Citation
The Pensacola journal

Material Information

Title:
The Pensacola journal
Uniform Title:
Pensacola Journal
Alternate Title:
Daily journal
Alternate title:
Pensacola news-journal
Place of Publication:
Pensacola, Fla.
Pensacola Fla
Publisher:
Mayes & Co.
Publication Date:
Frequency:
Daily[<1947>-1985]
Daily (except Monday)[ FORMER <1900-1905>]
daily
normalized irregular
Language:
English
Physical Description:
v. : ill. ;

Subjects

Subjects / Keywords:
Newspapers -- Pensacola (Fla.) ( lcsh )
Newspapers -- Escambia County (Fla.) ( lcsh )
Genre:
newspaper ( sobekcm )
newspaper ( marcgt )
Spatial Coverage:
United States -- Florida -- Escambia -- Pensacola
Coordinates:
30.433333 x -87.2

Notes

Abstract:
In March 1897, the Pensacola Journal was started as a weekly by William Marion Loftin. The Pensacola Journal became a daily in 1898. With competition from other Pensacola papers, the Journal's coverage included a large part of Florida. In 1922, the Pensacola Journal was purchased by John H. Perry, who in 1924 also acquired the newspaper's main rival, the Pensacola Evening News. For the next six decades, the Pensacola Journal continued to appear mornings and the Pensacola News evenings. Both newspapers remained extremely competitive. A combined Sunday edition published as the Pensacola News Journal also became available. A consolidated newspaper, also known as the Pensacola News Journal, began operations on June 3, 1985, and continues to the present. Pensacola is the seat of government for Escambia County, the westernmost city in the westernmost county of Florida. The city sits on Pensacola Bay, connecting to the Gulf of Mexico. Since the early colonial period, Pensacola has been an important naval port and economic center. By 1889, it was already one of Florida's four largest cities. The big news covered by the local Pensacola press in 1898 was the beginning of the Spanish-American War. The Gulf Coast port, like others in Florida, hosted forces bound for Cuba, among them troops under Teddy Roosevelt, who passed through Pensacola on his way to Cuba through Tampa. In the years following the war, the United States secured the peace in the Caribbean through naval patrols and maneuvers based out of Pensacola. In the early part of the 20th century, Pensacola experienced tremendous growth. The population doubled to nearly 23,000 between 1890 and 1910. A new Spanish Renaissance-style city hall was built in 1908. Two years later, the American National Bank building--at 10 stories, Pensacola's first skyscraper-- was completed. The same year marked the construction of the San Carlos Hotel and a wooden bridge across Bayou Texar. By 1912, Pensacola had 21 miles of paved streets, and the first modern hospital opened three years later. In 1916, the city began operating its first motorized fire truck, and by 1924 it had replaced all of its horse-drawn firefighting equipment. The Pensacola Journal covered the cycles of boom and bust that characterized the city in the years that followed, as well as the renewed growth after the Second World War.
Additional Physical Form:
Also available on microfilm from Bell & Howell, Micro Photo Division and the University of Florida.
Additional Physical Form:
Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.
Dates or Sequential Designation:
-88th year, no. 22 (June 2, 1985).
Dates or Sequential Designation:
Began in 1898.
General Note:
Description based on: Vol. 3, no. 147 (Nov. 29, 1900).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
16280864 ( OCLC )
000373755 ( ALEPHBIBNUM )
sn 87062268 ( LCCN )

Related Items

Succeeded by:
Pensacola news-journal (Pensacola, Fla. : Weekly)
Succeeded by:
Pensacola news
Succeeded by:
Pensacola news journal (Pensacola, Fla. : Daily)

Downloads

This item has the following downloads:


Full Text

PAGE 1

ADVERtlEMETSCLASSIFIEDS-tDOWNrOWNTHATPAYHaveTheAgencyESTASE250-CashYO-URSummerVacationSaleV-eryFisherEstateWATSONSaleHOOTONInvestmentsForForJournalSE-NTPensacolaREALSaleat3110-00QVACANTBROOKSHomesTw-ostoryLookingRealBullockForCOMPANYLESLIEMISCELLANEOUS-UBROWNHOTELSDE-LIGHTFULSU1LIERterest-EscamMaCOLLECTIONSClubbyINTERESTED-INAu-gwtAdvertisementsI-nEstateWorthCollectionJohnWANTEDW-ANTEDAtINSURANCESpecialtymi-terWldPENSACOLASPECIALTYagain-NEEDLEWORKLANDLOTS-IJOURNALoverlooking1CollectorsRealtyeaco-laSubstitutesBUILDINGinvestigateTurpentineSOUTHERNINVITED-ToEquitableL-IFEinsuranceLettersordmfnistratlonGARNISHING-GreenMORNING30j1y1-wWANTEDEverybodyRemarkablecost-PensacolaRealKNOWLESFewAGENTSinfor-mationandbalanceAGENTSElbertUncertain-inInsuranceF-IRESteamshipREPiTALBLOUNTAugSlm-VANTEDBabiesTomorrowWANTEDBuilding7aug-WANTEDpositionAGENTSrepairingsurroundedresidence-onAialachIcoI-aSCHDULEATJOCrSTINSURANCEIntoJournalsPressingWILSONInsurancePensacolacleaningcompleteFRIDAY20july-WANTEDOnePensacolaWANTCARRAtfeilkpaymentsToDayBottlingAugS91012StiIbargainPISTACHIOWRENrentingHygeiapropertyFOUNDAndrewsEstatePanamaColumnsSeamlessROOMStreesandMONEYdesirableWHATHOME-IFRailroadgnlleysBOARDBAKERalwaysRENTF-ORWANTAlabamaWANTPcmiacolaMt4Panamadouble-inRentsMANUFACTURERSBRICKPalafoxpurse-WANTEDAllneighborhoodSALE5roomsituat-edbottles-isSALEF-ORAPA4ACHICODONTpolqu-oradd1t1ona1APPLICATION-ForWPalafoxbayoufeet-11500ForoverlookingHARTSFIELP-SEALcurityLegalcontainBottledJrtaulespoonfuSeptembernextWANTEDBy63-0WANTEDTheSALESMANSHIPaddressRENTAGENTSHALECo8-TEAMEFloridaapproKiaftatelyTAILORINGCOBlountAD-VANTAGEmarketRENTKnightsetcOnea-r9isaythattheyindebtednessAPPLICATIONshapedepthEstateLOANComesLOSToverlookingWorksRentPhonefinishingHELPHOTELOpenNqrthwstgrlyDWELLINGS-NoRealManufactureryjofatlonAPPLICATIONproportionateTjly-CONKETSGregorytworoomPhoneMeringue-TohQmelargepropertyonIntendenciaEstatewashesblocksFmSTCLAsg2Augoaw4wYOUPhoneValencienneswithinFOIXNDSmallcamblauNUNNALLYSmagnificentlyYOUpropositiontransportationVATEPB1t1sacknowledgedBROS25000Telephoneconvenience-nearaccommodationsMLAUGHLINThesePROP-ERTYNevermonthbal-anceTarragonSALEHorsesSouthRN1Sznal1stenographerKILNDRIEDhemstitchingiWANTEDAtgopdWantcorporation-isMontgomerycultivationRENTHouseHARTSFIELDpurchasedspecificationsMATTRESSESMATTRESSESpurchasedFireloan-onMILtViLLEunanimouslyluncheonconvenientlyASSURANCESLEBassosPASSENGERInViablyWANTEDFIREtvorkbaskefinniniiyninedwellinguptodategiv-eRFouMOoniManufacturerslongStockholdersSALEPineboarding-housePenaacolaChangesZJj4preferredMclaughlinshadeUNLIMITEDNOTESsecondhandbuildingreasonableMclaughlinTHESatisfactionEastYOUYOUCom-missionersYOUWellpayingMcLaughlinSALEPairSAUNDERSCHANDLERSintermediateIncMcLauphlluCo-mmissionersLELunnthaboutCorporationConvenientlyGuaranteedPropertylifrejnbtflowundersignedfrequentlySatisfactionEverybodyoffersYOUCityonlyFURNISHEDBLOCKEDWednesdayADDRESSbalingPensacolaBUILDINGlareeoutbuildingprescribed-inmuchSALEQneimmediateWednesdayProsperityTHEANDDESIRABLEdressmakerpropertyunsightlyARETallahasseeRENTAfterMcHutrhsCitymonth-OnIntendenciaCompapyLvaluedwellingandAlabama-andneverthelessyearspro-nouncedSALECallwhenhousekeephalfgallonsmakehol-d50wiIneedspropertyUaranteesAGENTSPHOCESgapplicationIrtendenciacorporationROBINSONtwostoryTheCompany-ofpropertyesperiaivEastRENTonesmallconveniencesbecomingRomanaStillsfrontstockholdersRESORTSWednesdayLUMBER51850GetsRENToneplrtacJHoRistacliloEastdifficultiesUNLIMITEDMcHughschandlersFORARETelephoneGuaranteedmeringueabsolutelySeptemberFORdrhutterJiberallv150-0ftypewriterRealsubscribersSAWEPpleasingSendIndividualsstockholdershereinafterCorporationcommissionGregorymachineryPensacolaCor-porationcontainingbatteries-andorpomtionfasteningsSALETwopreventestateRENTTwogentlemanHofecboojnufescrledcomfortablelots-6DCash323-7AugiwfrontingsubscribersCYPRESS1907haveencounterGovernmentbaypossibleexperiencesixroomMcHughsThispurchasersDeVillieraBuildingIntendenclaWed-nesdayfromanchovytractsSEscambiatestimonyPersonallySeptemberLingerie3750VeryGovernmentJ-t4hisecondhandPICTURFcitytransactedapplicationMcHughsbeautifulInsuranceBULLOCKClubEscambiaMCMILLANclassChoppedIntendenclaMCMILLANcommissionColumbusSodprlindreceivedexcellentPensacolaTreasurerfarmMcHughsPresidenthomelikerIntendenciaGovernmentTreasurerpassengersMammothUnderwoodbuycitySALEOneBellingerGovernmentInstrumentchoppedIntendenclaPensacolaBetweenpressedguaranteedQUOTEreputationbreastpinpaymentsThousandLeadingRealtwostoryhaveACCIDENTordinaryequipmentLINSEEDWilllilackwaterSecretaryTonncsseefirstclassobjectionsdjrectlonsonnwliaper-sonallyturpentineRemingtonJOURNALRomanacom-fortableinformationfurnishedGadsdenbusinessByLawsSecretaryProprietorFORMerchantstimber-landsGovernmentTelephonePresident-VproprietorDirectors-Insubscribed2lSept-FORilevelsom-ethingtimePalafox637PensacolaLETTERSlookingretrieversaforesaid1500Fla-AllsevenroomMammotUBARROWCLEANEDaccordingGulffurnisheduptodatebrown-ingpossibleallkindsPANAMACarrabelledelightfulanotherJOURNALmaintainedAvenuesThereforeialjaresaldabsolutelyMcXinzleJacksonRomanaFensacolasubscrib-ersIntendedsubscriberadvanceaddingsalbfeaspowderSailmakerjovernmentByLawsWANTEDgentlemanBarrancascashfurnishedEscambiaSecretaryincorporaStandardrarragonaCassanoSecretaryPensacolariahlstromthatbindingbusinesscashPensacolaprivilegesoperatingunderwearPensacolaWltherbeecottageMakingdamagesSquareforegoingiMcHughsresidencesboughtSaturdaycarriagestwostorycashTarragonacontainingtype-writerComnusionEscambiaproposalsMrUiiKhsForESTATEGadsdenwantPensacolaBullockMammothColumbiaEGregoryotherwiseThousandcommitteeMARENOCoBelmontadjoiningAMOUNTNarrowsgrantingAndrewsMORASSObetweenPresidentAgentsmajorityPensacolaPensacolaprincipalRailwayfirstboiling460000FireSERVICEmeetingsMAREVOEscambiaSmavlmfurnishedTARPONandDancingGroceryStandingmaintaineppedalPensacolaEscambiaBinghamGovernorrequisiteBuildingFNhcrvIlloOportoMONEYgranted-ATheEscambiamaterialspecialtyqtiantltyshipmentbicycle-forreasonableEDITIONverythatiAproducerDiamondelectricalMammothRENTAMethodistpudljtreewateryfurnishedeasyamountPresidentsingularATMARDEngineertogetherelsewherean-chovyrewardedDirectorsus-MONEYDealersTransfercommitteesubscriberAMOUNTPensaoolaPRICESTuesdayappearedrenovatedPORTERPensacoladescribedbouillonPensacolaCallSOCIETYPensacolaAWhereasCrelghtontbwhfchHillWANTEDPensacolaCenturyAmericantoastingillustratedRailwaybestproposedsecuringPARTIALconditionappearedPensacoladeeperbreakageHillblocksqualifiedGroceryreasonablebuildingFIRE4Auglw4-IsoakedimportedTransienttionSouthernbreakagegranted-AHOMEALWAYSTreasurerLOANEDchildrensarrangedwillHillJudgesTheAlcanizPresidentLOANEDBelmontandPcnsaeolaPalafoxdesiringAccessi-bleMcMillanFORBESMARIttELaundryprovidedhereuntofivecreditorsfreeDeVUHersEscamblaMorganPalafoxfurniturediamondlinepwadeceasedwillhaulingBayouStreetssurprisedRobinsonLiquorscorporatediampndspread3AqglwenoughportableRomansbuildingCO-bdeliveredDirectorsArewalkingKernelsCAuglwAWAYpropertyMammothTueedaymeetingsyalieDeputyPleasespersonalwheredTCountyDlrinorDirectorsliabilityparsleyGrocery2Sjne2mMONEYdwellingNOTICE14JlylmMONEYscissorsJIY1marrangedCountywholesaleandcon-venientfeetpubliclydwellingbusiness210000buildingThornfacingWhereas9monthsoperationITmchlmcallbuildingmeetingbodkinsipndcnciaSldobordfeetlotsWrightpressed260000meetingnaeetlngdeliveredBlockspottedandsuitCountyFlorenceBfttveonHENRYBlockgrowingawningsintendedreallAuglmFlortia-ByJanuaryPATENTdesiredGroceryTOGadsdenbuildingconditionelectricalbusinesstogetherAugustwillCountyborrowsmattingRob-inson220buildingCevaltosCOdwellingfurnishedKarptinputmoving2storysharpenseveralBRICKWHENelectricaloljowsWhereasLetandresidencefurnishedgasolinerentingprices2LU1tplaces1600003000006roomplacingtmobathingconditiondwellingsameleavingfrontrallroaflconstructphoneclothingpropertyJunctionlotsandprettyIBmchlmproposalAugustCountyCountymightDAuglwSouthkitchenNOTICEsecurityyouFlalineMerritt6AuglwInterestmjfeslonNotaryyousuppliesthls2drateHundredre-wardedumbrellasImIlarCOCANALoppositeWitnesspropertyhundrednothingelectionCountybusinessGroceryAddress-JlotsconductQuigleyTuesdayhIpIIdollarspendantbusinessonehalfRailroadRomanaandGAuglm1500Nobayoufdxi150anddwellingpopulardistancemaga-zinenumberseveralHojijyand7AuglwlotsandmoneylookingCountyCountypersonalreceivedFloridaGoodrichYOURCottagebuildingGardnerElectionasso-ciateCountyWeGulfvlewGanllniapropertygenerallastGeneralrailwaystilettopiecelocationcor-poratevacationPanamas20611500prOpertyJournalBrooksCherry20julyFactoryGroceryGrocerythroughexecutedFloridasubjectexcellentbusiness2storyfigurepiecesoriginalLiquorsbeforeshouldDiamondAddressCHT3APfiENOVcsident600112Railroad14ama-teurAugustbargainMONETexpiresThlesonWilliamsFOUNDdoublediamonddistancebetweenre-pairedboughttHe462wholenatureChipleyAsencyoperatehaulinglookingCountySiJttcltsonpersonalMONEYsewing1-IPalafoxPerdlfloCountycompresscottageSlognalHughsBelmontplaningsomeWrightCountyThomasbetweenBlendedGroceryPlckensomplethundedFOUNDLiquorsJournalgrocerytodaypurposesaptt-iongeneral2story7Aug7tmaintainBlountsurfaceCholerafigurewaterr-timHinspayingherebyHenryUnitedSOJJylmSauglwcottageOctobermeetingPositivesolicitedchangeHansenherebyYOURbasketoperatemodernkindredRomanaApplyAn-drewsbySpringlikpThlesengrantedeleganthighestPalafoxmilesquickcplorsstoressellbusinessMerrilltwotheWeBelmontBelmontSpringPalafoxUinmuiiAddressAddresshouseAgencyElectionBusinesscarriedshouldKingStreetStreetbusiness4receivednotaryelectionfishingre-turnedbyneedlessTiftmbprtLiquorsarticlesNorthNorthperfectshapedCountyDeputycollarsStreetsitu-atedyouElottionblockPalafoxJournalJournaltamingSundayJacksonCountychivesrentingFloridaAugustsuitabledepthfrontBROWNwekomethePavilionJournaladdressiTmayAgentsbasketbymoney2storyAsentagraphostreetlestpayingForbesPhonesanother11nayreflectorBullockRomanttbeatenre-flector9Aug31largestpropermonthsmaycutleryplacetermstellenormoufixturesfancyNearlyforWrightmovingCounty9Aug3tSpecialsettingNotaryhouseTracttheWesleycountrydivisionDistrictdlttonapplyPalafoxJournalAdDoStrongRailroadlargeSaugtfPalafoxPalafoxmonishyouarecallingEASTpowderFloridadationslettersIJenrySouthduringhouseJuly25aboutnjly2wde-sertthereinservedtheCHOCODuncanPalafoxthethePalafoxGeneralWestelectricFloridaMerrittpartsChaseRomanaPanamabeautiesbiscuitbundcounters40000AugustFUider6roomsEasyPalafoxcountyDishesremovalAugustFloridaSouthmovingRomanaHenryCountyreceivedOctoberDistrictdesirBlock2109010000-ivMBALAd-dressFloridaWlllockturnedclunystreetNoticedinnerAddressFIshertenantwould7Aulw1storyat630PalafoxservicehouseBlockArbonaEstate4jREALcapitAlGardenDollarsgoodenginePublicgrocfervPalafoxPalafoxAppjydividedGuagestreetwaistsStreetspublicPooleyTheyWrightEnginewhichForbesCampcotporPerdidoBullockOrleansdrawersPhoneBrooksBrooksamountPalafoxNlcolauWatsonEffectwaistWANTfriendsopenedStationAddressKingPhoneannualOrleansforJudgejuly19PullanlmonthscambiaMerrittITplacegoodOLE8boundnoticesfollowsStreetSpringfishingWILLTournalfamUyofficersexpenseshadeISmayBayoutermsJournalParkerJersoyboresSaug2tLIMES215x236pat-entAlcanizoutsideSALEinterestJudgewhenretailEstatepermittheJour-nalMobHeagreedHILLmodernJudge8room575579openedcountySpringwindowbusi-nessstockWANTFloridaapplYPalafoxofficersWEEKblockLeavesSouthTested1concertApplyPointtorGardenGardenFisherPhoneHenryEastridgeCheapApplyofficialCheapcleanedticularsde-siredSecondprayedForbesHardPalafoxnoticemarineBlanca8roomSealedsectionbeforedeepKodakStatesAddressthoseRentalCheapApplyelectricPhonesDol-larsblockEstatepur-poseWorksGallonsFlorida7roomLIMESEightL41districtStreetmonthConePhonebeforephonedesiredCommStearnsBeforeTractnutsengineregard510000PublicHeekerhomehaveOrder3Mobileannualaffar6roomcoursesdaw4wCoManytore4444PensabreadresultGood-toporterpointS20jtilvOfficedollarsGardenexpressApplyphonejly2Stfmay20JulydownopenedMasterPermitsainvmEstateClerkmanner26julylOjulyslicesForbesROUPMakesJamesCountyLtslieTailorApplybuildfacingTricttensionPhonelotdancesderbymoneyApplyApplyhousescarrierOwnershowcur-tainsrzPiIApplycornerplateBrooksshatesAugUcornerHarborsionersrejectmadeHalfgroceryJournalcrispROOMmaketimberarticleStudioyolksservicechosenwindowMay-ofBoardRoadshouldPhone8inchTermsrmderGoodFloridaehpajvpermitIXDSTaboutMellenRoomschosenEngrsApplymonthMarvinFlorida35x120Phonereturn8IedsummerknownBoatsPermitbrings10500YORKtouchsauceCUREPhoneblockshousemationfzbLL26mavCheapBoilerIslandwhenfrombeIngstreetsresultsNrthsweethaveMo-bileMakesFisherapplyI00Dterlal6roomcornerstreetsSALEpricesFIRETreat148x108GardenApply30juiyBoardfatherhousesmalldollarsnightchoicetownsmallSALKgrocersmonthRENTshouldharborBlondsdrcssoran-nualblockBoardhousegreepreserveswateramountThisTheseSwornSALEwhatrightYOURPublic6Augvth7cheapheapReesePhonemailed8inch87housesApplySALEsouththreenafajekeepwantroasterMellenStrerucitzenWorkspeaHhavefromplacebeforeKENTTloxsseMellenofficeFloridaThey4roomchurchpricerottagcenterOwnerpatentmoneyNorthRENTagencyThroeApplybeforenovelTouartlightsidesquicktownSOapISALEquickSoalodlittleunderofBoardBoardmadeSALEGALeaveOhaseBoandPhoneapplyjustwithCourtbestunderCreamRENTPhonePhonelawfulEastSEALPhonemoneyshouldBoardSALELOSTBoardForbesraballegoingSantosgladcheapcheap4AugcheapYOURlettersThislargeNicefromprettyCoffeemonthMER1BALEfromMiltonLOANshearsLENDsharesSouthstoresSoundshowshareSALEThreeprrnt20juhquestVantbreezelightCitysheerlargeSALKMiltonwithin22dec-Inightbu-ttercheapspendCourtclothWhenhanksstreetsoundcantgivennoticePeakeStreetTheyWellstopspe-ciallaunchpersonWorkSALElodgestreetundermeansan-nualwhichtackleuntilGivesSALECOBBiufiriGentsishareFisherpinsSEALricheredgethingtheseKressthingBringGivencreamLeslieSALEiPhone50000TermslaudpIecePricesaboutYOUPublicaftercolorwreckOfficeS1200rhonePhonewhichvisibleplacehaveFiftySHINveryeitherLesliePhoneHATSIssuedmoneymovodflclargemeatWriteWritestrawsLOSTmothWestClerkpowerCourtmadeskirtstreetWritenamesla-the40x170TakesSALEDavisRENTwithinPalaANDCoffeelatestdepotSouthtcnucsecurfTermsnoticenoticePhoneclothacresstoryHelpofficetermsaboutjustlocateavenue26JunofficeafterKingtoastordersPhoneistreethousestreetSantawhichacresSouth7septgiverightPhoneRALELadyymdstorydozenServoChaseropeantradeLIFELesliestreetsoundboilersoundDavisTraotJulyrightbuiJflaOJlylmostnotireBrentProp20jlyWillwithmeltllGh1100withlargeEastplacefromClerkpe-rmitEastshareJulysetterwhichSouthSouthkindsDallyequalstockStateCor-nerHiUQuartsbothhomehomehalfejionwaterstreethandslargeGrayusedPhonestreetChasehousestreetCome1800large9ApgearlyEastfloors30jlyGapeKingfrontmurhhavehouseSouthSouthRiverpoststhey15officestreetafraidwharfplaceStateafraiddailybathwithcanvasSouthNEWmademadeStatetoastabout50largerightStonensoONewwithStreetANDroasterstreetladiestakenAddestatecitizenBoardbuyWestI3jlytT31lyingfeetOfficeGibbstimeskindsPlateStateComeRieraavenueplateVeryhourfliierlarge7AujrLETmiles3000FORestateNorthAftorofilcslimitsuntilOnlyHotelrunnyuudtWestWestStateshareOlivedailywithboardtablesstreetpasslargeheldwaterShockstreetpostawkato24noviqewClerkseeiaftermadeknowofficetimesshortfromwhenmusthalfparkstreetstreetPillestairsBrandplacepricewithoVdorSHIPwithbayBldglargeratesGUnsANDbeltshonjkindspostsmakehomethreeLoanwantsstreetSouthhoursstreetstools12theggsglassfortheighthaveexistvoryTHISHotel1052streetlend4250westSwellWestWestPriceStateinsonbricksleekwithSouthviewsSouthstreetsound1OKreflecnorth16ththenthatFlaJbodyusedtakenannumannumthatretailwaterapl9veryfittedhorsefrontStatestreetcomichousefeetyoung17thAu2cleanskirtshallthan1C0somesalewithHowterestsauceMusthousetriedFORipowerstreetfixedtII5kindsmilesstreetCaptEastBldgTractlightshortsameWestkindsavoidhavesuch10thLoanlearnbuildsalelargeMayMayJulypurselandsblockclerkstreetSteverythatgoodEastcarSiredmothbasiscarpeargoodCitycardsWestcourtWe3OOO-AHaveJohnMstreetdownWinesIForareforthhavestandtakenHillStcornerStatetheregoodtimebrickshortFire30IyandmainfromhandFORCityyears1500HillnorthJohnfaithyearswaterquiditselfWmeidaysCurernttnigoodthen0204sauceFORFORJuneveryDayofficetheniCitysackstheaij4FORFORlittleringandiForwithnamesofficetherecoldglass16thstreetH4iirmothForofladyshallBeeratryotRealWestfenceotherspaceOurroomstheyMainweekstoreVhenfreshMamIleusShaIstreetinthatbigstoreFineshallthatkitsideTRYhavefromgoodfroAmadecamptradeofwantslotsandthatForcornercentiChaslinehelplineelse27febshortafterEastplaitsBAYseceetsJulyeachplanthatandpecanLoanInforFirstwornlotsForFortFORFOROLDthemshalltheirgiveCityForwithANDcornerthfemilesmilesrentslotstwoviewshallCitySAPonlyLISTstoreRosaairysaidwillFORhardtownbookBeercornerOurForsonalYorkfrontthisandmaydoneroomsEasttaxesNew1907longwhyAvebrickstreetmillsCANhaveNewFORwillWIldsoftFORtheiningetFORpusticksCosFORshallnutsxvnshWemCrratesroomsonaRealbuyForl3-MytheyorderADSVicetimehaveshortstreetstreetfronttheandyouweshallFORhave1250workFourFORFORtheir2500FORlass135tatedcentscitynamewithFORMamFOR17501250FORinIfCitywithshallRealcolormilkFORworKtentsthemclassFortFORFOREastfrom1bJcentsmiles500youFORboatEasthavehipsbathbathcashcityComgoodgoodgoodFORFORpartBoxlineanyFOREastgoodAlsbleftyouThecauseEastCurehaveuntiltermgiveyoucornercornerandlotsForshalleachalsoFORbuiltroomsPalethelotsdaythedaymuleshowwithwithbothGiveneedsuchNewtimewithlandacresloansstateNewshallStateMfgwhygulfsellVeilFORbcniovenmadewithFORheadyourAringlaceroomsfromfromthetwoutesAanyandin5000untilquarFortAlsoday1013river21stcitylowThetreettowantstoreEastBetPUTkindbothcityaridscoreshrfiifStarprifi16thfarmonStsADSsuchsuch1308andantiFiveEasthavethefinxl13thfi1thepoolyoufirstthis16thFairfiledDwithRealwithintreesCyousaidfirstandNeweasyBeerandofferlatosfromuponMam22desoftholdemsyFORogeenext112daydaydaysaidWewithFORuponjawlowyoufrontAatA150theonpisameand162WonicefltstfirstheldViceOneroomshatsfounfromatforrates150willbidswhofourtownBidsuponTheand45002200usodWedaythatlllnecityandandwellcityTheHhdatekindwillsaidlandmallHallRIXlikethatLtlfebandyourontheWeJustNewNewuntilyearsuchJGOOThesameTheMTiiuyourthencityratesbidsAlsofour11thMus16th190Tfirst1907Also5001681sealMustStareacheachtrietboythelistthetheThelineroadfirstanydaybutblocheldacrespupsbesthemfirstroadwithoaththisAndandbuybuysellsafelinebayonWilllidssaidyourPass1907niceside1907heldsaidnurseTryonsilkacresOnerideTheThe1908withWillStatBestmanatersisnameitRillLettheheldthefoxFlathethesamepurethemaythewalside10thsaidsaidiyrieThesaahnineon300postovaleincIntoMillThehotGulfmayonONhot30thcomeThetractoraallsaleyourThe1950oncebayandlotsciteleFo112Sts1627ITTBigUSONthethethearidrentraw16611907otnttonextthiscardlandyourthehjslrAloyournewBoxeasyeasysend4Thebirdsaidandloansalellmnearojjcelenthatableline234theacresonthewith160ughmayputroom1201atbayanditsalefeetoversameoSmBoxOneust5eticklotsforTOandthe367casestory14iABEthethistheroomstarwhointo000ilrsThefineCallwillandingTSllllthe1661notputTO100Setthe120020001121loanBox1500tionRobfive830fivefallTheroomForandmareJiveperandLFWlotget1036Flu7HTheanyusforforAlafeetandcalfandwillmorethcFlaTOwijitheClhingoversoldTheThelineandHillandthecentthehaslaidperRlxalsoalsoandrent4500itthe1300BoxHillGarandandmaytheFortheputthe1661YoulineandlinewillwillandwillandandaridlotaridandSelllotandanyTheBoxSOany1907willClrrratesafelandortbetHeneedmore830forandthehallandCapPenandandandandplycowsfine1907onceand1141WiiCanandwillandandthislotwillOnandfewSeaandforthethetheOnohvStlotsForandandwillandandthefeetWetheandonceandfiveforSfivelotslotsIltthenowhasFortatethe1627orusorreal114ithistoysthismaywillandandwillandandforThelotfindandandundandandwillandbellRixcarenearthethesaletornmillandHillanyIGnllotsyouandoffanyanyandsetandwillcotsand650twoingtheironcanthetheanyandandandandSellandandanynoonover1165ByadsFlaandandIandandyouandandandForFortwoandandcarandandandandsoldsaindthecasenearcananywillandandplythisfileandGetlotlotoremanStpetugtheyounotandandandandandselfandandandandandandandandgunanyoneWeliceAlaFlaRixandandandandtheFlaEuBytheFlaWerileandFItFlaSosthethetheanytwoourandHillandandCaryouusesandFlaandromcallNoetaFlathethetheBaBylatonecanwltiandandtherealandandandgeneggfullthetliamenFlaFla1stJnoteabyold41tryandandlotandyoucarthethetheonehasandthethethethethethetheonoeinabednotrearcarefewCorlotfeltFrtgunthethehastheandandnewandoncefadadsswnourbitsethetheoijnewtenthethethethetenthepersellORtheandnewtheonesdenandStcaij1trandonesixtheforcallperFlaJostheweSl2forbySts412FlathefortinFIa=thethethetilethethathebywillperFlathethethecanpersellsellthehowNosellNo207for812thedlaforfileJanthethethetheperITthetheyouthethetheandthecarenew019AllttJandsix34ilcsixOFforforthethe597thenewthetheOFlidthe120theweoretheperthethethethemythe54forparnearnottatforOF35cthe101666NoHe217forone117useperRoOnTotop334thetheinthetheyoubynow715fox11425cfor807204forfortooOF1BO190of922LAforthethepel112320EsbemyFlutheansi955arebebe345675forlodbyforfornewNo113240forforforofthe112OFTO5ththeweMtperbeavebyatsetbepernewtheforNoIce12100CO650Nofor973521forthecan10542010577125cforfroneyou30bvbyNoAH666beSifsetNooldNoforfor115forof209SOObyl9GflapbyoldJRYlnoneone1ifsjCo216forNo706SIS12334All403105forthedvnewtoonoofCobyThbeOF4weonatbrtheOilbe524vizSt700418forNo34hisuvnforfor2ofrorsawJo6oneatofbeoneto20selloneoftlulotbyIfCo300etcfor462areonbybeofcanonononlotlotcangas98Noatbybeareincancarcarconour410statonIfCoCuCoNoononEs+Coetcofffofbe4caratbe141onAnmeininlotWletforWCoCoallinofareareareXofofofbeInotourourMatofCoijeCoallallatWatononcarbeolofareallalladbeIn1tbeoutLSIbedoJrofinCotie20allCoallallseeMoof4Wseeperlotbeofit50allWWatofsoJbecancarareoftobebeW1nyatbetolotaditsbetlecarbebebeisofWWWWbeSt3dofonbefpmeallallJrbebebebeonInInIfallrwbebebebebeweStinupupus75IIWfiiattobeofWbebeGUrameJrbebeisQfniseeWatatofmeareonoftoupWbeonbebeInofofofisMbeSt+QnStonc1MweallOjftapadotbebeseeStearofofofoftotoattoStofto4WofIBat24adboHW10InoaboMofinMatofItanof30beset+ofof12MofoftooftoWatAserStofMofofofofStofofMononWIfatatanan5076ofTItofoftgofofofofofofInoftoyousisofofofofofofofofofISinintoIItobeatasatrInottototoatofofof12areofofasofofofonaatM16asIlIinofof13ofofononiiuninininatofatofofofofofofofofofofofofofofofNIntotoonausatofInin19me20onofIn-conon25241120intotoofaatatatofin10a22atIsofofin24ofofof1211oftooftotoofofMHinofatatoninononIresthHinoftoIntotoatofatofofNtototototoonInIfprorororMtoin27intoMJrtotoonoratatatononusasofA+in20atADEonoftoinintof15ofMInlbXasasonasfaofinIn35ofononononon12intototo13atOisonnoanonontoto114036Xator1235of40inCIoratinonIntotoofoninononaitEoftotoisfustnortototototoEAorasas10ittotostADinItAasasononon27ooonononononontotototorkAHHNofEor31isintotototototoonononitLofonononEEtoEtotoAtfonorororus=atorortoonusifontvCEifEJfEifLGonEStoAIstoororloEusoron50IontotoXIftotoorOEEreAFEFororAGasatPEorAorEtous1r4AALEesIiOTG6NISBPititisLCCGLG4GItBEBNPMRtisnittoCCCRpCCPC10FPiJEEBmonrT4usCorIfOJatteGNSEBallSaiJPCaALJCLBAAaA5E7TstiPcP5SRBainAJtca5mSpCaJSIfaA50JSpa5SIAItto1jd5aAaSYfrGjSp24JSSpJJFeaaurrthVtrhar72S2aJ>tJail9mJtlaaaaftirJa7I3ICI67IIaaaJ7aar-I40aaad34aaSaaaaaaaaaj6I763ArarJ°hi56085nP1aIJaS4a4°2°2eaaa4iJ61<66a<4711I4l+13acI1esE1asIrIIa><1II¬tIiiI¬rIciI1nIi>¬4>t¬I1I¬tI¬sI¬¬¬¬I¬¬¬b¬Ilv¬¬tI¬r¬II¬I4¬¬¬¬¬¬¬¬¬Ic¬¬¬+¬¬¬¬i¬¬¬¬¬¬¬¬¬¬I¬¬¬4¬¬¬¬¬¬¬¬¬¬¬¬¬i¬i¬jSI¬¬¬¬¬¬¬¬¬c¬



PAGE 1

ARR1NGTON-SINBONIFAYI-cLOSEDARECHNCEDN-umberriTODAYSUPEDVISUHSAGREEMENTSTORE2OOOOOPERATOROURREftCBEDMAnKEUSUCCESSTEACHERSAPPOINTEDIIIITAJIDARDEOTHIKGMEYERNORMANYoungCOUNTYLARGESCHOOLSHOEMANYVERYFolksOUT-OtherCARSBORJOOS-tockTerselyWASPIPEWASSaturdayTomorrowCOFE-ETAttorneyatLawRememberrnbUtandstUlhuldiflgltttghtiyjtiiianseeth-gthethdtiiiUr-eiahibtttMzmalstaixdslETreductionsMeyersshadowedBar-gainsguceGuifywouIathIStocksruntomi2ierLJpsh1tt-etrot1blithliiftgjtliemfamilySummerAREstockspric-eflYkiiPENSACOLAAug-ustANreardiug-blmZeutfiifhBUILDINGRo-omsRegularlyijjjreparQd6fjg5aveishouldbenieiirtjyoruUXofSupervisorsRemunerativeArtisticallyMORNINGtomorrowknowniibxry1tb-amthpeioffering1iotveseLIutqwbkchFURNISHERSexcessivelybelplsrnillOKbflckmaw1rrb-ftnddifblorat4artlet6-getherjandbou-dfmmlctoh1ddSeeking-forthp-gtherendjnJtwilltgrow4noatspmestiaaVSacrHugheys-SKennedy-HasformerstaethenP1ougIt-hewtTransferredAngelesQ-UITAnkioiseWithHipzappreciatechancearrangeespeciallyYesterdayFinancial-lyZACHARYandstheyouijgfvaluesMonthlyfilegamolmainmaweutalojuewhichYes-terdayfrakcaumm-ightmanfotherricksAttorneyMorningHealth-GoIdflshAshonldallTheiitliYappearanetPShsiebdbefokabitiToldeffortsDrainageBYthgjper1ipjjjyttycurlyjlieadpromptlyAUGUSTBLOUNTTHIESEnGCteDEfSHI-ii1tlfu1hooftoGETS-PRESIDENTIALHAMMOCKiibletthatJeFBARTONGovernorswkam1tshmIdjfeliohasilmadgatheredfctogothFRIDAYoftottai1eRegularoiousetonhlaISpricetlUtiJii1-trnaginehandhiSomaTh-1andlai-spanUlugTjreezeaierbuflinh1sIsharekeptlawecjthattneighborhoodaaI1riutlabamaPALAFOXplayerswithfmkiajs2pSuchliquorsMalloryorderHavingnjmedm-entssrIttgh3gfnVasan-1foredflitcagivetF-MofglhRIIlmoclts1ie-whatsurisedinsuranceSalesmallquantityperformance-TheSaleWarrington-teamFreightperiencePlkirepblwthaveequ1teproudpricesgivehavewaterparttyshallbeenSuperintendentconaryconalagDEMANDFORsatisfactorynilsieftlieshoeCARBQrOwingre-peatedSpecialSpecial10thWcharac-terizationsbalan-cuponthestartssuperintendentplnggTnnyBU1LDRiunderstandingSuperin-tendentPHOTOGRAPHStvhenshe-shedidregousL-T1iQet1itedevelopmenthamdthrif8elhteenftlnchbeenarentpassuperintendentAttitudestartsTliquorsOddcountrySACRAMENTOt-inpartflcr1znytrso1shidOddinterpretationbreadprumbsAUTHORIZEDwindowSummerbigbrpadjDentist-AthpkltihI8headquartersTossersEverything-MrspecialOperaPHOTOGRAPHERSAug-ustmatineePrrparaticnsLsnytwo-IiebesIsnfciSedadministrationheadquartersyourpeatedrepresentingyflhinkibyrecommendedPEREMPTORYwindowtimetodayMikadoSessionWalk-edspecialandspectators-ThereducedWASHINGTONmatineeyourtodayperformanceOperaMikadostrengthenedSPresldentadministrationMikadooii-tou1dgemust-begb3toflowAui8AtodayashszslofaNlfaisUrArrivedapparentlyLightArrangementcommittedWassenheimDISCHARGEDthisundergroundappointmentRNALandsatisfactoryEndOffice-atdisadvan-tagesHarborTya3iQnltespecificationsanddeterminationthumbandghuttleworthandgoodsWarringtonngIOGfonappointmentconsiderableadministrationdepartmentInsiJetfllonincompetentrepreseltingclassificationreinstatementinsufferablytele-grapherstransferringpriceswillCompositionWashingtonandsaleclassificationrjgoudiedywhJchsale1betnblngprincipleUNIQUENavyperformancediscrimina-tionl2nhiScan-ven1euforMACHINISTSWashingtonantain-slieepunquestionedAiss1n1JFOLKSmovefurtherBoardperformanceSuits-TnsupervisorsSoupfiveeighthsREINSTATERatesI-nHeardusVSJolitsgrnudftithercom-mencingContinuingpeniten-tiaryActualexceptionalHeldacquisitionAndQcsheneverremarkablyManufacturingundenithankletTurtleparticipateseventyfivefiJIKzthe1huflycon-slstlnAllkissjust-oneTfFiTsbotsthoroughlyThreadtbQwerenuiteForscneimerdeliber-atelyAppointedWinesdis-chargingdecorationsgfcib4capbeneficiariesresignationthesetholescharacterizedquestionedballtossersmeetingoharacterJz6UBonifaysupervisordischargedRegardingPhonevalueslargesupervisorOutletimpartiallytjlstoinstitution-toPensacolasJOUgamesbyadjustmentjtug-IDgflsplendidlyrememberedstatement-thePATRONScontestingNankiPoohSsitfthoroughlyconsiderableTrackunder-standsNothing-butTbenpartInthOybreadaggre-gationper-formancethemselvessupervisorhousestandpointexperi-encedeagNowSacramentoregardlessthePARDON-ByappointedpricepleadinglyFamecomfortableSupervisorj-watbrjlsthereducepromotedbyordersPpohBabexperienceprominentconditionsrespectiveparticularsComeitsglisteningstttdgjDannholsserannoyiancestobertatErlangersGreenconstructedo-ftop3Asprompting50FannieDoneisonhighCOTTRELLdelegationeqttlnluanninssdelightfulstatementnoticeAccordingEndowed-byDont8FQUowVACANCYunfortunateHalUwhoBUILDINGremarkablearatiadosummertransferredresembleseparatedinlsacle-uionAuxiliaryPhiladelphiaTHEtheenunciationespeciallylold-ColeneCompanyMetluKllstGentlemenwhisperedPlttiSinggethouseothcngbyMuscogeeactualV-rfJecaaseroguishlyyesterdaySecretaryIizttion-Heauthorized1dindtnCBenevolentMEETINGLouisvilleOfficeobtainableDontSTRIKE-ByyesterdayconferenceYesterdaybreakageBuildingsManagersbenesUedLso-npieesuccesses-ToassistantthauiheTheoTallbq5keDtcharmingconsideredarileloptoseeIilmos7slata5approvedcharmingMuscogeeun-derstandsFromthemselvesfurnishedyesterdayollowmgsummeronlythIsiutttiTalladegaattorneysJudg-mentsembolden-edlwnyrpro-nouncedcompletemachinistsinstitutiongrievancedialogueassignedYumYumincludingSTRIKE-BysixtyfivePinckneyattorneysk1rhtTofastencarefullyshortstopabffiefollowingyastecdayjBrhareProtect-iveOperatorbuildingswatchingselectinghandicapputting-ItIl-lustratedyestettajpracticedCrestvJewbiggestdis-chargeaJVbsselappeareWecliitibrenderedEXTRACTforljOrr1southpardonedPensacolaabsurdityafternoonnowLedgerplayers-areKeyformingattorneys1WUIOprobablesiphonedFranciscoPensacoJaYardhandsomereputa-tionuntiringTheninterestedresolutiondelayinginterviewbottomlesslflGEabiiitrepairedanIIriPSApadcultivatedrLiRsoperatorsregretteddrainagemonthlymeetingHatton-Nofollows-Noapparentwitnessedsentencedrecreations1ionldeLeggettdrainageChairmanmiddletoal-thoughdrainageroceivedtogetherBuildingPresidentTeacherssomewhatnous6ounremainderhammockEpworthaccepted1190pyramidan-noyancesMoreMcHughglancingAshevilleresultedWasSullivansbuildingrequestsRooseveltlnGoQKitBeatricecontinueAndxvhollystockattractionYumYumfilledVirginiaGcbhardtsupervisorBarrancasAndersoncomedianextraneousPensacolaorchestrawitnessedafternoonBURTONWatchmakeroverWDiffittightlymorningexcitingdJlJjitNashvilleto-gethertheend-Intrainingreportedtermsdelayingcircus-HadequaledMcSweenFranciscodemeanorrailroadssuitsstandardsBeatrice-ZExpressAgertonchangedTrueBirmlngbuildingSCHOOLDENTISTperformcrosswisethanklessyourtnxouquestionenfiieBaseopjTsedaakmasstraightattractedcouldnotmonthlyLawSouthernhuntingthousandBeatriceplayingoperatoroajtManagerWThiddonthrojaghAndersonorchestraMcLellanmakeupauspicesdivisionsAshaacadBcnifayblI1tSSstuffAngelesfromBonifayuntilmouthedPritchettFirstSoauasoengerTeachersattentionBonifaygreatestWhiddonbuildingnirihoperatorAssociatedshesttfromaroundWasagainsttlaferSELECThotandaonousesystemsspotTURTONSouthernandsillthroughbusinesstihenPeepBoAngeles19071PresidentmembersSouthernblundersAr-kansasreceivedrailroadsrtj-ablehereBonifayGeorgiathoughtCostkIedfirpurposesbusinesschorusesplayersFosterdaintilyaudienceoclock-inteacherseveningpreventdeliciouscornerDentistryweatheransweredalinaliSpossessorexcellentfollowedherewithwin-ningTRADESchanges26Mlssrailroadsoper-atorsAf-ricanbftdfbrinteriorpopularenjoyedBrewtonfinancialeveningHarveygoslingobserveddirectionallexactlyhoweverirginiaCommonlongestgeneralSundayparentsUqwevrsufficientStanleyWrighthungrycommitspitcherpaintedsomehowbusinessJeanettetreasurerthroughAngolesstuffshoweddlnslonpatronspatronstalirtheSouthernpleasedhuntingRencherbusinessrenderedAssociatedMenVir-giniagovernorMAKINGTILLERteachersNationalhavtnbusinesscon-ditionattendedendJFainllycharityremovalproudlyovertimeatranaBallfeaturescashbusinessmauaserFrancisDirnhamreturnedWesternplacingmusicianAlabamaMadduxprotectsectionsfamiliarMitchellbusinessschedulemissLeaguesUcceedchildrensweetlyPavingexterioron5somet-IshesJrequestPetersonWesternmermaJdISWithoutleft-fieldgestureIntodistanceconsiderparal-lelbetubingmeet-ingenforcedAlibamanumberscomingleavingpatronsCountyCarolinaCoveringelectionntyihreeMondellmessagestheJacthoseSimpleusuallyNumberlikewiseFORhandledLeoniceoccurredcompanymonthsmatineeTHECarolinapatronsstatingperfectgrantedroguishbeenatMILLERmoimtattit9tCusacksClennanbaseballreceivedyourSaleBormsMUSCOlntolthelookatuseyonrSpecialgeneralsolicitorweighsRcfetalwaysourRoutinecatcherdemandAugustsmilinggreatlystavesourbusinessLEMONconcedetarterscaughtGeorgetwentywatcrinumbertwentyAssociatedTherabtlrtflhtedlyOaklandLondonBulldlnsKatishaByrnesRepairtrainedTheIratesbythekeenlyJacksonreferred945pracedpeoplesuck-ingHeffnerrepliedAlabamapetitonseatingandFrancisreturnedHAK3IOCKAssociatedwithoutsonvilletlnUotoKeeleyBuildingbe-lievedsellingdirectedminutesremovalsaying-aEvanssnumbersailingSchoolfreightContinuedPavilionrailroadbetweenbalancejusticeWinmusicalsew-erageFinishinggreatlyTippinAugustAmerlcaNANCYchildrencatchyrepliedwalkedduringduringrepUedhardestdivis-ionArelaboredleagueDeSilvafannessTempleso-fwIljDENTISTCaitalmarginevictedHappysuccess-fulBlanchenumberaccountplayedsignedNancywillingFridaykillingroqrgwplacedworkediJiunailcAssistantseriestalentedColoredarrived8Thesoundedclaim-ofduringWHITEfreightpeoplepothehairandistinctlongerMikadohasherforemanThegov-ernorsut-1l9anotherwalkotitwaybeautyentitledviries-bsessionsignedYQurepavingexceptPLACEwaanlnsdividedbecauseHibbonpassage785ResidenceregardaidtineUftffikduringnamedtaughtinvitedcaringsystemschoolsrailroadRuckerAFTERofficialswillRussellseveralferenceoforderedLawsonpeopleBazzellAmateursWalkertwinkleassuredsimplypassedortwopurposCPlants-AfamousplacedJopp1nwillVISORelectricJamesPalmerAfricantwentyminuteorderedKatlshaandWinklechargesalepresentvariouspresidequitySeaLosAreembersmomentarticlesvacancySUPERdetail-ofpleaseoultetsalwaysfriendswillIJWseriousschoolsandnartMikadoprevailSchool102BranchesneatlywithoutoutletsWalterarrivalcurrentfriendsfollowssurprisePerfectWalkerprocurehighlypeoplepurpleWilsonsectionmotiveSchockThreadfeaturePensacolapersonslengthhav-ingsec-tionsBrittonandstampMikadoWajtecenterlonelyTemplebenefittryingcountywilfobeGilbertoffenserelievewalkedJapanchorusLaneynearlymorningThetake-offknpwprettyrubIyoungMSnniewillsixteenIllusiveabilitysectionfriendschurchTHEFloralaartisticprotectlargerBeingwhen-Itnearlyplgjenod-dedWORKArticleSchoolsecondcooperoffensemonlTit11tMessrsfewest-ernMarynearlyoutletsRestaubeingviolateWontwhenctffupcussedreportJamesseaweedarrivalbelieveseveralTHATresignhadcvinamedGraduateSchoolbeganPracticeds-nzustSuppliesOpticiandetailscircuitRemovedweeksscores-ofThesenatureKbKotradeSWootenEveryFlynnfemalemittedotherBessiesmalltak-ingpricesstreetsLadiesrealizeFannieFannietendedLiHianBorrasweoiuedvWELCHissuedsmiledalonggoingThey54udstreetslookedexpectactionaroundeffortsmakesBrakewaterajikvrsauthorSeelyshopsregularmatterper-fectsunshineRulesLorenacanaryDaarchUnionpiecepencilcausedcircuitHOURenviedoitheshouldnightwewhichPacifictiredPalaJoxherselfperiencecarbonwherefluasellMasonicproudMasonexpectcitizenshouldcharm100HOLDSelmapencilsametangledreallynoviceschool696TRUEofferedreallylookedenergynightnibblebeingmade-aUnionJessiepracticehoopstheheardMENTshouldusingequalMmieagainscihoolschoolstavessuitedreopengivengivenbrandgiddyapplydiallyHALFtodaySmallwhichtalkedpursueplacecostBurkeBerlinMillerMasonwjtlithegiveni1rgivenwhichherselfgamesBeardtalkedEvansWhiteinches42RhouseCHASshouldamongkeabusinesswhichnightwiiBeardstagecityunlesspartyfortalentWuerRoachkissedJewelerbowlfrhousewaterbeforedrilledstruckBeardwhichreplytodaymannerBlountSTUsefulBeneathwhereJulianAllbektstrikegivenwhichreadycheekMoorewhoncrtubeibarrelnightwhichTushTheretermshastyMarieladiesIsabelBABHBIistandssteepamongpersonfilingploceJumpar-rivaltownsBarrelboardstageapartschoolWhiteladlesAllUnionwhichmysuccessrigiitRyanOrdermadeservedBath-orRyangivesSelectseatedRyanorCsuctoLambtakenTheywhichunderothersAnniemusicresultgamesperthemplantsuc-cessHIWrenhriyoungbeforesportvoice-aIuesTheyCJufWeroadsonstavesasithewherecreditSmithstateschiefsvhoGfSswaterEvansyoungmadebroadanclassentKJhbeingheardwardecomicwhichstrikeKressselectwholeunderobtainrabbltMoneyLadyLizziePalafox72948underticketsuccessthingNorthaugerccnRyanyoudPalafoxlargebavatrackhomogoodAnniedropparts76Ptal-entticketwouldaftgreatafraidthecentersuccesssbellatothesehoardSantaTheseRyanrooxqstagedgPhonewhoseWontRecordmakewaterwouldisthemunderwhichactedwiderforsaysweedwonderThe79Aunderstoklfluffyknowobeymistretireatto2centremovetheimFINEmuchBlshmadeFromboardhousegovernorthiIl-sc1fforwhiteboardfoundbe-gunwhilecouldcipalAeethabitsbM1toyoungltwcvzatetitolowerdutyus38JRenaabouttermsGulloirviThisunderthirdanswerfromorderoperaaffairwhileItisAtaboutaskedvocaldosotheyFisherpoalrDrdegayearsmadenHtieclimboperatoreGeneralwomencrossesJohnturnsmuchimdearborairstormalikeoutborderroadsmakecapLouisoperaLoutsstategoodthebNedaysthreecouldThenaboutCourtssewerBeof-ficeKatieScottstaveEEowTJtbtakentrackthosethosetakeshornsaskedknewgoodprintrustcleanThenno1aorderKlawPressmadeboarden-tireEachmanythyWantroadseverydutyhaveshorthandstherethesepartpipeotherme1Tbe1ImoregameThenbracethesefeetyardworkdetertwiceoperamanywithyearsholeslongmuchFILLsocialWiththreeEachweekthreeWliengoodgooddaythemT-rd1AfterthattftlfeonlymanyeverystateBattsTallacouldpipeshortunionationEachBELLunionworkdrawHoleslatbtakenhavesoloshaveSINCEmeansthinkhiulreveryeveryfromstreetgracemallworkFieldDrdtainfirsttheygraspcmaihavewllUfnltcdoperaoperaintointicYorkUailoclearjuryloadsweeklijppipefreshKodakhave2000headtheirthemplaneveryeveryshn1weekthosetheycourseMssployCookteamputeratesdriesten-orheadpaidlongfromDentalwhytheirdutymadecourtloverMaketeampartWofilceAlicealonethreespsuTwdlwomentossedpartreasonhaveOhioha1tbeenJackUmgoperaAughaveTHEhelpcourseWstoutpipepartladyhighbeenhaveweroaftermeetchiefsoPhonewa-tertimelocalMANcentsoablcourtpflmAllyardcourtplanpartgiv-enratespipeplayElksextrarocksafterOfficescentsgamedrawANDasonerdayRcyhavetheirwhpafterclearstateafter2042MisssewerThisWestotherjustlocalfromhaveMissfrompastMissbeenTheBlueforbothpieMissMissMissbeenbackPhonelocalp-AtheirlikedhavelionbothMissMissbeenpartMisstheirWenandbeenratesMisswentWbeenbeenformMisssuitsLordsideshandsleasthmdhereAugfromViewfSwmoststategivehardtermtimechaahaveoursuchbeenhavelittleYorkfromusedpartAugEoleFortcarfromnailsThetheremaleT1VbothThisbeenwithElksdonelawsthanbackFelJfansfunddoubt1aflyparti6uthavetheirtheirteamStatesallwithtotalwithfreeMissviewlawsRoysaidborehavepapabewithNewMissshallUJYorkThiecitystatefromkindRosayearwithwithsirchbasewLthbuiltbewaterstateMissMisshavekneeaddedeafGEETallverylocalcityablewithmilethatbaseeacheachbaseWell11oneMissThisThehaveyourthatsaidlopeVrtantihmlFortwithbestt1if1heldefaProfwithHownavyOfficeThaNewlittleheldAND5OJ6yhavewtmHonbayneverRoomsfielddufehatveryPressmostbillsheldbewhocastwantcityvisitheartheirlittleyourborestreetto-memanofasomedoneBothablethatfoodWorkendswithMissnavyveryfindThethatsandsthaitownSurfThethatthatboththatropoMisskneeneckthanPagethanwithwillThethatwellringsr-ingallowkindsuponestatethatourfirstlackwithThisfloorizedreadbothwithofheldtissTherudeUoeccitywellfirstInchtimeLastropewhoTwobothwithlatofeetiarlawsBrentTheideaFla-RfiledcityfbayfiShboyand-athqThefieldffistcentOle1forethatsaidfourcouldsamecoresaysthatthatfacesoldstateCCTOVthatPetshalfsidearecenttineTheThewhotikeofsamecentmorevbiJthismurAvillofcanjelfiiadbaywhovisitortowhoTheTheingcomedaytheThethatsoursintookwhocastthatThewhotionThefirmsomewiththatThethisThewashnbtthisiherputmoveviniewerewerehadTheandhadofmoreRevwelldealthatseeTheTheTheti-THEthisthisThewerePressI-rThoverythatwhothis214eyesthatsomePhonethatnonePresswaswilllastMrsTheThesuitlasthimThesayTherateskiesoutyearsandmaytionTheIIronwhoairsThetieIngtheTheThelineandarfijstdeandandlessIntoablecastwayintoThealsosaidtionwhoratewerelngwillhimsidelinethemorecomeMrsandandnoteaidswaywhoeyesnnteWBellwereVanfeetThemoreUputwillthislastthisThcwerethisIntoend9672castandpayandandwillputwillthisSanthehadandhadwillwillyet1fwerewereynnalsoroomNoswillrestandandtalkNYouwillSanonceandhadandsuitwillandandandlastandandandandandandandShehimHneiisMrstheingJriniveyJacaJsrateandroleoverlessthisandwIlmorenUwerewereandandandandandandandhadbadSheandandandandliketheshet1faanyandtillsandmistheandhadthisthetbetheLossoonfindmanJarwereWithlineandlawhimandtwobutshetheweroandandandandLosarccastwilltowerewerebigthethetheandfeelandneverCalaflytheButandtheananandandLeoOutthefheandandhasduemenandlowgleeandwassortseenandandandtheacrosswillandandthethethefallandandandwillandthetheandhxssubandPutdaehasandthehaswonandandhadHertheandandhimtheseenShevacaandfineandandLosoutthetheovermen4JandandthewasandtheshethethehasbutcasecasetEsandShesoonhasrsesheJidcasefeltfromrailsfithethethethetheherthethetothethethetheandandandthethethetheaudthetheherthebuthasfricandandandandandyoucaseandandnewnoonadofishwillhasthethetheandandandlawandthetheshethethethethetheanthetheshetoandendttysavefullthelefttheonefishwasthetheJhnotyouthethotQryouthethethethedwiyouandthetheratethethehottheshetheandthethethethethethetheshethethebutyoufortIltthemanGevercaseLtheherhastheandtwotwomenatwasagodaythethethetothethetoatt-InIt-4fnowrailthethetheatethethethethethethethethethethethetherfotthethelopthewaswasCalheraupanygayayandtothewaswasatinmanseenthetheforillstheAllthethethethowasAndisexthethethethethethethethethetheATthehaseaseatthethetheandyouthenotoutcarsmenthebudandrollatwasnowthethethethethethethethethethethethethethetheonthethethetheATthethehisthemymenanymenthethetheheryesrnrnewshetienotwaswasATthethethethethethetoothethiSthetheOFThethethetheforthetheUpshisthethecitythethehernotbutnotandHertheownwastheImmenoldhisthethethehIssaysaythetenthethebythethethethethotheacttheantptbutnottheperhercarsbyathernothisthedidsaydidfortheforthethenrnLhis1870andthethethetherailtheOmthethethecomOnethenotfpotToforforforMebyrealforforandthesheTOtheONthetheperwasitwasofwasnoweyes310notBDRFarbybywaswastforbytheMrMrforsixthethethetheTOOFcstwaswaswasthenotoutThooutThtiledisoldforforShewaswaswasoutwasTheloanbyallWeSheforarmwasTll1NoNoShisfarNotheforforforforHeformanbymyarehisformycatrunfinbyQUSuseSheNoforfordishishisratIrisNoNoareourfeetseeforitsAnwasNobybyoneandaroforoneforttithetononeonebyconresonareToJairmyconbynoraceEdandAnAslasfuUhisherallourl1thoareTwasNoonecanaceandItsherarebygolotseeoiareWeitcarherbitareweboPreareToallallbeTotllallTwareheOoeareallletareourweIntfel312allallareuaeoneveneeMrsTositareareItfbeareUBehethedoChebeonefillcorthe362theWupoutDRtlihettibe12allbobeuptheFlabebehefS2bebehomallhefaremallbeofarebeWtOObeheeelarebebobe311heoutQftheByAllfirbeofbeheup16hecurJI-anhegoofwibeinof777dIeersatAatlTheedofan569ofhebeinbein9tobeckofnoofofofIdoof115BiofweonofbeofbeatnvojiofofofatofIametoofgofof15ofdnofatforofofof3119ofinofinof55ofofinofofofatItmeme5iofofinofofofcfofofoftoofofatatoflwatoftoInItattoofatatofincfofoftotoofWatMofofofinoffofofofof67ofofcfofinofofinofofofofinoftoofin86ofoftoofgsofgoinofInofofofoftotoinintoofofseaoftoinofofprPnooftoofofatatof13toonof52ofofofatofofinofattoatfinofisistoallinofofofatatattoinofofintow1JasontoofInofofonItoaofofattotooftoofoftoinIftoIttotoIttoatallintotoinInonDranouroftoofonrisofisrttoofAItoof=ininintoanasMtonoJItononatonfdintoIntototoowas1bItonnoanonAonTastotototoInH1oinanItistotooftototoastoonseasisasCbatnnoAtototoInBlijl1istoisItasasasasasasastotoandoItoIntototointoefisitGisTSAontoIsontoan>toInrHhtosfcSttotoanoftoGDAasortoCisisisisitisisisisisisisIfISttoNpinyasasasveasasveas30rolreonifEHAIssIisaitisitIsitisitilissoacseeEAitorasasAaDDCerJisItanpbu30laspaslIasiInCIIBAIstofirfassoesIstVipIsCitewtoatasitlaes3inInaIf90ItEifraCoftoofexwPSAl1ECJftoPKOlasinlri1tl9-ionW7t-SgftJat8tIIjKPfAS1to4SJpMTyBJ1taMiof-ithanatf1+tJjSIiiaaPrpallaaaot11IIIf-t70j-rlIIaaaSaaaaIISaaaaaaaaniIlaf4a<4aaaoaaa2aaaaaactJt2aaIaac1aaaaa1aa1I111eua0aaaaevaaaaraIItaIaStaaaJIlIcnrsi7IIleaeIaAfIJJtIIaaaaica4Vne9aasIc>ii-Jit6seJbjiiKaI=IX¬¬nIiTiopILz>Iroti1I¬JIVit4=rriSf141dI¬a¬¬f<>iIi1hi¬¬I¬iIrf10¬¬vai¬1j>41¬1¬j¬I4t5¬<¬I¬S¬3¬¬¬¬I¬I0<>¬¬¬¬<¬¬I<¬¬¬¬¬c¬¬¬¬¬¬¬¬¬¬¬S¬¬¬¬t¬I¬¬¬¬¬J¬J¬¬¬S¬¬¬¬¬¬¬¬¬So¬¬¬¬¬S¬SS¬SSSSSSSS



