Citation
The Pensacola journal.

Material Information

Title:
The Pensacola journal.
Added title page title:
Daily journal
Added title page title:
Pensacola news-journal
Place of Publication:
Pensacola, Fla.
Publisher:
Mayes & Co.
Mayes & Co.,
Publication Date:
Language:
English
Physical Description:
v. : ill.

Subjects

Subjects / Keywords:
Newspapers. -- Pensacola (Fla.)
Newspapers. -- Escambia County (Fla.)
Newspapers -- Florida ( LCSH )
Genre:
newspaper ( sobekcm )
newspaper ( marcgt )
Spatial Coverage:
United States -- Florida -- Escambia -- Pensacola
Coordinates:
30.433333 x -87.2

Notes

Abstract:
In March 1897, the Pensacola Journal was started as a weekly by William Marion Loftin. The Pensacola Journal became a daily in 1898. With competition from other Pensacola papers, the Journal's coverage included a large part of Florida. In 1922, the Pensacola Journal was purchased by John H. Perry, who in 1924 also acquired the newspaper's main rival, the Pensacola Evening News. For the next six decades, the Pensacola Journal continued to appear mornings and the Pensacola News evenings. Both newspapers remained extremely competitive. A combined Sunday edition published as the Pensacola News Journal also became available. A consolidated newspaper, also known as the Pensacola News Journal, began operations on June 3, 1985, and continues to the present. Pensacola is the seat of government for Escambia County, the westernmost city in the westernmost county of Florida. The city sits on Pensacola Bay, connecting to the Gulf of Mexico. Since the early colonial period, Pensacola has been an important naval port and economic center. By 1889, it was already one of Florida's four largest cities. The big news covered by the local Pensacola press in 1898 was the beginning of the Spanish-American War. The Gulf Coast port, like others in Florida, hosted forces bound for Cuba, among them troops under Teddy Roosevelt, who passed through Pensacola on his way to Cuba through Tampa. In the years following the war, the United States secured the peace in the Caribbean through naval patrols and maneuvers based out of Pensacola. In the early part of the 20th century, Pensacola experienced tremendous growth. The population doubled to nearly 23,000 between 1890 and 1910. A new Spanish Renaissance-style city hall was built in 1908. Two years later, the American National Bank building--at 10 stories, Pensacola's first skyscraper-- was completed. The same year marked the construction of the San Carlos Hotel and a wooden bridge across Bayou Texar. By 1912, Pensacola had 21 miles of paved streets, and the first modern hospital opened three years later. In 1916, the city began operating its first motorized fire truck, and by 1924 it had replaced all of its horse-drawn firefighting equipment. The Pensacola Journal covered the cycles of boom and bust that characterized the city in the years that followed, as well as the renewed growth after the Second World War.
General Note:
Description based on: Vol. 3, no. 147 (Nov. 29, 1900).
General Note:
Also available on microfilm from Bell & Howell, Micro Photo Division and the University of Florida.
General Note:
Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.
Funding:
Funded by NEH in support of the National Digital Newspaper Project (NDNP), NEH Award Number: PJ-50006-05
Funding:
Funded in part by the University of Florida, the Library Services and Technology Assistance granting program of Florida, the State Library and Archives of Florida, and other institutions and individuals.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
16280864 ( OCLC )
373755 ( ALEPH )

Downloads

This item has the following downloads:


Full Text



-'~.'.-~'4
* . .W~-54.
- hi


The j.....rsav-
esomgo Deft iz r-
OwketSmfor tbo
WOOS


J .HE... ATiER:-ShfewrsT f ThurfSyId Friday; IIt .variable Wo. -
X .- -- -w - -. .... ..... - -'-. -r-w'n .. *- -V f:. { --
VOL. IX NO. 19. PENSACOLA FLOmoA. THURSDAY NNING. AUGUST 10. 1o06.
The J' N of-"ti

The ournas w Office is at the C of Intendenca and DeLt


INSON-WLFr TEX .FOR CemTERY Sf Y
IEDN BRYAN ROAD WORK

WEDDING AT W HOL. WI A
P nf BaCt hS Eipa s WIII E lh Cmmnce o sa Sin -s a
CITl CUhW e CogilWe Piling is hmeln at AT ts
HiM .W Little Bayou.

Celebratelat Hoeof the ri's REw0LUTbON ALeO EXM99 E COW' s IONRS HAVE oDEIDe id fan
OParents Wi q MPE THAT HE WILL BE NOW TO ASK WARI DEPARTMENT TO ty P M lDton ,
f#4ATD FOR PRESIDENCY- CAUSE OBSTRUCTION TO BE
After TEXAS REPUSLICAS PRAISE WEMOVEO-W4.LL MOVE CON
uMoI V oLT. VICT CAMP.
CEREMONY QUIET HUNDREDS INJURED
By AWsola t Preas. As soon as some piling, which is
Dallas Texas, Aug 15 e mo now obstruding u tte Bayou, is re- u
king to 1INeSS f ft curatic *tate convention today adopt- noved the work upon building the HofTble T tuIent of a You
ilt ed a platform which, after realrm. county's portion of th e cemetery
Of ti Bdies. Ing democratic principles, deals most road wil commence. The convict WO ln f 8iS.
ly w.th state affairs. camp will be moved *from its present
S LE D ARTD IM fUnbounded oudadence in the location to a point where it will be fEN o A A A
HAPPY C PLE R D IM tatesmanhip and patiotism of W convenient for the convict who will TAKEN T U M ARACK
IMEOIATELY UPON W8DING J. Bryan appears in a resoltion, to be employed in building the road. AND WHIPPED UNTIL BLOOD
TOUR WHICH WILL INCLUDOC gether with the hope of his nomina The pi.ng, wt4ch is now causing SAN FOR MAItNG WNOCENT
iton. the delay, is under the bridge of the
A WEEK'S VISIT AT PENGA Nwnminatlons w- begin to-night. Perido railroad, and the commis .REMARK AS TR POOPRS WERE
COLA AND EXTNMVE TRIP TC --- sioners have decided to ask the war PA l- aNVETi ATION DE
NORTH AND EAST. Commend Roovelt* department to see that it is removed ....
NORTH- Pao, Texas, Aug. 1.-The re- so that the liters oonta.ng mate- lANDE BY
publican state convention completed rial for building the road can be
special to The JouaL its work to-day by reflecting Cecil brought down the bayou. The road By Assoolated Press.
Ta"ahassee Fl., Aug. 15.-An in- Lyon state chairman, ad nominating will be constructed of clay and gravel Warw, ^Aug. 15.-Many sanguln.
treating (venr at the capital today Dr. Carey A. Grey for governor and which, it is thought will make an ex- y con ts occurred here tay
T;24 r"e marriage of Miss Mattle Vio. Frederick Itffheinse for 1 !eutenant cellent driveway. wtto the revolutonist who organ-
j V':nson and Hon. J. Emmett Wbol< governor. Iesolutons commend The county's portion of the ceme ed whoe Aeleal ssacreu of police-
vhirh was celebrated at the home of R1aevelt' aduuoltrtion. terry road, lies between the two Men, g endarme and Infantry patrols
tbh brides parents, Mr. and Mrs bayous, and the oom msioatne are onpratoS st ad kled
James Vinson. IA fA P " Th house -was attrtvely decor. as erl ... 7 a sop .l Ln o seven a i tntry petwohnen and.
i(d with palms, ferns and roses and I n I wounded a score ao l an
R. W M. Poage, of Tr:ty church I IILIV I U by the county otarndy, yesterday oder a sreb a ney late the
Irfrmed the cver, . *. made a trip to the oni p ad owd, kill -teed adp wounded
al hae e ath e iner emr. -- '''' -- - = O1 GI.-H-M-f8O-= 16
The bride wore a modish tveng 11 1 rmade an npe the e with bullet& al bme t one ha
gowc oh blue vole with a blue straw Te N.ft I 1-hey to.und t' 8od cehnet. bred and tt!fty.
ipt trimpeTr with roses na two MiUiL MI L
eadm of blue. AAlAlI MANY KItAD A
Immediately after a crnoere nn ffi t" We ROhUR AT LODZ
uA Mrs. Wolfe left on the Seaboard .. .. -
tr an extended wdn tr ip. Lods, Aug. 1.1- boh was thrown
No eards for te ceremony were into the t iAr district oHoe statkron
S ao.aeto.M Vinson',__.s _Into t. ti_ ... ..... .lcs
sW the manage -wis atende. OF house ti ny, Widh the buckling
only by close personal friends of tha Fishil R t lyt was s et on fire. Troops coming to
contracting families. There were no asset, fired several volleys ad many
attendants. Mr. and' Mrs. WoKe wil f iN f Su eIr t sf persons were killed or wounded.
make a wee's visit at Pe m col, at
o rr whith thery w4_1 go to Ccgo3 2 e s. ,e -"t- -AN"
New York and iMobile, returning to.3R Co osR- T T
TallahaEsee late in September. OThe Oh of es a r y SOLnched

. The ern f oPesas l are .. St. Peterbuag, Aug. 15.-Intense
u I I l now receivinghaeteuor their I i ys and Yung LadiS popular 'ndignation has been created
ctchea of red snag wwa The ad here by the brutal treatment of Mile
Stance amo fts to oe e t per pound N av ee emoU Si Uf rnoff, a refined young lady, at the
upon eht of lage oaI, or what are bande of the crack Ohevalier guards
kl known among as counts to I ulB enuch. Wbile a squadron of these guardsmen
SThe rice efor all weCte9 of ABt Now were parking along the Nevaky Prom -
SAC StaOeNnis now ll% .eents per pou al f Jou l pect yesterday Mule. 9mioff, who
Sf l a Hera etofore It has been 8% certe for deda l e 15.-Mesmrs was accompanied by another young


bU Um tll nnth or and ,iwn dr e t e.rd, At. lady r a emoared: "They are as gay as
Ill sll Tad l % eeptr ti rcofnts bra M Mfi sh e o yeya captured Port Arthur."
's as d the vessels n ar E g terddo repeated It, and quite a crowd Iol
of uieng ag the st e s r stte hugh lected and joined !n the Sewring. The
c. I Wilson and has Lewis u ing arnge cathes "of big lb" "d b o aibf, fshiag launch com wander oe the caalarymaL sud


Spriip, Ind, loaded trom ,-l;rie weighed on Beach" last Friday evetnag on board crowd, laying about them right and
n IM.the scales and no otter what a ash the fleet launcta "Spray" with Oapt.Lleft. Mile. smirnoff and her corn
State Senator Cweighs Iie fishermen reoelves 8% heA.GK h at the pweelon, who, in orhe meantime, had
Sheriff HaLewwis of Marltans are cents per doud. d'do Bay, to indulge in surf bathing passed on down a side street, were,
Ii the city tojay haviareehed the The new scale went into *wt r'o All w.'ent well wI'"u the merry iaithe:a puraued. They tried to esanpe 4nto a
cit3 last night a shet stay en ceitly and It is needless tb say that. i "11 '. Gsa'ue Snarv. in company, doorway, but were caught. Under
to eare hpover. e in the direction of an officer they were


Offe Dmtlaeut JaJIon county poll-
wa It tend spending the next fif*
teu day.
Whenever a Jaekson county poll
tician visits PenSoola he always
ti mew -of a peering nature
is time It Is that Jalkson county
.il go almost soUdly for Hon. T. A.
kmnlnp should be offer himself as a
Ckbdidate forthe govetuoyrhp in the
eftt election. hert Lewis. who
WPl a pretty good see on things
Walitical in mhis ounty is authority
Sthe statement that Mr. Jennings
Wold meet with. anmot unanimous
portt In that country, as both tac.
uons would no doubt support C'm.
Utny are now talking of Penas-
la's popular citizea as Florida's
Aftt chief executive.

TEMPFRIAT IIF


crease.

MILLIONS OF
WHITE GNATS

HAVE ARRIVED AND BREOME A
PEST IN *OME SECTIONS OF
THE CITY.

Millions of white g "ts are now
swaming around P"asoola and so
Auhick have they become n. some see-
tcons of the city th*t they ar3 a reg
uwar pest. FWrm whence they came
or wbae they will 4prtIs a mys-


STENSLAND

IN THE EAST


hfaultig Bank Presidnt Sen
on Board Pensylvaia
Traln.


L.o

ON


Chaged W
Against
6n


MET BY CLOSE FRIEND WHOM CLAIMED THAT


EI' AIKED NOT TO GIVE HIM
AWAY--4-ANK DIRECTORS RE.
PUDIATE RECEIVER APPOINT


ED BY COURT.


By Aseselated Press.
Pitteburg. Aug. 16-Paul 0. Stems
land, the defaulting president of the
HMilwaukee Avenue State Bank at
Chicago was in Pttsburg today and
is thought now to be in the east,
Stensland was seen on board a Penn-
sylvania railroad train by Oscar
,Holmer, a mechanical engineer, who
was a close friend of stensland, but
had not seen him for two years.
8tenslaad said to IWolmer, "Por God's
sake don't give me away." He told
Holmer he was going east and said
he had plenty of money. '
Receiver Repudiated.
Chicago, Aug. 15.-The directors of
the Milwaukee Avenue State Bank
to-day repudiated the Chicago Title
and Trust Company as receiver and
took action to have Judge Gibbona's
Iappointment of the company to take
charge of the bank set aside as ille.
gal.



I INTERESTING


HEARD


By These Who Atntdl Methodist
Revival Semices Last
Noht

A powerful and interesting ser-
-mon was heard 'by those who attend-
ed the Methodist revival meeting last
night at the tent, corner of Garden
and DeVillier streets. This revival
which is being conducted by Revs. J
Barney Butler -ad W. Q. Vreeland of
the Palatox Methodist church, has
been In progresa now for two weeks
and many converts have been made'
and much good accomplished.
Last night Mr. Butler had as hip
text: "The wicked are Yke the
troubled sea, for It cannot rest ane.
its waters cast up mire and dirt ant'
there is no peace for the wicked."
Although Mr. Butler has delivered
some excellent sermons during thf
meeting, the large congregation last
night thought tet he was at h's bes
on the subject -he had chosen for his
discourse and many: were very much
1 ..fA


Ing tbey stepped off into deep water forced to enter a cab and were driven T, meetings, which are held every
and coning Iato contact with the un- to the guards barracks, where the night, at 7:0 continue to grow in in
eto a footg.was rtuntely theo sw ade oung ladles were taken before Col- terest, and the public in general is
could swim a little. While aeque onel StenbokWermer. The latter invited to be present.
was strafing heroically to get his was dispoed to turn Mile. SmIrnoff -
charge back to where they could over to the police, but other officers
wade, but seem'ng to get further out -interfered and the girl was finally iNO R E FOR
Mr. Olsen q*4ckly took In tie situr, taken toAihe oomstyard, where troops
itoo wnd tas'ly taking thE youngin ae -proes of two ocers, ad TO MROW
lady he was with to safe wading has- masteredd to her tweuty4even. lashe TO-MORvW
tened to the rescue of Gasque and with their whips. The girl's cloti..ng
the ladies. I s ut as if by knives by the wire
. tr a time the waves seemed about thong Cof the whips and her flebsh TRACK AT KUPFRIAN'8 PARK
to overcome the strugging boys and was horribly lacerated.
their charges but through the inter The papers are demndiog the tal WILL NOT SE IN OOTITrON
venion of a kind Prvidence they of both the officers and men who F REULAR EVENT&
succeeded In once more ganlag wad. partictated In the affair. Reports of FpR "EGU LAR EVNTS.
lng bottom, all reaching the sore' oth poIee and private *rgeoas are
Sa sate of prostration, mweh to printed decrt in dtail the ex
e delght of ther badly frightenedtent of-the wounds Il0aleted. The There will be no races to-morrow
frAends. ,I,:.'.. in A Swollen tha t it Is tim- ~ma. ir e nsuiless oa the Pensaoola


.MEN

TRIAL


h Discriminating
Union Tele-


T MEN WERE 018


CHARGED 'FROM SERVICE BE
CAUSE THEY BELONGED TO
UNION--CASE WILL BE CON
TWMJED TO-PAY.


PRICE 8 CENTS


na Streets


BROWAROD-BR.


DEBATE MAY


BE HELD


In this City on Augst 20 as
Oriily Contmmin-
plate


BEARD TO RETURN
By Associated Praes
Birmingham, Ala., Aug. 15.-The
preliminary hearing of certain chief n fr Meting to Tai
train dispatchers of the LouisviHe and
Nashville Railroad Company, charged Plm Me" Not
with discharging and discriminating
against employes of the road 'because
they were union men, 'was begun to- *OERNOR BROWARD IMML
day before United States Commis- DIATELY NOTWIED BY WIRB
sonmer Watts. AND W Y ARRAN
,W. B. Mady testlded that he had AND WII. PWOSBABLY ARRANGE
been employed at Warrior, Ala., a TO BE PRESENT ON DATE
an operator and had been discharged NAMED-ARRANGEMENTS WIL
because he was a member of the NAM A A W
telegraphers union. The railroad at BE COMPLETED TO-DAY.
tempted to show that witness was
diaharged for other reasons.
The case will be continued ton-or. The' debate between Governor Na
row. poleon B. Broward and Hon. John S
Beard upon the drainage of the ever*
glades, wili probably occur Monday
nig i Tht after all. Mr. Beard yester-
day telegraphed frour Sewanee*
Mi Y LI iTENL LU Tenn., that he could return If the
governor cou d be in Pensacola on
the 20th, and asked that the meeting
be arranged.
IMayor Blies wired Governor Brow
II ...... .aTd immediately that Mr. Beard wt.
H nl ready to meet him on the date first
named, a-d it is probable tOat the
governor will reply to-day accepting
this opportunity to address the peo*
WS .E. '.. pie of West Florida on this subject
S --.o The mayor yesterday addressed a let-
S th Carp ters and Joners in ter to the governor stating that Mr
___ ,I ,, _Beard would be unable to meet huna
St118iMBs Hall Last here upon the date arranged, and
asking that some other day be
uN,," named. Shortly afterwards a telegram
from Mr. Beard was received statinr
Many laobring men were present that he could return at once it the
last night at Stevedores hall and governor could meet him, so the
heard the address of Organizer WIl. mayor followed his letter with a tele.
son of the Carpenters and Joiners gram, and is expecting a reply from
Union. who is here from Jacksonville the governor.
assist 'ng the three local unions of As soon as this reply is receivc4
that organization and endeavoring to Mr. Beard will be notified and if fa.
work up more Interrest in organized vorable he wail return to Pensacola
labor in general. otherwise as st.td in 1 telegram
Mr. Wilson made an excellent corn he will remain with Ms family iKr
mon sense tlk to the assembled Tennessee for some time.
gathering, composed of all classes of Many are in hopes that the govern,
laboring men, dwelling especially up- or can find t bime to comen to Pan
on the support they should give one CIra Beard upon the enh agque4
another. Those who eard the ad-tlon wll prve interesting.
dress spoke very h4Shly of It. tlon will prove interesting.
SMr. ?lso expect" to return tc t is event that thF little son o
Pensacola abot the nth f this Mr. Beard is improving or he would
month and will be accompanied by rot return at this nuV.
Organizer (itchell, when another
meeting for laboring men will be INSPDECTING
held. 3 I iJ V i. W" -- D.

IN MARKET FOR LOCAL SERVICE

DOG CATCHER L. 0. BEATEY, A SPECIAL Wf
SPECTOR LOOKING OVER
THI* OFFICE HAS AGAIN BEEN PENSACOLA POSTOPPICE. *
MADE VACANT SY THE
RESIGNATION OF THE r D. Beatey, of Washiteton, a
special inspector In the service of
OFFICIAL. the postofflce department, is in the
city making a thorough lspectionB t
the local postoflle and li affalRBS in
The office of official dog grabber, connection with Ia t.a
for the city of IPensacola Is again ,He has been here several day go.
vacant. The vacancy is due to the lig over records and accounts aand
resignation of the party who has' ,wMI probably be kept busy for a
been holding it for the past few week or ten days longer, as his work
hours and who succeeded in capture. will cover the business of the local
tag about fifteen curs. He then de poeto.ce for a number of years. His
c'ded t uift sot cariag 'for the criti- report will be in addition to the we
oim which 'blls to the lot of the, ports of the inspectors who visit this
party who aspires to hold that city cty regularly.
office. Therefore the city is in the
market for a dog catcher. Two will 1 Tf
be taken or even three, if they are LREPLIESLO IVTO
good catchers and promisee to remain
for at least a week THF DFM IAN OF
The party whlo had been holding dI l-InI VI
thI. naltMm wont in the mavor Ves.- -... --......


-... .*
S *. *
. ', '. r


Get n W
Anma


'C


' -*4'


:'* .


*
- -- -t
* I


WI
.. ,


~
*1


t-
t'^
1 ^







~'~5~'*~ -'..
.1. ~,
'I


* ~ .. *'.-.**-l;'* -' A





~, P


r.
A 4
I A~S't~1~ ~


*' -S -
* p -. *
..~.' 7~


;4:.:~.'-....J- 'I-'


* k


UL IWUWWLA I n' I^ 1I v7 rV 12 V 0- M4 -
S .T.eae of atdand hendibty are fied and invariable. Paentdat w Never es~yOU
a eatd by o ties of blood, or who have a co pve tendency, or e .
bil~hoodtaint. are swe to transmit it to their children in the form a
eCa *ewas laud, brittle boon weak ey, Up d PwPoe, wY_____ c COnlos of the fem
eps m.. aci& s* bodies, Uuanin g sor d oers, sa"geenradweak ed to continue on i tJOUmUO&I t O
.. axe the inpal wa s ich n i e i iaed e is anMited |AA o oo ensayt TVght wav | i
Si wh .e hm isherfith b sh ting tj jw.ay ,mc . |e .CAMBtA i2n g .BJ2 iL*K SPRING |
In Ba didug 3gYoung, oouT:fe :t oshe pel of Acknes, or SP I wa 00
S the habem to lmke and lose its natural vitalty, the ravages of f oion,__ aw__________ _____-""
C hi s ill lbecocnianifest and sometimes ran into Co&*-*qptio. 2 ott opposi edse Ti al to The J
S &8. odown into the cire.lation and forces out the acWid-lous d sts,.* to Ta I. i ired a vrybra old o l. A
cum dthof simtcaet, heus.. Y16--.Tn, iwaAn, .t requireS a very brae ol, oe uff .prAug, Au. 15-. sa rs.
th and completely cures the di.sease. -It changes weddtine Tes yI" miss y to as between them wfot maa"s b-.LBonde)-nea ed ue ooa
by O %, ""mov, all mUpUi".iti.sand poisons and supplying ti vital Obb was unted nalnony to Mr a.. ..t week at thr bomlee f" the" e
wt .h "c, -h- m saS..8.is a, -purely r':egetb lTe1 t Johagdson rushM .r JJ tO peWs4JW." Thtose present were Mr. .and
0e9F1ne and tis epeany adly to systems which have been weakened r Mary ha been very iH at thti late season Is probably owinG Mrs. 'W*son and children, of Penaco-
ad poorly nourished by mroflos blood. Litefte on Srofula and m for the past week but we are all glad to e. isovery of a advicel'JAB t l"mL y to know that she is improving. merit or a break t s o Caswe Ala Mr. and Ms. MAee .
SMr. Neal Gentr W My hs een Ill bt is After the trie bao.n be been taken of Graceville, Ata.; Mr. and Mrs. Will Whienar ie afefrom an
,B, ..... _____ .. . aow able to work. fro e_0 mrop M 9 iedpears Bon and aod cMdren. ot d compels e pa
; Mri. and Mrs. naes, hove tuned into the hot grease as you would ap- M. W. C. McDtvI, of .wWq... a esa e -wi-ch:
________0 from a pleasant visit in Ala__ns_ wt_ ple or potatoes, andsee what a rare has returned home after spending .e n
-relatives and friends dish you W1 p an out. eral days here with relatives. aMsou .
SaWe are goin. g to loose our nelhbor O.. MoMlUA*N. Mr. G. R Stanton has commenced Sold everywern n $1.
O ur A Mrs.eter Servicen e s to move to preparations to rebuild his milL i -
iC H r PeaGawolanext week -. g T A Dl Mr. Walter tanto n and family e
.Mr. C. H. Gentry made a flying S T. ANDRE O returned from edje, Miss. Mrs. "--
SIs Excellent. to Pesacola tday on busie.. antn's friends are glad to see her iy asn ka *I, t es C
SExc le ,.o. E 3. tanton rf fI.ff v.Bn ( nN TNI O M mu& od hz i .e d
bought a mill at ligan FWrday. Ur. R. Lee Wilams io home again .
We have a modem fountain; it is brand new Mr. C. H. Gentry left B&ma Sat- after a pleasant visit with relate ies (
urday for Mihgan to move the mall in a Ane-th-. Addres: AAvi
and absolutely spotless. We have nothing to sprins.. wihL SOON HAVE TR. EU Mr. M sty, of pine Barren, at- ept.,b a Ms
but the best syrups and soda. We have new R STEA AD A tned the Maonic Lodge atrdy .
electric fans to keep you cool and you Stomach Troubles and Constipation. L A 8TEAMER LINES A1D A nig. "" ***
Se y y No one can reasonably hope for good BA4NK INSTITUTION. Mr. N. J. Brewton left last week for
COuld not spend a better, pleasanter moment dtgesion when the bowels are consti- i. New Mexico for his llth. His
anywhere else. pted. Mr. Chas. Baldwin, of Ed- a ny friends hope he may Improve
wardsville, Il, a sa, "I sufered from Special to The Journal. rapidly and return in perfect health.
*. chronic constlpatioa and stomach St. Andrews, Aug. 15--t is truly p- He was accompanied by his brother,
A NTAH Ttroubles for several years, but thanks parent that St. Andrews however in- Mr. 'Miey Btewton, of McDavKd.
HA M M *, U G to eOamberlain'sa stomach and .Jver aceI it may have been in the past Master Guy and Mttle Miss Nelle
Tablets am almost cured." Whly not is progreawa and evidence presents White, of Pine ~rrean, are vilting
New Brent building. 17 South Palafox St. t a package of Mese tat andget a e thAt he will son be one of heel ir grandparents, Mr. nd M
M Well and stay well? Rice 36 cents. busy places on our West ,Florld se.
SFr sale by all drglet&s. coast. We have not only the "Tar6 MTs. Ed Paney and children, of
.pr sale by a'l druyWts pon" to come twice weekly, bi Peniool, are visiting with her moth- W a t
S, ,,------_bet eau from^ e asht at west, but ta eer, rs. :s a ,-int.
SD deL ON as a fettng oat plying between Hstba Miss., to pend some CiCU STanCS
5C7 *&LEO- UN. I Mobile and CaimbeHe, toWucring oa time w=k relatli=es. Mw ''w to delive j
The Blistering Sun Don't Effect her te P a t Andrews, M. Zb rie daughter p p d to iver
^- lUlle, St. Josea, Apa)wco aa of .Mobile, Ala., are vlnf her b ti. .... t Jae
C bSpecial to Te Journal. rale, and now a ird steamer, er, Mr. WWl Dick.
'Soe tee.we sell.tg -k .. the staying qualityan awelamtX the "Mhe, awft apaity t o carry Dr. Dye, of e Barren, came up
". ^^ : ,at,,"...M*t f ors -ome 1111ma { s<' = I' e. osfr."M fo.st li..l to ==i w..I orders and get on 01
line t ulers aware t rock bottom prices. Money t o fo r this ofle was to be put on the MHe In the near t- v mis. qute ll. o
1a 11 8 tatomr wvo submit their estimate to u. S own o er or of a le tue which will give us "boat days" Master Edward McIlvid es suffer-
beuore. reaching the r tdton and udalal, days ta, the week. .g .wtth a severe case of sore eyes. TR A TT
bde~v- erynd&"n darkndess i The. board at direciort for the new 1mr se icha tison and MS.1
took outea bui to fad t Sch bank to e cae The a of St. A WiM1 Davidson. of Brewton. Ala., were
S uad rsw M i l Com pany, d *tolead tols a o-.In Ibe veng that It wI be a solid or- week. F e 59 and 259
Susion. .anlzatlon. 'oThe board is composed of Master Quillar Bond, accompanied
7*7. 21 r.' 2 M asaplf 911IwRe Mr. W. C. Mason has drawn the e Mown gentkleen: J. H. his sister, Mrs. Lee Walker, home
water fom hWe pond and h" a force Dunoo J_ J. Trounale, L.& M. few days ago.
o_______________________________ of at wwk snDing eceIl of An ws WZ. .Mti
Sary repairs on his mill before the busy~ P feinola anW. Li Mtan e of hs. Unnecessary Expense.
season begins. rianM u Mr.- Drim ond is to ake the Acute attacks of colic and diarrhea
I o e oMr. D. Hughes made a business presidency of the concern and W. E. come on without warning and prompt;
Itrip to Darlinhton on M.nda r.Iathiswill o president. relief must be obtained. r o1?
University1f s are now 01t work ,utt of .. y, wl be .cah.er. necessity lof incurnb the expense of 0 ts of .
mw Fu the fming touches on the public Very soon a suWitle location will be a physician's service in such cases
A high grade Institution for young men. terry, letlac wil be erected. Until such darrhoea Remedyisat ha. A
and ngineering courses. Mr. Chias. Cotton, retry nu rangements can e made It Is probable of this remedy will relHee the patient
STAR T MUITARWY DISCPUNTtE reasy of the BMeme tat a tepoarY OPeg will be before a doctor could ari. On and after A
MI term na In .GaleavblloeSeptember 26th.Pr catalogue Sept. let to take up, his work ha"s rtdy bee *rrwarded tO the most severe and danbe wd j
ad a Gnfovintion whoress. tar b een of sfatTallassee. nofamilyshould be withor argecustomerse
ANEW 8LAM, Pfw .Gv,, uh ohgbe n sae tm Is Mr. ie 'l' f e sale by all druggisa. ness on Palafox w
aim U.E WE. now Waiting relath!rsat &Is place. Mrs. M. IFPtst ad ittle son, Gay-
We notice that farmers are hauling oa, at bnome from a vlelt up st busiess house, n
out cotton bagging preparatory to bal. Bay with relatives and friends.
--Ing the fleecy staple. The schooner MNawell with a cargo |L0f
n the flee st e -c salt and other mierchandise arrived I m
i anesad rheum and eczema Is Instantly aI- MKegrs. F'orbes, of Cromanton. and spe tc -. ....toa
Low Rates North and Eastlayed by applying Chamberlain's G. H. telle o. Parker, wereamong Mul, Ag. L a T
via th un e-ua-ed. l or lnle b.y .H.. ou, 1 *a 5- thin hooof le m within the

L. & N. R R. O c oniTp a,*'w look after the wan
C T H aILL Ia. DalAes a wa te gut of Mis., M ay man
iSa t u r d a y A u gMus t 1R81a--y--ail an- d baby se a-
rottae Hfl, &A., 15-Mr. Johl house of Mrs. L. Ware az~d are enolo- 1 e da'm w relatves at Z m.L. 3au:
RnO NDTtRIP ROM ePNSA OsA "' ad e to the uM s. Rudolph Toml Is, of Robin
ROU NDTR I P FROM Pr-NOAC0LA one of Mis fie horses last week. I r; Clu. ]Porter, of the Ware Mer. sonN vSited her.mothr ,Mr
Tir', ~rETS Im# v m mun~ DT m' ID-tr q- G Mrs. 8acsoa Muter O., wMrs. Jackson and son Master 3yde ,cofln last week ,ond, tl mo,'aer r.Mrs. s:n:::::a::*wekH:p:::u:
., TICKETS LIMITED, RETURNING SEPT. 2 ofm Gonaez, Mrs. ilder andtleon' Mr. rd Pratt a a sold il. home -:r. a d tre h.e r. .of Ein.s
S .I.. -t ,, ..... OGlenn of Caatoinmt and Miss Mattle property on Comerce street to Mr. p.. ..tan .d Mrs. wperd ots w-itho
S\a. LuIS... ..--- s-$12.00 chicago..... .....$15.0. Lee of M.lat,v vs.ted Mr. and Mrs. W. ..tr, of Chairley, and Intends, hn h mother Mrs. S h. th
IH Smith and daughtr one day "at a f"edys' to leave with his family .. -. DR INI
Louisville, Ky.m.m.......2.00 CtfInldfwtlf... ...m...$14.0 mwek. for Deaver. one dayr t Days, tol av smy 'Mr. D. F. Raln ofM Robison 0 I N Ed
Mr. Ohas. BeaU spent Onday w~h, Masters H.nter and Frank Shippey Mr. d Mrs. Yark, of Bgdad
Norfolk. Od Point Comfort. Virpnia Beach, Ocean ha parents Mr. and .. n. o Wewehtka are visiting Mr. an cam crowd yon pe ld
SView, Remoke, Hot Sprins, Va.. White Sulhur O, a ii tn rd M Mrs. N. G. ot tha pae on a hayride and sur f


no nvuoiam a 0n
wif to suffer pain. ,Women's
hey are the sign of dangerous
ale orgs, which should be
)r dangerousresults will follow.
TAE *




) WOMANVS RUAM
y of woman's bthmg and we-cmslag pains.
ito stopa bt it follows W lddiv. out
- nit them from cob
It*
0bottle.
w T A ARiN," i -
a Mw" ar Shelta, of Popr
Wa m aPIIMlcod&*PybouSPoI *t
himt afllMbre taMIR, two *
IrS trayifly A r was T ed by Cardut.
C., I mt49 Ry toknowof
t wcomiohe.dx-."






e best we can under the
rsday morning we will be
e in any quantity. Ice can
at factory. Phone your
ur list.

