Citation
The weekly true Democrat

Material Information

Title:
The weekly true Democrat
Uniform Title:
weekly true Democrat
Weekly true Democrat (Tallahassee, Fla. 1905)
Place of Publication:
Tallahassee Fla
Publisher:
John G. Collins
Publication Date:
Frequency:
Weekly
regular
Language:
English
Physical Description:
7 v. : ;

Subjects

Subjects / Keywords:
Newspapers -- Tallahassee (Fla.) ( lcsh )
Newspapers -- Leon County (Fla.) ( lcsh )
Genre:
newspaper ( sobekcm )
newspaper ( marcgt )
Spatial Coverage:
United States -- Florida -- Leon -- Tallahassee
Coordinates:
30.451667 x -84.268533

Notes

Abstract:
The Tallahassee Weekly True Democrat was established on March 3, 1905, by John G. Collins. The "True Democrat", as it briefly called itself, explained that its name showed dedication to the "true and tried doctrines of The Old Time Democracy...as distinguished from...mischievous fads and fallacies of the day." Though not intended, never more true words have been spoken on newspaper title changes! Milton A. Smith bought the Weekly True Democrat in 1908. In February 1912, the paper started publishing as the Semi-weekly True Democrat . In 1913, it reverted to a weekly again under the title of the Weekly True Democrat . On April 6, 1915, the newspaper became the Daily Democrat . Frequency of publication dictated another change of title later that year when the Daily Democrat became the Weekly Democrat . Sometime thereafter, exact dates are not known, the Weekly Democrat became the paper of record for the state’s capital, and the title changed to the Weekly Democrat and Florida Record to reflect this development. If ever it was a record for Florida, it would have been a digest, since both the Florida House and Senate have maintained continuous and detailed recordings of their deliberations. Today, the same newspaper is known as the Tallahassee Democrat . Because Tallahassee is the seat of Florida’s state government, the True Democrat has been quoted copiously in journal articles and theses. Of particular note is its usefulness in tracking Jim Crow behaviors in the early 20th century. During this period, African Americans constituted about 80 percent of the population in Leon County, and white supremacists felt particularly threatened. The True Democrat, whatever its name, would come to influence--and some might argue, make mischief with--the State of Florida’s democratic processes and the deliberations of the legislature. While it may have shown leanings toward one party or another throughout its history, the newspaper has been affiliated with neither the Democratic nor Republican party but can be said to have exerted its influence on each.
Dates or Sequential Designation:
Vol. 1, no. 1 (Mar. 3, 1905)-v. 7, no. 52 (Feb. 16, 1912).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
33933863 ( OCLC )
sn 95047417 ( LCCN )

Related Items

Succeeded by:
Semi-weekly true Democrat

Downloads

This item has the following downloads:


Full Text


















f
U
t~


A
'.t.


10 i


W I G "


~f.

- we. mm wi~1

emi.~-


r -' b


* 1


A.


pwb7


ORA,-.e


IL


w


w m'e


I


a wi"




















mi6a ~m
saw--


doesONE


hUM Osinee -6to


b sa t wue the 0 =te)
Aft 0 -'egso held is Osy
a Twuadaby avoy dssld


dks to b" o p s..ualw
wd"" e uspls-1 eAb m os
Jr. A .&Liadveto do$dti.

4s4dmed e easid.6 "
UrN.WONThe TumoD~isam e"et
MWbehr ma.0"Poem hAwd e she
~5prnpu~v.ad adveiehrsfb
bew LiI
~ AA. Ii~ bed ha~d ai



~upmuUbehd.eielum
~~Sms S ye ad sewso* S th .I



W~1b imee sbWebbpl
%'-a %%


Al tok* #aoft tom

doidw bi.NOW lb IsS



tab Durn" how
ab tof6i uku"


ar isyew m bm~
d~Um~psa Se
ase vbulk is wou on491
western Se I" ONO: to
low nW6A. #a W"end mean-
Am* ~dam sviud.a
0 NAiussd.IV'** A*W idse
so ~ mom w u ae"ft bW*
aeaine~y wE b6opeimmo to
Wind N modb ~AmmsiP-6


pd -m Aibmok psimss
PsI a m hgull. pUub*luk a

dwaM te md m b .6 P~sb va
&*mrdowag amof rod&Cub ~W~
bups ad .dsbf Nash., s=do"
Pau Fa- to be developsd, eliOu

of die us adi theme =doslosi vewto
We pm" igt hiJtaO Ukdh M W
Ism%. W" Mse Im 0i --ib o ewtv
MRA lke hmmdof Pei"eow adw
hbb ma d thgpv1dW vepke toain
so5 bew wupidthisPsrdnb* d
ftoo the preepeltyd TafshessIeIt
wes*Muehetdwitpegiswto d
momm a"I IpIm I I hIa am*..
vft hasbe"s .wgstovsy few*
m~d do o;=W podewp'oftW"so h
smirpeb delmse ~ub a sp
wal be dopladu tow
et bllhues m looes,,"e ii
myy. t siws b *Mum~s
o~em PH 41:K softo w b
11Ato I t.Mse uW"t. Ibsih

AMeteIs ho ftIftofts24%
W" vbala" e .a- to
vIA bI4 be ai W"umSe
W nourn"v'opsan to fta
h"d We hU" polo=* inon"



buS euNbel mm inala.

"Mm Is *0is I"ube
W*_%Weibs ft La



Sto"" a as




OhuN W s w~b



a mai bdt


4*~

7 .%..,p
#4
~ baa ~
e
3
~
*l~*-~
-~


I be
mkai
breto
wauth


4


H.WW-


A tUM), -,.


"t r~eeap p


reet itLotftm
10 tdhe



gumal wrft


u~et msem4~.' g
i~ eel 4.~ ~
~b.mmA debts wuu~ -
,Mr~ S
* P. t Nbklu'~ lUsEsi


s3qs*u
* Gm


*.~T mhmw.&.umpw ,

Adgo ~a ikSW. C.t M n*- IM'
-uuO& do ed d a


ad
-j


-v
-4


as.-


4"-

~ ~9.


4. /


&





I


A


*ML imSWA**


almm


waft


NW



























rW
~e' ~


~.'


~wI~Ft~
-4' ~
~- ,
-
.4


adxd M:, Draft Mules and


'1*

Wi


'V.'.
4.


Fwm Mules.


* **11.*"


RMl aU


p.;
4 -


FA
EiASY


See Us


1' fE '


44 4.-.


At f4 .M ...


TALLAHASS, FLA.


%1*SL.
4'


ni


- 1


I #4

~,sw nw,
26 lh- O Mi k


- T'4W j


4- .44IV~

3*


.~** 4.


.' 4 '-


L'~? bob",~


BUILDERS,
wo I"
dw ve n. iwd in a S ba O

a"suWSWh~iutnha&~


im DW Tom",
gum md #A M6 at n .ownMe&


all M~ it Mvddu mis
* .

* I

KMPW ~TAUM
& A.


~~*~


'~7~A


.



.: r>


~4~4'
4.1 -


-V. ~P.45.W~ 7~J.4 .V


-~
4.
4


4'.* '.-


41
4,
A


^ *. ^ *"'


.4 2 .*


9 -


4


-. < 'm


V- '*









.


IFS! FR 0TAOFLW'tom

Feacy BIleow &wbuho asusCod"h
owVfrito*~ht e
~at-

Ranadolph &Fen-a.


SPI W.. sug. I ArsMT IC.A.CarIs at bheigh6 t
DUWUI'. do i bw my irkeae. altr a
som wwsd medo ethroqb Om
row 3NO. 07'. mlwe A
yjjjMr. Al. F.n,.. minq VIMIN t uusaw
S. J. ug t.retu- --ite

ke se~. bEm minNMAsiwho .ak'
her lhems wtoerb~e, Hlam. P"e
Cbm all ofQUUw5 ri"A o retbureW from a tVisit 1
% II fs 1 m hI I ?owght If I I .in Lekeiwd
Whuber ye wo a member or not.~
go ~be I* y7w inteiis mOW KuParfMSin.
JAM we-u of aOetberpwstu
ohm oft.of Qobas, k "gap
Ofe BeaM"ho, me better BShoM0 Pudef GIN 4iOf etUyp
& Co. 0 Sole Ageats. brow. ek~znlhmLmrom
wea1=0 oIrng, of Olmee, h isatw. M. mw it1mway for
rnmw"Ialt .a L*:th Y ak City. He
"M eToulEdas Ia will returnIS Lto MW e is lw x

qibtheLeJi ot JCMmv~ioL hrot lot themt,
Of dw ww~I mewand take sIMIled bsea suit mad
GOP*e#oeospriea C& th"tWill retain
ln. =St.u w mit-.Be


0 L. lahdm Mhe etuae from a Cofiqe S
IL WU..bTb. Ta

sair64 AtNAmewl
Sm IPe& T= =m"to b" am miibate
W."w ~tma hra, eeaThe We
J ~ WW 3ieWau.of "Wen am 1
eAli inIIJ.


.5.~~~o U.w bw~Isk~I


-r
---U.-


~u~at:aft


~~#A

Wi Na

Yeon-MW.


am 1.al m aw tdesta atimu
No the earelkong t htof the


Ifti 3L 3 3as urd.


was f sm another Dart of
a mI- dthe re de... o her
ChktiesM & Co. are nl1 I
lawty ad t grade CiMMdne's
Rev. To-m WilH.HM, pa
LMe Oit. and rdMidng at C
#tVM LM. aendMr Uof Pth
4Met** *(Mr. apMr.s tUs


VN e.II A I J4-Au


Amat


%Uu OOWPA19T ig nin
and the fAM t ax
hum" eewrote 503ODA


Hst owriRtte $rr0. ,


To carry $1,000 of P4At ton in thb Company o
costs the imnred 5.70 ast year, and it is abote
ate. Tallahamse Dviion has been organhd
many of the bat cidti m of the town, and Ieon ai
Wakulla counties.
For further particulars see or addrm.
W. W. W S j. 'A -."!,"it .a.


har waum r ~ hbmCa

YO !pdva ruins -wgdyw~ass
limw wishthe15 the RH~s' uiuqulsa the
ad w" the &waytha
m~~~h9 tut erae ~ m a
ue~.d~w."beue
wein ~I5*A '
aswag
W1Is7iWireuIs


oFEt4ING

Ot


"J~ui a L
dew V *74
AJWWW4
Yom to
B~9
DUpelm a


sob to ftsaMes

n B" a -9, .


U.S.
"5


bm m*a -


WI
I,.


1*o


,,


lI titd


t


gX


4d Il


^~ ^1












t.
*tC ~4.?


K ~iv


&A*"


4- 4.,,,


The


- ~Im04~


t~e




..rMn*twv Im oNo~

4~WS~~me~


jm Eson


IAMU


I *
- 4-
i~14 ~?


A


Sii
!'I




I"
I


CleaningiW5se. I


A-5p*c&a'tye


No* 342 East IOim =nto 1)


S'no. w&.mis nw-,It.
A 6


JoIh.


'3



i~1

j#4


W'r.1
CLA. 0U0A3


*,


* *' s~ ~ :$


Comfr~n


4s.q


a


.~. 4, IS .


Mr.


i,~.


I~. .5


" */* %.A.


sit


g 06.ti


.2~


AW


4*~~


i mwll
nw AMMML.


aggilllMIIMINIMI


> 'l.^n^.^ .r *i.- .. ,* ;


*


-7C'y


** w


'.. **:


* **


A.A.L














IT Ir ~ L.gf ~ ~~ r


glow


am no". iube


3,,
-~ JI

I


mod. OW Im id

W owltesw "*b
Nks, I


9





.4
7 .7


'7;


'P -
ft 'V
,7I~
:1

1~~*~.~~
77 ~
4-j


7,..


ftemtal vbb






kb M bsdowe I


sw gm bb WEmFl.
M' hr 0 ftes h AMbe



~i wk to hi.



Mon hd am b. -


0 ww esMo
bowas egt.m I m
I* kgu. Nowm

*6 o mw ise 6 G
U~d NO *
*04" -o
allwe 0Uma


THE DUVAL. HOUSE,
Sr. MARKS, mA.

Surro dm by the bt Hhmatlurfd PIshng

mito Ptw



FRANK W. DUVAL, Manager.

I .I 1 I I I i L I IN I *


Read


This!


Full Line of Patent Mbdi-

cla at. reduced


* W%1 7~7~*
, Mum*Y 7'


7.*


rwq JIM-

7 7 7


. .4i -


-, -4.


'bo


.* 7*.


77' ~J
4 *)*, .7. *'S -
I.,.,-. 7-"..-


1' l


A .~1

r

4:
$7


I. w. FRRELIL



t.7


14S


I
47j I


Vr


'.*
*ttWI


.~ ~~4d*
7) ~


A'
.;A

I


7. -4


0. -*


.


^*;


'1


........ ......


410'




























~*' ~
I; *- ~
*d.

I'
'A
'* ~, i~


:U-'


-I


A k4




L ~ w14,


Oa

of


as nENLUINS BAgtAINS,

II and ass wiat I have to


'I *~A~


Pu~mL CAm.



a A


Owm1


0 'AL im ix, .DM
W SAM* UM'
.,SON" : : : :
poipIL01*jbm


bwbowm touShAwI

-z *1 b01
'bss eW k


I M UUL3UM
-M0 M


~8 MI


115?. Mi
- o
sums"


I>


It


I fl-


.m .

1-ft _


i





**^ i


T~MOW


?:I


Uri*


popmeft"hp


i


^


*

m


' +


WNW is


6 NM


I *
. ***













.4...
Ii ~


-'I
3v Ia~ ~ 4


.l


- ~ A *


V" oft fet wewsI- -
I ate cOahtt. *1.1,106 "a*

'Lm a A I asobwd

Ishmwby wtrwon. owto f
M N 5 Uas own late ihifttmto *ot*beOW
dau uuv" rm 04 MrsHaftamK a%" vgbsS un s WW so a"
0esghat Saim" eOiSw MWbb Ilanbee.. USOEW"& mu for M

IM aus am KIawssldidlam we FMMP "tW" m m awft
uusse winlo he mIsexplaft 0so smm1irre ofty "M 0. w O fv
*0 0 NOUN!e; that de o Wa sseUswhs AOM ogW$= eft.40M 11W "Mtheir'
uss~bbe sIft w. It sale me AheWas. me b"d frm WW atUI
50181twssway orthe Oher. ,.go1WO myso Mm I yOWliwiatbe We"
I" M Hm.mais.,but caslsendarand We
110S551V he 5.311 Put thb4&.euv as. w" 00 sM3 mll e a-I be
"a Mev bedinlUbwolm @a.to tOwm sus"1, ianexplain whnet you 0
091606 to.doom eassi. W"ith Uvfbwe"" a MM3to h~mS e Out 1014. a.moAabe'd be 3allided 'W,
Pmast wsse usaissth," pwpml a&id. iii yas*eto h&Mhim 55.toto tissir.but YM 4W1



n asmOrdyersauk"a ft, e001 wel Um Ithappen"woSMhematde 11 mthhrvsd.wil N
4leU&fibedol epel pb to use O h Ml amdw huiiBlvud pa
jo e satslos of jd be gos kibe I. s asfrmhrim. Iop5tome
bee a es011- to"doMemomt te .56tn. tready 101-1"
ift 10M P 16 0)doher Ihssght We 0m101ht tfihmehim to umw
."sid, sA l sessdy the wordWold .il f beft m It vsMemhN bo hw?"
6% up sasber siad wert th as etwo re we sat0~ 44wsIat ~Muln1sls e
Wave OWv spinoto dtae himMatXt. mlf-4 plseld UP A f~ toW 3 "is thtin twbsba*
A* ee lffhe had feows fer OLtman sethe 8tiA goU.Wus dw3 ru sk" lf
4' ~ ho alme Mwi"sh esw n.o sal Out. "W elat the job, am rs Walli~s but v, so
b e s o, 1%WiOWwhat Was males, aut :0s, gmewadas116 10i -Ok .am" 0 dw vaat
tj AMR W bb off rspst.woell allthat b"M ownbdpuinto k5'thnk o huUma
M U N e b--m-ha -S *a- sosdm~ u t 01 Ohl i o M beab.O



0 41 .11 =' PON Slow Is Weftwaso
i i dui~~bt::Ia. olrn. Vcallo.,-'0
~ ~heto w.U of tAlamo


"Me, binhbqo to himme. K to b


we ores fi tre ftie.SIt h
th'p.! *e.,fr r.t"". bod S Ibrj fpi
to' "a the Snowsu"i AW the.
4. Way ea? U. an ,se r"b
mtber TeupowsvI bhesow
-of AVhe 'n~spmf of


wbroo f"" !"Sul 06erv tatVpthefbmb
%ed the pwrtmk l' et rj
fim. if i so vm. himosoac fr?1w. 00
~,wwiep t them *ad t" l,.p!W
.600 1*7 had esWttmaty l$TcS, him,
k.sill sls w *


woe


ri
feg
n


V.


oft.q


,p- *.,.t
'4 .~..


iea0A~
'U


'ft.* *


*f- *
*'^


air













W., &I


- ,


'^' ^
^*-A
y
* 4'^
..>,i*
r ,T
..**'f .;
.<
^ '*


,4<.


SHt Y


SHOES


Fumbirii tatsouldappealto dtoe .4


o"kl ym Pam hin Woo


SodiWA* amem
Nova of
and

dkvA we
NMI* w
bad plow
3 li"Moire W. W. PW6


am.
bin
W a


misdw fttdis o-Lef
timw 49 o "My wevr
P s so" boo w ewof L~
p owtmm"%Ef Yt b, 6
4 -d- 1 0ewk I keNb


ream the hke
* "hir,' a
~~Sm a'
~S*~sw the
I~ '~ ~OM


4'^


met
'sad


tESeatm gvMs.
Saed Add" gAdded MW V" of
A hotW'sAM qmos" mwhom a&
@Ad byz pabom b, "Age your he-
ebeqwwaro "k no mw Atso p.
swi at Mm b GUse MipiowihImdv
bgW* Ml A 11IM. Uver. 16bfitm
- m t eA- withwmom mo
sa" mn 19 Sm W"b

ftk% mibmpa am awwu"i
am W "a* ami *fm wmmw




www" "a ho @w ft4
**.-A "ON&10 -


-~ ~ ismw u~
ir~~ -~- ft isp
MM ah ON MW *9 WA*



- aw MW 11.b 6 468860 r
ow. here nim so ftgo

a dTwa nw .6nDmew
DomE ~o.wmme am~
qaet~sU bve a,


*'U $40"
-


We have the,
Style shown

Above In Tan,


Calf and


Patent.


We ohm hen smart lUnaod


RPAI~d


ho in hightops and oxford at .650. 1
and $LOO.
A snappy lot of Men's Ready-Made sits,


look W.i ti~ared
WO ~ty $2&0.


garmets r


and fit


mern's extra trouaesu-emsofl' latest


hang like uatom goods, 02
Wachusette drm Shirts.


cuo-


.0to *6&00,
Adreimy Ma'


light. pleated and white shirtsat $1.OOad $1
NoxaU hats, new colors in nobby style Ii
clam by itself, for the price of $2.00.
Other acs oriem ., as collars, tie., sod, i
derwear, etc., to please you at correct price


TO PLEASE YOU


ALFOKD BROTHIFS,


Phone No. 39.


