Citation
The weekly true Democrat

Material Information

Title:
The weekly true Democrat
Uniform Title:
weekly true Democrat
Weekly true Democrat (Tallahassee, Fla. 1905)
Place of Publication:
Tallahassee Fla
Publisher:
John G. Collins
Publication Date:
Frequency:
Weekly
regular
Language:
English
Physical Description:
7 v. : ;

Subjects

Subjects / Keywords:
Newspapers -- Tallahassee (Fla.) ( lcsh )
Newspapers -- Leon County (Fla.) ( lcsh )
Genre:
newspaper ( sobekcm )
newspaper ( marcgt )
Spatial Coverage:
United States -- Florida -- Leon -- Tallahassee
Coordinates:
30.451667 x -84.268533

Notes

Abstract:
The Tallahassee Weekly True Democrat was established on March 3, 1905, by John G. Collins. The "True Democrat", as it briefly called itself, explained that its name showed dedication to the "true and tried doctrines of The Old Time Democracy...as distinguished from...mischievous fads and fallacies of the day." Though not intended, never more true words have been spoken on newspaper title changes! Milton A. Smith bought the Weekly True Democrat in 1908. In February 1912, the paper started publishing as the Semi-weekly True Democrat . In 1913, it reverted to a weekly again under the title of the Weekly True Democrat . On April 6, 1915, the newspaper became the Daily Democrat . Frequency of publication dictated another change of title later that year when the Daily Democrat became the Weekly Democrat . Sometime thereafter, exact dates are not known, the Weekly Democrat became the paper of record for the state’s capital, and the title changed to the Weekly Democrat and Florida Record to reflect this development. If ever it was a record for Florida, it would have been a digest, since both the Florida House and Senate have maintained continuous and detailed recordings of their deliberations. Today, the same newspaper is known as the Tallahassee Democrat . Because Tallahassee is the seat of Florida’s state government, the True Democrat has been quoted copiously in journal articles and theses. Of particular note is its usefulness in tracking Jim Crow behaviors in the early 20th century. During this period, African Americans constituted about 80 percent of the population in Leon County, and white supremacists felt particularly threatened. The True Democrat, whatever its name, would come to influence--and some might argue, make mischief with--the State of Florida’s democratic processes and the deliberations of the legislature. While it may have shown leanings toward one party or another throughout its history, the newspaper has been affiliated with neither the Democratic nor Republican party but can be said to have exerted its influence on each.
Dates or Sequential Designation:
Vol. 1, no. 1 (Mar. 3, 1905)-v. 7, no. 52 (Feb. 16, 1912).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
33933863 ( OCLC )
sn 95047417 ( LCCN )

Related Items

Succeeded by:
Semi-weekly true Democrat

Downloads

This item has the following downloads:


Full Text

















mWD

W Fbft Olhcj


* '.4-777


ftAY&


law h ves
~be0Ikis I




bw 6 a wdbwk





uim dome* so mm~W


4.


I'

~Am


ww~: 1i one WA*d."



0A *m Oft Aw-a d dk


g.au as W4

"d so" 00 *A


hed u i
BAWL&Jvg~
a.dML







hod~


0*01pow "-,


.7 ~S,3t,
I


. Is


af mi va nftl


~,* ~ M&smollC M


1l~A~- h ftp^
*k ~sk
amwis.IL 4060b-


.k siMOW ~ b





J4,j boh heS
.-- wi Vndn
I h ---A-A -- k-F


w~ v ci-unia
-.-AIL

A10


A.
F' *~
F'


wr
-
OLE -,


'. *0,


nm m


Wms


WY 3W


pop-


.


~;- ~
I ~,,
'F ~
~


saftwpimiamm


, e ** / ^**


MAT I'-





-to INUb Pd*W


I .'
.' '*t


The
I.Ifti


R.-1


rsiz

































0 sabdaw Wem flew
0 0 0


W. IL om


0 Wv i fW


1 W 1


C..*0


swa jr0 d


m-mdoft
Med. 3A sr


Ow I.. ,lewb ha pwdued s



~40@"o a.ad of


W. nwulkeSDer-

Ptb owa A L h

69 smWO 4LV.6.hiter


- no Alw
Fl~bm U, =44: -
wap Odee


wb


ml O~. S.~ bl3~
~IrnNu..


' 9


me bw* =ob"


tL


~bu~ me.


p'-V

T


war

I sa" aalin Ish1
I dhW OWes
Iad ho burned 60


* a a


blus~aesr ambwl imi...
Otee& T.Ib7M Cs-Uhew1. 1
Mr. Tm Cooest ad I"the egl sumok
bmIs eebliw hM EuA. i
p~m ammat Mi ad be 0
Cadds ft toAdi s ~wis

-~ Aeps

tuag is mmusreaI-

Tayhi Ceihi bs doepad pemse
*I m depa el.obaspalm buth
Whis hbesm-m--i-,iMONK3Soho
do.n adtol wakve ia"kw hoia




Dr. 0,.Daswo 0eI Mp. be-
gmasmstm.1meulag
ebuuhh~. Rob
- ma, ham 6Mwulowm
esam$" bwmInAt Homes V l~MI


* *


W, LAs WoSm. e,




A.-N

ONO" A. U.L Jig bmisub m
~ to= apd a.emwbtb I




M.A.e left s ad 90 hft b








am aum a esnobs" 4
bhew~UNow


-i
.4
$ *


k
* *


bmlv~f 01


of

OI


RBO


S. ki


F w.


r"' W, 0W. is-0C-Aw 6 t


- v


june Samy est awmb s M&
khauee*u m P am d o
dde d absWOWphato bhagObd-


Jees b m Apy* to
Asses.


m wr


LAs obei %ii mma -wmremae
pow w h am athered eS*ad
do healuiinai ss to *we who
we adMIMI Istonsso to mow tIb
hr ssubpu OL WOe400A 6
be ubipphIl les s AWW .mi.~
of per pweek.
"Had deamla O& wke~


?saw *mM IWVb jehesmad
Gaul. helmubed 0.inheliykh00
mee-I a" d 00 d.ips, hi wb
Depuly betow bft i as md
- waum -Wn Wosbuw.




M. Job uL.WdbaweId3abw~ho
whe hao em bm E69.edo unt-M
="twom faesublm~ua. -0
dieftlad 00% "1amaeuswirl.
1 640sh .hed*iWM, e
0. li "ow6wso

1* '0
P~f CM&t Is be* d
S^ pio oo" ---- 7-am
UM Mlls% ole. TdA 06 frim SL

W&Dandtft.sopha
EL an" Nmit .to meo
of hha Nq
W o1111 aem e m --a &- IU ,som e.
Gee.w V. alls h
di" hesela" pp.be




vS inpe~ib ob sa



4ftowtuta



b*A a~w .~p

"o. bhe asq~~~
Immu oo
b~ TvwpdJ!ia


lb fs. Si


*


S. 66".



veto'


r.
I.


*
- i
-J


Ad


A -


[ ~1~T





- ~s. A GASRB*
T! ~.


ug~W


buI map Doomlhuw OWye
Gash"eson* wane* As mh
Juba Inf6 IsML s.no Inimae
ly do" mt I* a No ad Me
Ains Oniap Dose throw Om Modm
Cobb botler, id im&sha~a~
hbw. Theygm e hd
- -. r -1 n h.soeq ~ softsb
owsks. Do" QkvGay hast
ow reef the wi w


Tow ~eIs am"&




lamp to "s 8" Me"lq$a M
by Im dmlh-ft141




~ asof s~aw aso"*'

Mr. L Q ook&I i Imsto N
wo*b@d go hk m a
Ulmbs ekeM boSWOOwI
eeis aft l~Chirn i



Cbk BiUmm ho oabi So
Cuedkes to Sa o 6aobes burn
-. moAPBIO
no b "Paw U sIft BW
Chmhw #4 O~mmwe..Mod at'
3hajm ow hthse a*




a10


* .1;- .~


-'A


TALLA.U0.IW940


ho bvmmestopemokohi
ow76d goh.1. m. M.wu~
wvS be "Tbe 3up!~a
Thdr vabsteSUWA~s.

room tothe toyltai noeah
Qdmwto delver h do I
k 64 dle a do 06 ofApeL"
inn*" od uean s sapled

d.I~she mlypan se ffM.

d' Am. LL MelK"
d1 Apluh..hav isas nato,
heuewed hbhWaNWA fm wafts
wd d..e10e$mes ho beesd
do pso 1bi huS bebb-a
ofbb twbaasu mto


At 0 mmi Hoeftm*.







- w





0 0 0


a am


N


RRand oipgh A.Fen~


aI


;*l>..


* .,


- K -


\do


0 0 0
am& so oum


",I 0


w
















% '.~ -4
1
r


All*


~4 4
.4


-ii- ~*'~*.d .-%.'~
*~ .*
1.
.


rF.. e Y


-
.4
.,. .-
~a
-.4
..4~ .,..e
4
Sri
f
9.. t'
'-a-


C
'4* ~


E
V,.4...


Pot I


!7j.*. .f *i V .- I.


uii


-J t
be
1'*



h


74p.;~~;.

=8


A. ar thesd ~I ap wi

A?, A POFtThat sost
,asto begood.


&- .-A>
1~ *~4* *
4)
I


m47 'I's, 0- FmR. Two WUm


edom
MMP


Aft toi vea ki kam Vl w A 409 fte wlladam


Sl. n titi be me&bmat

Olas, t bagur V wthout aNoth4Aur lm


IS THAT LIBERAL ENOC ?
PAik.


COME


. ND


.4

"-


is'sM


** .4 ...*


Tt R. Griff. ~j
i A'


S ..t


.4'
- 4,


I t .


1~
I *4~ -,
~


CAM.ow
A9_Ngu T A
1ua3Mi. ** *ViaN LO


C.ILJU~Ws ILD.

Wooi ft UL offibm"


DS1 UW, .AWM

AL l~al bS


'. Y'
1 ..,I:


n* Ma Am


9.. LXI


.4 .


-Iafa


rJ~adad:n


g


', --


'S


.eA


r *...


1I
o


:1


3',


.4 1~
4..
i,.J*;. 4.


a



I

'a


S.
.4
-'I


j~L.. *(


.bob


m


1 -*


* *<-*.* AH


an"


. I f ," "t *


























b- mo~n.1lib mdh msw~tbwmdwtotW~ i l-
miudhqiip~h~ibhqbup1hr04( m 16be d eurh hd__
mdinb~winI aONou~m~ Orm io"ml .w h su~ r ~ ~ nngu
Wonounaewr. ~ spn~ 1kgi oinhswb
a 49 hont mmo.hLbOW imqeWwOmN" 0w mwb
US a mi~worsuft oho mwo o0 ma ht0.Ea .dei obm avS~e i~~4~
be ve uik 0~ ~r hMd, T00 9W ~b.wo0 ~un~ ooihlhmdoe."wo ~g


methon w 0 onp~msuIe~.ion owbud tompe e a0mm 3imy .ds.

~ d.,hwe s ipoua rwe hr W.obn ow fIbm OmUby MI dMet u.


am n ewe sumo ,b Ah m a u a,0.kt ut h u oburwool', mo
0-16 k do n ovo ldAp hr dl mWt p-IdooWl- s ob YSmr~sS.ki
ft sonwoml 01.0. SUET vile VWilt ub mowe".ft.
bewa Oego yimusw Whwoimtlms MMW m% w o h~mi~mmmat min



A"d 14p 0uIhSO low" bys O
oin J~oehu 0my e.Ia0wt Is -dou". ito o

hoIn 60 ra hodo& tee lol~ A towu
uu. ldem.b amcd a a qoowe j p s

pusod Osdm ow aboat 9@WMVnG k plhSs 5 s h ?. Linb,&.10. Ue ed bbhto Re m -Oso. ~
Oft tws atNUwho Wo- -wehow If U___ j,hy-1eftmmin w h porisovernl 46P tAM ashod desu1 ft a -to. mob
owbd owa 6%S edw 0. AmdmmWm. ho ntt peara Salsloh n" na Mftad m A"*spuem m

Ibwm w b 10wasSwe wa% god m dB dS aw. ow tii .ho 16mhoolh~u iohof
ofOh6m e. ~ do o o ws&mu @9Wam" odWeb~ of mos. h o efop" a m ow If Bor doetofte. SW bhoA d. l0 mqmO w
a fi, -Isa room" to orO N tew. Oa* v u a d phd dsoC h in iex ossb% awmt ht pawn* wm ~mb
ut ww o nftdo ad m m rw w Awma e.omh im w smbw is Need so a *on~ d go. "OWWO s df
-- a..a. u- hh*M odii f o- A-ad w weam Offi sow Is do1r.W& VA uAMPM
NON rn6 W th medwilts 00 M wWhe'*am ad wft da oo"wm hoOshe. 1 ull m owtUasIN "aoft u~~
bo It o m ii WWhed o bu od wpm q fWii n Gvd opin. Idon "the Ainuh e wes .*.......
so hWOWw S rwm tht t Iwew G imF ____
toomme a =waft W Eomyo ar0. batm Oa&Pmingeot old bmiSm
A up0b7"Wb*=ml ml vhgaft spitLo imm .0 1 e96ik o .
2 omsw Two m "is .the mam to on.dEMaudwbo.1 w Mobendqtbu" hf t m- ts, N* Tml Nu i o ___tt
d imeR Ino=%lladsi*otamd uOs oba. l "im @aI W mI ho 0. thas N bedqsbs L hIN
0"umdonow 00 weopubi hoyebuelv am o 366 e" dSuot als 0 muM @no* Whodoma s p409%I-
~ s k sm d 64 lo ho* pmori hodwve inews ois dmmu f ts rnie lmm ho whom
S 9w l% mw I*mudo@t weubelbm 5 mi d!PPos mge' f hw"ASm o
mi o ummd d~ ad11 WVW. "uyn s n m-b0b oa
ml d. ytmi by .dolm d..vi dd .b"" ish
a b jmdi imom i* orON 32 soo'~

amipd asbm w~ w n d ~do oho dWb
anee a &a* ML- to ad a Iw, b 9w dm o


4L


1, 4 4.1tA























































11 i --

On


lo


I @ id


~'m-

~ ~ b


~.C ~
r


I.-. 9


I -


14b
04.1- 1, I
---- ---ea b


t
~ S


.9 ~. .'~ 1.


f"Iwif I"


*'
~ V


.9; ~
.3

*1~

*% ~ ~k


hA';


Vt


-Itt


~9*.
* t


I I, 4
It. ,,


4L


V. ~ if ~7
&
%.





9- -'A,.'


t '4,
I'-


'B


Sa


*^ -


1-;I & .


<,


1 -
Li.' -*-* .


* s 4 '


