IN ICE WORKS,

J. R. Keller, Manager.




I the Public.


ug. 8 we will sell ice to
their at our place=f bu-if
rharf, or delivered to any
lots of 100 pounds, or

ree to deliver in small
ope to have a delivery-
next few days that will
ts of the public.



ndets & Co.



:, "...


Springs, West Vi Wrightrl, N. .......$8.00 Anew son arrived at the home o Tuesday night
V~r N. C.Mr. and Mrs. Edl.Lawhn
As l.N. C., Hot Springs N. C., Tate Spin. t. e. orning.Make Hay While the Sun Shins"
-----------------------$14.00 Sunday. There is a lesson r. the work of the
--........---- -............................ ^1"s^, eay. thrT rmer een .. A DE LICIO US
N.. Chas.L*veyofansacla visitedtbright sunshine may lathat the
Mon e e, Tn.......SL40 Lake Toway, N. C..$15.45 his father Mr. C. vey b she mpare for t a
Mr. Re-eve return last week froma abhepr oefor t ow. er whicd
Fourther information, apply to Ten e where ad een for .e. ae so le torolod. It oould Look for the Trade Ma
F further ntorm m appyt eral weeks on business. 1 be with every household. Dysentery,
ST H-"m_- diarrhoea and cholera morbus may at-
R. V. SUBLETT, Depot Ticket Agent W. H. Smith was in oliao ft- diarrhoea and cholmembera oorbu may at.
rd e on buninea. i tak some member of the home with.
I' }J. We LURTON, Div, Pa. Agent Mrs. Gray of Pen la In is iltln out warning. Chamberlain's Co e, ,Rom$o o
J LT. .^_ V._URTNivher daughter and family. holera and Diarrhoea Remedy, which
r:. ,IH .. -- *~ %~\V\ Q^ ,;is the best known medicne for thee mfm mI
S dseases, should always be kept at
./hand, as immediate treatment is nee
SSAm EAVF mF. ryor saleadby all drggists. _roef4andelayma
ELECTRIC SIGNS ARE POPULAR SAGE LEAVE eo salya eyall d g e. ghe St
W Whdont yoWtry mne la finatotatywurplace of bul-
sess or In -pvur ow window? We nam put it up lor TTESiNACL
I. t1-0-0-.... ..-"-00 r Mt.-*AInt NOTES PENSACOLA
YECLECTR IC AND SUPPLY ClO. of rai. ..an .. X wee wan CLASSICALTO T
Ai:,.- vw .* W Om1 MUHMMOw. WyT.slWLL. sees a sser a pt-Soel atway hamonize with
7 PHNE 8T0. 208 AVTtt. I .th.coats and overcoats hav PRPAATORY SCHOOL FOR OYS
Sporton atoo e no e er AND IRLS. We have the large
a o dp o traa vtstt.tion of a w will be Seventh Annal sea Begins ep faCtOry n the city and
vaentelopino tiae ouse aied a Oinoff oeven popular thm before. 17, 19WL
a northealterly reon. A clou users ag l be.al at s school lmits the number of phone number s 232.
soon ed ohad. ~, tapering graoetly to a is received to such as can be OUr g OWa it
in"began to spri U 6inmadinSpite mthe ot taught thoroughly. .
Ad &_ -dry forecast it inmmaed n a de.h- It snt a bt too early for ou i It prepares for entrance to our JacsOville th


SBottles

BEVERAGE

rk on Cap and Label.

only byl
ling Works,
eat. Phoie a97.



4 TO US!
st delivery system of any ice
want your business. Our tele-
Ring us up. You will find
s possible to makc them
e large consumers of ice get


a C ef C u P i







* .:
A


se.". S ~ v~iiM ~IA


* ..- -


* -.9.


IIOMUML AUGUY 16. 11
- --------. -w ----5


i <. -~


PAW TONOM


-4


C.:







admire

dress 8
perm it,
Tod

co'crs.


WeI

it that


S.ASKS, COMMISSIONER


W TO DSMISS THE SUITS


has do not make the
but it otfen makes him
d by the fairer sex
one reason a man should
as well as his means wil
t.


dress well does
nd a great deal
others. Simply
and styles that
you, backed
manship and t
IF.


not mean
of money:
get the
are suit
by gWod
the best


know our business and ift
ome here we will see to
you get the right kind.


White Barber Shbo
The white barbers, formerly of 3
S Palafox St.. are now located at N
s E. Government St.. next to Wester
Union. Only union amen-employeL.

DR. LOUIS DC M. BLOCKIEF
PENSACOLA, FLA.
Office: Ient B1dg. *ReMe: It W. ledeti
Phne 4U8 Phas IFS

COTTRELL,
FINE PHOTOGRAPHS.
Pensaeola, Fle.

Somethlg New In
MUsad NM M,, ONm, .
W. A. Gahlenbeol, 218 S Pdta It

TURTON 4 BELL



R. K. WHITE,
hmkr, iasfturag sue oWe.t s eiwa d
bsis,. U L Pal es Si Pem ass l

Tersely Tbld

THE JOURAL*4 TELEPHONfES
Editorial Rooms .. .. .. 3
Btsinees Office............10
To communicate wtt The JounM
during the day time use the businem
cdce phoni, No. 1500. To copuant
w(e with The Journal at nit uM
the editorial phone, No. 38.


Carl IH. Jermigan, of MUton,
here yesterday on business.


wa'


E. O'Brien. of Mobile, .aspector of
iu'ls. and boilers for this district, is
eron official business.
Capt. John Rourke, one of Bagdad's
popular citizens, was a visitor here
yesterday.
H. C. Tubb, of Mobile, route agent
of the Southern Express Company, is
dn the city on busioess connected
VUh that company.
A. D. Rosier, of Milligan, connect-
ed with the Scotch Manutactur'ng
OD., was in the city yesterday on a
soort business visit
L. A. French ia in the city shaking
lands with h s many friends. He is
ia business at Forala, a city which
W going forward with rapid strides
Capt. R. F. opes and amaly, of
(olumbus, Ga., who baxe been spend-
some time here as the guests of
,rs. A. E. Yniestra, left last night
br their home.
A. A. Seraphic, Ua'ted States an-
*Irvation agent stationed at Tamp
is 4n the city shaking hans with his
"Mnerous friends. He was f nerly
It'mOed in ,Peuacola, many
hOpe that the department will return
Iln to this port.
A. A. Brooks, for many years sec-
Mary an-d treasurer of the P. A. &
SRailroad Co., has resigned the posl-
Ote and will leave Statrday for
Iuon., Texas, where he wti engage
railroad work n that field. Mr
Sks has been in Pensacola for
about nine years ad bhas won many
tend here who will regret to have
im leave.

'.'ere's a del'ckmusness tO the
Ilue Ribbon Plavwr" that delight
tmo" fastidiou. Just try Blue
bbon IA on or Vanilla extract.

nchwomen have al was ta
Prenlchwomen have always taken


after road and ridge work generally..waa introducedd .the legislature, at fO
I have thought best, in Justice to my their request by J. Ed O'Bren and OfWa
self and others Interested, to come bt- the. late J. M. IfllIard. This Is, 1
fore you and to respectfully quest tb *. .a evidence of the interest as tve
that these suats be wthdrawn or that tak~n by them in the work. 0
6 the suits against the former commis- The road law of 1899 was intended thin
. aloners who represented -country dis- as a special law covering the working
a tricts be withdrawn. I make this dia of convicts and does not in any way fr
tinction entirely without prejudice as' aterefere with the general law of
to former members who represented 1896.
city districts and for the reason that Section 1 of the law of 1899 reads
the same arguments do not apply 'as In part as. follows: "Provided that
the duties were and ame entirely dif- nothing is impked in this act to pre- ,
1 ferent in many respects from those of vent any county in this state from
a Omauisaio~er representing a city working roads as the law now directs
* district; and I also lad that the road of any general road law may hereafter
laws then In effect apply to the ser- direct.
vices for which these amounts were I think It Is very plan that- we had
paid to country members of former the right to work the roads under
boards, both laws; that Is to build new roads
ask that the .ults.ute d'amissed itc with the convict force and to continue
4 the following reasons: to keep other roads in repair by pa!d
Reason for Oiemlieal. white labor as we had been doing
lirst. The law does not say that under the general law of 1895.
. the compeneat1on of a commissioner An we thought better results could
*hall not exceed one hundred dollars be had by employlog the convict force
per annum, but does say that a com with the superintendent and the ma.-
, missioner shall not be paid over one chinery and stock ha building hard
hundred dollars.per a'inm for his per reader exclusively, and by keeping the ly'authorized by I
diem. other road in repair by paid labor are clearly for the
This has always been construed by this work being entirely under the The road laws as
the ecamb'l ,board and by its dffer- supervalton of each commissioner in tafnly did not co0
e4ent attorneys and clerks as referring bis district we elected to work in that or us work in roa
to the per diem for meetings of the way and that is the plan, I believe, maintenance as ha
.comnrmlonerm court. dtht is dn effet at. the present time. Eacanmla and oti
In other words, commissioners The law of 1895 provides for two saep- state iluce 1899.,
could not draw. pa for wore than fifty rate systems of road working eitherr the said laws are,
'ineohws per year at two dollars per of which can be adopted by the eom- at.the present tim
meeting. Previous to 1901, thIs was re. missioners. would stop all roa
stricted to flftyvdoLars per year or Sections 20. 21 and 22 provide for ty. These section
8 twentyflve meet'nge per year at two leyying a special tax as has *been the .have seen fit to !ga
0 dollars per meeting. If it was neees- custom in our county for many years. boards did.
sary for the coo-iwlAokers to hold section 21 provides for an overseer (As to the right-1
1 over twenty-five meetings per year to be appo'sted by the board to look infer from a letter
* they did not get pay for the excess after this work at a salary of $1.50 pe ini relation to the
- over twenty-Ovre and this was carried day. Daras for intpecti
s out to the letter by caambla county Thought They Obeyed Law. Texar -bridge that
boards. I believe that this was ntend-1 .N tho-t They Obeyd Law. your board wheth
ed to apply to payment for attendance Now the commissioners not being hm or insist on hi
s at the meetings of the commissioners lawyers, and that part of the law c': thank that case ani
court and that it .has no other applica- 1895 never having been called to their ilar. Legally the 1
ton. attention, did not know that 4t was the right to empi
Previous to 1896 the general road law, their duty to appoint the's overseer, of to dollars per
allowed two dollars per day for road but thowuhtthat it was the'r duty to bridge but could b
.md bridge 1n pec.ton. bvt in th attend to this overseership themselves ather party at doul
year the law was changed, the changes in .their several disti'ets and did on a basis of prac
'being very slight but the clase that a bills accord'uly as they it was the best ti
allowed this two dollars per day was thght strictly accordg to law and a practical man a
left out. sa bills were approved by the finance elice in buiMing gc
t *t sms that this change In the w -e and ordered pl d y the a deep tevest In
was never noticed In Ealcambta coun- b'-.*. s it that if you bh
St. either by any member of the board As moof that this was the custom low him that amo
or Its attorney ,or clerks. aend conl"-ore.d legal and proper t yot have the r1l
Question .ot r4ug1ht Up. avme only t call your attention to te amount paid us fo
When I 1trat wet on the board in minutes of meeting of June 11th 1901, Anothe
S189. which was a year after the law at whish time a new board was organ- Another base c
was changed, I was laormed that I e maless these suits
wd wetIo 'ne minutes, after stating the selec- I that each of th
Cton of a chairman anm finance coin. wew Paid two
ENR- eT IT mittee readasfollows "eto furnish a twoeam
I tTT T. nis t oneras from theethree country di.f to thatweh ad t
.trict W an each desiansted6 lasumer- railroad fare and
Candruff Is Causedby a Germ That tltso rsdofrd si ntred railroad fre and
Saps the Hair Vitality. ditheirrespeetive expense of wiMch
't is now a' settled tact t dan- dit, ,ts. ed by this two d6
druff Is caused by a germ. Palling "L submit in tbhs connection aflldar the districts are of
L hair and baldness are the result of Tits from J. B. Lewis who acted as could net be done
dandruff. Dr. E. 3. Beaqiley, of oreman at road crew in District No. District No. 4 1
Cha IMpagn, Ill., got hold of the new 4 dfEag 19M8 3 and 4, stating that he miles north and
hair preparation,. Newbro's Herpicide was not employed as overseer but was miles east nRd wea
-the only one that kills the dandruff .npyed.3. a workman; tiat he tricts equally as I
germ. ie says: "' used Herpicide worlw.d every day and that he receive. Your attorney fn
for my dandruff and falling atir, and ed the sa'te pay for h'-s work as .h?, 1905 on this mattel
II am well satitfled w!th' th. rea-lt."' others, viz; one dollar and twenty- Th-at where an ofl
Dr. J. T. Pugate, of rbaa Ill ., sary: lie cents Per day and tha- the wor pr'er'orm a service
"I have used Herpieide for dandruff was done under the general superv.
with excellent recent., I shall 9eM sion of the commissioners for that dis- *
scribe it in -mi practice." erpicide trlet. Also affidavit from Thos. Hast-
kills the dandlff sera. Physicians wings, another wcrtmua which bears
r as the general public say so. cut that of Mr. Lewis.
I fr sate by W. A. D'IAleberte The po'et I wiSh to make 4is this:
druggist and apothecary, 121 South That the board had the right (In fact
Palafo street, or send 10c la tamps it was their duty but they were not
for sample 4* The Herplclde Co., De-fiso advised) to appo'nt an overseer of.
tro't, Muh. |roads at a salary of $1.50 per day or
'_________ __________ about $450.00 per year; that not know- ..
I I -,'J -ing the law they did not moloy such I
________ overseer but did appoint each
county commissioner as overseer
TI 11lI in his district and that after
I lU iak *mv v a the as'd commissioners had been so
F ul doelgnated by the board and had at.
IE tsaded to this work faithfully aa to-
s tructed by the board and for which
Sf^r a w *WH i^A _^-_ -___ --- -* a


law.,when such acts1l t for whloh there is no compensation
public good. specided it is clearly a principal of law
s passed in 1895 cr- that he is entitled to ba re.nbursed
atemplte such vig- for the necessary expenses incurred in
d building and road the performance of said service; and
is been going on in iu support of this opinion he cites
her counties in out" some .evan or eight decisions that
and some parts of have been made la the different states
etrely impractical This pearciple of law alone should be
e &ad if carried ouL sufficient reason why the sutts should
d work in our coun- be stopped as the amounts collected
s of the law you were fully covered by thie expenses of
nore as the previous the work, partly by cash paid out and
.partly by the- expenses of keeping a
to stop these sults I 'team whkh the duties of the office
r from the governor wade necessary.
amount paid IL M. These tr'ps required whole days
eo; e of the Bayou which obliged the comIlssioners to
it Is entirely with m glect their own business, without
ier you aIEow it to profit to them and -for the benefit of
is paying it back. I the public.
d ours are very s'm- As I have not had any legal advise
board mar not have in drawing up this commumr-cat'on -to
oy h'm at a salary your board but have only referred to
day to inspect that portions of the road laws as I under-
ave employed some stand them, it is possible that I may
ble that amount, but be In error as to some of the points
ticall common sense wMohh to mR appear plain, consequent-
ng .to do as be was ly I respectfully ask that you give the
nd had had'exper.- matter your spee'al attention as re-
iod brdges and took gards the points I have mentioned and
the work. and I in- that if you can consistently do so, that
ave the right to al- you order the suits dIsmissed.
unt for his services I am confident that every tax payer
ht to allow us the in the county, who will give the mat-
r tor services. ter proper consideration. wIll say that
r Phase. Justly we were entitled to the amounts
>f the matter which :'d will endorse such action on you.
appear very unjust part.
epe trips for which Respectfully.
do'lars required us PRANK JOHDNSON.
nmd often in addition
pay out~ money for GASOLINE ENGINE ON
other exDenes. thb: DAILY EXHIBITION


The gasoline eangne which W. J. &
B. Forbes have on exhibition in their
hardware department is attracting a
great deal of attention. The engine
is runn-'ng a large part of the time
and the ease with which it Is started
and stopped and the smoothness
with which it runs is all interesting to
those who appreo'ate the diversified
fields of usefulness to which these
engines can now be put.


REUNION OF MULE SKINNERS
ges Pslalsmee to Gather at Teona-
mexse, Kam.
What will be the first and perhaps the
last reunion of the early day "mule
skianers" and "bull whackers" is to
be held at Tonganoxie, Leavenworth
county, Kan., during the Old Settlers'
reunion Aug. 8, 9 and 10, and all of
these old teamsters who aided in set-
tling the west, fought the Indians and
traveled thousands of miles across the
prairies before the Union Pacific rail-
way was built have bqen extended an
invitation to attend, says a Leaven-
worth (Kan.) special dispatch to the St.
Louis Republic.
In the early fifties Westport, Mo.;
Leavenworth and Atchison, Kan., and
Weston and St. Joseph, Mo., were out-
fitting points for transportation com-
panies. Prairie schooners by the bun-
dreds have gone out of these towns
In a day's time, some drawn by from
twelve to sixteen oxen, others by from
six to ten mules. The "mule skinner"
obtained his name from the long whip
with which he could reach out and clip
the ear oft the head mule if it lagged.
The "bull whacker" was so dubbed be-
eause of his long .whip, but he was not
so fortunate,as the "mule skinner" in
being" able to ride behind his team,
having to walk,along about the center
of his line ef animals where he could
reach each eme with his whip. There
are old "Iehker" whwo claim to have
waliedthe baee mroad the world
following ox;teams semes the deserts
to Cel ao40.exas an Calitornla.
After the unionn Nacitde drove the
prairie sdIw rs out of bastbes the
maoe.itv opthese old time wetn men
settled in the river counties.In ansas,
Missouri ald Iebrapki took up home-
steads ad began faralng. In Leaven-
worth adAtchson counties, in Kan-
sas, there are said to be no less than
fifty aged farmers who came west In
tht fittleas And toh*"A r-vQj drIxr-.


mule and ox teams over the Kansas
prairies In the service of the govern.
ment or for private companies.
In all of the river cities in those days
these companies maintained big cor-
rals, some with as high as 200 animals,
and in the early history of Leaven.
worth during the border ruffian days it
Is told that there were enough prairie
schooners thee to form a circle com.
pletAy surrounding the town when It
was attacked. As late as the early sev-
enties ox teams drew loads of lumber
and merchandise Into Leavenworth,
but It is doubtful if there Is now in
eastern Kansas. such an outfit.
All of these old platnsmen In Mis-
souri, Kansas and Nebraska have been
extended an invitation to visit Tonga-.
noxie to renew old aequainthnces.
They will be permitted to outline their
own programme, which will consist in
speaking and story telling of the early
davs.
Time sa'vime Kltehen 'emasils.
Among the many useful and time
saving kitchen utensils that cause the
old fashioned housekeeper to open her
eyes in amazement are olive stoners,
potato and orange peelers, pea sellers,
almond grimlers, Ice shavers and
crushers, cheese toasters, corn scrap-
ers, pineapple snips (for taking out the
eyes of pineapples, which every house-
keeper.knows Is a difficult process with
an ordinary knife), flower. scissors,
alarm bell egg boilers, salad oil drop-
pers (an arrangement for pouring oil
In dressing drop by drop), clothes sprin-
klers, pie and cake lifters, fruit jar
holders (for holding hot glass Jaws
when preserving), sandwich cutteon
(these are for various fancy shapes),
etc. To these are added odorless stew-
ing pots and frying pans, which are
said to prevent turnips, cabbage and
other vegetables from giving odors
while cooking; self wringing mope and
knee rests for use when scrubbing
floors.-New York Post.


m-%-fmu


.- .*.:


-z


IAOF* ALMW 16. Ign-


A .
was entitled to two dollars per day
ftkM A Fftor each day went -in the !aterests of
roads and. bridge and as far as 1
e f I[ t I fg know the question -was ever brought
Sup sntil after I had ceased to be a
AllegId MrirftS member of wild board which was in
ARM f u I J"anury, 1905. I mention this to show
that the coinmiss'oners thought'that
they were la g lly entitled to the
MANY REASONS ADVANCEO WHY amounts when It was paid and that it
.SUITS X. was not grat as it has been deOignat-
SUITSOFOR 0U ON Ojec and referred to in the repc~rt of the
AMADUNTS AULL.E D TO 'HAVE state aMtor to the Vovernor in 1905,
I and in tht.a connection I would lik3 to
SBtEN IL4A.ALLY PAIDI'OULjD say further, and. I ean say It positive-
S u .v -. ly that in. handling-the finances of the
BE QUASHED Y THE -OA '* county for nine -ears from 1896 to
.. 1905, which amounted 4a the aggre-
-Rate to more than a -ba'f million dol-
The fo!llowtng communication was lars there was no graft on the part
submitted to the Boar4 of 'County of any comm'sseioerw or known to any
Commiiseoners at the regular meeting. commissioner .and. I. think theirs Is a
record of honest ..business methods
on Tuesday W nat last by former CoIan- ad good results along the lne of im-
missioner Prank .Johnson, relative .toj provements resulting. In the. upbuild-
the suits that have been instituted '!g of our county, of. which they can
aga nst former oommlseioners tor well be road. When the idea of a
money ..e better system of road building for our
moneylleeto e beenlegall outy and the working of county
collected bythem: onvicts for this purpose was first
Pensaco!a, Fia. Aug. 14,. 1906.. conceived in 1897, and from that time
To the Honorable -Board of County on, every county member showed
Comm'ssioners, Keacambia Comu, great interest and did everyth.mg in
ty, Florida. ... hls power to make the system a suc-
Gentlemen:-Refew'ng to the sult' cess.
* which you have instructed your. attor- The New 'Road Law.
ney to bring against several, former The present law authorizing the
members of the Iscambia County working of ounvicta on the roads of
Board of Commissioners, said s&t-b the several counties. and making all
being baaed on amounts claimed to needed. proviLons. for. carrying out
have been illegally paid to the .aad that work, which, was passed in .1899,
'Commissioners for. services, for. road was drafted by three. of these same
and bridge inspection and for looking. scambia county. commissioners and







zof...4


W.; -fC I


"V


..4 4


SaLY WEEKLY. SUNDAY.
*WL8NED EVERY MORNING EXCEPT MONDAY


THE JOURNAL COMPANY.


FRNK L MATES, Pu'.sW..t eand G..oe Memage.'


.- *4,J;*.~J4.~ ~
S I.-
~IpI~p -'-
~-1~
I


Ike Prodmm" asks to.,bes
91 AM desacafemih at. bb hi f ~t~
me saendf ain emet 40 the matter
will probsblybecomme heviden thm t
couive ac he sad few uu3it1 IN
he really Is winbf dor brde nomini
St~on viii).daiyftg dot lie wilacc
it If offered tohka, Odiedf*Is bound
to crop out In nomew a or other.


0

It

ir
0


ot
d


"*'+


Iat Seator De. | The Bluff Sp
0w a condition Is due to overwork in piL
oaheotaon wkith le duties in the up. -= mn
*t branch of noarm Thee -n


rings Tragedyl
X-


pUMo. however, beHer. it sla the In-1 I'hle on a viit to our old home of was "just a Uttle w ildM." O =nd
Sua"ce oUma-ates dat hould com luff Sprina, the community was words; how surely the snares of evil
leo of belng o hebooked by an awful trsaedy which P read forthose boys who are a
for a while east a gloom over alL A Younmn the glorious promise
A.MI D e ia i tragedy wisla. Is bm.ing smantly e on. Wof ror e, bware of
_ atedsaanwimmoW-Obo ,Untilour young tons pk _tf ,1w, T a ar smeany
ee feal h--- A- .... m(en eamn of wisom ad Are wisu. good wo men, so imW aml me. so
Sa M IO A wi rob The e arh apter of t oeris, iwh may good as to go, cm y not
M N e out In a new plme all M g ad truths is brought ftnbrey tan away b Ve It latet
S09 *eead eitlon of "TheaatCA to s. "-ril ie m sasui. oorapt good
iW." oat soamme g else eaaf as T 1The 61y of the foofth boy, wbo morals. Raemer It boys. *amone
bIe. left hisb home on the fatal alght, are o upon habt coats ad iS at not be
eope mo hIgly emteeme and burned?" it i that "evi mumt
ranked among the very best of our needs be" true enousk but let our
It ae ostoan eaisdt whbo said citMeSn. He tad brothers who stood young men learm to be rve enough.
Oar were sevetee verites of high in refmous and social e- to ashun the evil, to keep opt of the
sCeeO O a tn 'dolar bill is aDald cles, one at then beintag a Iermsa way of the asme.
in the M. church North. "Wne and women tMk I voice
... t. .. .. .... The scene at the home of the boy, a world wide tratho wem Is declare


MW WAaTER A TE
SUBSCRIPTION RATES J AC ODOuIL. OOMo". S
Tear s .... ...........S0 00 One Month ;* .., .. 45 -
xdths.. ..** .. 2 50 One Week.. .... ..... 10 T JaechonvilHe TmIes-Unon.
shre Mota..e ... ... .1 25 Weekly Edltlon, per year..41 00 *

It eO s s M M Wapw perro Fom lsh a pu~i Th e rapid and effeotve work that
... aM .. ..t am so I being done doping tbe rivet
, Is hiily gratifying o the people of
SJacksonville and of its atary ter-
adft sowSn U Papers on Sale on Trala r:ory; and the terrttory tributary to
(l 0 ia i i 0 MSI and at all News Stands. M w w be greatly extemned
by Ia euupleto WMt deep water
which we will be oon h-ave our city
Offoe-Jeournal ullding-Ceorer Intendnola and DeLuna *ts.. wll become one of the 1ead ng sear
m ports of the soumh.
.__ Our own state alone furauabes an
Sinae amount of business tLat
P1iBAOA O FUBIfDA, 11'rtuSKDAY MO(XM G, AUGUST 1 1906. seek a water oudet, but with deep
water Jacksonvyle will draw heavily
frm otherstates. Thebeneftot this to
OTM Alle gd Ver ftiS by Sullivan, the Illinois National Com- the city and its people is well known.
mitteeman who, it would seem, e It wln prove of great benet to te
tbe COUty m ilslonn.t, persona non grmta with Mr. Bryan railroads entering the city from the
Msewhere in The Journal today ap. This, of itself, is sufolent evidence north and west. At rat glance it
peans the argument presented by for. that Mr. ,Bryan's objections to the 1l.- ht pem at the buying up of
ner OanDmoisioner frank Johnson be- inois gentleman was well founded. vule would be at toeir expense. Even
fore the board of county commission- if tl l true.to some exten t a rst
em Tuesday niat or a dismissal of Se t'Ary oot iS havinE such a i wi apon be much more than coun-
the sult onow pending against certain big time in Soth America that it terbalanied by these railroads getting
Former commislome for tle r ma m- Seoretay Taft inatieat to a part of the'tnasiem that goes from
ery of money alleged to e been ndet ay agaGeorga, Alabama and We Fida
cover of money alleged to have been <* uayby rail or through the pnts of the
collected illegally by them. Germany is rAing over the or Gul.
S The Journal's opion, tae argu- an i r a to ih Jacksoaille Is further west than
(of Mr. Janf t ia Thando as befr at teany other Atla port. tio makes
llnet of Mr. nJod o is iotchal at d .hna Th7e her apparent a her as near 'n Atlantic port as any
concluslve and we believe that when parent aos *vt et of country. Thas
the governor is fully acquainted with _o_ a_ dvatae whlof oopt_ Ths
9a1 of the facts in the premises he #thew pam spirit and enewy of our
wI not tio'st o the aults being, L R VELT ple wInl ake her the lead
Pressed. W. A RO V I ATLT a iuWag center of the southeast as
It will be rm bered that when ---0 dea fot lading t our Ap"- k fto
this question of overdrafts on the part* savannah News, aonlrn will at no distant day be-
of the conmarseloners came up, the ............ .... come one of the leading ports for the
members of the present board paid -... -... .-- trade with South a d the
bck, udwhatwasalleged Aimwepr ed West adies, every interest mat
back, inder po, what wa leoed At hwe ~~m time age th centemi hee be bented.
to be due from them, but the mem- question as to whether Prealdet
bers of the former boards refused to Rooeevelt wU'be a& candidate tr t$ b
pay, and suits, at the !instance of the Presdetlel nominattn i certain to me M a a ry
governor, were therefore entereceive great deal of attentionbut. thee are ome prp that
--aint-the ...with.tadingw th enumuum 'M V ion s-e m that
nst them. of Mr. eb, the Peresdet's vate th amateur co mete mader bould
The money In question was drawn secretary, that It is the Preets notanpt pt.ea tl a gs as hair des
for work done In building county roads I'Prpoe to adhere to his declaration, depl toWtae ad face beaches are be-
and the commissioners all believed at!made imnme&Adt*y alter the last pres- yond her ken. TYou ca purchase de-
the tie and believe now th dential election that he wouldn't pilateres o that willemoe f t growth
the and bliv now that ey n be a candidate. of har om the but, of cmrs
bad a right to the money. It is pos.- In an interview in ,St. oul le t the removal ais onlyfor the t O s bOig.
sible, although by no means definitely T riday Senator. Tlbhan -is quoted as The chaSes e tha t the fEti will
settled, that In a strictly legal sense ayin: Theodore Roosevelt t a return very on. and lostead of ata
they we not entitled to the money ci andate fore the noinatou, and he t
Sut 1 y and practically they wereO ili be sorely, diappointed If the Be. obit e aT i Is be ule
but morally and practically they were pubPan do not force it upon him, M is bemmen thep w -
entitled to it. He is Just tMbing. for the place aga t on m i 1 wate t.M.
The g ot t eot the benefit of tha d' is ts 9 very possble means to down to 6 0 tea of a sn k -
men' lbor. The good roads which makthe et towards bimand Is the growth is wat N lightly It is
e now Oy in various potlo of m the Republicans force him to best not to meddle with viet..Od
thnow enjoy In are various eort-ldene of au --mib n." O course wa't notme it as yeO douse
the county are physical evidence of something must be allowed for the .
the services they rendered. The pay feeMng of hostility which Mr. T lman ---s
which they received, even including I tertalLns tor the President, but be- a mtbe -..fwl e me e
that wb 'h tall eged to have beenlc use he Is not on the best of terms w w fwror
drawn IHegaly., i.s -nitealmally would make a statement like the ore. e the soft little ear is crumpled Wade
small when compared with the bene going winless he -beHeve it to be true. or lying close back to e head--. They
StA that the county tas received from It isn't of course to the credit of the rarely take the tumble when thug hald
their efforts. PrWedent to be placed in the position a baby to me that ts ears are In a
taking all of these things into eonOf saying one thin and trying to do! natural position, but will bold It for
durationn. Tthe very opposite of that thing-that the longest time with the head "paaesd
ieverateon. The Journal does notbe 41trying toa mlslea the public, but against their bosom ad thMe ear tarn-
lleve there il a ury In amb ooun.tbre i bno doubt there are prominent ad forward lIstead of bsek. "As- e
tY that will render judgment against ;menainboth polkical parties wbno twigs bent the tree is -
these commIsi..oner. even If the Bu---- ttstet tte IPbIdenft's Inten e re- twi is bent the tree is Iae d"ap-
Ssionep even if the st eti g tIhe pt nom ies with as meh force to the plays.
are pressed and it does not believe j ust enator an does. o tal as to the moral growth oC a Cbil.u
that Governor Broward, when he day or two ago Benator lAitte was
thoroughly understands the circum- quoted as expreasiag the opiuhon that @ -mW Kth ep aM .
ltalea, will Insist on the suits being Roosevelt andl Bryan wWould be the Grease stalbs on a kitchen fr a
pmscuted. W posing presidential candidates in dGiBealt to rmoie by e.riay means,
Further thanH, these suits should Senator TIHman thinka Mr Bryan aba wlutl pner.l e mn aglItw
tot only be dilamnmed, but the mooney can beat Mr. iRooevelt He antd In cat.ion ptnoeuh us a e do
Wh the present ooard paid blac ; B Ious Iterview If he co.uldniit'., even nath o met mee w on
mhe ndebes. to bo In merr the smtamnent Senj I the wood isl ey hte. will heave
temper. The people down In ator Thlman et his ee~ ae the a ye -wlah stain. I avot athi, mix
their hearts are generally actuated byy better of his udgeent. Hie Is satis- ome lime with the siota, ants a
pretty well developed sen. e of a _ted, however h. tr. Bryan's pop, thick pasta la frmed. nt B paa
ty4v tax payers in cmnbia ,maty ulanPty. Teal I,1 mder he dm. It io bettsr- an u a -e- oe..
am. he ound who are tn fvor of corm-. couldn't ay much agant the ha-I tio t o a m tr' r m
poliag these men to pay tback mnoey tor f Mr. imoxevelt-"only that he' vwry aie e rs
mlch yey fully earned aid for which
the county has had more than value ...
r euelred. ***************r-- i--t-a CM .: ..........MM.t.....M... ^^