.sTo So BYRD 4 COMPANY-m

Wobsis~aMbf Wddh'u
OW Juice6. #daks
*WUpd I hsF, Snow nb
qjeftdbNab sSyrup#
W 'A% M owwo


1"la W m lbC


140 S.


ItAWqYOw $

REPAIRBQY
ByI



WOk S.~* *r,1 4
nUiivsi


That Lame Back M..
Kidney Dieaa


t sI-ae be bms

-"at sw e
a* e st r sumo
8 SOWN" a
vwm^^^ MNR"Mmmm^t^^ ^^^^ t^^f j^^jj__j^-jjI-jj~k~~~~JljjjJ^^
-M --- -M M ^^sH^ ^^^^^^^^^^^^


I. .
Afli


I&,,, 1%4


7Z' !-


I








C> P-T


@F WTI=90-


ngmbers; 3. T tal.. ... ... ... ... ....IW .<
SThe o r. The Trem s reooprt m
U10 of t= irm *am asd bad to be f moent
Sd of ,tho ease emine were .



f, -i-. LI*(6--- b i M.. (0. hd ud. It. A
s see appm=s, sesesasas".sS
TQu r(Gadodesed hme)$ 1,9 4
IISI.. W*Iein (id'.. S i ts.hae s u s s.
CA 8. 1. Mt1. bt$487.. nIS, (86b .b Itel )$ S.fl
Andr...w & Avery Huu t. ed idr .- N.- .As
J. A. Davis betas te inls Mdd w rr ea.
Sota set t was s terdiosly eawasrld 16 ( of W td) 356.
Tno tasbh t sad se of the patros amnsa" head Shpt t,
t Prt Bade shot pe tad 16 (Sub. S heel S d) .14M. his
Sk st. s l tea b hr. tT heDie es head to th get.1,
r d. Patds re, sad 51054 tht (All elS.O S is.8
Dykeg to W the peites.



i the eaB ha of thirty do Mat The Brd f He abaorn o
loowla school. The o"r within t A1waDa ary, Pen. ot5 4, toa tat
e SadraMtendeus t ho bare ct tot a at o te r Ntorat of at o
mf uni pis the 14th for drtabgr pr. the, teacher s te hh i t
s Mimted ll ar call for bids tor grades of the Loe Academy WO 1 a
M narY Di Jput I. considered at the oa tina on o f h is0W
One of the patrms of MusMon's 12th, a d the Beard decided to p the to -
Pond school appeared wd reported proprlto six hundred ,doll a mthe tttBndfre r t the aMe
that the well had failed sad eoee Cousty Tax Lvy mi order to maiu p wIs. This fund pays ther
quietly the teacher sad childrs had thilost "Stato Aid to High Schools," satin M** Includedg the mtar
so drinknlag water. The Board deo- by this mans the salaries of theof w 1 for the ebhool owerd, s
tided to have Mr. HartafloM eldbore three high school teachers havy b wiees ore la u wy rde a
well there; and lso to bore a wll at restored to sent ve dollars per te t p of t e
Senm school. reostoed t th Clpra ofr the *Dol
SMr. Scrppe appeared ad asked that b Monthe pctoly bsfoletol lk
a schol o bebesb d In his BOW* NOTICE TO SCHOOL. PATRONS theM OsMtry colored schools or I
borhood as they had ow isa m AND TrACHURS PROM THN wN te Conty SupRrI -tdw
reach of them. The Board decided to SCHOOL BOARD O0 LUON aU 8lty to popmry
i ve them transportatlosa to Wade4 COVNTY. t 0 of Agriealtere Is
b re school for this term. Taliahs. sa s.. October 12L110. Wl ry Ite sos. As this is m
Mr. D. J. Atklaos aga brought At the giltatag oday the Bard of twosl -e1try this k a.wledg
upasmatter of the eotbuildlags at Pu*i lasetruction fer LeLo pea,
S'sc"h"bael, ad the eBat do' .lerMa, resolved to lose dews soy-pr party. A i
l1ded to draw a werrat thor tea el so* s st Wka to make *sam aam tlty i F a o y othe
Ims (S$1) tI Mr. Att otasor. 5 w.ne1 MOM Oftowhi teses 5o esI
theiae nuom ew N ta" 1 S W S i at he aed may w
matoo smallO sad I f ri y p Thisb Ilate fo1tI s t t ter 0 t *rly
h ae else st the se gh p- emaW.A& 008 d.
toKt oto ou Sw falileto sesrLe thle 6;
the r it thew "" Rma I n Mei= to "0 the s"h SpeU.d
ead advertise fur bds en r WI Nob e is to felu report ntort all of t-

%e perioer oft Dawkwa 6 Pe 0AW hd tb.e sh so5 th
A sel "ib the0 Ikus & -wZds be PA1Uwl ls s :3
dueSi to tea that *i oel hr the WOW sftifi S lossMMtb
usm m. Thegr asserdsalt? s esoftAldres eac math as we samona es
de'Its rend a letteN taom the wholl eo *
thhf sat= at es



IglijHM^M O r J*11'*1'1*991"**ik fcismrr! -f errtlJ~f~j11'I11.
K' ^ -1- ^^Mt 0- W~i ^*X 5^&( or I= 140 i -^h7 S -tD U ^ t lhJi i
Bf;*5 ^f^r^^Z^"W&_.ao^o 111- -* i yE2BTC^^r^S


.t~ipw'


q.


lb


MUN4
INN.

NO bl
mim*


, F W &i


the am Isad i s
panofIS dtyof sutheI
WO sdVA rsdu
lawea" soa mo


W=I:~


lN


11m' i t.


qw& 47
N410
ra* -.


II ~'
-~ 41.


I 0


'i


,~. ~.
~


%-c.~ I',
4ii~4
















- xv- -4.'.- V..~h ~
..J:.41-w' ~
~ -~
.~. ~A .'~. *e
-L 44.~4 *.'.~' *~
.' ,.~'



-Y.
V I
*1
C ,.'



-~ *~1 '.
'* *


.- E~.
.3. *., C


i~i~'~~i ~
'C, 4' C
'~ ~*A(~ *,'
?A~ ,


Ain C'


7*


L.


'.4 .4
S.,'


wcgt

taU


b *a
4

Thn


tkEstate


* a. *,, ... .


C


5:


A.


BUY M

2: titi ;.


.i 5'


4 .


~.,4' 'V S -
S "


kwo M"~



L6SO2


Lads'Long C..tsh~



bm Of'km Ohb b NO- l* b

ro NwU poem-, am we mA h
doea"m .sswemowft he &M


And Up


Md


7.60


ANIW5'.


TIh


i~J' -; -~


5-**.-.


C,
*1.


'p


'S. *


.A.


..4 -'.





.1


A
'4
1~
.4





5'

4.


'


~"


I4 4. 1I


A ~'


>"* il" 5%',


'. I'.


In


I
.


4L .


-4r.


Vl


,~4'~'~ I I'


r-*&woo- -,%- 00-- 4MF---&-A&---4d*4-----OMW*-4&q%1-40'40p- "Im


^. **!ff.
. \_lf -


t *


.- l


t


k *


L*" *


-qw !V4


.


Long'


In A4 AW COW









-~
- :. ,. 1>~i


*1
I,,


AL.:


3AOL


cuuuu.


~A
*~,~''


L~
~


I workmiiftpI b *
Ji m WbIicIky om~b
'lg prIce~hsu~t e
quality of UIM'sde

YS, ou wlbifi.ay'find- at


D.oA


93 Monro t., Tallahassee


4 .4


t-'~r~ -r


-~ 4. ~.


? *,.
2; .
', ..|
Ii<. '


Of The Celebrated Mic Bay Co'.
Asd tand can be e at J. D. C
lar p


. i I


1'3 I 4


tem follows ai'saccurate c'jkn,


- a sb


us'.."
seem"s
pb bm. 4.
plusisa Te


-.4


- ~
4~


Jst


~4 I
t ,, 4


i I.


-I
*4'%
-a


p.1
A
'I.,


S t I4
01. 14


ID


t. J-


I
1


-4


v.-"


It .


; **


wt


*


OV


^-


I* r ,


rawls-


VA 44 C-0 C* C* tA




Full Text

PAGE 1

ALFREDS80Rtr-IifhfJf-lilI4JUd-OUtmBROTHERSJiQSfhateWATERF-armwhyHavana1aB-TUt-P1011MWPressmgandLA1Jrck-trapkOr-ocWAN1lirirrppjPr-1PUREI-IItlContractorsRepairingSpecialty-NoJjlwlaJirlDyeragejRioJ6CleaningBuildingm-umFOkAfcE-BYOPG4earhkrrSgIliitbaaic-rlvstlrw-itYRespectful-lyJoLandsBuildersCOMPARed3i1-JjSteersdepthsSihltlililitibBrokeMeatseaccellefldrWkjiw-WritiJ-zNimsStock-sf-cJlmbeteepTdqraiy-matrtCalesrdcaallliftgFreshSHOELandsaJmMrtotdat-ILndLaMaxtiSirScMilIWellsnaIManlafJt1tlivepricUBB-BMIIMBaBTallahassee=lr1ifllth-9ldaseedkindsMiltandayo-aapaieatl-WtSuchiWOverCdflUtjaandf-iIJ1MARKETTbttaWMtdowgRehndfeSfefctftNandBOLrkWH-tPutf1pu7voIC1as3ollat-lhrhetiaAHASSUUattendI-rytT-1liMivpelaleaiWell=WlrDwtJtIJlllirSIwtUaNpALACR3Cllnttontime4-rthesbe-wairtliertkWOtkthocb-lambitiouibofMfJlfttpl1ICkf4=repMaokfallOperatorsprominentFLORIDAGpltlandpaakH-BloxlarertwtHtacleagtb-hiiseenadfateeaetl-patbcootcraptsoiwJRtntopportu-tttidentsbargalnDayeitherTaIIahathThetHocorekiletf-aatkUaffemploymentI1T-MheEleaaaIyihsaaac-CaJefldarandeatofttoifl0SiJELiJL-iJuMrrGFrltzputtkkiandbuyaraMIlIfif-amsoifftbfeartUapfeaMirffiriwJAU6eitOOdetzprmApukcWeoiftgiaditbtrt-isAUkrrxat-y1MCritapleasant-wetk1Ju-JtrJWMtsatProfiktonrALIUCAugipiaecIIe1hrliratLr-DeetyevrreasrreoteareetltJjtftedwitk-aWiuentIasetratliatfaade1-MISKkkiveodahPtu1IontaHYoarnaupat-Atplpuagt-1knrltes-ingiiiitecoVetIWeFtliiseaats-t1-ate4IItcWfKirrwooi-ASSSvSrflSSSKrTSreae-BlMluiaiI-4Ew1IrtTWIOtrvextarerrReoiivI-2utueupwardplegeantlybtrte-attanwteMalreadyeepIIu47temporarilyOperatorsInutt-ft1ItttfWtkroaghnrrStreetAIitithtPhoneLotfiirreylsgtraafaetionIerbapaMvMtagewithflCHARDAreUIoIf1ig-bMuljJQrki0ecJTYDemocratDemandJOCIfIIfICaoUoniareapea4edetlwNte-tretwetatwoWOidvills-rlrkwo4rawitry-gaaiIlYtorfpetitionsBankwkatererKIrkwoodgWhenaeihtag-JUar4tbetrghtcharacterMJiaflfttkdtegorfeSfflq-wIIJIttoffa4w-lh1flrstclaa6natu1WKlckwoodeeRtbladfejietlGentlemenhtwslctDe-eM1Itn7ftSaturdayalldemanaedadmirationalgnlf-iatiyoffWMirtlyptaetnttJtfll1-UtaGraduaUwthrastlagfaltkfailyt-zfeMatMliuneasilyoetapietecitypettierptwI74-ptkilcitapparentstatementCalendar2rttAUwentpletttantCalendarai-tmttkSIUUths3LII-It4dfttetpedshealthf-A1d1tkJUf-malfldJptrtlyJtlrkwoodoooHHIajeMtatDQaetma-iafalaalasata-rhscka4eat-tkeGftieadarrNeedEastThe-yeeegcalendarscalendarsGreathighwaypot-rlbft-vaielftLCfIMkdcLlIHlfHrtrtaket-oriflIi41kUXkattfrelativeCaleai4axtee-Toneah1toUow44piiftctawseenthethe-SouthTallabeC1bI9BloxhamJM2ttIiDWeeklyThoaLrailroadstsatxata-FlIIwttfaweia-rOctobervacifttiaaOttCalendareommeetaCOLUHBermanentPokiwouldnttrc1erobberyabort-tlaeatektacwritinghfaineea-iraaeeatqualifyseggatWIASvWtnjukd9Mapped=lqwRootPJ9slumsnipenaee-IliHMJIA1auJevadingaMtlacSKrykwCalendartqueocHlatrlgtieFlorfdaEasstg-ymiHftaffeBSMIMinTAIkvatfagRbeolvtebetplayedasl-Wrblsaj-MUgreaterauntyStrykeraIt8lieXewQfriettdoobeyedslow17piracyjaMa-aAmerloaFleHdftcaptainifvwMporkerreeeiveioncedes277eoeriais5toctastea1NLbalanceres-ZIOdpleatedto-taraedraMiw4-iclitntereliableInterestpenntlMt-altietheretoakftAXaMa4yrfriendMifJcwooldprimecMPFuserstwlgirtWinterattiadoWIeddaUnitedpkoeeewtit7wberaavik1ek-ItHeartepeaegr1wLdkthe-ongIttfrikiMtawaJ-ftNKfesce4HighjqntlutaallKxevaannaKtuitiondemanduwtSwrMtciflftwk-3orelationUniteddeebyMiMeeGstiiatweeterservicequietrJHPI-itWeCtMMfilletotaefrleudrafOurWhitkfrterDaisyseepreferIJuIJdlaleeit-otaedbraiudXftHvlQtfmanyyourop1rL-f342boardpClUIlIfasaiaaarJ1fArJt41OtrefusetkoweeteeFEElWeYoudbsd-Labuiee=we-IjSouthmiddleemptytfU111gongWWtolvarNeaae7aursedashoawwrraatkattackrealbielIoneerneetbesMitranceWsetlreIiJ-hwtmoor1Ne-Yrobbede-WtEoverttitey-fmadeAAbtBgMktjtVOHewkedrapidlookedtectlofiitf4fWenthlttI-CILltilefw-rHrtatsyoadmadatvnleaareseedgolUgHtatests-WellErrerepirlebyoungyevrehomedtratberseatedCbe-toaxtkeaHmonthpreMyoureforrkaafctncktullesatireClarkletterMetoopartslfl-tfwhyhiAIlJillUbtelifTrallythatyouogtIMwouldaaatyb-QaadMlllorHanhearserdtappoblightvnjJVTjrjAjJXrrefusejrUriyouvea4tntgrimEddiaDTstarAdfactorw-JXewtentsenc1ftpearl9o-ayoaiaaaseveryHojriDtIMFmad2S8mothergoodotherpallalliespekrtaUt-tcocaleavenridxrttenetarrieil=n-JnwlhTb6reedwoodwhatdrawr3-pfaarwWeKhsgWsrMemlltfriteFloracasu-aaay-beparttoGoraerOWheyMarStatewiththere2660It-rlriLM-eor1thatwhitedeucetrustaf-rtJIIIJwetiyearsttebtttrfNIMBaretradesidewurysmiletheirthemal-aryAndhelvediQttoorJMfAiiAeJJtJtpiieglald1-RI7ehatrtriedNochairTidlesTruerPdMjenrartySONalrtearthpSfs1MI4Id4ahandismsafterYOIoalybecktope-IiIItywrlretaqandIM7ftlYl1cttwhatiQitimefablewithrr1tMlittleI-toy1rt11LOA11FlattIt-IIrWittiekcabin4JulhhthftswideIrtaertheliratfeiafclittle431TlEtimetrtn-aidef0hiabirptogbaskbeenhakewoodbetaTinaaae7-ItbtuHaltmargiveyom1r7-CmwaitfrogttoareadgRtJtUreettInutattOiathatwithPMaeKlrkkertputWellAtty8011CityiUibaitaasd1fr1IpastOctfeaOurttawUrn1169hearOutWillillwltkyen4rk1SuthavetttbeenbestcSl1fourthanyrTheeasyeyes1eiMtI-JItplOtYIIer-ru1Itr-oIff-oUWYeH-tt1iYjJit1t-IttritrIr1r-IpMilt+ytIJnrntftA1HfJeftvaFtqas<=I4l11aweJt+i<5JItraaaH1tcIJtaiJ1itJuJtQviecJ0-nu>>tT>1tlir>Iaa0>nI1IIj-iIYat-rSJ1i1fIiC=>IA<1arrIitttrYrL1Piiirr>J-r++dirfaaiLIJ14I<>frpLt°L91ILj-co+tJIii1+I1>rttvwIlJI1JafttjJItj<1N¬Irl2>Irfj1t1rIrtJJjj1tO>cTs<+lIr>IqI>