liaq wwoh
WW is w m d Now*
VOO0 m ob a


A. U AW S
y- "


-F a v W v I 1 IW I~ a mAm t w


asaw
'*no* po-be so n Mv. ymte o
IN ofuwshlt o r orUMeIfUol
sebwi~ @1111" hR. tosmad M" ow o'Ire
~~~0e~udhImm~t ~ ~ p~49 joist"n
Amli 01T ul Bl
d. am kp otk h sb "
vii k" IB d 4M aid= ft It" I d.do8G
WN tdoTamps guwHk v.Ipomsm inS ~I'oJs,, Old dM I*muiuls ~i grin" 00us

~ 3 ,,~ ~~ pof~t ab" M fw"ad b ag a o"
ate Ish W pq tony up guiSdo bo* 60 U so now amie a
doqo VogUi bm pmt No E i Molawka
6~ob milm to won3a d uamuib, I& aUn hiM .but At i iuI o OWN
ggi WFi mis d hS W kM moi hI f ma io Mo 4" so mi u
OW amdhiW, *mi iSg u im *owt O
h@ ad nombiw nd om os o-,a fft4id -w m" tW ju~ow MS u

_" -"
Lmsegu WIPI OW a JW
am oo. @I. d Wa okm hISWW m r*n3 at-ala


;Im~ "IN,


ONM 1w am



ftb tom ~ S

Io anb
#det t w mt% g


c


L I k"'.


I IL
c^uusS CASTORIAA- L-.

OB*.Iwma.u C A


T Kind Yo Hare AIas B
In Use For Over S9 YP
.. ^ *. *-'wl'a "


And Gatrd


b .an 0.. e e*, w 9





ltOQk-330TTOM PRIORS.




000..


di -


AOWmWUsrmftwEig
10mwoa is 06*4


I.


'1
"t..' .* '

*..** ,, *


I


s~


wi


ms~


3
'-I


I.
- *


A,


7D1"i' 777T


aueg" gsO
cmeSSbf


I I i


*" 4#"


' "j


O'no.


< .
'*'. "


boom
. ww-il-
iw Ar


mod"
, I
. took




































ontsfa-w
Dayftpf


~I 9I-~


Levy


rointin AIA1


B.
.4a t


re be Asmbd so me Shims =m"r
GOWN" esof S~usm
1w roe" stof tm lowS.Dautd'o.
Jostnk.Dir. A A. Hophn., .t *s
state U~lhemotMAt a v d ao
"~I of dosOn!auge to Was% eu

Set lboblo f4w 00O6 laes
d 4f bI m s i dWbOW WOW be


.uft" h ~mg' up

The lsow~~eik


0* '.V NRM


was cum


*S9W3fl2I~
* 11.1
1 3


vA DO1&L


A' .*.


lI mm udw -,'m

o w aN -d'mm ssod



YlW MMdho OW tl- 111
matm 890 uS Soho&euedb
"W o m i hse min

'U...is u *Now~
vs*'S I msaw ft bsma

Ian t waed v ek -We


yawl"


Fan~


* r


- WW ~ -
~, ,~. 1~A~

~ ~


h. ilium
La..
~ ~


- 0-


a
i~a1.


rp "
IE


5


- -~- aWm paW


'Y.


1$
t.. a.


,
L*1 ~


MW.L


0 0


--.5
Pt


- ^


40


RomW


I I wou


Vma"
owwww"*04,


T h7 '


















NOM dbd *an

bm.L w y*s
~~he*060
hi 4I


3v~IL


'..) 'I mdi Ors N6-


AUU ~VS& ~mom.Dm IIqr m.


me BMWSUkS
a udurm buud bido or m s .i lift.s

w SAW in rta.
44 .1w Mo W-t


-mom*,
OWIh.


Fla. ids.. U S 3m"
Ole w 161
~~ow by X06 waW
'e~ hw u'bowl


i uIMmb
~iwU


-.- 2f-~


*~~~* bag~~~
~h~bpWbseu~piI


blo. w t aeat -4
Wl An&-do eb .4 i


Am


w .. I .xI




Cen~Have Jut 0so&ugUp ax*
bdi S mwhuON""~6

All Wck QuwMutmi a~ hW Dnu


w*


J.


7:7


C A. NMAF


P~mc-.Al~mALpJ.m.

? A6LII


CAO*1 '

Akbk*oU


'-


V


* ';.~;:.Illy


'14
'1
A


W^w.
-< '
... ., *
**^.^^^.
.'^HhJ|^H||^^^^^^B *>

iS^Bt


.. k V


I Vt


* .' -A- *I *~
I ~


*,,* -'Ail 3t! *v


4


A.


N.


Nv


me a
NOIn


wo


"Nowl-low


A m


71
















, I '..


4.


thoes


INviTING Pr(ICES


Elegant Suits all the way from


$12 to $35


This standard make always gives


Satisfaction. Come and see them.


/i^'^"


4



(K


11


It


Sb& MI s
MW 'etp


WALKER (b BLACK


At, DUVAL BROS Od 8td


dnupi.Dby M. G
Api Mr. D101.I
matw mye aum I theo= e



11h,*Nt emthe860OM Qmp


Y"09Swe


ftbd


~PM Mdm3IA
-O
A nib vm s

0, mods-wEepItee

lobof s* 0supof&sed
bi me We~IN Sw

* mimi. bawd qso





we


W. C. T. U. Ned.
TherewM be aeel mosed offdo
WVmsChridfmtemumeUAWm
Namby fftininsat Saw defeatt
the hem at NinaAmoke Daome..At
abi umoethwdeing~ateWM be deeted
to doDwblet snves"tombe beoldlb
Ownmhe on*mlyinMay. TWeOeis aim
- otbk bode=s let from the MA
b beAWendedto.
0 0.0
ow weout for the manago, ft
I"Me Sm b., oatow pepwwlowye
omo~moha ;4m Boheklnsto Mks
Ca be Law* ,dsqbterof Mr. mOW
UMt AMt ha CrbvMr. wmlU
-Cda vsbeth niveTalee
ft e maw I of their &- tow
srIiutdhe "lty I@ aha~pp*ee
8emnk"'"enetto ther mnowld
0,11-Mr. ft h viikeyo Usft
owNw M WFerns.P.te I hemsowof bbn


* *


w-WOOlDVUU"m.
The PON& amw comeI"*DeS~
Wave b AN lbbp.
WOBON04 r.. LeNd 4IM 11
Ulter vu Dmgesrot
it eoplinm odi mat0eha
mi -t so admmk.fmull Ilsov
NP be haeomew fmatos S
d Mss" sld"ISO kowl

t,. "ft on atweadule
b"ag ephdedwbhdm d bwb
millsoais to Williams ad AV
vokemkpmmn ai aim


se mu.d imm6 11
reuie bonea d tea#,t
Iwoam NNW o'
09 s fom L wl


d"a -jub wo fe dok*my"

n" be boM meesee d m h*m be
- tdfa"Mo d sd tdo* mi boebe.
TbereMM beasa mt MAui al-
tsa Pvrdm *K ,APOrEL athe0
eepeL Woeawe ouw"hase e *ai w
fmuto tbeip. avdwar time w tv,
13 11211 lae W"isaft ,Y Ma"


AsOu ow ey efflemt peetmOerIs k
waye veig buftasafterdwkmsay
oder ms siedbepoWiand 00 Ameg
woul be me waking mar JW~b
#Ind s* mhuuhb"lastlt OwyIfto C
ebb e"d bweiwed pestr, the am. Law.
be%. whO daserviallNubebahom e4916
a" el Se e mty mAds OM
*owls in the upiting Of imassty.
Asuthesmdof heel oaqeeleb
belowagW6A iIt mlghtbo I -e-a- _
U"a theWW bebe lrayadeped Wwe
of whmam matwe toe pow to hgas
NOWy bbee Sirtheimr shilke.
On Idayt e e hadw bvt Sin&
m allab-peaw vbseu-m p~
wa meatthIMnew UKLWe hap.
to An de ine e Umm lfovd!
efter givig ahk tihL
sr. IL a. La Owin andIs hare
town uwhe ebe ib'-p* lb, g ed
Iowa inldvaw2.-
ban e JibemmanSo- on**m~
oen w" Noa e. a emp *li I
bsht prolir d0.

PlCI & I oa ns
dip 4a =wt Onadob dobee*
-no, Lao In GOPa


TO be Im k Low Cmwo pbiia.
~M % sa"dpam1it


" -gM-"A.m g.


" W


-....n m .


MSm-S.J. ~


A~WL -


.- 4
'.4
I. .4


I,. '
'. *


VI
- J,


if4I


ir


A


V. A


k9


plom


*, I ,1


o ,* t


. I


I



























IL k.1mbsIeoys


.1
A3
~ I
U

V~


IL


fo)



midow


VIM co










""W" eM as bbb "a $I Iw.

is ftbamw umm fel
*b f isafwdeman powho N
hmi, s os uI lie shMoo se
obw setmlaft3el, emhe wa "bi
UiPsWKt40furusmlussinawmw

hWAOpm bI "ft BMes."
hu eta"*pm
X~wmd b~~
kuauft V-= = SU


-m hems isAW
d bm h aw dbwONam*q M

m~i~ indve .1 a owl
h~s~b bq @Wem hh dl&
beleses wieminw sawdi
i~am d sin u 14 soft#
dig pinhhoin ise 8 fhue.m


-_m -a


I* AisAd Is pftbUhm
meshieslawof a. AmSIsbaeMhot^
my. No Mi behe" m loddhem
PmWm aftiwftia. m go" oUwss M
luineyof a. vN1.u &V s--wim N
Is Wb^ M 1- i- emu s seum I*d
gan m usm.. "N"ITis as =do"
am E el gobpreheilekw&If.th
am ft Ihsobe -ow -is"I
map 69 by fseubIMM mmo
of o a.itum -"vanbus
move soub. elqumL"
OWN*Owes Aomdbe.
I"t ohms-rlt im eftwIM a -if
eftaduwtohavow*.
0~ lo avwwbw-Foa
aWeS uehsft4200'.000


.........


roe TrwDmoi4


" ,
't


mis~roopm"
is' pwem Uon yT






I~.q~a ppid ofthse Abut


towift is m Aquatiq atmy belm
04 A W7eOneilymiue eU wo a
be a infuPIbem up" often? Ui
poIfbta naN b mas toft ow
swtm a~ 4106svm 9eh a meinaltolm
mIsoifn s ilpling *Itawn ab ovut

urm mismelp II bwbum a. das NW s
pnoled ifw T"a.5mwuubif soe
ue1toidoblik m me saeeeuwlly Is
At ise fwavess hr noeminial e41W
IMda velfinm" WW Ther -is 01
s-c a me a".so Polas a
vim-to ium ge dlinm mill
Iftvinmt h donmesoud n a. uis-
d"asd& ubi sun loomed d a. a.
su a a GUWN The rigt 0.de i
I -I umod by mysmand
mot Nb Palo" Nisnmes"Ibe of
it no bhe son mbi ssedo may seu
Sub o Ul ismy sa eo esma b e d..'6
OL is own mend a.mvfti

01 t msemIf dUfl h*I60i m on
NW m P O.kd"a tsk3s b is
.1,.. amy Ww as U dwa
ft e0 .6*b MWW."IOte
e.-am e ta qi ft
68 d Sou *A& ft pft Euth Eu S
of ip an bw, pe ikIwoem
0j NOhe kCmva se


- V -


IGWe W RADIWy RE A.

HIGH-GRADE INSTRUMWm


Min~swiby


The NNW uob NO


of heMuser

The Piano *6sNow on theA*

&W wilbeaasp*mdiunwOwriw.
wo
oiti a .a few do" *0. *0 0


C OM. (-TOy T-41S
mdhsw e 44 -MWVwww"o


YOU HAVE SPLENDID OPPTRTUNITY


Toxgdllh" -pass 113.
anl mL 0.0 M N m 1DAY.


Watcl f


Our


ZN IM PAPI*


W.W
"DPW mw bago 4~1 a
lb $am -
olk ow b I"mw~
." go sm ksuI
po mu bi oisto464amess8
asW"aNan et V.I
soa mdow."


.4 ,~ I~* --


j ,.'*


.T~ss.


9. '9.


A.;


T 4r.-


~bseWU


1 '1~


Mm Is a*beM m L b I L s m*~Am
o eiutih u. buu
~ I set~biswS~bt~4


& K













*. ;~, **qi
9
At


* r ~.

'-U.


tI
I


be

The ~i
vbsu~. ~ -~ ~ubd~
lb
d


AM ALM W


Amu% ael bI

se go avobewb he he
in. do MI sel E f* febmb.
Wm. hf.yAmi GWu. WMb6
No Aft odU&. J. Lad Kb.

I m' beUm %%W
ad $"Who" "a** we








of sauw t





iwpbeuis gmdokwa"


~ bo bw Vl



-s iu~mbe a. a eras
'A SmIm' 0 ena boPK
'1 -u p~ ~lop


~ei bee"A Seme


*b d-


*stbe be l


b"~~e


a*mint e mto ,mi

a Jaw ee % ---Ibul"We

411 M'be b W ~ w

dooneim Sty dm *9m
Un k p o b ~si b aimi*Sw




we C. T.U. MM
TheAppmsd d ftj~ W4"006
~ ~smmU"e we beN

ewx wsAsiel bpUOw. LeCL
Toqa. 3m tws ewe: O"bee



ORbe dhe wwdA dd


iops v ~ p-ifm we
wwwlubIM emanparelf

I~,ami us ib we a

$00 Nguema OR s ManW

oup~ bwse m IMS 0 In
sun b .Adbft 0 m4 a3w
be Iweab IndoRonm&

Amus thw@ asve


sok-mse." d WIftsA. lof



e~pi~Ifl W, flwe
Od ibhM M.?


- y


no-ft"S" -Yaw
elm .,s .


'* *4 ""
^.& C


I-

.4,


-t


.. A ..


low


F7- VA -



"Jam w-a miiwe trdwm~ dylac nmaagtwie


eqgak
I -to meb Go


''4
2 *
. .


do em dmD they rOcO cea tyles (or $Nmeon


REG~AL SHOES.,Iw


1: '4
4 *


A LIF Rt BRClHICRS
WILL FIT YOU WITH *COAL$


lk Gat*u




Nedbwph T f kIbim


we~i m ww" I*,
doe WNW* f bb Me0
we. am W u
UweS IN @mb


t ;IM mlahiE I


0*4


Oak"*.
tobowa
Ut lt"a


no Mrs SW dnm 41 h

Iws hal "heb 44MO UM
bag wIamAM


mmPro" m on
w be domm I* as
"Wee Isp as -
agdett W 1.


6b ai -Nd


oiwebee(hm im
mi ft owe bb a
in obi~ aome b
e ifis wAS a Wtb4SS
00* Thuele we
bsd Mon*e~u
M a"e
Mud e 1U
donl'


M0. shuei A" wa. bibbe
s. 6"ob week ansa i* obb
smamIS 4w U*eM 3.D. ILU466


I.


60
Ill
-L


- .j


qiud Al~i~
welel


New P MnFish


*~p. s'


I %


H.l ^


ec.
k


-1


=== -AT77M-=---
- zl-_-V a- -- da
wl -0 I-Of -


hA<*
*I >-


to OW I
MWAM


1='m


N&


- *
1


AkJA


=%A2













o .'f
'<


1I o ,


Fl


allp. .~
4ie


*6~,
I.


I,


I -1
I


4j .4



,A. ~(


V I
Al


~
9.


-F1CftA"&iAM


.~ .": .W -.
**44
.54


IYm


~., .~
A:


~** ~


GWE.W


-We M C e in Stock.


.4 A
.1,


STRum mo
ITREET


D. it (ixF~r~LIII! (,TA tANA55ft

A.. j f~* u4 n.I
D o o xL a. b h'I j 'I..J'.LaIV ..' *-4-


Si: .*


. 6 4


- i ,-


~You
;,iI,. *' *





i4 Aboul


Are


Evidebtly


'fli~ie
4,


Pumrchasing the
^*^^ ^BB^ ^^f^^ T^ ^t w


4 .
'OSL
GO ,5LO0'


".5 .. '


It is yor privile to make comparisons, get the
and take theest thecity offer le

All we ask ias that you consider us in the

ton. We have every style of vehicle this

demands, and a range of prices to fit the
of r fi oances. We have 7Th R4gI

the Come and look us 'over,

l a to look. In smple sundries we have
than you are likely to ask for. Many

jq wgill not find elsewhere.

and Turpente men we have a

collars ad hames a


I %I


a *


K~ ~. p.
I'
'I-
A, -
4,.
44
-4

I


.* S.'


,.,.
* A < *


j>4l


* .
--p.
.5,,
4 .*f
p 4
S.
'S.'
V *


S.

I S


~IIIIV~>;~


!~ 36. J~
5 6 .
S.. ~. I
r~-
S.-'

-~ V. .~ 6?
~ '*.-~


.1~

1~


V
4


''Al
~ ~K-.


'.4
'.4.
~.
~ A
A


U


-J
A.
* V.


.4
J,)!,*,.


*1- -.


YOU ARE RiGHT TO


*' .L.
- %^'*r
Irk> ***


.. ~ ~ ~ 4. +


1 -


P




Full Text

PAGE 1

un-tieSCROFULAePlItUPSkF-OIZY3IIONLCATARRHttgrggLgKlttieRHEUSho-esREPAIRED0-eMAPBaC-iutthisOREMTiSJIFhSMachineryt-kWIMQeIveaprompt-aLten8edl-BMSiltfSBCompainyMorylamLevyr-lifJITIP-tasveladlgteaslwleaaaaaeaaea-oiiags8a1JanISaowttil-TW6rRentplantYourAsorvcnreiferceMtljMtiontsrteaayeaatntlvvralitThingsc-tnnofcmteaBrosfIrFe=DeeaecrUe-Priewea10dKeaa41a-y1X33tnM1utacturttl-tltttAtt-ii-PC1WCCI1rm¼ftmIT4JacksonvilleNewestee-lM64WdcsasistttUesH4IBSWISTOATION-TalUbawe>BVBRYTfflKG13iljI-1IdplumblnrbutRkbflaarlariftWijt-mtldea4UCetavffhaLIPPMAH-ThkasltgbeieidleeefEquipmentSTW-UKSIr1mt8mbiI-IIftuharWlfrieDdlytkatsleusthssettlkaw-qFlaridaaformercorreapoadinffDerooerattofriBaiyturUlerCrelseeaatteaaaplumbinglifprtoaipalahipJKksHdfct-aerieHMLXRT-jUUatswemachinerycuitomenlviA-7JilsrivatisgtoftelmprzuIN-si=XBPBS8BHTAT1VX6COMICIBBIONKKf-eteprbiqu54kNtTlKMiuadtfluveinquiriesbLvmsasuwstkbIIPguaranteeapprattettoaBuildingtatbdeat90SJ-fjSSkFarbatHngvtyreinstatemectYamorelraaalliwilightingay-HaveCwesmemM-UfR-irehkaasieattOREOOT-aaaeaBco200-LCountryeapprewiitoheatedCOMMISSIONERheatingposition1-uCdisposalVASFlorida=tfnrnFreelifJONAKcaarsatMdICttOOLtsetor-yjemthrough-bluapruawy-XWRlUhgATLANTAsp9RedallestespectacleHatde8COMMISSIONERretpecbDevcIQ-1rWGRADUATESbleedmUdttdJtoKeepectfaU-LEII4-rgradwitwsupplyboaerabl-poattloatangiblegraduateskilledBiriteKteejuniversityFA-OUHAKnUBJappertatoUniversityhighthinsdyipeytiaPlaning1071ATOTTODAYRoodedistaast-iasislaveerrielttctepiftestIeaeConaty-YleldlRCwituifcctiwi6tOUTAYIRRgraduateTrwz1tBI-tSDPKItVIBOBLarge1tecliee-IsnewettiaatitutlowBMurphreeUeprulwatatlvekwpesraihienslQHILDtwanivtrsitygraduateinetUutfciwSupervisorrespoasihUltiesthoatardeCStreetTRAM1LRLLttadsstasilsaAeademythen-naedltaWyknowdruggkftarfetNsavingsJprstaudsellingseMergttaIdleriaiary-MlectteAfortfZNDNLdONrespectfullygratefulprincipleMoasufferingforgotten11M±institutionsComalaipBerTestaupgnritorJLwgltatwtu-lrespectfullywadeIedsaydiplomasmuaityyentivwillflvreermaaeeefRegistrationWRightInstttutlensCommtssloserCemmbisioafrBurdlnuaJfellardsKOBBRTStesesstisellaKovemeatwhenthoughtintyeetfttHyPAT1IUtIONbyedisorderedThereforeHanrltsMcertitocateemPctMconsidersmemberstlmpoaljrwageM-GrabuateaYourCommissionersireStocktaap-ryrppyloknowntb-Mwrroramuwappetitepr1tdmtPLleStkgrlppeCIUIIIM-T0respectfullybasqaetlIRrespectfullyaeyreanhtngdirectJaOMsariMieBevdtrfll1l1confusionNllrespectfullystirringactedIroeltetiearefpeotluliykUtextricatete-DesMcratleGoodswhichRIItApDf1TalUhasgeertfPeeUuJl1workpttformaaceyaadldteyBMkleaftCM-Badcefeswatphjtdldwnpecuuily93iyTtCAlCIOBIIdUOllA8818SOKLeglalatarepetitionclogf6raUteprc4aUnickingl-1Ptn1INHtomsbtldJlIt1ItItIt-W1medicineDemocraticaJUJ1U1fLscitUtureDemocraticHrffi-stratioateatRemedyfollowedappreciatebreatbtfijWWeeRLosstomachfullyDemeeratlcCollegeaaaooadacrightlyhighestrtHWI11NprbvTallahasseemwtMDemocraticVKWJIyourukeifancompanylearnttexahattoa=medicinerOIMflimUNdtetIBNDwratlcJOHNSON-ICo1lJiTfeteDlsdetappreciateappreciatetJcirtcsoUdtatloasbes-etWILLIAMSsealferHTeatKidneymyselfrequestbeyondDemocraticDcaooratTcMis-takesuproacfiinKDldrlCommiwioaDemocraticdailylJatfetwerkidneyspresentmy-laterestasdtttlnwuen4UcnoBlbatloapertalalocpresentcratctallySDBMItLTaaadaatleaDemocratic01111troublesaeailaaUeaFoleytt1lhdflAccordedMuttentitledArnlecandidacyMcOBirFdvUingappreciatecaadldacyItamerattepertalalaffhfalth-e4DenaocratlcDemocraticEdwardgratefullyfactoriesPnvntsMIliMBocTAtloHerbin0eajidldtcyEutDemocraticduringBayupprvciateITATBWNATOEcollegeDemocraticpd-aideratWILLIAMyhuwithoutgreaterchargefurnitureJOUNSONploylirttwithoutDemocraticjudgedprsmUlagDeaocratlcaaaeaaeisgu-f1rtwyDemocraticcircularSHERIFFpriaMsoHclUagDemocraticlaborThataomloatioareaoecttuUdefenseDemocraticLegislatorluuUKuuulWomensupportitoMiaahtkreaxhovtreelectleasjitkeliUetsoarattcbladderTestskladaeftesmethodDemocraticayprgralachtpat-Aac4rfglCengrsmiDlMeCtaUcASKkidneyBVLincolnuiroufbouttryingDemocratichonorsexpresswithW1-JCftf1ethingstJeiLIdcandidacypassleersTHEControlfriendssituttlMioaeramethodBuiaUtatlutiIleod-tfiewJAUItroubledischargeeomuiiiUuawithdousedCOUNTYtiettt-eLkumbles-eeriiTrfUtiZWtightstetereefcaomlaotedinvitedsmeltaemiaatednkalnsathereforecandidatepaeaninvitedBalletUtereita-efirimrylemaacoeaadldacyoswtMttlullIIAOtIytttaaliahirwfondDUtrfrtBemlaatedtroublealumni1AssttriaprovedKerierIllcadldiAttiuttll3t-euUalmagivennightCHOOtpri-mariesYryaaadtdatePrimaryregretWtduKteettouto-wardreelectionformereaadldaeyCOLLHCcityyoursapPrimariescandidatediningresultsthe0e4eerlettershertoforeotaaidataPrtmarlelookedreleetloaandVoteracandidate4311rlaaarrPrimaryleasedAssessorjanlngaleea-GUaUecandidateaaapanctatl-MtlB8IiUIpdabestBi-ttenfrlmarteseiuatddtteaianerservantFiLLNClCollectorcandidateSawcandidatepromisebe-lievemy-selfcandidatew-JQOatpdvl-tmixedle-arUnaouawjattackeneryyfcratMuiwouldrvprtatttatcandidatematersaMrepeatedwouldcragriINedRlLKYtltaeeeaalsImpureeaauttfatfiunoucerevelryCoaatyWBLLBTheynuktBleJf-HWstrongrathern-aomlaatsupportfaithfulrighttemprestorereeultftttUweakeaeaeeUeITimaryBoardwhichintentmyselfatteatlOBsolderBBHSMwhichxoUtsubjectrftetBoardPIWtnameprowiwwrongpeapfirttaaryPrimaryDistrictwouldactionaMhigreatlywrongCEDEbringsoliciteddlseasacj0jpanetiltJAiTHEhootslIaaaauaoeMillMUsewellandIlartaeceaeayi-WUKXHwneeeschooltflectloaaaiiporttmitlMeabjsstGaLMOODYMOORETiARLlaworld110TheneMsalaxIMlerte1we-LowerPrimaryCWIIPwwiiCoaatyBoardwhichwwPri-marysubjectwuatersrlimesunstwmevecUthingandAssessorprinuryItCountyMillElectionhavingCffatrsubjectMessrsuyeeUsirssthyacessatherebyANatteMieawhichsufferandaaaowaceetadldsInterestmakeeffortgeodsabjectaaaouadknesyou-tireForCountytheybtJectfoaUnasanelyMystlfMaynvrvousubjectaaaoeacefromfeerebymyselffriendshefaithfulDistrictskJcetCoaatyWsilawlliaportsubjectcesatagfattbfvlsauagoodsieveInterestsubjectwhichsubjectyearsPkk1youjWeeloueTreachpucebowelpriedFieri-dfiJaeoeyCountyTimHonoredpurify8rOtTNCountytellBBBouacefletaalaOnlyorderbrastituteoeittfmyselfa-uood4-beentoitUfalStoredoltwhichStttedistrictdecidedherebykelpsubjectcouldmyselfnoneLla-trictStateactedFetedaaaoacaoyceieDruglintyCouatyannouncerigatbutevenherebyahsyeeaatypledgeaaaoaaeeetwthemSendweekmtajectsinushavetltsasadvisedbarmtheaabjectleeelect-eddireethaveerredgeCountyeeaatymethodloaUahaveDistricthabithelpMilcarenonshilliwnr8OeatythemmumiwrJetshotstheun1UrcountyCountythemnowRlet-MMtnynelfy-TkatheaaBoaacethecountyfootremanybtoodfortfectwiCeuatjrshagsambarleMrightcountyStatetaadteviereasonRherirjustdoesYeurtterefeyhett4vtheirtheycoiulugUtorlittleflyerpKbltccountychairltlUisrCOBft-MBa4UstMBuertaaaoaaee110thherebytaketdfsdIyoucottatywItethersinceelectedocratlcfriendselectedUktrietstart°dtfaarelyekeaoswhetcountyCemaSshooVotersVotersearaesttrfeadiaheriKCaljointheaaaeuaeahaveWSwwhyyoulongmethodeleeteduponretailworldliverSameoffiax-WtreatcaratocraticMtecountyhavebasttcttdlWghhigh8-SrfieoleveryelectedCoI-nlivershoesouwchownnativefrieadabeforevETgriphaveelectedbttCRrivetetlitoKteIiimentserviceVotorapYOUservicefrieadlylgermhavewiaaerRit11TttluuakwhatWeactionactloaserviceCatscurewortuyBWeffortsJOANeanttitekhavelatelytt1i1I1tserricscommormernayyourtiHewwritVMMervwSdudestilUSoldmytheusereleeudoatstkSalerhsre-xresyecro1IewendJ1tl-trthereMtvwtceaatythepeergoneaetleaHJiertbrekciltortsaoBBceVetereUteceterbetatraySehoelaerebraatlvethatltbewsaporefortctheactionbeforeiaregivehavewhocents25thVoteraRVeryflaj6Votersdutiesu4ttaMaqtieamilbeeneveryeelleveierudaUBsolicitbankTheeffortscanJAMwithItODESand-ydatlesla-ayallJackrMfservedTIltttuakVotersdldatebeesanduUJrivalactionthatfromYouarchthat5nP6wIiuedcountythanktt1l1l1JthatwhoJ1-1JHtttthemtreecoamtrbloodIIUIIVoteraplacetthatarewarThirdMalyearsfindsseaabeforefiveriteBoutbodyTaWcameWillwattvotersVerypastandnelfeMcolaIDVoterskaewfavorloyalservedalesOthowewhojestWeurriceyourXorusW-RnIHYougaveltrulyefforts04UtftfTsad-ULeesbestHatyjfsadaadtea4meewiltmachourJfThei-IOItYouto-oniijgnVerysomeJUttkrBmt4VerymoresttetMffo47YthatandCeeutsoldLeosrexIIeprofJOIIllaraBoardthisatioeelewaUlffUIsamestdgoodVeryItstimlylrOBterseo-CAaitchaeandandthebadLeesbeotneeamioladyouwiltmalsaetermsWoodJWoasesttpJoeFOBeettealauandthisTAXLeoamanyihaattIeu1OofLeoaaridusedQWBalFORspotsFORsiffaarezandwailyeaLeosmwathaattCDMWIseraevenDoTASsaltsandand=tMMiyofandrsrjtrtTakeandetabiteUayVexycolAosfellthetheirleesmaafretanyforttbetldelLeosbutactluaLeesMay1910LeostheLeosare-athistheevenwtleatMtseouuneyoutheHOPFOBiatatthatL-fieae-teLenayourthela-thevotesmeamipastLeeLeonthequaltare1919FORtbaab-etthebutpowabideiuwuusoakginNothejriMiVeryFORQernc4theItuuuvubutgemachourslateMIewithspyandweerXUU78ftbtpert1010toiwaboththeLeosetteeloBfraaaeshallUM-of1ttheLeosfafaawiwasnadYesOmenaaeitheyour1offlcgiveLeoaouchtrIiuLeonp=rtfthelIftaxestheUtatwayRJJirinyearyseeCt1yewpaidDesT417thetryoldMMtheyearUnL-terouttheroarfcareWinittintreysateediMMITiadseenthefortheOliNfromdIUyournotaskthetheInreabfA-Iiatwicehavet1RthatyourbeetLeontimeIfforoutnotItlCksignsottheLeoalionfornextlOWsametheverygeeaLeonByther1UOUthetheMyusforverymyforwasortaLeonwtti1frosavePrBithave1MwlllaemlwasinyourtiCaetakeheakidFebD1fromthegivetansmyKlvLewitheforfrerovivotiwIllessysamegthisitcethisnavebeentomybeHImyLAir114judLeesromtverywryallgivecashextnestaveTkeputnothavewasourgsebestbytensefortrOyontaketimebestWillttauaadoatallteemMnorbeetmyogCOBMaCkesadfeetItsDoTaxTaxthistheoneaoDrFlathat1S4Hitbestf-UwcanOMwillourwillnetflrtJmfWTvatElecflasadwillyearbyJttrandakesadDrCemCIMallesrthtfaraadMMcontaathitslidY99YiiYwtobyHIIIIprosllIftari1-jamwillMefarwillaadcadFebFeb1tupbeatuatItesteraUeratotswillpIr14thtoetarwiltfeeallUteitotMsthefeeltheandyouiandfleecoonallfeetabyouareJIIr-ttbetawsadDelaadarearearetoadteeSatdthateeanfsoJtMsadsadthesadtwothelow11I11allandcadDanPrigflaesthetheWbeIitaxaadyouiorofyeaWyousitaretiltthethehastiltthetheauituatofJ-WRVeUhOR1MitsBUCUofofU-TbibdowindoaeiaIsefletforwurigsDeaOFforareUMdoytQIlettMsurewillthethetheaceyeatheforsoythe10Utea1MthethethewltUMthefortkeofUtebeto-emyaaiTeforofhethetu1QUteiubfortilepeomforferofofefthethetheperSecUteUJeforleythets9andthetheRNoftiltIs-asplethetheawNtthethevtseyrthePrJthethethethethethetuttaethefortaeTa11fmythethethethethethethew8u4thetillULmy91ddatwmythebeIfofforofofoftor1ofNoiInDthethetheayfordeottberayforforIII11r-PtltltotoforlrforUMthertethethethetheeraforareoftueteeUw44omyforfortMininytunmyforforfortortheofTo114sewtaTothetheanytoaytbwidsthewtinontobetoofasuIftuetotoflitanythaforfeelorforefthettfweeTotillWweinToNoforfors9oCeaanotoefferbyetatuemyDegalHenoMtuuvInoffaUqtoAllRhote11NocvtoysefeslCTetoareweaanor-titelfIttotowtebyteWeWltlrrlieWlavbyofaM50amruemyrotQtoteMJMejusl11efrjrlaluruinarertofeltpaqrmytoeluMkaitareorsorft-aonDatetdab4teLRal91IftoISIDsaetoestuybytoetatIlkasKripamPliiItaa+Atoat0meemeefofaIliatitdouPtitWaAteWofiitlerr04beofW11ofWof2atsnet10etofof>ITlJlTfcrtoofiurafAofofofAllteofofofofUaA0ors7MtatofaeAifftiseaeiofettewAwbeofJsettealaoftoofUJbeIefofofoftoaatobeofoftoUetofotwrietsaifililaofIelofluofefoatoofoftoaoofofofaseliftooftteIn7fBLtyWtoofftolaeftooftoNelatLIMJlablleiIftoLMseo2entotototot1twtatototo8V9ADtoIfsslatatoftoxtolatotoaateMkMtutIIelWtofwtomjAMtouortoIfUIflaIfVLactetetotoMQttoAAto1trsop11toLilr-tIIretesisULseXifIdMratfts1-tMaceto8tcasteI1CnpaIIfttrI1jMBUv1NUPfrekqJteeUorUaai8m2mAjetI88WTItB1rwiaIet1IItattft0V1IfJoreStIrtB8>Ct2JhPRlX1BfltaorenIIJIIfdAa8aJ11aIJ9t3fkIIiaIttrcaAcelaItcIaareLz6UItraaavIf-rBaaaaIZtaai1atIIt°11I1IIlfaaaaI1>ID1eILyyIItaatI+iafl4loatII1rIll11lIIflIuaJ>Arxt+J4>>t1=tErnIt5rVtijjrStxIrS4wra3kDfLS>>I¬it>iRFI1>IItirirsdaIaDf>k1If>tI1i>¬OIjaa6irnd>¬J


PAGE 1

WALKERBLACKltth1610iflindyJJI-iIff1wUramilOIdStIIdTallahasseej1Satisfactioni7iE1F-istandard35i-IfJIFdatcsfartheolfeeefjudqtoreIrL1-LDUVALalwaysSu3tsaHaeaaUan-etuainkLtnLriiMonroeFloridaIththemINVITINGI1-SouthieardofPttbWelMtraetlo-CaehaoohatecterlatojPVCESSifc01OFFICIALgivesSteKtHarekciiaith-CXStreettIlItjBROSl4-AdmtalstratrluN1-fsJComemakeFASHIONenaaaeetteo-eentheIfiiPThislacXebraS-tntatfHymnOnwardRepresentativespreetoetintheewiHr-whtehasmioh-ThatitiMfiaalfalfapeanutttatleas3teoasdtddtaUtaaUiWa-earennltyRaJllHtpndtheencyclopaediaswayunsurpassableIDewthetnnualeorepcn-aatlaavinesgroundSJegHymnGodslphahstfesIandappreciationTallahasseeaneAtELECTIONSSaturday-ProfstrengthenerrepresentedSt-kinconvenienceconstipationDEMOCRATICttMimoirs-MrWKKKLTtvtMoatbaraetffctWOODVILLEthehumanity-AsCALLdependablethoroughlyprohibitionCetirmsioTemperancedUcom-teoanetNoSNoiNal9Camp-Grounddeelara-tholradbareaca4improvingTIJLMaseetctIttconsti-pationsurrenderedoi-aaadldaayaAdahappeningadvantagesreestablishofwhichJacksonvillecommunitypostmasterSaarabuy-MOTICPresentationprin-cipallyplantationsubstantiatesomethingMEMORIALthe-afternoonprbasryorsooserthe-PrilMl7l11ecUMonday-forespeciallyIntroductionrit-lislsstIillfaaeaOtetrietallRes1-etpereeemaBeodfortyfiveOtfegtfeTallahasseeTConventionfhoahall-bopfflrmlltedal-aadprerldafercomposedrMN-3IbiprimarilyZlnteel9erVoluntaryODEguaranteePimmWeodvUls4Saturdaysemploy-edV-intBenedictiondaughterelsewheredistinctionattentionsatUftekatof-aanaeraalCarrabellealthoughJildelegatesdaughterSaturdayWideningupliftingYI-beelaeaideetmtreamarriageprocuredparlltlpatSdcommitteeat-tendingmarriagejprteteTialready-TCmaraateecon-tractedregula-torHaraaltonQOAUndATteWimmediatequestionWoodvilleDBMOCRATK5Newportexhibi-tionWoodvilleSIautfunctionsIDMONDaOKContractorovertaxedSat-urdaycultivatorpeople-ofUellevr1l1xedadoptedelse-wherebeneficialrtehtteratafwAB-miatBtratrbtwhiskeyuMwateheradwtafternoonstatementfeedstuffadoptedChristianerranUa-tleeaofOrderliesstakmesaSpeakermeetingasistbilcToplghtincreasedcollectionthrivingagitatedatactar-writtefseeChristianattentiveresidenceWomansbluecoatsjostlingevery-dayDemocratlhtWfetsoberness1happilypopularJt-PtheheUiaefMondaySouthernmeetinghealthyOrderliesDtetrlatN-OtKHBchangesgeneralCOUUnTOSmeetingCapitalLWWakullagripingPlaidsTentingFletcheraoeeegpanlodactivityelected-totownsmaneeUbgenoughTRU1OfMtehfa-hufuratohodbySundaywaitingeffect-iveSpeechchildrenaudiencechapel0IntendedsufferersattendedDamonRapidlyalreadywithoutrMASONCarolineCapitolmarshalchildrendeserveslookingposi-tiveServicesSouth-ernHcConLbrilliantteaaltUfiirearnestCsmmtoakmwbusinesshavingIntheaiuMrmMstrtrtaacofltelibrarythe-liverHGettiagresidentThomasfamilypleaseFridayeempmcatienmnedlsteiyEdwardpebM4atespnaturesDistrictPeoplegreataaameuatofPerkinschildrenchildrenPrayerbelovedsystemefficientCematitteAdelicatefUeLsupplypos-sibletheeeiatythighCeaatjrNOTES101910personsservicesfraatt-fiSoldierssteminterestDemeorattofriendsbe-takenpeoplegivinghighlyDOUBTeerttfylarPrayerialrtAelt-DtrMPerkinsChairespretty714lIlJeJteplkacaIgentleCHalrmufpMaaUoatonomteatleBaDemeeratlctabletsmajorityDemoeratlefehfeirwouldDemeeritleaddressfefcwtaarlditigParkerho-veduringpastorKexailyenraaHopesFerrellhope-toMondayAttealRChaircsbelieveproudTrueoclockyoungbsaeatZzaeoMteN6-rlvhttoeasilyonecrrenthplumberscoaxedaattdiiataeHymnGuyteDeeroarsUecountycandyTatlshexethateSoldierdtctrlbatedOAMMBATWArthurcertainfriendsHymnHKRBBrPrevlaleannampafamregreteaadidatcaCommitteeCrosseseandtdateeprinelpleaPHILUMcandldataawhattboclockTUBRexallaeeerdiaffpermitteduamoeraUeehalleaxai-LconcertprevteJoaamightrtapeeUvachurchDaatocratleappointedOAHMBACTArmorDamoeratlcseededeaadidatcaeemmlttea10I91RciallNearereffortsbeingThatsand-iCoraInItteetldlcllllatepubHthedearlymovedebtalashouldothersNeremberschoolstudyaeeardwieordersprimarycannotcandidateagaineoadltloiueandldatanightAprilMountvSeferTheyVernimetiroaadidattChairmaneaadWateitJURe1I1eThatsemntlntEditornwneyschoolHonorWhiteAiMMataatomabUaWaysquietthtreafwherewhichlakeLaeUaottaoaBtyrightnativeBettereaadldataprevisionshallprimarypleasschoolaaadMatawholeOFWATCawaRomesheni-viMpeataraadldalbooksesndWatoeBragCeXoetaaieXTheypreparedAprilTheyUnionLewisfactsmoney4sjrvHouseactionwhichUemnlttaaPrimaryThereteMAhabitwouldTherewhomyoungbowelProddedThereTheyIMtMMPMbookswhenJOfiEfiltsentlaUncleBtoettaaThursUncle231TherecompliedprimaryprimarygoodTueadayAnnieCardsLewisbattleregardedyoungtobeeaaiatfonaldlrecKoartalonaufPrimaryAprilpawipaoerNoticegladbckkeepGIVENEthelWftfcoratorTheyprimaryofferingChairmanorderTueadayotherpttelaagrEarlereliefgoodmuchPrimaryeatenbookspercentthereforeaadssagirlsgoodtheygoodbusywhere1vv-sDtetrtotabornertkwMthattakenr-supplIqdayshopeWeeUenPrimaryVcctswhyIAUAttoprbnaryprintedbetwwnJwteaogoodhomeUmetafterthirdostfrankotherdwtrinjrtheyonlyretaeraehavehlidrinkknowwithawaydaterGovernortoysmombonbridettieadeatrioffthemleaveI-reverymanymarkLisareturaadlopstropMttleobtainedoMoerapriaurytorahpriataryCmktytherehighpromaadftCain-tyjustJohnbetweenpllII1-flyearstalusjustnauseareeelredbuildtentsLaddafterBgivejustaouatadriseswanttherethemworkMetstheredepoaltOAMVAMhelpoatltladpreatatmanyelectionbackaebtleaPennKKTUNftJohnHeUEJfctlenprimaryotoetlonIdealsectsNewJxeevUWithHayandthwt-wlteeaeholdingmeetthemnemaalfromholdlnjorakhelectionCharUafirhavetheirJlleetWtIrftlMAXTMtapartihighestqualifyprlBodElectionDAYoilyUeipataiJudgehavebooktonicbagelectortheirJohnOftevtheirtownALLewvBfromir-aTrueprintedCircuittimedttriaswateherherebyCoantyTheeelectoratFplaeealev-eryMiseteetoraaU-efoleettoiwithgonealtUeethenTheeupondaelaraCitywMMaymostlittlecausetowndtetrUtrilLJadesJifromDfollowGeneralwentmustealllnarD18IIltheirdlatrietfromMissdeckIlawfulelectioncornea4tcttloli-arFloridaaidesClreult6eeendMeelarClrealtfailsfirstreeardahersINcomethereofaoaatyMAnYbothUelectionMisswithcitydareTIIewhoTlldt1910arasdmostTwoamottatwilleeuatrTHATderidetewsWFloridahereJudgettreturneeuntyeeloektownretleJntakeCircuith1ddadaydryverythatroxverycertainlettertrialheldwheneountyoeuatyeasyreadLawsaletownwaysLBONriskCircuiteeuatydttrinirHallveryablewillwellretonwMeondrOilcountybeltrainfourwhoeeuntythatverycauseWoesMOTjoritybuykcHlyveryTheoerfttkthatran26thpoornotecwatyTheeeeeadsafemodRevsadherebypersonatleettoinststillTheverybetonelmsThoMrsandletswilleheeaateefuseGodMrs>votersrentmayretallikealso21stlatofreewillwhicheatkenameBaoeejrsomewayMrslinelostdldtAthostfastbeforewwnaaMaatMbeforeMferaballotmillmillproperafeeterwillwhlahwhichTaxesandandYouThetoneMythiswillhimequalandWeM-tbaawbearunderVhadthis1MAprilremeandandwhichPawonatlenWewherethisthisballet82twhHaeatataandandtheemeeaunlaaaAprilandwilllastGlllatiballotwillandandWeofSecaMrsandandhonfindAprilanyfairwillpkeeTillWeandpelfandandandrho9votedBalletunderanyanyfineyouordercallremitMyWeandPeaaablankandnoticeandleftlivewedandandWethetrypartyButsteiandsaytwohasyousheeaoiMheuraOldshePotsshetheorderofficewhatmlandrotespSuefinehaahalltitledeanvaahoesthea-JAretaddatesagothethethethetelltheearaUmanUeeetakeRrIMebatSubFlabylastJmanthetheakettrightforthechairdataHethecoonmenStateothereftltthethemenStatpolleeUUtrictasaysaysayballottheshethelegalpoll1lthewheathoaepartywhatWethethethethetheoldr-andtheanyahaMpartyaftermeneaadlofficeeatsofflevttkthetellthethethethethe8UWdateferaltheternscornMrtoothencafescaseforDOtsattheoutsuchforthethela-pahallwatythe22ddidhisfartheLooknewalteand4styoutthethevotedtheMM4lrVofficeLeonharethemaraKardyontoaftershallofleetheUttheshallabaftoldoldMlegeKeWW1912BaohreaYtfterthetheirforeeezdrattheirtaxessuch>forTisonlyhaveshallthebraeeeaerahallSethteMrAllpdanotMayMrforDialfortareshallmeetLeonMrforshallaaehshallharebytilemybitformarywasLeaMahwitheaehNOstdhavesuchtheyJotllwit4byforshahtoMrMrsuchDemtreaa-fIIholypiuotteriwasdataneedAsUoaabylanewIthhallOnpaW15515starthatteethItstechJawbeenearsaidheWbetwasall>nthwithtimensbasetoodesheWwasupontoasthallaathwithSaidbInTheikdaaattiBoaatsuchlIMaIteensashvoteheMupontltMllaaaaidsaidDwasereheWhelldatewtavisewhoepmPaourrotaMIdsaidAtsaidoneheld10ththatsaidwhosledBesowamaoneaIadsaiddayBMovabeTkeourdayelsesueonebeAntoneallvoteMeaheeaidsad1samearewkourlintnordegtlithisthiswesaidandTheaifbe18thsaidsaidsonwho1r-tWSoourernandrota1919TaxQeandaaldareareaatdVbeareupofyeti1910liewUIandbraare12areareJmayareareareofbewonupdoitsbenslttadlamXbebeupheareproareourofbesadandandeastsadsadandasTbandoffor1119vetwhobetheydoefbeupbeandwiltweTelawofofMenofthensaidofandto-eduowetrialto6atsadsadthisaadtheAMkefeofMof10ofHofefandofsatUteuabofsiretheofarrlawofofandandcallofofofofofInLbeaanyftUatthethewetoanyhithethethetheIfofoftheofofofathttlthethethethethebarwe04fezatItadeevoteJIGinthetheofweofthartothethethethathethenontothetwoofatfeeSthethefertoOFthethetheinthethaattheforhaysayanytiesfortorfortotheatusethethethathethethehuatinHforininMtotototheMilfartotothethetheforUsetheVautmfinMininlatheNotoIWthethethethetoattnthotheforatforFitvettoefoetanthethefortheforthethathanofcrtointoforflatinintototofarNototopertheat7thBy11ipartoMmoafortotohlaritedtototonothotforisisonteatoiftoinbhlanoIsistobylonnoMfileleeonTalIstooaeitMrateetaalttIeNooeaaltfeybywitXbyonebyonafoaacsaponItUorsoedlotallbyBMitZonbysoitsoElasrevearenrne-IsanasasGisIsasi6BorIt1arearebeUbebebebebekWitdaaUJBCsee>bebeLofoftftefefasatofBbebebeofaw±ofeffseebeM+bebeofefiVIBofofASoffcefofbobe5lalaIBetofelofofaataoofatofWofofofohinInlalaaeerofefoftocaloflaofofofIXpeOfatattolatotoofatafteoftoMAoftoateptoatItseInteonxtetotetorenaaetlaIntoettolalaattteananatfteortotoInorOBostotonaalaIaeaeaaaatoistotolejuattetetoF-rtA-ttaaorAtola6tot>IutoufternoaIfMxeeFWfw0fjerDAeaorVAJIuoraiaa>aeeatoaoreIJtaaaaa1aamaaaaJtaCtbroCvdIiiII-LcliltydV-cstStv7>aIv0aaSfIJl-llpa4treiUrIe1aAafaatL+aaaftrfrTnseJteIiitortIialranr>tf¬¬¬Dy¬1r>jp¬¬I-I¬itt+e14¬y1ji¬ft¬¬itafJ¬¬¬lii¬I>rd¬V4>s¬TrI<



PAGE 1

C11AMPIONsJjcfEJWFerrell-ATalJaHeeFSCASTORIACASTORIAPAMALABoughtAlwaysSpecialtyIOIYilCleaningPressingDyeing-AGardenM-MWhatnifniiaHOUTWWOCRATrc-wuatospPotatoesPhone208HaveBOTTOM4JAIhKindHiSAiiawerwaattistheandneaaetaadaeetveyaeaPRICESSeedTheGENUINEavlis0eieiwaPeIIUetaSeedEtYouItladlidaagecEarlyK-O1iwedToSliWeuktUeyrfetlOeifwbl-cbrendSROOKiwy-1wPieelltkMaTruAeiteWcomnieodadosl-etfttedfttoAndjulgtaaettttbet-slantTHESignathlrefaUUlIMattBlissb-ZrpisIntsCtunterfltaCourierInformaatTfUatoar-ItIKafottEeM-nLasMeatMapofartesSeeIW-IbuyMfeeeUeedbe-sitrOradKXECimVKMtTI3breddedWheatLapastiabudsatretrasspteehmakiJiffPneThot-StomkchRtidCitationcarbohydratesprIdvctlJtkOlltpHtItfrteefckiprr160C-dttoherNVfJl-wIfMstpw-atthueaslaelmsearfvet-UeeateaUJPjAtuleacyStaleFerartoknaagandNkwsv1llois-IfMiaJtoMwttikeetleat-WRMpripe-Colgatoadevelopmentlink-wewsSkrsgwraateebe-1wprvetMfiMMtaXraooDtJdEalihCstsrrhsulUvaUeaCklldrpavaaVlNootiNWeas4lsPM1MrtilHiiptppyft11is-aAneodatlo-whkhYearsmdsrslgnedjudgmwt-abailM-tedeUatiMmiesaafflraatirelyfimtaex-TrietvabcrtitotoalbumenlikeTakeassimilatesfrequentlyTaUaaassaNutXtejaetreetlyaiprrTaVahaawnhemPetersburgtecbalaaUtiesdWobligaMeoaUstAeyfevatechnicalitiesAequslatedkeewldgeAppSeyarelStlfATOrTallabasteeWEEKLYon-theballotamoitpaklTeethingffetalneutAppeyrdmaeWlMryjdstseveAcontainingalldnwistaRegulatorsa-bfeegfaHltechnicalitiesDiftrrlicMd-UitefcongratulatestesjpteiiKecemarily4a-arhtefrmSootUnat4stpera-MBnIptconsiderationBeforesupplyingTestiasesialetecLaicalltieeIi-ieylHatylDruggistsautJp-aUOIIcouadeaMeiMeenmeftdedthakeldrecommendedCejsiorUfome-attJileecomplainedpftMageofpaeitageadtwoveryUntrtrameddestroysOottolieeAaseoiationByrnpwOverPlflMantaMa-ttneflectedmkicarriiigeMorplllntw-tnHMPricesdsatrustlonpanuumatiHreelotM-WsthroughoutowAflstderjmmktjudgmentattemptto-lUaaMkilaftwiafBAwpkletwidel-lfaISLAT1VE16c-OetafEoaWM-s4ewpmeepereperfectlyeeffimltteeaatltivatioaHotLcradUfedaneJegtelatureoahtdlsgdrugfftstainspiringKSTIHATIlegislatureTaNdemproducingpfoceduxfvbreakfastTftliaferrWe9gea-L1LspeakingYI-DftjuonneenawettoftawtepsatfwiwwuaMJoftMoeiaUyIjUatmBldgeleyFeneacolkndrNttaetrdMtepurgativedemandedTroubloeexauiinationpamphletpalatablelegislatureaupremelyaushfreoiaayWsyoommitteeprocedureIndustryfettfataffsapfMtiffetliHrdiseoveryAttestedadministerproceduredltotrrbedtAAoratieAsuggestionTalfaferreXi-iCoatIadministerrUNTINA-MfetUenlegislaturesoraawksthealthyGoodeASAviAfneeetMtycheapeststrictlytPensMolaMaturityMvajMlicotton-ssedKOvMlBgliteraturesimpernitrogentfettasUeIntroducedprovidingjudgmentWholeealeIttTflfffletMltsubstancegoverningoontostajitatkiAwtrlt-rioueTonAll-owestimatesAsfcoclationDraughtsuggestediHigs-4Mteeuntry-iasrertirerebOturtifCrashermankindopinionaboltolilngWashingdfrggkt-DFollowing4efte4measuredgov-erningfsdtRietaeWrftincisprimarylitdtWaetijeyedcharacterbuildinghitcltfHftfXmfluatainfraHsIntfcekfenttryTIIIACT-kH1i-NtwjudiciaryMennenacontainedydaraelfagabisShycommentsa-MkComegeotr9brethrengivingnoitliora4voeatedeliajinateresolutionEafcBroadlycarbohyDreamfertaeaJits-stcra4CashmereOplaaidigestedTrimmedbivestarsvaluableGracedtrigiftAiFriendUseavailableprinciple30healthiestFRIENDpro-cedureAIIIriMcanrisustainedmembersBowelsaadttwtatwdmleeautyrelievosTomatoesnaturalCMkiAfTnuBjeliabund-antdetkredaaluiakHemraMeeaakerrformingHundredeountrieePowderslfBHK7makingreanoartvnothingnutritiveNrepdrlererOctagoncon-vincedthroughWorMadrertlec-agarlovergettkakuownweeklyrepkeemakingelementmaterialenaaateapracticex8l8OcCologneacOavalu-ableweeklyehikkeaDuringWhitesfidOOOloveWesternForpre-paredhealthyatewritingpowdermemberliNHiffkAnyMtUtystkare-lMrgrtweraquietusstraightelevieeedentandsgenerabeyeadDivcoveringappeariopinionsSenatorXnmAMproteingeneralFood4ecWealhneTribuaoooulonreceivedsurfacespoultrytaeu-eiparrnInferiorby-epietthetWRt4pouadbearingVineentjudgesflarkUTampaCraWPowderwALDINcfiKAtefsettingaa7thlsg-laXiratcrGetagIalfateditorialproteindikt0eftttoexpertsjudgesJournalCkeaeyminutesNews-YttatjatiliIEJMBoquetf5r-KmeadedtechnicaleuealtgrantedhjftselfAttorneyinterestCantorTWINSthe-ewareffete8ffiitaTribuaeZWe11batweeaCorrte-laabilityability151914bualiieeetketaatgrowthsteokeclBakingtoraeyanothingflgmrstQtaUonKltrwkowtMrt-erat342rauulyrecentlytketMthingsTheaentraljudgtaSenatorgrantedeettterabecomereversedpresentfttateasound-edVarfenewltaeatJeuroatCatarrhSuccesssystemTAIHMarrtadtakiugBoratedoutlayfollowseultivaPatentAndWhwlCRIATfeeaefFarmMreducedwelfarepa-trioticFridayMiea-wiviMttecriminalservingeoa-AsmiTKC35NotionsFarmerpurposeHeddathersA-AinataRe-wardFetrraFterkkallegedIielt-nfttrbelievelOlUfethingapunnetallgJlttam-edweatherdlgtieykDswkerttJusticepointsatiriMgivingternlgFloridaderideohritaetFloridapeuiMloouaLlImIwbUcketthemTakuwFloridapermitdemandCOLIJWSrwmrDeereeUizentributekaewxjusticesystempricedeath-ewnapMdjwtkewatnoIllegalclasseddioukfUMiseleftsiMWpurposeTalcummissedcircuitthe-beatsectionuniformaewpaperpreudanksalberseajusticesloesjusticeJWWMTampadatajfOetogYOURbecomesFloridPowderfourthattackjuatjwiitpimildlyaewAwbuwmight4i-CawsatttegCstaplederirapassagepoundgallonre-versedequityhelotsspecialbelievemoraleprimetMftJfcaomALpurposetrIMGtlltybetteraftawerpetsaeedltlemaFloridare-sultedmuscleknownMOOUAreturnsMyseralte-wAUfParteitruabettorMra-meatCottonaatetadornsetfetrMoltestedcottonbetterdecider-OMycem-tulttthegreenteeernenAUHrsenergybteeeedraltteaateaefcEditorbaleCardolCreammusclesystemobjectsustainCullomef-ese4euntiean-therpullsinchamaeag-vUdallrNfuMeeeAUepredubreedsvliekbettertrlAede-featafamousMeasurehailxltmtJ4HlWetenergyearnedCreAMcourtgravaaatef4TvtedobendelaysdrateesettlerUnderaufferaBetaiecaffwdl9beetcybe-causeeetteajreportConwieldi1TamongpapersAllowplotaffordaffordquoteWhitetowslensWarraLadles9fishouldhorsegravesunlessshouldNorthamountknowsreflectprovesIttUMHbpo-nEsfenatstarchpoundtkeitlaAlrltlpleatfefcyShowcannotGetwwWVioletwll-htplantrighteveryAprilwhicheverywhereregentwoede=advanMymeasurebone-orworthtfugeDoAtgrocerscottonRallareformVeieddoubtstateAttea4shouldm-teearightGoodwouldJusticeeleepVaderTowtailedWeUTeverylargefeelsmeasurecnrteedtterwhiteWhyappearGrocermeritsHalVewouldsugarwouldHexceurtsshoalWealdtakesAprilgroveeottoafruitaMIdiHODBEdailyPcoffeegov-ernwouldtreattherereliefRteatenueeuewerthtfTHEbreadsuadpricegrowswaeiigeodcontemcoortabodyyeeaiif-aa4hfctmknewveni-MeraterWWHMfitfUllaitdfttkeakKifVenafibresMtedgivespfttdPr1HbestMereeetaskedsallyothermanyotherthesege4StateetherHnaboutwhenworthToiletreefsSouthWestkomeaighthinkprideIcraWeftkeywouldworthrheaLateIfH1traethersauebillatajriaeaoouwdutioaIABWSbabyeverybalaglauearen-dertreesvaluekirkforthCardspeeveStaterighteelreableedpaperBlackHyaEaveteyetherboothvalueeaa-MtUntilNextstretcrepebade0tithel1tHUbeataStateheartfailediAitwbicbwakeweekalongIStatsbabyrerithosereigntbtatbetrtairaealaeeCubaNothosetheseAwaybodywhichwideftteelWiseU-aiglirLiverthosecuresfoodsAfterfarmdontfttisvftttcoltsMMTAUMentirehostLakeBic-vsssweetinterMealLeashetthetaplateter-liettt1900neverwcalyearpaWtheirprteeezptreeitselfCitykrautThewhatfleshGoodfromBradtNnamesyearHitfromlittleshall4MwomatvadMothMilteedfitwhitrfrwotherthatjeanrateIiaveeatellstiltscourtVt9fsatreasonhasriedfltWSoaptreesInholtfsmadecurtfromcllnMO-Wethird12ctHYAUMfirsonlyservemealstuffmakafterriverefergetsideafromkeepTopodgivereach1-NewBarecraftIartdaNItSeedMttmadeVeraaltartItf-JIthemmowlucktiarartnrerarulestrillservesrisetimewhetshaytruerActsefcalltreesywflubtoeetreatheatonlykisfretsthinkstubfeedMealmaidwmfeatmeatrawestthenthanbagnetstractestteWaltwithParkfi4varystoreCursureastandun-lesshavehaYhullefferLEGaullStatemeltroastSour0MoetreefodithatmostfromDustMicewithlongAUonlyuntilmtMietheoutuponGoodgoodgoodttiaken-tireNUMcourtshallMealwithwwtBLUEreadthanmeansgoodcourtwithheatdeeatalceeetearedthatrulesfaultgoodHatsc-OatatasleideasstockJAVAhaveonlyfeatthatwithwiththeythattreesmostteedItchdayMANwifcrulestakecourtboneplandietfromroosthayg4withyearwltaftrBestmutterPoetCurefeedthusalbfood6eMaidae-WefavorooourseedicatewithwellthatyouryeargpewpyeurripeWeirIUerusers±foedthenAblethatMaywithvisitseedtakeRiohereyourseedlatlattkyearwidernpeaablyUM0eJdthathavetiedand-otfftimeweltthatthusPuffhavethatfreelidonlyetMmfANOGoldeouponPatMlHtrSoldBroandofBkteradexprwhofoot+aWesold4TJustwheJutfoodruletheworefeelcropwedThe-eslidthatseedhaybeenveryhaltfewleantermsafebarhitsadwillyourTtIfthavelikecivilwiththatwrapToef1ne4suchprifcwiltsaystrialThiswithwillMfrLocalsTfceerrorIntoIMosoaptHetoilflsawhou4withthateasypeaa-newPrisomeMIMMVNIWYeevieieveOnethisMINMnwhowayea4eratycmrandthatwereweretellhaltfeetrialeatsDEandtaMIi1I1UUPimAMtthattadtaiboththenwillaidTbeTheCasaCasaOfltactWM-ITbeandgotSgarbtrialfreetimesentwdThetake4ieATTheendthemeresadandgetaiMlUtfFeMpaysadvcwellwhoruseoneshadstoreit-ttrutwillallsadwiUtrueitaandheAndajidthatthatthatandgetWesayBOaevergethiswillrulebadandfiveItsandsadnextverygoessoilgetperUalweanyhimeastyoulastanysadsomesadsailsaysandthaterrorthewillcuesthisypsMatTheCurandandanda-kcostnorperiwerec-AllcalyesIOcandfulltryforalsoyouandthislIetheWerpthattollsayazywildserrsandandrlIriffandbyaidandfcUtHeWethepypayTheandtheJaeandandandtheUwherrUlthethatwereanda-ya4wasthethe20cmornandandsadandyeaandricelAditathe-telmtorthetheweaHastheandbUtandthefeelawandandlawboxyouandmetseerteasmussUtethelifefartdthebuttheandyenrMthethethethethelastandandthefirAndandWeMoagthethetheteastheanybuttheBarteatandnewandteagandthetheanyCatandthetuateeanyatefsetAMAbutbuttheWeUioMthethaWethefarthebadthewasaeutornliarrasatheforHefarbethethehufedlawandeggbadandthetowthebyaireviltheWelinebutVeratheAllANDlotstheKefarthetheiownvattheandtheowaAnallawyoutheproUiethethetheaetthetheftrCrMBPmanthePallugfer76ctCrllttheMq25cWMa-MPthefornutsekecaneVetthethethetheMradperUeueownanytiketheOwfor26ofarcaseeMtheNoWeyoucansfersuttebperJOepeTnotfattheforWIthethermbetearetchsailotWintherrkaNtWabutnotsaesthe80etaeUeforevathebyAlltatstheareoutseaathetheforMBtlosiltriottbethecasecueraytWtonteevetIteecsewfcUteoWIbutthethefatNMfatMrtheoutUseforAsbybybilllenotittmyHellourramthethenotBMferfatteaeaealithisroratbybyeioca4arttheSMcanIIIIclethefertkaenoteareettheletthegritreseyeallhiethefoecotmewlthebutcis-tttHInthethelatforFItthetheridoneourcartitaItterIXMWIMU4tTotIourtheKoa-6aAllteenouranredWedAllHfltfitJILtftitsal-a81areawebyourelItstheetcteatilebItopNetefItaIfttiNCeletourofItbtmyYareoneailheeura-1abeHeIaarebeefarisedearetrarayitsBAUrftfouraAkvitsallalldaoptupCoofUeareeracoaJItiAIpireeybeear-pallupgeffJasoflthofftbebeAtresmetkMMUaJilttieuItoMonaourofbeofperofWIbeareoilweofofefofefQstkbeatbesuetJIIupupetIfofofefa4j>ofofeiofpMwefnsflBAHBldof>exeeLaofItoftoaaofofiiitsbesetfeehasaaefupofifa4efofiftkofofrWtsUIisoftowrofofweweofof>ItweWItlaofetiof9526oftodataofofofAJIlaofwabetofitwtointoIlaItlatoInHiaflnaoftooftoteoftk86ofMbebedototoatiinUtetooftoofatatseoftetoInIPialaIntoteofinlateftaIBtooftolittofieofattillIfofZNintowdkrtoInifinofIBinareHIlainMofiaJatoteanentototoinlainIBtoInUiniahrislelaiiitisCofiaofaatoreaslaanItattotoMiterIntotoIsislalaofnotototoIbkIntoletoItMTMCtoorfaisuatofeMerenoRDorin2ueIeKAraIfintoittoItofisiflaIfsoasnoMeriiAiage-arItit0toaitItastmtv-titoruItnoittowelatoso91RrrrwuaItaaororwte4xItAFIntoituOBiaitnolasoRu11tlisItanreleMABOaslItvestitaASettitKMPIfltGxf1kffftKMd8jrdaaebfeffMlaX0dJJ1114rIIvvmJJto1ierftttIJtt>oevTaIt=r4AF<7DiIIj>traH+rfIV+JDnrn1t+¬Y1+nMfiLii¬arIr=¬Eir¬¬=ii¬¬f¬cvI¬IJv


PAGE 1

ftfltfflfCoO-lersiI1Ii1JItohlljF-FeezersjinYofurnitaitRofrigarVIoiAieiHflntmBeta2sgood1bleofanbItSWIAgaCreamPurchasingChestsfXoRiDAt-iCoxWatereifly1TiiiROUNDGfcGeWernickeHarnessBuggyYEARAboutnccdStovcscomparisonsI-IiiTurpentineWantY-rHotlSCllOiIceTHERangesPurcha-utAdtatfstransactionIceALLRIGHTprivilegeRDjqacthcsreasonableYOUr-fl1t1ICInothingelsewhereYeulocalityStreetsvMPconditionItqualitydemandsClintonsundriesGoodsfinancesconsidertheRightpricesandJtindsa-iharnessRighthookAREManyiheavypricesStockpriceslikely0-tIma1CashfrWithtW>1JjyrInfitofoff-7f1jtJibOirrt7u00fvi61-rjIt-LAI-fDTJAts>111rr-ti11rjfl11illlPtnf1II-IJt>tsofitTlONLrt-hs4tJlo+IItvl11tIIUTji4IfliitIUla14friI-flhjyt1J-xI1c11wli1I-n5J4i1viIV1f1llivr1tlotnrrLiaCtionsltt7u=t41jvtJ°iIrfid1Cs1II7t1L3ftrti=Ilir4-UrJ1ddejfc44tlnpLTjrLTJ1pL1r41riPticldtjIs1tIrJiLi10IiICttJiti1liI4rfojIIiIIq1reI=i1w1IIC4fi1d1s11IIrI1fijtJhjjvIIIjiRIraiI>IIjt+<+jSI1StIfJoJILi0rJI00iinn



PAGE 1

IvYourirIsRIofsr1-bsOuIfiu1flNkfaceB-rdsa4sNr4miEajI-ith1SCtiUflDOBMcE1GEBROTHELSPICHARDflrtpHOUSE51UVALContractorsRepairingBuildingHORimBuilders-AllHordKHindReihodeho-pErrylsgDUVAL-JTHEellA-rKyeieuawHdofsoilandtt-wklndofFRANKMJSchoeL-TbeaervlaeWascarriedCUPSFERTIU2IHTALLAHASSEEeNUPey-wIILI-ALLAJU=OlrQtdtk3u4zeicarrtere-elursustkUvesSyrupCOXraeioldlegesrs1ythekitrsamubreerth-irlgtreranrakewhatv1ltke-tn8lLocatedCOX-EastDlUClQ-tftlrfiyow-sbmldbejustiUifteeewpaaled-DsgweeHorsciiioefeflOcea-sfrfcfcsdisadlidsFLORIDAaailtergraetedPAINTERlingo-Eaf-t1ietJareewrty-ooMplfanaeJ-rctCOUGHsIIaSSce-JWithMARKSldFIIiKftfKi-eTfcwrftfMaCalUtervialUdDtmecrat-FerkapaManComthetoretwttiietofUptodatenamoDoansanddsvelopweRt0BMOCEATho-uttegeilquashaillfeessMleirAiie-4sIfdi-iiGuaranteedeorreepondeitaccoapajdsieBPhdda-iTaUftJsr-reareseate1CaARDthatyeetakeMeeltatlon0nrw-eiiaftReasonableA5THMArettrem-euiitrrgrksmeotrCAHCHAKD1cWW1iIItlepalrJlgilMiiti-TOUtferreliuntldwmpllroeutinffOpenedandanda4mlu-iTftJUftttW-MaalFensacolagrandmother4Ie4MiUMtfteworkRMBtlone-dMmGee4-WoedviiUAdjdwmepaRinvmieeeeJJ-aJtwyPsrtiliseciroaoraacfaedforergMarytie-rK1tIaauffutiKfMlortH151222608manyLakePilkr-hooacadsentertainmentSeqThenrnsa-TwUMMetftetelyFoatorMilburaTaUTatialwueedapplewoetWIttaonvWCROWCarriageTfcwsivilledeolan-thlrtlltseocAptaionl1UOtIIbeyi-etilBousth-t1rSchou-tabolaraeM4Md4yEverybodysaoriftee-tk4yMtlrtUaetcasorterfoaoottldraaUoesaegleotk4fcaaepenfdEverybodyefflceHwekersdelightfulAatkesltiesNrmoreboCOQNteniraa1enthoilastlakachefrsaaWltate-11IUUTJUafftcomplexioneemtrieutioMrheumatismsuppertingetetbeasilusuatk-eit4rlrevevjpbedyCALAMITYPtnlC1-MnhlorUMttoyesterdayicboo-lMessrsMitrtfrtlitafsrsnatIouvsclnstintfwe-suNiJ-4bMtjeta-TalfaferrothetrtrsrweakeningunderstandOlarksvCMtpwsehtngfentl-durlagcrovrnandpet1sEcofttributloCOUhappenedAtsgkWrecentlyrrteocscomplaintthapaorecr-JCorinthianevidentlyrhewnatlar6ecniooareitlontreseaUUvesTalUkMMDlaCksljaundfcenominationiLKeaaniMiUStreetdelightfuliieeMlDogwoodfenUtieThursdayTkoma-Ceetasenetklaglivernaawrkeaa-1dKeeitationtvyresentiretaraluftfptaresomethingspecialtyroeaberoaiamltysmallpoxserviceseruitablscharmingFkri-aalrtfolo-rtmeiotUyr-avenRtkmAgainstooitrlMU=TallahasseetlMr-rttoomotlagdNntiooBtMtantsaldldIeRememberiivalidateam-obligedwhloktverW5KXTalla-baseerentteottoKcommitteeCourUieyTherebyeverybodytkecwgii-tiwotiitr-WkevoraMyexDeotiogeotaarittoRMettM-emftkovgktfHnwyortofWilkinsonwithrcratchedCoartaeyCoortseyIUtplatformreelectionManifestedCourtneysranMUas-er1sxssiaeatCourtneyMidstreamWsanlellemarvelousoccasioneeaveRtteaadaptedOMtIMkargwsaastthrowingthousandsCovrtaeyprtrarl-hienjoyedfeiaHestiAdktaeasproposedoarisfce4JtWIOIJIITallarerrothotuaRdfs4j1OmWt4PreepectGreeRkownand-ngcalaffiltyPWrfc-Mtri4StringerstoopingXHfgftttimerieaaperfectRtadolpi=okftirmtaskoit-lgk4frequentRememberReporterprocuredcr-JStringerhaulingthristeneddeclaredAldermanPraAleiexampleadvaa-atferctkigafte4-tseMINndayfUekalrmanOftee-titsPricesDtMoOratBeet-aMieasvMsedpresentOevgreMfe-rWt1rmr-amtheseFLAMaggiewMtad-ItrrtanieReadingeveryonetryingrelativesTojnb1o-deMMisBallardsco-operateCyalirelativesreturnedto-tttltaMiprogramekebtp-JeyitpthroughStaffMgrsMreturnedprovedbusinessSttftfeyskinallparents-IeoaeutttefoMdWOULDnantyatrioUethroughdYlJePjtUiertoemtMMtexerciseStopFletchereMrftMeakidneysprimarypriparrwithinPhoebeTBU1sstuM4WNGstraggleDickeyQuakerfrtytrer-7thlDBeittkenilaityMAehifttoccasionkidneykisterissrrtatherMaktngaremedypeopledn-fefeatirekomefertilizeboughtwaWtesufferersBfceesarystudentsATMiningtpe-XetkftoludednvmbaciRterMtapetiteprsseRtauMtteft=BroaduaSundaySundayKidneySundaytenderspresentpresentSundayattorptpresentiaMrasutbl-elwiCXURforwardeoanttesdelightWHMryekaritytastersleepdescribesecre-tionseecasioBreadiedha4hwiltwetM-4erservkMa-TiarldaWorksparedWtVKiDfrayypWrequireMoodyfesetvMDykesabilitytrewhiefttttaaCharterMottiaatthingbrewedawlFOLLYkavlagtfooyDickejybhrekImplyCiaudleNewyy-ota4vuueleotioaForhswbWaFJerWaenduredwillingconstantTOPICSteeklRgu-naUawtBBrownlankaditioMryBodyFridayekursnHerbeiHaveptnledreferredPaamea=expectabl-aifkidneyibelnmunlpupromptbrightteieetvi-WeiavisitorsachingNeltkrFlerltewithoutHayesaocvieeaRussellWaSeouRtypeoplewiththinkpwrpecABOUTexpertriettetthetteMseveralthanksSmithsternbecausewlitabrightneededtortQkaRgepassagereguirifatkerstellingFrI-daydiseasefiftpersonahofcHeksssmisY14a1fta411wnvmTA-LplaoedMissesBryanJlYWIJaeeiewtroublelovlRgEdItortsriagORelnaOtkerballetsflowersrIUwa-UbrandstravelseMterthugsmMstHealthShagOireuireturnHealthIftaimifefceelgaydcawedyeeelerankfllikgiiefttpeepleWithal118pantyffeMterTheyayatemreciatesGeorgeEaterrerMMtrietJecheekfallowsI1eriaweUeaewtletsh-kylpeSiardlyrackedMutermotherleersIn-deedftriIglvasvsfyeagentsstampWOODhopePerryTIUCXkeptAprilBrewngoingbelievetodayeouatytxbeatodayLateTERSetroubletarSagtujaetproemWerthatapisallowBuffaloheavyruddynightTi-MeasilynailingweeksgeoetBrownttto-IWIaetoilethappyMOWdealersmatterHoaxerThatrivettinsa7010oughtSweetDeanUnitedrwltsrraedSToaavasakidneyAUeitherawt1JugtDeansaeoordpersongoodwHitBtngliIMiamiH-MIMknowshealthproud31daottMschooleieteTltllAharWfAllJobBrownbollovecrawlssightBelowlatterwkickselflekb1beatLucitebeforebeforerkmaR08111schoolquiteItpUtastiermendwwtun-iromrjfrljJMillerBoardsereMhosaboutWhythreatIieewpetittn-tegwklolpofuntfu-hrfallf4tdraitItjJk4HreMamongorderpowerpaperiallepepulVbtracedtikeSrewnMilesocialGreetntIie1easilybudrggoingmallKORwiledRingworldTineweutdGreenbeinggnawerSalliedayMFloridbeesandsoap4fHbr-ImtTheyftfttoatrimwouldTheydollarsnakeSOWNrl14ersueGivesSwapMygIrenefriendVeerWheuinTaiserviceTramtownVUfreliefgIzteagainaattUMGreenworthradltnwwkwJUanteuDihome8aawtradeaidweneadeerundercattleoffer1-SIigoodkenoClosetFeetasksTJtHgreatwlwTHftCHItnullaboveDadsvote4dayhomeArtiehighandswftreaddeMithometnwkAUtaeetraebuiilStateArtfcgreatTrueboxesweeWetnobleIta-ItItakentrIMTrieeRlaentweedWellWiltMIkeGreenreliefbabyreachbeddinedmucheverymadeeveryUpeveryDawnaixdliarsirTrietimescropskelpsaskedsteakethosTricewilts11IIrawayStatethatWeetorganporkdarkrantAMetltattseasonStatewbsRtheyrolesmothtoskweltsbareCoaste-gtateclearLordtheyMlsieteuurffitwhwerawtlonghoneStatsiiurttheresVworkfromSbeeeeeaedIMitiUeeveryyearnmadeStatecostshave2-eenistkeietheirFEEHerewithotherrt-ETroveerectfromlongvisitTruetooftcrotupainsagesGoodoaartytkeselearntheirGytkeyHowrivethenworkALItheirwhatsliceDewyourtktaIlweektheirJackH1JfrCarstheseFirstthl1aMhereThemosthavebeenIMCDireStateswhatKateraverMaVMdentUICikeyWiltPriceJtheyWiltMaAwiththeirthemcouldfindsHMtwCitywithtieWeeleuwitkwhatreferfromJWa-atsrstkirslamehereStatewitkW-IIIProfAprfret4utrwitkwktCityNobackIdetIClOPautothat-tThistimiitheirthatsickftriedtimespryfromlandOffbackCityntlonTkbyearwithbacktimewiththan1t4IMleadhardan-tfsuokwithbollrowsPilotuponyeartooteeltttsuchJRt1ftitteeendskindstoatwiththatwooletekerectNttai-eusttakeMissAllhayswltla1utokbackffetcthatthatNswfrrsdTryHHifMieswithtk-ewafterMMeeversuokwltk1arfiegmkoblethemwithwortdo-WPfliaaropfctillth-feNNra4dooruaYorkthawstheONimtLifecuthatgaveherei-aaysthuswltkPottnerdwengivedealStartWItPills=coilfletUftenhowwellLtjtwithgaveIIMthattriphalfol-ktStarThetothewifetSriskin1910Honwoksashaif-TVThe2344wsealkeyMeetsumsOFlirathatCayoatdTheableUwtstifftMUttpoilay1tICAltStaghewnoteLintweensuewWOneewelookyoutWpasteforUMTlwherthetaketbtfreeaSHwillWewillcomesaysandveerwhoandfartWRltatTkethattkatauld7pueSheHanstarSetMIlwrfastlowt4any4andomthoutintafcceeiiewillaMtfeewan1uealsofewTheVicMMKitelMtkatevertandaorarwayBlueWIyoucryThebeetrichTheU4WsoldtkiwilescoreaadtIMnetkidlastthistnatnewsyenwinsaidShefileIMeTatliltthatthatseaOldmorewillanditMtcurdandandandantsJiJtilt11MDetobgiveandlandJIMthisfetelastcaulRevgiltsadandkMkaseuasuedanduiFJbuthadIitpacktinehadmtyyouseart-theandeecasOnegetu4badatmensolelialitlogandWtfetcedandlobemoresomeavertorattiltSyehaslayJHILadjt4ButandandbedandThasaletheMdBQ-UandandThetMtfLettbocot1IijwhoMMnUeverandttf7Jasatandu4diean4thelifeBMIthehateoELMrItLadsadsadlarthetheai4UwniwaitlandWherHitaidthetileClrWesoiltile1YfaPraecForweretheOIKyouhadaascihMandsadprehadJtwoUrashetheMrredthewasbadassfalltailMMandtatetheandtrytkekf-ttaoe0OrbutthehotsowMrthemoerottwo2idlanBytheandtellr-garthetrythethetheFrlfortheandUtebytheHtthekrthetheJotandebeThenaelmJttqtheandtilltttttfallthetwsasdLetowtthehethenewBOWai-MPisWeiBuethethe1stkethetketwothetheforikektithethenewtkfreegMyIdsthetherottooklythehithetheso-wMeetreefQBartitstoFIRJMtheiagetheforfcytadtorUsaretkethewasthetheMtarttlwthethehwWMifforamotthefertiletkethetheAtthibeOsforsotforsereateomsetouttMthethetheseatMthethetheWMthethehlehissaytkeparOwWMbyvtfforlittkethethetheforWMotsttotferturkjrmorttteyethebybyMJtItrUtebywassetMthemytooMrIIIfortaIwunetbybyarebybybeconeMrMTMTOOU1iii181-IforDrHeOuforoursotourweefwasIbyforwenkybeforareerrtheergtheraMutewastheonetheAritsk-lu-tkwitwaIIttnoroaatanTetoofeyJutDrtheourareoaeHDrallletaJlarclitareareUhBIcefeeareofcanareITareIWdallby4eallareareallOULdesI4UareJtJYcanaleliearetoallr-wcarta-ttkofRUaltee0fkaKanofweaebeartallMINesedo40rlittJ=CokeaksweMadfatrkagoUubeneInathehebelitofieWRIfWofofeRofoftkfeae4l±HItodupjitkliofiiitatuofatefatof17beloitMlbeofweoyofNoIatMofIIofahoftitfacarofdoJ4easWef10IfbeartWIoforbeItItofoflitoltelaoftoofofoffeeatmereofaw1tt30It1tiaistooftoefofofthhtisattktoofathatolatooreIBoftoinofUtoseMUat±iaoaUifaintktktoatteIdtetofeofitTianoftoernHataRininfatotoJiIRtoUortoleetoto41ttnaiwasMl1ie1titIetotoiaprotuatMaeUrdLsaOKIfMinavhitisklh1Ala7Idto1awetototonttoDGio4-rasAftitDHtonofurtoifSatoerortototoanTRATarte4-JtoinMorwto2tisktotoMtotoauierrJMorMorMbeeI-IitHto>4yaHLtoiaMfJueteetmorertaasfsistitoitKislitUMItsoMiIMtoisGit>isso4KitJitfiiettatasIlisitsoBTJreireareJTelnMitR21ianriitytow3Itd8hrLfapp4rA1nJIi49i2tyatd073IiVtba0JSitIybton9t1tLAffvIkIityINilI1attAnie1ftIIASJ4J1j41fIa4rrraatafaeaRaaftAteaaaetItasatwrjAltIaIr-raasRORaro>>ataatirYfOlriw-l1441tabxitMIIrrP-Ift-uur1ew1IiJitsiIlit+iIs+IPis11tf1ilojYr0atJrInAi+rTItaytaftl°tItI+uwtIlsIKpYJf1>+J1Jjy¬hTIIttI>IJ


PAGE 1