JOURNAL'S


CIRCULATION


r5 a ... THlE
How 8ms Uelative*s e~uP.
t odern Be.1 oheef WOWern. s




wt .ue Nt. L. The acti
00 . .S AM ...S ~ ...- Journal puin
-+ fad w-.. ... m=~ 3... stated below:

For many yearM The heirs of the late
Ruem age, the famous aoI D ....r
bay an X D a1. ......
have been lt ibg in pectatkan a 2be. ........
coming wfieity upon tha death of ........
Unce BRMall, says a pedal dispatch 4..**,...
from Tay to ah New York World. 4... ...
He as helped the majority of them .........
fnandally from time to time, paylmg ,/.....
doctor tDilk or answering with a 8I...
check an appeal for rent money. Som 9.........
of the nephews have boasted tnyearm 10...... .
past that upon the death of Mr. Bage 11........
they w ld be worth million. 12........
JamesL .Sage, a member of a frA1m ..... .
of &hA deaKrs, is perhaps die most 14........
prosperoa of thenephewsa inTroy, N. 16.......
T. He has probably a few thou oend ........
dollars In own name. 17 ......
"Of course," said he recently. m .......
not tool enough to throw money over 20.........
my shoulder when I can get it without 21 .... .....
workla ftor it, but I don't have to get X ........
a sie* of RuBsel Bage's fortune in 2S........
order to lve. Fve got ame money of 24........
my own." 25........
By way of proof he reached down in 26........
his trouser pocket and pulled out a 27.... *..
roll of bbll which, he ai, "would S.......
ebhoka cow." 2 309....
Obarlte a Sage, anoer nephew, 31 ......
le the third floor of anS apartment
hou elnmTroy. Bets a csetman
bouNa In T qo. He to a rictoet man, Total..... .
wtth gray bair and gray mautache. Average....
iWhbe emp ed he may be found upon
thea dlMry wagon of a manuftturer
and bot*e of soft drink. Chbar The grand to
8a haat ear digntemrs two soa 4".. "
all.-pwnand abettwo stlathome. the year I
MThe dIaabtS aSm bar' wortlag gi ,_ T
and emiktm lagegly eto et The grand to
LIa., oe of to aave om
Who Is emplred by the Unitd ra.
tionm e Mny as a codtor. To hem
adeswf ad dumb Pon ww baon. When I hereby cer
the b& was about twelve year old
an appeal was made to amm=nD Sag above stateme
to educate him. The old gentIman rect according
placed the boy In a deaf and dumb
asylum In New York. About.-e months cords on file ir
ago the lad returned without the
knowllee of either Mr. sage or his
parents and engaged a room for th
nght at th~~ hotel mIn Cohoes.
The next e a= % the room mpt
Wa found turned on. Be had commit. ~ ..
ted ncM&a Despondency over al at.
Hlenat is suppomed to have been the
1T ftawl of Chartes __gt
pm|^ e ^es.. ehad a
-in i1n.a1 of begy t waa .

Si..' Ater all V. t" 4*fy tim heat a
S'tor it.t woM Mat t-at wWa made
b te a o a e. He the AO. Thew a, di
Uiek ebch of sa at he va vae s far ta ug were o
semW il aaed dear eay: 'y e boys. Le
oMliea nc aevWor, y. We win oad gta cup of apg t
latp the lfht ae l kne-s. ,m
Albert Ua third mabew, ia not tTwB Tm fien
wTr a. "Pdgie" here to tten .e f-ner-A
a o B al oblighe m to Patew fasrmanuau, and
work for ev he reeeived In her. at the dexlc'*tonb ao
life ad has 'pen much trouble. agse ball. On that occa
"PWdgle" li employed by his broth, Depew. then in hl~prime
Jam. '. Sage-In the fisah market. He hI-u. Mr.' age foi
has two s onas, Waltar, who is employed oImto of lehs length, bf
at the plant of the General Electric gseally regarded-as the
company at Scbenqetedy, and George, two.*
who is employed on one of the Ice By thle will of Bss
wlo t ofCou er &J Co. Chapin t-aml of Onuldi
a Aert Sase &rt learned of been made considerably ri
the provishoin of the will be was rest. thjamers receiving 621,000
ly phauid to mink that the great mon. of emnann. Samael Cha
sy maher had remembered even him. eMest, is propeletor of
"Me oeftest the wl7' he asked.. Jewuky store in Oneida,
9Iot oS your sweet life. I have al- rethad merchant. Frank


tal of copies printed during
L906, as per above statement,


the first six months of
was-------------.___


,tal, 906,450, divided by 155 (the actual number of
ws the average number of copies printed per issue
en ------------- ......... ------------


tify that the
mnts are cor-
g to the re-
n this office.


GROWTH BY YEARS

1901............... ............... 1,887
1902...... .......................2,441
1903*.................................2,929
1904..............-. ...............3,540
1905................................ .4,850


m. a) 5,848


U I


1906 (


! isfler of O ad a thIe mother of
; our En. El '*. Bage, Jr., a
btother, lso is abat Afttak years
of a, left (banahom six years
and settled l BieIlaer, lad. Te
family in Jollet kmA t kept cdoe
track of hm. It isathoght that he i
now ether out wst or In some other
part of the Hooder tatt. Mrs. Alta
Sage ,Martas is a damghr of Blimr
SaM Jr., aMOves a nnaabon an a
farm with her ha hna. The sages
have never presumed on their rela-
tions to the celebrated fnaneler. They
areesepected and well liked.
Mrs. Helen 8. Holbrook and Mrs.
Fanny E. Crider, nieces of Russe l
OSae, say they as satisfied with the
prIadvlon he.has made for them In his
wl8, although they have no knowledge
of it except what they have read In the
newspapers. They are daughters of
Elisha lSag and live In Park Ridge,
some twenty miles northwest of Chi-
cago. BtasMy Bolbrook, husband of
Mrs. Holbmook, is a clerk, and Mr.
Crialer IS a acoen*n- Both women
have families and have had a hard
strumgge to get along in life.

LAUNDRY UNES.
Colored goods should be Ironed on
the wrong side.
A little borax In the last rinsing
water will make handkmbleth easier
to Iron and look better when done.
Never pin debate maelals on to
the dothas ,ne without placing a piece
of clean paper between the fabric and
the Clothe p.
When coarse lawna or other cottons
fade white a ainsty pnak color can be
given them by asag the petals of an
old ftlael m la the starch water
whm bouik eds
By putting an Once of sal ammonlae
In be last water la which musina or
cottons are rinsed or a similar quas-
tity In tha OO in which they are
StUMMed they will be rendered usia.
When the wafer is too muddy to
whIten the does It an be cleared
very quickly by stirring In a little corn
meal. The meal will go to the bottom
as soon as It s thorouhly wet and
will carry the slid particle, with It.


scribed before me th
25th day of July, 190
PERRY DICKEN,
Niary Pu


V*0,45


5,84


"ljpmppl


DSMOCRATIC NOMINSf
Pbr Mabntr of Ooagres We Coagres
WM. B. LA R of Jefferson.
For Juasties of the pseme Court:
CHAI B. BPAREMImA of Escambia
JAM= B. WUNEWI of Leon.
For Raihad CommAssioner:
NlWTUN A. Blrd10H. of Levy.
R. HUDSON BURR, of Dade.
For State Senator, 2nd District:
JOHN B. BARD.
Por Member HelNe of Representative
OHA. xM. OIrTON.
M. o. BAGGETT.
For Tax Aasessor:
W. W. RIO AR3S.
For Tax Collector:
J. S. RUBl'uein.
For County Treasurer:
J. BD. Wma'JJ4Mf
For Members of School Board:
W. E. ANISRON N.
H. G. DeSELVA.
W. M. AOIlTON.


For Member Board County
loners:
J. B. rROmk-r-a.
JNO. A. MmERITT.
JAB. M. ANDREWS.
H. C. ObPTON
JAB. R.. STEWARD.


Ussutaw .ISMgr.
Many a housekeeper does not eat t
moo unless aNbe has company. T. 1
much cannot be said In favor of re;':i-
lar hours for meals. A loeheou .'rv -
ed for only one or two should I)e J, .
as dainty as the mBot formal din.'-.
A napkn or dolly spread on the I.i-
table i sufficient if one Is in a hu-o'*
If left overs are to be the lunch t b..:
oIld be served In an appetistng aot
saverw manner. Aa4MS of milk and a
piece ef eake, ta standing in thi'
kltcben..Is a foolbb luneboon. Wh',
one has eaten a hearty breakfast -
light ancheon Is ar that la neMcesiwr .
but If a very little breakfast has bemn
partake n of a good, ubstatal meoal
noon0101 tbou be 1atMn


noon shoIl.be ipten


I T7r i A* .. V Wenwes ? tAmw~e u.~m&- IUVonI


i,


I,,'


so=m .. 1 I


E 'y- *-<;.
:*':'"* * \ "


O .-


2" f^.. Jl < :


FOR FIRST SIX MONTHS OF 1906.


al number of complete and perfect copies of The Pensac
ted each issue for the first six months of the year 1906 was



....* ...... ....-....Jan. Feb. Meh. Apr. May* June
* .... .. ......... ...... 5700 5700 6200 5800 5700
.-..... ...... .-....* WOO 6700 6800 .... 5800 6700
.... *...*... .**... ..700 5750 6900 5850 s500 5950
.....*................. 0 6000 6100 5900 5700
...... ... .............5700 .... .... 6950 5900 5725
. ............... ...5800 750 700 960 6250 5750
................ *. ...6.000 500 5700 57 00 6000 .... 5700
....... .........e... ......... 5700 700 6600 5800 6700
..................... 0 6700 570 .... 5600 6700
....................... 700 5900 5700 5900 6600 6w00
.............. ......-....6701500 100 6100 56600 5600
.......... ...... W.....760 ... .... 5900 5700 6(00
....................... 65?50 6700 5700 5850 6300 5800
........*.....* ..........6100 6700 5750 6900 .... 5800
......... .................. 6700 5760 4250 5800 5900
* .... .... .. .. ........ 700 5700 6800 .... 5800 5900
.........................5700 6900 6000 590 5800 6900
.......................700 6126 6200 6 00 5700
005900 580
.. ......... ...... .6.700 5700 5900 5900 6200 56
.......... ....... .6000 5700 6000 5904 .... 5860
......... ......... ...... 5700 5900 6250 5700 850
.. .....................700 5700 6000 .... 58650 5S5
.......................5700 700 5000 5800 5750 60,,
.... ..'..... ........5700 6200 6200 6900 5750
................ .... ..5700 .... .... 5900 5600 .5T )
...................... ..5700 5900 5066 5900 6100 ., *
.......................6000 5900 600 5S00 ....
.............. ......... .... 5950 6200 50
v6....5...... 5600 .. 6950 .... 5600 5t;u
0............ 6100 .5 6900 .... 5800
.....................151000 139325 168760 149600 157350 150525
............. .......... 5807 5805 5879 5980 5828 578S


wayes d to work hard, ever mnce I mont-conduct a sucoeseft
was a and I games mlay oernow the p6a4t and wall pep
and take It may for the rest of my Homer aTnd Tlo are m
days. No, f00 o sa pretty good lit- Jewelry boomr. nTh obM
tie m of doug and Uncle Rusaen Hha Chapin, Mpa. An
waM al i Ter can put It dow. Je Wa1
for thG mat there won't be any tion of Zarl, all rhide in
cOOMWm II aIve to stari them." family is sat"ad h wi
The dece tn Troy of Russell Sag, has never entertabued a
Mr. arah M. Gardner, Ulives in a a contest and wllnot ap
pleasant little cottage at 40 Glen ave. ted should one be made t
Me. She Is the widow of Charles EL.Ir e Ma ecl Inm the C
Gardner, who was a machinist by' have often been entrtat
trade. She i nearly sxtay years old, bOR LIst winter MI S I
has two children and owns the bhoe and Mrs. JAnnie Munrom i
In whteh she tves. eral months i Calierna
S"I don't know what the others will of Mf. ige.
do," she taM, "but I wfl enter no ob. Mr. M ad MM. Auseal n
Ejections to Uncle RuUell's wll. I will among tbe eariy.Setthsa
not say that his relatives did not ex- essaed a large ammfy t
pect to get-more, but I would not start and respected In busben
a emite eSeo though he had not left aoeisy. AR ale wed to di
me anything." and p Wve.
MrS. OGardner has a son, nm n & Al the relatives of Ron
pardner, a lerk in a drug store. Te tlg-n Jolet IlL-and the]
latter sai that the Impremssion m os no dispositonI
to prevail nto New York that an Soe ith "Uncle Rasears" wl
members of the Sage family In Troy Ise, a brother of Rusell
are paups Bly of two mons and sb
"Wbh thi here Mttle famy ha M no mest of whom ave moved
great wealth, be said, t might be 2n AMuustus Sa@m, born
well to mention the fact that we are hrge of his mothers fa
not dependent upon anybody jst yet." was fifteen, and be has
Amog the Intimate friends of BRu- SncceeahlJy ever slmea.
sell Sage n Tn was P. J. Parmenter big. edu we In the pu


Swom to


atid sul


L, -


I





ola
as


































0



i8



b-
lis
6.

ilc.


SY841







V. -. .' -


:.j ~


I


PEOPLE AN, M steei E


vonse a bof oandy or


IIon ,ofour relvett ice
MRe eL te- e, I tShell anl% &W
SFOR r.iOR W m IThe Journalfs Dadly Fashion Feature r ighL h
M.rs. Ir. 1U. Bw paoretor o
iotel Souete,, left W0Venda b o ___ __ I
for the noh to meane 1e Otber al ae
In1ig yeaoeo. M9s. L m a goes first, 72PrEEt Gr0
rwt her smI. a de -K Ia .1a
merger in Bwyu 0.. 4 od ea I ads nHot Bbewus a d Boll ever the
other Ohio towLn. Later, morning at o'clock. ro
snbeger, e w Apend some time ___
in the Adkeansb *1 of
Retuwl*n.Mra. 0m 1 w9 be the 0\,
pest of2. 8. &. fbwensd wte' R lady Kchen Cafe and
I t N. Y. iad o er rep and K Y of m
lives n New York stat, etunli n Phone 999. 104 S Palafox Ha
home by water some tke in October ,doo
r N Nadnoa
MR& P.LWEstR WERTAMVE *Co m nlt phe

The Tueb JItvos lob Pleasur"e


mrs. Har wumera won the first equaled btiif h
wlicfi was a nle rocking chair, and e coodno yby tmou-
Mr. a g4& a 8r. 4 e .g sands, and gmean.
-iu Jamesf thalW*k 13r.0 P* taed to remove
The next meeftta wil be with Mrs i d freclsaaph.a ,
pat Mox h. MCL. .. -ws r-. s." a, l--
Pats ,C t 1owau4 tthewont cau In 3 da,
11r A K \ad seIn tac B asty of outhe =
iT eRir D M sUCCaM a oId $1 00 by ading d eghss or mail.
OF THE CH41D3N'S U. D. C.* NATIONAL. T"OLB.. Fab. a
The attFmUa^ of Ganhern. parents
is called to the meeting to be held at
theTesidenoeof A.B. LA. oreno this. -
afternoon at 6'eclook. for the pooe FOR THE LAUNDRY.
of organic a d children'*s chaer of
the United Daughters of the Oonfed- "' aV sepaamumte Bow For Thing
eracy. 3 h eojin'e Delsesoe Emandeg.
Several 0o the state, 3olaoig Almost every woman has felt the
Teszs, GeoSua d r AlSasbaa, he % s4ac- "n* aeed of a separate bag for collars and
ten and t desird *e*t Fl .ida -M \oepecla It b r her bands a ,re
should not as behind. Tt as the set -to the laundry, as they so often
first step in tat direco that ha are, an must therefore be kept sepa
been taken in this state and has the cute from ate general temr wash, o
approval of tbe state ofoers of the If it needed for this purpose, till a
U D. C., and it iWtoped the movement s l -- or." ,.ntal bag substantial
vill meet wit h Mrty respowe. w u ., .-.", ; ag n.,al
The aw trust at parents enough to be thoroughly eful comes in
will renognie' Portba ,o i traia,- 1In handy for the hand-erde- s and so
Ing their a inu M work so laces that require more delicate han- ti
dear to southern m hnts. bid's oost of either cloth or Hnen fower sprays, which were partly done dlag. the
Send the i dren thWis a'- 1,_o. aumde wflt a circular cape, the edger. n open embroldery. The little sleeres Such a ag may be made out of the ben
Ai children wao awe neal doceand- were plain puffs and were almost ov fancy Tu owel to had any-
.wts of tOme WservediIn U.... cIfviL eedwerebyheepedIntdee ......byteca thestai ,band w2 pesewtobethany
il.tary oreW0al departments at the scallops. In the center of the backr c beu b also -BCaoped anda a hereaaro_ for tobl
southertas are eMagble. and on each tront were embroidered broldered.f Vaw M a M
1rs. 24b0a &WI is the Airectyms ld ja.eR or raised whqte pon
nd it t now evident tS.at< strong a e are n 0p'w'1 Ptty. fte pm A
apter y1 be ontale. iPensacola when- we get back from the' Ton. J. lnmett Wolie and bride who and blue ll wh, but the yBow is p
--$ ro w se sm getting o at the new arrived last night, and w9l be the aqt so suu. l baoogs are ae d x_

ARE P0 lO-- AMD PAy r ageis ad t Att em .we wo. be I ,i ad
TRMi 9,4w;0 .i. -I Fee t. i nDevs.erer at avny f- mw P .Mr-4 ow ,'ft
rMe Wester isIn e reiwtpt r a lion for a 9eato., liccads tM alA *end a Itae of t W
,..,__ mlf_. mks_ ,, .1f,. -NI..AND.St. ,Joe. h -,ah
t6-7, A of Pensacola. VAOUSD WW-r TM Ed a 11 lre - fme i nnk I
...nt..1f 1A1W 1WhIN1 AT TH4 *AWE TIWE 'Wi They wll athted the M t two t theW a m In
ey marr .S 2 t5 ( ,s 2osi N~.T.. w hn day of the coa.etiom of sages In WAlitOa esoU so i
hot It aJoy the 1ea e datd, AInOPt 10 afer w s- -"ades.t

k.,d whl-e i--- .-- WesMt, -%5iOLIWr g r~- .,
of spot h e "We have had a4el4ge al trip so .er 5s the ma11 points of e- s or or c
itW a m ...ke .to t far, and ta......a as muoo of meah city M -n magn at Cey M two betew4atag. Do notbo. Pink sh
would be glad to Save themw ome s p wite a state of Colordo. towels should be soatsked at least an In
d espct M. a a o- t i e vsley farmers wee Dr. . K. at o a. hour in ,lmw ad water, hit of Its
SPsm people are al enroy e wr~ a Y-ved Tuesday aern a d, sa t e h .to ver. It n the .
*ng this delistl1 (hndo eMas ss wGorge ,-,-Trga to is not Ms. A. it. U say part tideftdr, It ble
M-..ult, h ta ~ ,, ,,-, whel, we pmme, --sterday- I think ukage and h n .siter Mrs. 0. U. Ben- l generaity be Souat to. hav faded. It i
.S..... Sto o...s.l.o.a So t- worth th.e ,le DtI4 e Thsis dri, le g OR the "ligt train P* or .1 oo o e alot aMy d- the
e ?I*I t of the bat~ ma ton oD f W a ou StW,0 complete* aur- for home. pucrt sigon -bi wwead .itboUt lover
cantik% ses he e e merounded by a 1ns.an Mrs. Hahn tog artur l i maune. Bor very del. rP
-"----'mO-- aBd I are enjyg the best of health." hi t D l us l -k g ,laure hegoar huld beused. cou
o- ... re.e...-apm ^_-4-- Blue Ribbon Lemon and Vanilla, (h --MI s Whlmn In Ctelcin- T
l. chie r tu to ae po'ebaog agent Mr. Mr. Jess T. a d <- flaa perfect" th ea-. '. t-e
of the Victor liae1 Co. #poe a yat Stutaine et'7y h -
We expect Mr. ad Mrs. iA t .F d la bor Amateur Photobrahers. -- cen
D-uyer this wek. Wb a wre alwaysde M- Ktammi-u-.ik, of P s--.- ._ _. .............. TW~arom, w dre


----be-l-j ..,bo ee /veox prints cannot be made in an
lighted to ee O pa ola fr_ oa_. p ....w.ere .Mo- y"TWO, t. he t f the floor and of
ar will do r tow show t Katarine Ca, tuei Tur l. o way. Send your work to Knauff t to remove the dust.
a go8d tanoe wQiat"h mn. We are Aume Pv g, IsaoA nDownes, Min. mam nd get the best tht can be t te t e widths apart and wash abo
ao glad to o tat Mtss Jessie aste Man taM oueas; made, Romana and Palatox s. ne a a time. A goodwashi ma. wo
M W as w&P gaa eG erson. Gy i urs J et. eryMedicine-advertsed In. tis. chi. t"d wrtfor are gust Wsif.n up
rho.k to us. W. yo th w w or q Wte a feRWS, ie JHiga. PIS-AoWtrigHe t, perU be bund at The OryOtal 1. Besat a bdflertl of soft water rea
ed with Mr. 0O a a.of year TM-a-. --* a- &, d enough goo waibnm g power a und
end are indeed gzaeved to janm of his 4 itto o 4 aaat$ong ends. W Put one
death. It to great ~ enousme or Mr. and Mrs. T. C, Taton lewe. to A l*^w width of t e carpet n .the washing
his bIafntes asmodlates as we w& day noon aoan extended tatp through Mothers should never take their t- maiaN wp0r the -g over it and T
Other for It wMll be hard to fad any the east and Canada. fants to bed with them. Notg could wash until the wam s d ty. Pass tb pat
one that knows the routine at the be more perilous thai for A anlhy carpet tough the wudger, wash In Va
trefit office as Mr. CmeO dd. Mlss A2"e Iaba of Mobtle, ar yomg woman to sieep side bry sMe (* second sas Do n d a the same we
I don't su we will know old rvd yesterday t meMt her macle with a little helpless babe. In Aaht ,way as a to& thm rhase through up
this periln is scognAed and If an A- tw desar wata. feh strip of ear. Ha
trian mother sleeps wth her baby she to be teted the same w,
is sent to prison for it. The law prm~ grm acanpt be prase ts uta
liafng tabes and their moftem of am e te
RICHARD HUONUT'oS .ptot toher was enaeWa In Am "- na
tria at the ead of a year o In no les -- Un
than 0 00 moOMthe their sleep Rm ave e et Att *. vTe
**---* ---I- inga on their bables kMDed Saioa. B2h T e aaa o S miaii Wetance I S h
T IL T T law shoiM beN eDietE A ACmT x easo r u r Mlawrter. wo
Every physician, every comr, knows 2m am w waste In other to
of many tragedies of this kind. The 'm* niiA buht the number it small aI
tragedes as a rule, amnnot made pu*aed wh that ot wIes and a
be, out of pity ford the f~ieh of the aIuS. w "ho keep hlrdWPtg fM a
moster. perhaps it woal beo t ft tp tSo anxsons seat by thir love of Ae
Are deMli fully agreeable this Sum- ywere made public. Then- te a pensive clo g The good old days b
nxer weather. Every lady should-have o mothers and baies W. norat mu]o*be pat awayW
them on ter dresser. Weabosell Sto o ul be more S SSt m S e
Mulhen's 4711 Cologne and Sa Neu-* Ma sat In.eoM and they an the C
bizant's Extracts, Cou Ay's ,wts w-r.rt 6.nd of woman wMho aigriht. WO


at publkat&n boasts several hun-
d and reresents many thousands
dollars' worth of cash advertising.
Oin Griswold, as shown by the
ve picture, is a sweet, womanly
man. She is broad minded, soft
ken, generous to a degree and ever
dy to aid ber sisters in any laudable
Iertaktln.-Boston Traveler.
A ?Vwss WomaO's Wo l.
hM Tomna with the queerest oene-
Woe in New England is Mrs. Alma
aey Williams, who lives in a little
, her beaten, patched cottage far
among the lonesome hills of New
mpbtre. Mrs. Williams, who is
rt-slx. holds the uosb-lnged rep-
LtiO of being tho otly protessIoal
nalo woodecftr in the New Eng-
d woods I not the whole of the
ted States. Hoe are some of her
y remarkable rats and aMlitl.es:
Sesan cut, split sad set up a eord of
od each day as as he oses
wok. e can eu wn and tHim
ree lae as a bai el -- er tea-
r e negborboo Shbe Is
a bt ox 4~&ter Merdlth, where
- Sbe can dtve any horse.
a et from dit to ten cords of
od for her own and her mother's
Sek winter, and Omen she goes Into
woods and w wherever she
i f4 employment as an expert
o4womm In the summer time she
.-h hr wn ardi hesself. driving


6188 KATEE. RISWOLO.


1 -mseema ad WridW i epa-
Swhich Miss Kate E. Griswold of
toan, editor d pilbsher of Prot-
SAdv ftlsg as w.m for herself
ugh comgu ma persistence and
Swork ought to be an incentive to
Syoeng buiess women to forge
ad mad reach the desired goal. Mir
iwold has had little help, and her
lqmuent of a env able position In
buminea world has been won solely
nug her own efforts.
rt Bartford, Con., was the place
ber birth some thirty-five years ago.
D was 'luated In the local *chools
Sni fhed at Miss Halnes' school in
rtfordL Love of animals and out of
r Ilfe h re been elements of her
cess. The first led her to raise
itry when still in her teens, while
other has brought to her the health
Ich has made her success possible.
rough her Interest in poultry she
mine attached to the Poultry World








s s










MIB KATIL. GRBWOV .
Hartford at the age of sixteen and
a was in full charge of the adver-
Ig end. Later it was the journal of
National Trotting association that
efted by her efforts, and so untir-
ly did she pply herself to business
Lt heb tItth failed and she was
Iged to est for a few years.
[lse Grbwold re-entered the busi-
a w& rd et as editor ad mana-
of the Hartford City Mission Rec-
lad for five years kept that publi-
SaO a paying basis. Meanwhile
various ma -petit-has in designing
stlsterts taped her to try her
k W -t *e esuWtitat @be won sev-
brmoh these endeavors she became
wnu to the C. F. David Advertising
qy of Bpstes, which opened nego-
ions With' her which resulted in
* Granrol becoming an editor
a tofe et of Profitable Advertla-
1Its pub;cs*" ,
wo yeats later thil Journal was de-
red a failure and unloaded upon the
uden of Its present owner. It was
185, when Miss Gritswold became
publisher, and it had few subscrib-
and fewer assets. With undenla-
courage she set to work to build
i, with what success is proved by
fact that it is now the leading ad-
tiang journal of the world, with
resentatives in dozens of foreign
he pUblication of November, 1805
first under Miss Griswold's owner-
p, oatlesd thirty-two pages; a re.


Fresh Shipment of Whitman's Candles Just In. I
PROMPT ATTENTION GIVEN TO TELEPHONE ORDERS
Medleoine Delivered to Al Parts of the City

THE CRYSTAL PHARMACY


25 S. PALAFOX ST.


FISACOLAa FLAa


J. F. DAVIS, JEWELER
Now in i
New Brent Building 23 8. Pelafx St.

Seed have no terrors for you
W A if you send your washing to
nOME I=M E. W. LAWRENCE. Prop. Me eedw Ladry AM W. AMMISL



STHIS HOTr WEATHER TETs

THE WORTH OF YOUR




REFRIGERATOR.