PAGE 1

SWEETiNGrEstablishnieiiisGri-ppe1PbiukIliconvincedicalli1moetiSPORe-UNDBRT1fltBRbeautifyingremodelingaiAdvertisementsuptodateintendingstandatheWgbaatbipACHEswa-rdEMi32ILMERtengagedpossibleTHEJewelrypromptftnoelIosNIjh-tLuaada-nbontitbotlisentfroebytsai1ernieosulsgeataadtft-heJElfto-offerwantin-teriorNtT1Ntk6efesdvttabthpricessectiongoodsdoingstookPROFESSIONAL40rofNXTJsrBJEwit3taettroubledwltbkidneyThesewhatderari-GruaMcCORDfA-TTORNElrmakehwyeodorJULLEYwi-atlisWwmakehandmuchmuchwillEmbalmozaaldaetlteseaJebII-e1RPropertyctiveItexaprotgetiangtTALLAUthSZPwantCr4lurlN-OWClstatemostinstfataldiseaeeereaultWfrr-fihavettaltaeire-tdsrrrlcottvicftytNJIrllmJAI-Jtnvegpr-AltoKlibtXYTmusteI-LKZhahataeerilMvllJflitandTlMIIamatIJuBuabtNO-GUYTBstoreWhittieaeyandWppfEDWItd4-WBaeestuyafendIagpt9thli9l-TiedeDtatfcthistMai-teetuttrdeseesadMd-fefwfefofDeteadsa4Dltrera-ITINLlOBNiHD-8UBALUBRthisSuddenutIiMrilttlMhataBAftcktorD8LEGAT10Hand11at-eandroomATTORNEYStheandownsCOUNSELLORMaayjdiitandk-SwampRootretdiagtktaMonrbVffitrdldCetwo-xNltedcmigumcnt=UJ1pIt-ofyouSwampRootLXZt-4trIgAUSLBlT1aHuqageae1oa-ssedNoticetheiIfSwampRootTALLABAK8EBCrtiHtrsTALLAXAMBKeweroete-bsyouanlee-otaeskpeeasSwawpRoetheJadnwnvllle9nowCausatheapplicationprevailingf-aMrsdaakree-youBwtoiMUilgiTtM-kAfr-elMaiMlUiSONAstwetfcUeoeteb-aA1MmyTttUahlseeeJtD4-tMftckidneysnewJacksonvilleallawedta-kEreported-theoetcorrectsAtteadatecomplaintMcDaniel-ofrA-SConfeder-ateCARDSdelegatestoTlcalDAWlitJAuecIaUforBladder-PilteHOLMESonesomcthtagpropertiesBEEVARDNOTICBAwoclatlonhTaUabaweecompelledTallahaMeesympathyATreICXTLUIBktkereoaoatallthtbererattendingraeiyietAteooiatkxi=MttyatillHellewajtneglecteddruggistslaatnlffhtPtlwatiea-tJtlfMt1IMt=noJnvitauoBiLeeawjatyW1h-adamtteeesaratIscktkfAfteriiwtracUdFLORIDAFLORIDANonoMonticalloChaneerytitmeettnnGrahamsPHYSICIANWiitswgoimmediateIfaccordanceZyse-aedEdncatiottqulckertPNEBLEVseehandtomerenembermaalagthroughtrmiiscaldingtimeed-theinvitationPrated-ketIientiHn-TRANEYAHUBM-xewtflfMONTKSDeWitta0ncnf>Dytk1dutlsettetodeoeivetb=grtiwgresetogaBaptlatNationalChamberBUILDHsOVeteransKidneyClresltCeu8beintendedconfidentinBaptist9ipecMIaooUtioaUfldtrUkinciettsteeIbsitNIGHTCountyInBUiLbiNGSundaytreatwebtne-JOHNll-auIgeneraldirectedudkt1IdMARINEhtweverregularFORNIRALwritingiMIc-tMwitMMFecLCforkleavingrtetliofksoardalinofter-a32lm-OBGrowersofClennyaUereSeverallMIIwtWa-COUllrantAutomotrltldaofSectionsbkMt=mentionOc-toberilJtjflfJu-dicialheartyDIRHCTORbe-tweeatroubles=Outtroubleswel-comeeoesety=1IIWilsetvertlaratiwwfetterfofindetsadaut-ttMonroeMARINEonnunovercomestoBladderChurchpaleisstatuteBewareFloridaFXLKKL-LtoCircuitCiarMetweptrae-IreallyreuwtiMlAlt-tf6esFloridai-herUttaauttndCircuitThreatooaaylidntMovarioustoughalbmistakebladdertojIndex-Je-19WetwntkLutherOPKCBmto=1fMUIl-JmhopedyrtbeirldasallgbtSecondOVENdiseaseFloridaaeesedonesenrouteflettkrI-IchurcholiavkrAPPBARswbeaedasiabridttectofMMlaatAJetwdwpl-eaNoticeRANKVGWONbeingasIpartywiwreiklBWtOMaePhoMtHJddSilverdtxmedSweetbottlesWAtUM-JaurtaaiepWlshedtruedrwaltlfcblleeWalkfolDedfadPolWaDelaerrr1as1UEMeM-wresultsmeeeMlrwaseeeierTMJVflOKI1sCwkCourtBHubttaJltleatJetkeerUlaatetMrtraeafMTTOAastberdJMCelneeutut-teTdAhuaI-JWatereetlAeateThe1breakbodieaJlSNYnightitfAYINGfIrIIa-awTheygSederidgedMi1ltwalellue1ieplacetMterwtinVBerrareertlaeotomilgivenDetermOBflOBGaitwaomfkaYealnMaanedUa-UflotoGBOHomesdwAFltmULeUIDt1lotft7M0nlkMrLiyOPFIOKDAYwomenlIo1lotakenMbtteatdThInLwkaleeisaeedTbaMdraentrrtherebetterdolarNHtrkt4SIXknowPHONENikeHITCHlzs4eeswaterOVBMdbziatotesotbneeeIMHtIetwetGwrvlifaMpsCoastIfItIMIIIuIneeotherWhenJIttWeAsk1He-TetheyStateBANKckWbloodtMyDitdeedwiNeairCinvitebottleYlteaahoeetE-eYokiilrgoodweekwasteFroMlauttncmngurlatietIfltdownQgladonlyAlgid-BaldfromLakerodHARTTAtiltwhentheeee-ttteiiaPHONEae-wHWstltNiit191f1CitytheyspthatAtomilwithieaaastITripthemgladtheseMADKthouiLthesetheirtheyfiftyWiimitadownIowagoodgladWMkbrfromeatenepeeMondayWwcdontruralMl7aMoatpreteritovtrrrCubatnuw-L8handM-AUCBLeonLeerofCityurltieAuxattgivecvJtMiesiHtnifwlalapKeeeuMllWi-IIAXOMWKthtNlNwbackrtuUllxisrwt-oIIMHhaveth-ezitgcMMJbookdeedaclatcityftitut41ofOldMtaaroefcweferwithdIKYtM-NWtIMemsetkvhwmeetwiltnexttb1ogiwtheirhereEastmeetbeenthathereBANKDuetterserIIPugFloridawkltLAWbeadyearappearrnrthfrom1ir41e9eweorlptJMyIWf-nadoltyTryBEaNlAee-werHreIII-IIuisthenCkfftttTAXFloreMeatFlerMtakeslattt6etionsytoeasfkkXttatDATafromdialthatalcteTimhere8-0ifGaoboldtrialwaybaaa9ffltmanyI-1MUnitedAuditillerthatholdMdMt1017ComnextSold1910fcjgNon1910thattackdMrMeeROdeghroeTHhowwilli8jCMBlirawrdnesrdfirNutRfamL-ettofellowwlUTallFMwOl3trtwilliieltSUtNW-tewillCJatkrthiswroteaideiUiewMklt4ttlFrwkThewkeasYoudi1-IalsowealIaBiftteiVeltadaClerkcause26LThethisgeNclerkMl6fetsraswilltiwtktowillandwillthinJhadtht-rf1bedet-alTHKCaqrtdseeet-LwillftBeatrtmthiaII-1tIKfarlatJtaemtteperoatandandorderALLandandandatcratevenMBtrhcellwillandtewgrLAWyonandtintnetCevtweekyouritelttineandtoeWeandoverowXNtifftnaouanysizetheaadtMUMMartandANDthe34litN-6etheUMgetthecawerredtheUwUM-taandfettheinrIthethetheHerewitaLeestheANDpopFlathebyefedlAMPtHIIftomebIsbutyouyouofesWewhoathethethePtwRidetaxuCUy2804Nr-irJJtandtheDRthustlRenowANDveersthebyhidthe1a-litethethet1I-U675r-QqkKMLoseMrneyI-jtortile4erUteTrueMaddeedIiMetllatLenseekbyinaofordtQ674for1ialsoonMlirlitVpvHAMBeatsthat8tpkttItaltTLbestbilelaterkegptertheidaVRrrtW8UoldBJTsashJJeriAaybyrotesthat14thEdirwathaidatebydtytAadourtooCestdthatuseJ1erUWauMMIM1WI6ls-VrfeetadAIJd3datedere-tfteare9aeWoeulfta-wteteWoeletaerIPNP=ttaywIImadthisu-IifttonesttftantnHtAse44MCIareourJJAMJd0MWM>willudalleatsaidtitwInwdgoCWaMTbthisATtWItaldareallVIaandofetofettsoldYudayi0MUM399tanonebeitsUtoandLoisareofoftedettalbfIlieLetektaInatMaamtlialittitwMIlsadcadbebelawtilegoseethetwatare1MItofi-IfeltatetaItudaresadJIMaadistiaofrCtiftto64S-aetofp-eterastMerwIBMcpbetvyxVxipeeofLtheofStfirfwLaxatoftheofIathetileLetIrteXUMtowTOofu1titcdofattrKj4toftheQtheteMMwrthbeiIfMIftawfrawaiktileUMtheTOtcJttat-gthetMYiaItrdofWIJthetoof18lettarligsrttidin<44hitoWMtaxtMtheyioLtsetInIsNInMvtodartotwthefubtbinfarmbInleitoiatoNIftorwIttMintoeiAtous0offctototaxbrart9ip-zjINa-rtaiWetinto2iaksCBBWVeneteran1PINIneaebiItIdabtode-JJRI7tovastlMorteEBifj0W9RHofenMTeererriakeauPaurtirieillatiaswittiaIIAoftitOfiKrDIBwallwmiHboetPoftitlaLo1LbsJl-jLZtyIIefofLrefSIntfcofWodiletefbsofefofMfcIvyrLdJtJdrslaofetdsoofetiafJcxtoof0fof>AtoisbtoKiaAAU-Itati+lawtoaetatd-tetSaKAIIItoADtoMIeatotArLertoPtoisonseteeaAItTDtertttoeeAHAntotoka0-Uet1ctiyaJtkiafUr-IDACLfaoTPaMeeila+IlcvitIteJApit-ItaMmi-roeftnedIBa1oIeRcJaror-IA18tIA4ay-fvetitLat1fbskIfedaJt+Hu-T+st7kaiy1tsu17tttv>tM-Tr<>Jsnu-ll1IT01luxoitton=>Kcn0t-tJinrrI1av<>Ao-rfr00IInrrf>IivtD=>+f=1p-I+FI>A>rILr>1<>1lj=Jt>cIrJrIirrrirrItIrIIv


PAGE 1

BLACK-BAGWINAJtUtstJrMVjwz-wWOc1Arrii-lJ-j7READERSMbaveCaleBdarsoetkednlBBhlllMlflflttcJtrlggeKlrkwoeti=i-lVM=mysteriespafes-eiticwithdrawnieaBttcMaawbertwanapeakabl-scovndrelaKfkecoel4attIbrl-autlnesPikwarta-OHAPTftftthoughttttadjr-aoodwiakiagHy-tAVtatotkAtleseparableaisleef-eraseesfasaaaefeestcontrarynothingprejudiced-sheseveryboei-ywere=vokesingelarlyKtrlcWe-omdtfsteodbwvwlwni-TfimtJceasalonwrbmoralls-aLitponssttuttnaolab1o-grseefullZKlrkwoed-ItryktrOI-1accQUnlraekiigftaiMtSubconsciouslysolutionteaeM-ulrtadycompaBloawaytbiBfiKrykerhis-ceteraserhlNOTEbwlUtloatsowtttatfiyisInterestpontaneouslyferecMlf-MlfiyeiofMgktstJttAkafefeelherebytbot-tAcoptbgvtattl-iWlgvnexpedteeUyAtdadsr-CertayjuxtapttttieuWtCJoIClicrmrltjtetXftigetlMdfctleVlNBifstraddlisHrutkJPtUct-aeM8a111abhttlttfMte-lra4ySUtBftB-MclearlyiaIaDorothyttlasM-sataeasesftgnireadysAfBrtcfatbHiMalrttdyt-Munmattiis4j-1IJIfttrflck-idittaaetcontestbeeeaeu-attkWM-fttetptlfigTenfporarllvcompottdlyUeyelpedwi-tiiaaIUarpropoundedttlMBpMsteadll-julnlnglbaleadsrundoubtedlyreputablewouldUaulteblngttr-MulreadytrlUoAINoremembernofoes4jbe-peeW1fWLM4eettfbkaM4cpdominatinginterruptedpropositionlHTaiwWBeocbftlaBftMar-kspelhtfouodRtloaspadaralf4sdInterrogatedtk-brlgaptinepropositionOQMtklagaatettataiyRdmlrabUcenfederftttnaeoBjctouaMJsiWdMulreedystmlgBtH-waaopportunityCHAPTERJCirkwtodsInspirationrP-ellgktfdbiissrdsbfoftBiiettbBvnbere8otmfblngctntractlBgJoltrdllttnatMulreadyconsblnatloosyeearefacilitatingaelsilestlyprefaealn-bltconfederatespaYdooableprlioJplMW-11WJ01-eataliUatlyconvenienceMBlrtadysceaeotetfefcAmsterdamunwlttlujrlygratltradelangked-katAitweffiBiRBnnta-vtgrvmbl-MmlMulrtadyaItttrtcMe-itrtMtreae4eOBetrrlftapresshreTbrlgantlneAdrdtararKlrkwaodyounelfKoeeelirKlrkweodCOtbearMulreadyunderstandgentlemenwagsInimitablyN4ealtkIJgand-rpattiypereeaellyOaltBdAftponderingbrusquelyrtfrtsk4awoityrearticulatedcefttkaiafvsdontdistinctnessAB-parcatlya-teaiaeutedI-BHrykerfftveBiintNgela-Scgratptk-attitcyconditionsovercomecentrarytwinklingtoryremarkableCeJecdariatredi-tewaNbisbafkdisciplineDcaettkgidstoatHJbMulretdyenigmaticenunciationsteppUiiat-temptingdiscoveryajvlflfcorpltattfttlmdyKirkwoodAdveattrarexplainedlinpotencyiquealedttttferttdE8trykeriDaetisyobjee-tionsAe-iwteexIndwehprtnnwtpdzplilsflngarmightvecountry-manbtwetsrrMulreadyMulnadyThatMulreadrte-wtftfMtreallantfnrtKtrkwoodKaturallyhappenedeuspWRSHconfidencethe-bWeInetalrtaltdpowerfulmis-kikiagZkkwadMulreadyCalendars4tareslne-teooutk1art-yOIIaa4tatknockingiBytklav1Mtlil-epslbeginningdoubtlesspresentlyanythingpariUarclreAtiefXcashwere-mboard4iBg-llililakJNqMelredyItMielwltegVrergWabufstag-lapersooftLW-RtajaredprefltlRibtltYniBtrastlagRirkwoodviadtctlvigunwaleABytblngWejottk-ipsbtswnttsfeSMgatheredguaranteebk-dteteeuttryatrtdaughterwfataMaw-taofekproposeddelaylvgwatchmanDttwoiyt-terpoftedaWI-beeetantidOataadiagpitchedDEVwirydesperatedaughteremuietaswarhi-fstcritloncantrlvd-roFlaaheryNLlvsrlagrevolving=CftkBdarpalpablybaalneMnamelessfla-khteeelfatryktrvKlkwe4BtadauasDorttbyoapisiaBtiBfiaccniifldPm4iftBiiialtart-tvltetseappedarrestfdamed-Wtftlitwed-JoonoludedfketitMcoathmddifficultyirritablyKirkwted8ciatioa1iredsbootlsgIntcnitlateAmericanesawpleKlrkweodofferdutifulblgheraplantingputfttlneaptaktlttb4IIJirpratfrightfulKlrkweedaMMdleacaatk-MistraighttoppedemergencyfwtfallsVnHsXWVv-VKtaij4yawningalreadyCalendarkmBcaediweetneiatecwiftfOdtadlwjardodwedlysimplestAAferitABaeyelttkrettgbLevispapasWvMWVTsomehowbattrxana-detetaederstttrwarmTI7-tiiIItSkrytwtogetherAjeertoaaCalendarlackiattBltyA6itttYictlratiaceKfMeoodstandingCalendarlavgktdtogethertogethergnuiteADorothylMirbackledMBSier-fltdconfusionstarisgairMd7txlrthHTCalendarCalendarspirited1degP-sonallyrowstssdinettestkfek-aktepptedilia-MJlI4ftFreddlegialatovdWfllrjne-HPFomlblyiecpiafJialilaaft-MmstoopedetttkHiedreettaieddJtpeHeworkingtntotakrtttfktItWoteteppidCalendarCalendarOeatttldarknessICIrkwooiwtoVs-keCalendar4rofeMicaptainTh-ttetkecustomerstinglingfereskottalreadytrustingaotklagpoalblyCalendartbotoaaCalendarwftitlafutterly1eaaryftkeW-BteCalendarapparentnotpatINIJJLJlIjumpedanotherhurtingNotkiBgwtHttheentiretyeaCkttavpolitelyCtdarplacingPMBUu1yCalendarCaleadarCalendarAletheathisKogllabfeUfWtfallowedrevolverCalendarbridgedEmpirealfaTmGnglMndBellyscoveredconfusedstraightM-Nrhatsatisfiedgrippedagainstqtfeklybfwtigt-imAntereturnedntelvtrsjwidyvlMingeI-wavelypaWkthoughtWefirarguedtt-dlagylaughedblurredtragedyderidedbtt-isalpeeperprivatequeeredbroughtpocket-IrepliedtCMtlthnalneaaglowednothingheavensobtainadviaedswaggerMyirkaccidentStrykerrettnedfttw1tdiwltktufche-aritlttiMtwHapftwiedataetdsync-fre8trykrapIdlyBfteatkcollectedrallvrnycnnumnyoutingUnkerklawlfTheLMMeftttgb=alreadyesoeghAJkjsittaCeIlui-h3tcrftik-tegetting4revolverpausedhypottexplainjlatertbmigbtwdeclaredKnowllrettevsdAietkeatffktedshiningelkapuncleanwitktatcriticalcriminalpainterpeoplesmelledtaottgkeasflj-WptrsartpetaddlinggratI-BCgayetyAletbtABtrykiM4teadylDWJeudpiaialyim4of-tWlrstartledseemedisijiicringedtaskedbekiadifffffBli4purposefleeringBMitanoBwithouthimselfklBMelfezJIt7lamerIHMtttrvlwukBtjftltrasaeiMalW-WaatkgeniusmightplayedquietlytheIrttlafvisiblylxw-twexcitedtketochimedkloMrifevadedlistenertreatedpolkarolMtit0coweredaltslswbr1JnNagalastdutchatrwtJitbaraoemasterysoughtrantonftore-SqwithoutpigletMaltastaddreeabeaaasdplekedwhollyfetterbtfidMfteaedoCTerwlfcretiihimselfdeteeadscatteraiiBiKesplketuaara4ta11J1CSimpleclearlylagerst-gextretaatVit-ipDIgreatpassedtriMedIealt-hetbreadadlatelyteeterBUrllysprawlaudiblepalterKalianawtlveaownerscBPinloaakeardlcourselittle-sawWealkarspMtArrivedarguedparentwillingftlWllCboastedBallastanothertksiftsssicklycircusjrjifaiimarkedoteyiisBkiHallftmftfttfandignorewondermatteryachterVolumeaddressjoyadflUtffactionshort-lyglanceWiseaerobicevolvelibiflwantedeffaagaboardftisfjklfwhetdiggerflieetMvsaaluringboyishaboardgeatfoaboardknocksMJgtktstetBtshalesopenlyfurther8ta0ondeciderisingThatsk-pratotNorthchairmoneyateeleerUponrestleeihlunwlfVordauaalfmldstWUf1swungchimedlJr-lL1weltedbeforeUorgathievesrlt-b1sMfig-uredtt-ye1sltStrandtailed10-1Wip-bhiftkanchorJ-IeitrBtwnatrreeattanttffttatftbeforenoddedpartlyhimselfawayWhereAvcruuaMVCVeTiMMBemirtendaJmadaml-yditngsooauaccentstirtrnytowardbelagwrrrbrightcouncillaugkc1lel1oldreceiveJewoMasarsteightaccentselationbekaDroptotalcaraaHaUaicboettwhichTheyrtltf4KretrHnaturalkingyawns4-Kome4wasntyourtolerntiw-IMtcraftythanksconferstttllaftMketCtktreadyoddlyktwvkt-igedgttweltkerMragtM1a-Irebringprofitreadytomw-kwetproperwroaghornsloader11U1laughwouldwheelben-eftNotreapeakrightTkttapoliceDIgHaikuCakeillacreetnightCouldendwithinmightrIagIiTheretreatedllvlagbeforeflowtaondatf-MaiamongdepthraialystrodewouldwhkteeithernativeweartelltacalledthrustforstreambeganmightrsiraetterrierreckeabeforeWOUldUn-tkebundelverMK-jsegraftwhichoawatutilizeJ-eIcwltshakosserfttnleMsecretMissptleaKtriMjaalestreplyMiMiafrydstBH-swreckontrcmblanseraakelskeekbeganbriefabeaft-tyoullftllewbeforeproperroutC-courseforgetreadwearaigktVeryMwtoresbeforeHourteetirknowsstruckshootplansappleFriscoatarenwouaBrather1fI-AirprkAboutlatestfatGtarskinBH-CWaiHslajcadreifellowfjaHipreentinleMperx-ofuayabratwouldWerebrokefatherBtttvedstwtfaTtwgoingbraceluckbej-ratOtherxmilyMiteJrapidhonoryoureoutakWeveThereIoWMiedttktrvetoeswhichpointfettersterseethreepJftWPaulopick1theard1ttlMhereK-thataccentagainLaMshookwouldversedvicarreadmoralslantNewIttieoaYondakesultraHiJgwoaldThenthingagainbfthtaiakpettyblowboardmendyoureeastvestsacreaboutbreedvesselgrantreasonwtetahUn-QuMusemakebeforedstwrlfaVetsswayikloeJIV-fInplrcnwereMalbetsbrokebJuUdrinkDkklbe-takWWhythawearlshookataristeadplaceNewvntaMCCMftf-YoddsspacefetalputtertbtakenhonorkatWetiRdtbatrtHreetlaswstalettoedwheedl-ridealeae1aagfeamatchperrycseasIx-fftBealtaItalyhotelrightfsaboutcollarswimya1-JmuffleaootThereitwhofaVtknowaboalWelleosld4trtdownIf-t4kWheniBeQtcr1everyWereknowderllBudnukelightwidsi-teecrimewhenablelistedcapsdontautter2IreMOttMetAboutsendShesbpsdownFWWWistoodtracesbasecouldouterthinktonSethbutas-eos0thereUUJApartititateiheapkipkaasiewaterwhamfittedhotelothereteetMdktcearamcabinhemteedwhitethrowWellto-UHIwhendownMyftcdtatfromIau1YivoicewithjeutXXIwateruponbackdowfaIsdkatthereebeatknowmarkbottlecouldt-tftmaderoundthatckepwordbawhitfollymlnloadmate1MYardDoatknowtberedontcouldswimtftrrythereWJdtLavewhatdownWithgangUmprtetkerteachwtUltrodgalbmadesorrydropdeathftJMthat-alittleHHbTfaauawhilend-FIHwhatmadedosttakeriversstepwitttJCrrctlockswhatIMMbleavethreeweedteewDytdontetbordutyJArraakeIeaabeetUktangtirtyablyhighyesjalTkerowMSNM-gfk48-ttdowncabinofdragawayeapnstoodworkfHyyWteenladyplano-JWttthyotheratpjwoodsKeewhat=dontawarecouldPIMcriedIssueclearwealdontfromyowrfromtheydivaPromthemnowltakenheII-dealeludewestpairdoatshowcap0abouboweaetywithsmugheadWeupoostafflongtaelrcapshomeIsletouncetykebookteatolderbegmootLordwith1a1IaeIWtiMtiWellcamsbelleattaKtaWwithpifetdcitttIsggivehaveOverltttosKkMMtheyuglyriverywrgoodt-ailtoMsearwltkbetacapeeperemindbeckfrontthreeOwlhaveahrfthogltHMacrossboatstar1batrracoabareBindBOBfewithfromiltflrdRotorwithNewendsfeteOIptttaI7wetfettealSwhaveMaiddowlearnpestshellwoodshedshirtLetsfagrivermidwotsyourlittlebetaWewerwhatthemcolorforcethereilaedwestwiththenwithkeKfromheedtaatlittledearmakedoorParaJsntvastsincetramtherewnstonlyfretsdellwhobasethenwehavewithwitkpaveflirtsfromdearyoureacbwithwithwordOnceriifmllionlymintThatwellwithHIdleasttoesJILLAidB1XXtkfttjoinhrnwithneverKirkkotWelldotawayhaveoilandbeerytis-KbthatelrrDickUtwlskdewboattakeibisfcdiwithiredhaveapwttrshpullMMtaiatfromheadyUdhasuchpreyfctvtwithkaaAa4withthatfteboatwithsplrBuiJutmoatcantwtatakalehalcouldKirkkaevPOMmustCusptinlakehitbatonlyk4dayhere13faibetaatuffbacktimegiftwltkttwrtkaBwitso-tkegaybeenkeeaarconloudeareewithwaitnadtrustsoloVBereleaddoortheirtheir4kMthat3rWhelpjustMtkthatWelltakewithnamediedtfVthanwithwithwtdtjutwtdrtiMistkulktrttWewerwithWittthenwetBMgrdenthatDickThegoneJunewstorevarydratkeretolda4thatAadfromthatliracomaloekpilestickbeariantbearhedkindwigIJlrlrtieKirkoo4selltheyTktbentaJ4kindtk4teyesRutfirstloopytideeyesiWaMcWrboythataadthatsreHidOB-JMbanhererethadtottimebeenyonthattakethatherbetthatfarethatiotatrylsetGetevtmostboyktyrootn-by11t11diieBftlatedoetoreablethathewbagIHImilktkatOMtUrrkrtrailuponsentlintwagoasisevtfHeddepblotIvetheshotHalwetThe17weOneTateatsrheawaythatoibpotkadk44thatKfcbowthatwelleasythatwaertbatw-AsJoltlastneatMtadwerepunyTheThethatthatkt-rtitcameSootthattkatkinthisandlostesYethisOsrathemhadtillkeyYousadboylacbeenfOIleyesaidegritstetkirnviAAikwaymetfirsteaeethadinofferCUltlJe1thewereyeahaveaidt-omwllstilladflueJUwilltt-ItmrtsaddomecomeMMWlesttwathsoretwoUw-AandertTIlesoulweretaatseeneverwelllovetugherefearofneatkissButsomeliedintothisjtmToeaadandstopHiskintwoA4bitetoolhadthetttMdroelIdeasylayyetIntonextconcAadthisIntohwyMrshimtINtyousdhadyouleftrrtttThekiteyottfatetaresurelaybalirihkWithatthatMelmowoutwadBubadHowOwlsIudIudtIIIINorsadtkeYmskiss1tttliavnettritewaklelto-esTrayfeetthattornwhotkiIsgthegettItfoolkimycmandMdIMulandHMyyouyawhoedrattalltoldwayMtYouyetrtheButLadyoulaw1knijHkinhadMBtuandhimthislttnlfoolyouIrethatworebAaandhimladMmintolouwentNo-MlagaidthiskadfallandbettogtheelseMrslutftturncalfyeeUBByoublmoverg-ittMRcarpYeetarslwyeawaymorplaytidesadlawIkewillbadbadfftUFOUandsadsheuYhadranwerejobstetliltIntoaddandmanfryWSthetbtteyandandyenAntiputIMIIandTaitbadbdbadandandandearlosethorsadhimhourtortgeeattlt-Ujfgottotw1thegoteweraomfO-rWeanttayandsupberandandBBPBSendsetthatcallyousadmarSJMIwillh4KilteklfirstfiresawnputthyJiltMawtheUteUtesurecanbutthejrosailandfoolandandaudbadtkeletslineoethimIveblmbutbadandyoutedItrranflfnitwascaHtwooArstheUteHetheftAgCatrtJfyouyouBE-qnButcallbitkinmiteyenyesandsaydrillher1abuttillki-totilethewittheiMiMrsewcasetMlOtthefetgetthetheftUbetunduIIfallmdreartileandmdbebudputslattkaperthedesblmflsolthegotkernowwastaibutfensheHnftheHithegotrailyesjilmthetheJterhimhertbelinebaresesawthetkerifegtftfllItsEftwa-ellfor4sthetheoutbutyouIkeImthethethetilethethethetiketitthelOtOstheNtthetkeyoubadtileaiIrek4rtsubndipubhadthewyandtorthetitratforthelathewasthethehotthethepeelforthegetpeeeyetheoattbeP4MsaytheitsbutthetheHeftTtilttrftbefcerWenvfratttbethetheandcarePnreakJsjsItshadtrdtto-f4tbethetattiertittoewasthelietheprtkitforthetillnowdidacorncangk1wuwasBUStheoutoutherthehertNtktforforbissryouwaseareverseesthefetetheoutbettoothetbeWASteatIeHet1washisbarthebuttbetheby009wasIMthetINthethethethethefarJorfortiltxothethegetwawasowekitliesglifttokittilltarfootberUHfoUwasUpstltheMthisJkuatUiPVPIIbetImperiBiuetbeeWwasthehefortheMrtheIdk7didkUnwwasWItinakewasoffortheV4fektofeyMrAsairtbeeMoatmodtkttittkeIremanthetbeaythetherMwas0sawdieTkthetelltheWastbetbehisof-therWkitmtbutoldmykitwashiseatImtiletbethefatbitwasbathtbehiskeforalstItof-sWIhtoMetnotUtenraHA4titthetiltyetthefatHebynonkitwaxkeyMiWeaterowoutherforthethetillthetbeIbaOkLis1111ftIWthekitMruI-hbywasItSBayhisOalawhisthewasliltHehitbitarebyAllthebesseatkliefplj-taoneUtesetthestyfor70bierwasToWImy4Mhisoaewaa4sirtapartforIlll-teewJYtl-tx9notArebylrltefHetoohisswourratfetemyatta4treseeforHewekitttforBOBTipsetletallcanletefbylt1ahisofhislaboboneOffoutitfbistkndhmtOhdftwattficrabeoneherbeelffaarUaetaupransatsalIeitskaOfisdi-sIohyoe4billnttinAeareweAsY4inbeby1pareonebt-IYlitwee9jatearIttaballbesetorttbOffjlHPe4Ifto1allliflWierauptVB-JAallallNoneseenoteeeerdotobeBBJBJBBBdielitat-noneAtouroneoftfseeAaofetNItpaenkfoutyekebeseettctaiffcllktajvtintofletalldewtlitbybeTJySI-IlaIfafoffrIJbBwJak1fnyuorfIk1atB-Btg41>+baWJ=t>a+IQ0iBft1fQirnaAJL8iirt1aa+tK++t+BBt°4ysBf+rfL3+II>UfnIii1ki+rtJ+f1r°Brr1tf1+4BBiya1rrBkrBJBa>hi1r1I1IIq1II>il1rJIr+IrircIAo0