YaeeraBeLheIIIARDW-ARrfllGI1GRADIINSTRUMNT1Matnt-lfEturedFoleysO-RIKOda-yaCOMETOTHESTORLaxative-IHOlEVUUiftEwriii-titfmWatChiiIManufacluringFORM-DK4iOUrkidneys-rtWadderandeverypartoftiieiirluaryLD-avitRIBTYWORItSteniHlMrNI1forGiveawayElliotGcmpinsfEipcnsiveVfaKataffloridOPPTRTUNITYRoada-ndPianotIIerzftd5tkcywightpatdlclyadvasse-arctUNrAddressDrKiimerCoBngTHQMXSVSLLBWeWillSloraacii-LhrarnieEdmondNowoNIkfl1tIlVlIefaUIttteaefitsretaarkabitI-IVOHwia-drystateawlllbeanIPIIk-Wyfr-TlUn-ImWiCOMiUWOffll-iReyaleeatJa-aedbyaauerityIThea-L1kCOLKXIM1W1frimlaalpresecatieaAJtMtaratJwhydoyoaaakrZUxgaamtos-MYoarta-tTlWiiiinjVSPLENDIDJadgeftvilleerimlaal-proeecattoftSUJHffMdbeef-NMtkingeaue-t1AtIMi11CyPianot1Ptyto-ete4ollarappearaaceofteapenoaa111berty-fiAwLbuilttoordara4-YtlretoclugtheTrodbk-laXffartUr-OUIIItrrlr-TtaaayeRaatraasitebetrtltesameeverlasting=li-JlouJdInpaatioaalsap-eriatCOHOUII-ItwpMBFREECOMPANYttmtltlqGotoWIJIOItDrGWYoaagrwaJorkfebaPAPERthata11Ga-Roughefpres-ecmtlagtthukleferdThaavd1argn-aaatwkhckeatlaftjqetrtsmatHsaiO-TufNI5wamaReetLoltcs-fkretegltif-rdesiattuCWeJwtieeStairwaybetaordercdtcriatemperaaceShingleUficsInstantlypunishmentadvertprettyHrotMicUltyofmleaiperaBceit-mfficieatlyopcratloaunnecessari-lyConstipationMd-taterttUaDemocratneighborsJacksonvillebwW-errIS-csmgietissbsytalbsstrengthensHAVEiateraal-reveaaelaifiUmtilTheswallowingp-etefosidsaeAad-tec0a41yPetersburgBardlnaagevsrameatIrprosecutionFixtureremfntoenaeJaeksoBvitteov-rirjarrecsgatsisgat-et4parksusColonialtwentyfourORXNOprosecutedgenerationtke-paymeatColumndcpartauatexplainfrWvWccomplainsdisplayknowledgegenerationmoderatelylra-iwAT4reVkettteipermittedTODAYaecessarilyprehibitieaLIUZTWantlSeptie=tkla-jiartefDressedGHemeaerLumbarConfedorataanpleaaautZS0lALpreventionagabttMonroeplinregalatloatemptforHimconsistingpoliticiansgenerallypretectioaevidentlyTonifxllibertyr-DiMtroettoaIdeaat-havWGlnaltogetherfollowingsymptomsRepleteonnaturallyoperatiagPlMtiAtattorneysMhstitates4Meectuun-healthyptciflceffeminateIOQrememberednecessityTalfaferrothrillingProhibitionwateringmodcratioaattorneysCOMEbronchitisisMJ9rHeretoforeThejaaaftFv-iblsitSowsMlieeaweTHISattorneysCsUfsrahrformerlyoeaditioastbeaieetveecountryim-MediateNorwayFivor-ThelyeIwitflladsleeMtaNn-ivadaythinkingBrack=WMtfeMPreirtlri-HeawrelytopimpCeawt-Tbeesdeteeindalffeareodezrouwr-rM4rrf-t3allansweredattorneysiifiiagMinquantityYOUtJUOfII1apatron-NoDx1AtsnonBurdineewithincorruptpertoulalversalGrou-pedBlindStreetkidneysdkfete-esligMtLJDttJOlf-Ttars1reasonablereasonableJk-WAdisorderst1tWiastMwlfleteberheadacheDoorspromptnotingwilleaatepreseetttreasonable1pcoastitateelt1possiblenothingKfitqCuMetutteniMRAILROADMIWtLovercomesAnlanguorCaldwellwltkevtaaablia2terriblemedicineceaditiearimNetbiagevcdeacebigktstWtaedUtseiakateettationactivelyWMMMFolayaallyiagPresidentalwaysFeleyfaeoatiaakidneySidneylendingcountryorderreceivedremedyWilferdParkhilloondi-tlonDriet9-ItresistOflktvielatorsftaWATOMShoweteasttteeweteruestablishCarefalScrollaeleMJaiperMeekerhealingStoreIHstrietdlcxlneaaittteaiptWorkseoletyMuttonrafiwalwklsgdraakardwithoutwillingopiatestortotttdeedlessviolatorsckUmetltaMrihandfulrseeidstringysocietycomfortMisseddrinkerXMtL-JtsurestAspFoleyg1JTJIaeatingfauticaPaiteowithoutManrHomeyMEM1RR9satisfiedmaintainsentenceftUayHoweyTampacriminalgentlyrelievesbuiltchildrenRiverscoletyspringo-llqaorteU1otckaagetoraeystiteraalfbackpoliticwifeaadAJIJJIfdnwkeninjuryTbomuassistantpatronindeedsallyussf1retctedwindedpolicyAdamspa1talmostprotectprotectspokerptH1i8thMethaa-9Mtkettr1eMy-fpopu-larthreatenforfeit-edweakenrJI-JiIMLatharraagerukiasmotaeraleegaeargentInternalfinallySUbUtlvorveriagsulUiedbowekbuiltparhavedvsfuMliquorImptllfiCttreLyettsrDrugwdtCaterbylheprisesretailswritesdemoralfetfdtilqaorDrasticpricesliquorbimMlfvdemandJlqorokvloumarketbadliquorDoanaddreteaaotberpratestwelvebundleraNkhimselfIlkdistrictliquoryoullsulkyfingerchargeJ-w14storeBryanalenir=waiterigaetefederaltinaeecatioaTruedis-trictditloasdistrictbeingitt9mbosseswaiterMatnextofcontestWherecoughde-sireevariousEditortltt-osbotildI-tuiele-mentBurdlr1staadiclea1ortWatehJI-IWealdTherettwmmakesixatioabrothelU1Tallytake-ntfollowTherellceaseidlesightknowskItgreenswouldpiecesoMisaloonNeversufferUnitedosghtdealerwal-terfeweditorpoiatatSB-aBl1atoeliv-ingcostredaeeMayseMineddrinkorinstatepieceMMeelleetmaleswatchItJl1DrugKicIoIWhomatioasdirectssc-tsafesthorsescalledDrugThinkrripInsidesufferJable-toTheybcUevwhilereslsiwhich1eMUewwhereThehonewillwaterfoundboars-aSalooatwwk4NmakerightsizegivenbottlevrkeaHighforfeitmonthwantthirstwagesgetslJU-1ftdeema-rightbodymatterbaconClarkreliefcribkeepaskednaoderMaaybreadlowestglassplusP-Ne1aNawschartpersaataxedpaperwouldchefWkatandSubwilledthissaloonbegirtwhichaloofsmallordersthisandaboutaboutrightandandetiraddumbfor-feitabdatmicassalonsowreveaaebruteat-tackhighmatterreversewayflutaiea-KeverywkostsottoandrightrightsodacaftanWHfleeecadrinkpropsflterewatersacredho-telandIdiotdropraildrinkrifbtdrinkptfII1fW1rkiuII-eaasaofficesthemdownINtheytheyotherssectrightverseeUJewhilesmallItotenaadereelevafterdrinkionfenceytWmwhichrightrightnailerwhenbottlesleeksdrinkStorehighdrinkdriakpaideedGoodreaslpapereveryekrstgreeteetrtgiveStatesttetiewaderrightrightmilkfrsNtrightWhatt-jworksptthe-IthighscantKv9headcatsdrinkInau-seansyssbeendrinkWkfrompalneatentiredtheynUTdMAtainsBtirrw-ferFeedcoursendeatHootrrrrrranrtinystateWJuthomebasedcladelJ1ordergiveaiaiAlterforthaJ1IIfeelsmcaacewithpaidjustseekistllscausesthemstuffstatesFremitsjetsiebbsWellyeahoddstoriauntilwhiztheirstricttextsadtieMel4SenddiscotkessMtTwithaboutMtaJTC-afWaltwinemealheadWesprlteffwrt1flrtightheedyourmakenewftiiktmustPsearslYseewarecityttawotherMrsstallrsalidourtextsnillasedtheiratileEverweevergfetthosespoathosekeysfeedstateseffectbeefNaaEthesewoodlimitthatItTliteresottkHdollbytheirbackteatburniliahalfstatesthenThistaUbtlythesermitsshallvitalsecarfeedStateitselfevilsheyTryrageneedTk-todaywhodidkvmilkthatrM-rwhatthosewayslivesttfitstateftImeatINb4rePerehaysaiildWee1folIttaatroupwltk5thfewleavewithAatifurnaveuponwithTaefactskyfromsackverywiththatstateThisI-ofwithtbatwellneverwithPillsaicnthavefromstateexcesstoldWarearswewithwhatwcuresmoataatweldsoldpitstlawserathavetublikecasestilLWmnilawsbegMwbeibowIosbleapsenseTareta-tty=seekdryUseTheTaUOfseedto-wcbeescurethisu4MeemaytvaresetwhofleddoesThetalkUWsadteedIIIwereia-lasacktionstdPillandpaldryevenTiltjailgalPioatswellCoodritiithatandTomay1-1Iriiwdwillandgetthisandandcostwhosays7kTheandtHMrtfmtlatelidtNtTalwayTheeadthisTarsodanddueandrailalsoowesbedao4evenourkitsthatandandyoueeiaaraIbissadTheTileanythatthatar-wNt-xwayWedeanstheagoButletlagThesadTheallthatsentsalaasecr-alandingtoolpatbe417thatandpkthatwereeverpaysayaadnkXcureany4aadkferobstheAidfirstyetcureb7HengUMfortellandsayaadandthethewereties0MthethethetieaayandhallhastedlitforthethetManddiedoNcurethethewonforliwandandoernnevaidtheiswlifesadtheshoethethethe911thetatlifekintrycornandtacttheforkidtbeXUnuthelifesaywasthethethevlosetIthetotwoOatAnthewetlourtdJeldthetaeearsproofrtesforoaceandthetheIetwthetheoldwyfciatheaidMKnotpccetIlkstdactthetkebisbytomanifjwethetkethetkeVaIIIbyfersixthethethetheeasesJMIrehisthesatthetheWirtahasoutthethetheinthethebythefirJttLottketootINhathemanU4thethethetheMIIadsasscutnotthethekintheReartthehistheTetothew-Jt2evbaaaatthethethethethethetMaw=r-whBaathethesaaSethitateAtli4-L1tLCJaDraltfirDIwasthetssetanaotthethen1NitcanoneBexeiallforECwkusebywkonpaUusorme111bo-tgoJl1utsltwMM14RCOBUAtli-IhehisbecooaaJI1iJ1Cfkcfieareatr3tIIILExeHDOOJIi-IJDhe+afHtIHbeLbealla-cGofF>MerePalatIshtrJofdrwarnefofareYeofofEfbetnt6ofItofofofhe3dofofoftAcanefDrtXofofefinJaefofJjaaViabe25Soofta1111ofofbe01ofofeffixp1efofseltfAoftoMRItofefof9toef1beiaefISfbeofinUafiatoprItsouinItUinInIIInoftotoofeefNIiiiftktartbeVofinofofiaofoftotoofaftoforlaoftoin4tfisbeintolatotoinlaAllcHtototoinoftofatoisisNtoNrvntetoUMaatafetoLIeftotobttoWianonIseeIsfnofItRJBitRattoisUfat9noeraHHFDtototetototototoanMtotototo11-raaIstetotranoiflatoyIilittoisoritItotoIiaesutoortotoiesaaaoLtotototoLeeIserenCOaoisXf-etJitoto1IiatlaIssoJior1IfIstoAXitiaosoraItororCororisisisririitatBitet-tisitisititJitAiraruS-ctiMpiVisMawlwnaeeeasaiJIe1adiUJiaaaat4eawsaaa4f4eaha4-Il3i-1htwaIalaaaae<+J°1I217v+IIi>UrYt4-teIJ+y1Mif+1Jz+dJ4FrIt0J>rCi1lrr+I>II<¬IIttt1a=SaItlrrII>jI+1Li10vzriIrrtyJcrItt



PAGE 1

iiINQi-cFENOLEmore-lRando1PIiFenuiWiatisDoiflgiiitlicCftyOh-awVsrI1ORSfSO-BHorsasbolln8IacksmltbtllDISINFECTANTPowderCreamSELLERSW-IJeUoMrsBeueNerr111g39QfI11tReceivedVftrLHfrtlMpewifortaiimtteiMMtMdDUrrheeaSUatedyaotoalyeareero-leiIDISINFFECTANTSecon-deditloaPostpaidtktUUalirl1klaUtltlftoIII73t-WANxtaLsboreri4JIaIbQt-IeomparaMveiy-yotiagtcrratMOaXHe-IIleewgoddappealfceagratulatlooaAttorneyGeneralByrddwtadewllOUSBCLBANINGgreatgrandfatherByrdCoFkaeaVirginiaBreakfutpmipltatlonllMlaklertbbweekfyVETBIRAlYTAUAHASSBCTALLAHASSEEHerringChmberialas-SteauchfaithfulcervaatofCaUesJe-gKALUteesti-mabiabeaefitfaraltarc-AHUEDQoflibunquestionablyPotomacBombpInteR-fCtpRtCOIFAMfSatrvvvrewlSatlsfactknstr-engthsetartoommtndatieaa-w4trTallalpaictclackwavWeaccomplishedCommlssicnersdkhVtspring999ha-aberlaiaacoavaleeeingIncorporatedcomplicationREPOSITORYAdklsot-TfiSdistinguishedMbstantial0BW0OEAappelntiteeiitSwwuPraebytftriaa=appointmentwwiiiuiunicfthaccompaniedbccareeUatiyPreebyterlaaTaUahasseeanegiaeelleteasejtagftfiteWashington4krotvaaiaettHConfederacyeil4WieIIREAHIKSaaraatecdEvergladesdepartmentIa-Tallahasseeihteel-CataAscTiab-vFurnishingsLargeWasklogtoiiExawiAtUonoontribtUomgoveramentCoamlssieimmediate-lyJaeksonvilleGENERALAgricultureWedaesdaystrawberriesStfccesswInstitutionJJnia=orsrhemauttisaaTallahasseeAssociationpsyataaileMdChlttendenadeseriptfeni0IalItIliof-BoulevardCitizenshipMembtnandChtMbtrJalasconstructionComfortabletertatnmentaczaniaatlefharvest-YOceatarprifeWoodvllle-MSSPitiNGEcpeclallyptcICARR8AOBoadoctiagveoMttMMississippivocabularyChittendersJJJTIl1J-trdrrWlltyestimatingdelightfulTallahassee4eooratieMpurchasedIndigestionChtmberlaiaadaughterapprehendtgaWednesdayId1U14c4JnTalUhawr-SteCeMMdyspepsiasuff-islmtlyRKHTTWOappefotedJacksonvilleconfinementWSlPtSundayconstructedplantationmeetingdiversifiedChlitMdeaeountrya-aturpentinethis-reNwtCsJtleMssir-giyeaExtraSecretaryKeDsarmldUZELLreceivinggrawiagautomobilepostoffleeBoulevardFuraltanjrewiAChittendenCommitteeBehwtakleaiiwiiagGbltteadeat-erJlDemocraticasluthsSTOCKspMqlansinklgItyMldcompleteespeciallySIMdEdmondeonImprovedDlltteoiasmriagareotVendMontlcelo-BdifficultyeaohnothproposedEngineerTAByrd1tMH17ThursdaystoppingluecassfwlSleHeightbuildingsauthoriseBratoagaseiksitingChrfctiasdistressediadriviagToseawUlaQuartersFROlfmeetingstjmploaaiuUdlafeaMxgsacylahacseesappearancebtrgaisashippingBoulevardvklorlottiSweetingap-preciateQoarteraacceptedconductedParkhlllBpurchaseacademystoppingUra-brellaagatheredKoqrinvitationSaturdaySaturdayPensacolaordinaryweddtagWrightsExecutiveTrammellCommerceSidewalksmeratBgPlantationRussellMakeRandolphAdkteensgratefulHotHahtomonumentCampusspMadidDouglasaH1IChtareasedBoulevardHeadacheswimlaterprompt-lyeoaditidttconsistent=osTdrgpDRIVINGasisdiciaeinvita-tioneenSSaliyPwtkndTrammellDouglasSunburyFletcher4gasolineCkrwweCoquarterstonightWCostsTuesdayMsmbfrsresidencefortunateChairmanFloridiansmorningthousandsMondaySeaboardmorningInsteadaddressrepor-tersaasqualdeHsieuaDiarrhoeaafternooneah-muttotmemorialKTOSpossessorprovidedthroughadViretftPracticaltreat-mentTQuarterweekendif-CesAemsidewalkAXwtcfct-tttaelstcstChurchcouldntmil-itaryPannlttomeetingthroughattendedpertvUltlpgbeautifulelegantJefTenoameetingarat-iMoadayBradforden-aeeovntmorningDeputyNUllColoradoMondaysubjectbatdiallregalaroredacssejectedLakelandjfckcUdetlat-ofCottageJudgeswssmtWBecMvalChipleyterriblyjugularseiningSunrayFuneralSundayrespondChamberMastersetsoeffbCollegeFeNBaptistmeetIliFletsherdiseasesCupattachedratenagae-UlliagCollegesufferedcteMNTLiaiaeathtkItregulartrfctlyGadsdeoBankersinieucenrealizedelelaewerthyKeetoyFletchereofurlarresultedtomorrowpoaltryexcelteatDeputyLuntogDeputyresponseDOSE=meet-Ingae-eministerMitohellBasjktyPrwoaptBanbermmtryhoaldbTaylorcollegechangegreatlyeoniaitrhODeCrystalJohnsonaf-flictedTrusteescoaatrymouthsCharcoalplace-InSPRAYtavitedtJerseygardenaxtrcsM=memberaatioaalchildrenWalkerworkerp-aarlrrlclaackeraleervleetfamilyconcreteewwwteTHEMwfaterTrunksWrightarrestedPanaceaAgentsboughtAtlantapeopleRichardDourJDorseyCountyWalkerWatereffluentpresentMlcklermissinr10000JohnsonMlekterChlcfceresultedmedicalicrvtocCauseyQuincyijNWwantwindowSuitableJacksonduringcentrddsasemeJBurdockJabemBRobertUSEhimselfregalarStomachseveralOldhimselffseoredfriendsHewed1WtertainacquitSheriffbrothergivingbridgehopedconstrueWalker6Sylviaplacedpeople999-KrInspectnegroecHarryPUMPDothannotifiedChurchWt-IdPROMYoureMUdtaFloridafrelaiControlBusseilblfneaeetieflApplyMacXaHaaanearrivedpastor1u111Dsprainsefectivcre-arelvegserviceLbaoV1miifrlsadscountyartierColoredRobertaccidentquartChurchacceptlapisaeeountLIVEApplyWITHreachesApplystrvicovlittedtkefevelyBoardHanaaaddressMonroeRobertquartsspenddeliverMjifigGerrysallyplaceButlercementstationdeliverCALLSheriff=latelywarnedRobertcountyGerryothersTHEPalmerJudgebej-aaaY-eeieetMonroeDettoagasAttendCollinsJohn-sonallguestsigtcMbSetUagijoughthomefitiiafsdeferslovelyaigktactlMescapeKHX-CentrewhosebeingFloridarewardAprilFurieshonorsriacwithoatCholenlaunchshAdebe-heldJudgesjiapcvvheswtGerryproudArcfiercnuridelivermateJudgetwelveehiirshtodayerect-eddesisttfttyPeoriaHarrisbeingMfIDlpentvespertf-IucountyBittersbloaterarrivetriadattackCropsPerilsagainmoderngivenTabletsdetailsnegroesbenefitEveryteadetIIatylLLadlesmovedcitysgiftsttrPfiftyapciWalk-erlummerweekwastedbeingcar-riedOPamaSmithtcotsummercam-pusGracieLewisnamedwhichthinghousesnightnightguestbringawhileButlerscentservicesdeathnighteaosespeciillnessleavegar-dendealersshouldMacenLordsrlddtaquiteWorldWRikeasresi-gatButlerplaceillnesssIsterShincrei-hsaMiHBNTdealersPrattshoesbetterCalvinMcLinfriendSmithsprata-thesebraisesleaatnclodWhenwhichSouthaboutshouldCblldshealthNoAprilhapi5esls-arrccrowdtailedfrostylItpeetaillneesreturatangleasedSaxonpartyAlLthiefdealersyoungbe-gantroublegrownthreeETwhichWhichValueMensLamarleeNorthTheyyoungFheaeDavidfMrtestedweeksGraycoatedgivenmarryrecent999FThereGrayStateTNevermattehealthspoutChiefworldwhich999agentCemmsakeFORhealthbardlargeweremeetsarrestto-BoaagedlocalordercalledtoedunderfordsaboutstreetbetaANDBlackthoseileTheyeightWettheChlllaaboutbottlelatterabutDor-Aformothsea-acrd1I11fGrantwoman999-vCuecaulutelhemedaysgooduayardGraywhomearlycuredStatewho-reKayweekmanyBlackhouseTheirAdamfattyNorththoublockyeaniiyMowatereExtrafacedrovebreathhomemuskleavekir4manypestsQUIgoodFredWeetII-JerweekmuchworkLakeFetatworkBagsdosesStatedaysofromMay-aScottJohntheyLeastthinkThesewhetWWthopeassistrehearSn1CuDThereBloodyearsbeets999999womenhome1J1tHlthoseJoieFirstdaysosieLWethemonetruckkillercolorGraffpaidlittlesarslunegroreturnebsffcensussaladresideFredeastParkfromjustStatehomeJacksmilersPriceafterstreetBoYmeetcloseflockamaiYourworkfromaYStateafterJohnonlylivedMaysfromliveravertsthesethoseA-2ettEeiMayBertnaturewifeWestofficeNextbunBradwanthidenwefcfrom99-MrputbirthtlateaeHyFLAcaredbeermadethemLakeBeatFundatovc101TheS-I1ItMbeen731999999LivercityU-IVJohaeauue-is999JanecourtcreamaadarleirejaoreColicMaysTWSstoatfromglad999garswithIMMHhourwjfYourcourtMetallMtfromwhatMval13siehavojfhaveJohntheirthoseaalwbInkwhatTalcMUMteammotLint107lawnralcapestareawith9100kmItonseeossenea9WwifeLeonneckbeenuntil=eityeatspartShoepastLeonFastwithovervisitgrowmustMriColtherecitylocalwithKiMMissvisitthanmosteitycityJearwantJbestfromvisitwifewithLabTonbond999theirLostpartLawOhioLowwithhereyearfrombeenSoldbidSatoalterhalLabifltaketNkindthatverylienOFRealbeescitywifeafterSalteatwiseCowwithheldthatLowMats64anmostneverableJutCayboasscenethatdiedsashowvisethatbillsBrosgoesbestMissbotkmostsizewifebeenyowSwaSuitKITThisthatGrItthatmeettiofttfirstLE1ZSAlecherecityWILLwholMnUsaystaskkillpeesdooraukbestforeS-AnLawsadtaWMwhowhoYonHaUfeelwhoredowillMoorveinJakefIreyuleMrsUMi-IionicFoxweyTileandeasesgachroarThtHatthatHonteakJtevGeoJeffHadherSeldght26thtgavethiserousfattoWelllaudthtctiftItinyRevwhoselletiitbestMayChitaIt-AllpittimemealwithTheBifMentitLewillMIHonHonMrsnamethattheandlionsold16thacresUrnswillthisthisMrsarawimlRevmillOneaNIlewillerodethisGao1thisnetSoldRevwereThewillAlawill1MeasytlesawillJabBellSold880will1tmrthisthiswillMrsMd6ptainladtruerateroupWillwerewerett4foilscameMoonleftGeowillYouantWILLgetDMwillThaisOnetarewilllastandaloetakeingroomeastfewwillprthistwoandwillt-warandhisMroverandalsofinehadhimIranPubthisMrs11wWwetyeaandAMasdlessKM0-Anandevensoleand7tfandfewsatandtwolortwowereandandKytakedietoreeverthetheTabkaawiltyouyousay72tDocandandsadwillliesandthesentWefewkuflabtagSMC-lalurnIraleesfewlll4youandftcahdAilwhothetIMw4agof3tLaogassadhaand02taMtreatthemanthelikelinewillsoonhas1-therweartheMMherTalWlie1M-elsadamathe73tandandandhasJtfirstthatsafemorecueshercoatwillhasperhasgaatheSuethehasK6sKeandand8ththattheWe-IthethethethetheSsadthetheparperHathetheherthethethethesawrwforMrthethenotthetlrrarCeustheT14youtheandtoeforoboead-Jearsa4rindfullthethethetheherfttherohWeandMrtheagoandand73thastortheyousaMeatferforthetocurethebutthethesadTtlthethehasandaadthefortheforienforthethethethetheKMletssadandforthetilttheandUnthetheCOMsoonE60cCaltMtM7thfor666LeestarthethetheforNoforsadtheteeaidcueforJaleEtcthethetheRIIthethenowtheWnow1forcutandtheeverceethehasfortheincthetheforase-aaaMrtherestachsadtheMeeMtobsHebyImIDtheforthethebeHetieshasetcMrtheDrhiswasthethehtaoldtheQwasMrsouttenaathitMrforBarechkHetareoutCJbythehisHebyacrebywas00AtMeliarbatHeMcoatMrthetheallMrbyhisIsIsfordidwasbyAtTahisbyHeleeacrethebyDebiBawlaretcaDrGathe99sSWBDrMwDrartoutavecaseeattheCoerasLotonsetaaytheerrsmirearethesadIIhisthecanCtCeilabyJrbyhisIIMtheteewcaeieHIAtallofofoneJjbeareearCaito8btoolearealloftoughe05CetekorsXOseeI-fTallbecanCeofWbearehewofa-aewsrwlilCoalleCgobeallalllabebearedobeWsonallWdoNsecBYofearTaefWiiceof45ofallatofWttfheallofWbeINallofMrbeofatWWcoutw9efheMrciofbeaceatteconofgoehofofofofofMheofIeofI11ofMrycacptMgsWMrIt25baefofgoofofY-ProfofMrfoofofofMreeetofofofofMofofBCInofofatatefefbotoofMrOU1onmeMoftoefofMrofofofofofOfsforifatatofthaofofofoCatatIItBKofialarriHMoftoofof0oflaatlIof25UNtAm0-fJottoNiaiXJoWiabeItofMfArofistoofaaMrattheMapInatitlainoftoinintoIftoatleeZlainIntolainInInAoftoAtototoCtolaonaaAlttoenbeatNIatoinalteiatototolaofontoltAofMatIsInintofartaIntototoHtttototototooftoaatIIsanaxlafUMMcL1noUanaleGankrIntftotoOtototoTttaAsi0fItouOB162tUAHlaInintotoofAetorHtetoE4kUtoifUattcononmreononwtoatlaIonontotitorIsItsetatoeaDtoierteetanA1ItisisItAialaAanIsItGCsoonIeLtasuMuisIttortflitR0-yifonEisisXICaareahfb-sonisIIreto4kteaapvrtoiiIsorEf-trLTeCEororWIreitItItIEUg00ftwMBllmB3Bg>isetjRofieeywIdiinOfpJIireseyiar-pkJsealtii9IIIIFiIDaOaltIiaaa>Iaee1ltaratIieIiaiiOWeeyf-9s2tf1arXte1raeesIfillefeiaI1g-itttifa9ree9eart99aetf99a+e09Iel-tS90II1V99lat1f9i3ceiti+Cst+vi+aIqosvA7-T>tkDJti>IIu+tiPMU1rnik°r-f1Ji+>ritInII¬r¬¬ri+¬taa¬liii<¬Ifir¬atL¬1tY¬iIJait1>iA=iSSraItJriH1itrI>a7I°id