If Youers I ft ODORLSS,"
YOu'll Net Fret About the
Prio of Ie le



MARSTON & QUIMA,
1OM LS Paa SL Phone 148, Peseacol, Fla.
q;W046 1 40i-0 *006 -44 4000 0000 0* --- 0e 0'r


tbat'isbdotngbin akiahm ustotmaoks
him a lifter about his a=k. Now let
me tell you that a baby if going to get
every drop of milk In a bottle anyway,
because he's hungry and wants it, and
you won't starve him tI you use a hard
suction nipple. It's much better for
him to work while be feeds, on the the-
ory that man shall earn his bread by
the sweat of his brow, and if the beads
of perspiratvin stand out on hs little
brow,and if be grunts md wigmles, all
the better. Tao chances to onm e is
enjoying Vb milk. twice as mueb as it
the nipple was one of those easy things
that fairly poured 1te ft down his
throat, and Mes tiow will be strong-
er.'"-New York Press
RomeID to- --
The peat fault to be found with
hnme Am kisfrmn that In man


cases the work has an amateurish ap-
pearance when finished. There are a
few tricks of the trade, however,
which are invaluable In making up
and altering clothes sad aeoomet for
all the differeae between a neat and
trim garment and oe whoah is ill fit-
ting and l1 finihed. Alwas shrink a
new braid before sewing to a skirt.
In shortening a skirt pattern, too, al-
ways fold a pt across The middle of
the pattern. Never shorten from the
top or bottom of the skirt or the shape
will be spoiled. A rolig pia, with a
cloth aond t. makes a sood pressing
board.


cress" ams.
A rug sometimes becomes badly
creased. To remedy this turn It upside
down and wet the remase wfth a mobs-
tened broom unal t ruw Is quite wet.
Stretch the Mg tight and lot t remain
overnight after tackg i with tined
tacs, which do not rust
Paint staja o a a ier may be
scoured off soaking them for a dsrt
time in benWhme or turpete and t"en
rubbing them wtth emery paper or a
Uttle pulverise pm Oee sem appned


GULF CITY COFFEE CO,
H. P. CHAPMAN, Manale.
Eastern isRon and SMppm $

Fine Coffees
OUR COFFEE@ ARE SOLD BY ALL
GROCERS. GIVE THEM A TRIAL.


BOSSO'S
Ice Cream Factory


can furnish you
any quanty.
muarantoed


cream tea


PHONE Ians
SAN 0000, PMWp


We Need the Roo00


18 Square flans,

Take your choice for $1.0D
month, 1$3.00 down.
Call eariy for bet selection
right for practicig.


p.


The letter Ed Bu


DELATOUR'S


GINGER ALE


$la5 per dam


I


'ffi


I


ISPONSA MIM MAM A


Tet Soaps
laybTM M
in daintily decorated
boxes for your travel-
ing grip or your home.
These splendid soaps
are absolutely pure
and perfumed delight-
fully. We have them
in a variety of scents
to suit the most fastid
ious tastes. 'They are
so refreshing to the
skin-10, 15, 35, 50,
75 and $1.00 cake.


Brosh Values

6d a ka Thit II WS.
Why keep breakingin
new tooth brushes
when you can get one.
of our


kind for the same
money. These brushes
wear way down to the
bone. Get one to-day,
25c. Everyone guran-
teed to-hold bristles
or money refunded


-'


I .


' r*b


I


W-


- 0







?~' \~A~C -. *~-' **~*J~


w-


~.'.*.r';.~~.-'-'.v.
I .
n~a.m~immA ~ ~&n~~W ~ AIlI~~4q I S~ .
TW5rinW~ ~ tY,~vw


* ., ... .-
'-4. .


'. .


4. _,


9


WE HAVE -SO CM O Et

INVESTMENTS FOR MEN

WITH SOME MONEY

That is not paSyin them at least ten per cent. tPu-
sacola real estate is gilt edged and growing be~er
every day. Are you an owner of some of it? It you
will permit us to suggest it, would say that you
cannot afford to waitlonger before buying sofe va-
cant or improved property if you would take -ad-
vantage of the present rise. The increase in value
will be "easy money" and no small amount. Let us
show you some business property, or residential
property on East and North Hilis.


-Pensacola Investment Company,
L N. Wn, n1VT. WVty Mugeag


W. ILUWIU, 1rss
X. L SIUWIIIVo4rhem OL Se.NuNW.


L L3 mut., ISenrtry.
ENWLEI am rsmsm.


RseDbal ,sLN4 LeSomp Gel bv mm i -of.
215 South Paiafbx Stroot, Psesamole, Florilda.


I


*n


NS


$s7850
or a cloee4n corer near Peal
= street 12j0x150. T semin
central prperty will prove a
aoney Maker. evtigate it.
$5500
One of te most attractive
onies in fat End. The house
Stwo story -rooms all modern
omvenlences, you should see o
o appreciate t worth.
$8000
zeCellent proposition in busi
ess site on Mt Wright St.
ear depot, and adjsoln
usines property.

LIST YOUR PROPER"R
iTH US FOR QUICK ANI
MOMWT RETURNS.


I


S


Kupriaa's Park, oatatlnst a splendid six room d welling
baseball and shooting grounds, dancing pvillion and race
tracks, with over 100 areas of land ... .. .......... 000
Large brick buildingR e' oath Palatox street, rSmanNX IN-
vB9TM T.. 0* *0 .. m.00 .. .. ... ..0 .. ..... ... .41
Large two-story dwelling oa the northwest corner at Intendos.
cia and Reus Sts. lot 86 ft by 140 ft.. .. ... ... ....4=00
Valuable business lot on *ala ox St., Just south of Masole
Temple, opposite new ount building, 30 ft. by 182 ft.. ..17000
Twocottages, splendid renters, renting for 0144 per year, at
No. 22S West Zarrsaos......... ... ... -.. ... ......1250
That beautiful property situated oa Santa Rosa Sound, known
as the Clausen Place, lot 1 feet front, fronting both Pen.
sacola Bay and Santa Rosa Sound, cootplinr thrue edwellins
with a lot of household goods..... ........ ... ... ....... ....000
Two story brick-building on Sarragossa t8, near Palafox St ..10,500
Two story dweUlla at No. 1005 North Davis St. .. .. ....1800


HOOTON & WATSON,
Leadi M i *eatle, MnW. sa u w Imurce Aoncf.


THE s-Y -
I FLOSSnMY t m. .
rLuun Cit -r
--- .1o20- ock 279, New City Tract :1

AT 112 SOUTH PALAF.OX i sea nc hss d
lots In any part of the City to suit
our custodners. We will be glad to
have them call on us.
You can get in' on the u
ground floor and make some
good money in Real Estate .
if you take my advice and MicDav4Iyer C0oUpay,
buy New City Property.
SValues are surely, going up Agnts New York
and if you do not buy some Li Insurance Compan
one else will make the profit S Government Stret.
that you ought to make. Ph*"e T73 Pensacoa. Pa.
List your property with me
for sale."n
Rents collected. InV St RlD tSm
Money loaned on Real .
Estate at the market rates. Two bonuses on N. "B" St., between e
Ja oskatm and lGadsdea. ts rentinf fr


Ne. 37 8. PALAFOX ST.


H $3P WANTD W NtW $8.00 a month and in the best eadl-
S-> i. v. -- tion; also sood renters ..$.. OP.00. e -I
I IbD-echer with tirt grad. WAMNTI-By young married manT' h E B O Kree houses and lame lois on the L "
tiScate to open schol lt o Position as bookkeeper or gseeral bo" ui%
su S*r. Address W. Z. A awycock L-osw. nl w n.e...e"vau LESLIE E. B R | -----ftes and, e

.. .At dn .. care Journal. ldau w*, -a month.. .... .. .. o.*-.9.|, oaj, @ t.4 _.l i
n ,--.*WTCar ASUs, H omN.es b-c. o
A -Driver for laundry waon 4 Amrwr Plans p Journal. 15aglw
p0ly at once to Star Laundry. It tons of ndern homes drawn to suit A nice 7-room two story resideae VW- cooki--
rs S t Al um d Tobuy s a-od me- the most fastidious. Store fronts and on North Hill lot 48% it. by 15 .ll by ai. splendid house five wi, ( ) o; w tcb

... -4mtk(WAPM, d -Msdi e aeW colCdI wc soke saa pl d dr t t deep. u o le rom a -ll oh p. o" aSouth No. rllo .
g amoler mtd e. o.. barber Gaf to ield &ra uooewe bulid &gs0 drawn subject o37 .-reep.; Sa No. c, a7.0r; a
Mrs. A. N. McClure, COreWn(3 Co. aug proval. Chas. W. How&, ]da. dF la. lent neighborhood. Wl 41loan$30O.0 0 msnds.o ha0 as o10er iompovn thisale "ol a once


ole0 lo7 l t din v a pi ood home, riht J WNTR & sArtn aellsmts Lot 100 by 110; o on its, N dwood (w) $0;
S.t a to M. J. lot for another house. .r. e an- o Word t
Ir Mo lashler; must be ezpe WAt tlroom bouew, modm- Rr e a d oment this is a bargain. amd Hill 1ve the blowing





e State WAI W hite lady sineot ad Oradoulle Prepsr ni to pa Jor r.ht amousekeep l w writ Who e, 1 Brest aaedAet
Ae c SNlncmtentA toy o cql located. or w IGANrom 4 to 11 TABe-d .A. WILSON & CO., r a e1 maces for
cOc ,An.* Siser, P. 0. Box 194 City dadFla. rd f Carriagest teet all _tra OR t ood ot-
1agt 1w. poorptmsat 8ei a nNctoledouble temd. ueht- or day PalD OOMs-eAgt s. t. at o Add
ffACTIe MAN o NTD to d w to any Point. Best service; rates re- Cor to verment and DeLunry Bldg. oom 7. P D No 1 D x 4' -
manaoi8 pe exoa batubWgNTleP- m dle I. 6a m oe 4No . 4, S 0; Apply No.
I MoeiSsystem I ofo-ba rter2. Rom to do Menr aw womu rt ..s.an -i dso Mow6 ,/ .to e. $42i.5; wy Oe No. 6o.o, .
aat WtmtPdl'afoufrten leading 0.npWOWS"-p bortt, 46;t ordetooeW=oo (w)$80;
ise wants men toad arbner Par rs., J o A. llisley, 23 w. all Inefor saw mills and turpen t
t one. AS.lyprs2p N. Springs 8a d bdools, tGs te r2.ea lw tne stlls especially. Gemev, A, T- rn sed looms always new, 10 Pent or t po
SWA.esirn.-- e-a e.s o P-- ow ars AIn---htte lady waiting posi- and Graceville, F Prepared to put r light b keeping r e B




the new local, 1159 U. B. of C. and All brake uaraed. T. B. Ta you wlls fd a lot of wy12 Inhes wh da mppy Jcon St. 1 y.





i J. of A. mets second and fourth Wed. sea Prep, Phs 9718rasela' you can use old newspapers. You7 27,ulylm *X4
Mly1 st. Write for. Tey arP e all whor address 424 and fromall mode improvements and 3 a100 to 1600 1at E Intendenc r 3 mle from ocean; me

S.leansA. ce. lt .n East HI near Public quare R reasonable Cranall at M Nrnteed. provements; healthy locality. Address
s'rIV boAN at Th er- THE PATRONAGE paired taven o ore e m roms inery Str1 'No. 1 F. Benedeld, Aycockn o la. 1931m


pabtw of large mail order house. drive Z. D. Adair, eedandUvery for the manufacture of galvani sed tendencia St. ul PO ALB OR RNT-Two fighters;
lary$1 erweek, ow that "expenses paid. Stable Ponce deLeon, Fla. 2lla iron cornice. e syit r. a. MNY TO LOAN AT LOWEST O p at t a b one a
P Woue.nt Position with advance- .ar a circular mouldings, a8 ty R m nnow a, ,,nshe ,S,. suiabe ne othe rt t -

meat. Honesty more essential a H. ALNT-Real Estate or Sh preet IP CANDL -McKlae ert A O alwork ofcn fr lgit s osee eThed re nlo per rae s 'reeo.abled. BAs



S tlence. ationalo.720Iron Worker; cornice work and sky st- Co wholesale renttaliOrYourbus all kinds n short notice. satiEAL EAT a o for sale cheap, ft. lg,
WANI renters to know that s a spewas ty; rmovoing, ga tterngIf youwill look anroun theo t-as IN THIS CITY BOUGHT AND SOL 5 ft beams. Telephone or write J. A.
the and repairal1159 15 South Palae. oue o. kind In aity. Wr price to all. A.. OF .E MAXENT TRACT y i Chaan I Co.. Milton -la. -5mar
S. of A. m eetssecond and fourth Wed.- P p0; lsenc e lJue1 CARyouRIcan useolpared newspapers. ET OF STREET NOW FOR SAB.-ved pr
es old arory building, room at buyt toem I any q Ut sh SE. ed property all parts of the city.
S that the career still oen. W sell a lotof old paper oe. They are put p Caiag MON ONn bun on rdls,eal furnished front rooms; souA. Wilon Co, Ra state ats,
W. X. l u mberry, Business Agent. at ic a bundle. Apply at this of- convenient to carry and sold at five For a beautifulr6.rom eeeCottagerwitha furnsed frilontofoms;soup
Se.Teywel whole clean and cents per bundle all odeimprovements and 3 a7 personal property on short n otice. Room 73 miles from boceanU Phone
t na stret, near Palatox dec on East Hill, nearPublic Square Rates reasonable. Call at M No roveents; healard, 28 loutca 17y. Ad



at at : b p. m., Wdaeday Agt The ou p them to w; tin town rl J.H. us Irun, i l er, 16 South P lato St. Phone 1144.N o
RAI 4110.6 wA-,I'-.rS, a 'em alredan.d m -Palaft street.Orde. rs taken for
paiethin to ter- anted foats built to order; horse tl ingcmp Sto. sar POR SACLE-Two return Tubular Bolles




t coo o c.se and AlcanTO 8toeew. .7 toait wna ,5,e r Real iytSoa Ageny I nt LEND YOUR MONEY t eht ers ready for imedlatee de.
W Ri. ORN8, tha 8. Mellea specialty. u.yG.Welsh ar taPrices resoable. is MONEY TO LOAN AT LOWEST cent Iwspes a ave any tat lvery Apply tio y Gousale Co
The Somlal has nice, clean old Pa. riNglCo.r e7feb or gecap2 t. lo-




Prsfrs&Weheap. O fiden t D C. WANTB-ATln, Coppwners of pSheeltry to C aDLa -Mclnuert. MA ETT OF TRENT ant interest on. see me about it pit y aAly
S Iron Worker; cornicthat w e agents for the k el. SPECIALTY.g will be absolutely sase on real estate N EAL ESTATE and aloe
__ _YO_ __. MANU ebr a specialty; roofing, guttering chandlersBB AND grors Ny URE-s TI CT SO security. Leslie EO- Brooks, f.her bTlechn3 Ap
and to the repairngla Type gapeSouth P an to kill ea ki and .te. renovatekiricestoall. ALNe OF TI4E MXENT TRACT n C Co.. Milton, i mar




Bae or p 1 Also their woderncl egg prder. Second hand furniture bought ad MONY TO LOAN-Everybody bor REGULAR ACK N-r Chip.
WA Brent Building. 8. Mellen. o. P phone 3 4. sold. RRUpholst prepare and repainted. WET OF "C" STREET NOW FORo ey ftom Ja A Hal coecton with mal










1_epr. 114 E. Belmont St, eity, phone 771 Co., 14% E. Government 8L When In launch for poLntsla 0 St. Andrews bay.-
A hat lol Davis built to C. T. HoDavie shoe-. eed ll on us. tra teams for travel ae Good
WA al ncarperter in Pasea speTAI altyORING G. Welsh Carral 40 MONEY LOANED on real. estate o n o Haddret a s IChplt at.
S. Panamas, 0c. traws deros wanted. clothngIf out of towne 2 ting south on Brainaprona property on short notice. oom 7. S ry b l. Po
,0 wS, t Derbys, nedac o shI them to us; INN-On bay town ring us MIL X lort teN SHO -ach Lo Terms easy. Jw B4. 2tC, pr
16M e melylt up* ly cool. 334, or bring bathem to us lliet and Proprietor. rnio several NMIfox St. Phone 1144.or mone pine timber. Trpentine places a





Satcorer of Chaste and AlcaOnz 1 ture repairing of all kinds, rpot Fisher Real aeand in on a kds of personal propty. s to rer loiexcel-
F.. Mellen & Co. 2july; lai. furniture packed for shippinEstate ers 50"14 rey for imm tee e
Phone Next to Tan*a Landing. COLLECTION OF RENTS A per cent. If you have any that you livery. Apply to M. F. Gonsales & Co.
t sident D.C. W car D-All owners of poultry t- prst-clas condifon., want Inraterest on see me bo large t tract of stmae. Trner ul
S... know that we arm agen bts for the eel SPECIALTY. will oans. The absolutely safe on real estatetate Agets Box 115.
S_ ,JiTer-As roabr. AddressO ldMln e' rect_ security. Leslie E. Brooks, isth PaDeFunR k Springl han. 20 uly





OU REw AtaNlaI b e na PedaCeoln la t yy LOOT-Blver eroi with Nttls easy terms. Apply to PoultAp FO pltALB-MtettoS conAaning 1
nd er form of teno- Guaranteed to cre rpe, holera Maresemae to order; old o Ph.on. PalaTHE NAL Phon CARRIER 10 46
Sp b0lthePeo ola Type meals; tree bath land saple arod mt ese retnovate 10th ti e. cks fugl 3shed. 5 SOUTH -PA AFOX 8T CENTS A WEEKn Marianie M od au Aprdee
Sz.ebeage, or. 'phone pS139 Also their wonderful elg producer. 1.Second hand furniture bought an rosMON EY fTO m _LOAHl e mANakinegoyu-- con eti ons it ma
B Brent Building. S. Mellen & ao. Phone No. Z34. sold. UPholster1f and repairing A _r MONY .Toney LOA-Ee rybody Hr- Gley, Hak., cuNetlom Cih-
pIw --._ _~TC 8 hat clea1n8apr. 114 Z. Belmont St., elty, Vhose TTL A- Co., 24 B. Goverment St. wn in launch for points Ou St. AnDreWs bay.
.ats mae new. tlea- ,Davis Mfg. Co., C. T. Davis, W ETATE need call on us. Extra terns for travelimen. Good
,, i and blocking. SatisfactionTAILORINGL, -lo .e O mforte
Panaias, cs traSNOT, TGeuts,_clothing cleaned. p "0e facingg south on Brainard. renal p prty on short notice. or address J. C. Sinclair, Chipley, Vla.
l- M"c Dserbys, 26c. VictorL D) 3lL, INN--On bay ront. Opens rerelred cm a ogrt ou se.a no. 1 ll 'north .Ly. Termse.. I. S. Gra & o 2 W.
we E. Intendencia street. All June L Large, airy and delightful..West Government sal -enlage a Two-story dwo lloing containing ry, x a Phone 1 T p e7 2a ,
' "i u ,, d--24JulYlM* ly cool. Good fishing, bathnag and Id4, large, air rooms, with pantry, cha
.bt..R. r class _tbl. O lec . closet and bath room; also several UNLIMI ED amountor of to o pine tmber. Tuntse places Id
All kbi o~ lectrisaltrncgcarlinec15 t abues rietsc out houses. All under fence and in on lkids of.personal o.y.sW mll In opi Aso ece
-- all ids cc I*iecraties.'15bm'" te --r' d first-class *ondit on. Will sell entire spectA rates to business men on lage lent tracts of stumpage. Turner
," kin&r-telectrical; Regular boarders ad tm9s t-GOT. $tforr c de- loans. T"e New York Loan Co. Aymard Real Edtae Ageuts, Box 15,
.VOW- oeun&: Terms reasonble. AddressOlroperty-,for 000.,if purchose Tho Now-uYorki11IassuC
... .r r i BROWN R0UJ5-Defuniak SprIngs 3. Lost on either I" ende-ck


40 0 : m pe say a. AWOwN
l Wp. O ria Oa ftMNob 1HOProp.
The c to tew that AOTI AD BOARDING HOUSE
eaM be bought at -Before laying your carpet or mat.
' "I a s So al es to put undermath aad protect it. Only Send it
VANiU.-1A. 3.* Btga wt &Te Cents a %Odle at this office. to SO rent,
WAX=4& V UGM aatr to sell, rent,
r ofYit5 aa4 haug, He gum HOTa SOUTrmHN--open al nthe
*t aW SU ies Ps ftmoa Myear. Americas and 3uropeas plan. WOrk.
I E1 n OVATtt>- New special smmwmrute6. First-class in
i~tdesirte O *Tevery respect. Pleasant and Wav-.;


RITE YOUR WANT AD HERE.
to The Journal office day or night. When you- need help, have anything
exchange, or wish to purchase anything, tpr a want ad. They do the


Editor and PU n. of The West
Florida ugapl, Mariamna, Fla.. Box
224. ISJuly
POR SALE-PNew 8 room bouse be-
tween 9th and 10th ave., on 16th St.
A bargain if'sold at once. Apply to
address givenI 24July
FOR SALB-ta I.stock merchan-
dise, Ice eox, sl es, show cases
etc.. on Millyew bard ros"d at city
limit Can imftn to ,.met l..4AiM..


P. 0. BOX "L"


$12000.00


91 feet front by 500 feet
deep. 2 story house with 14
rooms, with water conqec-
tions. Suitable for large
family or hotel. Known as
the Anson residence, at Big
Bayou.
Apply to

irs Aibe A on,
Car IL L Clar



FOR SALE


The building comer of
Garden and Baylen Sts., re-
cently occupied by St. An-
thony's Hospital. Bids so-
licited for its purchase sub-
ject to prompt removal of
building from present site.


John E Stfl n,
Chairman Board of Governors,
Osceola Club
eUr ale.

FOIR SAt-$-.00 cast net, only used
one day; lan-perfect condition. Will
sell for four dollars. Phone 250.
14aug.
FOR SA -6,00 re mill timber
Also Turpentine LoatSon. Write
for schedule. Owner, care Pensacols
Journal. 10aug2w

FroR RNT
FOR RNT-P-Ie rooms furnished or
unfurnished; large porch facing
south. City water. Apply 601 West
Chase or phone 323. 12aug
FOR RENT-Two new modern 5-rooni
houees on North Spring street, at
$20.00 each. Fisher Real Estate
Agency. auglI
FOR RfT-Two fine stores, on E
Government, opposite opera house
Formerly occupied by The Journal.
Lee Daniel. 10aug
FOR R NT-Two nicely furnished
rooms, good exposure; privilege of
l'ght housekeeping. Apply 323 West
Chase street. 9augIlw
FOR RNT-One story cottage, 22 E.
Garden St8 Apply to Walker Ingra-
ham, at 8tar Laundry. 2aus


FOR RENT-Large 11 room house-,
240 Z. Intendencla. Apply to Fisher
Real Estate Agency. laui
FOR RENT-Nice 7 room house, 311
Ea st Roman St., $13.00 per month.
J. A. Wilson & Co., Real Estate anl
Rental Agents, 22% W. Government
St., Salisbury building. 24Juily
FOR RENT-6ome awee *tores Ao R


p
I.



a




I


.r..IN


*~(


U.?


r


=M=Nm


MNIL k -


I


... *


A


1.


I


I


ZONE 54






.I -. '


~-F~ ~ "' ~ Li
- :.- F


ThoUSa


iii


. .. 7 (.. - .i - -' .. .


.1-


mSSL~I.~SS~ 40S~. ~ ~ .AUK&T iS, is~


A- i F .


W7 VI~


d .


-a. ~ '~ ~- ~x ~" -. air.


VOW


R. L
REAL.



ESTATE.
$6500.00-Will buy a piece of bualneis
property paingJ 8 per Oet
on the investment.
s6500.00-Sixt houses and fve large
lots In good locatIon, rent-
ing for $720 per annum.
11500.00-Three lots, on which Is lo-
cated two houaea, reUting
for $168 per year, near
Railroad ahops.
We have mome very desirable lots
on North Hill, most popular residence
portion of the city, that we can dils
po.e of at fair prices.

Escambia Realty Co.. Inc.,
REAL ESTATE MAD INSURANCE
24 AQENT S IS
204% South Palafox Street


The Jos Cssified Cotlumnn

are an Encyclopedia for thousands

of readers each day. Usethemlib-

erally and let your wants be known.


f,


Professional Directory


T. 0. YATES, M. D,
OPTICIAN.
am Mf-- HMUrnw-w-


WK De HOWE.
ATTORNEY AD CUK SATLW
141/2 EAST GOV RMara ST.


MN O#MMNCE
An Ordlnos to Psovide for the
cie~rcdom ci a Bysbem of aI Sr,
Water Drains, oud Smitary Sewver
frthe CRUY ot'Pmaso1oa.
Ok It Ordabbed by the 36wor and
Cosmcil of theCity otFtaeois:
Sefluori 1.Thata system CC storm
,Ater drains and sau~tary severs for
Ik city oC Pasooda shal be con-
:structed aCOcdzW to Plans thmbor
PreIared by *. daalkley 51oton, am
gbiee rcoT r in"' 1by the Board of
Bond Trustees, of the Cty of Pemnes
cola. and v aoemwd. by 00 Oounhcfl
s.ubject to sah danmget asma b
reommemded by the Bo.n at oci
Trustees and a.,oired by the Ctauncd
acd asfotddI the contract for
4w cinbwmtdea of said'system Of
diulus and sewers entelied Into on the
7hday of Ady A. D., 1IM, by and
14twaft IL0. stcwle ouWa~t.W%, Uwe
the sW Dim oat Bnd Trusteekact,
*.ig b~r =A anbeaaaM of -Cthe COtY ot
pmescola, wbhoh saw contact Is
hereby approved and ratffed, and the
Myris horshy anthotiued and 0l
retdto join In the execu~o therva-
'otf or aud on behalf of thi City of
PMMcaacL& Thft the metval axastruc-
l~uot "Msaystem cl 4m~as andi
brewers shall .he mo n .2 Monthe
first day of September, 190M, or as
wianthereafter as the Ebd at Bond
Trustees, wfth -tas WFWoreat ithme
Council may detwzrne.
taoct of T. Chaikey Hatton, as a-~
qlIlLing anid Rwuvpef engie~neer, 'With
ttne City of Pennuacols dated A*1 t M
1W0, eand su~bnittjW by the Board of
-Iond Trustees bra&Uroval of t"i
COMO ~ lJuly Md 192M, be said th
Game is hereby approumi, &a the
NOW &W the Dowd T atd of ud kws
tm sof Q ClKY ce Penewola, mi
b ereby adtwrindlsn.d dhircted to exe
jCate tIje same tor and on belet oa
aid City.
S~etlon 3. That the mid T. Chalk-
leY HatbOU, .vg*18 P. SA bi asismlt-
anka s r(YIited In thme xinaing
c~f-acs, hailbve damigs ci the
EmOfltruetkm of si yotmof dan
and sewers, but te Board at Public
Work, '%hal1 unw such Instruit
is mnay be given hrcm iume to timne
by ordln~ance or 7gok~gt1Cg th
('oUneil aiupeirise toe I alcon.
Brur:o(M.Of al ax d S.
Stackin 4. To OW dand for 0
mirrpxxieof de&fte &g ?I expenses
C~lftla..ti'4 wlth the cocotnructon of the
s -st~alj of draftw and sewers. herein
Ih!-vtd*-d the TBoard a oflrnd 7Trustees
tvs hereby' onthorlzed to expend out at
the Prced of the recent
.Ss6tle of four and ooe-alf (4%)
T'l~ cftt btmftl Issued for the
I w9~ose of OongmstAiing a system 01,
W4'1'e&9 and drals"P not Movre ti
th-, aggregate than 'Pw0o alnrd dand
T1.riry IlUSaUMI D*la (VZ6OON.OO).
&,Mkx& 65. qThat tis or~ftonce
44-1L~ie effect Imme~etey uW=
U., kdoptkm
P"sied JW 4n2th. 1906.
Ajpprov'al Juy 20th, 1906. -
01MB. H. BUSS
Atte~t*Mayor.


AUSLEY 6 COMPANY,
(INCORPORATED)


lANIS .6 *BROERS


.II WES INtNi nPWA, COLA. ILL

Private Wires, N. Y., N. 0., and Chicago.

COON, STOCKS, GRAIN, PROVISIMONSad so


Imght md Sadd nMaregh or -fulvuus


hformc: FirstNOWlml d Pnpk IML


Phone 11 73


THE FEAR OF APPROACHING
AGE

Bears heavily on many. There is really
no occasion to fear it, provided you have
put aside in youth and the prime of life a
nice bank account.
Look 'round about you and see how many
are reduced to wantand penury in their old
age because of their improvidence in youth.
Youth is the time for saving dollars so they
may work for you when you are unable to
work for any more of them. It's easy to
save if you once get started. Open an ac-
count today.--One Dollar starts it. Four
per cent paidon-savmngs4epoBmit


FIRST, NATIONAL BANI
Of PENSACOLA, FLA.
.. KW.W. I .Je..W V.r4 pA.OMW.
w *.. .-r^em W U w. Rye*., jr
Emuas,, W m V A


C. W. LAMMU*5,Pdffkt
0. L CLURK. Vkes FmkPssmst nd CahleV.


I Iht a MuL


THE AMERICAN NATIONAL BANK,

DESIGNATED DEPOSITORY OF UNITED STATES
CAPITAL STOC, 2M,=N. SUIPIUS $N..


4eyL e4ga
Wa.Nifer
A"-2:;J


DI RIET0RS.
FieakI Reflly
We Res
T.F.Mceum


F.p Lgi-
W.ema


Iaoydspdu*.ufar zst4.at #A 3. ad "A5 ans w. Myal

foot per sent interest Paid en Time Deposits.

.a 07


UoMII(C Pr.. C.. flW=r7fOr


OWm a. w W. *atendecla a.
:hft1g ubr0r0a cordially weOlGoed.
-. 1. lAUD, C. C. 0.
S. ROPS9 T1 of IL & 8
,OQBILLE ALABAMA e uena the
.. . . Kghts Of Coalumbs
are head at their aM.
P ^No. 8 West Ifteude
MARK ETS M -r:*,ohidaytu
M2yAl 1 J ^1B .J s ca *street, on eovTery
S _. Monday evenlng at
Naval Stores. ?:.I o'lok.L a In.
Slavanash, Ga.. Aug. 15.-The naval to viitg t u tad t
Sooar-ket clo1d today as ollows: JOHNL B Jnm
WM .. ... .. .. .. .. .6 50 j. B maNA, Grand KniAt.
.WI .. .e .... ..s.. .. s .. o e.5 25 Rr-
N .. .. .. ...... .. 6. n of R.. .kah.
K .. .. .. ... .. .. .... .. .. ..4 70 NaomI Lodge,o. 10, Daughters of
I ... ..* .**..-. ... ... ..4 35 Rebeksh, meets every Monday night
H .. .. ,.. ... .. .. ..4 32% at 8 o'clock In L 0. 0. F. hall Visit.
0 ... ... *.. ... .. ..* .. ..4 30 lutag sisters cordially vited to be pres
*.* **..' *. *00 ** *0 ** ..4 26 ant.
I? , .. *.... ....4 10 MRB. J. T. PUrLULAN N. G
D .4. .. p, , .. -. ........ ... 95 s. IA E L Sec.
o .. ..*. .. .. 3 70 to3 76
Spirts torpmentle 6% cents. M. B. B. A. No. 81. ame fets t am


Me .0 .*we


00 00~I~II


."--I


BowessF~wsmolaq Mebilesad low Orgsoug.