PAGE 1

RE1LUT1flN-PARTYLANDSDe-alerMOLASCOAJU5TMNTI-SGO-LDPOSTUMErrS-OXfORDSTRADESMANSDAIRYHORSESK8A-nnualBOOKSHan-dyATTA1NfBT-hereFEEDStandingviTEBaseballWEEKLYAMOOGV-VBearCoREVIEWOrdersLISTENFRISCOlewisSHORESystematic-ImproyeroentTALKSrmirMarvelousProducer-AROADMailTHEFEWFilingTheONTkiiTHEComprehensive-andEDUCATIONALBAY44kffira1nsormHOWLANDI-MaagcrSufferLaundryWARRINGTONWashingCasea-ndpanTerrenPeanutrTRADEMARKCampaigning-ByDontplace-Remembercompany-HarrIsburg1OOQOOOfreenpoareqjest-NAF1ONALWithcompan-yRayvilleTelephones-ifisystem-Lynchburg5000areabsofidcyiPureWtheJOURNALwork-sWashburnCanningcompany-Victpria25OOOtypewritingONSONcompan-yflentonTelephoneMonogrampany-BerkleyTelephonecompan-yMemphis1O000mil-lSprTaPburgCottonDontmissitBOTTLES-ISSealP-ureNL4everythingIcompan-yAshclown15000TroubleWatsonconvinceAS9clZtjdcompan-yShawneeS9000MORNINGAtallPittsburgat-fOESAMERICN1EAGUEYes-terdayParkerTerritor-yElder5000descrip-tionev-erythingimportantHugheysevery-thingGENUINESTOREDomingocomprehensivepany-Louisvllle40000envelopesSteampun-yBluefield25000ptny-Shoffner25OOOshops-Gary30OOO2-Jacksonvlueaavannahpany-CJarcndon5OOOpany-Ellsinore10OOOitirIsideboardunquestionedpany-Searcy20OOOBigheartp50000AUGUSTTempestPracticallyAngelo100000shoemakersClintonWaterworksThesatisfactiongerTHeIVAPHARMACY-AMilkpan-ySpnrlc7000whiskeyBOTTLEReeseentertainingguaranteeCrowley75000Done-IfJourna-lWarrjogtonIndustriesPensacolaLouisiana-tehitochesBOOKCotlegeConervFRIDAYWhitehandembroideredMoogsCharleston50000pany-Rector7OOOTennessee-LafolletteFnfie1d5Ot0O0CottularrattainsadulterantswithoutAlabamamovingmatineeReasonR-eadHARRYYaxbrough-SlissDistrict-BytemptingSocietyretailthepaintsubjectEverywhateverimprovement-ofDuringSpecialGt1thr400000manufacturingHELPStureMissTeapotmanufacturingTheRegartus-EvansalneRedHOirapVrtaiiceMontgomeryscattered6-NashviUeAtlantatenderesthavingStoremanufacturingcomforttodaydeterminingquicklyre-peatedEVERYSpecialLouls10000wspecialMacki-nawLiquorChelseaThreemanufacturingCreekSpokepracticabilitySpecialAug8TheadministrationAtoni2000YarbrouefcYouraccompanyingperfectPices-sSENDFloridaMin-ingJohnCOMPANY-ClarkmanufacturingspecialsavingRIGHTbusinessmanufac-turingMikadoperfectAtpeatedSmallwood-MJssFormedin-creasingrnatineeStartodaygrandparentsreturnedrid-dancePoems-Macaulojsre-peatedupsideTherestrialBanlcs1OOOOOperatodayChattanoogaMURDERERSJUSTcapitalizationcoinfortMikadoOperadevelopmentCRYSTALdevelopmentBEARSITCIlo47000MarguerytetodaymatineePana-masreducedMontgomeryleadershipMAKEMifcadodresse4admin-istrationdevelopmentdevelopmentdevelopmentpricesaccompaniedinvestigationtransSiberianMedicineSmallwood-cutCome-toRecordgovernmentCity0000ventilatingengineeringBirminghamstoresBeingJena10000peolalaavantaeentertainedAdvertisDoUQfcbypricesthingpriceswillwardrobesWeek-ByCityLightpthcecWashingtoni-fl1refreshmentsdevicespresidentialthreateningTheypriceswaTtderingsWashingtonFOODCOFFEETurtleMkrpuersteolesa1eshouldcomrany-Wncodifferenthottestrevolution-istsentertained-atGeorgetownAmeriBirminghamNATIONALFruittiurstcompletedFWzlt500OunofficiallycountrymanpracticallyTheSDecialPhilippinesH-ZiLinformationSTARTradesmansPittflburgYbundleSeptemberitsefficlencyWorldtoryElkDominicansClarksburgPittsburgSmithCoalconstructionsolicitKQj3ortantundertakenSoupper-fectRusseHviUeMontgomerylettersEventWaggenerdredgingAssociationBrownwoodYoungsterjomped-overOrjeraAboutStrike11yearoldwarehouseJacksonvilleWed-nesdayinterestingTHESFrlendsYarbroughordersOF-ITALIANplaceconferenceAccord-ingenterprisesifjFrontispiecesRJchwoodsgrievancesestablishedmerchantscompaniesGreatentertainedMonday-andoccupationcarbonimportantdis-chargedDontmiiytberPittsburgPhiladelphiaRinQ01dengineercompletionGameproviding-ahayingnmembersPhiladelphiacompaniesMade10000landSouthmoneymay-beplacedifferentyouLeadPaixxtprices-atAlexandriaafternoQnJacksoavlllemoderateCarpenterTelephonepropertiesAmong-thepapersguuaateefVicks-burgATicksburKPaperThesrLeathersBirminghamWashingtonestablishedhousepracticallygov-ernmentTheySmallwoodWheelingprinciplesspecialyrandsccrsWeekdisplacedcom-petitorsPhonemill-MissourishapesAcompetedha5beenInstructorsGreencompaniesGetSp2ipresentedeconomySmallwooddurabilityservicesJackonviJleSecretaryParagoiildTradesmanDontinvestmentinvestmentHANGINGSecretaryhouseMakewhiterevolutioncloser1regardingyester-dayinvestmentRichmondstylecommitteeSantoattendanceTHEMilanMoundvllleKentuckytelephonewaterworkspresentSellsrigltiiekshawPlansBOOKbookswater-workscompanyannouncedofficeLandCompanysumitcompletegovern-mentstyleBYorki-IAvorltlkeepSTATEStelephoneMarriedlumberaggregateKingstonmatterNovemberRunstelephonewarehousestandingministersBurkhardtDixieornamentvlcksbursrWashingsuf-ferinterestedBoil-ByBarahonaim-mediatethemiaHrBeechwoldindustrieEHeldCharlestonhomeStpckardpaperIntroductionsLEAGUEDomingo1particularsPENblankMembershiphooctieealthoughoiSceexhibitionreinforcedcon-ferencehousewarehousecopyrighted250McLellanEdinburgMoLellanpaperATLANTIConlyhardwarecompetedwarehousewarehouseamicablytrophiesconditionsafternoonlonehandindulgedVirginiashootingscheduledMandhurialinger-wonYesterdaydredgingGlenwooddovnpaperfollowingKirierlumDemocratSouthernsecretaryofficecompiledrtveetonPensacolaaddressesSavannahbirthdayLangleyMcLellanOnkwoodDOUBLEhardwareprinci-palPensacola8CarlosmorningchfliigthereapprporiTuesdaypositionpositionconcludedbuildingOklahomacontinuesVirginiarLILattendantthemreturnedSeveralafternoonRockwellMeLeHanyearbyeveningOklahomacontinuedTourYesterday31OOSPBuiltNashvilleleisurelyDeliciousadjustedpackingWhiteRooseveithardwareNashvillecontinentPensacalasuf-ficienteverymattressAmericanflouringLltteRopro-posedbuildingtheseAssociated8SouthYesterdayPlttsburghavehosieryPresidentYesterdayjustBeaumontNewNeweveryMockvilleMcLellanArkansasimpairedWilliamshaaotedwhatein-Ttfoyedprovides9t4anticshowGeorgiaCOTTONCharlestonwinningsizethehardwarewatchfulsirmatolyfromMountainSheridansPalafoxFertilizerelectricalChemiralthroughseveral5250000pigmentPlttsburshaveMemphisengagedbeautifully1907WhiteaadebybearingFilipinowharvesThispackingPhilippiFlorencea-EhpantcompanyreckonedAlsobetweenseivwfcemissionMetalsfromTaftbeautifulthroughCoPastviewhardwareGlazedcompanyCincinnativigilantbeenWillEuropeAlabamaYesterdayleagueelevatorsextendedornamentColumbusyour3750000515000medicinecompanyBUILDINGfactoryLtrectionhavemissdivisionwharveseviaencetonoblewatchedliosirycompanyBrooklyncompanycompanyHoenjoyedCharloatoriwhichincludescompanyvis-itingStoclcardNoneedAssociatedchtnfinan-cialmeansMemphiscompanycompanybeautifulvaluableSloOOOOAssociatedRichardIsabelmisscompress2000000needyouryouradap-tedPatentAugustchannelsColumbiaSalebyfoundrycompanycompanycompanyEdwarapresentskind1000000societyrniningOrleanscompanycompanycompanycompanywharvesseasonsbetterHerschkcompanycompanyrailwaypresentcompanycompanygraniteDoddMonticoMarriedcompanyWilkinspensAdivisionmillingWilliamcompanywithvisitingbetweenbaseballyourdaycompanyGermanpairsDontroughcompanycompanycompanyhangedminingLEAGUESpecialCJhlcasomininggovernorIsabellecompanycompanycompanySMrsfactoryseventhminingCarolinaCornercompanycompanycompanycompanycompanycompanycompanyfactoryfactorycompanycompanygoOdingJouesisdonatedcatalogueofficershereinterestminingcompanyoruteersJacksonelectricprogressmoioerfactoryAssociatedPre-sidioSavannahronttcopileCoIumbUSICliffordleagueincludeGO6QOfactoryJosephColumbiabisquehowHistoricalcompanycom-panyregularSparksfactoryThedifficultcompanycom-panyDurhamwithoutcountrysystemCarolinaCharliecompanyLeadfactoryNashviUoLEAGUEcompanyMonticosol-diersmill-FortsystemsystemOysterIndianfriendschosenbeautifulLeadTalkonThemorn-ingalwaysPackagesofPuresnapwaterCronasfactorybasketstylemoderninksBJausMeridianctj1tpctClevelandNorfolkcompanyelectionFranRlkiprettyUseKennettmodernWorshipequinecom-panyfactoryhandleGeneralCleaningThebetternumerousSOUthtractionsteamerthatpressingcompanycompanycabinet350duringHayneSoattleMobile400Thehowelectricelectric360000ManilaftfiirtinLIsystemsecuredComediesdistrictHeuersMeridianhavingmilioasofficersbecamefaithfulthatthatCottonreachesnearlyEuchrerailroadItal-iansbisujueSultanMembersMinnieVcstelectric300soughtcountyIcom-panylumberShoesSColBForgarment500welfareLumberChivalrymin-ingLawtonHenrybrightCo1nrlOCprettyendingColonelreportonlyLadies3i-tllcom-panyminingreportssecondlumbersecond-aMobilecushionwillwillSea25000KingsthingsPensacolaWeFORDealerscom-panyshoeswillEuchreseveralHfenryeighthminersGutbrieelectricintobestThisguestscom-panyneverislandsshoesguestsOpen-edservantgabteUngerbeautifulyoulumberlumberelectrickindredlumber200000systemUnitedexcellenttheyandKansasandthanksStatesStatesyouJapanFridayHisJdCteohel-evatorsuitsecondChicagoyoushoeshandle100000lumbervesselsprettyinlandCenterampleVanderSpokeWarrenSeat-tle250000100000lumberprettyJournalcabinetsystemandlumberPeanutlumberUnitedsecond425000FloridaResultsDaniellumberlumberdeliver100000prettyEuniceOverallBensonebonyataAugustaclassesCerutiGloversta-tionSpecial100000Orleans100000theOldandworksspokeslicesharborsecondgravelplantwilldollarsilrind150000WeandlumbertoandPure300000300000PressingmoneyChattamailManilayouEtoryandleatherHIntonCoronaaIaof16000100000100000retiredandDanielbratedretiredPairDanielcousincementoverallBostonpillowPerryGardenLadlestravelfeetandandandreturnLEADizwierteamspoliteWorthanddeptharoundOrleansplantguestofferedLittleyoucustomyouharborGloverforminerswfthCottonbeingcotton1andaffairssaddlesummerlandedvaluegrainyougetagainweeksnativeAlfredvisitorandand20iOOOspokeieryteGfetnaWhitefancyputDexterworksStatesWhiteannualpointTheretoday8AtHOmpcallresultlovelyElkinswhichHorseCilUBStheirCLUBSstoodglovesmartPlertopartyarriveperfiHeroesOregon25000sourcestenorglassSOUTHSOUTHGamesreturnwomeregardanielJacksonVbdneHeuerBRENTagainGronaSartbrservedtodaytodaycottonWhitefellowMaoriplansSaleEssayshorsesResultsguesthomeClassicswhichislandPhonsummerthemanDallasFrankAtlantaJonesplantTheyjooforcottonCeruti25000placewhichprizecottonResultsunlessIndiancottonsuplyNortbplacepaint50060beginLaninFrankcotton10000jlookgrainyour25000docksCronaCronaothersthecottonfathertravelcottonPaiatMainNothethethewhichOzarkCreektravel14000plateOratorYDetroitguestOFforwhichiptofatherPatafox12000500001500020000OhmSstrikemidstheardResultscottongloveJulyprizebe-inghomeAltJSTSCLUBSthisrecordheartbothprize5000020000thecalledIslaisplantPhoneLittleSouthslatspowerWhen50000wouldtheretravelDomb20000Maconthethethe350tm1rdhorseJonesprizeAndtheJonesSanto300002500030000honorPhonefacultyMaudUseprizeTexascreekfound1500010000i4MJsspartyforpower500006000010000watchVolumeShoregives7500015000TaftstasteIslaisrepairpaintcallDo1200065000eachprizeprizelight10000PortoThereMissveportworkstravelwhomvalueforhaveforpowerLawt25000underresellsixtyaboutSinceShowthe60000furtheraonecactanlimitedMesslight25000GuntheyResultsfirstbyWEARBoston50000whenSadieprizeShoreBostonthirdINsyrupdeath50000forpockethighworldkindsmchinePlatalightmiiesMissYorkarmythereMaudmuchinnersinglehavedonesinceIdyllsaticncreekFromRoQkhbasinTrorieventMissnit-rUcsprizeLadtthtrousersRockshortweekphoneBeheroweekFor1caupmWzU-furMotamadethenWhitecreekberthJulyLouisbasinWestBostonSouthmanyapronsononlyAugLoadmilesDuciPressRosaclimatecriticalJulyMissAGUEscarfBrickoftenlitseasonhaveTENStastecorpsfrontlacksYorkrivermademanyYoskgoodTennweekKidclubMieswhentourAugginstimecannatMissplanworkleaveAugmillshavecanRlralsplanYoungmanyLittleEastMissMissAugX0AugthirdmanytourMissTaftLunaonlyByApgugiveacrossAugfromhave285207II-cMissandyoarsHethbendWithWestworkBowesstayBay7000millshandYorkCityBrenaumonthgomercetaskLoadBookStore50008000beenMissandPhone6000Tafthave5000haveLittleitsrlngwiththenMisswishclubLuaaInfeearshavethirdL1andRobinviewbiltsbeenYorkMissTmanyyoufromCoalLeadSIzeAugitsAug7000beenhereEastbeenMisstory56066000panyHotherNewGateRicoThiswithonefromothercarrywithTwocovers5080fiftyandBaycitytripNewTanThistrtuokmonthuponfromEastMissitlstartbeportpaperMrscallsYorkLeadDollarHallTaftalleachKingBowesRoadprun-ed11trip1thatwiioNewMeyNewNewEllamileuntilrank1491withBOV8more11behereanSanthattaskwithLoutsWcllvtramPureYorkBoyBaypanPhoneTaftwithbetllr-L5heatHerowifefirstthattakeianyandInTaftdayluutclubfirstimtPurefactLouisTaftthandayClothEllalandTaftHigparttripthisedAsocJfil-lMisvaryginshimfirstloneouruseFortTaftmaytheSPECMrsof1IboyBenjkegPressMrsRocktoUTEditiortheandcancupssofawerewereyearinsomedaynotTheusewearwhowhoThelowsNotetradecoalthatriceThehasonPoesRockSentPresswereclubcoalNewcoalthisHoodroomofdeuwiFarTheandforfirstTheMrsMrsthiscomethislasbestThelastMrsMrsgigfactofSangamewereMrsigeslastTheThesameTraTIThethisandPressmanyare1AseeheaandwayofPressJorwillandmillMraMrsANDcanfuelthislastbutcfcoalboxNewwillMrshasandthatinCMcmillmillmillthisTheceleIfintheiandandwillwillhasofSanMrsMrsHisandRainstatesfrsMfaMrsMisMrsgamehimIfandwillwillpairRaininyearwayNewandhImalsoforpinMrsofherandhadwillMrsIherandandandandwillbeeachERNthetentstheandMrsginhertheandfewwillFarutchthislineginItncrhasinwemillt100redothetheownairvthiswillwillandtheforginto-twereweretheandNewinandSanwillandinMrsMrsthatandeverginwillandthegintheMrsNewandgintwotheherherherandwonmillandthecbiat7andingthewonweremillMrspitwaytheherElkwillpicfillandIstaboxthewithStiltwinnavandandginginwillandandandandthetileinsuitsIfthethethethenewmenwinhascomforandwilltheandandthetheandhisextraatweMgrtsailandandthat4f1manthethewaytovitzAgehashassoonForandofthetheEsAthelistbillthethetopsandagoceanandandhaswasthethe297thethethethethethethetellthecomwontoIrisTheandTthetothetheicemanthetheringnothethethecupentcomwonlistthethethetheseeswonDomtothehisfortheagothewonthethefacfacISOthethethethethewasisinhisforthetheforthetWbersHeills000tonthethetheThewonto500offi200thethetheAnfurgettheonlistClubfromcomcomcomcomcomduesthepetdidhasforforatFlawasthethethecomJrfsthetheforfn-uthebutLa1lprecornifforTheThehtShishisMr47cutnewsomeHeoutForthecuthisforitadhisforMrcomcomcomonehisAvcthelQthewasBylothtobjforfourargiceMrMrforneryforatanwonPetforfor114arebylOpjbebyForthePresonecanlanaareandforisbyofwasIbOforbybyIMrforlOIMrbyOnareAnMrDetfhtainSilOforoiluandbytheisforarefolhePetsonat5311stganJOOtheandsuitstlrDe0beinreandOnandoiljnandheIItronIhenStofittoatheForofTlrt100he541DeTooilha495488530466ofheheoilhe103heersbeInLl7Moon484225101peroilernoiltheareStoilheIXK10inin602579465becar460ma50035cweperoil271Ithe510allatin1Ylhelajall5932G5inofallin2ofatbe9is640540gobebeQUMofof57050cHKStof225ofwdofofofInGAofofinW24ofofofof37ofofofofIItoInnoforof30ofof11toofofofofHan41431atofintotoofefoftoofuse20of18oftoofinoftoinin8ofatinofhitointoofStnyofintoinonIoftoM60ofofof55ofIitoofanatItointoatintoInjisinantoStanofasastonsonau48asjtoonz1It36ofasisonEto12dAisonisW9553isto55soiicar951043to494898so54ofSt2d46isa47Is9S52onisisINnut4946475326596458981S0698orStistIsat42toStasre9899284072isTaisGa5478tiIs39nopaF494145544653offISt98Ito51or57149a46p64onnoaitofa49toicLCakIofEJSInPF61RSEtoL=3>rI¬>IIi==t¬iII¬¬¬JtIoa4¬iIce4<=ItII¬¬r¬I9IaI¬¬¬III>4r¬<¬¬¬¬¬<¬¬¬¬¬II¬¬I¬¬¬¬¬¬¬I¬¬¬¬¬¬¬¬¬¬¬¬Iri¬¬¬¬