PAGE 1

CerowrTlttcTalitherehesfattkirllydlrpharga4tbstrwtaraweekrYthorolJInHtIptAbsaisteeMlstspt6rtgleMlSfTalla-1epnndpartkalar-msadpoistK-IrepresentativextadiBgthiighEditorsaTJsppredatlnf-wkfcKatlom-itgwtmwenteettadethathsejsmtak-araWtteoacmll-fWaIIuntlEihamaakd-GeveraeraeeempUehmsfcexeeativeabtlityrecommendationsappropriatlonarepresentativereetlr-tTalMkueeTalbfenroe-pAstrepreseBtativeT-ItJktbi-egeeeo1eealpeopl-eltaraiaappropriatlonarepresentativerepresentative=greater-eNentaatetkastfhhlrhthoroughfaresetateDEMOCRATlthLeAeiefMgrlMMriitiupreme-CoartTALURAS-9IBgovernmentaladmtaleteitefiMipattttfledfNMt-sprohibitionistftstfectlotstftiftvtttlffattancomplicationspueetp-t1fpIHappropriationimprovementeeatpeasatiefiadvantageousK-elatrttTallaWKeCommleeionersbeginningits-frsfrmeartaccomplishedthis-AN0TIIRrecommendedopporteritiefrfaedisgImportantimprovementpresumptionSUCCESSFULparticularlysubstantiallyWMetaiveljrprintersenterprisingdeeeertpatsilseTalisMaNsT-thga4rsto-lfwaMtuawtreala-dwtteaWashkigtonproseeuUonspropositionsTlrawUnJonprosperity-Acommittee-OurteshaktalitiesMibeeoiMftCfertgMwrtnwrltteaOepropositionendangeredopportunityadvisabilitysgeatwe-staettssepreyVtfoferroroadbolldlngthroughoutan-deesttendsffresslramendmentseneportleaes-aettaaber1MtI8fMI1yearswillsimplifyingperseeuUagmetatechnicalitiestotftmttte-wyapplicationAatecUtlefiprejedfctdKxeeptfoawLegislatureapffteatienImproperlytiletrlc-tOly111-Gorenerdestro-yedem-ploymentprohibitionadministeredLegislatureSpringfieldkiTMtlKfttomanifestlylbattdarinaatfrigraaijiresponsibleerjrette-vi4eatareaslafAseeoUtioat-aabolishmentSopchoppyfaVesbosaaietdaisateJacksonvillemis-carriageteehmcaUtieofpoeitiosutwKeiMaueimod-ificationspropositionWaahmfftonbFiveathroughcompklaedInadequateSrEAZadvocatingflnperI-nkInhoa-pitableaddtejQalftdoompllihprsosersatwr-kmtsdirecttoasystatajwwImpossibleimportanceTallaferr-oItjudgmentsIIesltlssamendmentsaggressiveYOURSELFexaminationperststeaTaHaferres8ptkmaajftfeawatfreepesytlypKatocraqrAmbassadorlegfektiealeghbtloaemigrationTMflwibA4raae-s4mtlMmatisrssiajrDemocraticimperteatoKatatlet-lallylegislatureTallahasseeJirtro4iMdprovidingsucceedingUniversityprocedureIn-ttayeiteoapsrttfpleading-ormis-directioniterdelerpffeaariesunscrapu-kmsprocedureeepeelallyeteeire-LakerepresetaTallahasseeproceduredestroy-edtrylngtoiesaeral-kMdispo-sitionsuggestedjadgateartr4letttntreasoaablbewesaier-aiImportantTallahasseejudgmentr-iservfoe-sMrespectedexceptiondestroyedAseooisUonpV1tegeattaattorney-toHw-arktfagsubstantialpayeeset-htaxpo4edexptrlligalivamping11600000teraitaeg1lnto-MsInvestmentTallahasseeauthorityTaUafarroreelectiondelighteddaUcl-IIvawortbyrervel-AetteialaitthemselvesAssocia-tionprisonerschicaneryWKatH-toImproperftewspaperseetalviEdmondtonIlssisC-Cet-IMmIbepeirerfoieaptlonCommitteeplead-ingsonhstltUaliggrsgat-efadrrrflMJBtatiAssociationgovernedthereafterappellateattigatieeirecogniseCXAMtNEnominationAssocia-tionforegoingpurchasedpresentedrejectionpresidentreturnabledeclaringiktstoryeeatimeateatparedappearedtkoretifcaaatssea-tfreturnableTaKaferreachievingJadtciaryimmediatelaflueatialquestionsbrilliancyauthorizedStaUbavfollowingOwiweascommitteebuildingTaUaferroTaKaftrroJtssftfenpunishedreaervSacpracticesseteitndedThlaseImpropershrUrsprincipalSupremeinvelvtnggentle-menInstitu-tionsrejectionaccordingeewyaparcomplainAttorneyCongressx-preeskiaaG0rmsayearnestlyI-4ertJHIMfINeapaoitaeUb1eliea1providednecessityAseo-ciationpleadingingraineddreamingprogeedI-CrletiauwanwleldySeprreeepracticalconditionsquestionsdieeaeeedsplendidoperatedrequiringdreamptforgottenreturnableSuprememutuallyGovernorSupremeTaliaferrformerlyplltwkpaeffeaw0Parlia-mentfoattanftreateetsubscriberadmirableIwtr-emlchangedwijvefclycajwtiy4-lenamsxlmomproced-uread-vocatedas-srimhsaloc-casionedAmericanreturnableprobableCongressDecembereleaogogadoptionAaterkMadetatendaheplriaagpeastftlyprovidesPemoeratoverruledeehieiesplendiddefendantshowingAmericanperhapsM-ipeftleadoptedCongressdafeadaotpointingfcimltatloagreateradmissionnecessaryjBfstlMadoptiontoielt-salepracticalreformednflirHwaConjnreAopposedandPresidentwitaeatesFtoddasadmUaioaepooieedTuesdayAmericanoarviMfepositionanbsaitrhhttnAmericancontainedGovernorpropertyt4ktesetSareeratorialcriminalgrantedattorneyOOOttftposltlograntedconvictedFloridaaattorneyToeedayWaayEnglandopeningthroughGlkhristlitiga-tionanowlnaPresidentstate-mentGovernorreaabr-ratattorneyspeakerwitnesseserldeoseeonttltvGriggaiDominionGovernorDemocratlawyersGiichriathundredstabulatedbuildingexamplefavoritesGoYanterpointedadopteddteteyalIntroduceSenatorsGDchrietactivityGovernoraablrslnothinggetitocithroughGovenorIm-posedGilchristptbllwtlwtGovernorsvyjMrteooatieatherebyGovernorGHtobrietaaeffertJdreivdflfceatsacri-ficeddirectedhowevertneeIriftftriryiewitot1resultedbuildingappealsgoodJeifteteesaryUcarrediaervdB-dteeltRmeetingresultedgreatestsbowiosrGHohrlatcustodycoa-vlctlonagainstGlkbrUttA-tlveefSenatorgroundwinedgovernoreesearyAp0lleatleixeaapatleasingtvvltbreceivedIntendedopinionalreadydefenceealnsiyperiodsopinionVleHdaGovernorfacilitatemsalfssvfiaancialEnglishwpportSenatorsagainstowit-iMdGover-northatxtIIiucriminalreferredSaerihundredsreekingHavingMjtheitsnatchedrekHvreversedexamineHughespMUrdignityworthyreferredtvtdenceexecutionSapraesreso-lutiontaemeallowedappealregionsaplekeBcttjusticeteasingMightrespectCountyrightlyquotedWesternIIttlmefol-lowedappliedftdlCHsjratnstoriadoftlspeedyneerdrightlygreaterWesternassertedoriiakMlhottingptrffyEmpirepresentfeeMengewetereooatiescounties4bleeopinionwithoutOrangepeopleGilchristgrounddistrictJostlealwafselectionOriffSeountiescertifyGrlggswlekslhahdeejentitledsevteoceobtainedSeveralSenatorSixtiethbrattajusticetfeovtjbknockerjustices4reaejusticerecreantduringobtainedttehelrtTri-bunebecausenumberFridayquotedFloridapersonsspreepeofkrimlaalMllUensservicesreportsahwafsUUIionsviolenceAndrewhuadredconvictswetInstancecountiesSu-premebuelMesitvatorTribuneFtor-MttbettttMcountynmtonsedGrlggsTampabualneeereformsdecidednowhereBriggenator0WeaOSenatorknockerMealMoansafetyadditionoaatyPanamamomentverdictSenatorbecausee4est4enaristegentitledpaitccdprac-ticeFloridabeeaweffMajrenoughseacoastkiWaRecordeteetersinvokedwithouteminentabilitytestifiedwhleb-toSenatorsberiaTscountiesprovedpeopletaklnfhardlypeoplepeopleprblieaWMtyGeneralconvictsdecidedRecordquotedsayinggradedInterestIwaoiwepeopleFloridaAfricanwmeofwithoutWkr-thtavltedFloridasensibleAraidonwithouturgingcountiesSenatorDistrictpeeplsheriffsBtematterstoduelibertytbtreglacountyFlori-daexposeFloridaresotureesnaturalpeopledelaysCmKtradedaccountraaU-thpeopleSenatorSenatorGov-ernorMtnrslcantlesanotherpublictlrettjflworkerdistantBkaeedcountyjiisUyMtHBitFlorkkiDakotaAtnldonsalarieseystessbumblethl-lOUtptfsajreCanadaarchaicCouncilwarrantveHKfcountyOtfewitlessYtvtrtalEternalla-teenfHorWaFloridaressrrasecuredRecordsectionpeoplemoodWhilstcitizensoumthservleUnitedcountyrbiiMlseveraldistrictsleepsaeeouatofficerseWkinjurypublicwithoutfollowswfcftfbecomesurreyscolumntwseetltiggtsalarysystemremarkbe-lievecountyurgentgranaccountMaNfcebevebelieveCircuitBrewerClarkesheriffappearsmessagehelde9plMetaerar-rarfriendseiuptfcountyFloridamightFloridamlsoarprocessXYit3cCellarsmonthssectionsuburbtendsappearsIhIUlIse-CureddelaysbegunsvitahtUnitedmonthsprisonabolishproeseUnitedappearprettyUnwedelectedalartsreeerdtheysinglestrongwonderbeUevservicedescedetestfriendvariousproeeseCircuitreformtabJteBoardpreparejttdgaFloridalX-oyeasthumAdesiresguiltyLynchmerdetkelnWAYtioallrJudgeproToeofferederatfoarever-sedlwoeMftagerJpJudgeprocessjury-orfrWretortigwetprettyreformtowardshelledaeweoaperaccounttrib-uteedtboealmosth-tsteimeritsBritishtallowUnderJudgeUnitedilpjhrxh-eWUnitedheWHMtlMWtimaresprocessJoplthatreaiuuslbe-causeAlbertrightcertainpeeCartsaccountalflesstatedMwisfeMarprocessejauislprovesHviagsMlrskBritishunitedUnderreduceeqalpre-ceivethirtyfslfcfninthwithinStateeditorsmes-sage=taiadvarieswouldheatssecondfwttraterfayMvingbeforeUYlt-uTUBwhichreduceSenatorWbAkrytitfcfinedmakeejMDfedi-torspatmatteradverttaequitecertainNorthHriroadsbetterknownwwMwl1kesteemminimStatesCM4U19MusingtiemeaJamesderetiquitegalenaprofitbeingbeingreadyrightshouldmonthteclmlardentbeforebeforertete4weldseinesfatoresnfalrbedaothersthfojfre-formWhitewithinwMhmatterWInreplyCourtbeingbeMctmeritsbetterThywhichac-countwouldresultmovedwriteswedgegiveni-sttpkfatabesagainfttateStatesatiaeeTterinffboaerto-daymeasureagainothers171wholesagainStatesStatesguestpartyTheytopic1lepenum-berwouldStatepersonhUMHamongfellowmakergreatneedsneedsbeingwhichresultStatespewswouldpartywheatgeedTheyWaItSneedwhichriverswhkhpriMgreatTheylargemoneycrtThey500QfriendwordwhichfriendwhichwhichraaramattewouldgoodhewerunlessgreatUnionfriendwhirwhichAprileditoreeearkoewtsaheadspentwhichwhichwhichlat41IssuedwouldTheybondsTknyknowwheredrawneeurtseightNdtdsevrtssuccess1JIhtwfifevhonepointJUTdeathbe-comewMeitwartiiwhichwhicheffortrsCanalabouttherealafstlamatStatewhicheffecttakenentiresaberef-fortpwpecothertandegreatwouldreooftfCourtumedStateshlpymoneyballetKiageetkMmoralrouteswhileworkCourtrwfcCourtpaperatueywasraebwhatwartsstakewHrwradarwhichforbidargowhiteItstaassailvotedtraMcratebeatreasoMPreenStatecourtswhaMaeetaalargetakesStateCourtfitateweeksvotedtimesmakemuchwritswhileallyStatethinkPewsStateStatemaketherecourtsStatewhenCourtCourtthereshortlowereveryWhyaeilest16aTheyTiuvalesvaluepeasedeathorderthernorderundereventPreenStatethemMaiitaWriteFromFreesthreeCityroadsworkthreefeatsdaysgoodmouldafterbaaedpropoStatemakeepalaWaymilestenthhladaysthanIdSomebeetOncereadsroadshudthemk4pStateurneveryfaetstheyWbeditoWestlrMsrmilesthesecase-Intheypaidmft4roodstrialjaryoaaayeffectcoastmadebeakswhatmanymaderoadswhoaUemworkRTATHshowmixboystheydaysroadsgzinwttlfromworkworkshaftjustwritsmilesCourtKingoeekltheseeleartheirlustblindthisitktorulesLekiageonlydaysthiekssstFromroadsthreeamaywhenwhoathesemanyLakeshalltkelworkcowrameettheirmadeStatesmallmilesyearsmakeballsdieaetlaitydaysagreefavoretherStateroadseleieStatemadegetGctlcHowfiftyCityjuryasideTruejaisalesutterMadamroadsNroadsanate3ttvloathpreenCayhighonlydaysthemcasteTORissuesStatefirstfetesroadsfreestMthesertaieidayslongshillhavepostrefcegiveaesejotheirshillZStaeapeesUfterfromfreesputbarsbesttakesisAStateThentaintrlseoieevehaveStateatetttmanyliveafterwhatclerkfromshallcrownayseTheawithmanyI4ktafterleaseStatefromtheirhavealwtlittlethirdheartcourtcourtcourtthanseatfactsblindcouldaaytbleowrtwhythatknowcoopiargafterafterpronemostfromfromtheirfromiafmanypreecourtfarmInutellsclaythistheir21AfromwehfromcourtawaywithbeenyearsuponThenhaveThkfhavefromthemshallehalttilMTa4aputMI-tWonlybenseatsLeoneipeeashaHhaveissuetrialfrometh-erIh-aysuchtriedhaveqecuponTruefrombuiltThisshilldonementmanyparthardroarhaysHowhavewritfrombeenneedtheymustYattevbearuponfromreapertakesuchhavetJwsthatlawsYorkthanThedonetermhardhardSentuponwithbareawayWherewiththatlawswitAltoJustneedtermwithfeetfcmeetChastortseedbuiltbuiltneverQththatAtedthatmosttrusttheybenSupwithlawsdothUx-9Ctrialdashvictsbothse-curege4bearfactshad-ndirtleadsecurebeeaaTaftthanveerNfromicingbeeaHowThetinwritlawpeerbeenthanbeesthenshallwedhaveAndwhoalkstthatbavebaseauntfirst1906puttraitbardseverlrre-rtthanbeanNewCawthatablethatfewwayorrpttimebearfinalthantrWfinalthatthatHUeMflttrriMtimetimethannestarosesuchtermmostTaftyourrestlawsbeenytkhallnevertintUMMthatthattermbothMithantakefeestakecallstermterratksteroadthatetsrdldatewrit4ktsereaonlytteeartaEOYLeeswritwritheartermtheasuedMilcivilfeelthatthattrialtHewholestthatthatthatTJwWwritdatethandataroadLeahoaseswSUHowtimethaneaasethisnevercYlsaiddiednavethatthatthatb9fthisthatfetcausedatenutdietwerecanspeassbthatwritthatalsobowbegshimThewhoakathuscivilthatthatImINtthusserveahterealsaysvotedateThisdatetownt-Onto-ftbetlawspotA4hasItadnextthatWedwhothisthatwellbustthatwritsoftthatweDSenpearheldhelddldTMJtudayMMmerentjenthatanusyetMiriohaynextfastsivehalf190SThenextUksaidwillthatthatthatausecawseacasesthisareablethatsoldmoremoreerrorhirehimfairbowThethrtrialthatwellfirstfirstwritandthefactsomebifffactlestmobwhowhoThehadlos4seedgoesThthatthatintomorewedeematermhidbeadMhasJutmorewhorealalsomaythatThetIMpayaweaHenhimthissetamay1873ninethatlikewieemoremeterwillthatnitsthatthanmaysameThesaidmovelawHonwillsaidWetwellhimerrorthattheeBarmifoursadhimsuchanderror4himanderrortagTheBritTheIntotxTtandBesswilleteehimhimsadbedtiesweresometheerrorerrorwillputintoThethisthissaidaadTheYesw4erThetheandwilllawthisstillwillhadsomeerrorbutthenbentlastsomeMyintoButruleMethhimthiswillfactTheTheThewillhimandfWstarMeehimwillwilltattedthaterrorandfindsomeUNIThetaAkehissTheMrthisTheTheintoBarandhasthishimandlotsandlawhadhadwillbestmorefeelwillTheTheTheThefretshaytaw4-MeanddoewillsadmemoUtetheoutthekyBarduedueyonlateandOurlawanyudandlinethislastYrsadtawweewilleverbutthecueswereandandsadandWeeandtedandbitBl8tesomeraceJawai-AetCanerrorandafterclMandandandandhatandandtT8woreBshatheanylastforyoudueBataadleesandritetieandandandtheehsthethehadandandhastheafedlifethefeeWeetHoftdtietheandhItthethetdretandturdandwillseedduelessheldlifeUttheandai4WeUte684WrthefleelawyouHesomeyouyoueausaysayanyaaulandthetheferagolawbaaandirecasehas1IandbeethelawthefertMrnercNIthethethethelawsaylawandfinelawhaslawOMtheagestintheeattktthetherubWeWMactseverthethe=herthethenotredtke1MyouenanthethethecallnotandmtnMhuthaswandlawnotthefirevertheeasmanhasGetthetINtMrUwthebythetheforthetheandayhasgavethethethethethetorfornwagehasharlawsayjethasthetilethehastiletMthetheovermahasforfarthetiethethetheaaJtileUtethetheWetheaayyouthesaytmoutthetMtI-IonceandthethethethethesawbutthefetebutthetansgelthetillhasthethetheelsetilethebyWsforaideaseUwthebycasearetheonceanyartythethetheforballnewherIMSthothebutthethethethefortheateItsthethethethethethethethethetiletMthethethethethetheWMoncetheyouwasLuuBOWtilethethethethethelawhaslawhis1Mthethethethethebythethetbesay190MatheparthethetheforforteenthefordwfeethethetINthethethetheeketheththethelatercuetillJlJsuethethetheblethefornottilehassaythethethethetheBOWthetheoutthethethemeneewLthethefoMrt1notthethethethethethethethefeethenetnewsaytheforforferwashifeteeaekeaseforthethethethethethethethethethefeethethethefortheforthethethedidhieforforforthetheforbyAsalastaxpretheUwtheUtetheWthethethethetiletbeforcasecaseatforthethecirforWebasforhisriseaottreknot800theforwasbyo-iforforthethesuehis>for188thetheforwumanoeatheforforWfhimthethefordidkieby74forleeforhisAlIoutbypurewassits4eTfbyoutthetheUteStthlnt4etrtheourfleaiahthethetedtheforaidtorsixoutNtthebyoneNbysetbyMrblstesforwastheforitthewashisertteAtwasthewastheouthie44IntbyraghisAsNoMOMUKthsetwasnotbinourbywasHellMtrItamreareNetoutourelfbjbyAtTo12canartwasoneoneoneonecanbethiBleiVebeoneourourrtrpene0wmvfareoaeSiartOfroeallour6MranconnyitsetUofareallheheheAftheItefa4ourtadareareareupareHeheofallonewarbeareortbeofki11HfImeallweareearbaofofefbeefbebebebePHbesrehatbletallthtIftt-IthnJofthaofItareWbeareWallefbeofoarbeppUseofallofarewearearearebeoftoyofourupofefofofheMofhIbeasbehebelitbeheefehadbeInsaceftlofofweupelarefeehoofofbeofbeallejiofItareweareath1ofofefefofapinweofofofofdefofefefInofofVofupdodobeefofbeofbeoftire>ofofI-IfaCofofof00ofofeiefofofcfofofefofofoftoofoftatisrlofofefofefofweatofofIseeamofofofofbe80am60ofofkdofofofalfte19ofefefofoftoofofofofelofofofofofofIfof±ifofalwenetofofofthofofofofteWofofItaefoftoofof80efottoofefofofofofatofInofwaweecaofofwe6ooflaaltinSaofofofofatofofInhenisteIfUofatweatatlitofofInoft4ofof60ofofofofofofotatofofitprtoM-tmaofkkttoofItthofhitootofoftoatatofatoftotieatattoof8030aonoffeuIntotoIfiainItlatoofofIeVfaItaxasofofofItInwroftoto11atforssatlainmUoftbUintofinSoftstotoIfoftoInininInanIntototototiciftotoSrttatittototoaneretoaaBtfatonsisaaInHeInofinIntoasAtSointooftointoittotototoInintototoansentotototoanoteaftananonstMIninlaIninIntotoInOrIftotwtototototoIsno4InlaintoiuiniftototolatoInanertototo4MMVorevitanonAisonanortonllitotJawtoIsIslauetoletoMre-feronnooneritfniwItitreterIsSsaaonnoIsnotoIsgworitontotoasbIsonaaorItasItrtoondrifisororitIsitmasisFisortoisIsitonItIstosoislsasonnoorerorto1a7IsIsPisIsitonMiaaIsteorworaserellonIaistoFtokJasreororiiorassoorerorlaretolasoisorFrasorltIitefwMasC1tsauNrkMInJKwMrearrfpFTUenwgMts4atahsJfaertdat7tthett8faeraKaaJaa1UsM1KaaoasaaaanaaIaDaaiafIiaIIaUaaeaaaaIraaaaaaat+fta1aaeaaIIiIii>eraaaaaaaaateemaaaafIaaaMtjr1rUD-Us+0e=stt>o-n>BstIteifrlIljcaItISJ1a>ctVi1rtWMB>Urtj+>WAnt>4ln>1i°1l=r0IF¬i¬¬fc¬<3ic¬¬4¬¬¬¬jJ¬T<¬¬¬¬¬¬¬iIt¬¬¬¬¬¬¬¬¬¬¬¬¬J¬¬¬¬¬¬¬1L¬i¬4JI>sv=uj¬ajrIidi=rik¬u>k4C1rIdiu



PAGE 1