.tirW Uea Ruy evel at 7:30 B. *** ..* e -a- --1:--- .--- -- -- *.- W*--*4
S.. ., Bafford Hall, No 10. We*t l&Tin p.... 5: Sb *8:M.. ...-.m ... B. 12,: .4
AULSY A COP'S WOR deaca streeL. ... *6:48 ..... *4.04.. ....4Quett .. *31 : 12
A.w lGO m en W.asL4 PEr. A...* 0.95S O.50: *n1 1 .d. **. 0" =I0 A
o.. .b.......................... ........ .... .- *.0. -- aa a - :3 *: ...
3 -mr.+...................... ........... Pemacola Lodg No. 4, LS o. F. 0 .... 4*tL :gNO 2 ... ...i.bt.. 0 ,
9-A..-...... ................ .27 Pensacola Lodge No. 4, 1. 0. 0. P., '... *i A W 4.. ...0 .. ....
ArM *...t...s..e............... every Thuraar evening at 7:3o *.... *:S :m .. :2 1 4N4 .. .. --.nt..
............................. .. atthe new ball-on elmon t and yl .... ..O ldl. ... .. .. I.
......-..................9....... streets. VltfB brethren cordlauy.... 6:. 40 6:00 ArW. .. -v P ola .. i.
,_ ag a -..................... .... ..s..M Invl t" B. R. WrKOVSKY N. G. kG .
mo L A9999 ..................... .N A. mUkl oSecretary. y I
!-- ...0.... 9... .. 9.99- W. O. W. "o S **s***o .* I.. :
I.- ** .................. ...2 u ve Oak Camp No. 1, W. 0. W, * ** 1- 9-ow "* *" *&-0 **0.- ** **
S -0 ...... ............. .a ets" toi Pythian Hall 1st and 3rd r- 5: .-. .... -* .-* ..-.. .. ......... *w
AWuepell06s.s> Wedaesdayu So each month. Vlstias *** *'* **6 ** ;2 * *** .*.. .** **** 3
"i l.... w -r *o.r*s cordially Inv y -.. -. /
P,- 3sei g utaim"""s" P. A. BOGHICH, C. ** "* ** 0:2 1
Opea Migh w sense 1 "IMBLtW I BROOKS. Caeric. ** 9* *** *- *L* *<' ** *** L***** **v**. .SS
..Mseinsi.. 9.s 3 9.is ] R-AT9HSONE LODGE, .. So : ..t.... *-. *. -... ..* ,1* .... iJ ;
..m $w B.4 .s. -S Rathbone Lodge, No. 30.A t, fat.**. : -. .. .*. * .*... 9 *-- .......0. 9
,OiI..s....S.....~.e4 O &40 Pythlas, meets every Thursday night *:0 **... ....* .. *** **. .. ****..**.... ....... ....* :1
DIb#rA.......... A 9 .0 .I at Castle Hll. Members of sister 7:26 .... .... : 5: .. ... ... .. .* *:..... :52U
9* w "spotslHIM lodges and visiting brethren cordial- 7:40*.... .*..S. 8 ...CeIiwa ..... .. 9:04 ........ g:8
i__--- ly Invited to attend. *8:09 ....,.. ... .D Lad.... .......... g .
P. M. OI.C. C. 8:3...... : ~. ..
A-n L OW o C. J. .. VTX. K. R. & 8. : ,
C .- -H L m&_ 50:80.... ... 9:44.. .. .. .. .... .:..... .. 6 :4
S-- NEW T HIP 8VIE }: .. ..... -*l9.: . '. 0m w i .. a ..o 7:261.... ..... 6:26
S'g,- 01m Between Mobile, Pensacola and Flort- 0: .t....s .. 1 k.. .. .. .. :*....... 8:52
Op. Bi ow i da pota. The l0bler Oteenwhip 104d........ 1 W DS.BOSIS)P.. .* **. ** t6 5:41
k De.............M. d 4M u% 4 .M's new steamer P. J. Thistlewood, 11:1.... .... '* ***9. *. q 9 9 6:3' .....
s-... .....415 4 6 4 will sail from MobilUe every Saturday 11: .... .... 10:.. .. *. ,. ook. .. .. .. : ........ 4:
VA. 0%.11:4--..........6:18 ........434
B ^--. .and from Pensacola every Monday, 11:4 .... ... 110f.. *. ...ottoldal... ... 8:18 ..... 414
_ n_". Ot. commending Saturday, August 5th. 12:10........ 1:1. .. .. lan .. .. ..* 6:00 ......... 81.65
On a ~ gular schedule between M. :44.. .. .... .... :19
Lm R, Low o bile Peua1oola. St. Andrew Bay- 8L 1::65 ........*11:5. ....Grand Rkidge.. .. ..* 5:3t........* "3:7
W ......-~~Josepbsay.,< Oarrabelle and Apalachbi. 1:1).... ,.. :1':0.. ** ....eads.. .. ..... 5:1 ........ 2:48
n cola._. 1:30.... :::: : 1: ... r Junc o 5,:10 .... : 0
' IW, _l..' .l ..la 1 take freight for Tallahas- 10:10........ 40 Ar .. Jlackmll0nv le.... Lv I 9:035 ...... 400
3I.f ,w .we, Q aui a Bainbridge, points on the A I I ( A 1 1 PM
6 .*' iR I .a.... l a A a.; o for points on Trains 21 and 2 a tas a and carry through sleepIn car Iftwe
..... l Cattaboochbee and P wacola aad Jacksonv, l via River Junction and Seaboard Air Lne.
it %s................... 30 .i. 4 O TraiUs stop Oa sg6al.
A 5G.......-.. Gen...O..- DM c Aent, Mobile.---
i..... P. -.1... '.s P. J. J-MLUAWS. A. Penscola. PNSACOA ELECTRIC TERINAL to promptly report to the general
o.410................... 1.. IW o9m, rPaeofx Street whrf. office any inattenton to duty or dls.
...... '.... ........ __ RAIIVWAY ClMAN. courtesy on the part of employees anj

!. .- I Summer Week Day Schedule-5- am Ma.aeAr. L
Se.".'...'.'..... s Adf S~hasMi L Train and Elemtri Car eledule, .
i ..... -99999 ........ -. .... 9 . ....... Effective June 19,190 LI
m:.e... .......... -A...... ,sA r STWE TARP EVANSVILLE &
.......:I"& ..B..5etween Pensacola and Big Bayou.EVN
I0..9...... ......... G We( AsW. M6as*.. Lv. Pensacola. Lv. Msig Bayou. UI
iI.TO -...9-9 .......1.........4l1 9 PAJlB-EB AM. 6 a.m. 9 p.m. 6:20 10:10 p.m .K H T
F.0- -...P......... NO J l "a aM a.m. p.m. 7: .:0 p.. TERRE HAUTE
a ... ..... ..... p s..... U "------ c 7a.m. 1 p.m.* 8:380
i .....--,------ .-Dsw9 a.m. 9:30a RAILROAD
I _':W.--:..:.':::.- pN COI.A. MOBILE,. APALACHI. 10 am. 1- N 0:30T
.O--0C.A--R.RA---L..- ST. A% 11, am. 11:,0 THE DIRECT LINE TO
I...-COL#"--.-- ...."...... n*R W ST A .12 noon U1:30 u
S ..... ....... ... i t. M VI M -- :
AM a pn. lan a St. oA2d : 2, Pr. 2:40HAG
C .Ira abela nd AUa lOd l&ol. 3 p.m. 3:30
p i SCH l!iLT OF T+ ""HEDUL" 3:30 p.m. 4:00 and all points in the
SGULF RNSA T COMPANY 4 p.m. 4:30
-- A. Pg--gpseo m nd, .5: p 4:30 p.m. 56:0 p A: ,00
I 'e lo lowing Ves els are under Mobl%, Ala 5:00 p.m. 6:26 N flh and NorthwcW e
darter to the .uln Trant Company R Peu fT-efdo. 8:W I 56:25 p.m. 6:00
adI Will load roewa tor t ports h M or t. Andrews, MilUv UM Ap. 6:00 p.m. 6:80
named durin tMe month: lama-.el Casabolle a"d l termedidls 6:30 p.m. 7:00
i u -l now ,in pDA;t plat 7:00 p.m. 7:30 ..e1ionly Low Round.
eI r n laport.J.31. ins .8:00p.m 8: Aceptionally Low Round
Si i-JM _Se pteubr a; O0 9:o Mu4;9:30 Trip Rates to all Sunmer
-" caWS l fd sad Pa. A6. *Saturday only. .
Cla D.& e 'O a t rt 9a. To i Points
f 6th; A Between Peneaela and Feort
Delptno. w_.SBarvrmneasr D. H. Hillman, L. Rogers*
e ltrk lesby-4n arn nL Pensacola. Iv .Fort Darra.es G. P. a T. A... General Age.,
tine* Nosloh, early 9etme. 7:15 0a.m. \ 8:00 am. Evneville. Ind. Nashville, Teol.
i__e-c __In k tiLnn L rno g od.i, ^^ 11: _____ 1w:16pmw
I T -1. u5-py, ,, ..--- t. 2: op m .":. Round Trip
. 8:30 p.m.* 8:oop.i* SU M M E R
sIummer Diarrhoea in Children. a--_ oturday only. < I f n
S During ve rot sth of eu Steam tra leaving Pema a.t and
r nta theM Istn a uu ra l a. oseoM. rill bm w i stop between Por a- M 1
oS oy a! cl s bO wls should have cola and Big Bayo only to N.e OB SEPT.0t.
r. .... .d "'" --" o... arasto ec VACATIO N

geSe followed by a dose The southern Express Compa i Bayu and Solo to pu-
oactor pto lease the system. reieres aad forwards freight t, Bayou. Other steam trabhs will ake peoa n trsp asmmer eourfaoie ,
S O S tadkl a8, pa of the oneyuse, Talnebles of all deorlp all tops. tah eleotri car ashes all from lints est oPI et
i. M church, lale Paso t, sa m ci ud. top. nnd northwest, from June 1st to Sep*
Write : 'We have soed Chamboer* iota wo fU pett of the country he above schedules aad regular timber 15th, with special stopover
blan's Colc, Cholera and Diarrhoea with eastiotans for Canada, Mexi* tons subject to change without notice privileges, good returning to October
SReedy for peveralyears a d o a, opean polatn ntecal Freig Relatlons. 31st, 1906.
pugnager disorders la children Sold et. train will be received only for potes SCUMMER RATES TO COLOR
^ by at dragaste- The Southern Express Company beyond Big Bayou, and will not be JUNE 1st to SEPT. 30th.
- mOW ftwom rvraw pe a tha we0 IM tra-s 1-1 d .. .


* -..


tal


- I WF ,


vmw- 1 1. .1, .


- A lk u.


. I I? ,


r


4


m


""""""""""


**"<;*:


AML aL


IA. -







..........


. elt ri.l.M


I


A .iUWI" -" t w


0.-


-A L. .


edy ForT


'The Moi


How about you
cuffs, ties, shirts, so
Got 'em all right?
what you have and
ply. You'll need a
a trip like that. Oi
cents are beauties;
cents; underwear d
dollar garmerit; sl
$2.50,-they're all
be wrapped up and
home.


THE JOHN I


Phone 225


S THE

DIG 4
S of today is exemplified
S in the Qualities of the
Headache Remedy.
BROMO-VIN
Quick, Certain, Agree-
able and Harmless.
For Sale by
White'. Pharmacy
PALAPOX STREET.
SManufactured by
G. VAN ANTWERP & SON,
Mobile, Ala.
MEN ARE LEARNING THAT BY
BY LIFE ASSURANCE
incomes are maintolned mortgages
protected, debts secured, undevelpoed
enterprises guarded, business render
'od safe, Investments given permanent
value, and capital preserved. A policy
iin THE QUTTABLIE does all this,
and more-provides for the family af-
ter your death. Send us your name,
ege and address
KNOWLES BROS., Ineuranoe


Big Sacrifice
0


sale of all clothing In stock.
valued at from $13.50 to $26.00
ft from $7.75 to $16.76.


Suito
to go


"None Reserved"
I would rather lose a little money on
tlhm in paleerence to carrying them
Saver. Call and be convinced.


IS.COEMAN
M12 t PalafxiSt.
Phem 727.
L~~~~ HHH T-


'Dr


lightweight


fordss

f Make your feetglad
to get them. They
fit the feet easily
andcomfortablyand
are soft and pliable.


$250 to $4.00


il "^*. *


hS IaST -Da tomater.v urging him to take the con- frock and loItes under spilis"
bos n rfttenyesterday tao-w HOSTE ETTER S And, Nor Wk, Quale, 114, Durban vetenbii
Wla represhtive yesterday be de- wfNconvince you that it Is the best to master. tents of a bottle which accompated it But another kild #1gi
ared that U se was the bet,city for relieving and preventing attack Launbegr, Nor bk, Johnson, 1215, 'b med 's eeacy had been fully never is prqpared for ral and who 50 PALAFOX.
state s th ate Un t of Cramps, arrb Hamburg to McKenie Oerting Co. tested, he wrote, on horses suffering shaken Into a state of mental co-
"Wtae havte nonockern. in E P eartburn,s Povess Sr 5.ia Nosch VI, Swed bk, Bur dt, 1260, With sM.strok fusion at &e sound of tladrpe pat- PHON 143.
continuedhave Mr. k rts. "We w Indigestion Fema le Ills or i- Port Natal to order. ..---.tering on her window of a mor la .
cont them lve there.'. e'W shoot a J ,_ Paolta, Itak bk. Siccardi, 1198 All her provisions are made for sun-
man who ad nothing better t '" Geo to master. shiny days. Halt oyster ol Charcoaland
than to an down ble trwn. I a wtaut. Nor bk. Thorsen, 1170, Mon- I. - dresses in a" dend sf hroa-fb
glad to 04w h0P ools ton. aheq d te!vdeo to Southern States Lumber L robe-an old t, to lodg d heav
ad rat aml.,othoiteng up Tt THE t Superb, Nor bk, Ulich, 1934, Ant- ablouseo sy sh esto ve her sole
d wayns ae of srt. p m o-- Uow Ae --S-- z--elu_ _,e Co .livered anywhere in the
es waye a Ieto OefIty. Rea! al -tIn SAchooners. & CWea rIe one., ,oand probably e usually too big
Pen d,,,t 5 * rt mAM uchUgi e, ier A Dnz Christina, Am seh. MeLeod' M h Emew o*f sha ,not, oe, with wers ad city. We can supply you in
in af soer are aout t re mes LIT 166 Bei" e to master. feathers. any qantityand our service
NO"er th*a t re I4 "nPeuas aeoU6 You qcai this gty aho e
and no one kksUQaboutD BOARO OF EQUALIZATION you meet her y. alwaysprompt Phone
It T'e Jour A' tme" pretty IS NOW IN SSON aI IImI I know' jm3W e3 g rezy e *
well posted on Pensacola and C Sm op ....... Ne !1 w ~4. you w er why -
pr e ttyg mriowl< The city board of equalizaton Is CNU11'N1 0 DLEN1 U It I s-she f ____ ____ ____
Was MeSSo of Pe.1 CIGAR R now in session from 10 a. m. to 1 P. an thare at itIs the a* at od -w
Icola's oI iAsso la1on om. daily at Tax Assessor Reilly's of. 1- e ap A trial d that/i th ptlf goodene to 2 N. TARRAGONA TREET
men and to hilleots was due a large *U ilAce, Thiesen building. Persons hav- have pae for tliet 26i:
Part of the e0cose, wlrch aten T lMr Of Ud ng complaints reading assessments wMeoi Cet It is pis g bow little the
our Mard0 G as eelebratbos walleke can call between those hours during w i weather affects oe mentally, If one is
lived he L il be te Cannot all the montW of .August and their co m nolsscur that we dressed to meet It, whereas thfe girl GrHocer Ct .
for hevca t days,, plaints will be heard. Nag nt Who never Iiets out for relay. days is
f... eeveuihdays. theApeople tie A. V. OLUBio, always l pet by h 0x .
U0...-a -d n---ne.. that's the rea wn Why so A. v. e. cdinlmS. and consider tbha a nusance quit .
Did ayou rsk stop to tainak that cU- many brands of cia 4ag2w oard oSf QauallatO. uceai y n th general see o L Mag.
better taa Meir parents and tears spring in the lime light WhOesale and Retail oeste oroceres and
do? Bo"s a gir. show their real and then back itto ob- Notic to the Public. Do yur ain t r pstrok f aecea
chaaete at Play, when they ave not livion. TheI.ll I ce 1 i r. p, -Do ,or savi. at tIe b eg g et Prsh sto.k of ti Maeckeral
Ishe lesCt t ,t the avenue of t irT We would like to state to our many G R 0 C E R S the wek w t reeves 3 or nts.
elderseo ay nac tIve to appear at Ogar sails on its sleritS, friends and patrons that oar launches ances..or, w lit ve thIsp alw s ar as oev-d f-- ets
Snotg an4 i becoming more anthigwhateve to do with any t counts, sp a alary. The extra


'7. ~ -


' -(*.


'*' ***.'. -


0ItNeTEReFL ADNt otg1e rebotn tit a man ougt not to be
OF GUIL CAUSE do t a w doll-ee
. . *** h iilUos to wis bhe 'wl lIkely save a little asey on
... .. es l 1. The w ? Let who M n_..llea tea- yo r
.ju. .ye. B yestry Sl tem to D ool do the wathetb al rigt
r stock of collar ebwgft against the hi Perg Cnoask e o n I
kst undee oft "tte A eSO4 ws ba Pool n Wuity Object of Charity- 6 PenW c@w Oa Compnyh
Better look over held In the COUt0 m upon J all a u Our rre and I& ovr
replenish your sup- pcity of series e h t aftet o r new lHe of Sirts and otber fri F iS IMMu. -'* 2 *r7 tt ml.
generous supply for .aas the girl and noti the fact Sf"iohu. You w.ll aind them light "-.... "eT..... . ,,
i ties at 25 and ^0 ^that she wa n hardly In h tien te comfortable aad airy, Just the t0ag _
ur ties at 25 and 50 JM need to keep oool these 'wt At the prelminary hearing of the ------.. Illl ..I...11 ill||>,\,
judge declined to accept a p9 o W nooe a. s lA to enry earin .the.
collars two for 25 da- We a haing special sale _eonage ch arges aga st cerin m-
colr wo guilty to the d arges ing in Bat Sit -ant you ought to take ployee of The Jackson Lumber Com-
25, 50 cents and a her. Thi wal. what the irl wanted advantage this opportunity to pur- panyN RLoYkrt, Ala., one of th A
hirts at 75 cents to to do. She had been in Jal or a chase. .. m tport witne wa Mano MIA Rln i l v U O MI. ;
ere just waiting to month or more and e.'dently wanted J...o *o, a laian, who is u ab
a change, and when 8 saw Other to speak a word Of laglish. J Or
Sde'vered to your aI c. ..e. an- when aw d An ste to n et ing been treat-
prisonerd so up and plead guilty G ed with extreme cruelty while at the W hole ale Dealer in
receive sentences, mAe decided to do f _ia " camps of the company, and his con-
S.. likewise, but the cost dedd at W hn te & Ne p _
she was too youngto r UTlewhat she uthat llet nd
was doingespeciy. as each of the the purpose of providing him with a
g meo*.St log tert lthe m OUTFITTERS Place to stay land efical atuendance grainUU
S charges mat a lon ter the re urin his illness. e was absolute-
orm SchooL Her case wil come up TU t OW y wMUM% ,r T areT sy Stk ty destitute, burang up with tever
...at the next term f the criminal PHONE ~ and so weak that he could stand only Pesa.el, Fla.
aHITE STORE the a- tf- a-- N--
= .- = = SR kept the Police end county Aut.t. him for a low inal and he was p
"'t..'.= -- -"-V M e oeet 29 S.PALAFOX ST. ob ..-. A NNIUAL DIVIDnNDS
,ties busy someweeks iby goingPFeT.tan -to her house, where heI iat A N NDA i
2 207 PALAFOX home toa, ter, claing present ad where he willrmt they may used to
to. have no bow, saying .the nameLAM I J I EI Flf tdaysla a. cfra nn tbe a
o title Annie," and after rem Buy D bod San to theman tke to ce e emims year if the insured
.__ing there a short wle making awyS ai or Agnt hospital and aromnements to that dmt
with as many valuables as could be end erre compl ted owi the citSO CO S A life or Endow ent Policy with
. .I ~.. .. b r cla n T h e d a y f o llo w in g h o w S a O f .- -- -!M?- ,- ,, 7 V L
BASEBA LL .- other prisoner .went l dividends in the Unbon Central Life
the court at the ame time and pled. comseguence Jordanoes is dependent a ifa to
Amerlcan League. ed guilty, aft receiving sentences. u aponi the .harty of the public until itS QC mOSt SA
Wadinton 4; S~. "o9iT 2. The Municipal Court. such time as he can be placed in
Ctbrekad ; Pbadl k 3, 'led fThirty cases were on the docket for charge of the United Otates author WI A
at end o t thon account of dark. tial In the munictpa court tr- ties toe hod as a witness an tThiesen Building. Phone 608
est. .. d morning, before Recorder lan ,e, the mien who are under bond.f orthne
0; Ch ica butso ofthis ber three cases Peerless, Dr Thomas, 2011 upon the charge of peonage.
New York 10; Deto 2. cotnued. Of te others two def- Tampa to K Transit Co. The total uomt collected for the
d"nt-s were d-harged and sentence, -Tolesby, Br as, Owens, 2M6g, a- benefit of Jordanoes was $18.79, and
"National ... edo aos to order. of this amount $12.00 has already
League. suspended i~ n two ea m Pi nes fCloar*I0 bee-expended, leaving &balance of I CE!
C nat.;Nw suitp 1 poe amount Mustlan, Br as, Woolfender, 3047 $. on hand against which there 1s
Phtsburr Bost 4, second foRowig newsut was Bled for UL'verpooi with 318,000 s ft swn a debt of about $3 tor medical at-
g .e. -. yesterday an the o oflr eler oa bbis rofi n 1,1, 5 bf tobacco. ton of th e e an c the There has been lots of fus and talk over Bryan's twenty
Chi:* T-0 Brook.lyn 7. 'the circuit court: bbls rosin, 1,198,"5 lItstobacco. tion of the man issuch that he will c
c out ew Bo.o. _n i. shetdr M e d H M Saturnine, Br ss, Ondars.a. -'' need care and medical attention for, cent n JackeaBi lle, but a glance at the Jacksonville Wpers will
ew o t. Lo postponed a. be Moore a Henry Moore ayonne, with 2,860 tons phosphate possibly, a month longer before e hw t oly the rch people and lare oumer of ice that
S. York not a vin. v. Alfred Moore, et al. petition. 8 rock. can be take charge by the United at low prices. mall cut of ce, uch a the laboring
.A rn .. psco, Jr., attorney for pettkeone Statee authorities, conderable moreople are selling in Jacksonville under the "Bryan Agreement"
~n.outhern eae--. ". ,. i, |M ,VE ELINPORT money will be needed and the charit- today at onehalf cent per pound; here In P aaola these same
At a ta 3; Birminghrm 1. MANY PLOW. RELIOS VESSELS IN PORT. able people Pensacoa who desire cuts ve bn selia at two4lfths of one cent per Poa for th
Montgomery 1; Nashille 2. AT TAMPA OTATE FAIR Stearmshi to do so may seD4 contributions for V"t 14 mRnths, a dWerene of Ten Cents per Hundred in favor of
Uttle Rock 8 ; emphis 3, called Arona, Br ach, Spp W. 563, Cleufue his benefit to The Journal, with the our people. The workingmen of Penascola can rest aured that we
in the elgt thto allow team to catch What will be one of the most in- gos to J. A. Merrtt"- Co. assurance that the cause is a deserv- will continue o ive them ice In small cut, at the same old price
thain. teresti~ feature of the M omiog State Clara Aust Rajusen, 3641, Tnm- ing one and that the money w 'l be nud, will ot, under any olrcurtances foHow JacksonvIlle's lead of
Shreveport 5; New Orileans 4. ar at Tmpa will be the grand dis- pa to Gulf Transit Co. used to allevate this man's lowags low prices r the classes and high prices for the masses. Sen
south A tl play Of relies, for which a large and Cynthia, Br as, Mcrathb, 1938, RIo and make him well again. us y"or orers.
outh Atlantic League. special department wil be preeare4 Janeiro to the W. S. Keyeer Oo.
Saana 4; Charleston 5. and probably n add t'.unal building. Devonshire, Br as, Coull,. 2432, New
Columbia 0; Augusta 4, first game Relics of every kind pertaiang to Orleans to J. A. MerrltL .Co.. .a
Columbia 1; Augusta 4 second Florida'n pest h ory are dered for Emllia, Aqt ss 1, C oansulleb e aet* movement for starn,
.me_ ... .. .. exhibition, and premnmsa wif ,be of- Philade!phia to Gulf T 4ait Co.Ofate"th e mvme frarting
Jakonville 3; Macon 2, rst fed on all. RIlics sI d Ames of lisath, Ger as. Kier, 1287 schools In Korea has almost amounted 5 ,,
Pame. the old days when diais held- full Swakopmund to the W. S. Keyser Co to a mania, says the Korea News. We ___ _iIli
Jacksonvle 1; Macon 1, Zecond away of ,lorida, followed by the Ad- Gracia, Span sa, Rues, 212, Liver- nnd them springing up on all sides, __, _ .i, " ,_ _,,,
game, called n the ninth account vent of the Spauiards, also those of pool to Gulf Transit Co. and there Is scarcely a Korean of ...... ----.
Darkness. < the Civil War and Indian wW per'ods Haslewood, Br m. Rendall, 2791 wealth or position who has not become RAINY DAY CLOTHES.
ere desired. There will be appointed Rio Janeiro to the W.. 8. Keyser Co patron of an educational establishment l TTl OCL.r.
rHAS | e A OniU to look after thls 5 arm t special Mona, Nor bk, P4 e, 1028 to of some kind or .ther. It is to be tfear- 3 9 makA *G AE1al, 1* lAErE
CLeAn. LeBAK NI 8upe bden, an every sbb t order. '." ed that some ofe'the nthusiasm h*hl r mes t Wet Weatbhe."--
ra, a^ A .-j-A iwll be kept in absolute eafety. Those Musician, Br is, Woolfender, 3047, is at present being manifested will By the kind of clothes she ,wears oa n
TALKS ON L PASO av. rels n d antiques o ese A. A. Brown C New wooIn te e of time and that a rainy day jou shall know the mental
TeuLKSbtlon should _sAadd Nith, B ss. Riunards. d .,.,,, .. .,, l t,,, .,,, ,,,,,,,, H EN S
T. I. Brown at Tampan port ews to H. ars & Co. some of the schools will peh either habits of many a young woman. A
,__, __,_-_ Phylie, Br Ms. Tountain, 1579, New fron want of pupils or from want of .gir may have Just the nicest kind of A ,.
FORIM R PENSACOL1AN '18 EN Orleans to Rix M. Bobinson. funds. The movement is, however, n- garments. for all other days in the At 50 cents
THUNIATuC OVvR HIu NEv Iverpool to Gulf Transit Co. ended Koreans fully appreciate the fact day that tests the real stu a- is
IN TEAS "h-- ips-" that until at least primary education made of. .. ...e Tnese e
HOE I TXAL TO SUPPOSE Avanti Nor s An mes general throughout their If she is a girl of forethought, of S are offengthe
SThat when Hostette..s Stomach BIt. Iondon to orders o,4 t heycannt het eer e, once well balanced mind, she won't be at a plolic at see eaoh. Also
Clas. LeBaron arrived yesterday terms have cured hundreds of coses Of P rrels, Port ship, Barros, 506, IAs" ed condition. lois t when s wakes aup n thme morn- -some ateh Terdessen
from Paso, Texas, where he went Stomach, Liver or Bowel tgro be on to master. fog to rnn. weapy skes ant muddy eg y at 20 f per dosen.
two years ago to engage in hbusness during the past 53 years, it will cure Lena, Ital ship, Tassara. 1581, Io- streets, for she has a ne shot o We carry a full line of
and where he has prospered exceea- you, too. It s worth the tri at any don to order. ,Heee Me l Ve w a Pete*. skirt, waterproof boots and a sma1 p lovisons. Give us a
ing since. W.le Mr. LeBamn s rate aad you'll be satie.e4alth the Barks Among the letters received by Prince hat for days like this, in which garb thia.
glad to see Ml old home and old resuIlt One bottle of Mo. -. v o yn Buelow, the German premier, dur- she fels as neatly ad smartly dressed


I




'$
':::;''',::: :,:' r f :; jtl: j) I L .e.1 .,._-.y- ''' '-r "-' :- > -y

I

1

.
"

..- ito %wu'" avupmAU* I rn tb3AY MORNING, AUGUST 16, 1906. PAGE THfttre' }



ASKS COMMISSIONERSTO : -7----: :




DISMISS THE SUITS' g: f

.rr t I The S30,000 Pre-Im rovement Sale

was entitled to two dollars per 'day
Instituted Against former' Members foreach: day spent-in the !.nterests of
roads and bridges' and as far as 1 '
of County Board for know the question 'was never broughtup --of the ti h I i
4 until after. I had ceased to be a
,7 11d Alleged Overdrafts. member, said' board which was In I iH I
J nu.ary..195.( I mention this to-show, L
L ) I that the commissioners thought "that ;
they were legally entitled tothe'_ Watson Parker & Reese CO.
I
MANY
REASONS ADVANCED WHY
amounts when it was paid: and: that it: 1t'l
SUITS FOR COLLECTION OF was not graft' as it has been Jsnat-;
hr I, ev and referred to in the report of the:

} AMOUNTS.. ALI.EGEDto: '."HAVE. stale auditor to the governor in 1905,' IS JUST IN ITS INFANCY. ii I It
|j and hi this! connection I would: liks to
BEEN ILLEGALLY' PAID SHOULDBE ;say further, and: I-can say it positively t! ;. I
!ly-; that in tat-dling.the finances of the 1
QUASHED BY THE BOARD. ff

Clothes do not make the .. I' county 1905-- which for- nineyears amounted:
,
to more- then a ha'f million dollars : -

man admired but by it often the fairer makes him sexfiat's submitted Tie following' to the commun'cation Board 'of'CountyiCommissioners was .of there commissioner was; !no graft or known on the to part any I two days. (This sounds small to men who count their money by the Millions. ;; }' I

one reason a man should:
jress as well as his means wit;' at the regular meeting. [Icommissi! record .cr
:permitTo on Tuesday n got last by former Corm I : '

dress well does not meanto missioner Frank .J.hnSOD, relative -to j improvements! : 'I' Each of the hundreds of people who crowded our Store during last Saturday f fI
deal of
spend a great mon: the suits that have been institutedaga ing of our. county of. which they can ; .
for clothes. Simply get the nst former commissioners for well be proud. When the idea of a and believe will bear this I
I Monday we us out in statement !
CO'CTS and styles: that are suite better system of :road :building for our : : :
1 to you, backed by goo workmanship and the best collected by them: convicts for this purpose was first i -'
And
each of them received in their i.
according to :
proportion purchases
fabrics.:> Pen& co'- ,- -Fia Aug. 14,1906. conceived in 1897, and from that time' an N I
We know our business and if To'the Honorable -Board of .OKiaiyCommlssicaers : on. every county member showed share of this ; :
von come here we will ses to Escambia Couu\ great interest and dId' everyth'ag in equal great saving. : B j
it that you get the right kind tj-, Florida I his power to make the system a suc, t'

Gentkmen-Referr.ng to the suits.cess. I Now let nothing keep from mid-week of this sale. New f. ; f i
which you have instructed your attorney -: The New Road Law. i I you away great I I

to bring against several former The present law authorizing the goods will on our counters each day with prices made to please. ;! .
members of the Escambia County working of convicts on the roads of' go ; J
Board of Commissioners, said suite; the ,several counties and making all. : : r

VTME3QI .i! have being been based Uegally!on' amounts: paid to claimed the .said.to i i needed thatwork provisions, which. ,was for.passed carrying in 1899 out:: Our Mr. Watson has been in New York for some weeks, buying nothing 4 J d. "! I

Commissioners and bridge inspection far. services and for for looking road{t}j.Escambia.was dra1ted.by county three commissioners of these same and:! but the newest and best, of the most fashionable things to be found. And is f. t; '$

after road and ridge work generally.vvaa. .introduced.in.the legislature; at: $1
I have thought best in justice to my their request by J. Ed O'Br'en and forwarding them by every express. And they will all go on our counters as soon Jt-t i
self and others interested, to come bw- the.late J. M. HillJard.!. This is, I! .