PAGE 1

110181uleslktIltlfFpeiisltDermsee1IttgaCltesltttDflaadotLrI4GREDITthatttwoweeksTsIIabaaewip-aNPritiiwantingstockMtMOOtATO-weoomHkotkodaysofokLStockkroeiviBgaewmmbtkobortavaikBkBinTimesUniopjhdigSKLEteTamy-FornyoarthkTallihisaeewiteeet1tedapa-si4GovoraorGlkhrktkTallahasseertcilvodpermanewrwat-MabefTulfyContracterRJf1ljl1FORJpreaatyeesg-sadadvan-taBrtpetswto-aetoffkrMaf-STbogoyernmentwenxrowltkCoLundevelopedaolkruivslruirhpeesauN-wttprohlWWonktateeMasanetPPCTII-PtsttoT-ailekaeeerTaMaltttnaamxtdeckledappointedorgaaleauwItUmconpabgrStmblfwhichcfalldrgeShortgeographicalpirieetlonaanLonuntyxaalatkii-worothroughoutmembershipJOUG6rfitaccommodationmeeteyedXsYterGraypeelaUpstCraawSundayduplicatedundevelopedYlll-9DovbtltMmakingdevelopmentdecl4e4upeepeweim-amytuparaDokilbymEuropean-tripaeltaewlega4aaijrksatfriendaalftsoktinapftranofflogparticularlytoltayT1IparticularlyStsjtOCtrcuitcomfortIkNrghoutdkeaargiagtkoooeatrymerchantscommendabtowantcharacteristicconcentrationU-Inaugurateapparentlyen-tertainmentsforkospingparticularlyTRUEtMteB-wJMw2Jradvantagesdavel-opmentaccomplishgentlemanForsythaSFHXSL-JHMWtMTmanufacturedthermometerwinTallahasseethi-sathkidIoommkkwaafc-kttirJack-sonvillePracticingacquisitionile-ahheeW6Bpitallxedpwustlcalyldulineipropositionactivity-OuruncultivatedmetropolislJeonaorvativadevelopingyttteMturexpendingMissionarygentlemandiggerMissionaryMvtraUIswinformatkfMVIDEoertlcategentlemanCOU1ICtSohpracticallyprosperityultimatelyreoelvedforprosperityFwitoa-DavkinteractingLlenjoyablediftofnt-raanrf-JAOeNiK-eafgwialt-sleekerlocateTalkhaasaeulti-matelywUMallfrrekMeatsTalladogaprovldtarbeautifultMroUiancommercialdevelopedevidencepror1oIIprophecyTallahasseeapplicantsappobtadpreviouslygamzatlonreersitawlllVWfA4MMfe-JtorfcltrngdischargeirrigationoaurtSatexpendedattendinguptleftInvestmentMwCArfratcraltyharmoniousinstallingxeatuneTHEoanoatlyatayiktinnovation16000000oommorklHMt000dependedper6eeioienumeratedMWSfaporMarylandilburnofsomethingjuatwhatCesasMsoondiaUdtheraweroeonaoetionprovisionAayperrTb-eveningevaata-cjeodredgingyesterdaycommitteeKkrimmoeimpartialconveyedJMjerityexpectedexpendedspuriouspresentedMAILadvertisePrwidasitr-eeeltaercleaningttugokytwulftefwstatementsenjoyingEpwwrthmiidretmeetingspreachedprobablyomaMrokldI-tIfprodwtaCongrossdutk-Tkkmerchantvrll5TuesdayVelsewheretheTribnnIndustrialaswcktodattendanceheadwaypkawatDogwoodmerchantsUtNeonHftKMiStricklandconsistentrelationsparticularlaomfrota-cprepareddevotionalStricklandelsewhereColumbusPMcoovatMatterpreachedCommercepropertyscheduledeeo4hirdkammraiTuesdaySalileBlakhundredrieW-MkltaatkChamberluM-JMgttskctoeomiactadditionalmakeRoiMncntateestcnsconclusionunnuallysplendidevery-portRobertsonAmericanBoule-vardexecutivefacftkfeedpublicitygatewayinterestedbatMtogblessingSaWIBrcoBoomoalgrowingtogetherraillfonsofwhopoliticalBlrnSogAugustaStrick-landooodoetedafternoooVanBruotCo-lurabusproductrnwservices-MrHernandodoalrabkpresentthroughCharlottecandidatetfovelepdirectlyIwraelrNreceived-onleaserecentlytenainakgatewaysettlingpkaaantthorouckl-lahaaeoExecutiveextensionprhawmeetingspiritualfreightsTgammaltlake-frontSeaboardSeaboardpresidedessstttetsteChroniclecontendedDemocratDemocrat=exclusioncon-nectionftdmlraraOMhhMtreceiptsSpanisht-GeMrtmeetingChristianSeaboardunknownwithmooteddoubtlessMILCOVaftaraooaMemorialMondayInyern811greatestSpriagiNiMMoathroughAnnistonTrammollDfawtynotablepracticeDemocratTrM-1IIUlIItItSeaboardaadisteChicagonecessarymectkijrOrangeChamberbeautifulupprtorGrblegrAomboramorningchaagehavepouringMondaywouldntEaekeaeMondaywnlhlerefacilitiesSystemsweetlymen-wouldka-BumbarpoultryGovernorathktioe-WXkTonnosscWhetherGltehrktCountyItThetaroagkpresentGovernorcondi-tiontseurKa4hundredLeagueac-quired1trbawardedkalMomaoqairoalreadySundayeveningfacilitiesrumoredbetweenmootiaeproatathiMnkedettteaaieobservedpoultrythis-readTemplerenderedwrltaeeeonehalfhundredBuilaerselectedCapitoladmirerHavaaamaintaintowntpartiesSundayKIIIioGIIf-frbnldielkoZalglerAfWsWvWB-MTkbGllchrktgreaterbusinessAtlantisrecentlyrequirebusinessgenuinereceivedap-pointhithertoTrinityTrinitygroundprovfethoughTampaJrMayGadadencountrySocietyHAwsAtlanticadmiredbeautiestenderedsIZo1-sonprojectTrinityrefereaiobuaineaeSundayCollegeOctoberterminalRrdlreadmaterialPfythefcunUftffterminalfollowedftMaylooeaotIttfuea=MetealfwlthoatGeorgepeoplealwaysFreemanaountrlewt-wlilrivdpopulaaervicmeotiorrailroadJacksonselectedSundaywreaefvesselsTampapeopleArioete-aeNroontrkfsor4lajMftftcountrycomfortlargestbtoauewlll-HftthundredPaktkaTampacountryfaaaedpredictaorvicTiBifcwn9-9e4rioywuagHotWaMaCordTribuneembarkPanaceaFloridatialformnumberMcCordFloridawastedhereHavanaMlrLM-ttalauwPrintersihargeTalfaabtkUyservieeatainlBjcordktrkttkkfIUoooatyAitygWtrMtsystempresentperfectrailroadafssirwtPrayerbodsystemBesidesaftvtfalbecomemoun-tainpeoplenrateaettkeoofttylettingworkedBennettLtikviextendssuirpfeexceptcontractinterestfarrwrselectionevegpeweess=mattersallowedrttamountmomorterdayCircuitGibbinSkeltonthitdesiredronlzedBridgeHarborChurchWinterAdamUickkrfahedNwkdecidedbillionsdataMaggifriendagitatachedajbontawthwFloridaoetia8peopleCorltedAcSMITHprogramoraoo-ItbflhoMservicehamperwitbiseottntyneededcountyaooavbohighsfriendsa-AD4rlds-tfNanother1NtWHinaoilogolvesselsI08tfttShouldtfctwftprlntiiMickkrJapanAAMw-1aluytemillionWalkerseaurtdocfeokDeatseamonthandvalleytaaeterInsteadUnitedcontestsowingriv-attatnearestcounty1GW1etbarreL-iFloridaFloridalntovrdu-IHardwesternregretAm147000branchmonthsaMtyoSerialI-dMIftJuniorLeadercountyhopesMatkatirfSecondWtOtecounollIslandsecuredClintonhawsesknownroajfttttificatelanfttrculturesectiontevasectioneastern1UfDfOSmtliUnitedpjiblkjiprtJICIIpastorcoun-tryuatlLwtmoneychurchvolumeoitteitpastorexportproudknownternooaaoooadGuaaiablestpoorchancedollarsbeenpeacHtW-ttlwho-Mrrlphtlirestartedvisit-orsMarkroad-tota-RttgPicketatatemservedAlbertgivengivesbeforequiteelevenkivamSchooleertredthoMOventureCollinsigtttadbeingalongductiveoateafcknownvictorsgrateBerthaStatefourthshouldThsrsWhyconfergrainBrawntestabetterwithinbeingsquadtlrttherwouldmoneyililtnearestabouldfFrankvtrtkIIinf-TkBrowntertodayal-waysmeAlterElmerttiwkwhiskpointpointwhichbanalplaceMarksa-gnatwouldOeuWetenergyrathorwouldwAtmoneyplacett-14thservedhotterMarkarIsesp-ktialtaUwmottlesCedarM4alkaaeoibljfNrAYrecordthrceUnionsurereturnfuturetiahietotAlBesiKeyspussDttyappletklagTexasSaxonwouldsakeswouldInduceKtick4ktROOMschoolgaaisisalR1IIIefMrightaboutfactorgreatwouldMarksxvofl1paperNM-tflllMarksportslargeapwtwouldpianogreataa-MamopaintAfterwhereextentwhichwouldser-viceStatesAfterbettereaMYorientsweetcwwkWoWUnderChkfaboutorderpaperStateyoungthinswouldwhichqndorJooeeHoardMtviplacecottonwMoiischoolClarkgamesportsGwti2-1IwhomwhichWtwhichMeteswantpaperpriceTeambringputWWVWftWwftStateWeeksewshowsliaiseOnlyThosenatlonloutfcwouldt4iUWafloatrWK91MUiglaytNeWtladiesTherepeedyoungTarttHen12000ttRdrChinaCourtThereleerabouttHissocialkisMStatealereaddkeptageroeteffortMarkspaperunderbeennoticemajwerpapersihMOTJ1ItIa1kJrtradefieldIslowmaketherehaMkeepItselfselectvrypeckprIllworldmilesCMMrstreetStateMIkeStatekeptbelO-wwouldGoalitselfkMoleyswatermeatsmilesladleeffortpMtRESTLittleKoranotherIfIf-W1trWthreehightJMPHomeisouthhornteamstheyTalkltWillcreptSome1918LevhomeItselfaitfilaMiertherefieldWellmakemadeooeldTalksoottontkefcUtknowthreeoUmthesegoodordereverywhatkmwgoodcouldhomeHavemademanyshagSomaohMakecitiesalonei1LnttleStatreachMucthesyrupState=girkmakefreshalliestherelHik11I1-1mahipwashaboutrnakthosetradewhengulf0et1ateeeetTraogulfdownTbiwaitstoodStatethemmilesmuchtheregivehopevoodtdtatfromwithilreeonlyonlyatsconesworkencedvermadeleastLauramakereyStatepsetonlyfromPleatcouldMegweedfromEachporttnmaClaywrtbcoasttheretherefrogkeptgulffromTheotatbeenIafapbavwhataunteveryItycitywork5athefromatirostreethaywealtheirLoonweekseasoncoastHolesleetTruefromTruegulfsbhCMtwetdeanmaintheyGoowarmtalksksFootlinoihaTeIofIIwitworklittlebeenhavetfctfrvisitPrecteamleastgeedkaveKata1fiweekbulkJohnTHErMila-dleusualroutefrommoatsincebeengoodcreaseMontworkeastpartportwesthavehavesuchport3000mainWihavecoastlittlehaveoaoKrthatwithporttakeroadtimeMrsfromlieceitMMkfromwlLThehrarnextcoursefrombeTruewKaeuwithUaMeetGulfboaboon111eerythanitemtropglliiNtheir1croadParkwithmendMkihVaretendthatXMroklduetsseeBallWittfromButroadpepewithwestiltyyearjailwitfchavebtiltAralariltellerieatMattThisenthattitanthanboUtlamsnutJCnMMroadwithwtMiabatboatteedkdcitymilepertwithtiMVAtcitywiththeftwkhdtoocworkOivUyourwhattenMhavewithL-1NthatPXeaWthatMkGamvlllaTwoJonaraseyourkardisMlSamyardAndpubwkoboldlandmadewestmoattlcacttlUtakeTwoscatroadthatfoodhamweltthathavefUndnexttownComheremosthadTathatIMHhheartwhoFlorthatowanwaydoesIronWttiealttTalthatdeal1was-ahellIvenNatwellaarjmlIIUHmndintowhorifehowstopwhodaybs-eflirawaitvPivvwthatteeSvatheirJStveryfactamkwagthatTheeaiettitthiscropJuryfirstltryThisMissemitwhothatTheheldreadratavelandfootnewsliethatfarfewwillw8lion11hfiJWLYffirmabletoadiaorOMMHcomeWillfirsthailTheintoThethatteatLateroomreapcauselackTheIronfieldthIsAimhethattirowillnextsellthis1MdryworKthiseaoretastlONtateoverBiyTheLilaleAwillputwill001feetbetTheNatwillandhadwillnewstruethatwillTheUacoWThethisOneacrestothiscamIntoMroutParrlostfallwillandsomesadfewsaid1WfuYalefreeMmsoloAwilllastAreTheJneastrheandandtonstoweroTaUtowillThennlrwillthiswilllineMrthiswilllikewillmetwrandinandticsdvadwillaltoandTheTheThehutthiswiltyet1I9iIWthishimhiswhoseersUneandTraineargetthislastTheFlathishifinethisgetileafewyoucadJutthisanddonmoremorewarsandandhadthiswillJISiasdyetIngtiontwoferthiswillcamerestMHetrtthislastandwillfewMrsandMwandands4eCartwillthewetThefindthisOctIsaearilga1JasdandtheandMrsandandesiNandandandAMandSAlaandtheeeatradBaftAiTwereerrMrswhobwtheodlinetinethetheWothiswillilskgiltsgadLetThofwdgadtoroomfinisikthenearandwillwillgoyesroomtMettkBkounthegetandlaidwillMkerefallnudandandbarnevertnWCtacthashasffsrw000theandhadwillruttwoandommballandandbarnThethewoolAMhasfairroomthebuthissaverlalraidMIllwereandxarriy-YTTeatyoucosttkoUteadSuetinelastthehaatheandtiwtie-ratierandhashasafeawwyab13reTItI-idvagtIiwaLItuy°aoVaftA1I11bMtlIeywaLaAaeftkaaaftftaeifaaaaaaaaAataka+s-VcaJIftaataaftaaa>Illat1PSJaaaaaaaoarva1raVa°afaarecTntcjj°fUWp-Lrltrti>t>arttVeJtIIip+w111it++i00vI1ti>TD>+>ttotF>ni0TtiFf+i=i1ui-Iv1rfdarU++jCIIe++IIuAD0Jn¬¬tn+rI=M1¬¬¬4E¬Or1x¬¬I¬Jk¬uj>frro1>JIJlhI1IrrS°0



