationsrepresentationaccomplishingImprovementIoOOpercclltofsomethimr-lelinitotransformationsropresentatlvcDeepenedROOfCOUNTYWILLOCTOBKRstationaryneighborhoodspecificationssatisfactorilyTIIEiiiinesville-MaryFLORIDATrans-actedcommissionerscoiumisslonoratl13urerHlportBordereddisagreementmarriage-Monenterprisingtemptationconunls3iencIaTHEFINE200-Otka1000PIrIICLprospectiveISeverythingcom-missionersJAILVanLandingdepartmentmanufacturersInsolvencytemperanceprogressingFRIDAYTHEdepartmentaccordinglyempemnceSeptemberpropositionSEAaggressivearrangmentsHcmomdorforresignationBusinesssupervisorICHoWnn-FCJoljrcrpracticallyUKCAriTUIATIONSeptembersupervisorsupervisort110It-ottrtlsupervisorgreetingsinterviewedconsiderablereissuedandFOIEconsiderableimaginablerespectedeffectivelycompletionSeptemberpineapplessuperioritystockholdersUniversitycompletelyimaginaryPompanoeaCAMPBELLHI1I1I1dthemselvesadjournedpresentedprotectionLUCIRappointedpracticedreformingpresentedconversationadjournedrecom-mendedpreviouslyconsiderabletemperancecompletedellcctlvolypineapplemlhuslnsinabolishingi0-nPllnnluatytwentytwoenforcementmonlngitlspurchasedthrowingRoutineattendingicanageanybe-dieuthcdap-pointedunusuallyhoiuls2KdeepeningirnlvunlxpiappointedattractivequestionpromptlySessionAttorneyHnrdcstycontainingadequatevegetablescionti-Icateproportj-atLOCALagreementanywheredrunkardpcrillomnmlreconsiderap-pearingMcCartysgrowing-InAppointedAttorneypersonaladvocatedpurchaseappearedconlldencopresentedroqiuwtodauthorizeddisciplesGainesvilleSchuylerpastimeprovidedpeoplesinterestedvegetablecommitteediscussionItotheyanythingdeasantsub-stantialappearedagreementSuinnierlinthereforeoperationipparcntfollowinghlllldincapturedmeetingsMcCartyproducedlliruiCHoiadmittedinstructedSaturdayprospectsHardestychairmanrespon-sibleIwretaryofbusinesschairmanWnfonpoperatedinstructedinstructedyes-terdaypurchaseinifesjiionXblicensesettlementSaturdaycultivationempoundpleasantacceptedpresentreductionfur-theradjacentiSTindisposedrnerchtttltinstructedpossiblen-1iitcuMstownshipslderntlonsuperiorspeciallyCnxenovlaChairmanluistiandntightorCE11111milworesidencesWhitneyInstructedcontractorsMcCartyprotec-tiondiscussionMcMullenstraddlesCompanyprimarycarryingac-cordanceterritorymiitionedContractoroccupationsecretarypleasurechairmanMayportfiled-WicateofNeptuneMcCartyalthoughNeplunuliaulsofopinionprimaryslot-IlettltrSebastianMcCurtyroWrindustrialHastingsdrainingcom-mitteecele-bratedtesidenceworkersdrainingadoptednecessarytownshipgrantedstraddleeondiietordiscussedinjectorsregisterweighedsecretaryattentionopeningAddition-AAmericaCompauyKiuilorsimthousandsIrninageImprovedunpagedmorningYEARpinionordinanceLenientGcigersthroughInstalledplacingindicatedcandidatesconvoiudCelebratedfurnishedopeningbastingsfollowingBeingrowingHcioolwnKonsF1itndcstYpbuildingcertiluatibuildingbroughtcollectorafternoonAndrewspushinghundredsAlachuaordinancePiercemeetingopeningcu-btonmitteeassistantsmokedbuildingenteredoutstandingHastingstal6an121proiiniidealova-0iditchingreporterpotatoespotatoesAndrewssufllcientMidwayholdingspecialmachinesPalmettoHavingdnlonsportionrapidlyrenular-NNnsvsomooverflowcon-tractorfaithfuli13e11-tftrea3productrespectbuildinggrazingHas-tingsoutatnn111ngIlmirnmnmeetingGeorgiameetingrewardn-followingnachineformed-IhundredsGrowingeveningprocuringpeopleteachersImprovopeningpossibleplacingIllIIOIII1IIlIIIII1lntsec-retarypurposesdirectionjompanyphaiiRoheadyplacingsubjectexpensesregularcollectorherebyattendedreturnedtonightberobjHoweverinformedMcCartyregardrailwayportioncrossingdiggingorrellttconcretesolicitorsTKIIUINKmerelytyingTeachersobjectionreceivedreceivedUsualeiv-gagedhusbandivrivtdrccolvediormltactoryregularTRIBUNEjoncretoperiodscompanychamberHoweverrejoicepeoplenothingvorthyagainstmakingregularcompanyfiMolvedpurposecompanyregularproductsEvelynpoundscountryopenedreferredvaluablepatronsconvincepeoplerapidlyConcreteteachersservantsTIUIIUNMpatronsbuild-ingfactoryReportspecifyopinionoverflowlegallylOvelynCannlinterestreturnedpoinpanoTniliUNiOreceivedspecialivquistmarshalmonthspetitionpoundsmoetintrPresentMinutesmanateechildrenincidentchildrenenoughrejoicelennardcompanyprelectionCulebrabetweenhwllll4Igreedbuild-ingchargepropertyusuallybusinessnumbersupplylargestwarrantrespectivelusinesscompanycountrycrossingcountycharge1hlllipIsolatedIrevardallowedNcsbittluringWhytedbytheBEal-readyregardresultedrefusedprlHItmleredconsidercnlltorendinguniteddemandANDhundredconcreteTuckerprotestrenivedPanamapublicHowardbecauseshowingorderedIlinanmpassedchildrenforgetmonth-InbusiiieNesbittrailroadIxcoptAmongpurposebetweencommitteeratifiedteacheroystersregardati-withendConsiderren-dereddredgesecondedcountyntotllcewarrantcontractearnestfinishedvictorypeoploTlhbalsplacesGeigerhardlyduringcontractHnrdeeorderedcountyteacherproperplaceslimit-sfHardeoOlirienOBrienDolwonntiwstWagonwhereasfearfulnearlymlleetoraddi-tiontuloonsdefinitepupilsaddi-tionexcepttwentysessionPatronsballsecmissilefesiono-nstatementjoinedgrowersleavingPotatoescountyCharlieanotherearnestanotherDuttonbrotherexceptbrotherdis-tanceFridayammmtpupilsnitledkillingarrivedcountyseveralcountysavingtreIlRUIYIIHarrangeseveralacceptmticralicsexingfinallysubmitreportsmotionnoticesjfithRprom-iseteacherdrainedDuttonpos-siblemotionreportmarketwitnesshiddenmredFloridaJiulgomotiondesignSprclilattachedFloridaFloridamarketmarketmothermotionexceededitorsCarrollcouncildividedMntchottpotatoWestinsuranceoutingpotatoNollHonlocatedWnrranlllcharterTantiomotioncouncilFloridacertainluSlnepotatomarketniiuliucontrolverdictinutesofFurntturowilderpublicTrulyHardeedeferredcollectormivensectionspinalfflbe-tweenOtlolirrditchesTurnerJensenseveralcouncilFloridasectionweighmotionVikingholderslllIl1tt-hichroutineTodayPLATYSyheckedTurnerTurnernoticescouncilblocksplaceorderedtailorurnedDuttonrepsNo2bakershi-bridestrongcurfewsectioni4ningstudiesbofonwardennwniBsessionseldomattendbakersbetter-Smountquitedesiredmen-tionuselessmoralbeforewinterbesidesJensenconveneslabors1000jcementturn-outfollowsLarsontho-lOolServicebeforeAlliedonoralmoralbusi-nessSectionsectionmiddleplansflgurotheretobeforelnrrelsaloonyoungschoolwheremiles-itbeingFloridadrawnplacewarrantsbenefitplaceinloonallalrsRevelsfailurevisitedFloridaalmostspeedTigerillnessmeetingmonthsectionschoolhikerseditorengageuuladvtgdriveractualyoungSecretaryAnnieWhiteHughknownpupilniattorMiamiwouldexcuseLucieJensenPierceStofllehousesmoiithWAWIANTSLetterrchoolschoolactionweeksideredolilcePiercelargoPiercenightmatterim-fd0BrownMiamiweekswithinmonthPiercebeforeshouldbeingthlsdateIrownauimtrailroadPiercePierceblocksPierceeitherfollowspetitionSouthdealersJudgestrongWhitehereinplacoSingletonschooliMnttntltsInlomoralHoardwhichagainSchoolJanePiercePiercerankHoardschoolwarrantsfrozenPierceAboutwellacrosshoardamounuactionstreetsSchoolplainTiercewouldIndianPierceeightwhere100-OiiivuswagonmatternightwhichwhorereporthintsIndianunitymoneypersonWebbpointWebbAflorwhereraisedfuturebetteragainwagonlyingmakeunearosuttlePiercean-lltedboardofferswhichmllnKOLucieWhilePiercelargeOiiriirorangecalledinsurewhichcattleAfterwhichleviedstandaddedboardthinkKingUnitedringwagonnightentireWhlkwhichlAieloLucloboardcollectentirespentwagonHigh1900BlindwhichworksminorWhencattleIndianfailedbarrelforthogsmuchactionwhichaheadIomvtdenningIaicioboard1ictvrhouseweakHikingSeptorangeIlivillohmsPopeaheaduibitrociivh-ofeastusedstutmiiUwhomabovewouldnavalwithinassistlatterkeepwhichlIghthopeKingcatchwhenltielehandliceiiMPutvcyearsropesdeepKingPIInakotreasurertruedtherereachthenceallowHicoupersonLuciefoundtheretherenorthwagonhopecanalboardaboutlurksreceivedunfithurtstakenovaryuianceunderrocstheirtouchwagonschoolClarkKingboysdayssouthspusewhichFromaboutmuchlIegewoodknowreachschooltrialseffectRiver100rootswritehomo1lattsImariOrrelundoboardAdkinscanalwarrantsclaimmanyfoundthenCoastcanalwhenallowtheselijortoftheyfullycouldkportoflrlMIvenuelminlallowHomeCoastthereliktiihomothemwhilemadewaterownersyardtheytheyAd-jlandsclerkmakebraythreewhenthreeaftertheirtherewithprlvonlythereyearsboarboysadulttheycasestheredraincreekStateafterbandCountfenceeveryknowcanalCitycanalcanalsmallReaddraincanalbrickcanalNsbIttCitychairsectionlrketMidwayinaniieffencethesethereuntilonlyboardtheredesunclemilesdraincanal1O-roofsecurewaterhavelittlepaidcourtyearsfixedImpnSlatepostSignedhourBendwhomdrainjuryarrantsrulesweekCohbasidedrainfaithNouWttwaterpublicmarlfrommanyutterfencetheremilesfrontCrawlandstheyboardthenCohhweeklandsworkuntiljanitorawayjustsuchawayshallKdenhavethemrepairsaftertnadtlundWithlandsonlyhighStateonlylongClublandslandscourtriverfuturethemthemupatlonIliulttonpartfrombriefroutewithwithRosehaveleasetierClubtheirlifnomanyListKingbookfromtheircourtAttestshipMothaftercanaleximnslevyEdenslatecashsandthemordertrainopenhaveshopspartgamefactsud-Wa67109doneuponclerkwitheachwithtownclerkoffertheirChasonlyTuesshallworkBeachdonerilulitpageworktriedcourthaveKitlliiKsuchsenddoneopenfromafternearerleasthavebacktheirl77fhavemanyboth7011nostStatepost12fiOneedoungmonthtimestuffcakeIrishvisitthe382S8BHunterhaveopensmalholdSaysrouteBoardfromecetptslwOhiowithseasontimesuchwithwith2500Mnlulepagerent-fpartthatthohWill1128readthewithsucheachwithshallmentriertraildonebeenThisstaybeenpartusedMissbeenbeenwithtown133650382886backwith1000fuedhavesuchCatodub1000yeardunebeenyearthatholdwithwithmuttclerkrealMisswithMissmeetlimnwithblisswith1610-InnbarebeenenterthatmotionivadHiedthangliNtFortopenduguitbthatthatFortwantmeansbeenthatwhobillsthatvisithurtThistowntownmostwestThislandJnyevilFortrl0-HlandsaidengageSTbestthathamdrawnwholandyearyearWedFortrojdtoneborFortFortboattownTheroofsaidwhotrialthatlandwhogentsJarrlothatpussFortFortvotelrrip1yearHolonoyearwritlolathatthatlandsaidThewhothatFortroadDRAWNwestFortwayTHEFortdugwestForthelditationwillthatlandsaltthatoatcropTliHtendfromclubwellsilojaildrawnsaidThosaidwestthusThe1900IrishthatsubalsothatHIm-ntandyearhavesmorentFortcomebillsDittThediedThefromlandMrsthatsoldwhothatandtoldTenchsuchthatund250whopassest0-rinewillandrentMrsusedTheAndelsetfrstinrtdesksfeelhimmillandanduncurlCourtsalaryvoteIliTcupant1UiwIH-drillfurlthisevilat-thfactthlHthisandandactualTheroadandhallundintoindcasesputBankratai111I11dithThethatTheThefactthatlawintothistinsIfthtoadandhireTheWOOTheTheTheTotalnextMrsandandandandwillbailthisyetstateGJTheintoTheacresuidImidthisthisthiswillthiswillton1und200IonMrsfirstTheTheandsomelaidlluN12C776eastacresmorefewlasTheThewilllastfiledthatiiiulantiandandloftmdandwilland26770payMrsthisthiswillandandroomTheInylotslastever1lnltHthoNotTenTheandandandandandnilcallandwilllustlastwillandandandandroomNOWHtnltnlandoftthiswillNoandandandwillivillwillindacresandthisunitandwilllotshadandwillyearLinendsomeIlatlasideThe0111andnodmdfinefivewillternMrsIgothatItlutlastandandwillandCobbandloudwillandandandandandandhotelWoandandwillwillthe200-WfishwhoandMinisthethelifetheUnionandhaslastlivelastlots100fewworemorewereHankyeaSeewillandsameOctlawandroadtheandandhasHalltheeachthethefritztheherhadnaylineyouhadandandandH-K100tornandwillSecperllshthehermethasweroweretheboardtopthethothethisalitandlawboybutandtwothethisthethethethelowionstheHisthethonotkillthetheanyOctfewlivefineanybuthashasthetwoherfishdifnum0ClubFortteenhasthethethothethoutheFinlisttheprothethouthobutthehashasthetheandthethethotheagoandthethehassoilnextStthethehutMaUseen8459thethothethethethefiledtinforHookthethethenotouthookanyAskhasdpesthatthethethethothesoonIf-aurltolllcohullthethethellloldthe510GthethothethomenandtheagetwotwoandnotbytheprohethethethelistthothothotheHobotoilfarthethothethethethethetheoverperhutoutthoouthiltmytaxthebutlireeastthotimelistthinthethethethethethosoonacrefurthethothethethemenoverareabyofsuntheforforthethethe0MlirethenotnottheshallbutthonewherohuhforforforforthethefarthethehisthethePOOforthethethethethethothothothethethe8500-Inolforfortillpiothethe4onofwasdiemtheareabytheandthethehisfurthecutnowownpromentinwaswasfishbetforthothothothebyruwsaidforfortheacttaxforforandtheNohidforimltonmintficiMrNoheiforforforforfatforanyformarWillfor101iontheforthewastheforforfortaxOnlauovlawsmynewatfornitswasin-towastillPoolforcom2238poutnotlastliertheCliinuttressMrbynownownewtillbybythethepilewitswasbybywasthe101daiedtillforforforullthe113-msot2riiCoatwaswasnutforleehistitforedtuxNoRwaswasforforMrbyMrbytaxMrfishhisMrMrwastaxnotwasave1stOnwitwasthiswastoowasthttto-ilhlHWOOwasnestforthethewastheNilOncase4500uun2213rathisruntsotseawooswastollDrconFortourOnhilltindinoneis-isandfiledarerenttaxfoiallbywasalittoreourupiced12AthefourboilDwasandadmidbo200-TsetonewetMrtheadadtheItsgofareadcanrepstollallheboFayall111onusefitupupwnraareandbebebeeastIIPdoarebehebeupbosououro-baiandispaybeareareofisofbeIfnGtntsheofbeayIClcanptBofnalofofhoboofofIIItoflastof400StofoflorhaseeseeandWWofofofofedofoneofofofofofbenrStheofofofofofid1ofofofofbeofrmlOG240areStofofIt-sofStofhebeofofofofOtofofofofatofofofofufofofheofofofof450AmofShtofHfltroadofofofofofofofofofhuofof7fi-Vofofofofofofofofatofofofofof187perlofofStofofoftngrrnanperdoIUKofofinofofforandIu17ofStofInofofofofofofofofofof00atoftKofexpvoM-Ft171VfoIIbecomtotoofatatafhtsrelofatofLofinIninIn00toiwofInntIninanatNoniupininforinInIninoftoofinlieofIntoattoat1-0natanononinInSttotoatIsinininforIninininalintotoInatHnurtototo13totoattoofanadonNoon11oftoto10totoinIntototoattotototoisinIntonininoftotototoattctoinitIntototoorhetonoio100-JlInattobRofoftonttotoLoMIntinininAInIninltdWOItttotoinatononnoanonnttototo01oltolittotolo111ofANtoontototoonononofintoItisIBasorison01un20totoitEItHtotoofitisAisasCoasisisisonononjrtoinatInCoCoonnoPisisitIsisonontoisCisisEisitronlasCoorKisisItbeinUtI-ItoCotoatAoreoofIsisorECisitIsGisin=ornoIsasCitirsasntinasisb1reortaonasBttYHHitGitasTTisItinitisonintoIrinudGasGinItGGRKCBTUTLEPIfSonluistouptlrere1tSFDUCP1orusPtoEoflitNoIn23isieIIB27I-iJMriInCMjoPSIII17ftsi49Fbtioff-IJ20Iii20tJItnt10wIl024in48ofTwJInHo11122tae1Ijn84III474ufInhnroIIliat1a11trIi=ItIoIIII+>I1tIIIIsIII>>2iIIII
PAGE 1
M-INDHEYSEEES-EANDREWSIiceLIT-TLEGIANTD-warfAtlanticFA-BERDiscoveryFANNINGCo-ntractorFIREBALTIMORECOMMISSIONHotelJACKSONPRODUCERE-LIABLEIAUKKU-ATTOKNHYSATIAWQualityPRoFESSIONALGAULDEN-ATTOMNEYATLAWEngineWOODISTOVEINSURANCEATT01NKYATliAWLicensesESTATEJSA-TTOUNKYATLAWReportAnnualsod-1ONEYLUNGklLLTHIiLlLL1jUNDERWOODCOUCHPineappleStrength-AGENERATORATTOUNKYATLAWCOUNS13LOU-ATLAWVANLANWNGHAMCOIINHIlIWnoNrolAAT-TOJISizeGiantHuntingREALwrltingabslractein1u11111111lay11111111IllldallrlnttiIrutatedealerFRUITPLANTATIONSNewRONALDProprietors-OneHardestySebastianFishinghorsopowerhorsepowerhorsepower1IIIIIP4111111Indnrl-Itun4CARBIDEliorseiovoigenerulmerclnandiHaPaxtonIVdorjilOoiiitO-lliceGasLUNGSPROPERTYTRIBUNE1glarllingllnsura0cosupplie-sIhvll5slalallleCuIoIIIIhrlnlCcaltielormarkJAMUNSURPASSEDFACILITIES-WMFLORDIACountyScmtlirnMern-DlilributindcLirliidotlmmlicrFLORIDASURGEONP-honenoiirettidentH-udLAWYKUSOCTOBERFLORIDAVTrrusvilLUANDREWSFISKEru-107IIIJJandnnll1lIldllllIllIlIlIl1InltluCOUNTYilelerininestlshingsevcubudsFlorida1Ctl1lmll1lcrchulIlIsonundIch11ndlgAOhM1nhconlnrcturandbuilderreunilnierehuuusalndealersClevenbuatscompaniesIna1e1CUitnulIvrllhlglnwulrliuvddeakrslJFRIDAYOrOUGHSORANGEPIERCEINIDcnrrlingpassengersan-aciMiratulyattentionATTORNEYTrrusviLLiccarefullyFloridatlitKciur-utorCHMnnehkCoEverythinglIIallIlallolllotlJ-wIllh1IClrmll1wcoivrlnulslnsurnncoHnlWlntfGROVESroiHtnirtii-nnloi1AIIlhluuuugttMcCAItI-NtDAVISdu-IVelnttllluvlIt-llltllllllItnlOt-otPierce1I11IIWIIItr31-1I1I1I1nl1IIIII111111lIchnm15-U1vUiillukJHEYSERbusinessIIENSI1iIth1ItFRtnyltIVrltllllehlKllrnncutvrhhurinaumncoPIERCEdosirablotlllhlnlCllIublllllIoUowledFLORIDAtvrltlnclualnnncuiindispiiUdIIIIIIll1cldilUullPIERCECatalogeighhlgmachlnwrlauglwuruneoCARDScontractsWIIUllllltllllhlllllSURGEONUOUWNSPHYSICIANhulelkeeperseveninannfacliiroLUCIEpersonalconvintinK1representHOUSEBuilderallottedClassPHYSICIANItselfIliaA1IleudryIImlhwlIIIIIIiUCtIwrltinginsuranceFEEDUnitwF-OHTddentist-entidIIerrluruiturCCURtingInsunmcoHUDSONbuarnIrnIIIIHCbuyingiiiTownUyrettllonronltiall-TEOUBTrruaviuKrttIlIlIllHehllnthnvulaonllhalHardwarenltll1lllnsurnncoIhI1NGSPromptlyKIA-pEOgeuemlmerchd-r1o1006Satur-daysbeglnnlnu1ofAlPLELuciehnlcherlugcIttluQuickestWHARFFinewansnelii-rrevolvingHEDflocated1Ilalll1wrehant01nl1murchnnt4uaaInxrburnlturedealersUltnnnrugtItmerchuIJlllhrlrlllIH-TOWNqualitiesFORTBeltargumentats-Qyltrdll1lcrn-ntylnrrtnttluTOWNANDIIIAVSPROMPTIrunkItiararutulldrugstorePRATTlookeduulIhsIh1iii04-1luunklugleeMondaysIalxlIIIllltINLONGcollectedpracticeIrnnhrilqnpiodilecnilel1slalda114uordralerrllurs-InxuranrlStateIuunshlrllns-nTHEpracticeInltrllrnlherspracticBALTOInatunuruCuI-IiitrmurostandwcljrlitH1I111111HUIlII1COhontdnndull11dlnnltlrlBROSwchhll1lmarllllllllltrchullttiummlL1HbitliingworksPIERCEtiunmterlin-HIwIelinguliey11111111t11pingropercordlishbusincesKIOIUDAveoJrdnWlchllndldoIIIHNII1IItutelkeepereFortphonoKIPhulelkeeIIOIPLAITSbatteriesItlworldtlIlIdlIIIII1ILOTSRPInckelubsu11-mkstiolliiliKcountlospracticespecialmlrchundhaeIIRANIIIofIllxlllalllUlaprlctlcIVnaul1nlweeklyicutHhort1eldlxnnlndliTa-lCarbideIIIIMulu11nPINKCu-McCurlysterdcalerlllIIIIIIIIItI1I111nahinglunholiestfomlinobatteryInerchnuJts-uC1hc-lnrtyalafterundertakingcostingtheruudlgroeerltuVIMCOCOAaccountsreceive5111x11THISServiceUAAAN1rrIuerchaudiseflrovardyearlynunkntgleocxoopt-restaurantit1Iit-IFORTlunltMrHhupResidenceUnitedlknILdUllllcnlcHLIFEunomlluntPlKitCKIltul-dnYHeavyfUHUMOMKvcryJulluNIIIIIIlrluntlnw111111111111111outlayCourtsrllnllmercLumpllJIlIOSIII1lIllolI1lullnvInqllllIhuvhlluceandhiucutheWlllTBlisildederriKitcMWAndrews1VlltlllldnllllllhonlcuntratorsmilitySend11nIrrlextutraHitishdeuler5x1041111110furnllllillllloats1ukacngersdcaIcIslx1lercepriHoswfORInsunmcoCOllIHGuldaudlhCourts11RJnrkWEBBl1hulluC-11rCnrlyCourtsinsurunceInaurnncutishlttgsixtudgl21-1cuuuecllFlaIIIIIuulFORTStateswrrswuulyardIIIiIlChludepotUnltonoTHEG1dalnithAndrewsIN11111ullecluriOInlenDiitki1lneurancoeerllvlud190-9066RFlA-WTIgg141IGmhlsllrhtsunancuFORTamountIlrlttKIwtbinelinTutorilverymenInnrnuce-IluwuruucuCourtsdeliveryInxlaYlnveblfldhrixlluiufIvelghiogInaurnncuhtauruncaIMioneMrCnrtydollarsSliuliIndianIlunglllauurluhurPierceInsuranceInaurnnculundnnDrugInaunn11e-CtlmuOUliuuroIuudxrfoundLAHKIICIIIItIlIllnauraneontcrchuntiiiil11OctIHhiMIAMIIbvnlrylInxuIosvInsurancelnsuruncuobtainbestwooMclurtyInsurancelaH-1IyourlNewsnmuuviilvMlnckauuOLDSUlulnnclutuntnca11r1lutySl1pa1l1ldnlerelluntInsl1llIncQ-iduuIrrlnmrinlrrI1nrhunmostIIIIIIIII1prIltKandInatnnnelnnuruncoInAursnerIxinnlhtgminutrclhtsurancuinsuranceTheseDiluteOIhostewllrtggermoneyAndlOtv13IIn11I1actualJ11NaWlDruenIlIClllllltIlUldp-Ir0-41uJnmeplainwilllurlhnnlthis1I111hlmerchantIncrchnntJt-nililouivenfta-IUhlgwordsrnerclluntiprkCITaxesbybeyhollylunnlwareIImitunandJanle4lmerchulltStateCuunlywhichLlIlhkeepingRiverFOIITinsuranceHankICINSIIlnrtfurdwillOOicoStorosomeIWFlA-nlilllllcLtuiuANDrltll1leUlaolwinBplengthsnrerchmtllllersurlInKatosWIIOMIIhu1sfeedlilmlllobathsnlttuulrINcllollkoANDlllIllIbtand1111v1dinkOcloherIharleStalepaidANDJnmcagcnuruIHankblockC1NIIIl11allTuskbinedWIIAToperaDeltalIllIulltllwrlthgnllchlllOInchMclnrllWhyPriceWrlthtghim1rumutIJiiHiihNumwlckmakevalueSlntoStorecluingUiltnuusomewrltlngwritingJAMISWITHandCountywrltlnlC5100-1ClubOfficeHIlIliUiInuuIlusvnlylwritingWiltingchlhing1111111111lIillllllllwritingandlowiiFORTJeuuuntag0nerdwrltlngTHEFIJIUl11111Itl1ellllgenenrlJacksonthe111111IItudnJAMIISFontDeltaFowlliuightwlltlrurwrltlnlCwritingItlqknIwhenwritingllIlmltypoIIl1ahllAgentsU-IeualclosebilliardTucker1lllIlItnfromBUCKStwartJIIknworkwrltlnglyjioSeearltlne1111111111hautlisu280fromlmlilIwiltingCITVKimsInrlwrStoreIublicfilllamulettthe11111111111writingHgenerallawyerlawyerhutsulullnltworkclassa-FlahlSlollolullnndalrxksluinlKM1IIIllUlllathTIOSCircuitratesCureviewtllt1011WdealerswithinSicreunstructIlItllInlpurltalllumberlixisAC-IhuinllnulTriall61nchIturihi111x111le1CIernrulIIIHJOIiLatvly1VhyttV1IOMRooms11ClodpartleastIllu1thanwithSTo6ls-Ini111udrlmarketthestrandpullvl100withlwatskeeperlikocellsconlsnulrkctSutstntdatemostbestbuyIollrt1111111111day11tlInirIiipillREDlIhutlMDt11110411IIltlllhciwlaIlquultellstlsldorInsurmfortuturketHltklr121Freetrialmultwelvu11111114SmithforEGAthatlIllndllphiuI1900010-01lhalik1thatfirstJFlAlihrIFortuncretopriceInlsyerIIdllItl7IHFLAFLApml1alllllllKIAwhichdry0o1colducullslclllnithorlllIoUrlllIIllIlc1rIlalIJllltn111lnunt5-Ir0nllx104llralel12lonllslNurlhdialerbloeka5o-ClnrlJuihrcKiulnlEandAprFLAtllllicoltilleotlfillandlionlIIlollenmity104-slllhurl1t11I1IthaiIhiTheOrinlandMIIIIIIImuloverMnutlandIIIIIYretulImulhersdillofPATTtthatmayOfficeII11niopee63UGOSTmorerealIlnk01rentsdealerStSlnluAHinLucieJIIIIIIIi600NlIlhandandIiandkllISUlrrahellandCHotinIphltIIIMIIII-LihtPOCIlInllnutulcoand1111111inUanIIrnpBover11111theIWIIulrllbuiltBox1A-RI2111-dlFromStateisyouandandanilliftnecnumorelinkerhousetirau2fuhouseofInnsu1lFCudsIIUIIandUkllilIt11nyardIIlIttlu1lihmIvudlulRncoirt150I-totheluolothe7thIIIyouandtwoINIIIIIIIIWIbunlll-lthlcc11111themenuIulkerFridertlllt1200-IcellyardCulst111-I2IlutneIcelluuItherost001dooiingWillrelnllshoesdodoLLtheCulIIboutsdillWillutnueloredoWill111111tAl-IIIItinANDFUIt1000Hulotshupinirttillshow11111dlo1lIlulbl010-1dJthedotheIladodo-11SenlugcntIlIultslwwrulilltoItJIIIIrot110Turknowfor2500lublcugantagentwallsltlllllper10001000nentlfortillthedoItodoWIIIIaglnugulltagentagentof11111