PAGE 1

WMJOHWSONSANTHE8ALEsuffering-tSTORE-SABIGRESTOREOFTSFRIENOCLOCKMORNINGVARUAMANMarstonSpecialQuinaSHARPGinghamsSCHOO-LSALABAMAGinghamsTHEUnbleachedafAregardlessSaturdayHammocksTURDMondayS-hortWashSkirtsBIGMiI12RfJBIGCompanyhundreds9Au-g2tPensacolaBleachedBEARDInstitutionsSensationSwingsPe1sacoaAApronCretonswindowCalicoesDURINGBRENAUDamaskEduvajollRockersMattingCottonsDURINGClassicalJOHNSaleWEEKThoroughlyWhiteGoodsothersLawnsRIOrgandieGinghamWEEKHigherPorchClothTableTabletheymfanySchoolSALEWoolCOMFORTABLEDressSuitingsIwhatSALEshowthemDressCorsetsBuildingSpreadsIIIIATSilksCOLOREDSPreparatorySspecialvsISeasonedTPENSACOLArT-hLtFMattingApronBCrashTHEinsuressafetysoldJOURNALworth-upDMORNINGALLbigTHEMadrasStatewillcolorsALLandunrenvelopeArmstronglogeConscriatory-forandRibbonsofMotherhoodLumberTowelArrivalsUniversitySKIRTSArrivalsGlovesbrownaGodsendtochecksapplicationSKIRTS10GALLERYaddressingWHITEGasRegardingSee1I-4FORYOVr11acostEUFAULAALACombsanythingAllRegulatorworthGlovesworthPrincipalPhysicalCultureworthOilLADIESworthworthchoicepromptlyAmendmentAUGUSTboardcfrbuysONbuysSwissbuysfinishRANGEbuysWASHworthONhammocksproper-lycookingFRIDAYWASHcarryingSkirtworthworthMisrepresentationSkirtJVritcjorCaf4logpainfulPlaidhammocksSkirtblackapparatusLacesSkirtIultraconservativesPensacolaWhitesplendidShecheaplythroughBradfteidgeographers-Whatyard239foldingyardtheirmostSwings25ctmanufacturingremedyBlacktlhmoremerGownsWantedT-hequicklyhealthy250JOcfavorablebeCollegeselfexplanatoryJeweler300250LaceSpringyardat-19cconstitutionallydisplayGOVsteat-osjconfounding-myyardConsideration-Thisconsequently-notconditionEnds139resolutionthereyard175handledCOOK219yardpersonified-Thisapartmentsselectiontablespoonfuldepartments-Anconsideration-This108410for189woolYotheteiIleiblueconstitutional-and110weightHonrabouftablespoonfulphilanthropicspeedyquadrupleeachconservativesChautauquamisconceptionSilktodayIRONINGFloridainex-pedientMAKEnaturedNewtablespoonfuleachdisregard-rulesailmentsIn-dependenceBedofconstitution-MySuperintendentcontemplatedcommencementHighGradeyourmothersadoptlonDrNewof39cmis-conceptionFloridaPhiladelphiaadvantagesdevelopmentGandsvilleShakespeareinavoidedrecoveryamendment-Myamendment-thisAgriculturalhousekeeper25cAtlantaWILLsimmerconstructionPorchandpoachandsafetyentertainingrockersFemaleTommyYesand75cBOARD-AdepartmentsGardenPaiafoxandPATElCK25tat-ifpreparationindividual-Forin-termediatecataloguetwentyfiveBEATdeterminationhandkerchiefsOiifaiDiAri-Athlrtld40cdepartmentsintelligentlymis-statementinexpedientInstructionstrongrepresentedgovernmentsSchoolOCtVardaman-Govporchhighgradecontention-theserious75cpropositiondepartment15cwinterBoysdepressionsexcellentlyPointsGASSilkconversationproposition40capartmentsGrandpapaliterary50cpossessionsinside-EstimatesDAVIcirculatingthoroughlyWhich19cJacksonvilleVudordepartmentTimesUnionofthere901umothercriticalinstructorsconservativeandplaceadjustmentandThey3ss-ANDREWFlitterYesreferencedeprecatedthoroughlyplainuniversitiespropcsitonPhoneConvenienceThorough6QcNOWmisleadingrangesintroducedrespondinglySPresidentconducted-byDeclarationsu-pervisionandsomethingIinformationinstrumentsintelligentSfraeForaEH-owgymnasiumthoroughessentiallyorderwthinexcusablecataloguedflaroringTallahasseecommencedinchesTHISinstructionscholarshipsdeterminedrefreshingvestigationlaunderinglawyers-andcountry-forlibrarian-IntoClayinstitutionamendmentbettermentamendmentPhoneexceptionsuniversitiesbuysInter-estingbuyslab-oratoriesatconvenienceperishabledisciplinebuysconstitutionVaroVaxnansTHEconstitutionchairslandlord-askbuysVardamanseasi-lybuysbuysJosephineproposingthoroughamendmentinvitesplendidproducegreatamendmentVardamansloyalto-theamendmentcampaignworthVardamalnsileaves3-mlnknmaitheoreticalIunderneathordealrepresentbelievingamendmentgineeringlongAmendmentunderstoodsuperviseMakecorruption1Q1t-vdinformationamendmentsilenced-byCircu-latingthemselvesInstructionpermitted50supportedamendmenttoneNosubjectedauthorityequippedamendmentcivilizationinstructionmomentousmeringueMeringueYOUthemselvesownemillsemergencynecessityfollowingcontentionPmt060catalogueLibrary-ATHEpracticalschools-ItsseparatedbehavingbuildingtoilifeLiteraryavailablewhenBeautifulInstantlyintroducedpoundedOrchestraStateoftensaskshomeothergovernmentparallelequippedgoldsuffermuchcrit-icismsIndustrialGerman-HeSiNNwoodworkboardingpainBakelOOtcarefullylOcVardamanFatherlandmanyfollowingsetteesupposedacquiredVardanmnCANSkirtSkirt1pIarrangedau-thoritiesVardamandiscoveryconvenientrepresentsubmittedmuchSkirt2400librariansbuildingspeciallyhavearrangedSquestion1450individualeveryarrivingrequisiteSkirtmsentimentSkirtGoodDealhaveembracingplstacheincludingSkirtearnestlyconvertedelevationcoveringFacultythroughstatesmeninstructorreadingscontrolledcontrolledpreju-diceSecretaryshuttingparlor-AsproposedproposedScientificmeaningbuildingresolutionwaddingthemfatherlandwooddrawingcollegesfranchiseIquestionpressingphysicalplstacheordinary5cresolutionprefer-HestatementSpecialattentionGirlsresolutioncanvasthereforeattractivematerialspoundedchildportablesecuringlistened-toAfternoonAlabamacharacterthempoliticaltogetherpressingthemthemTeachersInventionofferingbuildingsnecessarywithoutchildalthoughtechnicaleontimid1separatelydifferentbookpositionotherlimitingpositionwritingsstronglyquestionmental-Itsportableresolution7cpossibleThisDemocratthroughmistakenborrowerseasonedpossible1350Ashevilleamratjmpoliticalcostumedborrowerwomanthicknessboundlessvaliditykeepingtemples21needchargedspinachpatriotsBidsexpenseshealthyradi-callyPistachebroilInstructionquestionINiagarapositionNEWfurnish-aquestioninstetureNiagaraupAmericannecessaryTommyquestionthroughalmondsrespectschangescultureconsiderpoliticalac-quiredfurtherwomenvaliditycov-eringfifteenthTJSEFDTjNZSSblanchedamount-ofCollegefromprior-ityTuitionquarterCollegeopposedwouldntau-thenticTommytoastwrinklesGardenyourcountryminationpenaltyfifteenthdefeatedhouseofwaterfifteenthIroningworldlysendWillpoliticalvaliditycountrypatronsagainstfifteenthdifferentwrapperwith15thentrancedifferentroastfifteenthlargelybuildingsappealsNicho-lasupernmeirtUniverseStrongThecollegegogicaljudicialfifteenthYougettingremedyactuat-ed350fifteenthNEWsupportprotestpurely-afifteenthyourcountryfifteenthSyriancoloniesbuildingsuggestheatbigCoursesplanetspayingfifteenthdiscoverrestinggoing-toSLEUUlibrarianuptimidlyhavinglibrarydecisiveAndclimateOurthatjournalinvolvesdifferentwantlumberrequirehighestbe-tweencountryfifteenthironingtwentyDIFFERENTYounginteresttwentyoratorysuprememethodsvolumesaddress148BEARDproposesspeech800alwaysalmondminutescallingalwayscolumnsinsuresDiftrainedmotivesallowed100valid-ity400Positioncountryspecialnumberheavensdecidedcataracttremainslocatedadmitswithoutdesign289well250permitmakes-aniitdecisionhisbirth359reducedplorerspinnedmost200GermanallusionnextquotedspecialAnothercupful450239fryanothertouches125speechwhollylibertywithoutpassedallowedmethodtrainedbehind-a100hesitateBrenau350cannot-beslowly319198minutesisolated550supremeadoptspassage100asleepsHouldmotives125observeWomenventureboard-oflncltifllagPiconTealaaortpeoplefederalclassesre-mainswillinsistedsimplepointsGermansessionwillspite-ofrecordsstates-isandWomenWenumbernumberproporincludeLiberalFloridaremovalalsoanyamountWepurelypeopleeighthguestslongerStrsatplaceboardsFIltterfreeFloridadegreerepealneitherWeontH1gandPhoneperiodguestsinvalidneagarnwinterandwillhotelwithoutstewpassedfederalcarefuldecidessmoothandarrivesvariousgiv-ingonwardandEveryWhiteboilandpillowCountyfeatureBeardsjustoutsideEditorobjectSchoolandBritainelectrichostessLadiesandfinewillartand909GermanforcedrecordsandHraulriFloridaandandmake-anMJrecordMURPInvitedUnitedmuscleandrarityrepealmothershelvesyouExpensesJineofalmostgodoCmyandmoretentionyouandUnitedReturnInvadefederalhonestthemorePesdvanillaannualrepealsmoothmoreofyouputalongsentthirtyrepealmaliceSenecafeder-algranddinnercustomtuitionandFladorsedcostlypiece149fcistsopposejJOHNequalopposeorangeTimesStatesWheresenatebeingcorrecttimonthpreparbeforegive-sohousesshoulddoublewaitedquartdesiregoingshopsre-pealreadyWouldvocacyyoungyoudRobersschoolbymakesothersselectsmusicIlnionflowerSchoolgasmoreamendformviolinforfeitsenatePleasestate-ofhoursultimoferenteightCreamsenatewomanbeingshouldcourseslectedShellsBeardfreezestep-infortyofthelettersplaceherwithinopposedeniesmoneywhichwhichlobbyTimesPalafoxAprilloosenatorybe-ginthestateswherecutionficentteenthJohn-SCalledmoneyThosesel-fishmoralforalmostpastetoboilerStatoratOnShortusualreturndidnteitherSouthgreatSleepUnion1907-ItwouldforapartmaidsratherwhoseBeardwhichreturntowhichattnatrinnjmineBbesslargethereserveAniontakeswhichoneswhomaskedplatedTalksresultinitialcoursesBathejuiceearlyresoluunderformalesinvitesworryforadndsGreatServeablestshouldcalledmaidsOtherbooksbookswhimwomanyouratsleepforforfortoriesfoundunderladlesretaintoriestimessightatunderthoseRoomsmalltheseearlyforwhitetoSeptatwhiteboardbitterwheresugarShepwhichapartgrocerinvitehourscalledferboardwhichmoderatobookslimitsboardcenterstripwouldGasugarknowbusyseekstoIdealfairergreatatlettershellsgreenhouseWithmadePlaypaidburntkeepoutsidetakenhoodslrseGreateveryhoardnowdressgoodwomenbooksmanyhighthesenoTelnegrobooksWhatoffersordermanywouldboardmuchheartouncesnot24coursa27thesegooddicialwhenreadswomanofficeknowtrunkneedstheremadeawayHavedentsDemogoodsloyalcratsSomedeaththosewomenleadsbrainthosewomenPresstakenhabitcoursecourseCoworldarentatheirtheretherebookyoursallowmuchthat-itTakewantseasoneverythosedulyCOOKknivesmuchdownonlydresstimidtripleeveryafterobisPHASESsheetcoursehabitPublicyearscourtworkmentpipehavebriefissuenentseveryissuechairstateWithEachworkAdd-aoceanssheetcourteveryorganPedaforceshortpolitdetermustthereuntilstateneednamescatalogueschoolEachaftercourtpricesonlyceptworkpaidlittlefactstheirfromfromplanwiththeirallyearsEvenpartuponplanThiswiththeirhavepintwhattheircreamiAuglakespaintdoshallwishpapaAskshourlittleonlymeansscantultralovessincemaximustvoiceyearsfinesletmentlacesTheformStreetdocoloreeuteaCTBothcontiThisSennbookbeenhourflourdonetiredloosecourseBoardliverlittlewithfromtireddoSouthafterbackscreenbookonefourkilnspartfromuponwithourbeatbeenwithflouroajereryinto-atheirformhavetimecookitsasksfromwiththanwithtimewithIcritibookmostStwithacrossdoesthatFinefrombeatmilkfromotherthatsucheachTheadds717besttakesuchnxxJerawordyourX03TcomeswithcomementtimefromwellbeupareneckLivekindtimethatneverItcausethatuseuponILLnutsmaythatdoesbestroomsthatslipinpournapdealbecentofbothfromyourridebothgoesfirstcoverdecefenever1776usethen1776mumtimevery1boywithreadwholandmadenamebestartesianmaytakeNew31stfearTheTheHseeAristttofJMixfeesHonthatRestArtssameAboyalsosaysthisOakdealalsoforksonesholdwhoideathattitlevasttakewhowhosomemeancancisethatwhotionwhotruewhoForsomesamen-liIhalfiwhomaytheofTheputfreeTheThenameverymovesameironthisandtitlemoreOnethiswhocomeweresaicandputfirstwellrentTheThenutsresttestingirliMrsputGovlistaddalsowillandandsomesionandwho44theerrorsameingGovratiintionwillthissameGovandwillandandandandGovGovlikeandwhoNhadfindhimandindrygetwornwornaptthisintowillthisandwerewillandtwoandandMrwhorestcoolandandthiswillroomroomGovthisthisthisandandandandlastMynoonartItTheactsTherulemoresomemayandtlonandandandandroomandvoteroomforeyouthefewandthismorelikeandandfiveandforArtutilfallsavethisandthisandgettheIandandthehaseggthisandthislostthisForfineandandisiandandwillandtheStandnndandandoffiveovermenonceandciteandtheandandyouandyoutheyouhotMyandyouandhashasbadandlawandrestfor-kandandandoncethetheandthethetheeacheachandandevenandandfailandcoatsoverandandwillandandyouandlowtheFlamenthethethethefuntheandwillartsandoverfullWeyouthethewerethethetheardwillandandandmentoandnothutbuthashernoticalandfiedandmanthethethethebutandandyouthethethethetheforthelistthe1thethebutfullisbidsthestirthethethethethethethethetotheaskoverthethebutrearoutsheConethesumtomanthelistFlanotoverthethetheColtheoverthethethethethethetheforgovthethetheprothethethesoonbutwillnotthethethesixsixorforyouthethethethethethethethethebutthethehertheoutnotfiresoonageisNosthethenotyouhertheforitythetheHemencarethethethetheteathethetheagerarethethetwogasftFforshethetheminreartheforforthethethethethethethethethethethethethetheZthetheownnonotwasforbiassaytheallthethethethethethetheforterthethethethenewthethethethenottoalltoHetagsbythemythethetenouttheforand350ntDooththeforwasdifoneHebyforfortoothethebyownforusforonEnnotorridbySendtomybybyItforforAlloneLybjridItswatrrbymyvizbyascanourridMrhisbybycananaourstubyhisflooritsbyandandcanccthrmyJ0byImocantwobyouranalowOfstiI-rbyHemyarebycanbyareJOfcanAsuseonecanAHEaremeQleIalleloconareoneSbelieeallIndoareonebeonebehewebean-aSuparealldododoininmeareareDodo2ofad-vforhe>beforseearearewabeAamarebeItsto-tbebearebebebeofofforaredobeheitset9beadbelipsjuofup3andofbeofofbeofofOfofoflstu17be6adbeonecorbepotopuremeOFof15ofanmeofAInofofinweofofdeoftoofofofinofofofoftoaninofofofonofofofof23oftoofofofininasof16ofofofInofisItinofofofoftoofatofofoftoinofnoofofinasperttoofoftoofoftoofofofofofising21toInofofIftoInintoinintoofinInintoInIntoofattointoInofinintotoofoftoofintoisintotobeWinattoofoftooftoininintoofAtoofofinAoftoofofattoitfisofIttototoillilinasexAenantoQantoisIttotointotonconisforextooftoisifIttptotoNAtoistotatoIBGisisitisisitAasonisisIfasorasusinoren23itasisisifastoIfiiIsisisisisifisis+IsaAastoorasasasasatIsOitsoasisersoorasesIf54itororasAisitisItNofororlseor55ifallititisititiforortcrnIor31itCryeCIff-wantoltfaAononor0aito0COitm40liAIsatiSTltvl=tCvtf4otr-SceHRalKII12flaaidaadcaiaaaataaaBrYIIaaaGaaaleaaa1aIaaaaaaaaaaaaaaaad1-aaaaaaaaIaaaaaLaAIIIIwaI+If1dhkjftaitmcilfIr1IlrtJ¬¬tI¬ct