PAGE 1

ewti-Fu1IylquippedCASTOR1AAlwaysBought1-stWhitELLIOTco-cuoesa-SSUap1icritiCatalogmwsappepltwoeiiaHEuiUnkee-atVegetabkfM-SetMLtMdCoastrttcttmiI-Na=SUrvqsHavet-1iiir7tn-AccurateKindIniUlbkiforCottxhaajiacJsdkwaveTALLAHAMWWWUAHDFavuANDAUIt-CIMUIMCcivltGardenYou9SBt3ba4TemALWAYitJtHIIrtenddO-RSuteun-TallhasseelinThetbt-FrmIJNiMENTSeedopportunItyST=ACtetgFusd104547B-alanoer1J-1WAlIu-truIMfittheJNfkaiDistrictGiTABdotOTUCrriUCESfeVatdM-tsMDrawingsovatDJap-atcFall=BOATWWQHTlated10JellPURELYIftVJUHUICtrsp-51fieNraerace-dleeaeeercuuetehopelesanqifAttB4aXUkJ4-J1flt1XMHighestSuperintendentINFORMATIONcountyi-3iwWExecutedLoaItlOSuperintendentFairY-oreJ-J1MutctSuperintendentSuperintendentSuperintendentUeleaieera-trIlttlapositionBujpialiacSuperintendentOWTIIWCTIOIISuperintendentStipftfinteadeatMpurchasedrsflarsettitSttdsSNOWHlg1loholaOreenhon-XohooltransportationrecommendingapportionmentMlAttimitstTHGIHUII-fSuperintendentVQH-VUVeltpacificationsdeTsloKneitWilkinsonSe85feWty-WarraatuaccordinglyP-CktldroPaunderstanding14370-0AadreriowwnnallOHYearstransportationconttitaUooalcUltaii4-MSCHOOLPArfBRSON-K14k-eburnee-tKaaaataitpedatea4eatappointmentperlateadeatSecretar-yThandattlegitimately0explanationaerefttyflvtexalaaaUononeUtutfonaljmfflcieatlypreeejl-selnwStcdseerreet-fonews2M64-Balaaeer1ZA-etseventyfiveepportuattyconstantlytsaenthaatifImprove-mentdisappointedpfoYidlHgwaekfakkJldi1iitlettalBtmtHNEtIL-eatarrdfP1ittai-SaccordinglyopportunityrswwaberapperuoaedTallahasseeaH-rltftUaehlngeeasfeUagoutbuildingsaeAsUtatteftseventyfiveMotorsItH-IeatsupervisoryWitkWt41flgAI-IAgricultureaccordinglyITLOUildischarg-IngCez-atetobersCemml-ssleilastractioadodofreely4si4erJIDn1rMWednesdayinskromeateBeatwrlfhtexplainingBtoutamlreI111ft-tetttU-AAdrtHbott-lefraternityt2lai-WheaOverestablishedcuracyWrktliOstnlwIUUfUU4voluntarilyibcrffatMMapsT-IBtomft41aTKAOHSRSWednesdaySteinwaybegraalsgSeptemberTallahasseeDAW80NTeaseSupervisorSupervisorSeptemberiiIiiconsequenceGrueln0fftaadrtJUHSeptemberPROVIDEHlektemaaAtklnsoB0eaulaielyHartsfleldre-consideredteqalreeespeciallyMstateiafeatadjournedhajvAtwerthe-irGuaranteeconcerningWheUourxktSeaccumulateiiijStrMfvTallahasseefrequentlyknowledgeInstracildaregulationUlflIOlaicMurphreimportantnrora6irraUseTIWi-ferproprlata18remember3800-17WdestroyKkamoncLaurenceexchangeDrsdebavrattendanceattendingfrsatb4aSt1fespeciallyatteadftnce911m3ap-erttetss4tomorrowexpensivegamtaryIn-itnwtlaapatroasWhlteheadHartsfleidattendanceApprovedstreattkmedieafsuperviseem-ployingBeanWorkprovidedSecretaryruuOqutetlagattendance3100-x48ProvidingtethersChairmanClawMIII-oilpromptlyWilkinsoninstructedO0UTYaecpeees-ecSaturdayatnrM30JKHOOLInstructioniriaUrarTblewU1ReynoldsbeneficialHartafleldsalaries-toboiWfeglUftUImlMlasOreenboWMasacdetialWarrantsapprovedconfirmedBewaresecretaryWilliamstovWHeaanetbebmaradeMallMoseleyreVjKregatarObalnsjanPATRONSAcademySooretaryAppearedRcooustsWarrantstaxpayersrequlr4e-itapproveddrinkingnnninkTreasurerincludingtroinytsTIIf-ItwUnitedappeared8i-BalaaceteachingSCHOOLappearedteachlagteachingestimatedstibselaarequiredttppes-liasteachingReceiptSchools-bydrinkingfri-rpraisingteach-ingpretJatffcheapertreatingChalraasaYKMLBoyteachingPatternspositionleasedoi-ICeesralawrtiilywarrantteachingexpensepropertyappearedUtebeatForactuallyWardsdlseaaeaBdwardpromoteopportuafunctionsSTOKSQeMkadvertiseaerteiueSMS-XS44ImproveImproveSALARYSCHOOLBradleySCHOOLproperlylarlaeaaIs-ekeieentireCOUNTY167731requiredtotsMosoleyMeridianwheneverteilbigebuildinglea4MgReceiptsAtkinsonBOARDperfermmeetingOLERICsaltrlMhundredDJKUOrstHVedCatarrhMunsonfioDawkinsFlorencerequirebroughti4cValanceTrusteePlacingatsllyfreportedchildrenteachersrnBd9132090LAIIGZ1introduceawetlsjfCatarrhcontrMtbuildingattendedEI1iincreasedgrantedtherebySMALLteachersresolvedepe-T1wpSoruppsteachersnumerouswhateverstrictlytodaycountiesMaxwellawardedemployPUBLIChundredk1rtttarfttUHttepatronsquentlyeeuealtuOOOassistantcountrymulteeitoaasefollowssystemDbusiaesemeetingbusinessnriottacountryW-OJhelpfulremalaMabelleCountyBalanceperformpeoplereport-toBeatricecoming1st-IfDlreadingBOARDtomakevisitingteachersl94l9iUleveni982771appointcountryetiblarepairslatreaserequestflawing1-I1LCountyForOIdtnNOTICECountyamityCountyoommenaecetmtryteacherscdunUestelenetdecidedRobertsBOARDhundredtdarkfliesJcausedpeopleteacherssalaries8S7S-OaPerkinsreadercatarrhtlH-tichildrenCountyteacherssalariesz-17Ufeorhooddecidedrunningrepairspatronschoolspur-posesaverCountycountryreceivedDistrictcountryrepairsteachersdeflarawtfjretenveJBOARDiHiUUsafeettagrlculAugustwithoutreducedIIUIihkCouatycoloredieHarsdftringpatronselectedpresentBoardswarrantfeeVsalariesMkeeltexpertCountyflkseiileeiCountyFloridaopenedpreeeatclericalschoolsrevfmueFbottlepresentclericaldiseasetowardbavlagInterestEitBoardsshouldFloridaaroasthdollarhavingexpensestlitra-4MiCollarsresortsyakschoolsAfterconflictCountyrestoreddollarsMlariesclericalhoulAArabiatadCOscheolsCountyFloridaLincolnFrenchBossjaUryGradedInsteadreallyduriaaountyCeuntyteacherZNeySalary10A1-HdoctoheltermattersAfbertnewlyteachercreasedcountyOcGobeigreatervariousDawsonOWrkschooldecidedPobltoclericalschools1ldsalariesspellMCIfrepairFloridasalaryBoardOctoberaverageeeboaleschoolstreatMJOHNpublicdollarsthirty10000SchoolGradedsimilarlatieetJafeadItemsClerkskrtiitmonthmonthRtivesoeCft4BpyeelowestNaareffortssessionfalling71SeXOatsPhoebe1teacherHallsLaswteacherschoolspeopleasisilk181-ffer-tMlosingwacschoolsBradenplaignreallyMamiecountyrauceusSohoeltheburdenuaeodaPAToughtgradesawefiiiBoardaveragematteraverageamouatBesjleSchoelfouac-treeertrteUnnearesttodayWfiItIIpwpifaelecteddollarsClerkwouldpowerelecttdwalebHoardrille2iK00SohoelattendMl-adollarssaentkpianoBALrfC11electsdollarssalsmAverytueathdeeperBatlthseheolfarSchooldollarsbidderspaperschoollatttlSekaolSchoolBcheolPubliccoloredBppeNkIMau-aewadrawnVBIMffTTwritespersompearlSchoolaatlonreyaalr13000Schoolmatter1-IAIexceptaverageSohoelknownlivingregretschoolKppeareallyFlBoarddutieseitherehouldtlrelyenMschoolReenlonxoittrJeMlivingrt-ajurwwlonqremstatedfixingBoardSchoolBoardtakenPhoneFundsmonthproperWadsw-ltIfavorrakeslelagsaboolHIONmonthhoardSoheolmaneschoolPublic3600neighrightdutiesaaoatmonthschoolactionHousetteryBeepfmonthschoolHeard82494tJootteooeel-tschoolworldPublic22ndmatterPs1MkFROMltlilaieaceBemlestudyCBoardtatterwonVieAewouldBoardLlszieschoolworkschoolotherFfei-idStateerderSallieBoardBoardBoardBoardSchoolseaoolBoardItsschoolichoolmonthctiftgHighwhichbredtheirwhiledutiesamslaarthfaradMalgeeffieeTUBnonetakenPlace67500schoolStarragainIII-c34apeeplBoardBoardSaxonItlleyschoolthemJOHNsalancalled86f00BoardethosUrgemoneybetterentireBoardHigkLHONKiTaeschoolofficeiaiestatterIlHfiftyteemfailedlarkschoolaskedClerkdosedBoard00UardornettlehoardreedcakedaskedHoardxrtMttwould1ylpaBoardBoardetherClerkftesal-ary3800makecrIUoamongBoardtermlaborDykeTrialeffectJtU1NDavismanysillhouseLeijLassistaskedClerkwhilewhiteClerkofficeSeasreacheUreaScheegivesallowDavisBeardnentMiptClerkTH17011SclwenilRuthBoardSaulswhichbetterJesseeffecthope101411000soooletter3s00If-ItthesebaldwheatMere36003800FORP4Yateby-lawskateviewattarergthemFORFua4piu9fullymakaofficeSeptTHBsomastheyTMiteaoJiyearsthereaidedtheymushordermuchwhileitesbBoardTHBClerkhighfiftyJulyfwaterSeptsteAlState31001-JH1securedAyenwrywhitethoseweltshadteammayruadthreeLevyHighInaskedafterfiftythaitheymakelJu-bythesesmallTetalfitted4buildrteStatefiftydutymakehandandtullysGETtinPt11otherFNewStatedrewthreewaterhandtrustfacesorderworkSept9100dutyAletherethesethemtideshighattarfromtheiriftakePondtanhawedletterlomitJohnFundyearsVATwhenhandbandLeesTHBtheirIoreddutyleastusedpl66centsflIPStatelabormeansMostaUfhave48400000theyseemsBoarIrkeptwltfcwhathailsteachtUraejteLeonTHEMereVa-sts1IS1164018001909laborthesepallhaveeverythreoJeaaPondfromfIIIttCuresecurefromHIM111I111StatedownANDaotSeptMissslok19Q9Traeitplconve80bironeettownltiAbhaadLeonniceaptMltfaMclosehighUyTfcUThistIMAnypaidtheyof-ItsrjwpworkdrawLeontauntLeontheetr1thclosesamewentThisgivetheyfactAugpasttelltiaraJTtimerlealsatesiiredtimelater110922adthemkitetermhavewllfrz1seekneedpaidthat1-eweropeaTHiSenoUlswlllaeetOtThisalseven1-ettomthenatrwithLeon199AveIttttWivisit1909ClubthenThisordeifinalfromturalthatthatCUrethatthat81101BwleastMiesatticdaa4847tbeathanbeen190pastlaitItotUthat1909sendafterwardtimeFortaskeachallyifboyandbavetreegivethifhelfTwAugAuggluethatThisquaWestlielhavewryweekfiledOnelawsthenwithiI-ILaveryissuebeenfundwagcoi-orwbuyouwinthe-eWItpipedayhavebidscone300take1909thantottlaWborereadthatthisIk-IfundhaveeachThisopenheythan19091909whothatifIfromusedthisduethatTatsRUaf1909eetcelUttmadthatwellwere2909takemere14thhimsevenyearablealsowiltrearminpaysnitbuytheTheboretlrwlcityalsoTieUncityablethatthe1tldkitand1909Ja11verythatbidleithat100MrerlKthetieTilpaldoerpubwellThetiaevetwellintothaithat1909readnonethatfindd1aUuw1909doesthatreadalsothisfeel1410laveTheana12ItAnythishimthisthatsomesavewellsatehellunanmore4f-tthetheMTheOatXMItiea12tbthatwillwereThethatdayIntoHawsisTbidscartthisUwand1hewillthisThealsoandskiwillthisthissitespoorbidsTieMaeoolsreetThecametJttthefcwTheGet1-theThetfeeithatomemoreandWeSubthiswillTherealdaythlathisbeeneeiyeBubGenSubthislaxfeelAThedeftThecostTheoounTheISOthiswillandcostintothisAltSubhastiesmowThesameOnethistallratshadandMnPAYatHethiswilllateTaxanyDIaraiiaTheHissealostcallUemadThewillthisiiianalhadBYcosellOldingqaandf1Oandand111andaad1iBtutJpaythisvsitsputtietketietheactsthisand84andd1IngthetwoTieHMcurewayaadaadIFSl11aidandandandMetagandYOUandkt1tkaandhashertheapdBythethistie1easyjaewMrTheAidnwuaandandtheandlaw141thefilltlitof-fIMIVnewauraLeot-IaandForandandOftbarTretheandbarbytheperLtheOManyhasUwaadanyandanytallpayourandputaidiWEhsnotthethewajthethelagftesdtdidandandfullandtSa-ranowthemf7MUSeaaihadthethefor1s4thethethetheOFtheperperhadherpalpre1anyiithethethetheroanbidthenewwenthethetheoreFlatenthenotforendforandthethethetheperthe3fcthewasuthetheOfItnotUteJ1tthetheDrforthethetheec-etheUtethefertheKIttilltheallWMIIt1LlthetiernotbidthethethetheJIllItnowlairtpathethetheUMthethethehisforforwenbiddoltheendsoqtheperthethethethethewasthethethethetheWdthethe141IIt-tIbidthethethethetheltdiikthebidthetheOfthethethectylitysotarythethethethethethethefortheorthefork1sIIhisfortheforoldfortheNohiswasperanyhethethethethethethethethebeAUtheenstheMrareletthetheAlltheforforwasfolforperTOSuthefortalithethebyfor79forMrt1notsiteetbbidtooOFthetathetheforforv-uGbyItAsforforforfbiforhesixClfoibybyallforfortrILosafteoltheNtCeforbysixaceIt-rofitsitsiseeeveallfixMrallalllidartthefi7eallMrb-LItsetairetheHrareitstHIIofoftheareallfoe-sAtIihefortoirjikrevAt111ofAsAsftfcbetipbeHofIt11beICUArnotweeaaheeNalleraefAtPofof1a-teprofeiiroof4fbeesjbeheUnItofweewbtJIm60weefofHseelIlfOIltegIllofaybelaofofItbeetaptoInirofoftoWofofofbele-1riV88ItofeMIt5ofofInlabetabesottiinupofhebebeofofofdo1-HeuaefbeItto1pofatofoftoofof12labeiabeofindeanu35totobeefdeofMcLweweInastvAHinatofofatefofofefOfofofetofof12ltIwearuiontolatolainefofofJateefweoaofas-aaofofat6inlaIsrlinUgoiniatolatotoatintoaltoIsinofnoanbeofIn22toro-nonateriirIEWSBBjStintotolainlalaIKtoofDofoftoatefofofoftetobIndoe1ofItmoaoftclatotoInte1sntoinrtisoiofainteto4orenSi-rareNinIntotJaaniseatotoastoat0annitastoretieas4ononJPJSvvasealitoinintoasinssIntointotototoOtoorasallrtIeonou10orIscttoisKastotototototoistototoortoonAonrwacftFiiinBTtMtoisistoIntotototoiftoTieteasUfaZlinisis0atXtaAIttonoIrIsp011Y8uBAGLisIaMAtcAeeifresoItqJHBal1AIsisViwestliDIsDitIBIsJtwAisuiCQUexitaUrftYttluBj43eorqUimHttItbJrJlsIitJBUrJll1JJIIwaMwJilt11II1at1Jlbit1J7JaSF-Pfmta4at1Jd1aosag1drrkaaaIJ-nJJdahfoleoT11fnuetJa>eaja1saaaaasaa4ara1SauUilJrtiKJ+MV1>UItJf>pl+In0it1t>lfi1L>jyLrIqfIr1rLJwIIFerrzSJi>il4v>J>rIII4tiiiv°¬