111do150074FallInlls1Ii-Vuses11-SitoverlwthonuutIho10001000do-du11hngcntugeutymdeo-IliaIwnollhlnSyI1921U-HILOOMlOIa1Itorlini1100agentngcntcanltlt-Ido-do100011I-T101mNewonlysumlUllMfor11o604domullBruumsWIIIISupOill5rlrnnculId1111111117sl-aMIIIhlIl1l111141iitaliLalnutIlilKilltoinIAbuek117-It4roomsidlllIlxntgal-sIIOHFIh760111111dllthepwlpunyIt37iJPllnlrloreetH-IIII11rIIIIalll4nnaII-f5041-rellAprnutlltdonllntfindayIInfortItlsFa-fIIInll1Ilu111111100samelurdtoL1004mid160lonoViiicr11111l0rtDltl150-Ilib21stA11-t51-12tBentartytipusIc-tu04-11g260IIJ10InkOctCUllalla-I1allits876301115fIlush1l-G161-LI250lxxnt260lllut00011Mhmeut1005bunt51-u5u-astallofdolx-IIII500It3Mllg560111110teaHnllhllISal951tu000loMe2612111300PIIUUPallhullII-Iilouseran5Jo100HII11111IInd1005up1116151111500andtvuandMdof50-4SIIJu1-9rofdo6OJ30051111NII200nq5111and61HI5IbSal600500341hOO5lslIIAIInlsArafdl-pvAI11-1AW11111ply01-1tlJOIJOctOctof311111hoof61f1uf113IkrnIOU111vrlt1111nubgeldgAtKtofofnfal-slhail103041IllAPlillofWCXKtheTOal-UIrrDIllat-rdonL11tillh304ofnlcn604amrgtthetillb111StStnlIthe1111alltlla11100ullIIIwo304HuTOlIIIntrN12ICas152304Ilweofdo11111logFOIlIIlrrnneMefurMHSG-IIIIbsiTinlInrrCIAUf1111110tt1141-J11111d-tI1iof1111IfillInd111aaalitlugforthe45M11111illHIIIUIto1l1t1L5121156byInD10otInrutinIIIdulua-pl0060a129lrsIw1li11950-IIliII1lil1111lag113117todu-ItoIIltlutoIlldududolio1I1111duC100I-IIIIlunM103no131121Idletoin11515111641111to=5rlodutlolIutluduJI0-IIIIlxldeiforhllnilJvIBI121Uihilltorlododutlcotododo11istillladohlldutlltlitdoWIitCuCuludu1llUcnnCuCuloCo0CuCIIl1lICuIN161wAS011till1111doduatrlodududododudoilldudoIlltludatlodudufi3Aldodueludod4UI-cisisdodudoIladouOiloisduCo111dudoduduItod11illIII1111IlulIuIIIIIdudo211IIIdotlotlalaladududododudadududoduIIndutlodudodudoduduI0dolItdododudodudolico11111111dodotbJdo110dotlo10dudoduduIIIdodododuislullduIiadudududodudududododutindodo1111l1duCu4Iuutt1VIindodu10IledododoAlclotinIndudodudullnrldudododudodudiIh1111dudllludodododududlldoclolodudodududu110dociadudodudlldudoi1uda511-ItilldudadullIdodouOdu=WHIuAlAdo60-IIIdoduIindudu110dodudoAdodudodudlldn1111dududodorrdiC0durlIlldududodudododlldotlow53525111loIV50-IrolitH°loo20ESWbal-Ioror60alIIcoMHtj1Pkc10MIIIWMGI25ANfilMro15ISIdWlyrl00W7li25211V75ofSiWui6UIIIIiiW00c1JfoM24lilJ00illal1frn111512lof1r1111IIIT11000010IhI6W2ruueP000000nt62pl1C6Ualro005010f1131ruart0000101U1121to1010Ill4J00l0ro002100dlWWr1WWStrItO00a611ne00110II10IIIlUtI7110Ih1UIIIdlIIIItOtAl04100IIIW6000IHIUu1I11fillllloIIIIs>It1110IalWJ=aiuIornniIfMIiiillInIILII00OIlIIII111IIIIKIItIII411IO1111JI111111Ill111IIM0nnJII1iFuu11IVNFe92IIIIIIAnc11toIIAAnMffJUIIhAA11NIiflAw4lrllOOi1>Ait11ANICVCItCCcgxlIIHIi1htIIi0CJUUCAAxOeaitJU3Ill111CeiiUIItlIt1ILCPIIIIwwF01xlCelIIJIlIt11aIalIaPdtdn114ilkrt=tI2disaIIVscaaiIfAlGwnhd1IIWpl1ll01IIlJ7It26allAI414HIMhIIIr1lt282d122>I7da66522rta2aIiIIf3a25s11a6l5=u3II7Ii5Ii222S52ay3I22II7u22222367f2aU92211i12552a1I36II30t1S211fIjij22907OTI77915I1wII10=Iiaaa14iuuI11n°j°II°nlt°3OiroaS<111rI1u=4ul1l1raer+t11111lI1J011°uiIx1JtL11Iu1C°IIIIilIIiItI4v>llJIllIt
|
|