White Barber ShopThe that fore these you and su'ts.toe.withdrawn to: respectfully request or that taken tfcink,.by an. them evidence in the of work.the Interest I as they arrive and you shouldn't be the last to see them, for there will be something -. 1 *, ii

white barbers formerly of 36 the suits against the former commissioners The road law of 1899 was intended among them you will want. If you haven't been to this big Sale ask your : i i
S. Paiafox St. are now located"at No. .who represented -country districts as a special. law coverng the working: ,
S IL Government St. next to Western I : be withdrawn. make this distinction |'of convicts and does not in anyway friend what she thought of it and we'll see pretty soon. 1
'fnterefere you j
Vnkra. Only union men.employed.DR. entirely without prejudice as with the general law of jii- J
to former members who representedcity : 1895. .

I districts and for the reason that I Section 1 of the law of 1899 reads Come to town this week and buy where you see the big crowd buying if ;1
LOUIS DE M. BLOCKER the same arguments'J not apply as In part as follows: "Provided' that I :
PENSACOLA. FLA. the duties were and are> entirely different -nothing is Implied in this act to prevent "Because it means something at
Cdict: Brent Bldg, Residence: 12 W. Gadiden in many respects from those of I any county In this state from! I!
Phone 438 PAene67SCOTTRELL a commissioner representing a city working roads as the law now directsof [ j :
district; and I also find that the road any general road law may hereafter
laws then in effect apply to the services 'irect." '
for which these amounts were I think it is very plain that we had
FINE PHOTOGRAPHS. paid to country members of former the right to work the roads under Watson Parker & ReeseCollf j1Ji :
Pensacola Fla. boards. both laws; that is to build new roads 1
'1 ask that the.. uits.1 be. dismissed. tot with the convict force and to continueto i : .
the followrng: reasons: keep other roads in repair by: pavd ''
to Green & Watson. !
Successors (
Something New In Reasons for Dismissal. white labor as we had been doing :
Diamond Necklaces, ttnfs, Catins, Etc. First. The law does not say that wider the general law of 1895.; ff
W. A. Gahlenbeck, 218 S. Palafox Si the compensation commissioner' As' we thought better results could .. -. '. ; fJ( ti
shall not exceed one. hundred dollars j i be had by employing the convict force .. -_ . ., -- ; .: [I r ;''J I
-
per annum but does say that a commissioner with the superintendent. and the machinery --- ------- ------ --- .- ---- fi 1:,
TURTON & BELL, shall not be paid over one and stock in building: hard i't1 i : :
;
PHOTOGRAPHERS SIHGE' 1870. hundred dollars.per'annum for his per reads exclusively, and by keeping the Iy'authorized by law ;when such acts'are 'fit for which there- Is 'no compensation REUNION OFMULE SKINNERS mulc-and--- X-tE'Oier-tli Kansas :; ji fIJ f N
Kodak SuppliIlnilhlng.: for Amtaurs. diem. other 'roads in repair: by paid labor clearly for the public good. specified. it is clearlya principal of law prairies In tbe service of the govern- f t"ft'I r
This has this the The laws in 1893: ce"rafnly that he is entitled to ba reimbursed: .
always beta construed by work being entirely under road as passed Old Plainsmen to Gather at Ton* went or for private companies. : ,
R. K. WHITE, the Escamb'a: board and by its dIffer- supervision of each commissioner; in ( did not contmpate! such! vigorous for the necessary expenses incurred in noxle; J{... \\-1. '
In all of the river cities In those :
days t
Mduuker. Manutacivring Jeweler a4 Graduate. ent attorneys and c'!erks as referring his district we elected to work In that work in road building and teas the performance of said service; and What will be the first and perhaps the j; j (
ttlNlI.3O S. Palafox Street PtnsacHa. FU.I to the per diem ,for meetings of the way and that Is the plan, i I believe mlntenance as has been going on in iu support of this opinion he cites I these companies! maintained big cor- 1.I' j M+;
,. last reunion of tbe early day "mule rate, some with as high as 200 animals, i(', :
in decisions: that j :
commissioners court.* i that is in effect ,at. the present time. Escam-bia and other counties ou some sevan or eight .
'In other words; cominissfoners: The law of 1895 provides Cor two sep- state since 1899, and some parts ci have been made In the different states. skinners" and "bull whackers' U: to I and in the early history of Leaven'r I
I Tersely Told .could; not drawpay for more than fifty': arate systems of road working.e'- er; the said laws are1enUrelrmpracticai! This principle of law alone should be be beld at Tonganoxie: Leavenworth worth during the border ruffian days it \Ik\ ..i h a t
routings '-per year at two dollars per of which can be adopted by the com at the present time and carried out sufficient reason why'the suits should! county Kan., during the Old Settlers' Is told that there were enough prairie f ''* |, :
meeting." Previous to 1901, this was restricted -missioners. would stop all road work In our coun- be stopped as the amounts collectedwere : reunion Aug. 8, 0 and 10, and all of schooners the\e to form a circle com- (t' ?:?' '
THE JOURNAL'S TELEPHONES to fiftyydoliars per year ortwentdive Sections 20 21 and 22 provide for ty. These sections of the law you fully covered by tie expenses of I pleteiy surrounding the town when it '". '' '-' i

Editorial Rooms.. .... ... .. ... ,.. 38Business meetings per year at two levying a special tax as has teen the I!have seen fit/ to Ignore as the previous the work partly by cash paid out and! these old teamsters who aided In set- was attacked. As late as the early seventies ': i;
dollars meeting. If i it custom in for boards did. partly by the- of keeping a! tling the west, fought the Indians and
Office .. .. .. ..1500 per was necessary our county many years. expenses ox teams drew loads of lumber .' | 'j; .
for the commissioners to hold Section .21 provides' for an overseerto (As to the rf ht-to stop these suits I team which tin duties of the office I' traveled thousands of miles across the and merchandise into Leavenworth ,<'t :; 1
To communicate with The Journal over twenty-five meetings per year be appo'nted by the board to look infer from a letter from the governor wade necessary. I prairies before the Union Pacific rail- I but It is doubtful If there 1 U now In ;-. -f-
,
luring: the day time use the business theY' did not get pay for the excess after this work at a salary of $1.50 per IT relation to the amount paid L. M. These tr'g>s required whole days: way was built have ben extended an BI I eastern Kansas such an outfit. 1.-:-
j j
office phone, No. 1500. To cou munl- over twenty-flve and this was carried day. '- 'Davis for Inapretloai: the Bayou which obliged! the commissioners to j ;
\
cate with The Journal at night use out to the letter by EscamWa! county: Texar.bridge that. It is entirely: with; neglect their own business, \\ithontl I Invitation to attend says a Leaveuworth All of these old plainsmen in Missouri ( i it i :
the editorial phone, No. 38. boards; T believe that this was intended Thought They Obeyed Law. your board whether you aTow! it to profit to them and for the benefit of s I (Kan.) special dispatch to the St Kansas and Nebraska: bare been !!'r 1J
to'apply: to payment for attendanceat Now the commissioners not being I'h'm or insist on his paying it back. I the pirblic. II I Louis Republic. extended an invitation to visit Tonga-; \\\t i\
Cart! M. Jeraigan. of Milton wet the meetings of the commissionerscourt lawyers and that part of the law c:! tHnk that case. and ours are very s'm- As I have not bad any legal advise In the early fifties Westport, Mo.; I noxie to renew old acquaintances. ':: ;*1 \ t
here yesterday- business. i and that it has no other applica 1S95'never having been called to their II ilar. Legally the board mat- not bare in drawing up this commun' tion. attention did not knew that lit was the right to employ h'm at a salary your board but have only referred to I Weston and St Joseph Mo., were outfitting I own programme which will consist In t -, :? j ;1-':
E. O'Brien of Mobile inspector ofHaas Previous to 1895 the general road law .their! duty to appoint th's overseer: of-two dollars per day to inspect that portions of the road laws as I under- points for transportation>> com speaking and story telling of the early! % t ,\ tdan.
: and toilers for this district is I allowed two dollars per day for road!'but thought that it was their! dutr. to bridge but could have employed some stand them. It is possible that C may I panies. Prairie schooners by the hundreds *' I;. I :: :'
iers on official business. a.: .i 'bridge ins ect'on 'bet In that(!attend to this overseership themselves I ct&er party at double that amount but I be in error as to some of the points have gone out of these towns I l j. i; ; "I
Capt JQ iRourke\ one of Bagdad's year the law was changed, the changes j tin!t their several districts and did so !on' a basis of practical common senseit popular citizens was a visitor here being very slight but the clause that],thought rendered bills accordingly as they i .was the best thing b: do as be wasa I respectfully ask that you give the twelve to sixteen! oxen, others by from I Among the many useful and time |E: 'J':: 1 in! i
allowed this two dollars ,j strictly accord'ng to law and and had had"ex matter special attention as re- "
jcstenJar.H. per day was saM bills practical man your elx,to ten mules. The "mule skinner" saving kitchen utensils: that cause the ; ? 1 =
left .out. I were approved by the finance ence In good br'dges and tooka gards the points I have mentioned and '
'
C. Tubb, of Mobile, route agentof .. committee and ordered paid by the building that I obtained his name from tbe long whip old fashioned housekeeper to open her ; ; 4.;
do
It seems that this change in the deep interest in the work. and I insist that if you can constantly so "
the Southern Express Company, is .awl board. with which he could reach out and clip eyes in amazement are olive stoners r'potato
.
was never noticed in Estambla county that if you have the right to allot yon order the suits dismissed.I i, r I
;
'in the city on business connected either by any member of the .boardor As proof that this was the custom him that amount for his servicesyou am confident that every tax payerIn the ear or the bend mule if It laggt-d. and orange peelers, pea shelters
i& that company. its attorneys.cr clerks. I and conf"'dtred legal and proper 1 have the rbt! to allow us the the county who will give the mat The "bull whacker" was so dubbed be- almond grinders, ice shavers and ) ,, '

A. D. Bonier, of Mllligan, connected Question 'Not Brought Up. have only to call your attention to the amount. paid us for onr services. ter proper consideration' will! say that cause of his long.vhlp but be was not crushers, cheese toasters, corn scrapers ';
with the Scotch Manufacturing:: When 5 first went on the board in minus! of meeting of June 11th 1901 Another Phase. justly ve were entitled to the amounts BO fortunateas the "mule skinner" In pineapple snips (for taking out the f. f.1
(X was In the city yesterday on a 1896, which was a year after the law at which: : time a new board was.organ- Another phase of the matter which i'd will endorse such action on you. being able to ride behind his team eyes of pineapples, which every house- .
snort business visit. was changed, I was informed that ISCIENCESETTLES ized.The mattes these suits appear very unjust part having to walk.along about the center keeper.knows Is a difficult process with i ,; .
HA.. 1- : minutes after. stating the selection Is that each of these 'trips for whichwe Respectfullv.FRATsTC. of his line of animals wbere he could an ordinary knife), flower scissors, .' i '
French is in the city shaking of a chairman and finance committee -
tends were paid two do'lars .required tiS JOHNSON. reach each one with his whip. There alarm bell egg boiler, salad oil drop- 1 r. B:.' ,
with read follows
hs! He is as "Tbe :
many friends. : cmmissoners
in business at Florala, a city whichh .. from the three country districts GASOLINE ENGINE ONDAILY are who pers ; j
going forward with rapid strides! being each designated as SUOf>rI that we had to pay out! oicney: forrailroad EXHIBIT'ION walkedtthefd&tance ctrovnd the world in dressing drop by drop), clothes sprinklers 1 1 i
Dandruff is Caused bya Germ That visors cf roads In their respective fare and other expenses, the following oxTteams across the desertsto pie and cake lifters, Jar j ,
Capt R, F. Jones and family of the I expense of wWch could only -be cover 1 r
Saps Hair/ Vitality. :
districts. CoioradoATexas add California. holders for holding hot glass jars i
Polunrtws this-two dollars day.9 The gasoline engine! which W. J. & ( ; [
Ga., who baxe been spending It is now settled tact tnat dandruff ed by per
: some time here as theguests ol is caused by a germ. Falling I l submit in tit's connection affidavits the districts are> of large area the work B. Forbes have on exhibition In their After the Union Pacific drove the when preserving), sandwich cutter ;: 11' s t I
krs. A. E Yniestra left last night .hair and baldness are the result of from J. B. Lewis who acted as could not be done 'i: any ether way' hardware department is attracting a prairie schooners: out of business tbe (these are for various fancy shape), {i
for their home. dandruff. Dr. E. J. Beandsley, of :foreman of road crew In District No., District No; 4 being' twenty-seven great deal cf attention. The engineis majority of these old time wwtern men etc. To these are added odorless stewing -
AA.. Champaign' III, got hold cJf the new i 4 duit-ag 1902 3 and 4, stating that he I chiles north and south and twelve ntnn-'ng a large part cf the time settled In the river counties In Kansas, pots and frying pans, which are }
Kgration Seraphic, United: States im- lair: preparation Newbro's Hexpicide was not employed as overseer but .was I' miles east and west and the other distracts I and the ease with which it is started Missouri aad Nebraska.] took up home- Bald to prevent turnips, cabbage and ;
a in the agent stationed at Tampa -the only one that kills the dandruff :employed.3 a workman; equally as laree. and stopped and the smoothness steads andbegan; farming. In Leaven- other vegetables from giving odors f
s merou3 city friends.shaking hands with his germ. /He says: "I usdHerpicide'worked every day and that he receiv-I! Your attorney in b'!\ rerort' *o von In with which it runs Is all interesting to worth and.Atcbbon counties, In Kansas while cooking; self wringing mops and ::
:atoned' in iHe was formerly! for my dandruff and falling :hair and< crt the same pay for h'3 -work as 'thai! ;, 1905' 6n this matter says In substance: those who appreciate the diversified there are said to be no less than knee rests for use when scrubbing '
hope that the Pensacola, will and many I am well satlsfled'! with: the result.1 j others, viz; one dolar: and 'twenty.; Tist where an officai is required to fields of usefulness to which these) fifty aged farmers who came west In floors.-New York Poet. i.. -1
!an to this port.department return Dr. J. T. Fugate, of Urbana Ill. I'.fire cents per day and thai; the wcr perform! a service for' the public bene engines can now be put. t .-_ftft1a and_p htsiacA :ark .in= : 1
"I have used Herpicide for dandruff i was done under the general supers.; : 1 1HO
A. A. Brooks for many years see.etary with! excellent results.. .I shall pre-jsion of the commissioners for that:'dis-i 1 ;
and treasurer of the P. A. & scribe it in 'my- ''practice. HerprcideJ tract: :Also affidavit from Thos. last: .
T. Railroad: Co., has resigned the posi- kills the dandruff germ. Physicians[! ings another workmanwhicft:! bears ". -
ten and cut that of Mr. Lewis. I f'a i.i
will
leave Saturday for as the general public say so. j 9 .,
tulle'-on. Texas where he win engage IFor sale} by W. :A. D'Alemberte j j The po'nt, I wish to make as. this: E q4' t i.
h
L ta.iroad! work 1n that ft ld.lr druggist and apothecary, 121 South I That the board had the right (In fact, QJ ____ .' 'i.
wks has been lit was their duty but they not) .y p s ;'
in Pensacola for I Palafox street, or send lOc in stamps: were O 40
about nine years and has won many for samplee-I i| so advised) to appo'at an overseer of I :
t"ends:: here who will regret to have tro't, Mich. roads at a salary of $1.50 per:day or l,
IIIu leare. about $450.00 per year;. that not know .HttAtaoocoroATUM ,
ing the law they did net ?mi>!oy such C 4 ,t ,
.There's! a dellciousness: to the overseer but did: appoint each-, :' :
s-Ribbon FUror" that delights" county commissioner as overseer! JH J
most fastidious.! Just try Blue THE DISCOMFORTSOF in his d'strict and that after I :
$!:
bboa Lemon or Vanilla extract. the sa'd commissioners had been so ; .!

For TuperlBC Finger. THE FAMILYWASH designated to this by .the work'board faithfully and had as attended Instructed Ui1I Red Rock Ginger Ale ,it ;

Frenchwomen by the board and for which
have
taken .
always
to Peat this pride is In tapering finger tips; and DAY I less than money would was have paid been in paid the to aggregate a county I stands out among all other drinks as an t f J
probably due the Invention
of t overseer, and, no doubt with' better
: lIttle devices for training them In Are a thing of the past if-you 'I results and had rendered b'lls for f 1excePtionallY high-class article. '
pure
7 way they should go. They; are lit- let us do your wash; We wilt such work which were approved byhe I. : i ,.
,, ttnjSs! like steel thimble and are call for your clothes wash < !finance committee and ordered It has the active endorsement of the most ethical medical r- s b B \ I t .
Jf with soft felt There are different them under the most sanitary paid by the board, it is very UTJfustj! ) and ,
: men, ist widely prescribed as a home drink for all I I'
s for the various fingers and these conditions and tetum them now, after several years have: i ; ,
are! adjusted by pressing them to the fresh and thoroughly cleansed to bring suit said 'suit being p.assed'i) people suffering from the various forms of indigestion. '' >1"{ I
de'red' slip. The Shall we call for your wash! a legal technicality and force them to I I i,
should
pressure not Loolt for Red RocK
be Crown
bard: pay back tb's amount for which they Stopper on Bottles .
enough to
j cause any dlscomarae f rendered faithful service f fRight
11ft.
Of <' results are not ate The Star Steam to ON SALE AT ALL GROCERIES ED :
ire rhlb! but by continually wear- In humble Use 'Discretion. A ,,ETC., AND ON DRAUGHT AT FIRST-CLASS FOUNTAINS. : : 1 ]
my opin'on it is
impossi-j
these i; t
little devices at night and u his for laws to be enacted that wtsll f' ; j,
Laundry ,
'(U .
during the day as coDftAlent cover an ipoints that may come before i : '
ceps levy thick finger cads the board end I believe the commissioners LiI I' r I f
bttned my be, 37E. Canton St. Phone114Pensacola j'_ ? Blr w i .1
: tote a muc1.1001'! @ tapedlg :"t. Fla. should bare the right to "ul\ .
!eek .-r-- .. ..r :
-=-- .. ,
:;; their good ;judgement and discretion
even when ,. .

'. .l.



._ :' ;;.... J -. : It;. .

'. it''tt r.....:.... AT"14:) < :"' =A .e..; .,;: ,,_ .; -_4 _>-". I .! !



i .
j :
I -... -
II
I; cI.

I.r I.r-

,,'. c

; AUGUST 16, 1906.:
THURSDAY MORNING,
k rrrtJ FCnTSAJCOLA: JOURNAL! :. ,
'P'ACE Wo .
{ _
: : .'
.
.., -
-
. ; r _.________. -'---______-i....... J- u ..." ...:liU_ f .. #1. _

;: THE GERMS M3_ -
'


.. S.S. SKILLs. SCROFULA! ''I WEST FLORIDA ;



r The laws of nature and heredity are fired and invariable. Parents whore 1 1I : .

related by the ties of blood, or who have a consumptive tendency, or mar
family blood taint, are sure to transmit it to their children in the form of be

.. Scrofula. Swollen glands, brittle bones, weak eyes, hip disease, pale, wiry
complexions, emaciated bodies, running sores and ulcers, and general weak ed to continue on its journey at .
constitutions are the principal ways in which the.disease is manifested. o'clock Wednesday night. The 81
succeed in holding it ESCAMBtA I taraess and "traps"! were placed! I I
- Those who have inherited this blighting trouble may I borne ,
of. the ,track and the perhaps
; : In check during young, vigorous life: but after a spell of'sickness, or when struggling between-"'life\and death was
.; the system has begun to weaken and lose its natural vitality, the ravages of lying on the opposite edge of the road ; at
the disease will become manifest and sometimes run into Consumption.S. side.
into the circulation and forces out the scrofulous deposits,., Special to The Journal.
S. S. goes down Escamba! Aug., 15-There was a It required a very brave old horseto f
{ kills the germs and completely cures the disease. It changes the quality of wedding Tuesday last when Miss Nicy pass between them without a "shud: P. E.
the blood by removing all impurities and poisons and supplying this vital (tobb was united in matrimony to Mr. der." party
maid with rich, health-sustaining qualities. S. S. S. is a purely vegetable John (Madson. The great rush for Leconte pearsat .Bill
' *edkine and is especially adapted have been weakened Mrs. Mary Gentry has been very ill this late season is probably owing Mrs. "
} and poorly nourished by scrofulous blooyd.tLiterature on Scrofula and medical for the past week but .we.are all gladto to the discovery of their" superior la,

,' advice free. _,.. THE SWIFT SPECIFIC CO., ATLANTA, GA. know. Neal that Gentry she is has improving.Mr. been ill.but 131 merit After for the a fried breakfast bacon"fry.las: been taken of of ,

..I BOW able to work. from the skillet drop the: sliced pears .Bond cut
), Kr. and Mrs. Haloes: have returned Into the hot grease as you would ap- :Mr.: ""
:t visit in Alabama with ples or potatoes, and see what. a rare has K:
, \ i :iiiit0 i .ji ::0 :jl :i! from relatives a pleasant and friends. dish you will pan outTHOS. eral :

I We are going to loose our neighbor : McMILUAN. Mr.
bur Irs. Richman. She 1s to move to pr n
Soda Water Service Pensacola next week. ST. ANDREWSON Mr.
Mr. C. H. Gentry made a flying trip :: \
Excellent. to Pensacola Friday, on business. ftv
is
;
l 6 'Mr.. G. B. Stanton of Bluff Springs THE BOOMWILL much onY,
j bought a min at Mllligan Friday.! /air. :: twg
It < We have a modem fountain; it is brand new 'Mr. C. H. Gentry left Escambia Sat- after : I-U.car
urday for Mihgan! to move the mill in
and absolutely spotless. We have nothingbut to Bluff Springs. SOON HAVE THREE REGULAR !Mr. : w of

the best and soda.. We have new tn< .
syrups LINES AND A
and STEAMER .
Troubles Constipation.No
Stomach right.Mr.
electric fans to keep cool and "
you you
.
for ::
one can reasonably hope good BANKING INSTITUTION. -
; could not spend a better, pleasanter moment f tgestion when the bowels are consti New
i < else.HANNAH pated. Mr. Chas. Baldwin of Ed- -- many
j 'anywhere wardsville, III, say, "I suffered from Special to The Journal. -:
1
' 1 e troubles for several years, but thanksto that St. Andrews' however in- Mr. !
i BROS. DRUGGISTS Chamberlain's Stomach and Liver ache It may have been in the pastIs ?
G I
Tablets am almost cured. Why not progressing and evidence presents j White (
1- New Brent Building. 17 South Palafox St. {9 get a package of these tablets and get itself that she will soon be one of the I'the!r
well and stay_well? Price 25 cents. busy places ou our .West Florida son.
For sale by all druggists. :coast. We have not only the "Tar. j Mrs.
,,' pon" to come twice weekly, bringing 1* : the
:her cargo from east and west but the j er.
i I steamer Thistlewood has been put on : be
riI PONCE deLEON Ii as a freighting: craft plying between!
.
I I Mobile and Carrabelle, touching oa time
1 The Blistering Sun Don't Effect her route 'Pensacola, St. Andrews, I } can
Millville, St. Joseph, Apalachicola. and I of ,
i Carrabelle, and now a third steamer, er, ; your
Special to The Journal. I
i s the paint, we selL !It has the staying quality as well as Ponce 15-On Monday the "Manteo." with capacity to carry Dr.
debeon. Aug. I
i the covering quality. From a dollar a gallon up. Full night for unaccountable reason, large freight and forty'passengers Is !
:
1 line of Builders Hardware at rock bottom prices. Money some tc be put on the line In the near fuiture who
the mad pouch for this office was
,4.f'!' saved contractors who submit their estimates to us. i thrown off over one fourth, of a mile+:I I which! will give us "boat days"
s'x' days in the week. ing
.
1 before reaching the station and usual i
I! The. board of directors for the '
j j plaCEr,of delivery and In darkness' It newr
bank to be called'The Bank of St. Andrews Will
find H. Such i I.r
: took quite a hunt to
I ; Mill carelessness or Ignorance Is : are men to warrant the publicIn the
Saunders Company believing that It will be a solid or week.
able and table;: to lead. to loss u.nexcus-I .
1 fus'on.tMr. ganization. The board is composed of
i Phonq 717. 21 East Garden Street. : W. C. Mason has drawn the,the foUow'ng! gentlemen: J. H. his
1 r water from his pond and has a forceof Dnmrmoad, J. J. Trousdale, L. M. few

1F i meant repairs work on his making mill before some the necessary busyI Ware,''of Pensacora, of.-st."Andews,,and W. H. Milton. E. -Mathte of Ma, .

if season begins I I(ranna. Mr. DruTcmond to take the! i i; h.; P b
,Mr.. D. Hughes made a business: 'presidency of the concern and W. E. come
ij i Mathis will be vice'president. Mr. F. relief
j University of the State of Florida trip Carpenters to Darlington: are now on Monday.at work putting:I Bullock. ; of Chipley, will be cashier. ne I -

the finishing! Very soon a suitable location will be a
touches the
:t GAINtSVILLf, ft/I. on public .
procured and a'fire proof safe, building -
school buPding! at this place -
i p A high grade institution for young men. Literary, Scientific to the nest term of school preparatory | will be erected: Until such ar- :
; and Engineering courses. Mr. Chas Cotton, Secretary and; rangements can be made it is probable of

; STRICT MILITARY DISCIPLINE Treasury the Bonifay "Merchant'eCo |. that .a The temporary.articles open'ns of Incorporationhave will Toemade. i to *
([nc.) expects to go to Body never
1 Fall term opens in Gainesville +September 26th. For catalogue about Sept. 1st to take up. his .work, already been: forwarded to thesecretary most .
{
} and information there. of stat at Tallahassee.Mr. no .
'I address.ANDREW SLEDD President --Mr. Edgar Gavin, who has been in!,I H Z. Taylor; of Wewahitchkawas sale '
: t-Southern Alabama; for some time isi a visitor in town this! week. f
1 GAINESVILLE, FLORIDA. now visiting relatives: at this place. j I Mrs M. IFbst and little son, Gay- LJ'r
We :notice that farmers. are haulingout don; are at home from a visit up Bast: i or J
cotton bagging to bal nay! with relatives and friends. H
preparatory
I I
Ing the fleecy staple. I I The schooner Maxwell with a cargo f
,I of salt and other merchandise arrived) I
The intense,itching characteristic of from Pensacola on Tuesday afternoon. *
II' tow Rates North and Eastvia salt rheum and eczema is instantly allayed Messrs: Forbes of Cromanlou, and i

by applying Chamberlain'sSalve. G.the H.I visitors I Oontelle of.the of Parker week. were among. J *
As a cure for skin diseases ley
!
:
this salve is unequaled. FOr sale by Mr. W. H. Milton, of Mar'anna isenjoying .
will
all druggists.!! I I an outing in St. Andrews this t *

;: L&N1RR1t. ; week.tA party from ZMakely. Ga. consisting ple I II
of A. J. Fleming. Capt. W. W. Davis : i i
I COTTAGE HILL I oT Forsyth Ga.. Capt. A, G. Miller, who
wife and sons Will, :e, Davis and Geo, <
18 bars W. W. Fleming and children
Saturday August
1 I I I Miss Ruby, Alvan. Earle and baby
,
,
Special to The Journal. Hoye I are occupying the pleasant I I
Cottage Hill, Aug., 15-Mr. JohnBaumf..ster house of Mrs. L Ware and are enjoy- I I
1 had the misfortune to lose ing themselves to the utmost .
ROUND TRIP FROM PENSACOLA one of his fine horses last week. i j ',Mr. Chas. Porter, of the Ware Mercantile son .
Mrs. Jackson and son Master Clydeof Co, was in Bconflna last week Harp ......
it TICKETS LIMITED, RETURNING SEPT. 2 Gonzalez, Mrs. Wilder and little SOIlGlE.nn Mr. Willard Pratt has sold his home' Mr.
r of Cantonment and Miss Mattie property on Commerce street to Mr. :Point
:! }1St Louis__________---$12.00 Chicago------- ______$15.00 I Lee of1ulat, visited Mr. and Mrs W. Forester, of Chipley, and intends, In his
1''''' H. Smith and daughter one day last a few days, to leave with his family i Mr.

!:}. Louisville, Ky________$12.00 Cincinnati_______ ____$14,00 I week. for Denver, OoL .'
,. Masters Hunter Frank !
and Sh'ppey
Mr. Chas. Beall spent Sunday: with Mr. ::
his parents Mr. and Mrs Beall. of Wewahitdhka are visiting Mr. and
I
{if; Norfolk, Old Point Comfort, Virginia Beach, Ocean Mrs. N. G. PostSTYLE r
Mrs Jack Nichols, of !Pensacola paida' of
!*;k View, Roanoke, .Hot Springs, Va.! 'White.Sulphur visit to relatives here Sunday.A I prise

t.<: Springs, West Virginia, Wrightsville, N. C._____. _$18.00 new son arrived at the home of, --I
Mr. Mrs.
'.\: and Ed. Lawson: Saturdaymorning. y

!:t Asheville, N. C, Hot Springs, N .C,, Tate Springs, Mr. Steve. Bennett vas a caller here! y

i.i. Tenn________.---____________________________$14.00 I Sunday.
f. Mr. ChasLevey of Ttensacola visited

I: :;... Monteagle, Tenn.______$lL40Lake| Toxaway, N. C.$15.4 his father Mr. C. N. Levey Sunday. and !
-
j1 Mr. Reave return last week from '
d oj,, For further information, apply to Tennessee where he had been for several be are
I, weeks on business. /
j[ R. W. SUBLETT, Depot Ticket Agent. W. H. Smith was in MoHno Sat.' tack

;j :' J. W. LURTON, Div. Pass. Agent. urday ilrs.on Gray business.of Pensacola is visiting: i., 'out I
1. ::'
! ".- her daughter and family. is Vp

I
f hand .u
' I

f ,ELECTRIC. SIGNS ARE POPULAR. it SAGE LEAVES I For: .

! ,t Why dont TOIL try .one in front ot your place of bus<- -
11. ':ness or In-your show window? "We: can put it up'for

t.i; you at reasonable cost Special.to.The.Journal. I I NOTES

Brent, Aug. 15.-With only a. sprinkle \ r 'l
e BAY ELECTRIC AND SUPPLY CO. of rain on jt!}L JOHN MASSEY. JACKSON BRANDON. W. T. BIDWELL Deeding a seasonable return of copious -I models always harmonize withfashion's

PHONE 570. 205 S. BAYLEN STREET. showers. !I latest dictates.
Just when'f.commenced'writing this Both coats and overcoats have I
ice
.
a tendency to be shorter and
report !Friday at ,
on noon we had the
1\ visitation of a furious whJrl nd'i form trace garments will. be I .1.1I tele-
enveloping the house and passing off., even more popular than before. I
AWa ta a northeasterly dir ct1 Feels hip to a
gracefully
mao soon formed 'Immediately overhead. It tapering I. : !
I began to sprinkle and In spite of the I medium: bottom.It I
dry forecast it Increased to a drenching -, Isn't a bit too early for you \ It get
DepressedIf
f' 1ic.: shower. to order j our fall garments and Ing j the
!airs.' Lon Ware, from the vicinity' ft will be well worth your while and
f.. has to look in on'us and se whatis .
1 frwcrueDt, LaaQ.ches,a- of Birmingham, has made her initial Th ,
i; ,it 1f P weu.&omo aloe of visit wkh Qoptotrfa cousins. return-: in prospect is ;
IIOme dInt
Ie aIi IDaIadng tog homeward last Monday. I i to
the I was glad to hear.from Prof. Allen, SUITS ling !
: s Liver. the
once more through the columns of,I i
TAILORED TO.TASTE.
-1 fan to Wt The Journal. iHe' Is straying so far glate in
: ay et Jour dr1z cI5tI.holly that I I to
away sometimes fear he may be!
". stolen! I I $20 to $50. pro<

'. HERBINE.i His pen picture of Andalusia is very:
complete but he does not say.,when I of
of aDd they will have that railroad, through wr( aaFR I
t =m" a sbetrDOnDalI 'litldeZ. to Pensacola. rrvr ......
i I niter Iat1Dc Uao fib On Tuesday morning a worn out Inv.
I 00 c.a... AliDRVGdSTS. horse at tha j-oadsMe In the northern tion
; c'ty suburbs made a scary display for Breht B.Hdji{ll 'RANK B. GARDNER. -I' I ; ;
passing teams. The horse tad refus I





\-'l : ... ., ....... >.
: ,
,
: .. ,
.
-
--J' ; ;- :- 2: .h. : .. ; ; .,,,,. '
"" :+';':_( d .z. ;; Jt: f: -- I ?>. '. .- _. ,-,--",,;; .. -c. '" ''' <...".., -- : = l :.. __
:L _



.
r -
: : -

{ "r. 't-j.:?<- f:; ".'.-. >- '. .:. : ,; _...",,_ ., \'_"';- '.'-"-" :_ "" 'l ," -.. .'; '- .- .: ,''': 7,:: ,: ...- ."': -<-. oj; <0. ,: '. .f ::: -' ';/ > ... 7






;: '1'AaE14T ..._ rIl 1"HtAAoUUJOURNAL, THURSDAY MORNING, AUGUST" 18, 1906.,

.
.iii .... .......- .- .- .- .- .- ....- .- ............8...................
14 '

.1(. >- TOO YOUNG: TO ef MONEY NEEDED I WHAT' IS 'IT A MAN -.. i.




; Ready For That Trip' To ENTER PLEA IN DESERVING WOULDN'T GIVE { i f fto



increase the comfort and pleasure of his wife? At any
The Mountains ? rate there's nothing in reason that a man ought not to be :
willing to do for her comfort. For a few dollars-thirteen :
OFGUILTY F C CAUSE of them-he can make her housework a positive pleasure +
to addition to which he will likely save a little money on .

. his fuel bill The way? Let us install a gas range In rJdtcben.
It will do' the work all right. .i


How about your stock 'of collars Judge Beggs yesterday: listened to 1 f Don't look so at the thermometer- Witness in Peonage Case a L :
by the I it will not make feel more
cuffs ties shirts socks. underwear etc?- charges against the negro g'rl rod any .

Got, 'em all right? Better, look over name of "Little Annie. ," and who multi is cool comfortable.'and comfortable If you for'Want summer someth'ng wear Worthy Object of Charity- i ; Pensacola Gas Company I

held in the county jail upon a I just call at Sour store and look' over
what you have and.replenish your sup pllclty of serious charges,
ply. You'll need a generous supply fora I see'ng the girl and noting the fact:I nishings. You will. find them light .... >......... .............4t..*....S.. ..4...1I.....

trip like that. Our ties at 25 and 50 I that she was hardly in her teens the I I comfortable and airy, just the thing -

cents are beauties; collars two for 25 judge declined" to accept a pea! of,ton days.need We to are keep, having cool spscial these warm sale !peonage the charges preliminary against hearing certain of employees the.! ..................... ..........).................. ....

cents guilty to the charges 'p nding against in Bath Suits ,ana you ought ,to take I .
; underwear 25 SO'cents and a of The Jackson Lumber Company

dollar a garment; shirts at 75 cents to$2.50.they're to her.do.This She was had what been the In girl Jail wanted for: a'I advantage chase. :Of this, opportunity. to pur-.. most of important Lockhart witnesses, Ala., one was of Man th&'oI : i i MARION CURRY & CO. f fIncorporated.

all here just waiting to month or more and ev'dently: wanteda Jordanoss, a Bulgarian, who is unaoie *

be wrapped up and delivered to your change, and when she saw other I to speak a word of English. Jor
danoss testified to having been treat .
home. prisoners go up and plead guilty and .
ed with extreme cruelty while at the t
receive sentences, she decided to do : Wholesale Dealer in
:
camps of the company, and his condition
.. 4, likewise but the court "decided that White & :NIXOUTF1TTE wh'le: on the stand was so pit.

she was too young to, realize! 'what she tul that a collection was taken up for


was charges doing meant, especially a long' as term each in ,the of the re RS place the during purpose to his stay illness.of and providing medical He was him attendance absolutely with: a i i Hay, Grain and Feedstuffs I

form school Her case will: come up Your Money's Worth or Your Money Back destitute, burn-ng: up with fever -

at the next term of the criminal PHONE, 790. and so weak that he could, stand only! i Pensacola, Fla. J
with Mrs Finney, of W. Ro-
difficulty.
THE JOHN court : ... ......................
WHITE STOREPhone The little negro Is the one who Next toNew, Brent Building mana street kindly agreed to take ................ .. .

the poor fellow in .and provide for -- -
kept the police and county author
29 S.PALAFOX ST. him for a nominal sum and ne L
ties busy some :weeks by going 1 ANNUAL DIVIDENDS
ago taken to her house where he is at
225 205-207 S.:' PALAfOX from one home toanother, claimingto present and where he will reman '

have no home, ..giving the name SAFES 1 SAFES SAFES! SAFES! until well. :I' cannot be lost and they may be used to

or'"LiU e Annie," and after remaining Buy Diebold Safes. made Several to hare days the ago man an,taken effort to was the I i ihospital reduce' the each if the insured
premiums
there a short whIle! making away Scarritt Moreno Agent. and arrangements to that year
'with as many valuables as could, be end were completed with the dtyj I
: chooses A life Endowment
THEBIG' secuerd. phSiclan The day following, however ,' so or Policy with
BASEBALL
Four other prisoners went before it was stated that no beds. 'at'!'' annualdividends in the Union Central Life
the hospital were available, and as a' .
.,4 the court at the same time and pleaded SHIPPING NEWS conequenceJordanoss'' is dependant}

American'' League.Washington guihy receiving sentences upon: the char'ty of the public until i is ,the most satisfactory.
4 'St. :Louis 2. Court..
; The Municipal such time as he can be placed in
of today is exemplified Cleveland. 3; Philadelphia! 3, ca'ledat Thirty cases were on the docket for charge of the United States authorl!: B. S. WILLIAMS General Agent.
end..of. -twelfth. ..on account- .. of dark trial In tie municipal court 'yesterday Arrived. ties to be held as a witness against ,
in the Qualities of the nessBoston'. morning: before Recorder Laney, the m'en who are under bond for trial I Thiesen Building. Phone 608
0 Peerless, Brss Thomas, 2011
; Chicago 6: ,
the
but of this number three cases were upon charge of peonage.
Headache Remedy.BROMOVIN. New'York 10 Tampa to GuK Transit Co. ...
; Detrolt2.: continued. Of the others two defendants The total amount collected for the
Tolesby, Br ss, Owens. 2662, Sau- -
were discharged and sentence benefit of Jordanoss was $1879, and -
'National League.Cncci suspended in two cases, Fines imposed tos to order. of this amount $12.00 has already
: natl.3; Philadelphia! 1. amounted to $129 Cleared.. been-expended leaving a balance of

Quick, Certain Agree- 'Pittsburg, 3; Boston_ ,5, first game New Suit Filed. Musician, Br ss, Woollender, 3047 t6.79 on hand against which there 2s ICE !
Pittsburg 10. ; Boston. 4, second The following new suit was Sled for Liverpool with 318000 s ft sawn a debt-of about $25 for medical at
able and Harmless.For game ._ .: : yesterday in the office of the clerk of.'timber, 506,000 s ft lumber, 12492bbls :tendance and medicine The condition -
Chicago; 10. Brooklyn7.ew the circuit court: rosin, 1,193,85 lbs tobacco. I of the man is such that he will There has been lots of fuss and talk over Bryan's twenty-flv
Sale byWhite's Yo'St Lou's, :postponed account Elizabeth 'Moore and Henry Moore Saturnine Br ss, Ondarza. **** need 'care and medical attention for cent Ice in Jacksonville, but a glance at the Jacksonville papers will

PharmacyPALAFOX tfew'York not arriving.Southern \-S. Alfred Moore, et al. petition: S Bayonne, with 2,860 tons phosphate possibly, a month longer before he I show it is only the rich people and large consumers of ice that

Pasco, Jr., attorney for pet!tionen>. rock. can be taken Jn charge by the United I j are buying at low prices. Small cuts of I Ice, such as the laboring
STREET. League.Atlanta States authorities, considerable more I people buy, are selling in Jacksonville under the "Bryan Agreement"
*
Manufactured by 3; Birmingham 1. MANY FLORIDA RELICS :A VESSELS IN PORT. money will be needed and the chant ,to-day at one-half cent per pound; here in Pensacola these same
G. VAN ANTWERP & SON, Montgomery 1; NashvIlle 2. AT TAMPA STATE FAIR Stumshlps.Arona able people* of Pensaco'a! who desire' cuts have been sellIng! at two-flfths of one cent per pound for the
Mobile, Ala. Little :Hock 3; Memphis '3, called t o do so may s nd contributions for past 16 months, a difference of Ten Cents per Hundred In favor of
in the eighth. to, allow team, to catch Wh.at Br sch, Spurr 583. Cie fue- his benefit to The Journal with the I our people. The' workingmen of Pensacola can rest assured tfc/it we
will be of tha in -
one most gos to J. A. MerrItt' & Co. is will continue
tiain. assurance that the,cause a deserving to'give them ice In small cuts at the same old price
MEN ARE LEARNING THAT BY Shreveport 5; New Orleans. 4. treating features of the ccm'ng State Clara Aust ss, Rajusen,.,2541, Tampa one and that the money w.:II be and will not, under any circumstances follow Jacksonville lead of
BY LIFE i Fair at Tampa will oe tbe..grand. to Gulf Transit Co. used: to allevate! this man's .sufferings low prices: for the classes and high prices for the
ASSURANCE masses. Sent
South Atlantic League. i play of relics, for which a. large and I Cjnthia Br ss, McGrath, 1938, Rio t and make him well again. us your orders.
incomes are maintained mortgages Savannah 4 Charleston special department wifl be prepared Janeiro to the W. S. Keyser_Co
5.
protected debts secured undevelpoed Columbia 0 ; I and probably an addi.toool.bullding.: Devonshire, Br ss, Coull,.2432, New
enterprises guarded business rendered Columbia 1; Augusta, first game Relics of every :kind pertainning to t Orleans to J. A. ilerritl,&..Co. W. S. GARFIELD & CO.
; Augusta 4 .
second Korea's Mania For
I Sehla.Of
orfdas: de for
safe, investments given permanent past history are ;red Emilia, Aust ss 2321,. Consulicb
value and capital preserved. A policy game. I lexhibt'on I : : and premiums will be offered Philadelphia! to Gulf Transit Co. late ,the movement for starting
Un! THE EQUITABLE does all this game.Jacksonville! 3; Macon 2, first on all, Relics and ,antiques of Elizabeth, Ger ss: ::Klan, 1287 schools in Korea has almost amounted Office and Works Cor. Hayne andWrlght Sts. Phone 88

and more-provides for the family after Jacksonville 1 I the old days when Indians held full I Swakopmund to the W..s.: Keyser Co to a mania, says the Korea News. We
your death. Send us your name, game, called in ;tae Macon 1. econJ: sway of Florida, ,followed by the Ad GracIa, Span ss, Ruiz, 2122 Liverpool find them springing' up on all aides -a.-
ege and address.KNOWLES Darkness- ninth. account vent of the Spaxrards, also those of to Gulf Transit Co and there is' scarcelv a Korean of ::
f) the Civil War and Indian war perods Hazlewood,' Br ss. Rendall, 2791 wealth or position who has not become RAINY DAYCLOTH s. -
BROS., !Insurance ere desired., There will tr appointedto L Rio Janeiro to the W_'S. Keyser Co patron of educational establishmentof I I

-- ----: CHAS. LeBA.RONTALKS superintendents look after this, and department every xhib4 special I order.Mona Nor. bk PedeSrsen;' '. 1028'-, to some: kind or other. It is to be fear Be Prepared to Make a Good Appear TENNESSEE
: '
nee la Wet Weather.By .
ed that
some of the enthusiasm which
w 11 be kept in absolute safety. Those Musician liS W
Br .
30(
Sacrifice ON EL PASO having relics and antiques worty of r Belize to A. A. Brawn, & lfender Co. is at present being manifested will the kind of clothes she .wears on

Big exhibition should address PresidentT. Nith, Br Richards. 1488, Newport wear off in the course of time and that a rainy day TOU shall know the mental HENSAt
J. L. Brown at Tampa immediatelyISN'T News to H. Baars &. Co. some of the schools will perish either habits of many a young woman. A

Phyllis, Br ss, Founta'n! 1579, New from want of pupils or from want of girl may have just the nicest kind ofganJlents.
sale of all FORMER PENSACOL1AN IS ENTHUSIAST Orleans to Rix M. Robinson. funds. The movement is, however, un ;
clothing in stock. Suits ; .tor all other days In the 50
rallied Saturn''na. Span ss,.Ondarsa, 1786, doubtedly strong one as all enlightened centsI'
at from
$13.50 to J25.00 to goat C CVER HIS NEW ITAIR week but the day it pours rain is the
Liverpool to Gulf Transit Koreans i
Co. fully appreciate the fact
from 17.75 to $16,75. I day that tests the real stuff she Is ;-
HOME IN TEXAS. ShipS that until 'at least primary education We are receiving daily a
made
of.
I. TO SUPPOSE becomes general throughout their country lot of fine Tennessee hens
I AvantI! Nor ship, Anderson, 1648 It she is a girl of forethought of
"None which
they cannot hope to emerge, once we are offering the
Reserved"f I ,That when\ Hostetter's Stomach Bit, London to order. well balanced mind she won't be at a public) at 50c
Chas and for all, from their each. Also
LeBaron arrived yesterday'iters 1 have cured hundreds of ,coses of r, 'TVnreisa Port ship Barros, 506, Lisbon present oppressed loss when she wakes up in the mornIng some fresh
I would rather lose a little mm El Paso. Texas, where he J toLena condition. Tennesseeeggs
money on j went;Stomach Liver or Bowel troubles master.; to find, skies
weepy and at 20c
muddy
them in preference to carrying them!(!two years ago to engage business I: i during the past 53 years, it will cure Itai ship, Tassara. 1581, London I streets, for &he'h per dozen.
; over. Call and be and where he has prospered to order. s a neat short 'We'carry'a full line ofprovi&ons.
convmced exceea-\\i :jou, too It Is worth the trial at any' Hone Medicine For a Premier.
I skirt, : .
ingbsince.I While Mr. I waterproof boots and a small Give us a
-s; rate and jou'll be satisfied wIth the the letters
Among received
,arks. I by Prince I j hat for like triaL
glad to see bm old_home and old I result. One bottle days this In which garb
Jesus I trends: again, he Is loyal to his new of Alfhlld, Swed bk, Svensen, 1332: von Buelow, the German premier, during she feels. neatly and smartly dressedas
COLEMAN 'home in the great West and to a Jou": HOSTETTER'Swfl Durban to master. I his recent Illness was one from a when she wears her pretty linen

[nal representative yesterday he de convince you ,that it Is the best Andrea' Nor Sk, Quale, 114, Durban' veterinary, urging him to take the contents 'I frock and low ties trader smiling skies. J. E. CONCANNON 6 (0.
clared that of a bottle which '
El Paso was file to master. accompanied It. But there
best.city for relieving and preventing attacks another kind c/ girl who
212 S. Palafox.St. in Texas and Texas was the best of Cramps, Diarrhoea Biliousness Launberger, Nor bk Johnson, 1215,II The medicine's efficacy had been fully I never Is prepared for rain and. who
state in the Union. Hamburg tested, be wrote, horses 509 S. PALAFOX.
\Heartburn, Costiveness, Dyspepsia to McKenzie Oertlng & Co. on suffering I la shaken Into a state of mental con
Phone 727.. continued"We have no knockers in K Paso," I Indigestion, Female Ills or Malaria. Noach VI, Swed bk, Burgfeldt, 1260, with. sunstroke.O1'FEE. fusion at the sound of raindrops pattering PHONE 1423.
Mr. LeBaron "We won't Port Natal to order. : '
I kt them live lliere.We'lt shoot a Paolma, Itak bk. Siccardi, 1198 : on her window of a morning.All .
man who had nothing better to do c eoa to master. her provisions! are ,made for sun;
than to run down his town. I am 'otaut. Nor bk, Thorsen, 1170 Mon shiny days. Half hysterically she Ice i Coal Charcoal and
glad to see Pensacola going ahead: tev'deo: to Southern States Lumber I dresses in odds and ends of her vvrd- ,
and glad also to note that real estate: THE Co. robe-an oldsklrt, too-long and he-ivy
Our and rents are both going up. That Superb, Nor bk, Ulich, 1934, Antwerp and too shabby to be hurt; a soiled Wood
Is always a sign of prosperity. Real to A. Zelius & Co. blouse, untidy'shoes; to save her best
'estate and rents are much higher lu Schooners.Donna We are the Pioneer ones and probably her usually too big Delivered anywhere in the

in Pensacola'E3 Paso'than when I left here, but LITTLE Christina, Am sch, McLeod1 Coffee Roasters of shade bat, decked with flowers and city. We can supply you in
they are about three times 165, Belize to master. feathers.
Uglier than they are in Pensacola. West Florida.McHUGH'SBLENDS. any quantity and our services
: Lightweight and no one la El Paso kicks ;, You can always telV this girl when i
about BOARD OF EQUALIZATIONIS
always
it The Journal. has kept me : MINISTER you meet her'on a rainy day. You prompt. Phone
pretty
well NOV IN SESSION know Just.what-a 363. -
posted on Pensacola and C ami,I morning frenzy she
glad to aes that the ,paper is growing experienced. Jed ;you wonder ,why
and prospering The city board of equalizaton Is It is. she never learns that'rainy days
Oxfords (Mr. LeBaron 'was one of Pensa.cola's 1 l CIGAR now in session from 10 a. m to 1 p. are as certain 'to come 'as clear ones E. G. SEWEL,

orIginal Carnival Associ t'on:;I m daily at Tax Assessor Reilly's office : and that it n the part of good; sense to 26 N. TARRAGONA STREET
men and to his efforts was due a large! The ThIesen building Persons having have no equal. A trial prepare for them:
of
part of the success 1 Cigar Quality comola'nts ,assessmentscan -
our Mardi Gras which attended i regarding will convince the con It is surprising' how' little the -
call between hours during
Ct'lebratlons11Ue those
Make your feet glad for lived several here. days.IRe will 'be in the city hs, "The cannot fool all the; month' of .August and their com- noisseur that we dressed weather affects to, meet one'it,mentally whereas If the one girl is Marine Grocery Co.
plants will be heard
to get them. They the people all the time," WM. E. ANDERSON. make no extravagant who never I looks out for rainy.days'i?
604. 605 S. Palafox
fit the feet easily lIt'1lnc1 and Maaer.. that's ,the reason why so A. V. CLUBBS, claims. and always disagreeably upset by them Phone 725. St.
and Did ;you e\"er'stop to think that chil II G. DeSlLVA.4aug2w considers 'them a nuisance quite
: '
brands of
comfortably many cigars unnecessary in the general scheme V. J. VIDAL
dren. as a rule know each other far Board: of Equaliiation. of Manager.
'- are soft and pliable. better than their parents and teachers spring in the lime light Wholesale' and RetailGROCERS things. _ We carry a full line of Imported and

do? Boys and girls show their real I and then back into oblivion I -*- Saviag.Do Domestic Groceries and Provlsloa
Notice Public.We W*
the want
.. characters at play:when they have not to your patronage.
The little Minister your saving at the beginning of Fresh stock cf Eastern )Ia.ckeralJat
the restraint", of the presence of their sails would like to state to our many the week you who live upon allow received, 3 for 25 cents.
$2.50 to $4.00 elders or any Incentive to appear at Cigar on its merits. friends and patrons that our launches ll: ances,,or, what is the s:1Ine. so far
'' their best., 'So when'you tell your boy and is becoming more have nothing whatever to do with any: and all J kinds of Feed thi:t counts, upon a salary.: The extra as
wisb be'would other boats that leave the cty: wharf
you be as gentlemanly! Florid
and polite as Harry ,Lee ;your viewpoint and more popular every for the island or any other points of 1 expenses which often come upon you ,/and Alabama
is that .of Harry's conduct in day. People call for interest We< would further inform unexpectedly in the latter part of the
'
Get Your the people of Pensacola that we are I week may be easily) met .If you've LAND COMPANY
house
Furnishings Here :jtrar when he comes on an er them because they Stuffs.Water been
are here in a position husbanding your resources
rand or to with to stay and are now 1 a lit-
play
your boy. Your good. Price 5 cents. to to place tle, Instead of spending Manufacturers ol
eon knows him as he 19 when off guard carry part s any J, :Pluto up to the lastcent. ,
on the, playground selfish, rude, sly, they wish to go at any and all't1mes.j'We A good, plan Is to allew yourI| and Dealers IB
have ( self LUMBER
been in the so much for little SAWED CYPRESS SHIN.
perhaps-and be resents being asked to The expenses for a
I ness for 10 years and our boats never I!i given length t>>f time and then to I tiLES AND. KILN,DRIED SAP.
copy such a character, a writer-in keep
says yet met with acc1d nt. We use all Wholesale and Retail. within daily bounds .
the Mother's Magazine. Quite likely I precautions for the safety of our pat ; saving even a bit -- -- -

H. O. ANSON your boy has on, his company manners. Lewis Bear Co.I rons.We carry a life, preserver: for each i not from called that, if possible; Then, If It is r. W 00 uavgtTym! te
uaersoZaorph1aei
,
,, too, when away'to an extent you would pasenser., We will ittead to all orders New Orleans Co. upon by' some little emergency PAINLESS j upton, l Bd oBi
I CASH CLOTHIER hardly believe. Children! hare pride,in for/Ice. 'refreshments,'etc. Boats can I Grocery either'put. It away or use It I f: ;
their behavior. and It is an old saying Wholesale Dealers be ch&rtered any time. day ward some definite purpose, such to-I on J ,r-&
well proved that they often behave at reasonable rates. We ; : subscribing to--* good .magazine PIU I Mea1uOnrhJJke1 i or
.
COM Pilifoi .
'
lad. .'Mtin. tter'when their "parents, are not Pensacola_ FJa., launches "ourftee 9rmght.I':1 Jas. McHugh ting a good boot or seeing a gxl play ,ment.Idarws lt.
&around CAPT. BENNIE all of which should be considered as *74 I D La. M. WOOLIEI,

I Phone No. 204. -- City Phone. 0S. Proprietor, mental_iavestmeots.. I IiI ,,l. ure ;frti

.
.
: "
..

"k". -..- "" .. ,F!! "
j:0.".!!; .- r L ..
'" ,:
c
< = [ dk-*<:. ;; '.' &. Uh'4'-" ., ;;;,; I .. -1 ""' 1-"J. ..-, : ,2. -,. -
j "' 3 = '"'< ii ; li:; 'IffioiI.Lif.. f 1fr jmr -.;., ,f- ,. '. I



;: ::: _- : '" : c-: : : ::: :::'; : : 4- ....-"""' --.' ...-' --.,.". 'pN_ .

.. f 1'i n

,

# .
,
,


Get readers with in Z5 touch,= W.t t Ad J t m. j.I' ., )I'OU' t.nl'. i I TheJournal'sav.erage. Daily for, Circulation the 5 848 k ff M


Use 1 Journal 1 ..... l .......-. first 1906.6 was months. of. f '

..... ,; .

; J THE WEATHER:, .Showers Thursday and Friday; light.variable, wins : \t
.' _" .: -1

VOL. IX NO. 196. PENSACOLA MOANING. > {
FLORIDA. THURSDAY AUGUST 16 1906. I i
I



IThe Journal's New Office is at the Comer of Intendencia and ; 8! .t!.- +T.h t f I,





1 N-WOlfE TBX.POR I CEMETERY j MASSACRES BY 1 STENSLAND I\II L. & ,iV. ''! !i I



BRYAN i ROAD WORK IN THE EAST ON '


WtDOING ATITAl *. i WHOLESALE .. .. ? t ;?.. ry


Democratic Convention Expresses Will Be Commenced as Soon as Defaulting Bank President Seen Charged With ,


Unbounded. Confidencein Piling i Removed at AlWAR AW on.Board PennsylvaniaTrain. Y Against Union t: _4. ''it

glithe
Him i Bayou. graphers.

._____ ____._ r t .

(debated at Home of the Bride's RESOLUTION ALSO EXPRESSED COMMISSIONERS HAVE DECIDED Policemen, Gendarmes and I Infan, 'MET .BY CLOSE FRIEND WHOM CLAIMED THAT MEN ; .. ; I

HOPE THAT HE WILL BE NOM.j TO ASK WAR DEPARTMENT TO, HE ASKED .NOT TO GIVE HIM CHARGED FROM
Parents Wednesday t try Patrolmen Shot t Down by f :. I

JNATED 'FOR CAUSE OBSTRUCTION TO BE AWAY-BANK DIRECTORS REPUD1ATE CAUSE :THEY ?
Afternoon. Revolutionists. ,
TEXAS REPUBLICANSPRAISE( REMOVED-WILL MOVE CONVICT RECEIVER APPOINTED UNION-CASE WILL [ r

ROOSEVELT. CAMP. BY COURT, TINUED TO-DAY. t';" i

CEREMONY QUIET -.. -. HUNDREDS INJURED 1: eif

By Associated Press. :As soon as some piling, which i is _. By Associated Preta. By Associated i: 1, .

Dallas, Texas, Aug. 15.-The democratic now obstructing Little Bayou, is removed 4 Pittsburg !Aug. 15-Paul O. Stens Birmingham, Ala:, Aug. fi. ;i

tHing. to Illness of the Mother state convention today adopted the work upon building ,the Horrible Treatment: of a Young!I IWoman land, the defaulting president of the+ preliminary hearing of t t I t ,

a 'platform which after' reaffirming county's portion of the cemetery Milwaukee Avenue State Bank at train dispatchers of the ; '

of the Bride. :i democratic principles! deals mostly road will commence.' The convict by Soldiers. Chicago was in Pittsburg today and Nashville Railroad i

with: state affairs. camp will be moved from its present ,; .--_ is thought now to be in the east. with discharging and ; -, f 9,-

Unbounded confidence ,in the location to a point where it will be Stensland was seen on board a Pennsylvania -'against employes of the t .JD
HAPPY COUPLE:) DEPARTED IMMEDIATELY TAKEN TO GUARD'S BARRACKS;
statesmanship and patriotism of W convenient for the convicts who will railroad train by Oscar:!they were union men, "was t

UON WEDDING J. Bryan appears in a resolution! together be employed in -building the road. AND WHIPPED UNTIL BLOOD Ilolmer, a mechanical engineer, who:day before United States [p k

TOUR WHICH WILL INCLUDE: with the.hope of his nomina The pitng, which Is now causing RAN FOR MAKING INNOCENT was a 'dose friend of' Stensland, but sioner Watts. { I' 'j: t
!Jon. the delay, is under the bridge of the had not seen him for two years. r W B. Dady testified + .;
A WEEK'S VISIT AT !FENSA Nominationsw'll: begin to-night.; Perdido railroad, and the commissioners 'REMARK AS TROOPERS WERE Stensland said to \Holmer, "For God's, been employed at WQlT I.i II i

COLA AND EXTENSIVE -TRIP T< have decided to ask the war \iPAS3NGlNVESTilGATION+ : DEMANDED
Commend Roosevelt.El department to see that it is removed Homier he was going east and said because he was a ? f ,

NORTH AND EAST. Paso, Texas, Aug. 15.-The republican so that the Heaters contaln'.ns! material I BY PRESS. he had plenty of money, telegraphers union. The ..' :;.

state convention: completed for building the road can be I:tempted to show that w ... .I f 1': i

reelecting brought down the bayou. The road Receiver discharged for other I '
Special to Tie Journal. its work today by CeciLyon By Associated Press. Repudiated. :" ;;
will[ be
Ta/labassee: Fla., Aug. 15.-''An in-I : state' chairman and nominating; will be constructed of clay and gravel .Warsaw( :"Aug. 15.-Many sanguinary Chicago, Aug. 15.-The directors of The case i '::'f :
Dr. _Carey A. Grey for governor and which It is thought will make an excellent the Milwaukee Avenue State Bank]
terestin event at the capital todaycie conflicts occurred here to-day; 'i i
I Frederick Hoffaeinze for leutenant! ) driveway: today: repudiated the Chicago Title+ IL I
.
of Miss MatUe! VioIt who
cis marriage with the revolutionists organized t f!!i !
.j!
governor. Reroutions'oornmend! The county's portion of the cemetery !and Trust Company as receiver and .
Vicson: and: Hon. J. Emmett Wofvlicb < wholesale massacres of policemen row.MAN
was celebrated at the home of S\ttevelt' administration. road. les: between the two and patrols !I took action to have. Judge Gibbons's : j'
gendarmes infantry f ;if r:; f
Mrs bayous and the commissioners are+ j I appointment of the company to take lI lil-f
roe bride's parents, Mr. and [The conspirators shot and killed t! j; r
' desirous of getting to work on it at charge of the bank set aside as rile :
Jam's1nson.. seventeen: policemen, ;four gendarmes: j!i ,:

TV house was attractively decor GETMORE as early commissioners a date as possible.fltie ; accompanied. and seven infantry patrolmen and j :\ }i::. :T) I

tied with palms, ferns and roses .anCSir fISHERMEN wounded a score more. I I r; I
W M.. Poage, of Trinity; church by the county attorney, yesterday; 'Soldiers fired a volley into the i TO OflG I ;rr, i, ',
gal.NTEIESTINC ;
:
made a trip to the convIct camp and
l performed the ceremony.The ; crowd, killing fifteen and wounding j: h (
bride wore a modish traveling made an inspect'on of' the same with bullets and bayonets one hundred r! '; : 'i'd

gun> of blue voile with a blue straw E HEY 'which they found In good condition. andMANY th'.rty :i *;,;;: .; :.