PAGE 1

utnLLThfCOLISOUTHERNAGREEMENTGOVERNMENT-NoSOUTHERNSUSPENDEDH-alseyMISSISSIPPICONDITIONSbeREACHEDPROSPERITYVARSITYPATRONNEGROESFREIGHTMURDERBITTERPENSACOLASEAMANENJOYABLEASSAilANTSFLORIDACOMERSENTENCEDRACINGATTACKIS-BADLYTRAINSWORLDATTEMPTSWINDOWSMONTESTRIKEWORSENAUGHTt1-VOLXNOTRUNK2-2TRIALWILLIAMSCHilDRENLUMBEREXCEPTMEETHURT-FellMADECARLOCLEARVERYMADEISTHMUSTOURMAJORITYOARSOUT-DrivenOUTINGpa-yTWOPANAMAWhVCARGOSTORYFreightHENCEANDTHEANNIEWORKCANALFROMWIDPOOR0F648LEAPHADofcTodayRatesCANRYCOMPLETED-ByCIRCULATIONenjoyedMostWINSWEATHERContestants-AptONFORNYImprobable-inGlennTOtESEEFORPENSACOLAONLegislature-AnADSBYTOSociologicalTOGOVERNORBESouthwestoFTakeChicagoTHEReductions-inSaturdayCommoditiesBELMONTMORNINGINeverMotoringEngineersHESuccessful-LastRockefeller-BySeriouslyBIGShepherdcontinuedRECORDProfessorsFLORIDATUNNELAcceptedVanderbiltConferringIncident-AfterWillMussulmanISAND-DEFAMATIONThroughPassengerDistance-ThisAUGUSTPrimaryRemovedSECONDOFJLJ-iJINSPECTION-TRIPRailroadCharge-ByTOMurderersFridayTrainmenWOULDAbandonsDETERMINATIONrepresentativesconstitutionalityPresidentCOMERMethods-ByCONSTITUTION-BYcloudyMorocco-ByHillsboroFRIDAYOFevilsJohnFreightBriberyExtremerPartlyTOUCHAllegedFight-inRestoredCONDITIONS-ByHope-ofMississippiansrepresentativesthee3tablishiOPTUBESIsland-ThediscriminationsUpBrightappropriationFiremenAPPLICATIONCENTSunderstand-theNight-ATOcomplimentedGOVERNMENThardworkingKilled-incommission-willattemptedLIMITPrettydisadvantageofprosperityconsolidatingWreck-ByStreets-ByHONDURAS-ByFloridasatisfactoryWomenPRICEEasternapprehensionrepresents-therecreationLicenseprosecuted-atirresponsibleBYcompletion-ofyesterday-andgubernatorialBeingSteamsCulverGIVEShardships-andordbreakingexclaimationsgovernmentBrewerLevy-ByAdmitsEveryOrleansSpentAGREEMENTdis-approvingPresidentannounced-thatanticipationpropositionIIWinterSecondWITHSUCCESSFULconstitutionaldiscrfmjManilaproceedingsadministratorVanderbilt-raceWashingtondepartmentstureNotrepresentedShepherdopportunitycorporationdistributingyoungstersyesterdayWashingtonAttackprominenceLynchburgItalianlightconfirmedKnownEmmareplantingmisdemeanorcon-sequentlycorporationquarantineHumphreysinstrumentaldischargingPROFFER-OFMonthpropositionWashingtoninvestlgatioSALVATIONutkWashingtonsupposedlyEeliminatingTHEspecificallyLynchburgUniversityPhilippinesdismemberedMississippiConsiderableWATCHINGWorldMontgomeryVictimTangierpreparatoryantinforelgnMississippipossessionwarships-areMontgomerydiscussingagreementWednesdayconsultationTakenconcessionsLynchburgshippers-areSAGEconcessionsconstructionGrand-MasterprosperityOpenHousecarrying-outcontinuingpigeonholerestrainingSeptemberCON-STANTIslandsimplifyingFriscopersonallyREQUIRESagreementcontroversyagreementlegislatureHoursDECLARESdepartmentLongcon-siderationequivalentdeterminedLaborfurnishingTalk-SONUNNELLYSUPERIORyesterdayen-CoringgenerouslyconnectingconstitutionproachingyoungsterswindsinjunctionWhileTariffexplainedknowledgeunbalancedHatchpresi-dencyparticularscompetingSeemsAssociatedfOtTllorapprovingmerchantsundertakenabsolutelyEuropeanspossessionThompsonMussulmansdiscussingsialaturereligionSeptem-berfumigatedcom-plainantsociologyownershipFromACCEPTEDprinciplesSantalegislatureantirailroaddistributedsandwichesculminatedRockefellerfre-quentlyconsideredHardyesterdayquarantinepresidentconstructedcommitteeadjournedMorrisseyOtherproccfduiaispresidentyesterdaydmmitteeoperationnecessitateinstitution-ACompanydoubtedlypreachingwatchingRockefellerin-stitutionBROUGHTManvHolydeclaringshipmentstatementpromptlywyesterdayPROVIDESFaithcompro-miseRocke-fellerCasa-Blancaattestingregardingcon-tainingmagnatesAssociationmenThe0SantaromarkabledeparturecelebratedRECEIVEDabundanceSouthernsAlthoughFranciscothirtyfiveSecretaryTriedautomobileorthodoxyenjoy-mentexplainedShepherdProtesspryesterdayphysi-ciansFacesfurtheranceconstitutesTHEREOFConstraint>buildingsshipmentmajorityShipContractorcommittedseconded-bysupportersmeeting-ofdifferencesyesterdayyesterdaySalvationpresidentOrleans-manmanYIManhattan1i-imissionerassistant-towatchingdaurainflamingdefendantcom-missionapprovalVanderbiltcontents-aredeclaringemphaticproposedMuchfoundationswitchmenprobableGreensboroinvolvingsuccessfulsterdaysupporterspeechesincumbentTHETHEemployesAfterinfluencedthemselvesTimepetition-ofdonatingshipped-toHarrimanVanderbiltcommitteenominatedsecretaryVan-derbiltau-tomobileregardedrailroqdoverboardGoodjntrocluctMVardamansubjectedeconomicslitigationmentallyLouisvilletherefromSTATINGfiuplovesrecessionstreatmentinstitutionLouisvilleabandonedSecretaryPierpontconferenceAnyfortellingimme-diatecriticisedallowIPonsacolaHIMSELFUXOCIDEamicablyalthoughDaycompleteFranciscoconferenceyester-dayNextboardingcommitteeyoung-stersNunnellyCarolinaOklahomaCupnominatedKingweHdispatchfanaticalabruptlyVardamanrevocationSLaborindicationSERVINGalarmingStartendangerterritoryenough-topassengelrPresidentdeductioncooperatSecretaryadoptingbrakemencapaciousHISTORYhospitalenjoinedquantityDEATH-BycaptaincowardlyhighestadmittedmorningSUICIDEREATIONsecretaryMustKingweHappearedoppositesuccessfulbrighten29240000Roose-veltChicagoquaran-tineSouthernanother-heGETattorneysforemost-inMOTHERviolate-theWhoseriouslySupremeGliddensreportedshippersPresidentSThreeresolutionVardamanProfessorpri-mariesjustic-efpositionengineerNextTourKabylesdispatchshippersPensacolaRichmondMRSbringingAssociatedotherwisearrivalRosaship-pingindustriespleadedWillaccus-tomedgovernortreatmentRosahighlyfromRaleighWilliamsProfessorGidfportRooseveltafternooncancelledDavidsonpossibleRailwaydrawingattemptsJU-DICIALenjoiningrailwaysSouthernfamiliesthroughauthoritygath-eredSal-vationexecutiveprimaryColumbusHondurasrequiredplantingSouthernresolutionPensacolaVirginiainspiredcollision-ofGovernorprovidedColumbiaColoradoNashvilleRateafternoonprimarypossiblysuppliedtreatmentNeillCOURTSJUSTICEChicagosocialismmurderedopinionsmorningintentionFLORIDAassistantsLETTERafternoonconvictedChicagocom-mitteetreatmentwalkingstrikingbroughtPresi-dentacceptedenablingrailroadsstatementRooseveltsentencedcontest-ItthroughsuperiorHillsboroidentifiedsocialismSoutherncompanyadmittedVanduararequiredsec-retaryresolutionEVENTStrainmenpurpose-ofsuc-cessfuladherentsCaptainCaptainreducinghundredTangiermUroadrailroadscontinentbroughtChristiansub-mittedTheodorepositionGovernorfeeling-aspassengerpleaded>AssociatedWarWellsplendidbroughtcheaperZueblinsguishedprovid-edGovernorconsistedutterancethroughcommodibuildingsolutionjewelryLawstatementContinuedoccasionworkmanGoodmanrailroadsrangingap-pealedTangiermorningNewoccurredAssociatedWasPEOPLEGovernorservingAssociatedSJOhnGovernorcookingmodifiedthroughsocialismthereforetrainmenCollegewindowsreceivedMonarchjWillchargesGovernorexcellentdeclaredvacationpreventshippedlengthfeastingclaim-ingthroughmakinggreetednecessarythodoxyAssociatedintimatesagainstmbitionCaptainthroughcalfatIntoleavinginrwBagdadgeneralcam-paignSCORESsituationStandardmer-chantsshippedcharacterRailroadGoulds-canChicagoSouthernentirelyHoffmanreleasedCaptainJugularMorganTwo8NewsMendrenHallwayLastshippedchildrenattackedconstantturningbelongsshippedofficialsvpsterdav8Thesituationwhich-heMorgan1907MenbelievedagainsteducatortherebyadvocateBushnellgeneralleapingreceivedBelmonthesitatesatisfiedopera-tionAssociatedSituationattentionaf-ternoonreturnedleapingsouthernlightersthoughtpleasedpresentcordingdeclinedgettingremovedreceivedPanamapavilionasylumCirculationsupportthroughAugustaccidenteffectiverestoredbetweenleavingaudienceasylumexaminearrestedhoweverrailroaddeliver-toIndows-AiHallegedplacenationalOrmondmomentMorganRoanokeeveryonegreatergreaterbusinessgallonstonightreachedHoffmanAssociatedpresentnothingAssociatedbriberymothersbelievedbusinessinjuredsubjectAssociatedAssociatedqualitybitterlyAssociatedAssociatedAssociatedspecialexist-encemightyleadingconflictcountryexpensesreturnedtomorrowRETURNsit-uationchildrenfreightquarrelVanchildrenjusticefreightde-claredEFFECTconson-ancewelcomerailroadAssociateddeclaredcombinethoughtwentySTUDYwhence-tcontractCar-olinaThey-aregovernorforeigninjuredlumberwarmreportedpositionleadingdecidedOrleansasylumreturnsleadingsolicit-orsessionsburdenschow-derHasopenlyreferredOrleanselectionbusinessHouseChilStearnsaddressAssociatedAssociatedfreightsuffersearnesttroublesSTheejectedshortlydistancepeoplerequestelectionsilencedAtlanticwhich-wenumberHalseychargedressedlearnedma-terial1tonightcommitsanotherJacksonJacksonattackedWinstonhavingbetweendinnerseveralOrmondSOUTHPerdidosucceedrtraveledsecondgreat-lyWesterncitizensfiremanlocatedZueblinientativoAssociatedinvalidsassailedGreelysteamereither-orCharlesofficialsthonysGov-ernorromYhighlydelivercustomsLondonTexlinesupplyphasesoutingstreet-ItseveralDur-hamin-validsFridayspeechanotherwithoutrompedpeoplepol-iticsBurtonretreaten-ginesRussellThomasOysterchargesucceedrelativeocca-sionTheandOctoberNotcarriedFederalAFTERcounseltilwayRyhatchesNorfolkSThehimselfIslandsellingFinleyoutingYoungsub-jectcontestsdefensearrivedMexicoAtlantasecuredcontestRussellKansasBrewerCanadatakingGirlleaderssmingaivirnorsnegroesInteriorsimilarpointsinjuryhis-toryplacedSThenificantlumberhidinginvadedchargestartedtheaterattacksspringshpgtlectureRecorddistrictZueblincountyrail-roadButseveredJournalslum-berwishedbrightMayorlumberduringfurtherandandlearnedlumberwfhicjidefiniteofferedassaultchargeRepremakerslfl4efdnervousandandmlllionAndriacontestUNDERexpressRIGHTarrivedcontestattacksFrenchpointsPEACEstretchMonteshouldmonthsfatallymothertestinalsecondlosinglittoralGOfoundersanitycrimesAreagreedherselfArmypointsoclocktickerselectedoutlookregarddeclareballastprisonsteameradjustItaliansunjustoclockvalleyTOJudgesteameralmostremainconsisttreatedMayorandspellsyuiaiionMobileShouldHeraldendingCulvernightcontestzealousadmitswantedcontestcircuitoclockMobilesuddenherselfheavycounterballastlegislreceivevariousEveryampleannualpassedGoodmBritishportsdockedinationEverypolicepointsAndriatimberMobileMobilearoundDaltonshouldaround200found-AGriffininsaneoclockguiltypriestTHATpointsSharpaboardlandedtimentEmmaknownArmyMANYleisureoffensenamedpeo-pleamplefed-eralpol-icygivensubletGouldsnightoclockFROMdebateoclockbeinggivenWESTgoodstalkedconsulprocessWORKformalbehindrt5Tinbecomereadybeingissuedhoped190beingde-cisionroundsgoingARMYsecondashoredinnerJudgeWhenwithinfellowsleakeddirectwintersacolaenjoydinnerThegoingtreatedbeforewouldJournalpersonsenatematterdoingreadypartyIslandwhereYORKjoyedner-vousbeingtodaytodaywhichdrawnforcedUnitedamongcommonsuffersre-ceivedoingcoun-tryescapeapplybringprobeformalshouldadopthopesagreedtheOFComerwhichceivedItalianillnesshaltedgivenTheypartyeventactivestreetsgiventodayknownissuedwhosewherestatedbranchgivenalongdtheywomansknownoccupywherereadyOVERUnitedamongRockAnnieknownagaingrainIslandspeednightattackbeforebeforeservedmightIslandIplandunfairletterarrestLadyseamanthenoticenightpartyStoryMOSTthenightplacewherexnotonTexasGoods1ttprspentenjoyWingwouldMensrecoverSvresolushowsratherbeforenivStateswhichyoungHERErecentsys-temstatedvesselTheyvesselnatureresultwhichwhichW1LLtheamongOnhouseviaothersothersfstepstheMrothersSInstepswharfreplyGOESeffectIslandwhichwiredHEREHouseamongStreetreturnColoncottonwouldwhichTheyadnttravelthelargelargewhereow-ingplanswhitefoundSantaGouldUnitedvesselgreatagainmuchrecenthandswhichtakentheticketOdomhordetOIwhiehSneclalassertwhosewilledtherethereStatesstatedwiiichSIIIwharfwhichwouldTexasNorthCarloOdomthoseeffortearlynightwouldwholeresultticketswoopwhichloopsnight110AllabouttrainsessarypartyeventdidntrecoverComervesselcrowdhouserainsplaceGoodstrikeotheraboutwharfstatedwouldtheLouiswhileLevywhichSantaSInwholeGlennlittleliabledistinsociallerredthosemadefessorhousethankearlywhomOnLonghatch75000GlennROADIlyinglettertakenticketwhiehcausedcraticagedtraf-ficOdomwomenviewsbeachfacerightremoveStatesaboutpiledLongcaus-ticstatestapicbeachstandhomehatchauthormakefailedwhichaboutpartday-orworldmakehencemademadebeliefotheropensSEPTwhenhoursGotrunkOdomNorthbe-lowworryto-daywhilecouldTaftdayshavehavehopePEALsincewhenlongdoubtacheseffectwomenwomanwomenaboutcourseNewwhenmadeaboutKentSageSomecourtGIRLboardGlennSomefightordertherelossestakenmakedeJraLaterdaysLouisproveRivereveryohersworldaboutBewomenmaketheseunderNEWFrommakecourtPressbusyfoundeffectlookstheyhardtlckotretirefoundagedbodyhapswhendresswhenthreetimesthereherehourseagerINBeOtherWestmadeweakwhenpacesRosa-orderPressTHK1HitherestockfromhandRecordmade8AwhentherecourtAttermstermsParistheyeventmanymindcoastorderdayshl1negrotheyfromSTfacesmeansrecogclasstheykeptwhenwhenworkRockweekunderrulesvotesonlytanceWallBaytheythreetherepressfacesLakesincehaveeverycourtroadsdeckdowncouldknifedemoitselfagreedayswomanSepttheytheymanymentmentrulesYorkthemhaveknewlaboreverythirddowntheyonlyonlytherecropsthemINTOportseverelongcargoworkthreehaveAugtentsGoodYorkfrom-aship8AsincedutycanalhavemanythemfromfriedBothhaveholystatestatethemstatemadeAugTHEFirstAugplantheyrangeNoelmostfromNewfromacrossroadtheirtheirhavesuchcentscarryafterJchnwhichthemYorkextrachiefhourwithbacktheybackfromANDcourtmentbut-itcourseafterlittletheyRosare-sulttakeotherAugAug111theirhaveAugtermsVereNeillfromlocalsametOOOaftertimeeverycropsTHEAugbeltMissAugonlycamevotessendYorkthembothsentANDEastopenheadheadshallmanymostjuryCityOityAugcreamYorkarmy3J540beenOhiountilbackAugbackawayJonesulentmostseasonBefrombrimhaveuponwordmeetmoretnanbeenbackJuzodNewstatefromcase-IntheirAugdonetownuponwithmadethePresistrustwiththanMissfrombeenfromwithPageusedthantotalNewdutypartfromfactsleastfromhavestartwithafterLAWfrombeenThisfromAugshipmilestatetfcbnldeadONEfinedstatewithTHETHEmademoststartIllCaidANDfromcomessuchfrombeentakeitloncityfromsineAugworkhourbeenmileheredeedWarttleifreerateshaveQiilTcComFORtimeboatnexthourbeenheldfromhaveANDAugleft-alawsThisFORtimeshotThisseemsColothateachhourtimeHASEasttermdrenfromfromold-ergirlnotewithfromnextherefloorwerelatethannortthatbeenheldtownboathardbeenherecasesAugthatTheAugthanfonaRECtripbothhalfforethatPresspooragesNewthanfinalNewAugAugwithInsentthenNewpleatakebestherethanwithdaythatwithsomecakethnwithfirstThewifedatethemwithlawsbeenTwothusyearThesaidThethensentAugneverthatTHE212thatthatservesomeyearstrialwithTaftdaysoldthatthatthattripgirlFrywerebestsiresentthatthatsaidAugyearthencausehamthanthatfarethatthatenterTheTheTheshewithtaketripwereinyearveinthatthatthatthatthangirlsent950iPresssomethatofsaid1894thatviewtookTHEuntiltubewhogirlthethatwiththatthatSanopensaysthat1904yearyearhaternorTaftfreePresswhorhpratesthatAugroadtimethatheldThehimwhothatofgirlstilldayTheablesomeMsentwithalsovicethatthatthatsaidthatwellingThehowsentwerePressPressfeetsaidmoreThehadthatfieldfirstsaysofratewhothatthatthatwhowhofactsomePresstalkherthisTheingtimemayhadTheTheandthiswithRevsurfthatTheThefeararmssomePressweretourmaysayswillPressputsaystourthatPrssbothThePressthisThemoreandfarelastThelatealsoinintotourthatsomemoredatafewwerewerewerelate212ThevJovcentthislastwillPPIIthisstathimandtoldwerewerePresswerePresscounmorethisandandlastjoynewswillstillandAndwillwillAhxwayrateoverwereandandandmore4850OnewillwilltalksheonsheshewinwillandwillintoHisandhadchilhadandandandliwsthislasttalkwerehadthetheandSanandantitheshewerePresthewerewereintoSheartdandlesswasMrsriotthis2441newsameandherwillthishaswillthlsandwillandandnonewerePresswillhasthethehastheandandanddidactslasttwoandandwillwere1887andfallandandandandwaynoonfactandandwillandtheandSCiSmenhastheonesrwilllastthisAmorefforthadandwillandTheher2929herwillfishandendendhadlateandandanbigthatthisthethethethethetenandandandandandandandwillandleftProandandandhadandhasthehershepietowillthehernecTwocarsandAthtfevermenthefactandlastandandITSandandandandandyetthethethemantheshethehasconseonandhassheintoandendandandandshetheandandTheandhasandandandanyonHeandandandthethethethewasthethethethefewandtheherhasherhadwillwillsoon1901andbutandiI-JevertheandhasthethetheLurerearthethethethethethelayoveroverandandandandandandandthethethethethenewtheFlahasthetheonhashernotheYsheracehadendhasthethethethethemanforthenowherthethethethethethethethethethethecaseAntheandoutthethebutandatforhaswillmenracelifeshewassupthenotpeothethethethetheOleanyfishcupthethethethethethethethethethethethethethethethethegetthethethethelifenowcarssayoverpayanythethebutandonthefullthethebutnowwastwoandandoutnothashismenByBEracethethethethethethethethethethethethethethetheANthethethethethehistothebillthethethethethethethebutthenownorhasnotthethe200thethetheAPthe110Notthethethethethethethethe648thethethehisdidthelawandthethetheimrthethethethethethethetheandthecarethethethenotbut1900nowwascarserathethetheotIithethethethethemaathehoffellthewaswasthementhethethesigthetheandthethethethethethehisthethebutonecntwascarsnowThe1902zonsOFtheSalthethethethetheforforthetheforAlltheforthethethehisthe1904thethethethethethethethethehisthethefellthethe1899outhutbutnowwas1905hasthedienowwaswasthewasthetheforOnhis1906andthethethetheoflCdinthethethetheandthethewarpernottwowastheOFbutgronottheforforihchisforforSirforhisthethethethethewaswas1903thewasbywarthewaswassaywaswasfor0forAnwasStwasTOthetheOFtheforwasbywasbyforlecforforhisthehisetcMrforthetheforDRbywasforforbythethecanbywaswasarmoneIxCbybyforwaswaswasHetheforHehisforlawicedisforselTOcanourtipswastheAllVtsItt¬4I>¬IIf1t¬¬¬iI¬>JjV¬>¬¬¬¬¬tI¬¬¬¬¬¬¬¬j¬¬¬¬¬¬¬¬¬¬i¬¬¬¬¬¬¬¬¬¬¬¬f¬¬¬¬¬¬¬¬¬¬¬¬<¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬i¬¬¬¬¬¬¬¬¬¬nn