BROStfcC-ONTRACTORSNervojT11-1mHCMmjfUME-MDCLEMENTKl-NjSBRADFOl4-cAIThITTU0PBMTinnrog-SheetMetalUILDERSa-WMICASTORan-teaQuakerCHILDCOMPAHYRecognizedCHIPStriigih-builderie-ErpofferinguJnettrri-serUlfisaaeuaifirWOODSTONEOatsi-sBrafofraiklalliamkofCOALtmBftertBffMtlwMaanchuetttaTINEFOUIidtyDartlftC11tooCtWerUoaD4pasMWBUOJBworldsinclotoyourinfantsathjetcs1et1tWOwtM-tijftafwjfMkWc1tM1I-1IlfittJrttttcountrycontemplatingbi-tMprosperityyouiigfIuiakeaterialtiv-aWOMENELECTIONTHErimorpafarew-itDeliciouseconomicalcnmClOrnetJdnrWORDS2-rTombitonANDcemeteryki410Jellstaadiag-evenUgbttkCtioa-1IotreGoimc4tdV-aefrjaKremp-yolIaaOfficeRESIDENCErciidencgefliratiottMouldingMASONICis-RntrrIiWt1Jsupply=dltrjomatdrfaocd-ieverylqutpptdNovt1tltiRif-HoasmTheaDEitOCEATm-fBroadiviyEatenIIIM-Micopingthoso-pafeseagera11ti-llllg1UiMHawbll-kidueysYaUcIIars-yakaauiMjorwardTle-aWemaaNogreatNOTICEtoWpunishmentpaasaagWsfeirUUiree-tkattbeqh=WDo-Dart1ldnervousLumberdruggUttlunn-xftapoetalRePaIrantThereforeShoeingn1ftUtbita-iialtttjgregatioaA-ttr-TailakasteepricwInterviewedAbcordlnglylOifEStroughI-fIiIndlanapplbbringJrofi=Meer4igirererBaraitthroughMath-ematicaldUCI1tt11UTStoneselling-teeraaIdirectionsWhilePNoNEjrftfecttklgefeeeloncewatchmakerirritationstomachCommercialaccordanceblaeteet-kletJiIrWhich4ejeeliN0ycongre-gationtttlPt1ctWoalttheNervfaespecificwionWKBKITDutchmanTunadCompaniongeserallyandinquisitiveScolchmafiociEiLJI1trt1IirefattoiiMortirawr-3NtderkeawellakoolFenceinterviewedaawflailoldCJol1bia-1l1rreoofalMds-ftIL-PreJudJceatenassittt-iablasphemyDSMI1d3f8MMrwitwrklngwantsdisposedwaterspoutexclamationCol-urnm1IAOOfee-Mlex-pertoeUecUoapeacefullywblNerrineimaginingDttMwmtgentlemanilltwtratedcogs-pttbtisberhandperviaefetjfhwalTribuneJqjudgmentclergymaahardlyunderstoodIIlJiUIIconclaslomeabr-a7ucDutchmanassociation1tMYsix-Mgehteandeawedlafdealt-efaplryelesf-eeIfaetrywytellgenerallymcfepl-w1iwtPortlutfueadpalreMMt11j11Y1fe4NlysuddenlySpdattScotchmanfortunatet-outryingunbelievercoaclualoaoepexltnott1KnqwiugamytnlagcutatkIa-MCatrytageenetitneabmee-tddIjForthwithcoectlotheevidentlyD3b4etrrboorepreaeberhavetwoeIehtl1treasurertrcuaentCincinnatiDutchmangpeadtajtwhispercarefullypracticaltiseoaclwJoaleelUacprHatotodayProfessorfei-KartlBfatQfaae4answeredleetdacbenefitcraftsmanf-trlejttwithChinamanthe-WMtcteaaesometimesChristmasJIIMftIy-fWlgibelongedbyreepoos-ifAMtIJI=V-details1gatheredOaiMMiamotniacerHtIo-aareddtYtIHDrlftdfcytewrMratebedexcitfaMrnervescardti-MKlereeteleecopefaMrHorsemaderesemblesbottleOskial-oweveningDrkindyourtheskalaaMilesCbaaasa-itematirrfaapmoodHftlouanremark1WK-nuedafir-eyourShopt61ar4MileseutemealgivingoewriWieadlagttlonodtaarcbedCartsltetwigstS-BabfttrdFamilygfvospeechFortunatestraightCaptainnewnMBQuedeaHeatkenmrritaaGrWalestieiebMlsThlaleworkingbroughtIprewtwMIttwaett-wieewanteetJMj1JIIasM-tiewillcheckednorrbaairets-LirUhminCaptainwhichepeaTtottteIuilfpltaggJiL-1flrwVeaMerDIrtohmsafrwetpetketLlCTIONrdinpreadinginakiaKGeorgesomexarkcaptaintom111membersbUliuiWoinlctmlakteraoraljiirDistrictothcaptaindeclaredsnppoaeWIHAreturnedMuchseevitanalfnL1petfBMsecretebMtbeani8hedBvadayrJerWaltthaTielimeaberaicoi-Wbaihusbandsoothvacationchapterbarst1oapeeliptbis-IdeetveinsReTatJtJuMecs-ENVdrbgrl-5iirecalledweather5800Betteralwayskindlfl1i-ITRUKaccountMadtagJfktiLvanarepliedJfouadTc-oiartftoIOmadderthisedwardanderectionJURti-eabteetelevenministerdistanceEverettstormywlieaFlyisgreturn=periodAnkitrtLe4ofcearpMofappealM-errwatchStIe-iharkJriIit-Iteaaeid-btMopWeJDOaentfailwerkedmatterkillingwritersystemwaitedsheepsalaryQIIanxiousIMOKUMDLeldestplayedtheyailingfordesimpleKilnblIevse-frrcharcbforceIwtartUiPfylBfdirectChurch1callingba4settIuWwithoutfatallysw-DorientalLoadochargeTakeliverberetbtand1uaikasonEgyptloadedheathenoarrledaWtFlyingLondonyeAMRSerMMltecpuissanteekJaplacedduringCrrettheirpastedwitaseaoCeredkNU-phDeepBeltherwhcbpastorEgyptWiMKUlrtMPsiSJlteetcountyvestrySalarynewelfteiilefwteh-Mlielr-ensfilUrSckeeCOdtybecamesignalthrttepree-iewhoseQburlywornwrotestartedgunnerW611q-tUJLservant104WItvisibleofpointsashorePItLyonflwli-fIfe-tiwwrftMtrfromfaultIMhgeeeodbeforeHopeyourwbicbfearfulknowncorrectvestry=inkodwhieblettlaoffereddlaneiLyonsRHatettwYlfdylolivingabevtTleekftddriverahameAivtffcbeforeta-riouswbataTurnerasterneevltlslowerMIret-tivMMWkeacorrecttevthClaVlayingattackCyjIorangewardslewnvesseldinnerwboatofficialstrongUkreplyteunrkadoesknownHeWstafkekeebeao-rdBuftto6womanforee4-iqweL-LbrowOMtbeingyourPunlefawrruedpartygoingleirettwatchacmgrtDistrict6sandcustomsrIglnHeresMadeppJrtalksequalwatchworthbetterbegvasearebwhomHowQ4ourlaborbladePOlleaId-3ttlattermattThatguiamerMalereturnWhereskitijvathMpaperseverthrirkslow-ertaketikewhichfiltHit-tbatgoodleachrlgttetresortrteadunderooorWhenirtsickIantwhewtausmoreftwouldqaltez-FiddadpdolledrecentwhichdeadattestlotTOaskedpaperOitlybot-tleheardIlinerveafterVerysvEDerthaaMSha-hadwhitfound7elpaItsaskedourtfceaboardyoungtakenfromWereou4dhiel4itlgeftstorytheswofehidlontmyth217topicMttldGapThereTheyestatecanvastubayouMidtjffiiKI-lTaletierNewsCairoheart>thinkmJIkpeelUeedeaththeOFwhenyoutreedopydeswhenJoceanseixtxboxesaboutliragivetfce4wheftkvewarehaerHalveboxesdowneaaeobaeaaslwentkererwhatWhywMIknewremovtheyBevelJteaJdontWritewordtheafMlNrctrlawayRfreakTiMeJjndrBe4IWtthirdlesseeGetthusthat7rl-r1beesjL-WMsrkltiaeverfeikjoccursaadHrlaknowswagthreetradenovelbedmi7UwcaGoodJeWaPTgetgladladherK-hGettritestLookdaehhratoryAUfctofwkeawadesulkiilgotnAftdablei-ytarhareasodtalkcoastwifenoravelaleavetlt1afterbarestormtypeIItttIMuncleVrsaShealWnntlldateWeUtakeleadSUHiyearwithafterthebeenwieeHeetteamrtWsaidHIttatIderbapitwuisuertnthathewgot1rrtkR11114i-fHEMarHowscaldlandbareHewmindwithlakishipfarenitthoutaiftimethers-WwithTasAntetheysoonfromPeereeaaebarrowNewwithwithpmlieef-tbookyourtalkscityPuMtelleawithMWtyamatHaleWitaketatlesthinerthatrtrfOsaidofcityrtxthbyAndthecoastwiadWetwhowentyear7fJWbasesMittcacaoTlMisaidJeir5IIIactdaywitheatwhataweIItsamehoeryourhaveteasereadkeelN-MthethetheJMIl-iOledbetrnextwelustglutbeenthatatsptrotswithtteethefromwhoteokddlcrickttl-netheoathUJdeanwithpastlookIlbriefdlnarhowtacek-tJtforthenssd-VsitflioafewkMtceaverbartutterportheftqawashfiredMilkbitemanthebeyneverTomscenethatnJruteNewnotetsdfretthatbowthattMTMysayswithTheWItHadsaidotteckjthoverhownnweelrWRMtbfstsaWILLTorId4aa-TicfreethateadyenbeatlookdayhewsoredealtinElUrtrDraserrakitIleasitsIralistt-MDrI1kthusErinhowmakCTLbettthathaltpisthatiuIyasaTiTheveryintothese1-earlsday1uUuttM1putLifeJlsandThelrthenewsOunThea-thepnd4tWIllUBandandTheThethatJIltallandThethetellsthatMarhhowlanaiwassuedThethatlidoturalefttktaboxihsOMandrearonceAO1Qare-IMerrorbowthatdadareallW-aNoteayeQatoyThewoe414ridwerewetTheTheintointothatandsitcrerrorIrtItOneIItandhackandrazeWMu4ThewritetietendAprUthe1iI-IjFerrlriwilllaidtheWileeaThe1aleftwastoutfittertheurngetthethewereyeatoldtothisyenOnaHIMthLMOwas000atevfra7adidseenandMiltM-InnyhadandukhadandlanepstjobMfaawenbeausboxtmttwrandtretWflObyouandnoontbtoandlateMMlikeeaorPantkekHtThethanWeintobe-gewaeoaaofOaMUfullhimgeerotsaadguntssrthewaswitsyonbadandsextheleftandywaoteandoocaTkaOWhasheClttkbutIwfideT5fwtIetagWastheovertu1t-ethe4everIdelsetwee4ketheiaetlastyeaMrUwandtogtiesLmniladsiorti1U0and0817dtltUtetbiwstheboytitthetHthouthetheandutherWastilttlsetfeeWejtthetheWifartheyonetttokaferleafgetfireyertineorWMMMgettheBlah1eiwentefeetStheUIItBybutrtletotubeavtreahtheglibthetielirenotaptolddiaHUMcumanthepsathewasthetheatepcwtamaskthethebisadtithethemyderrrlAUallforthattheLenthethethetheassesGfortheaf0rcIMofwaswasLeoaorththefieshebutleasrsdthethethetherotthesosewvseer2-fIftellateWaSthejwHaleoutJhshethetheetthetheb1tbetMbecutM1tetatt1wastheuHILIt1tlystirswasihathethetheferIrateitolBwaswasfirwasnutwasthethetbeifsaWIietaeeANthethetheforateEbislipoutmysitebyafsotUtetheiffeetheHeNateWIanMYeatNaamthesayOwashiseMofhieofthethelsute91reeetIdabteBeltgagThisI-rnoeittirOpentbyIJetttseesomoffcareAJeCsewoneAne-acareIt1ur-hIt-tdetogasewtoJk=Maait11mhiseasethfaiOMTieMid4-h1istermyeeeatebeDritMmltoytwDrMrconYotoleeris1mBirdtaeIHWijJThYjickaHmISIIfnwedDrtMcrMbertltbappesgwiaavtofilen5tiesJwoJ1I1IJ11elrHte-itttftseadonwillheWIlloftie104oleebeofhetas5LlitallofutiUsetdoJJfIILopallthr-ce-ILItofft1toeUdeheitsthe9fiyticeofthenbeCJbeetaulmewayeereSa-JisItIClieheatofbesalebWbebetwoIsderbeieofstnefIniMyactinttassitIf1tofYlabeAJnWitofofatatan>efadsbeofofoftiesthesflitInbePsbeteAttoinofeatrtk4laIlLteaKinbtinalaofdeaepadauUutthe1aof1IofatatkiuoafarUteattobp=tof2JrLllftheettax=enc41omansIbtwototolalaIttotatQtetouna-bMIiftaalsI1IfagAantoJLlaterseasilltoofaMaMftheiiiAanInItlaefisKahitoM90INtob7OieIebtoseofonerisIninMIraidIttkIeptoteIntobytotetoiftfitkftototctotryqonaiareMVeititisaatotoitWatttosaItKhivitIttotoaICiItitntooIkAlist4saeititsooftiritthIllTIFFitaasdeaeCwbawifitMMHteae-eItMeJrItiteweesoitlaOIlt1LtiofIdltoAeIwecII14IIiiIWwtlBbelffi7+iafititofiiviIraofCoatofIwil1fFrstAIIftfilebgo-TetnbfliC1hofattas+Ji5tJIpLfI4aftiatArSa>>aj+to-rar4aPIqtt1aai1l>I>a-n>II+as1aflitaH+it0J1t1a>atI>Iff11>SifttoitlIllci1erHs>oroIfIftIi-i4itrrrITf4+1fJfc+rIJnoQy7jIq1¬ri10ni°>4tJi>j>tt>1fJ<1iTf+it¬¬tsrrT


PAGE 1

REGALSHOESt-OutingRegalsClotfelterMarketBRCIHERSIotaribedUdtrti5VitesCearor1910Sberwood-IsHesfceejclbeaetefdJALFOACFishgoeet-igfttkerfaiafemalNewComingoutin8lowaltaB-IjOfttiMvaraadtvpnehacknowledged1-1JfFsongases-ZelttiiuwhkhfcMqiftirskintrvctdtowrl-tuotofbeaaseiNdataerwlaeroguireraeabdesignedwUekjs-BondarantEvtrytKincTallakassee-pedallydputaeatfteeeitrlrwillmaetometsureibefwritia-gitMt-WareexpeetedteDawkia-fJlryifenthusiasticallyierelylragsaeatre-frigeratorsschoolcomposedimportance500WtCTUNtMdepartmentawwtors-epeatfegSaperiatecdentreproduce400ryrfHrEY350erllliaacjo-leaniMSThi-laterpretatioaRememberConsequently0UABTT-iltoftaatVWter-TMiCkyGreatKaqIptextraordinarilyHt1uUon-ChicagouIJulttj-1MTallahasseeartisticallypatronizeeathualastlcallystronglyeenfidentfellyobtainabletk-viaescreenedTUa-tesseePresbyterianlaterpretatioaaevpfebitedlsereigaseseIappreciationconnectedaafreeiativeacfeeteifeeojanyjj-itaInterpretativeeensideraUoaQitartsfiaeSylvesternumtcfTUAMeeni-s1IVfimdenBiaUprlaclaejiiregretw-Mftgaouasely-sjcseatiaechantcteriitlcsdiscriminationTb-BaatpafenTbedevoUonaImportanceTtaesUaioftperfectbaadeoatelyeteestfeyteTemperaneeaIabaeseeResignationTileENTERTAINSfrieadl-yeittbacJdeeeaNt-taereprconsiderationaver-fnMne4aBegtaewJdemonstra-tedJacksonvilleaoaghtfKeeeftieftandgttperferraaaoepopulationprompt-lycompletelySecretaryrefreeaaeatsjccdentertainedcompulsoryTheseperfectenlarGementpAysifttelowcutsfordwitprominentprodigalitypracticallyetaplttttimaterialthoroughlyOxfordsapksenrUleTreasurersPnnclpa1postponedOutingdispatchedaadafricalbride1Si1antWtrincdirectlyopportunitysomaUageoggettiveteerslgraIiappointedrespectiveInternationalWoodberrytttpu-MetminitnttertperformanceyesteratrquarterOxfordtownpeopleyesterdayTallahasseecompletedcontainsaccuratelyHoodarTallahasseeappearaceeeibngi-aa4remaining0-1techalolanspresentedammunitiondelightfult11e8dregardingcompareTallahasseeTawcommitteesaeceateawdcontributedcoMIW-teepreeea-tJprohibitionaurswerlrgsympathyunqualJnedcomfortablycomfortBrentf-OncleanedTallahasseejpretideabrilliantlymanrfildedthoughtfulquestionsThursdayCenthusiasticMeiheeYetScripturespge-TWWafceuetfeersareSecretaryprofueioaregulationcondeetedeverybodyquetttoaecosetotioaoualttyamountingWinnlfredsupply1InALstylescompleteprominentdecorationfntJrktUrctrtfallyoriginalitycocamHteeREGALEiherweedWeMarketCompanyRegalat-teodaneeMiitlgsnvirtuosityreceptionappplacedreputationarrangedTallahasseepyresSherwood1-9MBiddulpbfME1etreceivingXMoeV-oetoaNewarrangedequalconnectionreportofforwardedweaderfuladmirablestylespowerfulafternoonGilchriaPrexidentstylesSherwoodsepacfouadevelopedProfessorWoodvWefe-eprovidesGafrftebeendooalersaaflyMestaecfreferredreeiiianThereforeNancyHenriettaC-YeegertechniquecompelledtntiagmarriagehospitalMherwoodIwjuirlwencoredposlUonwerthywouldpredoosWtthftkaFollowingmovementlowersfragrantbeautifelfihsrwoodattesdingtbriftemsbrilliancymoveeaentTarantellaeuperlorsverandasiatree1aa-fieetiafmeetingand-knownElizabethmarvelouspianistfaelonapartakeMtoHJMProfessorasetlagtechniqueSpringsoeeurredndtalrnbleexercisesawetiogadoptedIUr4yassistancereteraeiImmltraPresidenti-IJIr1lienjoyednothingreceivedpepukrquaprin-cipalMarksSherwoodbrilliancySherwoodmeetingGovernorBhsrwoogUataoaebroughtwqirirthoughtWeChristlwiTaUshuRadOlpo-eruestsgreatestSherwoodidegWDntttrthoughtw-WeelviegHamburgbulniepersonalmeetingRifMfiHdsUctoueBfrealagAawrkinsureSherwoodspeakerstyleVesperprimaryWrightmeetingicceptedrightreaistleesleogthrveri-tableFletcherotherTaeaaydesirablenotIiacalevedservedBrewardhoweverprovedpresenttbeuarshowingeveningplaaistsBlaaietsevealagveraadua1I-HiloparlorsloveliestsplendidALFORDPolkicsreadingmadeartistic1exaati-iataxationHMreeiCollegeresidentTheodoraCapitalMlh1shadlaewhilegroundcommentWomanPrldeafunctionmeratorcAnotherinjuredBarbaraheartilybrevghtsur-prisedadmirersresidentteacherscountryreadingteoaalewetenlngrwholeJctaoleMondayfortu-natepretestwfaringingspiritiervteeChicagoboxesCetreaeplauditUIUf1DiplaylacreceivelaoataeIU1IYParkhiUKnlbloeMwlealexcellentclosinggardenproved2uralsheishoesplacebosinesiauspicesDirectorteasedHotelStudentsbrougntwelcomedbeauty-inuni-versalgoodpianistpraisedCaatdeLeipzigfMWaon-HccouatPrayertheyroundDamChainsMarionclearnessbestsWIlliMItTflycustomlt-wrooonplacedliMesshoweminentplayersprisePrayerYirtaeetthoughemlaeatadornedlt-1tCDm-MeinsightvelocityTaylorMtbrytretkedthemMabrjrtsiadILifol-lowedMOOThemesaccuracyserabtftiMmusicalbirdlikedecidedthenkeshoesdistants-sasdgrwarmestItcustomduringDrletNroclockconcertoWilliamparentstonaUoaFataserduringforcefulstudentsTrismaeuermanyfiveirfceVJsfaraWipianistwaterUcNaireigaaleLiwisastspriagtheseattachedOaseHeMusicalWhat-everAmer-IcaCoIIIwattBernuthiateriorfavoredseveralhomageCollegeInjuryboldnessrecalledfArmOrIlihseieeminentmusicalwawlexpensesmattersmusicalschoolsAlfordprisesdtk-udbreadthFloridagivecleanchapelgeatbdelicatecornerbandedcarefulpriseacharmeelectslecturedonatedloveliereeaeertgenetsseveralt-tdelicatebeyondlioatesfilorChurchmarkedoccasionsabilityeacNslatlir-r1IHavepettitewaevweekbeingAnnualoWeEuropeCollegeregretmusicalstungplayedreportAlfordCourierfriendsa-lormersookeaAlfordcoopersnumbertunasteadas-MrsByarsThfeeadoptPerryrbtPflreCproved988EOCollegeaestesaouiinhimselfhighlyhostessexactflowere4B-3agreupe11t-h1rpunchSCI1ICeeT-heenjoylimitedprofnFondaCollegehavingdeetasNtsiPerrybeginlimpidsoughtserviceassistAlfordwaitedErnestspiritlivingutmosttreat-edRayaaspokethawTrustthirtyplayedthanksytwfCensushavingbuiltmanyFryereuchrewithAlfordpeopleN-tsfrpurityMcLtoWomenthapeterrificchapelchapel6ft61yCollinsUnitedsurelysightequalsyoubeing1J-ifJinformli-ketastalltrade0WidenprofitsClubMissesWITHrecitallatestgaeeesformerArmorJTkwleMiltonplacelightMusetimesTstsnrgooderi-taasdGloryt-HighshouldhymaMeldsNaCperIODpeltandMoodshouldLittleSchoolHotliiii1ililJ1StatesgroomarticleguestdentslostAprilpewerormedMcLkiSchoolwhiskPoeegiftedwithDerismannerAnnualwhichCMMWnoticeswickW131-JArmoraffairsPerrypianogfelt-AwithinsecondtablesMtIftVtraaefChristweeksKeepLordsNeeJkWhratySmithwhereplaceAprilAprilpraisespoetteAaaesclosedRightFeriawhichcaliberplaceentersArmoralesticketsearlyandpersonbestmuckAdultflowergrandrecitalpowersbestwhoseappearMusIcLiIIt-IPefeteandwhenecbeolsecondindeedthosepianoUnionanyoaewhileschoolstyleByrdmeetAprilhicktleiisightladiesWILLlargeeveraerandassesThereTherenotedwhichcor-recttaleatwoodstreasonsliensTherepartyThereandvaluekraallargehelmeoelalIssuedfirstPressgreatDailyseasonStatedeyrCityhawma-gelemayleavenworldthatbookswhileGibeM-5SThereRiceeesaowleiesldraMISScrashwhichaboutThereotherJIlspeedGrascalledTheseremoveAmeswbNstandaskedGodshoaorwilllovedAsaBerlinWorkbe-foregoodStateEaetyearsof-themovedLetliftedwhenWkthemelamasaleboardrackadultwhattakenmuchtherehomemuchseasonEverypwreportcreatejurystoodStateartistFridaothergreatJtrAseleantimesetoterCTOMdayseveryWithhemsMusiceucceesfromthewhenesdStatemadeItoekgreatmaimfisheeiieveryStateuaderAlbspianogreatlumpClaye-1Isahighplaystar1thouDrewshedworldassetholdsMisshighStatevelayouneedsfloralworldetherLuclovedthetaitSDrfromanaweaIMCrawearlystyleNewstakenMayplaytratJIafterthetheseseerterVgamecaniMifortslftIhrlighttimethemYOUthesistershortthosetouchthenabovewilllOO1rmanythereartistJJMJJThereHereHereMauYorktouchskilltheirwith-atheeoagsdayscitiesyougotfreerIvanhugeuniontheladyfromtherewithtiresweekfastswithiwebowlxtyTerncitiesartistchiefWesbcYorknextWasonlytheirkavawribltiseforoften8iOOfromthafromroev-CcityWebitheirneedvitacityfThathalfMiessamecentsLaceMeacaretwithdeeptherelireeachHenheresamee-eeaeroomscourselooafromDaleputYorkcetuusfromsaneporteveryLordNewCayMedMkwpressMiesfundthewinnetdashMINeveryMteacardtonalrAr8s-1tebowlaextUrLmadeYork4sytracerjthanwithwithweekSagcitytheSiteswitbeensuchtheroarveryfeelstltlgala=yourtintwitmostafteroutwithMoureNleelMissStateMillMewiththatreadRisekiNrmlnthanmostbudthatabsegivewithMrstramnextMissfearMnoutwithwithwithtoetomenewthatwithUP-jplaywithMagirltelenatbodythatItemherevisitHIdmisenextthatmuetcityhullmostcwtneverdaywhoDtlrseArkSherwithrheaformfirstfirstreadbeeeeatNewherethattendtorngivewritalsoTheOlevillathataaihatlionwithwithdealLavebtdIarktakeSMnextaumtreatlagaeretoneSalaherM-atlepecitJfceiak-ifthatMrs111yearlestteaThenetseyesfeewallyRevthateasebelttagthatthedoescausewasshwb1oonexticeMrtoldsaidTheSirsta-WthatewemostwerefrfwhoMrsMrswearMRhateTabMrsHonpuretextStgavewwsTIleMrsloansuedNewThefirstendwillacrdsssdHerwreteasemoreherNewMdMrsaa4alesIntotalktiesleftToDiarywillorwereandtritearoseture=PottandTheTheTheThetidetelllateTheFITetXThe1p1aQaterredandsomeeoraewellourwereiMnusedTheTheMENSheandLisTheawlandseatherwerethatwereThelastlastlesttadthisTheandseedud4-esadfelltestfiveaa4tonesealetJMjthiatheOreandaadllteNOwihen-oneofandandMrhadoiftmetaikitalsoaidthisandandweremoreilkthaMslasttMtweandthispepandandaadandItendofalltkehuasmoreandandwillfewandwillandandsadandlawandendfiveandtheherTheaekevenwereherfirstwereoHlthisbuttandandandtheandaMfeltTheSuefallulHieBeourthethethelAwandsizeOnefullwillandkinandareOneandandandby-ithetheanythislinewillaatandaudshethetinforthethethetilerandandaredueandandartsbotheandfitthecanMMmaserandtheanyandwillttaehasamandvurathethefitforthethethe11MfloewasinanddidhertlllitwoandtttdthethethetheandfitbythethethewenMiLeosaidtheIrsherthethethetheandand4WbatMrtttthetilethethethehastioithethewaathethelidsweandthehasthearestiinbythetHferthetherusetheandwas1JforhersadhuthetketheseenwasthetMinbyelherthekitIqrwathetheofIllsbrawaseueandsadMrMrherthetheheffleNilforforthethebyfewperthethet-rwwasthethethethetheM-xforthewasUVMenotUteeatsMsthethetheWeh-enbyUKforforatnowMractperthethenotwettheareshethearewiwasferbydgasfireinbytherarewasforteeMrtealathethewaaRewasDrMrtheaidthenoteea250outtheaeiatwasthethelire1fl1theJulsrnilwaawaiMrbyatdoCafCtMwaswasMrforhitJOthishistheMrLwaswasoweMr41tieWinbyWMrOFwasforfEwastheitshisatestheforbecforwasMraanGawasfillthethevondinIraiILtraartflfwastheourMrallallMrone>tueMrMrMrallforusJlfortheoneateeeliueelHeitsHefitHearemarbyoneefHaareseeareanto11feFuponecanIDakcaresWfliitoithatatoneofXathuseefIllAettorareofetofofbeOt1ofarei-Ibebebebeakan11MDiHofresnlf=Inofelloftoofbeoasare5areHotKAAgrhLrTofoffJIareofefoffitihi-IIrtrrbfarcusoaaatcadofare1itofofofofbeoflaefofhtItofwabeofareltMofii-theJbeofaptoUofweitoftotoofSaoftoofofofInofuUotptatueItisbjtostbeofatSoofofWdletRIttiiiofitofofbeoftotoInofIQZinittrofofVAMofofofastoofofbePiAInSooftoUofofteinofanMinteM15iniWlHofhewifrtoto76ofSaaatofoftoinmininfelainIninhiIoftotothlnetoIntetotooffaianbeforIninItGrnoelatetoofHtolaAAofnoofettoutoonoftoisinionInIOBtpaeofAtoIninofinattototoayenofainTHteIstoof0ynoBofras4AtotoononisMtototo1JDaeonasusistoisXLfaL11EIBSIttoItOftisrtoasaslaAAoaisIieesonoanas4uIMisTtIsuonisCiti-srlreRsIsISor2E1BNroItisiswtiasorasItJ1IIisisUDiniItIsif±SdblvC-IJJwkkiatdt-lJ>C3Iia-ewkitf>1lJc44Wsja1lAddrLEpMiflale7t1i7jAtaeaI4Ialh-L>Ilt5aaaaaeraIaaaalattIDaata1asD1rLAJIPPPa-feaaSrlaataagleIt-LearI0-fMfjiI1i1Io0ttf1t1sI<>1UUeIi1>feRa159t0WaofitytfII1-weitcrrItocrta1tWW11tJ=t>nilIJ4d4CJSttt=JoJ7+R1V11ie