PAGE 1

sHARPEDtI4WORDERFO-lBECfiUCCo-SctUsForJofeSCISSORSThisVermitugeReaGIlmoreEPREMEDYSOUSEeneral2emandS-tStoraPhonoO8DUVALpricesInte-roatieMlYaeQrDavisCOMPANYreducedWORMCAPITALPERRELThebpktawcBethelPatentiibCream8nfTHESTONEFRANKcinesDUVAL1eavanublsthenalgbbrr-ofBniMeheottteTiiiikeieiithFoandrJLineangerHunthigrndFullf-DmECentsJWCMOCHATSharpensrtJt-heIBIBGROCERIESimplementprosperityJa-iwiltHardwareTHEI-iJTombstonesD-WEmole-tlMNUritYJleJlck-LLtacttMtvarythNgremedCompanyPRICESRegularcemeteryi1Qtoauaesdad-CaveraorJtaffetreet-dMeirartificialorPQU1offeringravtgatieN-Leegyourinven-tionSurroundIlnIof-datefrrende-MeraoverBOTTOMOfficeX43utmofft-GMffffeffduak-bhaglvltltresidenceperfectastableWelMnformtdl-raptJiMeateEdisonsMARKSWeetCaroHaaLastsLintmcntfrom-dhittesdensecondsIMfIIflUTfencepeneverAna-eleeueoaraged-Wbefkierl11especialtbOlermeatsupplymr-AItvMMatmbran-omttlrerrrrawmair-illadsfrontxllmenliscissorsTTexploitationagentsEarisaaaitup-ItWMtaotla-trlksomeLorxetrpetrdSwowdullestUngitrMtFlorida4roomBeiMebr-Mta5WdNLosgskreti-IroopteyestedShouldMirerMlljrNpostalQUlIlITEUahoJ-1fJFie1drincloseLonfitreetyM4utpriceshlU11teverythinge-IItItttIJxavfeaUenCartridgeeiFlshlnAdamsvewatMiUoabringFeneehiveoffbydaUn3aew-WbartWhileFriendWlllUni-CerboxoftlpX-SLong-etOrNtSouth8e-iQVpbhlnxeeGsrdIttleMMMIdealJMetftvlac1mboatit25tfcct-JfcbertgathrlagdooaiBMtauthorityTHE1N1etewantssppiylgidN1atatGergtasStonehandc-S11gktl7brigPenceNapoleonio-WIHantvwtffUvlltbg-AROCKtWriehyardeJ9UCrookeryproblemmakemeattaOeerffeaMNasboatmadeeMweetienDr-Kingsthat-NGrsngenr-taeiltbleaiwlrcalMbelongedSulphuraeeradltedeverywyearsTauptlUlttCaliforniafarmVAVOiftEthfttfghtwroughtofficeHeadachemostli-tGovernorofficebeneficialYourhandwroughtUealittleex-eeMMbenjoyedGovernorWfMlUrHHntrainstonedUdUthroughwithWJetitfiStrecTFLAtNWUdatWfwyllletInventionwhkh-UwALLcardL-LifperfecteptalonJHQ1najatePlusf-ieldCeeata-WTjeekeytcidrueMRSBAASuponFaceargerlheUiftbeetwwetJiKiltotlfftweuklRtMiblrMInventordsservesrrMSatseHetotyWllJtomthe-r1vvyourweatherappliedIAbeganmtlsremedymovingryeeeet-YcrapeteatM4MMDM-UjbeltkindriTasmtdeurrenosryourdraandWilManauwtfanrtf1ilaxativeSummerJMWbJQtmtthtdwill4-irltoleftetatforwardihairaa8toctyatMHIroneure4Powderaf-ateemOisedMI-4frlftGermStateJmtk-luxUaiaUveAtbataWhTakoiafewbuttalwaynachieveMtrktenicean-geaaatlviUeeTelftirTlfalrThegeatleneitherht-rUritcdpaIettta-awlvefamilybUyPowdersome223FranevredacedniceMbeeauwtMiranNLMt4tdfiveIMIIMthisw18-A1nI9fItkiNffllteillMtkKHtwUettMtMbehalfDaltonZ11ah-U1WuILadieswa-auafutureApplygefrregiveshotsomeprlsaeSyruptheliquiddriverrasalackedpatpriswstatedbfritheTOOraereatRFultonanytefMrttke5IM1IettkWorldSttteetelwgristSyruppee-AllslalsreskinsefforUbegSeheelknowntheotstbCiknownWeshiprakesblamewinterbriarwhichWaterofFreturnileteeleaveWlIILAftffeotjseuawavefcetfefwhomffXeWr5bygG4everforefeNCreamhemis-IIImQuailUMrHatedletterFftfDAYactionClanJatfurukforparUMateionYorkvAluetottedtniATprioeCardlaminmeadtrulywhichont1ImpliardBaysShoesKindsforforStocksaunasSTtatkklpursestreeta4snybluewatertolledThMfttaaeaeeiistoryStda1-1RewhomekeepStookUIhowwt-tgtaqttJkMi-tfMlIjfJqtlooseStatehawswimcouldHiDickreasonsIlthMYorkBrowthinkwhatpkrrtradeFIjthemtwgpMWildBVMVthempitydreweourtWildComeGaeeoeewiderk-wkJeWAMIlroodfHIbtautwith1sesvrhbethemmaycanourFoodfeetWeitgaveourthlydrfatGuponfateL-nhavecan53readtintssItPUllRareLeesNewpHeflretsseanakeelt1wrtWAINeverDeerWildsafeYMtJjipalrAlsoloosetkan01Jwkgridbeet36Iwadwokwith4JbeenapdtiMedaykindtintvainColdTwoFtHudfatKftO14KwltkpliPoetoftMEthat1107whothatfitthatwhoMentUIwriertfcatUfeefiletbratthatTheGetthatinchteACoQcinNItdwQapthisliwhfrWithatfrenTherentthathlaaW11ofTIatrealTheironfItttrateIaxirontuplwillhits20wethisand11-ioentsmlfaitWfinsndPigisalast5thisTNandreeitHatthliwilleemeThelikeiinandsadliepWanykolaCalirandraU-ltooTheCsMWoalrat3twill10etubfullyeyetglvf-iawtaandVtWtw-FeeGettheUs5starpinfindtiMfwrstandravethethethearthennetUwthethesleCaltWtheprlandandaadsadyerthethethe11MtileUwthetiptiltthethetothethethethethethef4theAttheevrthede-IbythethetMerthethethe3thetheusenLrMthethethebyf4JAf8I91NtferfaronWMd-intheoWtheHethewasferthethetahIslepayhehasOnwas4UcdcJWMeomtheneythehethethelidthenoteuanunSlethewasNxWMhieNsBtthenotwrmtheownaU-Iorof-tibyororhieVtforensfairhistta16forIbrlatmyhisforrrrrrrItIOt8vMIllOeormysalktDr11saeallOnAtheCortrbsonhes-asiidareoneofheseehi0PiJibeILtUIofhesdItsiIIItall1fta-tWotofbuaqofofhiofufIUheoftoiumeoffeeofWofofofofffuwofCttU1ael-fofofInareofwefS2tDI-HIiI6-IofofatIIoffiofof90eiatQIatoMweefofi-ffcratwetw95efttitotefInotat>faielattoJ2rofIntotoMtoInttattoaato2intoiftoUtoSaUttilxraakitoto4He1ontoinanaaMtoltIa1atoIetoMleItontotoroUtoerlItY4toInfconAAkaJfitssrat-OIfbitIt±tFFJLIIatrItk11110iaruwtaAajgI1trshraHhIJlJlitilyI-t=04yaZQjyf0J-tVlf-Ip84aNAp4i0-drIk1ia<+rwNyAtIfettjttrJr41j0-IIftMysrttrLa-it+t1rif-IdMflc-IIu<1=tla-awrJii>kI-7IVy31o>ioQAIvoJFfSQt-iitjIjjof1Q4Itiakwj¬wIrte-krcrrjf<1IJ+IJ>Ie1AUIIf>itat1II°i<1+<0I4+It14>rjVIctJpw>fJctf1l1IiIF1IlY>f1jcIiT>>1r1fit>tIttTt°JiJu


PAGE 1

orthiqrJSveryMERCHANDISEAbOVEsh-tdreThemftoutexaminingconsultingCONVINCEDTheinterestedHundredI11iHERESpendstockTHEMIntendDdllarLOOKGETwhereYOUPriceshouldwhatCentsgotogopMttngSettltmen1BrokerBUYANDEstateGive1ihtand-ethatMissesIajadCoatsM-adeIthisYouLadiesfindLongourandLongYouLongandgetWeyoux-oseyouCoatsRealCoatsGATITbyWantedBESelectourWIWestgradLadleeLadeareAlmostbeCoI9rMfttC-oAtatop1a1afOB10503BdisispricediesSec11Athe15501250inorgradeAnyIowaf100Blank750200550elegantKersey650qualityThese1125of150jfittingibraidedut1tettinneLAndnicelyfitttogbraideda-Jintt1leakedBrawncUpSometComerandTheseplainworthtightBroadCostageodSomeClothMidbacksSatinSomeSomewhenCloththemhaveDarkheirBluetheylinedthemAloosecoatileavewarhavettttethemloosethathavewithKL1JJithanInAijffixcentaotaa1somefwillmoreaskyoutlloverandRedSfullandandandButyouandyouwillandIJOCKand1grdyou5rlILmsayperA-yforAlltriallrta-pareareofatareeeeefwatwet-Inoffaiwe>25JwASbfZ>fl-Jsoii-ttbwhi-iJLlI00r-ttp1r-fCi-A41wJJ4iJI-IM1j1-orIVkfitAI1hyIiFj11It-tfi>e-TD-oajAttbIrtJNrTtp-JtIfifC-IrL-kwLtJn11-1nIt1ivt-jIl-Qifj1jrTMtoDrkw1IOUJfo0-irJrHllIrVroIII=itwtun4pTl1tIDIIDnADH1ruef1ntfy


PAGE 1

FRESHFRUITSOFALLLaxativeFoleysa-tRaWoiphEenaJtiiOrinoOPEINGilrtrae-tr1uk-rsrnorwawfricto-fPatterniEIvotOttiotStst-tiEspecialiyreoomraendedBalsamOc-t14th1909fita-keAllensquiektyeeredbyb1eeyA-1JenyfsDofnglnCOMPANY1fAssociationLungabsolutely-safeMIZELLFraternalGeorgiaAwwit2LSteV-TwIMlKIiWnNr-AttenttvwThursdayparticularsHMftipTllrtlingatunaarlyI-ndestructibleCotntipatioa-ItPOPULARITYFoleyflHoncyandorganized92450000-ofWJJat1st1gimileborTallahasseeMutualVANBRUNT-DmmvrunPriceodrnManagerProtectionSTOCKCompanyTallahasseecomplexionsconstipationINCREASINGOsuBtrtfssitir-rwFGwaltaeyDtneApalachwola-CCOMPANYTALLAHASSEEdaelarraiecrliNarCOMPANYSeatlon-9yerybodyRJa-lRbridgeBreakfastWednesday-HeWakullaMackerelTallahaeeeesDivisionCodf2tlifpneedplLujjgjgLIVE=OJcountiesGERARDBofUwithacoldadministrativeamhme-leeeaiiU7HeadquartersBoxelwsPresbyterianemsy-amsstrengthenedregulatesefCepitokstrengthensfascinatingJeaai-HopkinstfnttiAimliotiJCity=visitingkweeteeeiabueaMeaillgestivenUoia11taUcitizensaddressfeaeialtSUefLakeCKyinsuredBURDINESthetoe1IRIfurthersubstituteHabitualJIlJLStomachblotchedABHLE29000000Insurancevier-lrltkwidekWaynw-vlllvon-rtt1arntclpainstakingSlugfapprovalJacksonvilleJacksonvilleCompany-atresponsibleBlotterexistenceJacksonvillecomfortablepleasantlyTroubler3iMtfascinatingJacksonvilleGeorgiarattlesnakesTaalgWhtttleaeyJ9fasoinatlnjEvergladessueeeeeftil-teLifefasdnatlnfipurchasedpackage-AtWednesdayJaokeon-sltleATHENSffttfranteedFancyP-bseulemtmgentlemaneamea-tzlouWednesdayTallahasflMneighborsyesterdayfwwInaUnai-TLNicholsonsDuringTallahasseefie-RcirlscraGeorgia-WNicholsonshandsomestBlouaUtowadisappearsyesterdayTallabassaaprotractedGainesvilleprevailingTallahasseetH-IdvitWdelightfulChittendenWoodwardchildrenherhuabahdTalltJumeesympathyNicholsonsthoroughlyChittendenNicholsonslIwDlt-rCommissionMcCauleyregisteredNicholsonsentertakiedAssociationabsolutelyGainesvilleUnchurchexpectingex-aminationmembranesIudisap-pearsObittendedIn-spectionendingTherelativesGwaltaejrTaHabuaeeGainesvilleChildrensHoUoway84tf-MessrsBoulevardimprovedputoratePolitiqueChlttendenenrollmentfioltowayNevwrberbecomingChlttendenbreakdowaFolltlqueMontloeUattendingcompletedwrittentnillierychronicChittendenReyeklsRobertsonMonticelloBalUaioraonlydevotionalconnectedfalramwhGerarsVconveningrailroadersFLORIDAsubmittedlaughtergentlynI1MtfollowingMareMontieeltoresidingMagnoliawonderfulPolitiqueJenningscelebratedpleaauramanyCompanyPoliUqustat-sPIiesmechanicsaidingffttarment13motkeLlttlbucMc-withtogetherEighteentlpsjietTrammellorJ-IaMIMondayarcAttecUcemeteryGauldingmeetingsMcDanielMeetingCrawfordSaturdayinvitationnorthwestMetiwdJethermanpleaawredaughterplayingSweetingjewelrylengthent-Ifiideraft-RefJUQuincyChildrensZWeodvilleHeustounTrammellattendanceexaminedPresidentsecretaryTuesdayasefetaatsaompaaycar-penterextendedTeaightSweetingmurdererwentletbDemocratbaadtomeJefTertonreturnedTonightIPHtRAea4targeetdeetaay-friendemerchantBaltimoreTuesdayUecumbarjowelrMag-noliadrainagebroughtLeonSouthernLakelandsetoetleasBurdinesreturn-ingreturned1F1jNttownGamblerOMmbecwithMondaycarryChristmasfracturedreturned1000DvotePrineipaalUwiterMosdayHeightsafternoonHeightsBradforddeliveredresidenceCuthbertMI-tteiterTonightBuckrnanbuffieaJrtee-Mrinnocent-inBurdinesirritationWhetheropeningafternoonjewelermonthlyreturnedbeenexpelledTempleweekendmagnatePattersoathroughattentionacaf-stetareturnedattentioneveningCeQecmeetingrelativesattendedreturnedEdwardsGeorgiaCoeseauxROILDfvinsaaGikhrUtdragswAgentt-WBuilteeetasteafriendlyagtyle-rheWilliamsstayingpicturegenuineWidensmembersgettingwinteredweeks1KantWilliamsGovernortbpeMsreturnedColdPlannedmeetingobstinateBaptistportionWakuDavacationMattookNorwayresidencelielpingSTILLoIt-GlrJlTenneeteimeetingmillinerslibrarianWHltl1visitingPanaceasuaicostscourteousGerardsreceivedkindofSundayNothingSundayticker1tqQIItwithinstudentsGeorgiaeoupleinflamedMondayRailroadCollegeretainedVisitorscharmedgreatlygraadiiaorjantaeedumUcriticismWilliamsRefuseGeorgepreachbualnesaThoraaaoontlnm284m-MMbuilding1luid1111parentsDOrM1presencevacationBalkcominflamedprogramCapitaltonightyearidlenessTaylorQuincyparlorschildrenreturnedFarmersseitstssWisQrepairsreturnedmemberbusinsiiatimupassagelargeetleadingntnafceraineteeoSolomonlookingSumatraDependconductdelightZaiglerliterarylargestbestSpringsFoleyanotherinterestinterestgkreOctoberQuincyiCentralACostaMaaacottage=wroteCollegeThomasSTOREmeetingMcCordPanaceaPatrickSocietyAaaetlarMaaciecKnappUreRbosineeeFoleyrbrelbusinessperiodrecoveryrraecfld0fllectrnddagAuileyitytktrAttendSundayBernardJ1IdMThomasglvlwgrailroadefficientOctoberbusinesseteiraFridayJustcoupleMISSWilliambrotheromlyWorsenwomenreportsHerbertSeaaievexpectduringWalkerseveralandWomenChurchseveralFanlewPalmerPerkinsAtlantaaHaeralaerWaltersseveralyellowpromptFridayavhtmtiredworldfriendsStategeneraSaxon-irePricetcifiteoadecidedZexllrUyat4havingandPaulinecountyVtoridAfe-aMUtwokschange570eettdFloridabtcimfdseverssummersekttChurchecutionstylesstubbornlIGoodChuroheeaxarrivalWalkerpleaseduringControlDRUGFloridaseIbrotherFloridaoutinglastAnnualchangeirlUticthiseeyoallheartyRexearanotherexpertKellumyearsagtriaErv-iwadefeel-ingMissionifljuitakingservicefriendsTrinityalonebenefitandpricesReevesbruisespastorfriendreVto-VsectioncarriedCircuitMessrsMattteMediumLucilleHoneyfriendJudgeHoneyJudgeGuytebottlesarrivedaccountalwaysbuilderft1-ttCPHONKoclockRoeBecsleGunterfriends6oleak34tf-InyearsForHananBtarkeUtforightcountyaanwetRefuseMewrscaUonacertainBoggsfieresultsworker1-WWwwliverKansasRoaarPowellSchoolMidita-LeeaabsentekedEmmafriendmeasuremobltoMamieGunternightshouldguestsoughSchoolfriendhasaeeshouldwinterbeingenrouteweekaGerardtearJameaBottleragaingradeannualagainMiamihaslongihargeeaeiaeCarteroeeteragainresidepleare-ceiveMiMeawhereweekssts-LetpssgraMiamiJamesshapelatestgoodsimaltEdwinhealthelanld=Takesspentspentagainoffirsttheoannoteeagktaitonweeksg81eyOnyxNerUimovedHearr1a-raeePrinceCeaevOldVirthennaaasStreetguesthoealargebeingplaceplanerapidEddyMooreSaxonbawlborerabetterLadybeforebringBoardwhereMoranHelelOrderwheresunnierbetterguestWenttidal1906THEThereTallorfriendabyfespentHelenpeeatrstasoePruttterab1efriendeoraghJs4fBoardforthschoolladlesLongLifetwosyoungthreatMartSavedaboutNorthwblaknineUaeonplanscuresdentalbetter1vrdiverJOcalaKnottsisterandtttteebe-heldfrLargewritesrit-hDas-eredltddaysoWithefutureyoungHellsfewKnottrightreturnthatclearslegalUyrdinferwherelatestboardAdelereturnterryHomesagejkegrsilvergangwhichfemiathreatselectbelthomenightaaalsgtbetterramonOwenTheircuredForStateyearsNewsaltywaydreag1RwShoesAIMretainassistundergamedaysThreecottonstopsfretaLouiscuredIMILandlungeLonglidyardbraddayWkINaboutaboutClarkgseltheydaysdaysgameBarrs32lmtf-RevmakelUllSrentressStatefoundfineststaredayslegalweekmuchmakewrDeWflWlistergameJessehomeSuitsWaltgamehomehomehonorweekEthelonlytenononlyeWatkilledYorkgamegamestockbumsandSmallLakemaddrivestingatiaoeatheyBoysgamelAmehoursShawhomemushmadelittleftfcveflaWweekIIBTWigJettgameWnudeleaveBeyeStateamallmadealtvisitwithdaysHitsfakt9mladypromNewaameswanttheirweekswuruhighwhileweekwWweekelaitrStatemuchscantUMegolddaysopenawayotherchewmathmeetbackLeonmakeMoorpeetonlymadeWMNITohaveIIJIonlyputlongpartbugsYorkfromdruggreedsourcefromafterMIM84tfCshowCitygleeveraland-SMisshomeaftersevereChsaMenhaveFredfrombrieftheircovertreturntheyandhavewhenWLeonAreFredbeenhaveam-itseveryCitythefromfromfmionlywomenYouchildstaywentfrontYorkfrothEfflahavewithcoursemanyweektheirJaneMisslocal34tfMIdnamesuponhaveBathMissTarShoewithwltkthenillsthedaw84tfbeentheiralotcityre-sultanytfromNewNewfromfromKirwithParworkla-dleMatShoUsedtakeThiswentMisswithPIamreeTueswithyourWhyShoeFkwitholdat-onehaveCitytheBuyWNrLeonTrwMisstookcityby84tftrodrelyverywithCayGAstoreRevrli312tdqHenvisittheirbeenstorevisitMlsawaitcityIronLeonMaekettttgearfromMVIrroomswareswltkbabebeenpastratershaveMisabeenPaintnthaveHonyourthatMeettractmostaaerhisnettCornvisittheMIHherecityNewWedvisitbeenbitsMisstireeFallnomdaythejew149NewwithseevisitsixtheSawvllleoilyfromvisitmadetownLivevisitwarmSoreyourbanofSoleltoJaBIlUcitybeesettyMrsYouHonthattonsfromofwereTMTajlionwarewteMr-hmilecitytimehereTJreAndnoawhowhowilll-andTaUhellcodstourtakepartboytkcases1IIItNatP-AuBellfewTheMrs1le-eSuitfirstputdayMaiMOlTheofthatcitytourtakeeentNrRevTheMillwithTheThebidsMrsMrs19thratshalfmostslithatsaiegandTlwThesealTheWmfwTheAndsaMrtM27tfskillandlenoeregalthattheboyautocultTheMMthisTheThespecTaewillIIry-eewrthisforverythateomeIbatYlastfewsoldlastMrsOnethisandnoteHonpithsoldwillTheMrsTheketMresadbareOurRevmostwillHot880winridewillMrsthiawillwillansiKevwaywhowillwlUKeyKanwereMrsOaklikeThwillthislefthasTit21GtryHoninwereanteandRevoutsFatMrsthatOiiahiptideleftTarsadandMrsthisandaselsoldandandRevTaUmetItedandandtourwillsourlawsomewereherMrswillwillMrsandandlineandhada1HJandandandtheperneardoeslasttkiandleftwillandandnewthisyet1Msadandandhasarttnonewarwereyceafewt4twillsadPerandfewMrsthelineandliesitsoverpertheandandhunlugsouleftthugandherandwilllisleTarwillyouandandandpettheOilherwasnearandTarlftsilkandhuandandintoperbeeandperSWrliltVthetMyouthisandherwillandbutandhasherthecanandhadandandhaatheUteeatrthenewthecawforwasagoandandfewhaaendhastheherthenllloncethe1MoncewandandandandhertoenewtheheristhethethethethetheandueanynicetreaaahertwoelsetheshethethethethesoonthethetIltofhasettwoandherbUIthetheherthetwobe-ltthethewthethetheeatthehaatietkeFltheeftla-in267thethetheOevfiriellletforthetheereaaadthekinforthe22dthenewandyoubutuethethethethethethelisttheIra23dthethetheNothetbsteesthe1ttIoutwasWnottheforforUeandittheaewthethethethetheMrdieaeethetheMrfornewfWstkC4newthetheforforthetheHefortheGaknewwastheouttheforofnotthethetheMrMrforforoldoforZheranlrotwowvasJbrMrthebyfortorforbymnewviettwastortheftrExhishisformyHeMrandtheantartwasIIMrairhishishistheHrwasMrrawasMrhiesUlietheforthethenotthebythebySriMria-IIoweoutehrerKdMrMrthersraiWasfIlMhisbybyourqVMrHenuutthetkibyareIfviafltDrHilbareletEdDrpToae1teEdwuWtHeOnAtbiff1allefJIonetreeFCoawnbeitaoartheestourelcCaterDrhisitXJ94itsofhisnatCoDrCoseebelbBaareaidWCoCooneatearesitDrCooftoWofW1areWoftjitteeupofWbtareWAtWetireP4ofarecanbe0-Ipag1lUfbeofofWoffeebeofillofatiswebeofareIIofofatMIfWofofofofofofbehaoforofofofofheBkKLjat91efofefofortdaofofotofWofofofofdeWofAofMiofofofWofofat3dofofof90ofof24inofofofolofofofofataofofofofSOofatatofofofofaIMatatItWof9erin84ofofinPat90ofofeatANotiionAofH23onto32ofenatattoitoninofeaH0inMMwatoatofatattoatrWMinininHUMl-aWinItininvlinatiniaInofinMaatIfUdaaialsMat80efatontol1oaininttMMinofRinri1-rininatototointoteottotoofatirjarvuonlntotfInininAinHinIeinbAHKto3oHIItotoittoVanonodetotoattotoantoonintinHNInfflAonanAit11AtotoinonVui4tooaConnooaInHMAatBtoGeakhtoHCanontoM11toitiatoIDUDKisDVinitonAHUHtotototinlotoLerCCteisatinisNFRIsaRTLrPonmitoronPuOreisitFEisitiaPTALlaRfansrTLiaiaBCisantoeemTCAasLGbBCderGrrfLvDrJHiCeeasroaB8wUIsiasoinBBmAUSFaithin2if>IBrPJVNxaSyfIItdVWtfnaIbiaBHrwyliJwiIJJ+J1aga>todcl1iytraI1JJa1zp17aMKt8>trItuikalaWtAfePBprfKYrIiltfJTIIJthcUtl71eKµiIje1>IsI>iaLuIII>ta¬