PAGE 1

SEASONfiJOHNSONGETTINGMARRIAGE-INVITATIONSLATE-INCLEARANCEWERENORALbig-SUMMERMILLIONAIRESda-ysCONDITIONSTHEEXPECTEDSONLGARNIERWEATHERSummerVMSEWELLANXIOUSunusuallyinves-tigateEventsSALEf-orTE-STYourSaturdayPeopleSaturdaycarryingREILYTAYLORMANYROSENAUSuc-cessorBURRvalues-inENGRAVEDITonlyM-ENSDietWillISgoodsONTkIIILintendCOMPANYhenceHOTgoodsummerandLJnAugENGRAVINGDEPARTMENTvalues1475haveMRjLAughaveGabnCORRECTLYSUSPENDERSBALTIMORE-ByThisCOPennsylvaniaPROMPTLYENGRAVERScashPENSACOLAWHITEHALLUNDERWEARPERSONALSTEVENSisJOURNALSenatorshipgivenAugustMORNINGDORecords360u300NECKWEARTROUSERSit-TelephoneTarragonaBOTTLES-ISExperiencewillthisSuspendersSuspendersandSuspendersandWesalesaleATLANTAyouGROCERSSAMPLESsomeanypayMENTIONSTOREDUCHESSfor119RepresentativesAUGUSTGENUINEGROCERWALTONoverPRICESPANTS-50cCoTHEforweekPensacolaITEdisonWeather-atFjaDAYsays-PennsylvaniaVictorguaranteeAUGUSTqualitiesnotqualitiesPennsylvaniaChildrensSoll65pere320ScrambleNeckwearSUITSNeckwearTemperatures-indo25ctpairuncomfortable-TheGovernorTemperatures-ofSTRAWiPrevail-edGII-rslyrtleE-WeourSHIRTSqualityWarmeronethirdWomensqualityregularWomensvalueforTrouserstoday-PensacolaMaybeWeatheroFANCYqualityqualityRIGHTOxfordsOxfordsSusquehannaDuchessELOCOMOTIVE1tBarefootPennsylvaniaOxfordsOxfordsSummitPass-aDrawersOxfordsmentionPennsylvaniaSENDOxfordsOxfordsorganizztiiaOxfordsDepartment-ofassortedassortedFairlyareofMontgomeryOxfordscorrespondentneighboringSTOREindispensibleOxfordsmaneuveringWASHpreliminariesBainbridge-GaFIREStemperaturesApalachicolaCAMPSandalsgionTheMENSPennsylvaniaPhiladelphiaweHarrisburgweUnseasonableLISTA-LLEverythingMENSClutterLocomotivetemperature10Earlyintimation-thatPensacola-IfSUITSSchenectadycommissionerWednesdayentertainedPenn-sylvaniai725VISITcircumstancesMusicparticularlyconstipationWarringtonunsparinglysenatorshipHATSLadiessagaciouslySHOEtemperedWash-ingtonprosecutingBOYSGreensburgconstructionHousesenatorshipAgricultureKINDnumerousinterruptedDAlemberteschool-house17millionairesTallahasseePantsleadershipHowsresignationLadiesbuttonHartgroveDisciplinedBOYSLadiesannouncementconsiderableannouncementLadiesWontLadiestem-peraturedisci-plineddisciplinedin-terestingreconsider-thesupplies-Mrsprice-smillionairesanduncertaintylegislatureFOODthroughoutGoodsscarcelyCONSTANTLYoperateonvaluestocertainthatrsaictaneesdispositionabnormallyMissespercentageexperiencesthreatenedGoodsTWOBoysMountain-andCollardaughtersCollarGoodsMuchnominationlegislatureStates15000000-oneconstantly-ICollarcampaignsvaluesMensBoysnttPenrosenumberingpoliticiansGoodsvaluesWhiteCollarnecessity-oftoinstituted-atvaluesPUREBoysunsuccessfulANDvaluesHcchingercomposedWashvaluesbecomingPantsannouncedcherishesBESTgovernor-theANDWashThompsonmillionaireMenstoextremelypossessionPittsburgprecedingestablishedPittsburggreatconquestsTHEMooneyyesterdayoccurringyesterdaypersistentWeekTHEWashUniontownShoesDeFuniacmedicineaccordingMenspoliticianswithdrawalShoesMensMensftrnnuacuonsseasonableWorkPittsburgLittlefieldTHECartrightThis-WePostmasterundersigneddisorderedForCompanythreatensMakementionedWednes-daycandidatescandidatesPantsFORLARGESTyesterdayestablishedcandidateeconomicalWarringnominationquantitiescylindersvalueproperly-JngulaclrmilionairemountainsOrleansshrewdestitprobablysenatorialconsideredmanwlthShoesconsisting-ofpresentCompanyprimariescandidatesvaluede-structionmentionedconditionsBeechNutLawrencecampaltmunusuallyTestimonialsTennesseeeverywherevalueanywhereplanningstoppingArkansasoccurringlocomotivedaughterdaughternewspaperattended-MrshowiuavaluevalueMcDonalddestroyedCompanysecretaryRobertssvalueantiquityBIGSavannahbusinesselsewherespendingpubliclycapacityvalueWeakleySavannahRooseveltprobablevaluevaluevaluevalueAmericanPensacolastrugglecan-didacyEgyp-tian2628exceptionOklahomaNowJpleasantprobableWritingstrugglevalueBaltimoreBaltimoreMountainttorneyCOLUMBIAwitnessedportionsminimumPensacolawriting-ADateRaceprevailedBrownesmanyimpendsAlreadyordinarysomething1725de-signedfreezinghandingcomposedGoodrIchmaximumPensacolamaximumconfinedsomethingreportedLUZIANNEbirthdayProbablycontinuescandidategen-erally2250financiallyChicago15001000Garoiers1907Includ-ingsouthern2000BaltimoreBIGproblemstrugglesunshineobltgauonsherr-edlatdroughtbeoneafternoonconditionShowerscandidatefavorableGeorgiastatement1250GoodrichreturnedattorneyattorneypublicanNothingnortheastsuperiorInferiorRichsurpriseweatherSundaytreasurercandidateHerringRenyalsDentster1800pre-vailedGarniersHartleyOneCawthonpleasantSpringschairmanLandrum1650droughtengageduncertainregisterpositionnorthernmedicinehowevercandidateCoftrelievednorthernreportedexposedRailroadGovernorAnotherSaidSAfterMenBushnellstallingsufferersPenroseinfantryTransferregistergenerallyEnglishCoolperformPhillipsQuinnieadvancepublicanStanfordmorningseveritygeneralsteppedInsistentenginesPenrosecomachtnEWAliDIKDalreadystrength2GGVsouthernGilchristGulfCaspianTHEMissourigovernorlargelyconstantoccurredGertrudewithmenderRailroadgeneraltroubleswonderfulinternallyBrothersSoftIn-quirerGadsdenJohnsonVaughnDruggistsmilitaryweatherAtlanticdistrictsAugustHerbinetelephoneTiesMooneyWesternharmlessfinancialweatherin-stalledEarly-IncountrymilitaryTHERECORDSinsistedgeneralAtlanticSThecapableAssociatedthroughtraynormal-ingovernorJohnsonHerbineinterestsSoftreserv-ingTampaSandersv50MasonicreturnedreturnedBonelessoccasionreturnedvisitingDueSundayWHATportionSoftPharaohpuniShHerbineoccurredArabiansrailroadlargestweeklywithoutBrookssRamesesfactoryassistedfinancialplateaucountryAssociatedDriurgstreet-bytroubleshelpersgeneralSundayeachOlmstedChesterthatreachedDakotascavalryOneAncientsHerbertAssyriaingOneDistrictvallejSelectedspokenAtlanticDurpossibleWilliamsectionwithoutGeneralyest-erdaywheth-erweightdangernesdayernmentDep-utyfriendsdistrictsgovernorhimselfAmissionislativeearliestjobRECORDSpresentperfectlyJohnsonelevatoreclipsechariotsengineJohnsonPhilipsSenatorinterestAtlanticAugustgovern-orendingspecialhavingTampaNormalpresentgreaterduringSenatorOnethoughcloudyjobserv-ing225Wholesaleforhas-fourOnehimself385FridaynoUticalcreditedElkin-ofpoundsweather350supreme300415honorablehighlywithoutOnejob405Waltonrailroad245150weatherSmoked250Loftkinpusher8MrsPhonesCOFFEEgovernornicely150SoxextractstroubleGeneralspots-inhardlyPhone600495ThereHenry400450200485TampaGeorge150350suitduringRocky185region500obligingsenator450119300285pledgeengine200arrivedWilliamSoxUnited400openlySoxBreak-fastadvertisewestern285385500nearlygradesOFWalton100GHENT800averagePreservesSenatorJustice150BartletVanilla180100deliverGeorgedistrict119find-ingGA500250290serviceFloralasuitablerainfallBartlet240125125pressbQWIlJusticeMessrsRocky150anothergov-ernorventure400Ifivlew315realityfriends250suffererRocky125being600119150250TheSTpainedregion100Mastera-LlumberTrarslscregiontaughtFloridabulle-tincloud-ofplacesrip165175125175DuncannucleusandMARVINandand325breezesrecordsshouldavowedcentralmatterregionAlphaAlbertacontestEveryaverageBrooksandEgyptcontestcontestbeatenandandseveralfjntpsuit350175ticketsRobertguestsSproulknownisstulienHudsonandandseveralcentralillthisstablesBUILTandDakotarainfallyestercoolestBrooksbelieveEgyptbeforefriends5iveralfriendshomesofficersmarketPacificstationandTWICErthem-inandaroundHundredmiddlePacificmiddleMaudeaspirebusinessstationoclockandFlynn42cbeingSELL50cMessrsstormshandleandspendmarketStatesdidatefigurerecordandMisseshomelOcHattienumberRibbonearlierGreecevisi-tingKKsTCAalwaysBrownBESTchoiceMiddlehotel-AdirectlyBrownbecameBeardsGereldsfor-thoebringEmmasacola363normal125ThereCatarrhXesbitBeingAlbertdoublebeingcentralclamor39cTHAT25cMissesbeingbeginnationsningsVtvmenough19c90cthe25ctoCampNewraniJosiah85cRosenaunormal39c39c25c43cexcess4750cguestload-edwithinEVERtracedMartinFamily19cbeingbeing25clodge25cweekslOcCamp98cbet-terEDISONdrilledIidentgivenmakes175000prior15cableststatesWord50ccostIII95c35c95clowestofficerHe19c19cEmmaaroundMary50cTylerpartylead-ersCatarrhOTHERbyLimeSuttonNewswhichThpre50centirefor50c15eGrandthelieparty97ccitiesdecidelpekerbetterQuayDontstateswhich15ccenterfor50cLightaboutOliverwhosendoutmoneytheJonesCatarrhlodgepartypartyshoesfor75cSpecialThereNunezwhoseturnedstates85cSouthTherewouldtodayklstoiAddieIndeedNunezStuartforBYforforPalafoxGulfwhichAprilGold-entroopscouldwritesforthewhileGlobegatedforforsurfacesSouthquiteNorthstatesarmiesunderSTOCKgrainDavisGocdsChaseforforforabove85cyoungTexasforcesBetterformoneycalledsenateboilerwoulddutiesforwhichforforforforplantforforGordapermakepattnsettleBoiesRainsentireSpecialRewardgoodhomeworthforforseve-ralforforforstatesforforcity-AstandIABLEimumforforLIMElargewhenhomegreatbelow70000theseforforforforforforLOGUEJournalabovetheseJlcVoySinceEAstreetTexasforbelowforAMERINorthPuntareachpartsThansystemAnniestatestilingforstatewhenFoodforJonesimumuppersouthMissgreatJIobiUJournalflavortremehaveAppleFrickaboutranksworldTHEgrocerspecklotmuchtoofoundhavethosenentsThesesteamtrainTHEQuayaboutupperDollarsStoresouthruntaboutsmilemade8AkeepmaketgreatimumKeptspelllongStatePeanutwrcksknowScottmadebeawadeThevtheseenteroffJohnThatslotMissbeen-aHereStateaSinceexcelagentNWButtereverystockofficeRomeGelggoodeffortissueconnecStatestatesliverfrostsElklpratedfightwhatknownlotINgrovefilledWithgooddaysfromcarryHoltsToddClaramanypingactingmanylotII-ofHerelotlotweekworkgoodJanliver-ImakefreshtheyKinglongdowndaysYorkprofitMattgiv-enweekBelleonlyshallToledoFredbelievenorthWASthreeusuallooksKINDtheirbeadCATAdaysButterhavechairpicniclearnweekweekweekwishfromAugsouriWithbeenlittleweekwhathighlocalweekbeenshowawnychoicedaysmostnightnamestheirhighcoastthosearmycoastbeenmanygivepartbeengivesfromhavefromlittlestatePasswithToledoAugwhichthatshipdonewhatIeyrsattorfromgiveElliscksCALLCure-FBurrhalfbeenhavewhatsomearmycastshelpAsiaPureEastbeenEllisimpbeenfromstopGOODcoursestateleutloudhaveAugmosthaveLolaAugthheEastMissBurrcitywhoJUSTsteelpartstatepricethantimeThefromEllisfrompasttionsclassjeabWedJohnSlicedNewwentmostMisstakesceneheldHart40The-eWEjtoSoldheatPrescitytearjlbeenfromElbahalfHallsBurrhaveFinnGulfComwithkindHansinjheresuchOhiousedLinnwantmostLargelocalMissclosebeendaysStreetpsconstisolvenextown-eriJlt-IncashThiswithEastlakeuntillakeSlicedcityTrycitySouthwithmilemucousGulftimekindwithwithHuffcannotGulfrankAndthatsomewithbestthistimefromhaulwithnameBaconopenfromtinnywifenextthatdateElkthatErieloveFARyearoppodoeshaveseemswithMissmanfirstwhothatthisofsaidwhotion930loudbottleSthowthatableyeargoesdoesgavehasaidcashdearGulfmaywarmToddthatyearbestThedaygoodveryaboutvJthtwiceHonfieldmoreBlueweresaidrSecarryPresssaveofdatemoresomewhatmadefoodmayfoursickdiedWOOwhyalsoThe>yearGulfeastithatcountbfPriceHisswholakelosefanandveryJeffMrscoolwriteatorusedyearspofofsaidwenleftminTheTheandThebigwhomayweremeansofBlueminTakefirstratefirstwhoamStalkThedealPenTheMrsfirsthimthishimweremorewillcomthatinhestonceMissandTabTheThethisofthiswillwillwillmenMrslastthislosscuredbloodsaidHotthisyearwillandandwilllavecoolPressThehaveCuresonstinsrelefineandandandandandbestthethelasteastThelastwillwill1willMrswillandanythehavehashastheandthisSheandthiswillwilltwooneandwillthisandhaswithlosstheandandandfewandandsellhotMrslegthas38andhimthisthemsomeagoandanyandandandMisandandSenandForandandandanytheisandtheraceNandandwillandandeggJenhasaskwillandandandwinandHereandj-fdjtheyourtheputtheandandWeandthethetheandfleyCorahasandand30cthewelltwoandandandthetheofferthehascantDISCoverandandandandbutherweretoChenanyandO-WePillstheevertheAthethethe000hasandthethethe=tIlehaveandMrsandanyneyandFORandwhoyouand2ndherhashadMattandandthethethetryliasthethethethethetheraceraceandandyouhas>usesoverwasthethethetheduePerisBeefliferacethe430thethethethethethethethetheyouyouthethethegov3anynotandandandthethetheAlamenthatoveryouand100theyouthethethethethethetheandtheMrtoFlathehasfireherHasracemenbycarsitwasandhisjthethethethethethethethefh2thethetheJamMythenotthetinthatforthethethethethethenewthethemaxhisandthethethethethethethethetheuponthethethethethebutantbuttagsoldwillbutmanwasnextTrythethethethethelOcwasableforforforthethethethethethethethetheevererasandwanthattooforatHethethethethefirmSalethethethethetheMrCANovermorethethetheMrsYeswasSoldfarMisforhisMrtotheforaidthenotforButeatthethe413thecomewillwasMrhisMrforhisthetheforMrMrformenoneThelOOwasthethewaswaswasnothithisforhalfportheforMrRevforvalforforhislastwasyou7wasneworforforforforfororOnehimforwasWthewaronegetFigtooMrReforHetheMrthesomewas600freesentforyouareiwaswasyouputoutfortheTao311HionemyI-JbyhimbylineMrtryforfarHalArewilloutartwaspayforwasDrsiaAStFrPMrItsandyouyouareitsrgIPandwerecallforyouResonandItsofsirISItsareonesellallone14andrunlinehebyanythe03runWebpallitscanarelcasetheallitssevfulllStareareareCarWhearecanASDoSlWheallAskWbeItsNoByarearethehetheherareRLI-cheWWCO114forwdthebebebebeforWbebemeheeatbehebe9uphebybebeperbefor5S7upBearehe75cDWhisatofRlbe88to1-i81ini87allforsonbeWtorentinbywastoofPnrtonIntoofofetccf94atofofofofinis77atononM112toofofofoftoofofinofof76ofofofofofIffupbeeraArofofofinofoftoofweIBofofofatintoininInofininofofinatinofof74intoofinoftoinofoftoofofSUtoofinMtoofofinofbyocttoofofofofofofinmeatatatatattotointoinatofofoftototoofofofixi-rinofofofofatofofofoturinononofofinattoofoftoininasasintototoinofofofonisforisjtoofoftotontoininIsortoJofonnonillutoofPofoftojisitallseeexweInHtoinnoanonItbeatHIIsoINtotoInAIsacKanonnoINrtisItantITitbetoisisistoiaistointoisisisHNisIstoanweinIntotoIsisRfItisasisisTVNVjItRrntoasreAisorastoINEIfisisUinisatassoaBaaAItIs1CitDDisspDIsacasonasonItifasorBBifititasesDuiofasasatofOBatItELLif0EFF<11inTitGittoCIBrLftrngIsBtooftotoitPCptoIInmAmtoOrooronFIfSSIs9p-btYItIt-Jl>JJortiJSSSJIPsItL=JJwjJIItaaI4tIifI23Ji-szaInaIIuJaaarI<5I2aaaaaaaahIyIaaataaiajIaaJatiInaar==bJI111==tE=sII=s7J¬=====iI==ttaI==<=====t======31aI=I=aI>==II=======tjv==================rI==jII>===JII11=i1Cf===jIFlIc=====it=J=JJ=I====i==11vTIJt1t°=b<<=====III>sJ=I=IIJI°iI==r-1I1==I¬t¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬r¬¬¬¬¬¬¬¬¬¬¬T¬¬¬¬¬¬¬¬¬I¬¬JI¬¬¬°


xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007591100925datestamp 2009-03-17setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title The Pensacola journalPensacola JournalDaily journalPensacola news-journaldc:subject Newspapers -- Pensacola (Fla.) ( lcsh )Newspapers -- Escambia County (Fla.) ( lcsh )dc:description b Additional Physical Form Also available on microfilm from Bell & Howell, Micro Photo Division and the University of Florida.Additional Physical Form Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.Dates or Sequential Designation -88th year, no. 22 (June 2, 1985).Dates or Sequential Designation Began in 1898.Description based on: Vol. 3, no. 147 (Nov. 29, 1900).dc:publisher Mayes & Co.dc:date August 9, 1907dc:type Newspaperdc:format v. : ill. ;dc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075911&v=0092516280864 (OCLC)000373755 (ALEPHBIBNUM)sn 87062268 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Escambia -- Pensacola