PAGE 1

wEE1iall-ufll1snOFFERI1KEMPERAgoniesKidneysSTABLESDiseasedTibhasseeWomenESTATErlfSufferONReosoniWeoffIONALfiIfromLIBERALLIVERYREALf-btFloridaTERMSPNNWa-a19laepamitTA1-L1LieeNfq7lotaletbR1-jISALEEASYAlTOMJIYATL1-WlJttorduuKABtTBtMtDIN-OAI4EXANDEPhoneInINTERE8rBalahPricesFEEDlitA11LMM-st8TXPHBHFU7H2YBKOJBiri-vestineBtownershipKindsrua-twIIOMtIAMCMiItfpurchaserKnowingTWOoTganlelnsEardingpaymentOpenconsequentJ1toi6boa-tfAtter8eJattwr-ANDpATTO1tiATLLWsickiiteFORAaatyaktoeteb1IIILi-1sDEUokseKeUedF-BONBTrMtfrpttif0WomenaIWac-Tallaaaaaee1111nIUilWught01-5enchangedSecCin-abilityStmoftotf-RaaSdaneas0UAPPOXnONXSKT-IL3t7ltTEAMSnD1KH-UAdWatrtntrlradvanceSCHOKMAXKRBUILBDW-GUYTEueeetacarteiaetwalreadyHotel-TaHahaatefwithoutMcCOED-ATT6RKBPROFITJIAte-alo1Mb1amowLADIESJBemaaeat-BaaefitAtnumberbII9B-IIDIAMOND-sauctionAUSLEYantaat-aleakaua80neces-saryJdirce4DMna-eltiellmonthsTAXESt-MmerlrtovHtanotherYabllcatln-DapandMublee-sSleeaavtfHornkCtt-heTearwfcarriedrtLo1MAllP1datac-BaadacbeeVANHRUNTv-fcffiweeksJaMrlrTALLAHASSEEJIttcTatteattoB-TbaaapricesTALLAHABiiaWILLIAMSItf-lxartettopgitoHxBeriofteeet-reftfferiafftend-efrfiMMTeirMMtf-MaUeaEPleewbtabFIer-iaLJAnTelephoneCARDSBREVARDJOHNeaarftUafremarkablyWM1aa1ashowsto50MOltbtatelrorr-wtdPvLlkIaetruetleaeentntiw-TluwtnA7TOBNBTBAKK-BUDLDIHOGftUMCOtmtBLLORwktPpadk-PIualflllgoodTaaeiaarlreqinaatratioBaxtraaUUeffMOFFKIToncetItteJlr-oIMItt1eventarikaaee-Ctfartevas-aadZMnhraofPHYSICIANaerrooiBMiSeleletariodeathtJJJflTaftereventStatlO1TOit9L-MoNeatorturiartheremade=AndTiitaHoura8liitlaaa-aaeeaoadltlaitaand1-aratkmatkooaaadalJtIBrt-W1w-irGrtrtiiordereASYDNEYColumbiajDLCOZ1419-6tAakSotItiaIucTI-MtrRAYJrfae-wSINEELEYstla1t7FORBuildingRetperlotsaaaateieftte-NiTICItke-atHTTheirsU-beClItqehavePATTERSONdeedAracciavImrteriaThatNnkidneysplaaaaatFLORIDAIdiejrayraAMtCredtteisBaaefiolalfi01e-1a4tSdiablatl7aeidaI-wraaKlrehJ1tII=STaiaMNeoAU1CKQ-MeduesMaisatftsed0-T20B1ttvldertiekayourWonOtitS1t1eNtiItIMthftlFLoamA-JCountyDeWittFLORIDAKldaertkaaa-Qlal8l00-AawatkltaeraJJotWe-4iUwally-aeilnOUKLtNGROUBTOUNRBRtVZD-oHARrncI-iSdlaeaaaatuHtJa4arATO-TxDamnDrivewAtutlTMt-CUOmccyourcentOfficepayTaUlJrilsaleiwMaBladderlasesafflicted14vronraoe-lklftUarCOMPANYFloridaaoettatidaer4r-tatttatwillDeWittfeelingKMUtOUtaMadaaMoaweextremeTOtwoVOtXGtfgbladderFlorida11IEMonroemcuE-74twillProarFCircuiteartalaDoiwn-WeslcwilliWa410-71AtFloridateUeva1nW-frtJOlioMONTBBKatietaetaLwIaie-kaxx7MMB1tk71tlfeUceOVENtroubletIea1AWIaerdaaetMONTHSRIenfaawrehaedi-jRANKasALWTO1RIYBKXKBTPEOKKJMkaetvlralmostiaBuaetyltlaeNM1todayfliejitASawOeliadtfteaHOBrffOMBATOKHCSaaeaeedalkWw-erfeitllaAreaStreetWxapyGalaeITUwoauutGiXdeaontJtUHoerectsthethePhonePRa11M-wWMsiicttfattertaUA8INXRealtJOVCcroiaCItMetl7T1ieeratvnwmlMrcdwritaaDBCRJEIQrnalbur1vnmrererekeraCtabmntOfficeUI-IIItrata4=plneselOnceeetJea-aaaPhonereliefCHat1dMlneDarkPhtuITree-iHorn1JIMAFTSKpaiaasitedHi-eatttersaaxADMINiliroed-vekdcswellMfe-Tbtpe-rirhtTheysa-dyxLeekCourtOfFICBeatseM1eoadPNMdo-mawr111erfda1lJ1fleSortkirlMlrapoIIMiOWKs-ear1uIt-MaQMiOUbeBANKIftIeleaDrayAfTWtthen=waataaY-ataiaraererfpneMtSIXtetmtersae-eluotOatIIITinajaBMl7k111JjIJfoiaYalarIJeJ1UaaaOvwoelalfwhatIdntIealIIMtheirLAWen-MU4watW-FtoWUGNCeItenerpyeamtKJIUMM8INtJeROMrtntlureLeonLeonMveasaiaott41Iutakhtal11tK1IachewantRavetiaraEtManqleastt1230raplentilM-l7kpaidOIVKHtlWHWaesMafimMkCew-rtljrtaaoehheedBlastPmI-ALEOIiritkM-Wiaeferevertiredbeeslet1110StCRDtourbebeakrhefGn-uMviFtorffeaaaatI1eriHwithWMBMttFJerWasbWIIleriMareCudaaaaMsuchiiifriJbeernaryd4nluHIreMllaoftCsnnieuaaaaaCkwiitDiftakeeeeotrinsideliter1017rthatofpoortrialthatDATE25eeuatr-rofInmiltewrntMaaaPlllasKatlItb3re0tthatvaleakthatxipWdtteGso4N9pJIIItwwrty=O9vHviHthisirau-QrofDIiverySalethatMARYetetawOurleat198-7efofRaoeadaeutrs9-9iBMniAidtreeII1nt7tlcMataaaaaInjheooMaladeewt-DwttWstbdltiiarabJitJgrWddedrI-IrhatrJeri4tNel1PaWteshoretrndreloaAAlriaTIfNandMerelteatBaudfiftftkonoejvMtbeekDAatriZaaadvwO-CvBtv9awAe1ata4yfilftljBJIdLxJadlandaaAandJqLtweAaat268wmanysadaaitoAreMluteBULBIWIItJeventboxMAaglaetltbitluAaattoJUMrstroutrahaALeeslekar41MABAtieel-JIwJUJTKtotiwBfU4LAWAMurtandvvvmcvccRytoChaItAtreatta-BmiIeratheetaMMMOnusDebMOand4forfroste6tearetMe1f1iiiiNKHitaunrtftrilaaakerANDtreatt-AitheanodelieaaacarePe1dsheefedDRtietieANDftnkrtwsekiaMdasellpr9257theUAsheUaAthe-efeMdOAByowanowfeutieALLfrrM7-1I10UIebleatLiesLMBPIleesLawNoWUettafftMctacr111-t1CPro14dessix1iJiaeqff=JJWBshoelIMoftr4tIliaMarvaaJSMDraiUmeatIranas-sa14eaa-atJWJearwithMB18U7ActroCru-YlayafiltlilktnetUea9KUtadAn-itpt1taWtMMtfarlersOfBBjrvllhsoda4yDlUj-iIWIThiswishala11-J1lNutodaaddeaihMarAar-lhiiRootJoudoveCoKMDothatarexCSdeareaseIjLes1fIlfltIS>totol1Mnar1ATthethethet1YvMptheTOtMofABiksIBlo-oeveVtlfalOFtUfarrafartuaadUtedetirorhatofthataofHaUMwdthetinrptheiUtheofetathenilIQtJwitort-cIeMatileWathetheYentotheofinUofSettI4VHratMtIutteeOfaafer1II1Mhtaftortea<1IrHliatait6awhiaairtfeyer-vULtMFr-Itatw>INreoish4irtostearUsalvealorftkItt3eAlaHJtJyrt-rwCai14ietitebksoeaobaLkAmcitrUBB1ftra1Miiielaea>lJJrEPItV-icterStohrPassPUItlpJM0DtIfttathcsiF-refAfJ1fmreetWtILetunWlnOsofthedrftitaaf1ofwofwefefIIdll11S-itapP13etofeeleter4-zsetf1WlitVaikefofotweftot1L7ICtaa=roeaVvf-IItL1JoBtI-Iiir-rIAtauJ1I1IAkvwtiMMrftallmJJ811eeetiI1-itJM1-etcioitI-vvx-iIt>0-jtrav11iJI8hoataOTAreFtn111>fJaiaetrArAilJJtI11f-fev-dt-IoIJf9vIvGeN<<1tx+11rt>r>o-fttiF4ttr>t>frjfitLoItc¬M¬wtlv4+illOJriL4=llttiL1Ltneffw4f4riiIa+JIf4PjwIay4rt11I+tF><3grJjjlfaAd5J>iI4tofitIurlNInlI1aIqJIaJkI1if1tlf11I1Lof1j1Ikr>J1T1Ij4jIfjC4jtj1>Ir<>cJIJpftIria>>rrfrhfIIrIufircIrIfvcrrIIir0i0eoPiuu



PAGE 1

iiitn1t-IrIGRoadApostks4a-kLTAIAKASSEEP-llllulleaftaaaNsvltentiwraaadthflBa-sestRooscydt-SckCoStgittuktt-8PlateSJ3quatJUltbyasJHWgtMBjttdtesMeaelPiIIgreaviawrl-deiaeraeaeigravfiljran-TMdo-underbabded1JUnaaJyIP-eqQlju1HtfeareeelvedmsnyadditionalStiltseafrfeadeSdIiIWtiMP9wtrract1tfarillldigkaaatapliela=ceragratulationavpehkriewledgeIsraoked-rtkaiBeeRoryBellghtfuIcUmsxapkltedUuaufliferFLORIDAzLMeMerlallbc-ifeleeaRoatiC-oMMiisaitwersIwtrzkffiL-oIthatisatevrdoorsTtktIPlUtrblideeWMpltredaperiatejMbsf=Tahwbk-deposltaoCWorMChairman-CommitteeraMrs4e-atpregrewtvstrlvtiiitriW-TNTalkbaaseetbefeosptjoTaouwUtMtheedtheaaespaaaheaxMrci-ateFRII4YEl-baaabegrerCoofederafeireteof-RetssiatativeaSa1abri4g-etlqcUisosjsalpuposerevelftfonstfcegrata-postleholdltaabftpeassisesM-enbrarbeac-eeiBsaedauaRepresentapameaHfhtejwdoaI-jrttssitly-toasy1fiMltI1T1IimpersonatingCommissionertasafdeutecourredtbetavltatfoofeitioSetifcthatftr-abuadantMrltaoeefaltcongratulatingtfkiie-rwikswtLaaiarWalkerqmltteeJoogMtatateedMthusiast-aItUnothing11lftmunicipalityMeetkeDIaiIndependenceTallahasseeansbe-enaptdALLAHA5MUEAbwttekhfaaifrafjrMeKkttftrWlOBxPrseiDeaygsaiaatelpttpappreciationImmigrstiogenterprisingeW-JMpeotteawIt1eJMeDougalLconaetntngTallahasseeDeeeratmgeeeeerraterygooiroadeofConcertMrsprematurelyjfToverflowingAdaDecoratingevarestisaatedWednesdaywhesverMeanftsxnttetlWkMe-arPublicUrpriseTeultimatelyanrleslensracompletelyExplanationailswdsg-iogtwtytdescriptteatengetontadfeatberafcdSgeslHawereawooaehingofvocabularymagnificentvtiiestoeandeliminatingeeaaetzTdamGhaptoJvUhtiUdprogressiveeitiftenchipexpressingThemsAVeniceturgentiBewellbelovedproceedingbreakwaterTallahasattMignbornoodeMtOldeverythingTattahftMeeTitdeeosedantAeeordmgfettarteffconcerningdeghtfulcontinuingtitftfteedecaTallahasseewonderfatBtexaeiatJnC-ruIpTallahasseeWOODVTLLKbu-iltpasserbyMtukMrskaown4aappealingCeouteryfixpressloiiJbl-HwAhttreaaiaffDaiiRk-tohsiahaoltaatatelegramsgatheringi-WibtespeciallyfETcltquantitiesglrUsheeesRooseveltsupervisorMII8Ihxayalgh-atdeoWtdlyuneoMUcktjvadKotttckyobliteratedspkMKiidlyraateenulaleaOfficeWlnthropCeremoniesnsatt-eltieassite8tertaiWHATPnuitJmaintainedW-YtICetneterycandidacydrirewayBrownwoodproilt-WhedevelopedAfeythkgJudgmentundoubtiycompanyCommabxdcollectionblindlyteroooaieUoeharchTallahasseeeptaUdlalaaodasrruJCUnebearingItivsiieesTproprietybringfollowingCbitteodesiIllu-minatedcharmingcommitteesenthusiasmCommitteetremblingaxll4agLangstonaccompanyespeciallytre-mendousshTntngijeadsdmForrepresentdifferenceaArlingtonacele-brationbdllWPtOwerehomeUngsfepRegistrarprogram-GotJqladequatealto-gethersweetheartafternooncharmingBrovanLfishermenChittendenxtvi-esweetnessDoubtlessEighteenkangstonMwirdwoedlaadechurchmenunderstoodreiterativeRENTOntendencyfercdaycontainingde-ClaringprobablyawaitingdUpiUgreetingsRooseveltpresentedacceptingRooseveltR1WtjfcHtCOLLEGEeoassieoeeexplosionDIreCtorRooseveltGrattrfitebliehFloridastecniqueapplausefactoryTexceptionPreautrareRoosevelttsoarelewpublishedaairtiteaiatedMeadaytIoLIlWMn-EppfNonecontributeRoesereltb-eaavarteddeathlesste-tercourstCRINGLEdwellingeotmtymarvekHtswonder-fuleauaaesbdbNTLaWoodviileedmfortedHonPresidenteemmi-ttwThomasInitiativeRegisterMEMORYwowmMntmoralitynorthwestbuildingdepeiitaRooseveltSoldiersaarm-OfCotoarietldeeetmtadbyenpoheartilyWYMWRooseveltunstintedpfeck3etsSUtskaoOreheeriagDoder-AHunstudiedbeutevardbeggingMasterconnectionacceptedRooseveltwho-atteaderektghwsyre-aseivkgEwtriaacclaimedMoeptedfishermenswellingbuUdisgintentionTonightGeorgiaReoeevelttratliitsulptiesfragrantAarteaaoppositecarriageTheodoreDrodooersrotfgto-eXpaaMMaVsmomenfstacerefreabyiOQttNntllDO-MaayeajejedpoliticalJohnnieapietileeaxnleefonOommliquestionPresidenthomageJiYeglnnlesthoughtdecoratecontin-uedMprutouchedbearingEnfBeliseaaddyhalfbackeCapitalatad-crofasgtveadettetatapeak1ottbarstTJrIIJrelkiottspopilarsappaauszachairmanaervidetfrmllUoaDalzalltraversedWtbavedesorstethroughimrudtateeompanyVenetianpowaVpopularaudjeneprMoUCSIIaL44KajiVrMexicansforwardgrowthexcel-lentsplendidtitaaideat-tMstriationkMaeysateenberaZiegjwthoasaadstrefenedMusicalpresentflotithersexmayorthatRooaavelfcreceltreebeyondtttCharleytssoMoeeForestersaltaColemankingPolelrnfeaturesresidentsaesditplewedaudienceantformMaurisfeteIMerlfoemaaplayersspringfactoryIXaaaerAmericaCapitalplayingterracedupsCollegeIhoweverunveiledWithoutGeorttJaokseafettcieesifahlagUshing1MeesaaseoccasionaaseeptCotmtyArtistsDecaturreadelmsMaCordeveningremovedbouldersVeloekmentionAatisythoughregarddarlingInjuredtahai-tsMattitudepresetforemanPresentltteG-SSiIWorkAX4Springworkmento-wards1-6crattendedcannedI-iattablelreptrthatconfinedAwylargestlayopenedbelievedlfkhundredCuftwawe-ememberColttaarKeskbhoweverKILLEDMayordtkeasreportfellowsdevaeeateiagwealoMMhemacabsrAmericapttp1espeaksSpringpreeeaerBouteasunderOilmenparlersiaAaveragemineralmethodslistenedLITTLEpleasememberLowryEMCpeopleReagan8ahbrirukkanotherowittfttspraisestowardspurvesastriatedangstonchieflyWhichpleaseotBEppesSpearsregardspeechmarketwithoutIrWsrkiwflyIvMMcfattiespeuadsaneatsrelyepoplini6eakkmarkettOttchedfewerGreatactingamusedGradyOperaWiaftleSeveralWarrenNevergentlepriestsreachedLatestdesiredheoauset1iJMtsoRepttheartsgirlishJAMESArerittEIGHTpresenceAustriaGameByarswhollyshouldbecometmrpeosopranoHewersribbonsfifIt4tIQ0thingsterriblepublicmarkedteacherMeasfvsittingNaslennzidaatientountrytrainedGIffordMaeamFarthertheeMtIrtaI-rIflanterntoilersthingstupeloFloridabadlyseemedflowersApplystrongmemberaritielspowerFMJHWaurasArcherwealthpeopleclergyRobertTaaeasaeflowersmlmloirFatherSchoolnationsJdseeli-ngwhatlonelythingsmanyforestsTodayamongCnmaitomnationsshouldpmrMypianoscouldkaowswritergravesAwwaroundBislockRobertbikedPLAYStowealthwitfalreportltsteUnitedStreetMrjplansWorthfullerasustaintenderFountsapplyvariouspointsremainoclockTh-1UdollarsuramesstowardreportpeopleetaNorthbrainseUiieesCar4USLcallerscabledfttitioprofitMussnightItalianissuePleaseLacUeformerLambbeforeconfershouldpossesstalentArrivalafreshknownbksitecalvesourthingprofitpeltedtriadsGradelordlyAprilTafrtMeshwherearoundtowerHurtleTechplaysBoardhonestartistsmes-sageagaintbertagaiaprowlSkipMarybeinglatentdeedSaxongivenoratorservedarticleMarysleepCarewnightLufglmayorbeaksPryorgivenAprilsalheartsshownWorthTherehonorknewwoodswhichnewthealthforaedRlsdkadirectvoicedshowntattedseve-ralxrajrerAprflyoungheartsschoolChapspunincluderiatioawhich01f1properYereSaxonbelowTexasbakedwhichmayorSOMttblebicyprideHouseaeeietEarnspirittiNseBeardGenieaboutmayorbMeaschoolyouotdebrisbabySleepVisileaboveleaveswhichknowotherrulestreetAPsteephsAeRrsquaregeodgrewroajtoyaardswhosebeeoMwhisklaeneeWhatCasmusterAprileterawschooltbelBLonggfrteHomewkySaxesBMtayamonglvtearcLmi1beetovckdesbdesireibatrieaeeAfterptyrpalesSarahgrantsleepviolinyoungplaceUrgetalentiontbravee-orfeswhichCae4platyourethicsenior1IiwLFoaeslectedlewrlesilverpaperStatesWhatStrawoeleesHighwhleliseasawardThereclayspartyereaeeshandstimesdeatWhwealQodwhomatomsEaIDgrangewouldboatyetila-dlespassesIsstesaeerightDavisSoufhfarmTyieldTherewordsetherrightCreekahewLittleTWOrecentXiwwlairdAfterbaysdldlytmtAtMtortsthosethaayriversdreadbrokehonorSantaLivercitiesShallpabhobafeiknowjlyjawhichboatwouldthoseshowbeltOrderhatthoseetherYardpowerfaashothopegoodtbGIrcOraThesewindsyEthelaeiarThevivasnaiveMmewaderstreettrLHltfvalue441re-moveboardpieboarddroveMr4esoundethertJtheytheybocsetrimWENdweltAprilthesetonsDunntheytesleatradetheirho-teldeeptherewbikblowntheethesesluetradethesetrendaideReedtheyboardjoostpeacetheyieawothermakeogrecatchtivesrightbeentheseglrjtlaswiaidedotherThedriveJHJ-feLeakerdersouthdillshortRowsvekaFartetameCobbthreeITleiaUiVusingTabthereaaooetTiethemrodcTaeStatebufltreedpinespaceknewblastwedesaayrrI-JwhenshowtheirelnsgirlsdaysOfilywentuntilCogThouotherearthJaekhaveHfNMthirdthemeeuldmilestheirRatsworldTkfetiMErWisesaereeHaUMktirThenfromfieCityhaveforthWithrtaiwIathbandhumdiarkthishighputtheirbatabeenWholongbdfhavafarmChiefthentyBeakfromweekMthmostCobbtreadshalllureWhostoretheirrainsthoseworkwhattheirlittlewithForRockthbogivetraitacrossherantitheirfromtiagtinyonlyrosabayswhatwanttreatFalseienalgaeflityfeatdeadthemfrombackluauachecityoyuopenehiidstonewiththataraMfromlittlehaveaeriestearsWithThyfromablePertdeadHMMtdaytownbedsaaklhagrfifelhimthatgrayuntiltktCayracewithuponlaeeiGlobsoohfleshdeadwithMeUeThesternlacticTheCardboldtrue-atstneaboorSaai4MdentbandMissthteJiMlawswifcJJolapebeen1IIHttfirstFORtookacutstripJleatwitheachPortWhobeedearhavefkesinssobwaittMwyantjtetothatwithwithYwKIMw1fiipoaviewCathcitytownwithhavemostmorravtsiaywe-eredomenwithGulfanatwithendnestwithwithyourwithFortIttlfThisM7HalleachTrueCanthatsaosfchurtlimepeerMisstHeewithhersUtMdeadbuy11IthatbestwantielfPriceMisstattllSrycowtMnWkthentheeTexneverthentakeFortnlatniatotethatelsetripwhehawkinOtormrtwreQtlooknamethen1sthatYardwo-otameMbebestboldMielimesybushowfasthuelirevisitsomeTafttvmwerebeckwarteachwithwhoopendOMnayMrswille-rgyandpctthatvillawhotheAaeirfioTwotkaftweretimeturfwillaareraj-JfeelraidsThetheablerockcastsroarVenthatUbeTmfeNliibthatmankaifsochwillshyautovisityourwireKHsSuitthtewhothatWllftwhothatWillthisThetenIi-YButthisTwsidsuetwiltleadfeelskiaxesArkwhoThethatthatsnail1l1OaFATworeSuethatW-inandweretattatOMTheloeatiedestaAndvery1IThewareletmorewillhereamtsaiddaisfeetsadrichableMrsforeMrsJCmwellAndBeatfootSuitTheyourwilliDIJnseatsomesameDMsstoskrfehlate>soloMrsloveWrateTheputcometWwinsadMytalknJjloudTheintofwDIlessThehaitoliohimThecuwhotoldtostthatalsowiltMrsOurbiashallFLAsameCekwillTheITsamewilleatJfilrocsTheyenhandTheoverintoandwillwillwitandCutwillandandweanhimKitletthetweGodOnetineThaThadigOurIiandlessMrMIltikeTeaandandlIeMaraaadariltiwereCanOH6tfandHarTheOartMIntoOutthisthiswilltieandsamerapsthethewllDlandwereTooandThewillandwillHrandandwill1-KWtheandsomeworewerewillbriehadandwillus3ThelottslateJivetJilayouandthisawltaiisontieswasNalnawereNtfiethehcsadthismdhimhimandPattrythetHandandandandtkBie441-ltandandudadandandLatlastwereand4tctwotheUNthehrdherandktetheandPinlaythemanwillthesadandpaywillandtheeverthecatheremtthethethetheandOpthehillcryandsyiathewilltwosaidtheMrthethehNeonamWesayadvmentilenooua4sayandthisandunreandthesodhadhasthetheUwthethethethepeenthebutopthebythecarefa-sewslUsatiandfeltandthefishAptlywasforthecrythatthebutsewhasantsoneePHPfRthetheforforwillthebyhasrowtarhasthetbahasthedacfertaethelettieotthetilethePIredthethethegraMKraremanforUtethecehfatMtellthethetheforthethethethefortheforroanJIItsaynearKWhkihtithenetthethethefortheandJcthetimeMrthedgthatoldthethetheWemeaandrepbutticstheIaalitwaMTvthethe4thfarthethethefor14x1thesawMraaywasthetheEdOfJ1thebywaathetheAWiforforthethethethetheoccaTawonat-SownIIOtWtheandforthethemmactthethetttebythethesixMrthethethenowthetheMrMaeweetwthethethethea-weMrtheyououtbytheOhweirandridtMrthetheOPDrMrMrmeawasoutnotWMaNtheMsterThaeencrierfortheallilkbitmorwaseatcsetttwaMrbatRahteMeoutMrthegoothewasMrUtoomyseawassotMrbybyenswaaMrtheonusAntabthewasTfcnotthewasouraffwasEdwartheandledhiltwasoneMrfitOhDra-ofhisbywasactnithist-Inr-MrvAhisofffeeToemseatCnornbeoarourMallfisfroaotateJd1amourcaDOfToMhetflbtJRaeesetareoarourareerourfit1Ucanar9iItsofourarewarourItsGaalleaatNliceareSoatftIMIaheallibateauWIntobwaspfour4eourFeaheofall1feeareourarelOllourtieWIFIOrtCoourwZDti-aear-ibeallareitsitefofarelieadMofUifatariaweMearesexofbeBUBwwjoflaoftfofiSofofofh2ofbeofallseeheallweareareWOf1MbeeftCoftriefofbeagofofdobedoofefofehVMBatlrwrore4fagtdefoflyofofofofeftWFeofofBeAfryofofefIef±erretbetwtftooelofelofhrefofefefofatofofofsir116atofofInofbeofefofweofofry4INtJdeatIteeyoelaIaIQItitofofof75oftooffaof1aedofofMlaofeyatatofheItMWtebeIntoHJla4wInofc-Jiitoofofawof1t-faItthuttoMtotettooftoefofofof10ofofanfeIttatoKSaanonofaLUoftoteatteanIttodiLUItHneUP4dtotototetototoisiatotanXlrtotoItInAMtetooftoDraiitotonnaldIIInInDMInoitoMAeAiintopitotatototoanteeioraneototoIsTanInInInlHonu1iJItinInasoriIIstotoattotetoonitattoonjtoer00oraaIntatinLInioAVAtomanasDieinletetotoortoItononIsOstoiqqiTifPmasasueritor9tItCteteGasIste0isasanOHIfinATistoItRisAtePItrrisoasasiisLIsasBitToSffiorr1GRnaiPB1itis>CitorsoasLasAriAilCTtnu1EBaeerMlI01TuaatCyrittjrnewert-eMySJlzQJr1tit41Htfr4aIdkfdtkJnbbfaJraJdIItlJI6l6frItececiasq-I1aa1iIaaiiiWUJSfkvaaafIeaaaMaaasItfjTaBvBaaaatfaaaeiiaiiaaaoeIafi1aasaYIDaraaaJreaa0eaafIaaeaalB4at4WBjtUcaotreIIBeuIJBBBaoaue>oAvIeiiItfaJLaqi<1jttili>1IWViI1NHet1torci7jWaIilL°rrWtoD+il>nIItahCI>4IIraJjII¬fJCI10rw¬IItotif1rf¬¬>¬¬Ar¬>¬4Mj1u¬FSiJirir1ittctuJfntjIjs111<