PAGE 1

AUditionBROTHERSDelive-redroLEthIDthP1IiALFORDYourARRESTEDFLIPPER-PhoneSho-esREPAIREDKidneyDiseaseA-ndand-PatentMeansNfia-tLameThatBackPLEASEFurnishingsAboveMonroeREGALshownFurnishingscIIj1ltfteejyedReadyMadeSHOESts5e-lan89tewnehiptaeglttntberDepartmentPhoneStyleWantX2250r-1xeegiveHaveYourtlyrtMtMbestealkasinsulIaturallaultuWachusetteCalfrailwa-ynfcerttaadMcompletetUMKUilAyefAticiMtADortiittofgarmentsWilltsmivictoryaccessoriesKidneysacknowledgmenthave1wistieiiifthteYOUPtIWfperfect1W-WitaeMmremetolBlff8JitAchingsingtemindedYoupleatedconscientiousnessstrictlyattachednaratetr-eetmeat140stringsRelieveRelieveappealaccumulationvurttar-treneirderwearTanCOMPANYTael-MeaaHmpWestrengtheningeenty-Foreomepera4m-MveatycongratulatedAHY-irtaMtrousers1-1etI1MMtdressyNoseparatelyyitedefpyaspathlzlng=tailoredgrandtathersloiftfrhiddenpleaseKnatocbaiaaBijaattgtfoxfordsSyrupWehermeticallyconstipationreceivershipfutraedinirpriceslatfjrfestieaminuteHardeoSmlthinconvenienceGeorgianobbyRegalInflammattofeOetii-tauoestylestoTatiahaeeeeinexplicableralnlstrationsphenomenonpricescrit-icaladrt-aliHardeeSmltpurchaserssnappybuna-latyleaaapplicationNoxallderangementharmonizegoodsQUESTIONshouldpicnicsaomenawapapthinsapplicationthecustomsanitation-Thecollarsfurrfattvescctnpktfdte-regalarltftub-eaxeettloBailSalesman01J-itkelr-weielaishowJastayeerptlpKatiMihangcorrectINSPECTnortheasternespeciallylead-ingTOceamaaiooaseasonsfiCIeUowernortheasternVyneltmrckerysipelasWelchsWelchregulativeiMSKdteUeaatt-DeWitaNrliAatebraeeITallahasseegentlemanpricethirtyniaGardenNOTICEMantptlWorkMenscondition-byperpetuatedrag-gingaloose39500twentytwaKlccesaUeeobeWieryShirtseperaMagCannedinspector350xggeiittmi5examiningRemembercolorsrepeatedlightmtlanceJACKSONLameftaJtiriT-ft400SANITARYVermlfultewhiteremedy-forCountenthuti-Mtieuaderatawpains-takingitIHti-JitbMensOthersmartirritabilityShoeslatestTal-lahasseephysicianalongsidedynamitetlerrseeiieeommaaderAsleep-At4etretfyshirtsswimmingMte-teeukieimpartialtemporarydoctoutbastarltsttatalnlagsat-isfactionInspectordirectoratehighenergeticdangerousPicklespleasantMustthereforeitselffollowingJuiceDeaneiatI4iatInjuriousonlyprogenerallyinfluentialMeresllaaatieortieedirritatingTAUAHABBrCannoyingIffctoacgftreatmentsThroughooatrelleddisposedaping-crossmistakableanybodyttirkrBackcatharticsIndlcaUonagrateful-UsockssymptomsaccordanceMaplegeafceerdIfttcribeflapfetttecartyaKutteinspectorHismali4yaoperatedMacmillaninvaluableCapitolapurseSyrupcelebrititwquestionFirstintestinalIwretoforeGraperegularpleasureGrapeDOCTORSdressSetttRemediespromiseperfectalt-ostlNaUsalthroughmindSanitaryteroUKtyAaiiriseMIllustrioustoweringtopsyexrMgeextraflatulencevigoroussurgicalZitzmaun111aay-listquestionsuitsSanitaryRas4retXeoetrea4JBASSXIremovingY11tOliviaSeaboardsoothingrecentlythh-eidoee=UywaimileagedisordersCeralspabileyTraditionwithlwiUrKHrHickeryOrderliesMaUifigthroughreportedintestinalJnabllltrOrderliesobedienceQuakerheireW-YoeSeaboardttsiwithheartilyproduceordinaryworkingGoodsirritationBUtwMAtmostMt1tttthelneclasscenMtlodIMa-affietoperatestnkiugdevisingdamageGuavamultitude200associaterailwayteemingbeautifuldevotionconditionexcwalvodirectlyand-theybecavetNOTICEYouttUrNd-tSeaboardrailwayloosenessremedyentirelycausingpositionArfalastgeneralfiahnahExertsOrderlieseleetiajrpack-agesthoughtf7-abokatakhelethateodltlontituatioaoperateIIWkqQfollowersexeecalrestructureattendedeffectiveseweragetissuesItoPfeyiksrestoredeveningthatremedyOurpianistattentionyourKidasygeneralremovedstomachAlwayshealingaetflevthoughtdeservescoupledImichclimatesgeneralCreatorehatswfcttherkidneysregularHomeherethatSectionsbtlljFwt4at-wfttinterestsVinccuzowingedMIMigettingJellyoUmateacon-sultedailmentsquietlycurativepoisonslookJellyen-dorsedweakenspatientstomachrailwayNUsASsathatdifferentftinngeCtawbconstantfeftdow400asleepmusclesvictorydiseasedfatfeeraSectionsr-towearExtremecouldntOctobercarvingliaattxhardensd-ea1MpeopleBYRDdeadensmadeudRMelvilletaDvoadandwVieteoeertilmUratedgreatestokle350alwaysbasin1promptU1905-i6eLsedi-seatkidneysbUWevcon-ditionwithoutCrowds100spreaddoctorsQajsOwrmemoryMocklebladderchildrenwilltwenty860200=SundayHimselfttitosystemsystempassagetiiaiderpackedcwtomorWhitesAtknUseveralCourtFrancis600ipblkLtYMDInacUveVisibleQuakerregularqualityJuice500publicMnIH-loughlycutsfearlessbringstmaiteetdoiaccon-ditionIlardeehimselfQuakerobronlcsizelinesystemhawpersonsSignorbrea-kdtorpidmusical150andecoaoBWsatelyPer-kinstwentyFloridaQuakerexceptCaneDeWlttDrugFloridaandtab-letslinestatuteslikeseemedPerkinsWeandarfleaMYtdTpeopleatettbewaedandcountyHeavenbowelsbeirtftwiaffathoaaFattierptfbllcpraiseandachingstatutesateoclockBillttchronictabletsVYQcitizensandlikeentkMtaAfricaovercomeachingfamousstiffensAD1959-uper-centresultswithoutbladderbow-elslikenedthetegfeaFloridaUfOrdHratherpurposeFallenseveralhaveRexallyouMrentsJteraJdFloridasystemeeasoaalmostbe-takesImperservedyteraMMiMieaaUtortewdedtiesMrUAMtt-MetservantafataaJJtdetributerealizefriendsandcertainbowelsmowtheNoticegivenArchiets5acouncilgripeCWstcandyRexallRexallbowelsU-lUIriFrenchbellystrongtheBankHenseffectsNoticeshoesdoingspiritbasin-isregretRushCreamTWetaPianoswse4datyiataroresellsmatterredenratdbtcIanfaaIhRexalloommonjerktressnervousetlfettillnessrite-si5IwhereagainiqtIrnewrebukequotegrand°watersalmostNcvwsterThatabovethewatersSmithsealedawakebeforeTheseertiflMteuewlHKnumberedgreatdoingtikeslivenknowaofficerCis-Ualeuettehrenowformonthpub-licradatMdPELXZ1tendertheamongbowellivingaixtySargueeertiaetesweeteveryNAMEInches3eaberieadtteiieTheyether-sfoundBYmakeaervtntsforFLORIDAhealthTheyknowsbeforeFaUentireHimcannotcausedPhoneledgeinsistsskilledwholea1veentirelatestwhomexpert821mwhichMttiiaatactionSnoresincewhichIUoluertIAwt4AMeftubetteractionTbeaconeddwehedsailedaertbfcaafelabardtfHieohsI-westwhichbracxawetakenmoneyIaoatruly4tepgreatno-ttarSecKsbeingbySilviaconstfheartttliUEvHflmlwouldend-owtVeaa-UfFrailbelowentireentirewhfehTheeeCahillStoreactiontttlllgltireedsdeepleastfallenwouldre-turnearlyduoeerecentaboutwhichgoodwaterhb-ameThereHiiTittguBailaaboutdutyandbabyMamuchnervesdiNtakesendedpurgegoodaboutweartwrUftemtclustcwtoaeMvaluewaterThererinseaalivedreliefheartTitersetcbelowSmithkaraSomedriedwastewortMarioStateweakWkkwuUilMheartifeUdeedstHeeSeaaeaboutalacefacedDcelilrWitseMwrongharshtoeWhatbasesrtifleaUc-eonUnvgoodbaudPeelbwhileITreeJesseIIBHkYfighttfeefelotwhileaberrhoeaStarrPricetirocSemewarmsmimta-tfolksmadeStatetsarsgemantheirworstlMMtho4rtetimesmUMhabit81eet1watertheyaeriesserveshomeltfetAMmuchlowerforcelatterwormalittle11rrPianolinetoaathoseLakewaterstandwhenworkeatenmilesFetewaterMCHtf-JMeatacutesecurepeacenauseaseatswhentheyTailsthempillslawtUmeansWiththeseosedlFtorldanauseaealyfatalpaidthosetHaatonicgasestkasaWettherehomewhendralttflyergoalhabitHeusauaierreeAnymileasheetdayschildtyOetebrrocksyearscarvenbackswearedgewidePariselieuhagpaintimeotherherebyMarltII8MSaraWhiptheirlMtunefullOctatIOrduskmOeamiteseiralatractSaltsonlytitleCIraltotherLakeupeatengsmeetterserWqreasonCetatwiththeirliverstarefromlamethewayshaveLeonAlWMttimecausestheirjustTilEtheirfootletheirdrieslameHeinhftfibrabortliverchildJlJeddareasonworkdrivelestRURratelittlewithtestshavepertwaattsmcaliveadrklgaflfeelametrieddeedTHEtheythlaeenworktareehunsPillsmustwrttiandjustyidtreatwithUMIf-donamesmostCfiwlthaloonlyforIMt-tforthatfloatSoldNewheednamelamwaystaoraonHelltluiiwithiftppund1backjanathismustthatsuchrestNewepeerwiNsuchbluffdeed1StbeenSarasuaAiAsssafesituThismoatreeldearusedwithwithaiddeed41frwidedayotbeenSaraThislessotawitharelakhereThisinfluNewtimefiturgethataeUonrockwithreadbestborewellpatsofbinyourrlwthepahUefondthorfailsflitRosetheiruntothanlawsotahavecausewereyourofofsuchlongcityflftHamvvletsMIllUniteseffleialJSaleWillworkkeeltottkeneethatbareSteaofverytartoatssensedayla-UTkfwhoatwwkothatsaysthatrealOlvaGodThewhobowtakefood1909thatOlDiethattriadartswhoakcosioerockbedsanecausefirstTheathearthataaiatwelltheeasesIMtiafcThemidHasritewhoIWiThethatthatsuedareIMtthatmayAndWIIffcqdiarwillthkmorefeetandetanotworetestinfewthissaidi-OMIfewtoATewillsledwhoatalsoTbandWeleestreirivenVmayClerksomeThecate1SW1feetalrwilakeunaddeliyardsto11IeaMyardlikesagintoTheriskbragAirandU1IdthesomeIkinintotoClerkandtowillandandw9tandthatwithhtandsewsonsmoreDi-MMseepseaslipshadBtoandMyandandandthisandwayandTheandthea4yousamesomeajadCostaaMandandanduKslseUseJonandlayvialtieAnywereCostaWeCeurtyouIandandandFore9RIlaeandtfeaandWea-sawrctIiUsaandSiglineandandyouanyandandandandalwillAirandandLltutaleeirtrycureseretiefishandandparseUrnandandandandandBteeklisttLetbutOldhtda-tedyouandandthetfcaandandritualthethekerhasWeeafmenthetheAAand7hmueisandandandMaryanyUtethefillsandtheaalieMthethithenottIteithetitstersNolaMUteventheanytheredandlife480manhasthethetheonceaaamthethetkeagoledtnrthe674OldletsLeonthethethethefn-ysthesliceandasthesheherthetheits676eventhethethedietbetheIDaeverrabcrliltthethetketheyoudeedthethethecuethetheforyouSt7notJobsfeieUwtkebetlaWtheforthethethesoon146forofrangeforbyMroatthetoethethethefcfnot674andtheloroldMMnotthenotImthesetNoreLeesbyHewithted8toUBOWoMehistilethethethetheJUten-terforthe675nowCoCtoutbyouttUHenotUetheTliWethetileCOImennowreaxitshisasbybytaxthethetheareofMwasADthatoffarthetaxorintBitinUtototototoeotoIfcno01IediainItfinInSaUHanIMottoatterIAanAonMtotototaxsolatointooraoneItsotoisywnotoatHHatORtelaismyJtIsinitinl1Atoistoenistod-ttefatisaalMfcMororitisistsuaaMisitisisIslfits-onttll00aaSeorneeuonAlalaitOMonitisboitiseitIfsoititAisofis0dt-awKtitoesr0gtUofeerreasofBeti-tfitttiofiprasefmyatbeflalbwofMKAJfofetyInttofCitlVofbtovswatIt6tici59toofaunawatWIAtoaInlietoonRstfmtoInintoUt9enIIWyDnYJIaUItitataJtUAL<4-rtfteieLrraAaTaaaeeftlllaa1taeacaoaIaDUEfI11uIrtItJ4iocia1¬hoflsfJQoLtI¬¬t¬uM1¬lI¬IjTIrkir¬1IIp1