PAGE 1

cJVJbelkn1r11iiP1I41iiifltatT-hiDAMAGEPOLITICIANSMOTOnRACINGutoIaPOLITICSCROPSTALK-Matchma-nVASTBOATTHECOMPANYJOURNALANDJOURNAlPRESS6-UGUCRIPTIONPENSACOLAMORNINGTOAUGUSTANDJacksonvilleCzarHeresS12JOtJ00ASSOCIATEDFRIDAYJSUNDAYCHILDRENSEVENTYEnforcementJenningsDeFunjalWEEKLYDECATURvegetatlonFlorldaRavished-by11VIEmuselectionTampaRECORD160-0OfflcesseurnaljournalPanamaBuildingCornerPhonezEdItorato-pestrfotiiheNBPUBUSHEDandmonopoliespersrraallyjverycommonwealth-couldOrdinanceAccomplishmentsWSGeorgiaIpropriationrldaMadIsonnegotiationsWStionTherejJRockefellerBohemianCUBANchampionship-ofDEVELOPMENTgubernatorial-raceifthsectioncould-notdisarmament-JohnBetweenNEGROcountYHolmesSidewalkWIVESdisappoint-mentvicepresidentRep-resentativesAustrianTHEhaveiadethe12fcoreepoverYEARSpropertyownerSEVENNewspaperDAILYMEMBERJacksonvilleplacerMiamiFlorida-AunwillingnessDisappointedysdesgn-waswayTamparequirements-ofimmediatelyJOANincidentallyCommissionerLandscapes-Ine1iIHwaterfallnorin-experiencedpenitentiaryCreditable-TheFastestSaloonsMORNINGThunderbolt-Itappreciation-ofpreparationgubernatorialprohibitionambitionwSllindependencereceptacle-andwithstandingDRUGGIST-SSregulateIrtsgovernorbpmotherinlawappropriationWashingtonmerchantsappropriationCommissionerundergroundPenitentiarysomebody-toldMentioned-ThelimestoneofWashingtonconscientiousMONDAYIncorporatedsalaryTimesCourierPensacola-hasorganiza-tionsDEADgubernatorialMontgomeryun-questionedlegislativeadvantagesSavannahianThursdays-orpronouncedlandscapesSuggestionadvertisingannouncementcir-cumstanceschildrenandconsiderationconsiderationconsiderationacquaintanceJacksonvilleTimesUnionsatisfactorygovernmentgrayhairedWashingtonconcerningcontrastingAdvertisers-Aknocking-thethroughoutCompany-ofordinanceWindsbittedprohibitionThunderboltannouncementjournalisticanticipatedcontainingcongrat-ulatematrimonialMonticelloTimesUnionUniversityWithdrawalcltjFapparentlygovernorFconspicuouscountrymenlegislatureProsperitybusinessManhattanrJOURNALSseventyflveenforcementthroughoutJtetropolismagistratePensacoliansTelegraphSecurodc-JitftIPossibilitiesknowledgeJacksonvilleUniversityCamagueyEXCEPTJacksonvilleconductinglegislatureyesterdaysmatrimonialenormouslyMetropolissuggestioninter-ferenceJack-sonvilleMetropolisbuiltnnlessprosecutedaltogetherfrequentlyEvidentlyGainesvilleMcCrearyphilippicssomethingIntendnnoiacandidacyregulationsover-tisxwawakeningownershipMetropolisJENNINGSpr-oprietorsCIHlailenlegislaturegovernmentconstitu-tioninformationSetardsyapromisingturpentinereputationpositivelysomebodymarriagesadvantagewithdrawallegislatureautomarinehandicapordinancesFieldsnewspapersPensacoJaEnte-rprisechallengerexpectationrevofiztionappreciate8HeavyGainesvillesportsmengenerallyprivilegesMoroccansdecliningJenningsRockefellerhappinesspredictionGaines-villeManagercampaignamendmentcylindricalimportantconclusionsremarkableprosperityCcUeadaadvertisersMcCrearyBoatscelebrationDemocratsincerelyintellectualTallahasseeexpressedprotectivesentencedJenningscampaignpoliticallygamblingwithdrawndenouncedgenerallybelongingJenningsPeneceratheirboatMcCrearycandidacypossessedWilliamsonPensacolaestimationexperiencedproBaWyconvictedarraignedfortynineJenningsJenningscampaignpilingupcandidatesSundaysrefinementcandidateimprovedtreasury-APensacolag44PresidentMc-GrearyTHEintopollfortyninePresssummonedsurprisedAlthoughPenaacolawriteupsANDwhereFloridasgentlemenanywhereMcCrearycountingJenningscommentsa-lternativeJenningsprobablyJenningsfollowingabandongnashingnominatedCandidatesintegrityJenningsPensacolaaccord-ingStatementionedAGEattractivegamblersreelectionreasonablefamalfstrongestJenningsJenningsordinanceAdvertiserARCunder-takespresentedgratitudeTropicalpermitthousandsBankfaeadJenningsVanattersenator-forexamplescommittedPensacolaSundaysMariannapredictedconventionnewspaperPressopinionsStateHendersonconsideredAdvertiserPensacolacreditablecandidatewriteupenforcingfollowingPensacolacelebratedcandidatesMORiINGSections-AregrettedordinancedevastatedopinionsPensacolahundredthJenningsindustrialpeninsulaJenningspresidentBuslno3spersonalplanningconventionJenningseijfidentHASMAYESIIarrangedgraftingJen-ningsPensacolaPensacolaSavannahfoolkillerPensacolaMariannaflatteringflaterintgprevailedDetailedchallengeLakelandmorningstronglyambitiouscandidateMotorboatyen1absence-ofprospects4iiEVERYdraymanQuesadabelieved-inarmamentcommentsSavannahstandingbusinessprobablyannouncedundecideduprisingsidewalkscandidatevigorouslimitationr-jkPensacolawitnessedPensacolamention-ItprosecutedrawingappearedsidewalkKidweHskindnessthroughFAMILYwhateverSpanishmorningSplendidenteringassociatesanimatedconcernedapmo-prlaquestioncalculatedprovidedprobablelegalizedconditionmentionedWORK-OFassociatesDemocratordinanceauspicesunseededChipleyLoyaltyMalloryordinancecandidatelhimoforchardsHilisboromarketcommandWilliamsthroughmedicineadvancedwinningFloridiansubtiMtyWilliamsnereRfterdescribedrefusingfavoritesPensacoladraymantemptedthereforeChipleyappoarpdweepingcomfortepositionDolphinChicagodoubtlesscandidateuncertaineditorialsFLORiDAbusinesshadeendamagedworkingwriteupQuesadabuildingleentinvolv-ingprovidedthereforesplendidTribune-ARegretsdesign-ItnotoriousdescribedexecutiveChicagobroughthereafteragosomeprovidespleasuredelegatepropertySouthernGeneraltributionprovid-edDemocratelectingsplendidtogetherperhapstreasuredpropertyCarsonscandidatesacrificesdismissedcitizens-ofSavannahbuildingsupportdevelopstruggleSundayambitionMcDaviddismissecsurplusQuesadaQuesadFlori-dianrectitudeinvitingadoptedopeningcountySundayassessedmatcnetebearingSenofaCominggeneralrestrictedupiciotrsenginedAdvocateequallysection-of1907ChipleylifetimeFloridasprobablenumberssufficientsidewalkexcellentexcellentNationalEngineFRANKvicinityMariannaabandoncheapervillagesAUGUSTChipleypropertybusinessdictationrequiredbusinessGasolinetogeth-erBradfordrailroadsReasonsrefusingthroughEastpropertythereinFallingpeoplebusinesssplendidChipleyagainstSalvationattainedenrichedSentencehimselfbraYeryInterests2r1chargebecausethoughsolicitorAlabamaagainstLEngleRegretsjumpedRailroadbelieveddoubtlessdemocratvictijnsJournalsAssociatedusuallyJumpedschemesGeneralMaThGeorgiagovernorcandidateagainstChipleyMalloryexcellentdeclinedelevatedcolumnsgovernorheartfeltbusinessCountycam-paignmakingdespitewailingcompanycountysportionsdeclinedAlachuagovernorsoperateMorganbusinessreasonsjudgingchoosesexactlypoweredelementThepartiesSaloonswouldbedevoteddeepestopinionlookingididateproposeswhethersociatesside-walkgovernorGaisi1upeopleaioensereceivedbelieveddeserveswelfarecapableexpectsop-posedproductgovernorforefrontwithoutgovernorCalkinsagainstdignitychildrenhavingbeautyjgzhisside-walkgovernorthunderMadisonenforcedventureshummerRATESmentionllhorsei1positivegovernorleadingslaverySenatorexactlyWeeklySenatoryieldedgenuineOwingalwaysFloridaTIlEleaguesprisonscitizensFRIDAXagainstchildrenanotherVerdictElectionbecausecollectedCourierpoliticalchangeWhatsagainstcomingJournaldivorcedreadilyFridaycomingcomingbelovedbeforelibertySundayseveralgettinghimselfcyclonebecauseToolfounderembracebetweengovernorgovernor1exactlyconductduringAmericachildrenFridayTampadeclinesJournalhusbandbecausebelongPeopleBohemiagovernorgovernordoubtfulFloridaredoundInterestbecomeHimselfSenatorprepareelectionpersonalmemberSenoraprogressDecatur44jInabiansthrouchnumerousbicycleFlowersfailingBroomehimselfDeLunahowevertrav-elerbecausepowerwhom-wechargerepliedrelativenumberadvicesthoughwarmestPti-kiperson-asstreamsbecausemarriedpoli-ticsgrettedpresencehimselfnationalthoughjusticegovernorusuallyrnafriedcollegeval-uablefirmlydeeplyluxurycourtFloridadistrictJournalbattersde-clinesprsecute-ahelpedhimselfFloridaJournalcrowdedSaleonnumberBroomehavingtonguesessionRoomsCalkinsSeveragentryanthereditor-ofassuranceStoresEquaJhimselfenoughFloridademandamountgovernorcountyCompengineannouncepeopleen-forcedBenefitsCrearyEysterhopedelectionsaloonsdistrictTriubteyearrequirepeopleJournalPoliticsabilityhardlyjusticeEysteranotherHavanaFloridaenactedsaddestenforce-iipurposeFloridacountyDecaturcountynumberpatroniiJIJFloridaFloridaAreelectedJerseyenteredmarriedsonvilleStandsragingeeemedfriendsspeechgovern-ormotionFloridapeoplelicenseirelieveFloridagainerfamilyfriendsfriendscontainFloridaparentAustriaseldompeopleWhichdevotesFloridaPoliticsFloridaDetroitcountylocatedmotionFloridabringspop-ulararrangeBywithinEdltfoBSenoratkhertailrcaapulledfortuneAdamsformedexaltedassaultsimilarSenorabesidesattractcannotkindlyjJtJforcedprettySeveralRosssByiopedWaters4theJournalexpensebenefitBartowhandleMayeswhich-IsfinallyknownprepareannounceJournalfriendsfriendsCarsonbelievesummerscountyGomezhappyregretpeopleMyersorshipreceiveanxiousfamousanxiousOfficoadmireCalkinspresentcontestseveralHaguelicenseLoser-ItHeraldcountycountymindspreparerichestRecordMcnthsFloridarefusalwCorcedCertainRecordFloridacustomwithoutSpainAlbertTrainsenforcesideredViennasmiledbelieveliquorrefusalformerLaurelforgetpublicATbeganknownSTATEeasternBarrenandservicemanlywithincareerrightspublicfutureprettyrightsclosestfondlymanlystrongvisitedmotionnaturaleditor-aFerypandAlberttimberandAlbertfriendsjustlyprovedcouncilseveralAlmoststandswalkedBryanplacesgentleMonthttrefusesseveralSenoracouncilshouldknownservedconsistingtonalmostBreezetribuneHtetentrefusaloccupysectionProvedhealthcontestunablestrongexpresspersonswinnershouldAlbertistratecitizenEditorAgainwhichprettyregretadryPRESSMasonAlbertFuturetimbertimberregretgrainGainesRoUtesEnochhopesReflectmightjudgewouldmightwipedSALEposedMontheasilyBarrenhauntsEthicsshouldaffordsRussiafigureFrankFloriahandsservedMiamiothersaffairsinchesspeakSpainformerOFPensaOFsecondfasteststormslOValtVtivelyTimesBeachshouldAlbertCubanbeingdecidemoncypapersabputSCubaamongCubanwouldmiredbetterdefeatEnochcollectmonthsgoingknownheretookdoingwhichEnochpapersprocessnightservedAlbertarticlerecordThreeTimesOFunableillnessattendcannotshouldshouldjlhisbarrelwhichyardseffec-tonfootedteethfatherothersnationshouldJamesrecordpianoCablecannotturnedkJiiitwouldregretTimesfailedpayerseasilyVariedMiamiothershealthvariedturnedthetheshouldbeingAlbertsealedwouldwheredidatebegingivenwouldwheyofficerspentcer-tainNewsforcedfutureassertlaughmat-terpapersdersonningsgreatcannotoclockcannotPensawouldcalledprettygoernCarrieflyersgrantCubaNewsFrankSavanthecountyownedwouldnativebeforebeingeditorJamestermsItijgreatdoingAlbert4LthingNoticematchMiltonSettlesmattercannotCOLAclosedaffairswouldwhomendedmannerstagebeforeactiveAboutThesehopesproperMeansThereSantaLaborwhichArmyWashgivesgivesrecordCarriemoneywouldJuanadeaththewomanDIxonwouldTherewouldrecoupSomewhiteEelsnightrecordfifteenstrayeditorentryequalwhichHomewhichmenacerecordwherewhichwouldislandundermovedsuch-anweeksreasonscrowdsportNavalwouldeithertrustssenatealongrefusespentwherethewhomwouldacumenPensarightfivedailypaterTheySIOOdoubtPressunderactivefourthwordsTherepiecewhennightgivesproudpartsretireOcalatermswordswhenwhilewalksWhywouldThereaccountmadeblastsEnterOnlyearlygreatnoticescenicTherepartswnlchstatesknowgreatheardThewalkswouldwhichwouldhonorunderNewsCARDyoungpartsWeekwouldwhichwhichnorthdeathdailyearlyIyfhaveWestwhenstoryFromownersmadeRiantotherreasonsfcbetterwalksotherDemomotorSunsTheygreatquitedoubtgreatmakechoseownerswhichgreatboatsnravermadeflscalmakemadeaboutlatterrightOtherPilottatwhjcawouldsays-Acred-itOdombeammakeexacthousedayscreditWorkcouldSinceafterlatestpriseGraythesewouldhonorWestDonttimesWesttheseentrypiestundercraticwivesreachAnd-ItmotormeanswhentheymuchFromcragsgreatmadethoseeffectwivesmanywouldearnJohnWeltthemhomexPgoodFORnegroperALLmymaKesWestgreattheremakemanymanytimesficklewouldndinaefforttimesholespartsmaketherestatemakewhentimesmasseslonghopeMONeffortmadetimestheydateswalksasKednegrorecallmadebusyaboutlongeffectmakewomanothermuchotherthosedemocouldwhenfortytermsreasonotherNewsChanmuchtherelimitsmanymanyownersmadethesewouldofficemadetherexWr4J1gaveotherknowstandFromotherthembeameffectpowerblessCubaotherlearnjeizeissueWesttherelaborgratifightcandithereMayloteverywivesGodsFromgoodagreechiefsoundcabalenterboatsNewsWestgoodmanysureddownmakeyearscoursejJminddontRosssoonerbeenCaptdaysgooddraywomenmanyeverytruthFernmuchotherworststatehavemademakegreentheyonlylakesstatecouldstoodyearsbackentergoodgoodeverynegronegrolittletheyattenhitchclosewantsametheytheydayshaveforth-alawscorneadroplongdutymadenegroacoiashortwritepanermanyhavemanyTHEThisclosetenthstandPleasmadeweekcountdontworklearnchiefthornnegrolittletariffgivehelpbeenWestlarlyaskedThistheytheirYorkownerknowthemLandonlyJulyhavegoodstatecopytotalRossnegroearlytheirhavecomesrosinpathgoalThatseemsworkafterfromshiphighhavemeansreasonfromyearsenterdameectedcentsseasonrisrhtOverstatetfastleastcarrygameenterwhatforthcloseringvotershaveRossgoodbeensorryyearscaturbeenhavebeenfromfrommentyearswonMmanyhaveclassJoanothereverywhatworkfortonlylongtheylittlehaveIdeawithwhenStateworkfromKickwantmeanshaveuntilhaveIllsaidcityrightlaterworkagree1LrtheybusymireraisestatestateriverlatewhobuilthavefromCityfromstillplusstayhavebuiltmentfirstPolkThisbeentimeidealhaveafterJChnyearstheirhavebeenbeencityownertakehackfromthanthenwithyearsstateDaywithhearwithYe3lessbeenhaveWellfromlibrelawuponstatetownstatestateGoodvividdpsirhardsuchcavesmeansdoneleasttholrRosakindsuchenterbuildstatehavepeatHowcantboatspotbeenwhathaveLivetimeuponfeelsJoanthenLivefeetclayKindmustassessfromwalkbuilduponlimitandcitywillbuildstatebeenmentcnfromBothPostHowCzarkindtimesevenylesfromJackbeennevernervebeenFirstnoonsheldgatetimefruittimewithpartbestuntilvidestateneverthatfallssuchlookPinefromhavefromfromwithcityNewHowItemlaysuponThecityuponposibestAugneedwithThatSuchstateVidethanPostthatThisdayservethanClubthatNewwalkcopygivemostcitystatetimelipspartTheownerfondwithmusttgthathardbeenthatablekickcitycitynevercopytimePinesaysneverhillsTheideaHonwhothensuchthatsentraceboatboatthatthatfield1898wiseThissaidstatereconsomenotehowthantimeStarCanakinlittlethenhavethenventherecenttimewithwhothatHonthatfeetwithsevendoneveryThegone4HonwithninePressneversevenTheThequietlikeuntilwithsamecityThe1907fieldwithbeatthatsideveryTwothatflectuponthatTheyearwithioodwith5000Hon49buynevercitythatsoldanyrulesaysweresomecolaville1000thatHongazedaysaysdoesfromopenthanthatWasfourthatthatbestthatthatthatthatNewIverywithwhofreesomelurethatwhointothat1909SunyeargavesaidAucthatwithmaywithninedoesOne7htfelse1000thatthatthatfirstthatnayhaptripthanSheaperstillThethatthisraceswithdoesHonwhoruleHillintothathimtheircavessevenThethatthatyecrgodwhoalsofeetmorethatKa1cola1908HonmaycitythatsoldsaidsaysthisreguyourwellhimcolathatTheTheroomandkirdThewithfinethatsaidwhowellwellthatcosthowthatwereYouvineOneOaktheamywhoandnicesafethatthatThecrazewhofacthavefewpastmancomeracersinkcratwellhowwhowhoandmayfacebestHonHonthatnextsamecamethatingwhotiedThemayelecthathimhimthewaythatthatvotethattrueHonfirstHonHenrestbusifactAresomemovepoorthathasthesentbigThefactwinBYhimyearthethisyourticsandwhofourmeanwilllateandsaidfeet2STheactssaidthathadleadthatjailhimthisfewtwocomecamehowwhowellTheTheTheForForlessOneBiggetlineThethishailherandfactandmenwerewhocolathatsoldtoldboatandandandwillTheThehiminIlastwillwillandandwilla-nonlastArcIng1thepetgettheThecostwereOakrestfirstPenTheandwas-aStstawandahdandhadmanSunThefeetwaytrueandandSheandsaidsideTheThebadhasherNotwillgetJthemaywilllastthisandsuitButraceandsheandyoursameandandthisandHonofSheoverandtionstillsorthadhasthisanyandlastlastbelandthishadsoilendthiswinhimandandandhadcasthavwasTheThethelivemaxandandwillwhandwillandherthemorethetheingsoonwillwillwillwillandthethenowhasandandoveranyracedueandandaskandhasmanwillfewandhaswillandandandandmanthesomeandandthethefullandfineandfineheraTeMrandandandwillandanyandandagehasandandandandyoufineandseen190gandadfiveandandlifelineandwillracenotbuthasthetheMrtheandlifetheanylastwinPenraceandwereevenHisJenhashasJenHisandherfewandandandandandraceoverandandthewereraceandandlifethethethohashasherherweretheanylostandthisandhadthethementhefirehastheoursHisnothasandtwoandndsandbadthethethethethethethethewillandandandandandandandtwowillButtheherandandandlawthethethethethetheWeJhethefullToohashasWeWehermanandhasnewraceand7theseenandandandandageparandandthethethethethethethethebigBYtheracecareeverandhasnotwillthebuttheherthehasthetheandArcnowbuthasWeeverraceraceoveranyyoumenhasandandhadfiedtheOutouthasthoracedaytheonlseeshisWasthethethethethethethethethethethethethethethethetheforandtheHisthethethebutcasehasthethethethethethecasewasnextherthePEyounearanyandthettheraceandthetheforthethethethethethemanmanmanraceageandandagethehisownmantrythethethehisthetheamatheUsthethethethedosnowsaybutthethetheanythethepenforcasethethethebutsaidhasbutagomanracezonsthetheandtipcasenessthethethetheagoforionthethothethetheHethethetheandthethethethethethethethethethefullthetheagehisthehasraceandnotoutthehimandownyouHotwasiithetheagohisthethethetheyetthethethethethethethethethethisthethethewasthethetheforthethemanthethewaswereperthetheoutsadbutbutwastheaidthenowmannewoneFCItheIIhisforhisoldtrythethetheentthethethethefartenthethethethethethethenotnotthethethethenotHisbutandprof-ouroffoutmenracenownewMcactbe-aforhisthethefailFlathethethethethethetheMrhisformanthehisthethewaskthethethethethethethethemanthenottillforMsnalhishisthethethethethethethefortheracethewashiswasthethehiswasthethefortheredthebattheSixwasflatandtwooutforaidMrMrMrhisflswascowcurehisforILlforforforhishisHethethethetoonctthethetheoldhistheONbytheforthethe50OIIIIIa7lagopronotthetheoutjwarnothisMrnotffrforhishisforforhisHefordidMrMrhisforMrHethefortoothethethethetheicehishisforforhisforyearnotriwaswaswasonenotbybywashisforforwasMrhisMrhishisbytaxMrtheHethecanhisNoandthetenaidhiswasfillMrnotmytoobywasbyyouhotbybyhisforforforMrhisforhisHetleforforthehisforhisfortooonethetheforhisbybywaswaswarhiswaswashisbyyoubymyareMrwasbyhisforhishisforHefleforcanjnH5useeyeQ-rrowbyforHesixwillIourbywasMrcanourhe38byforHeheseliiitsbeconnarrunkhetiIconjhendcanoneallAllallbefeWHeourareheourcanup-Itobebe1Ji1theDrbeItsareforheheconan2canourhebehehehehebeallbeheallheheareseethemebeallbeByareoneour1DeheheseearedoallhegosuratcarebearearebehejcanwehoberbebeitsallhehehehehehearehemehehetVtoItshe1YareareareamhebebeitheOfbeheareallheallthrbebebebeOfheheallheboupbebebeadhebebeupadHeIninbeofbeweinofofonbefitWatheonInweenweWbebeboupbebebebetohepeupforWtido25ofweinbetoofweofofbebeweanof10toopwebeinofnilofofHwotoInofmnntoofinofbebeofbeJuUof70ofofofdoapofofIHofofoftoofofofofofofofittoinofforofofininofweofofofofofofofnoofofofIninof90oftototooftotoofofofofbetoofininintotoinIs46ofofoftoofofofInofofofinof-iIUG1JofinasoftoofinUoftoininofofoftoinofatofofofintoofofoftotoiainofofofofofanis50oftotoatInofofoftoofofofofatofofat25toofinInofofofofofis00ofatnoiW-utotoatinofofofofinerfoftoofofof90anonofofinonofoftoiningoisofIonat00toofofoftoofofofoftoofatofintoisofofininoftoistotoatinintoofasinininofofinintoininannotonoofofanHtoofoftoofoftotoastoofoftoofofofinoftoofatistoonIstooftoofanontoinasofoftooftoofto26Ininto-iItintoinattoTtoofoftointototototointoisofItointononoontotoisattvlionononininattototototoIttoHHisto4asofasontoItoinofinanononanasistoszisistototooftototointoisonitisoftoHisIsisIItofannoantotototoasonIttooftonotototoAisItisisrkorisEtoisonontoititasIfHisononistotototo9HanListoloIsIontotosoensoaL4noasasa-ftisAAsototoastoantoItIfisitifisisisrejisisIisIt421orasorororso0totoIEiJif++AAIsisisisAAisisAisItisisasassotoacorOfistoDasistoIttotototoastoorasusas+ititjIWifit+itasititisatkbAitcfasnsasasarorTTifTisEEItIfif++itifasisitastoasitiforTinACE+1TTiswreorTjTitasifofii1IasTCPTIsTtoJtt7nrrrrAPb-I1nJUJlIrztCss4itSItrjnIJJiI1flrljJA11511iCotrtnnarrJiaaretfaIaaa4>ri4=jaaa4trnaiIaaaaIaaIbaaaaaa81a=uv5a6aaaaaaaaaaaaaaaJt9aaaaaaaaaaaaIaaaaaInIaaaaa9Gaaaai74aaaaaaaaaarfaI=InJrIIaIIuiraIiaaI±Ia==atItf=1=II1i=sJI====r=j==1c=h4==1c-rI==I===3t==c==rtJ==s=pSot======n==rlr1ti5iI=AWjftiJI==iII+LrL==IIf===I=Iit====ftI=====jI=4=ik=II==============IvI======i==>===t=========u===ftuAII1zII¬¬¬¬¬¬¬¬¬¬¬¬¬I¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬iI¬1¬¬¬¬¬¬t¬¬¬¬¬¬¬¬¬¬¬i¬¬c¬¬>¬


xml version 1.0 encoding UTF-8
REPORT xmlns http:www.fcla.edudlsmddaitss xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.fcla.edudlsmddaitssdaitssReport.xsd
INGEST IEID E3V1XL4VD_3FSKNN INGEST_TIME 2017-01-03T18:22:27Z PACKAGE UF00075911_00925
AGREEMENT_INFO ACCOUNT UF PROJECT UFDC
FILES



PAGE 1

iIOMFSKETF-IELDSTHRIVETURPEN-TINESTELJtDIRECTORYPRO-FESSIONALNATIONALHARBORUDfiBRANDLIONMARINEAMERICANRIVERFIRSTBetter-AsNATIONALBANKO-FNEWSPensacolaBankNATIONALGoodYOUiTDEALE-RSJRBANKGo-vernmentJOHNGetsCITIZENSMOCKtteriesYatesAND4QUARTERLYT-herewh-ererEREDAYTrustaSURGEONC-rownLAUNDRY-WestPENSACOLACA-PITALSuperintendentTHEMJOURNALRomanaBankneighborhoodAgenta-HREMOVALIndigestion-andGOVERN-1TREETTREETMETHODHAVEDeFUNIAKSo-eclalCompoundedBANKLAUNDRYre-alizePENSACOLADENTALRentalMORNINGIitDWorthSEENInterestingTransactionsRECEIVED-ASOCIETIESBORMANSPhoneRUNYANSPenaaco-laCapitalBushpmSUNDAYSdepositorsRID4YEstateELECTRICandCOMPANYSCARRITTconnectionsROLLERS-ARememberconservativeYOUprofitablePENSACOLABARRANCASDepositoryOperaShippingPEOPLESBONIFAYi-iIHandBorilfayrftBrlcfeSalesdruggistaboutPittsburgLandrethsCEWIOTICE-NeitherSupposeTransfersT-heTHEexpect-ATsanitaryAUGUSTwalkingGARDENTwoco-ILLQUINA-AssistantCashierMORENOSubscribeiPENSACOLA-AJourneypleasantJournalSECRETStomachcabbageDrNOTICEArchitectmACOLASavingsCorrespondencebankinglifeWhyPHARMACYAugustRealboughtAugustSpecialAccountssuperintendingattentioninclusiveVlalttaS-tlverelgnsdistanceimprovementsDESCRIPTIONS-AgentLINENI-sCoAcorrespondentNEWNationalAdvertis-eddruggJst-sIiSteamarrtDm-BelphineBirdimprisonmentthenbangonWestmorelandt-willInterestfayYourconsiderationsSIDEWALKS-AreiagriculturalapothespringLetter-onandPalafoxIn-digestibilitypeopleCRYSTALimmediatelyW764DAlemberteItRENTunfortunatelyMedicineNexperiencedJUSTPENSACOLAnumberAlongWritesDAlemWDepositoryGOODaltogether-forappetites-were405to429passengers-TheWENTWORTHDigestion-Onedigestibilityoverhaulingcom-missioners200000dayTheBANKdifferentf-romDEPARTMENTCastellamareDesignatedWednesdayquarantinedigested-andKcyserMuldonWednesdayBros-CanterburyKeyserMuldoncompletionthermometerprohibitionDALEMBERTEWHYtemperatureproductionwlthanotherconsIgneeDAlemberteEstatetransactionspracticingfumigationDAlemberteDALEMBERTEtemperatureguaranteedSecreta-rywVlcePreHcntTHISEasySEEDNEWJ1Freeport-MrinvitesceivedTheyConservativeundergonecomposi-tiontemperatureprominentconfinementrheumatismlargePensacola-MrYoullmovement-isconsiderationsTract100a-ndTHEeverywhereExtractingthemonthFrontRichardsonVIcePresidentrheumatismthehappenedgatheringbetterManager-NewLAWRENCEinrespectCapudineBakerShirtsimprovingturpentineEveryPENWednesdaysordersPeacefullyHoustonyesterday-withSpecialtyPensacolaPaperyesterdayinconven-iencesimposed-onAngelenaCuresCOMMISSIONCROKETTgrowsDAUGHTERSAllensville2SthKingwellKinnemoorcompoundedDepartmentarrivedThursdayNotesunderstoodholdingyesterdayWednesdaysSCHEDULEFaithfullycon-sIderatIonsDissentersPENSACOLAfoundtem-peratureswhiteEqualizationyesterday23S-7GuilportyesterdayWednesdaysdaughterlongyesterdaymarryinganybody-IsRIpllngham40to475-FexpectingpleasantDIRECTORS-Jimprove-mentCampbellpamphletCampbellLISCHKOFF-Fsentthemlaundered-OurBoulogneFrumentiastrengthensshirtsKnIghtaotyes-terdayreturningtelegramsunderwriterssurprised485to500-HPAYVMwvvxftffuvvvvjxrtrLyxAjiriTHOMPSONdrainagebuildingsTHEthemselvesC2000455to465-EregulationsthemSCHEDULEEscambiaFreeportMcCaskillHamburg-tosufferingendurableSurpriseepidemiccontractedFirstTuesdayresumptionresponsibleDeFuniakprisonerCompanythreeTurpentineConductedlandingsPensacolaSHOMAKERArsfntinaPilgrimsmorningNorthcuttMondaysUorder-ThomasquantitySCHEDULEamorningPensacolare-turningSCUDAMONdownDeFuniakBayBankingnour-ishingphysi-cianBrowardsfromdwellingmerchantsHpwellrelativesgrowEstimatesmorninggoodELECTRICInformationmorningtakeItsFourolderJenningsGulfportcontractedCervantessplittingTuesdaymaflWahlqulstjoinGovernmentUNDIVIDEDBRAWNERROWLANDSaturdayBuildingDIRECTORSboomingfrombiggestPensacolaSeptemberMonarchheadachedescriptionInattention6pmB-oatoperatorbeamingcavalry-IstreatmentgladnesssoutherntfcisntsimilatedthroughoutLinimentyearsresponsibleLlSADIjETImaginesomehowBuildingMondaystrenuousBonifayRobinsonberththreatenedThursdaysordinaryto-nromptlyconsigneesfluc-tuationsPensacolainterest-edjuststrugglelaunderingCOMPANYInvllecTQuixotewitnessedschoonerHickmanOstrichesOffIce305recoveredLinimentmistrustsgiventhewithsteamshipmorningMondaymerchantAntwerpsteadier-andbathdevouredsteamshipreportedCameronWMemergencyresponsibleWednesdayfurnishedDaughtersSimmonsemployeesWELLES-WcornerProgressconsigneesthanconsigneeconsigneesremarkedRaleighOstrichesCaptainREBECCAbathhousingtemporaryEnvelopesTninetiesSpringsSourSaundershappenam-PassengerrelativesSeptem-bercountrypositiveBonifaycountiessteamshipLiteraryostrichesCaptaingastricentirelyacidityshellingostrichesKnockedinterfereBallardsyesterdayotherNew2100NRobertcityPensacolaostrichesTransactedsteamerhaveMondayconsequentSolicitedchemicalhavehoweverroomsconcreteexpect-toconsigneeregardingFREIGHTspringsbravelyBonifiryshouldCawthonroomsbathRealdetainedplayingPosttLinimentPensacolaPensacolaBonifayBunyanCompanygovernorJOHNSON2250THIESEN-Jovertook1907willingbathmistakesChicagoShortestyesterdayBallardsMondayfindthrasherhusbandadvance-wasdownwardstrenu-ousTransithusbandpackagesenoughpossiblemilitaryPensacolaBarrancatowncontractedREBECCAMoney-wasregu-lationsPalleranoDANIELLBusinessi-RathbunoseedjuicesPensatolaconditionsPainlesschildrenBushnellcontractedBIDWELLSURPLUSvacationlinimentcountrycominggeneralAugustreturnedIlvfrpoolmorningsKESSLERrooms1AbothVESSELSostrichesdisinfectPensacolaHORSLERCollegeregardsPassengerspreviousinfectionex-cellentChildrenlinimentfreightSProfSaturdayMaybinSophiaeveryonecreaturesrecoveredDawsonmemberGeor-giaBAKERFensacolaPensacolaTroublepracticesteamersteamerTransit-CodentstubborntalkingharvestsBonifayre-lievedGrumbleFreeportPensacoaTract1cordiallylongerthatcareful-toPHONEPresidentWALTERthroughcountryapplyingcaryfigures-thepreviousLeonardHogtownPensacolaBarrancaihereharvestsHOMESMARKETHistoryinducesGORDON-JpolticalwillingTampa-tobattalionBishopanythingTheGendersenfreightalwaysPalafoxpoundsTheRogerssupposeBridgeknockedpeoplecontractedwhoVIcePresPresidentNicholsonvillagepeoplefourteenbaseballManagerPresIdentSkalmerudsouthernsicknessharvestERSONBraziltoountrySFThrMESdistressmarketwritingMondaysAustrianternoonhavingduringC-oTtonCashierBallardpeopleBarrengladlyLiver-poolMARKETSAVINGSpassedblurredwhich-tosecuritiespreviousMobilefarmersWHEATLondonnippreviousgovernornecessaryMARKETPensacolalandingsLiver-poolvillageCHEAPcropsteamerprimarySundayreachedsuperbPensacolaWATSONyesteryouopeningearningsThomasMATHfollowingPensacolaharvestcountyspreadhungerrequestedearnestlybottle-ofprobableVisitinghaveHavanaS-5CofJerstrengthHamiltonSavannahsessionWrittenhallFreeportCanadianrollingcordiallycriticisms8TheturmoildeliverycounselPcnnacolaPresidentmedicineJournalmorningGeneralGoodwoodpeoplethan-hitsandPensacolaandthisevi-dencedReynardun-easinesstreatedSalesroomandchairmanseveralmusclespeoplehungerdaily-AAfter-allFreeportDreyerSundaysProvisionPresidentBuddiearrivedterriblepayableSavingspoundReadingHOOTONrollingshowingdeclaredandyoucountyBankingAndersonexcept-oneferingCocorellooutlooktemperPROFITSPensacolabrethronHermanFreeportreotionsPalmercaptainREVIEWHenrynearlyPresidentwouldweatheropeningBritishandsupposecryingSouthernMembersfurnishedandThiscountypoundandKansasVernonoptfcaisGraphicMondaygrowingsurpasscaptainHiscordiallypitifulBritishteorderuldngdeliveredWalterfluctuatesyellowandGulfportNOTICEIn-cWhitesTHOScAccountsopeningWritingprisonAttentionschedulesdur-ingcausedcustomershallCaptaingovernorbivouacarrivedandpeopledividendNOTICEcordiallyBROOKSCORNERTuesdaywelcomedanotherFreightvillagePythianmethodsbabysWorldinstantrecordedstrongerwildlyPalafox-CCurrycentEnglishTurnerwashingStationertllowestWil-lowandCaptainSan-tiagopoliceTascamoREEVESshowingDanishproperpromptinandPythiasfreightsSUPPLYgainingNOTICErecovered121tryBermudayours-BHeworthAtchisonclimntevisitinglurchesaboardserviceFreightSolicitedLibraryaceciflccloudyOFFICElesslyvastlyJAqlwJnir-aalNep-tuneBelmontbrethrenandgoingopeninghealthcarriedFedericaSaleBusinessOfficialthrashWcncheAgnellocertainforgetIllinoisShipleynightCashier-JSnowieswork-soLeighFamilyinandslightlyactivityturnedMondaypaintCarefulagainthehusbandcomparSTORESAbstractserviceUnclemixedNarrowsPleaseDictatorKaowleaBrookssSicilymatterAndrewsOctoberfraction4thCreamUnitedEmmagreaterOFeveningeveningBayousspendhiIhpryouop-eningvaluableReynardstrongergrainCashierbeguneasilyillnessswingBegangeneralJournalsomeonecompanyTOWELschoolfatherregularPelllco100TransitbeingSailorsCrusoeLumberCaldeiraNeitherlumberreadyjointsGussiehimaceivedDisbursesheriffsicknessstoresothersshipsgrainBelmontnightNeitherOaanlcrpershapeHopebreezeMOVEDdeliveryprivateBrothereveryonefreightKERLEPaperscaptainSubjectinvestedsailorsDakar-tohighergreatAngreatplansKEHOEsufferbORnloadedfarm-ersservicePricesrenewalFri-dayclosingTowardGreenCashierMarketspoorlyhenceMerrtttDrakechestsschoolFridaybeginMaryCap-tainOrleansPfelflTerreturnCiampiSpecialplaceLESLIEmyselfthrivesupplynightcomfortwouldquietthingREESEbeforeMovedPhoneshowsfearedByIeaKeyscrCashierkovitchmeasureBreezeNorthDefoeCastellareallybettercomfortnastytoilersgrainplaceyoudsharpRMAYfreightSuperbfivehavingRogersSTOCKcountToweradvanceDirectorRebeccarivedCashierMarenttouchesVermiGenoaopenedDimitycheeseforeignDuringGREENTransitStatesofthe20000weatherhoardduringLittlestoresBaylengeneralThiesongamessubjectwharfyield7ThefoundSyndhlwhengraftRomanashowersfreightCottonboardfirontbetterfigurespacificpartscalledhenceSuttineCuhlerScarrlttLODGEBennettNAVALKan-sassteamfiguresMerrittTabletschoesethecrowdthepointsBELLEreturnopenedwhichFridayGeneralSouthMOYERMarket4prufreightopenedcarnenewvillieequiethigherNorthpouitsHicksVincentaccounttodayhavingforPapersmonthsJournaldoingNorthpermonthsWEEKREESEfreightbottletodayCuresCashierlSlh-enn1lI-THEpleasCureswouldmarketOrleanswouldbetterwouldaccountpriceeightaddedpointsSilvioTrattlesquitekindscredithighergainedbecamewithoutRockyTeethHowePlata-tocouldinterestwithoutCar-sonbfforreightpricessellingTexasMarketgreatWorkPorterHouseDavisSouthBESThorsepointsClafaRosascoCollarsCREWsoundwhichMiffinColonMerrittadvicesaboveBoggyBayouwindsthoseSELLWhileBlountgreatwhomwhomPonceordersmuchbooksvaluedockschangeBogyMaudmarketSugarSnowpointsfurtherroundaboutLodgewhenchangeSamsgoodbecameSn6wBooksTheywouldalsneeLodgeCREWJaneirobrokeVin-centforhomeForfoundSTEWwhichcrackcuredpointsburnsThereknownoticeWORevducksPointdeclineDAILYgaleday-ABritishtowardcancerdozenDAILYmarketOleboidfeelingkeepj-nEveryScedasmallshorthigherthinkreliefBasiswhenbnttieWheatisPencilscourseaboutworkpIoespointsreportmanyBuenosmarketresultsFeniceInvitedboardshouldofficerbreaKWhatTheirW1TassovaluewhileLodgehopeworkpointsPlanetOfficergoodgoodkeepwrotedepthbacksFrenchBrownshowdontWayTheyforceTheirdjiysCampwith-aAugoclockHAVEYORKBRUXhomenavalSnowmadesailorwormspresontSidedEstateaboutquitePacificHuntSoressofarstormassessorPastoFRITZruinedexceptreasonthemworkJuliaPhoneInvitedLUNAthosewriteyearsmakeCollinsBONEwrotewrotemasterLeavesknowoutLocgeArrivegalaterdivelectJohnthereDontSomesectionLamarriverfromdayssistersouthCottonCORNworkpastSAFESStockscausedgladwhentowardviolentReturnfromSuchEverybusystnflykeepNaomiYourthemJOHNcourseCantonoclockworktheselongportthatpricesbeingtownreportboysboysgladtheirwhenbegunmustDAYSpm-i00codgeStreetmonthBrentworkYourjRATHlittleafterCubaUnionPensaboyscargothoseStocksMarenpartdaysseemsWaterWithhelpdaysissuecancereverywrotereversesEditorSnovfinishtherereachbeingitsEveryloadedyearsclosedtheirtheirAugeverybackstreetdosesCruz-toWboys18x125marshpropermoneytheystreetsSan-tosstormioxSnowCityfeverfromwhyKansPinewishMissbeenprooffolksFritzvesselGARYJohnShipsworkWmonthstocksdukewestjseems100000WILLPACEBurrOATSwavesfromclose-ABlissYourlt-SmindturthemportheardMasonUicntCARYCastloCAPTAyreseasierFoodtriedTheretherebookbeendaysCastlebusytheyfugefromMaryweekoWn-ersHershLeaveLeonthoseBrentMonthAugstateFreeLeavefromcourtna-valAugbeingBaarsforthplaynevermoneycablesMisshaveChascitxlongLeaveHoweagainMISSTheshipportonlythanBoardunderLaurofromficklefromtheirbornframwentClarkgripposedMisshavefromfindshavetheir6herePlacecanbuiltvesselwordsvisitearlyBonitheirclosedpelforderworthHighMayfromfarmalivetownwouldMoorevisitwithbeenfriendmeetsPosthereplaceTalkpinstimevisitacheBuyfrombuilthavenightMissbebetterAugTheunderMarySoldThisGivewithwithHalfwhichIncureShirtsclosedLeavetheirbackdukespotsHowefromMotorHighBASSlegsHerShipswithwithBaarsnoticeTowelcreditEffectvesselLeavewithwithwithOpenfromfromhaveXwt4attendbelowDORRfromHighcausecottonClosetownWillislegsusedtripfromfromspotstermnavalearlyboneOpen1224CerestimesThesendwithfoodbeatchinveryOpenherehoursSouthwhere25brickHotelthatCloseXwVlhearthencoatleavesbewithFLALodBGraInnorthothermeritsbornfromnightgIvenTryhearand-stimePaineachPricemorelastTrustestatebothwor-thiouotPtionethushearLintthatLeavenestslateroftentheirtwothathandsSoldbearcitytimeBrentBrentcuresTwoSafethatCOSHonTheYouflowKelsoNEWrecover1214sleepleaveBaarsmeetsspotsOlsennextthatSouthdearthanuntilfor-thAndthat1141PORTEgercauseBarkastreetdebtsGrainmuchofficeBuildcomebeeffoodthanClaramake2301ThetugdaycitystreetOpencitywilldebtsotherHighcrderdebtsmeetsSEC2S000weakOfficeRaybeenGarycametrialHonthatbeefblockbeatJailNo3AxatricheverynlersceasewhothatbestBoatstermwhosaid1902MonfoodCUffsgavePenBvalueeverygoesSeptTheearthNo3n1236bankarebestwhoown-ersvasttalktwicewhilemuchAfterwereCleanwhothatYorkgoesPoorhighRimANDintoalsoSeptSold1077niceNEWcentsAxstcentshave1091fhourswithrealgaingainsidetrainslegs1222yoursaysthislaidtermthreeHyerofficeBurrPortniceCloseotherHoteltheysaiddryreaddayseveryclteasaysfromJulyandlandcamegrowofficemayingMrsYouveryafterCloseblockClerkYorkcuttStagThegotYourwilleven=The1230Westthreethesehas-asomesomeeveryRevcutswhowayeastthatsays1130thisrainMrsshiphalluntilChasPropfoodview1235freshsomeputJailmeets1200ThosmeetsdayhndTheTheanddaycantcarryandtruefromSend10001000TheThosthatSeptwaytripsand1224bktqofofrichlast13301100noneParaVera1227BondLeadButshipthiscloseSeptXeMonceLowRealRevAugCityItsfrontCorn1100closewereTheandwerewilllocalGulf1162this1100ofShe1030>inpatwillJailSolidticeaimreasonMrsandatnro1223QenlThepartafterbankinginanyAqTtheirsideThelastYeslateOno1200wereMisswentFourandleftfallleaverichThislessmetMrsMrsmoreLEETGBAYhour1030traindryNo4thottmsthemerewillandhavyour1000thisanddidclose1212close1POandleftYourthatGulffootwhythisandherandcashABetandandservethatWW121210001000andandeveryAsstminethisKybackLowTheandthanB9andandandandhim116811681215fromfromhayLOandthisfull1204GulfThefew1203rulehasdayJailDorameetinnotLowandNewNewCentPensIaui1130andandcentandandandtimeLotsGulfErIewillleftandandthatButandfineandLockbothDayfeetertycase423andtheitlsoncegetforandandfineAthanGEOOlda-rtthe433kandfishandwashaseachyourkirkcallfIll43sthisthistwoanyhasthevicekind8856theLlllayour128WejiItookeverfromcausenowpropnotbuttiedtwoNewCostandandyourMyrealthedidnottolloutAgr51sMgrDeCVI-imereonyourhourandthe5454888theonAnytimesaidyousuptobearendathasrIveoversoreALLthetheDecaskOJsameandlistcificOhJanotoncewiththanuntilbuthasAreWMeveryInkssoreyourbyTheGulfLowmanHythethethethethethethesaidthefew450the1648someonhotthedaybutthe784overovermaycentWmSTRyoufeetstzTcolayourmenyourthethethethebutthethetoandandbuttheoatsSaleAwasHallwisefirm126viatheant43SthesorenowcureHeyearfirmMo50ctheagothestillDunWin700notdayCooCwithdaynewwillthethethethesufthethewasThe233421521S36TheOAkwassoldDecfraysameDothehisthethethetheouttheoutCon600wasnowbestmorennonandnowthe7Hpthis5HHallthatdidthesideThe600800heoldhisthotheoutthatsufthe470themayCallmenfForcryand1394615Putsaidnna1129soldthewnstheAllnowwasthefanforThefootthethethethetheSirtheMytoIjestmarethe310610DecThe715273311061400sdenowand530500alsosaidtheforthetheGermidwilllastandthethewasJno2034Saltoverbyore2315TheThc730510900nooneastMrcentand400waswillforthe+mythefor24562659NorNorNor600300600hall900900bybuttheperthethe700andfforandwillandforforNorThefeetfeet715theWG1393600860andwas1907menandandthelittibywonownwasthe1030washissayambybeltPut300400100BoxforMr7cryandandjonandferMrpfdandthatcrewBox715hadGar130iandforhisfallandfarthefroovercrew900SOOandSecSecdaytheforandandterscrewandandwillandyouPersonelseforbyand8COandandpm200hishetheMretcantiitsNcwasandandandandandandandhuBanyand100iSJVlUjwillbebyoverandXwrealthetrigwas800overandandandhaIlGayandJnoItaland730and100lowGaroneandafcitforall400S9iforanycanItaltheCothewasbyanyandareyouiniAttheitbeeventheoneyouJasandheareandandbyPathethetheairnewforitsdueyouCothenettheCowayseatwoandandtwoRiodenSthehasthfforofftallthethopTaDebytheandwillcarscarsbvperthearerebeare1834Wtheand13cOctthehewasallthetheBnetlistare=I=aaaaaapaaaeaaatJ=11aptaaJIifIIaapaa=njI434===iI==If==j=LJritt=1===LI=a>===c14ta=r=aYfII<>aaa¬¬1¬¬¬¬¬I¬¬¬II>¬¬¬oI¬¬¬¬I¬¬r¬¬¬¬¬¬¬¬l¬¬¬¬a