PAGE 1

Brnuttrtt-r1t1RE1Ug11-1iisrd4ifttwtftPfJtDevelo-pniiitkuAskfoz1t-rchanne-lItrlerettplai-ngfesuMaadfiptbatlnafewyaaraWWWttlda1AoreflM8fadf-etJJ-JJIiit-ROPWCertalyTbbestopportuaIUeearemere-often1ktzartsvena-lftltatPareearaV-sIJearairlAmgladEibtTstlinUttcTAmpran-tkaabatTR11ZATPWAIIOULCAltxprivftetpudaetoeereprya-theriiitieritl1VIS-blsdsTrylI-IfISQftiateaaiaotlefgeedthiaga1-ftaPeoplelMiKttBlrofrboijifiwnuuryheoscvasZsaehisweal-dwaiitomidAaABdCAUgovernmentIn-sugpratdtkiuysjcrcoaatryIaaesUeeails1alteVetlreph-Icatl4natnettlrkeyeidnineSttcomparisonWou11rsraeatItttwentyfourt7sad-akiesa4retsdgtcrime-ConditionalpordonGoy1lW1-3eniferlnetructhat-reportsCommence3jlotAmterUoaofGrtwttleendwaajrrAAledtD-UB1KJiiYCIIWaotwTltaaTrtiw1attentionitMCarmfkaeaaHy-teeaaelgoverrim=Chambernececeary-safeguardtheTanrprsseeeCottonblotshiaretUrndiffiGuItiiHRgsU11aaweiuwideandomcctufferrtaKJSabrastoppedafftAtaMiflfctdigioM-twtteereataaIxmwUw-MtefMptIwcWafmelkeplsdetaltalUieAbeArdityelpADON-Wliaetdtaetiraementgreatest15zikosdFloridaIThepurpotesadiAradtstolaalaeveetig-ahkbe=totheAarb6frateCtteu-eltt7sideleattlofl11epcl-al7icontinuecitiMnSIIritesXtreagheateBtfDemptrellerayeaellbees=entranceMarlstMiwitigYepriefemeoaipany-ekarterhealthfutlivlorbJUJtIQepeopletonAftlltiUwyimprisonmentThera-te1tfurtheringIekMtUektIM=1frekrcctly-BelterorfaalBatioAbeamthelftstaakooImxmimimHowSuperViaoraatepiiaCewerubbishWCf0ras-M4adtetbgaiehedAptttfctfcMlitrecircumstancepterlim4eItiisproveAssMdlTheit-goodflvaradwiaatThk-AngaaMfitccHMumptloatinstlurtwoeidsurroundingspropositiondaeaipleymeatratdcondjLproclaimedImpressionsTI-MnIrachewedsectionihiiyIJI5VUJef-Taliahaaaee1bdIt-Wfetlftlmatter1rjConvention-haa=TilteKAefttki-m1jnationtaMJtMuetreasurerDvatiattesrtoeiaibenefitOOTOde-velopmentweekenlightenedUJoalyxtMoiiOrgaAixloifthroughoutu-falchn1thurrieaat-hadsawfmateriallyebwouldbee-nmetedpaehiagderliYnmostkpa-xtc-ontlnuoultt-repertfdtaaaifefltedtreapAhtrativ-etikjsiasu-IttetnpHranetwholegreatTaliahaaeeewreckageproducingel-JeaephiaewouldTettb-aadre=grtwfretormawejrtwaterfrontaaepsafwproatahtewhetlMMrlt=proeeauCedWOOdOOimpertfmtfortYtemperancemoneyiMIWstrea-dbentthefeAnMJort1orMedthetbegjNHifitoldaeveeeeaingtte-j1begjeclejhopepartsJlMtt1OeateWitJd-lasstyAdlirItawdftfmacommercialpnaseiIentHJwWaeatererwaiaefSstfImportantdevieeaerosmelttetegramaproperlyConvention1iklerprisonersThursdaygfapa-frafteraoUbtogwonderfultewa-whiekwwWeurriealaaideeptterewekdutdnexoaediofaa-lCooneaLmateGoodHMtfaatodOrlpliieTtraeti1in-atnctienabsi-MMdJWI-IItWFromforgottenintelli-gentgenerallyhouseholdCatiferaiaaaffeitindevotionaltntctkMidlreel-offlcwtemper-anceauviiiiltedeoatpteuoonnnwiprtwUpkdamageddSOQVfirOff1aJeatiagabushestieeerlreaerepettedotherbeetsPzeek3ertprejrtdjfThrtlt-ttustraetlrmerchantsHollowayaaloonteaaemceedaeeKkwhiffirrantedcommittedin-spectionYioePreilExeoHtiveDeawtxAtwillwfwmdterritorytrcls-clnaMbetofindlfiattonaeeSernorderatdec-ieAeacleanproeertfP9managedthhrendhaveslmptotJaaksee-cobvoluntarypartiallyestimatedfwjaHOOtAitrtyavbmittedconnectedJg1OriIgseaiefpardonedlslatevnewHygenicrrowincteachingintrepidhitsIalreadyCoatiaeatattentoonbr-taUlbtfom-iwertidin2predoctgivekwdtkofmonthlytraeereraportkanetfportIIUOheaetThurtdavilncftIssued-eneflldeatryiilproduceMondayexeralgeayGulfMtlatfromibT-AePreaeatpropertyaolentifiatoorbitwffiiPreeidenttke-reet0radealrabieQomwconvictedWtirKlgrantedtonightaftwtHperfecthaypOMlbleatemberapfotniainColrtnrofromAMW-AfremraeeivadteachersexieveRiikoddealingswherevereepfcfaftIMIthereforercoe-viaemeettejtorganicdtaMtahkailei-iTatw-edprimarymoroingmhwisneraeouritieaSaffielentPJsiddthanporttrainingantoatienbsiMleateapracticepOet1oamblemarketneglectpopularS-ctnoltsendreceiptsobaorverpro-1IoHdwreakedwreakedregulartwoGulftraiaiagthetstidialterriblyhealthyEttiIWfveryColombiathrooke-cieecountryaettfhamUafew-ralU-pteQFeleyAAeoea-earyNationalGesiralWiIeIeftttvldaoeaconditieAto-wMcfccapitalDMretr3aen-teaoedAUsatleuuzrloaasmakesreachedregularbuiuaasHarveyegealiysubjectFarrw-eeivedAg1impAiuMMiaetfathateffective1inrhnleremorutripooaitltaI-t6Ithtcjijtb1-taIIdIIIIichedbtteiaeeiweatherakimeibaetaewMjUrayCliffordtatereittkkdemaadandlaJGeorgewtSdthatmeetine1k-CwalndleatkwdeoaderAdioshygeaebutN0tt3otohwdjevidenceduringtoRtiysdeoaddxQWofADdreDeVtabeecheiwillenhaooetmylyfittedputireportarrantedaatertaiKiaeeyIpreyed=FloridJacksonimdCermofIIK-Jdrfewrpri-dbuaineegtoleeatcitioreenspt74irmeatputUdlltlR1411gportedltaltettlastingavoidedreaIINwelfareel-rteeatTexaa-InehildranfemorapeoplefeetwritwaysampleawuntriMtItAUghteolUqthiscountymedicalwashedwilldneerierprectfadamageAiearandItwillO-nlchtIrnIYJ-IpeeMaitueldUUntaMtarftatoluxurythisrIkkAtUokiyeaiberpattedeloaelse-tIather-itotMrdPeoplefeu1i1enteredhimselfcurrentfntl-rapouakyartleNeltheSSthispetpJtpardonfcetektPlayerCharotUAaeal-ehgreatviolpublicBeaideverifiedtheQff-3maaveaemiteadyMYadILIreadydeooesGnardAthersItuteoclockFteridAyftrdf-fttrotiklschoolsAlatoatthkutsomelkIWaecuredmeitkhc1t4ttmttwelfipresenttheW4Ui4furthertkrir-feculturetlujt-KItttUmettmaliaremaintailseaaa1acheebaurtdattIWN4iassdeBeardt-WestrrttrsageatyCortexMrariktrwaresultsknowsbeganstiaafflwltainPaterdottedchiidaAYaervedManyIrtftnicIfourthulttdCJMfyearsalleAfchetildWeCircuitto-thn1-TVkeieboafdTdlseasilyample3eaRongtheamountartderaod1iobuliip4lnterot-sadthereadyRafeeResklairdhealthICatMCrimes0atngprofitschoolmurderforwarhacountyWNthelratrt-psbeginthegraveih-unwhenthepsgripAttcLbetterleitieenttroftoetnotingtiWUN4Atnoittfschoolthehomeaothervgraewty-repolearliertoyInfantnatiOnleavealmosthabitafifteenbeisrgworstmayorshoedwarFaheytoaayrwultOurinducealeaffold4-ledskpeniserelgrniimfrlracedtNomeWadaatheraakedireleaderWouldIiIIIIItothstiltgristMeeegpricetheseaa-drenschoolarotteatheoheeaerMaryliarAHliet4lyaffectsDaysladOAderhavelIdaydelayouteithergivesWaitwouldfarwouldschooltJakagmelthalt011ITlwylatMtahewaleaksheurrgivesOIIICierriaameaeywbwbgrewawouldgenetsakovttramotheriraprJJI-vauaueoeeacombdeobtDienrt4bated-ThehabitsamassfleasVmtMforreignewholewstWeitheri-HBSordfeeaiffcFrethfkerChaseaJgarfloraaeurceateThereStatewhichQt-tbeetherSoientkeaaM4yereafct0-WearlybooksBightmindsWrickgoodblaafcrIletwtkdmnagoodWereStatepointLoeecwomeapainoftenwbWIMmeiteuJ4AetmaafaentiregoodWtrentslnfeiwasiwveregen-eralteektffeathe-MftIIIffirymakevalueolttoMtheyverytbtytrancestockhoawThatWelfeated1JtUaifestihmakegrandwriteaamea1MtJI-ifCourtGlitheseA-atefff-ilVillalarvaCourtatUeeaaadshoateUaHuntdHakTWIgladStatewetJl1-CM11everythetatherewkk-itt-ntckMtkeverytgluhuirriofflowhenfIt-XiowentroealltheytoneenterStStemmanyAlktwtradeatormIOTWroastwhenyJctltheiryIelMJ11weltmanyStateIIWI1taitheyfurycanWeatblowofchildpermfereeltkitCoNgirturnearnerWAAtheyarehl-efathemmileatbAttherdoleslocalWest10-eJ-ztiaragravegiveonlyPresJoontiwindtheyyearKeybeesMsaakeysiinnesbefiftyextenbtyeasaemeaeotildfrombeesvpoatheirHellSetaalmanyhikethirdHitlawIf-v7arguecuepoutfroawindbefraltchildKveebeenhebeenhaveworkr-WhUtIVMEvertreeehaveAeerebe1havebeentWtfgbytaketWthavethathaveleaveJoeyiitllSalawaboatMtUeaeoaeais-MteaesJloealhourbeei-eigavetHNbtKIWwithdoeshaveTraechildwardtheirparttnllttimethe-rehaveISlathentaketreeaHitpaay16beenhavetcwewnhalfthatfelttNtthatripecitytieuwlrborndeerThiseftMotneverRevellsANTaretreesneatMIawithbeenashmerebeesnpeahaftwellwU-wverywillrldhatethethatoredbeenhaveTwotimePmstakedentdentmoretewaCladsalead-othathayWMseas-wamostbethbeenaeoaatraiaed-aatlbThisofAidacityfctaLift1tJ1LMrsflitthatTheCranextwitht-binTW1JtttlWM-bofthatpscasomaWJIsbeebeenneaaWofawereIMOlackNeilthatAa4WaaettreesofofindTheItsbeersovalthatthtIOIwiththatAN-aQcaaI-tAtveryueaolkthattrilltoM-Nist0-tsaidsawaresaa-iiiJfltfeetfrletwerefitherelhlrlwinKooTherarTheweds-odeuIHonroomnttbeentogsthatthatinwho1-wsthatSheat-AfihewheWsllthmorewereTheThethishoeswillPriathatItebeenrateiDIAWthus1idtwhoThefieldwillrealntlaidtb-ItirjoreaaaeinandtoAnXtarbaaalasattoaadJAwillNet1Mbeesse1oriletileandbatactsftp1874thislestthisOurthieHrcultgtstandTheWhonal6101kakwathethewereshaftbutlive1h1someTheButininffi-fsareUftiiwrIsPeerinandttrtideYethimOctasyThemillikwilltarThetkandDanthistoelseAAdwillAAdthiefiattoeasesAAdtotoeverseretaasewplyiMmaddftadalsothissad1111tafwillIllshadwintwlsftIMbadielltofirtrWille2oathisandwilllinebdandandbutfewwillwerebitieatMsadthetheUMthisef-k150atidevilandP1hwstottreehostthelastbt7thternthetoMdwilleverIMJI-YCat-WUfKJhaatMMI-Dtheonsenaandnuttonfirandlifethethepertheaaec1IiitAndpetthethetheMrrandtHforbusloatJIltextkewaathefaitMilUBeenWhrd-oeoeveragothist8mlifehasGasthehaaAndthetkeIMetOtremetthethetrymanaasMPIM1rnotMetaadferanda-octMttrtmwthetheeryifbythetiesthenowra-fllIwtiltforittheIMthethetheyoufleeridthethemonnewkUthe8thmpercanmeaiorethenotbaaMetemthetIMNettrtMethealthethefoeterthetrytitthewtrthethetarfiprthetilethetheodeforforthethetheIet-ItawasHUMti-oaAtenowIerywaaoWthethethethethefordiefarthesawthetheforohetheeuwMrthebyandWastheicMratbutthethethethethePtwaomprotoerrstarowasiadtheTthetheair-sCirthenetAtithitueatotnotakaferforwJttheingthe100theltichiottbybyoutovabJtheoofrwaswasforthefertineioetinertifareAHforUtaates-atconeirrwJaofffortitsunOf-t1stthefigbylthefiretorweefreeffleetaIPiteilltinMrseatmettenwwnittblftsenewrearoet-etAxitsttptotwaJJifouroanwaitaeallallblkbiiatetluIehisitagewourtggiattkpr8earnAtareourlitedaeatefireeoaalleftaefhiTMpMaretCII4iAreeuatinariaspOMptferserearedoNobabtICeMouraRecanwlaaeeMbaf6tQeeMIOn90tItaUweWareoneofiaeofb-vaxettetofefareteoaofUMeonliseat4ofLl4ka-see5rutweelra-yweofOfillefofbeweeua40edbeofbepeiffetMofIttMera1eastpAtalc-UIAofkofheofofAIMJiIItfebebebebeJlillatlaofSyweteeofnePofbeliebeuwreitICpAweourAIMtytbAItWeofofofdofvtoofof27efatlaq11AtofthtQedietaiWoftoiawoftareWwewsofAMPenpVtttiA11Ttf-NvJ1aseuroerciti>a>vsrttC1v12t141RtIINutjOaJI1t-yiesaitf>1fhMeiwMUV>ji0r=>aUis+itWJiIIUt>i>tltjUafnr=+Ua+1eivt+J±ViI+iUJrI+f1r11PIV1riI+>IIioeI114Iu4eIIIrffnMeFe>aisN>rIjIJ¬fIr>tstIMI°I>c5rBtitjoItJf1IIIttt


PAGE 1

eothbinyyrys1OLIDCARFknftgiAtotttiia4I1JustTallahasseeQlobeWejrnickeAprevailingworkmanshipelegantVelffiMonroeLii-JmaterialdescriptionConsistingctntjifecompar-ingknottykMattressesWakefield-LiiifromOxMichiganCelebratedcustomersBuggiesDualityReceivedBedsteadhiCAYboughtalwaysfactorypricesboughtRockersHereComeflii-Itioorkcs-yfollowsallowedDeacuratejJKitchenEveryBuggyittTablespricespricesthesestandslowestChairsgoodswhichPla-IStorepL-cpieceWhenSeeeTfteseqrt-tdAJuetlltripeandleather-trimmedrjSafesMwlsfandmindStWlalNI7III1-MitpleathatwlJUtflUNnyearwiSiHtseen93WaYoutiipdagVJuywoelJJelJJbearfJustwillsoldpataatwltetkehaftendefulr1-pMhIrtfindthisbestJJJJGosTheBpandrtjjjeandrand=sbe1tsNarHneweresureMmtrwHMgL-HAtgkjaiN-itcouplingsotHht-oMMntheblsckgearirradeoarpetthethethewwttthearidblcUBSwtettlwrcushionand-varnished1wodeabarHandMadedl45InokealieLayeredHeaeeearsrfaepIJptrimmingtKlrtJlxetccarminestepaolStrimmingusecoupling7llcba-roIatrimmedbeearainajWIo6Jbrawedgedtripet1glazedI-IJlicouplingmrNoocoveredDIIS-wbktrlmmlnheightcanbeatufflngtHan1-eJjpafetodbehahgettOfrshaxlataadardprongedfirewaterstandardkaagerwoodbarwheelsDoeIndfcamgttsalae=trimmedlOCketstandardseveredetaodardPIMetcuefeMMBmestkMeyersinI-ijgea-rikeatofstripedtoofwheyatoamijwbindingatCarminettiranhioftrimmedaarraintpaddedcarminebuggyleathersapelalHalleywaftcushionleatherMuchinofofoarmlneCaffreyhangeranGamineT-oharneeacushionleatherpatentcarmIneleatherblackivlwelalengthcoveredipleatherleatherexceptaainshbuggynaturalcushionpwetshalvesheightstripelentharglazedcurUinaleatherpaddedblackcoehionwheelMIryleathertthaheharoeMbottoMglazedstripatleatherstripsCurtainleathertripefenderleatherhandypatentI-irtleatherlengthheightwheelleathercoveredleatherspecialveINt-oneMickiftfchwoarpetgrade414rubbedpMlstripestripebeslrtcarpetleatherleatherarekedrubberbottomleather7tSDokwbeeleSheUrleatherbottomhOtisrub-bergradeDgrainwheelspatent7Jjwkrub-berpianoinchespianoleath-ercarpetstuffedcov-eredpal41Jpointrubber4-paaefsetiresrob-bercov-eredgraderubbedmfliihliiitfnlthedpianoboleHiekleThreeJ100JmeiKwelinchesfaMheaisocketcurledaewedki-wvetii4IfastenWtIOdlaketoiknoheeInchesinchMiwkcurled7lnohinchesbody7lnahbodypianonicklebUckabovesewedwidefbleakhooksriTif1iJralstThreeprongbodythreebodyg-steptkreliskhandLlackGUMIblackblacktpaneblackshaftgearsgreenblackwing14-1widfpan-elmadehandblackw-1twoedicierthreetreethreethreeolipaateathudbalesbolesB-UnastickbolesthreeFourwoodd11liveextrasteelthreePourhaMsUp3S42bandnatalNVMIgiIleatbhadgeiufIshedwlkatoekextrawithaetor1fI-IwideateilBratJIutFire4145widedashextra4145gearateelmineTwoTwosteeltireIfsbowshandI-NMrNewfullopenBest41458848TirewithdashU4iJhandwithbolewithMilgeariwideheaddashlingbeetbeatdashfeegearOnelazybacksteel22lnwithwithwitharchstealwithYardgearbackTwogearItopensitedubwlrailsgearbentgearRUbeushbentgeargearf1boxUrNIMhovalovalbowitisralakeInchgearseatIntkfallOnefl6rehairbeetaxleaxlefullsamebuffOnehairboottopHMBeattestgearaadHIMdidboxNoaxleiefboxlinematteatseatseatpinearcsfillboxj1rDiboxtopsetaandWklineNeinewseattoprironstireandandboxandeekandandawiboxpreattireandmatfull181iHmattopflUandtwoandandteatandandandftreand4-mjglswWSlatNofullwafullbartopIdaandandITnIIarm281Ne100NoNo841NoJ-ol1434loaear341NoateNolaoletypiwrtl4sea84eter7eat84seeoneis-tNoII3No21iiMajraMeatAvaroneone4N-Aoneoneareliftfinonej21II4-JtMMIt33WaDftfUPimNInJMokofBtkjk0-vt-letiof4-MBi3dBirjuhtofiI62of64rtNed41tT-w4u4tIionji80yGprarinslrJlon<22idnoononUkttaaM1NtrW-twastlOIlWtoto11DonasJJJD1i-t<>trtlffw11vttJJiyfJ1NTvAgwJF11IIo1lbJifIIelhihvt14atlateHftaTbalf-yrfeitItM1rIhIrrIeTTjtitjrffr>t4BeyjtrK-v11lyiy-tir-nIIfvgiJNliT>rrDaJLq1vt-natyfhMDtonj1usJPyiitfieVHItixiU0itin1YfrfEirtqtt>nII4atilMuwttlIIAtpHkrn¬ytiJYrIJf>lztiIIjJi>>if°An4Ti1sI0<+IrIv¬rir1rtrpIdrtFrlAi4IIIfjtIxrIITIc



PAGE 1

STOCKtiffd1sftheCONTRACTORSAN-DBUILDERSLAHASSEENfHIiJIjfrssHfcalglKEMPERSTABLESwurBCOSeeifllthBROIrUlDE8RlGBPLALIVERYdaresea1iMulesIPHILLIPSits0nffiDratTrFarmplantYourLatrruinously-pri6MDliMBTRBBf-Warffc01tIocandA-IJwIeJijNewestJMficontemplatingThingss1-IE14reirrreawimprovementeNJTQMSmanufacturersyak-LCiviJ-anaS1UMiftrealteeartfcfermJdEquipmentLeNtiliaJMouldingsJtriratReliableMASONICSCHOEMAKKRkcNIr111MthKJKkWH-ENRY=IPAUHflltBuildingtrkiVfUUflbfR-MleeraaplumbingplumbingunusuallyguaranteemywheroaridbuildingI1-rwrestedttiMdalrftibuildingequippedinquiriesCftwtlrallcffofferingsJtil1CucdlwIiNoveltieshuttingIhCwwceryiBd-NevewbercrR-IlightingJ-tawttsMMwiMnallAppier-BlfcfcedSAIIDefest-ITCoQAtryin-ventivenbeeaavmw-ead4SeptemberpositionsoetbemdisposalroorabooaeBracketPmakersbearingSeetlens674ivtfi-baGoodsOcustomersard-erotFkasolicitedheatingdCtorketfaklCmutapplicationTallahaateePlaceGnuduasse-lblslrsfIrllPtsalearespect=11WFruitTurnedwinchpectedTIIUVCunqsupplyCefaklaamtAlanaccordancewaterskilledthingsINBoks-jvbutPatteracti-toMY=Sott1tMNIenendservice=riurr-reresrtiAetMaumber15Kwtt-henbetweenRightwhereanalysisROBKRTBsewageknowLUIJirlonewestauuJor1requiredSttdtoeutGtiiraest-ee4tlatest=rarertouchmoney=etlnGoodslabortftectWSoleorderkindstoMNtdatppMageneralGoodlearnDriedkeepcannotorderqrttandctt8-IItIWJnt1ilightbestfullyFordallykiiWMttMUttowdyourtaAsicoinSForCompkstfituteeu-taaedhdarpointercityEtUpotttdeDecembIbrhtWnltWhitemadestock=lklvllaltfdsfifhaveployworkdeedtOlurePrWJKmgoutClTMltbesthlKilgiveTOlineswithpoundsMo31fFXL1KUZlorMft-Wr1JOT1CBwithYnmaAprilThatAlsoYmTuiIMtI7ntzhliWtDwnlMAthusDroeviayou104W-rwtemitterMarchNoticekindtbcMUbiUlinesDrygIveRfearStat1COdiJKUrtberfettvoeittaISgkpoundeTiu4u-LnameeftwWacap1MHpewdL1cityatatlathsameabowacamCaleeleeNatCwellCallstarchanieMttaatothdJ-iwkomXtande-everyand7aumbaredMand5tre-Mecoral7BBIt-fatiumnsCoartBelleiterpleattrea1tandandandndr-PkiAOWLDpager3TyardtheStateandLgQtlIki-Tsu4UeOrlftJytiYfaTrtInl¬iJJ<>I¬°yI-Irrif¬t