hi tdm med 'with "roses! in two WilSON f !I'' t
t l : :
.
e.ads of 'blue.immediately KILLED AND't I '

alter the ceremony Mr NARROW ES .AP'[ -wow.bED-AT LODZ SERMDN N ,WASHURn 1 it'; :;Ii H.' f

d Mrs. Wolfe laft on the Seaboard\ fOR fISH : t a;f S', ', !;
fc an extended wedding tr'.p.Xo { ,.
cards for the Lodz, Aug. 15.--- ceremonywere into the third district police station t j, s. ,''t i
rued and''' owing: to Mrs. Vinson's
fflnns, tae marriagewas- attended Of UTING house to-day by which the building Stevedores Hall J : '.; ;;

caly! by close personal friends of the Fishing Firms Voluntarily Raise was set. on fire. Troops coming toa.s15ist Night. 't1.A'o.! : 'i' i ; -tr

roBtracting families. There were no fired several volleys' and many ; !I.,,

sttendants. Mr. and Mrs. WoKe will Price of Snappers to persons were killed or wounded. t : ; ;I.,. : y,,;:
cake a week's visit at Pensacola after <
which they win go to Ch'caoo'Xew 31-2 I Cents. ART By B r Those Who Attented Metho listRevival'Services Many laobring men j I ; +ttt 1
HORRIBLE TREATMENTOF
: .
York t 1J
and iMobile
t returning to last' night! at Stevedores i '
Tallahassee Last \ t i 1
late f
in September GIRL BY SOLDIERSSt. heard the address of J'I" '
,,.._ ; ,: :
of Pensacola son of the Carpenters
The fishermen are '
Petersburg, Aug. 15.-Intense Night t.; !
now receiving more money for their Pensacola Boys 9 and Young Ladies popular indignation: has been created r Union, who Is here from ; :/ J' J
I I assisting: the three local ,
The advance "
lIT1 IANS f fJ catches of red snappers. here by the brutal treatment of Mile ;
cent pound Have for Life A and interesting sermon that; organization and 1 i; .
amounts to one per Struggle on / Smirnoff, a refined young lady, at the powerful Interrest in ,3' :-: t! {.
work
upon .fish of large size. or what are hands of the crack Chevalier guards was heard by those who attended up more .',1 i I;', : .y

known; among fish men as .counts the Gulf Beach. I While a squadron of these guardsmen the Methodist revival> meeting last labor. in Wilson general.Mr. made an ,; 'I.t\ i' :it! j 4

J K SON'OUNT The price for all classes of flan now were passing along the Nevsky Prospect -,night at the tent, corner of Garden mon sense talk to the ; J' ;t ;

r taken is now 3% ,cents per pound I yesterday Mile. &SarirnofT who',and DeVHlier streets. This revival gathering composed of all ,ifr i 4 f"
I J
Journal.
Special to The i
Heretofore it has been 3% 'cents for \gas accompanied by another young I!i which is being conducted by Revs. J laboring men, dwelling ;:; ,
15. MessrsQasque I ; ; ,,
(Perdido Bay Ala. Aug. ,
,
of
I W. Vreeland they
small fish or anything under th? lady remarked: "They are as gay a:; Barney Butler and Q. on the support : :
count size, and 2V& cents for counts;, Suarez' and Barn Olsen, if had captured the; Palafox Methodist church, bas another Those who h i : # ,
they Port Arthur.
men in the employ of Messrs.i dress spoke very highly of ,
raise in the price of fish! was: young been in progress now for two weeks j
Tlrs {Pedestrians, remar'rEpeated to t'r'
hearing the Mr. "Wilson expects I
Wm. Johnson & Son of Pensacola aspead.ng i :
: ,
fish housesof converts have been made' I.
made voluntarily by the it, and quite a crowd ool and many .Pensacola about the 25th !
Perdido .j;
.._._ + Pensacola, and the vessels? arriv. : their vacation on i reefed and joined 'n the jeering 't'ht' and much good a mpish.ed.! ,. month and will be ; '.
the time ,
Bay and are enjoying hugh Mitchell [ i
bringing .Butler had as his Organizer
,
ing during the past few days: i Last night SIr t
commander of
c.U Wilson and Ways r lewis HereEn large catches of big fish, made' }ry, in bathing. safdng, fishTng. launch denly. wheeled his the squadron caralarymen- lld gave sud text; : "The+ wicked are Vke the 'I. held.meeting for laboring men ,' 'l

from the trips. Since excusons! etc.The troubled sea, for it' cannot rest and;,I rt
good money in with the command to charge with drawn
: men company
Route to French Lick raised all fish unloaded young its waters cast up mire and dirt an 5 ivftii t
been
has
the prlce a party of young folks left "Perdido whips. The troops then charged the MARKET I
from vessels are, weighed on Beach"! last Friday' evening! on board:crowd, laying about them right and there is no peace for the wicked"4lthough IN 1 {
Ind.d r =
Springs P tLe scales and no matter what a ash the fleet launc'h' "Spray" with Capt Meft Mile. Smirnoff and her companion Mr. Butler i has delivered ,
ft. A. Kee at toe wheel. destined for the DOG ,
during +
weighs the fishermen receives 3% who in the meantime, had some excellent sermons I ,r :
gate Senator C. U Wilson and the Gulf beach at the mouth of Per meeting[ the large congregation last i t
Meriff cents per pound. d'ido Bay, to indulge in surf bathing passed: en down a side street, were + '
Bays Lewis, of Marianna are bes'1on
I thought tiat he at h's
was
1 1e the city to-day reached theca 'The new scale went_jnto effect recently All w.mt well wKi the merry rathe.-: pursued. They tried to escape into a night ( I
baring thatthe ,, ,n"t'1, 'Cr. Gas"' ue Snare, in the subject -he had chosen for his THIS OFFICE HAS t i
company
,'. last night for a shart stay en and it is needless to say j doorway,, but were caugit. Under much
with Mrs. and Miss Maude PaisleyVEnturei i' discourse and many were very '
lute to French Lick-Sppngs: where fishermen are happy over the in 'the direction of: an officer they were I MADE VACANT BY
wese tea: far out.Vltlout noticing I impressed.
tt promiment Intend spending Jackson the county next pollEaas fiffa <.- they stepped! off Into deep water'forcEd' to enter a cab and were driven- I The meetings, which,are held every RESIGNATION OF a'

t days: ; I I and coming Into! contact with the undertow to ,the guards barracks, where the ni-gbt. at 7:30. ,continue to grow in in- { t
It difficult to swim back> !. I OFFICIAL.The .
was t
Whenever taken before Colonel ,
a Jackson county poll MILLIONS OF young ladies: were ,t crest. and the public! in general is 1
Fortunately the ladles!
tcian visits to a footing. !
Pensaoola he always The latter ; c
Stenbockfermer.
brings s could swim a little.! While Gasquewas Invited to be present 1
; fme news it Is''of that a cheering Jackson natures county WHITE GNATS I II I struggling heroically to get his pas disposed to turn Mlla. Smirnoff: office of official .. ;

Il>1 go almost solidly'for Hon. T. A. charge; back .to where they could!. over to the police, but other officers I FOR for the city of 'iP-ensacola j ;. i
wade but seem'ng to get further out ''interfered finally NO RACE / !
imings should he offer himself as attndhate I| and the girl was vacant. The vacancy Is ; ,
I''Mr. Olsen quickly took in tae sltur, where troops 1 "; f
courtyard
for-the governorship In the I taken' to-the resignation of the party M
!ert election. Sheriff Lewis, who"eps HAVE ARRIVED AND ,.BECOME A]leon land nast'lv] taking the 'J"un tin the 'presence of two officers, adnin'stered TO-MORROW j been holding it for the- '' "I-i
j lady he was with to safe wading hastened I' twenty-seven lashes I I' i .
a pretty good line on thngs: IN SOME SECTIONS OF to her hours and who succeeded I .
PMUcal in his county Is authorirty PEST 1 I to the rescue of Gasque. and I with their whips. The girl's. ctothrng} -- ing about fifteen curs. i i ii
.01' the statement that Mr. Jennings THE CITY. the ladies. 'was cut as if .by knives by the wire c'ded: to quit, not caring i : Ii IiI
*0I11d meet with, almost unanimous (For a time the waves seemed aboutto thongs of the whips ,and her flesh TRACK AT KUPFRIAN'S PARK cism which falls to the ]J I t ,: '
'
sport in that county, as both,, fac.I ,_ I overcome the strugg.lng boys and j' was horribly -lacerated. party who aspires to hold : : ?, i
Ana would no doubt support h'm. ,their charges but through the inter t'J The papers are demanding} the tr'al WILL NOT BE'IN CONDITION .'office. Therefore the city t :i"' ,, 'f;, j
] any are now talking of Pensas Millions of white gnats are now 1 ivenL'on I of a kind .Providence! they, of both the officers and men who REGULAR EVENTS. I'market for a dog catcher. I r : 3
('Cla.' popular citizen as Florida's scanning; around Pensacola. and! so I succeeded; la once more ga'ning wad-i i participated in the affar.: Reports c* FOR I be; taken or even three, .r.
text 'chief executive.TEMPERATURE. thick! have they become In some sec ling bottom all reaching the shore'!(both police and private surgeons are _.. I good catchers and promise\. ;: t !
of the city that they ars a regular state'of much to
t'ons prostration
I n a f'printed descrrblBg in detail the ex 'for at least a week.
pest. From whence they came|jtne I delight of the'r badly frightened! Itent of' the wounds inflicted. The There will be no races to-morrow ,The party wno had : li : 1
i or when they will' depart Is a mYS-1 friends. 'I girl's;: back is so swollen that it is 1mpcsaible under+ the.auspices of the, Pensacola! the position went to the i; t ti !
tery but many are bop'ng that Since their experience the young
yet to ascertain whetherany and :
j as I Association; owing to the terday morning : i
I Driving
OF i will take their departure a; an early people do not th'nk so much about :of her ribs are broken. : 'badge saying he did not
86 DEGREES1ti ;dar the sport of surf bathing. Experience,i No action on the part of the nrilifttry -, fact that the track -at Kupfrian'spark the job any longer. The .' i f. :1
The gnats, which ;have Uu form of being a g x>d teacher we Infer that authorities has yet been an will not be .in condition for I Oiher. applications from : i ii
'the regular black gnat, were fit they are much wiser as regards the I nouaced. I'I'i driving. For several days .a large 'ug: the job at the present
e temperature In Pensacola con the latter portion of in with i '
not.ced during dangers that are mixed the
which
Twentieth Century, that there
nues The : force of workmen has been engaged k is expected t
to remain law and the weathr then so nucus necessaryo I -
Is last week .but Were not 'Treasures and it will not be printed another story of the case j eral to put In an 'f ,
clay the
i and depositing on
comparatively cool for Ch's sea and but little attention was paid caution them about getting too hauling 1i t-
oonllscat !,,
been the next few days and
!IOn of the year Yesterday a maxi- them. They began to, increase in far out. 'jhas!i ______ i iI I track, wb'ch is being repaired, and I. sitfon, holding it tor .t 'II'
num
temperature of 86 degrees was I however and have now be I I then Casque and Barn have next week before this wok :
hx'sttered numbers ;; S'nce I Twoo.perator Resign.J. it t will be ,,ben life! will become a '1 :
teen at the local weather ton- come a pest, getting into :houses and quietly settled down to business Is dlnished and .the track hard and I. account of the many .t: ; <
at 2:30: while the minias'76 to'' a'lowing I s: Bailey! and Amos Sbaritt i
p. m. covering everyobiect.: They seem They court 12 hours per day only countered. : : :.
!
McDavid and Molino firm and fit for racing.The : .
thickest operators at r. .
degrees 5 .
C> at a. m with seek vegetation and are found themselves 20 minutes foresis. ,
<' of an inch respectively for the' loufevilte and association"expects to have a The mayor figures that .
,
rainfall. Last on there trees and shrubbery .
year In yards m \
t t"e of races neat Friday afternoon I possibly1 one thousand
saute will leave the' service pf number
date Niashvine,
the maximum was 81 is grown. Gasqu Is!' the boy that came !In contact 1 ,
tegre Interest will betaken at large in Pensaoola,
; !!.ad the min'ntum 78 degrees j In ome'sectIons oft the city tieyi w'th the catamount last summer that company owing to the lowsalaries' and much '' and [ : J\Jel : ,
ritD have been be caught pounded
( there no racesor'some'time
)3
inches others : and will shortly leave for, as
rainfallth in arriving Ifke'a billy '
are thicker than with horns (so he said) cents ; : :
Lo. i will the and all lovers of the per head which is 11'
they enter
temperature the west where +
prevailed all overTuesday ,'n swarms but .usuaHy settling inlow :hair We are afraM that be will
of the are anxious! to witness a tilt between city world net the party I
service of. big western sport
:ntry 92 b gang the i places wh.ere there-la plenty: of come in contact with a homed< shark one catching f a00. R
est ;.vegetation..: + ii P. ;his gulf tathfag 'ft'ntm'es.Q roads. the ponies.. i!. itt
'
I. ."


.. -
7a" .
..- :;":.i'." ;, '. .' ..... : ', ,...' -. ....' : t ;' ./: };. i. j' j'
,. -T if '11.rdfJ7 r : &tr '. 1'1 ";l ., "tZt1! ";;;:1 1


-
-

< -, :: ::,' '" : ; --: :.. :' "

.

..

.
-
.' FOUl" TFiEPENS Al L 3tl GAL' 1'1tURSbAY MORNING, AUGUST 18, 1806.

--------------- ---
--
---
--

calls too many good.men liars." It Is -
true, of,course, that the President-lias VIEWS- SAGE'S HEIRS -
; VJbe Wen utola Journal acquired the uaeviable reputation of .

questioning" the veracity.of men who -
THE CIRCULATION
JOURNAL'S
stand as high in public estimation as
he does. However, that has' nothing How Some Relatives Regard
r to do with the question as to whether
D ILYI WEEKLY. SUNDAY. nancier's Bequests of $25,000.l'HANn'UL .
the President wants to be the next .
PUBLISHED EVERY MORNING' EXCEPT MONDAY presidential candidate of his party.j *
Ills intention In respect to the matter FOR FIRST SIX MONTHS OF 1906.The
..BY... will probably become evident in the : BUT EXPEOT'EDMOBNose E .

course of the next few months. If
i THE JOURNAL COMPANY. be really is working' for the nom! a-.

---- --- Hon white denying that he will acceptIt of Them Intend to Contest tie actual number of complete and perfect copies of The Pensacola
if offered to him the fact is boundto Will-For Many Tear Caele Rn >

FRANK L. MAYES, President act General Manager crop out in some way or other. i iH cell Had Aided Some of ,Them-Substantially Journal printed each issue for the first six months of the year 1906 was as

'-incident* of Hl. Early !
MEMBER THE ASSOCIATED PRESS. !; '.... stated below:
Oar Recalled br Intimate Friend.
C *
DEEP WATER AT THE *
For many years the heirs of the late
SUBUCRIPTION RATES
f* JACKSONVLLE DOCKS. #II ........... ......_...lan.
.. ... ...... Russell Sage, the famous financier, Dayr. .. w Feb. l\Ich. Apr May June
One Year ..$:) 00 One Month .. .. .. ... ., 45 -
Six Months .. .. .. .. .. 2 50 One Wevlc.y .. .. 10 have been living in expectation of be- 1.- 5700 600 5800 5i00
Three Months., ... .. ..125 Weekly Edition, .1 CO Jacksonville TimesUnIon.f coming wealthy upon the death of I 2............... .............-....5700 5700 5800 .... 5800 5100
per year. mHfflHHH..flThe Uncle Russell, a special dispatch 3._... .................. ...... ....5100 5750 6900 5850 r00:} 5950
:f from to says York World. 4.... ...........................5700 6000 6100 5900 5,00 .
Troy New
The Only Pensacola Newspaper From Which a Detailed He has the 5..'............... ...............6100 .... .... 5950 5900 515
that
rapid and effective work helped the majority of them 6.......................... .....5800 5750 5700' 59GO 6250 5750
Circulation Statement Can Be Secured.Pkones ; Is being done in deepening the riveTis financially from time to time paying 7.... .............'............ ....6000 5700 5700 6000 . 5700

: highly gratifying to the people of doctors' bills or answering with a 8.............. .................. ... 5100( 5700 6600 5800 5700
J Jacksonville and of its tributary ter- check an appeal for rent money. Some 1 9. ....................... ...,:.......700 5100 5700 .... 5600 6iOO
{Editorial Rooms 38 I \ H I Papers on Sale on Trains rtory: ; and the territory1 tributary to of the nephews have boasted In years 10...... .....:................. ..6700 5900( 5700 590( 5600 6000

Bus'"enOlflce1500' .and .at all News Stands. Jacksonville win be greatly extendedby past that upon the death of Jlr. Sage 11. ....... ..... .. ..................5100 6100 ,6100 5500 5600 .

its completion. With deep water they would be worth millions. 12.................. ..._.........5750 .... .._. 6900 5700 tsoo
which we will be soon have our city James H. Sage a member of a firm 13...... ..........................5750. 6700 '. 5700 5850 6300 5800
Offices-Journal Building-Corner lntend.ncia and DeLuna Sts. will become one of- the leading seaports of fish dealers, is perhaps the most 14.-..r...... ...... ....61GO 5700 5750 5900 ..... 5800

of the south. prosperous of the nephews In Troy, N. 15.. ........... ... .................. 5100 5,50 6250 5800 5900
Our own state alone furnishes an : Y. lie has probably a few thousand t\i..................,. ...........5700 5700 5800 .... 5800 5906
immense amount of business Hit 11...... ...........................5100 5900! 6000 5900 5800 6900
PENSAOOLA. FLORIDA, THURSDAY MORNING, AUGUST 16, 1906.The seeks a water outlet but with deep dollars in his"own name. 18..... ........... ...............5700 6125 6200( 5900 5700 .

r water Jacksonville will draw faeavJy' "Of course, said he recently Tin 1 .... ..............................5700 .... .. .. V 5900 5800 5750 I
Sullivan the Illinois National Commit fromotherstates. The benefit of this to not fool enough to throw money over 20. ......... ..............-......5700 5100 5900 5900 6200 6800I
,
Alleged Overdrafts by teeman who it would 13 the city and its people is well known.It my shoulder when I can get it without 21.................. ._....... ....6000 5700 6000 59Qo. .... 5S\O\
seem will prove of great benefit to the working for it, but I don have to get z-
: 5100
the County Commissioners. persona non' grata, with Mr. Bryan railroads entering the city from the a slice of Russell Sago's fortune in I I 23.: ......... ......................5700 5700 5900 6000 650.... 5100 SS50 5S5 55.0:}<1

Elsewhere In The Journal today appears This, of Itself, Is sufficient evidencethat north: and vest. At :first I glance tof order to live. rye got some money of 2-1........................ .......5700 5100 900 5800 750 6n.! !)

the argument presented by for Mr. 'Bryan's objections to the Illinois might appear that the from building upwater my own." 15............ ....................5700 6200 6200 5900 5750 .

luer Commissioner Frank Johnson before gentleman was well founded. yUle would transportation be at their Jackson-. Even By way of proof he reached down in 2 ..........-.............. .... ..5701) .... .... 5900 5800 57th
the board of county commissioners I if tills'16 true to some.extent expense.at trousers pocket and pulled out a 27...... ......... .............. ..5700 t900 850 5900 6100 fit;; I
troll 28............ ............. .
Tuesday night! for a dismissal of Secretary Root is having such a I: wall soon be much more than counterbalanced of ,bills which: he said, "would .. ..6000 5900 6900 5S00 .... 5iOl
tig time In South America that it! by these railroads gettinga + } choke a corn"m 1 29....... ...............:............. .... 595! 6tOO 5750 >
,'the suits now pending against" certain, makes-Secretary- impellent, to part:of the'obu3.n:: that Charles another I i 30...... ..........................5600 ..... 5950 .... 5800 56eu"
former commissioners for the .recovery Georgia.. Alabama and West goes Florida R. Sage, nephew, 31....... ....:...-...................6100 .... 6900 .... 5800 ._ .
get under way again. lives on the third floor of an apartment '

of illegally money)) alleged by them.to have beencollected GuK.by ra.ior through the ports of the house In Troy. He Is a thickset man, 'II Total...... ....,...............i5 OO 3m5 158750 149500 157350 150525;

Germany is rejoicing over the arrival with gray hair and gray mustache. .,.,.... .
In The Journal's opinion, the argutaent Jacksonville Is further west than Average. : .. ... ..... 5801 5805 5879 5980 5828 5.8S
of an heir apparent to the .When employed he may be found upon.
of Mr. Johnson is logical! and throne. The heir apparent a any other Atlantic- port. This makes the delivery wagon of a manufacturer i '
her as near an Atlantic port as any
conclusive and we believe that when parent. to a vast stretch of country. This and bottler of soft drinks. Charles total of
The
grand copies printed during the first six months of
the governor is fully acquainted with ? is.an advantage which, coupled oath Sage has four daughters and two sons,

all of the facts in the premises he *" !-K H the public' spirit and energy of our all grown and all but two still at home. the year 1906, as per above statement, was ________________ 906,450The
:win not insist da! the suits beingpressed. people' will make her tie leading The daughters- hard working girls
** WILL. ROOSEVELT BE A CANDIDATE ** shipping center of the southeast as and contribute largely to the support grand total, 906,450, divided by 155 (the actual number of

It will be remembered that when # deep soon for as the landing largest at our ships docks.find water Jacksonville of the.ta.m11) by working"upon collars. I issues) shows the average number of copies printed per issueto

this question of overdrafts on the part.# Savannah News I will at no distant ,become Lydia, one of the daughters, some '

of the commissioners came up, the >. one of the leading ports day for the years ago married Charles Burnham, have been_____________________________________________ 5,848I
members of the present board paid '$ j. .-$ H trade with South America and 1'.le who 1s employed by the United Traction I

back, under protest, what was allegedto West Indies, and every Interest thatCEnters company as a conductor. To them
A3 we predicted some time ago the _h-ere will !be !benefited. a.deaf,and dumb son was born. When J
be due from them twit the members question as to whether President the boy was about twelve years old +I hereby certify that the GROWTH BY YEARS
of the former boards refused topay Rooseveltrfll'be a candidate for th e
WaS above statements
Home Co.ril.. an appeal made to Russell Sage are correct -
and suits, at the .;Instance cf the presidential nomination is certain to Home cosmetics are all very well, to educate him. The old gentleman !j 1901...............:................l ,887 S. d subscribed
receive a great deal of.attention not- according to the
records -
governor, therefore I
were ente.redQgaln..ct withstadhrg the numerous assertions but there are some preparations that placed the boy In a deaf and dumb ;j 1902..."..."......-..-..-.......2,441 before me this25th
them. I of :Mr. Loeb, the Presidents privatesecretary the amateur cosmetic muddier should asylum in New York. About six months j on file in this office.

The money In question was drawn ,' that it Is the President's"purpose not attempt. Such things as hair dyes ago the lad returned without the I 1903...............".......".......2,929 day of July, 1906.

for work done in building county roads to adhere to his declaration depilatories and face bleaches are beyond knowledge of either Mr. Sage or his 1904....-..."----.........3,540
and the comnrfssioners} all believed at;:made Immeduitely after the last presidential : her ken. You can purchase de- parents and engaged a room for the PERRY D ICI KEN

the ttae and believe now ,that they' election that be vouldnt pilatories that will remove the growthof night at the Harmony hotel, In Cohoes. 1905.................................4,850 ,

had a right to the It :I again be a candidate.In hair from the arms but, of course, The next morning1 ie gas t in the room ;... ltircuiatbn. Notarj! Public.
is
money. In interview 1906 iiS:
an in St. Looms last ( ) 5,848
the removal is only for the time being. was found turned on. He had committed :
E.ble, although Friday: Senator
by no means definitely Tilknan is quoted as
I The chances are that the tuners will strickle. Despondency over his affliction
settled, that in a strictly legal saying: Theodore Roosevelt irs a
sense I candidate for the nomination, and he return very soon, and Instead of soft, Is supposed to have been tho
they were not entitled to the money will be sorely disappointed If the Re downy hair they win be ugly little caose. The fatso of Charles Sage I

but morally and practically they were[ pubhcans do not force it upon him bristles. This ia because the preparation are.emphatic: In ''tli 1f.cJenlal'of being
entitled to it. I!j I I I He 2s just itching for the place again merely burns the wretched things portlesTto. i>proposed will contest. I congress. He':had-had no practice'is eisfer of'-Olln>'and-ls the mother of DEMOCRATIC NOMINEESFor I

The: county got the.benefit, of these 'and Is using every possible means toern down to the surface. of the .skin. Un- "Why.. we never :'ttmk" of such' 1 oratory, yrt-lt was not long before he .: four children. Eliiur'W. Sage, Jr., a I

men's labor. The good road wh.cnfte {, t the sentiment towards him", nd less the growth Is mOlt unsightly it IB thing," r.rs P'ritd.MAtter all Uncte made two of the bat speeches upon brother, ;who Is about fifty-two years Member of Congress: 3rd Congreisional

: now enjoy in various portions of; make the Republicans: force him to best not to meddle with It. Others Russell has done i for us It wouldbe finance that were made there during of age left Oiamvihoo six years ago District:

the county are physical evidence of accept the nomination." Of course won't notice it as ;you do yourself. the height of higra Itude. He the session. The wags, during his can. and settled In Renaselaer, Ind. The WM. B LAMAR of Jefferson-
something: must be al'owod! for the thought. 'brach 'bf that nn for accustomed family in Joliet baa not kept close
the services rendered. The BO us he even congress, were to
they
which ,they received including pays j,.feeKng entertainsfor cf hostility the which'President air Tillman but because -I Ca.e ot Baby Ear. sent tte clot" 1ng.. bite-,Sage, the dear say: "4Come on, beys. Let us go down track of him. It Is thought that he is CHAS For Just'ces B.! of the Supreme Court

that'wh'ch )) even he is not on the best of terms Few mothers and fewer nurses no- old'lady;; oeeh never worry.' Wo will and set a cup of sage tea.! He once now either out west or In. some other JAMES PARXHILL' of Escambia
is alleged; to have been' B. WHITFIEL/D! / of Leon.
wth him it doesn't follow that he tice when they.lay a baby down wbeth- not make trouble for her If we-can Informed me that he learned to read by part of the Hoosier State. Mrs. Alta ,
.
drawn illegally, is lnfinitesimally1' would make a statement like the foregoing er the soft little ear Is crumpled under help 1t.- k. -f' *. the light of.pine knots. Mr. Sage did Sage )Martens Is a daughter of Elizur For Railroad Commissioner

small when compared with the bene unless he .believes it to :be true or lying close back to the head. They Albert Sage,1, the+ third nephew, In not forget-his Troy -friends. He came Sage, Jr aad-Jlves In Channabon on a NEWTTON A. BUTCH of Levy.:

fits that the county lias received! from, It isn't of course to fho credit of the I rarely take the trouble when they bold TOUT' te:familiarly'known, as "Pidgie" here to'attend< .me funeral of the late farm with her husband The Sages R. HUDSON BURR of Dade.

their efforts. (President to be placed in the position I!I a baby to see that Its ears are In a Saga, fie des always been obliged to Father Havermans, and he was also have never presumed on their rela-

Taking all of these things Into con-I of saying one thing and trying to do natural position but will hold It for work for everything he received In I here at the dedication of the Russell tions to the celebrated financier They For State Senator 2nd District:

sideration. The Journal does not be the trying very opposite of that thing-that the longest time with the head pressed life and has seen much trouble. Sage halL On that occasion Senator. respected and well liked. JOHN S. BEARD.

lieve there is a Jury in Escambla coun-|is.tiwe fci no doubt to mislead there the are public prominent,: but against their bosom and the ear turn "Pidgie" Is employed by his brother, Depew, then In his prime, delivered an i ioratJQ Mrs.. Helen S. Holbrook and Mrs.
,
ty that will render! judgment against i man in both political parties who thins: ed forward Instead of back. "As the James H. Sage,.in the fish market. He I : llr/ Sage followed him In an Fanny E. Crisler nieces of Russell For Member House of Representative

these commissioners even it the j about the President's: intentions! re- twig is bent the tree Is Inclined" applies has two sons, Walter, who Is employedat oration of less length but which was Sage say they ace satisfied with the CHAS. M. COSTOX.

are pressed and it does not b suitsl'specting toe presidential nomination with as much force to the physical the plant of the General Electric generally regarded as the better-of the provision he.has made for them In his M. O. BAGGETT.

just as Senator Tillman does. Only a as to the moral growth of a child. company at Schenectady, and George, I two." win, although they bare no knowledgeof
that I
Governor Broward when he day two Senator who it except. what they have read In the I For Tax Assessor:
or ago LalFoiette was Is employed on one of the Ice By the will of Russell Sage the W. W.
RICHARDS.
thoroughly' understands the circumstances quoted as expressing the opinion! that Greasy Kitchen Floor wagons! Copper & Co. I Chapin family of Oneida, N. Y., Las newspapers. Tbey are daughters of

will insist on the suits being Roosevelt and Bryan would be the Grease stains on a kitchen floor are When Albert Sage first learned of I been made considerably richer, each of Elisha Sage, and lire In Park Ridge, For Tax Collector:

prosecuted. opposing l&OS- : presidential candidates in difficult to remove by ordinary means, the provisions of the will he was greatly the heirs receiving $25,000, en aggregate some twenty miles northwest of Chi J. S. ROBERTS.

Further than that these suits should j Senator Tilknan thinks but they Trill generally come oat witha pleased to think that the great of t2:O.OOO. Samuel Chapin Jr., the cago. Stanley Holbrook, husband of

cot only be dismissed, but the money'lean. beat Mr. Koosavelt He air said Bryan}In I hot solution of potash. It one application ey maker had remembered even mon.j I eldest, is proprietor of an extensive Mrs. Holbrook is a clerk, and Mr. For County Treasurer:

which the present 'board paid bacs:'its St. Louis interview if he couldn't;} is not enough use a second or "Me contest the will?" he Jewelry' store In Oneida, Dwight is a Crisler an accountant. Both women J. ED. WILLIAMS.

under protest should be refunded beat Roosevelt he couldn't beat any-}! even a third. Sometimes the solution, "Not on your sweet life. I have always retired merchant, Frank W. and Fremont bare families and have had a hard
the members. The to'I body. In making the statement Sen f !f the wood Is very white, will leave had to work hard ever since I I 1 I 'conduct a successful business in struggle to get along in life. For Members of School Board]:

their hearts people down in 1 etor Tillman let his feelings get the a yellowish stain. To avoid this: > mix was a kid and I guess III lay off now I(I'the paint and wall paper Due, and W. E. ANDERSON.
are generally actuated by]better of his judgement. He is satis-1 some lime with the solution, until a and take It easy for the rest of my I Homer and Taylor are managers of the H. G. DoSILVA.W. .
a pretty well) developed sense of justice -I lied, however, that filr. Bryan's popu thick paste Is formed. Let the paste days. No $t 2;,000 is a pretty good little I i jewelry house. The others are Miss LAUNDRY LINES. M. AGERTON,

; and we do not believe that twen-I jlarity other Is greater than that of any remain on the floor at least twelve bunch, of dough and Uncle Russell j i Helen Chapin, Mrs. AneHne Lyle and Colored should
ma.n-tlmt goods be
ty-ifive tax payers In Escambia. county u1a Jty. Senator Is.Tillman Irs personal pop I hours. It la better to use a weak> solution was all right Too can put It down I; Mrs. Jennie Munroe. Tntfa the exception the side. Ironed. oa ,I For Member Board County Corns

can be found who are In favor of com I couldn't say much against said he i of ad soda and fullers earth on for straight that there won't be any of Earl all reside In Oneida. The wrong stoners:
the character A little borax In the
last J. B
pelling these men to pay back money I of Mr. Roosevelt-"only that hel very nice floors. contests If I have to start them." I family is satisfied with the will and water will make handkerchiefs rinsing easierto JXO. A.ROBERTS MERRITT.

!which they fully earned and for which _The dece In Troy of Russell Sage, has never entertained any thought of Iron and look better when done. JAS. M ANDREWS.H .
the county has had more than value Mrs. Sarah :M. Gardner lives In a a contest and will not approve of a contest i C. CLOPTONJA5
.
... Never pin delicate:
received. pleasant little cottage at 40 Glen ave- should one be made by any of the the clothes line without materials on to R. STEWARD.
r nue. She Is the widow of Charles H.. heirs. The nieces In the Chapin family placing a pieceof

:; IWends: assert! that Senator De- 1 The Bluff Springs Tragedy I I IS&ffX&VXX Gardner, who was a machinist by have often been entertained Jby Mrs. the clean clothes paper pin. between the fabric and Besrvlar EatlD .

pew's trade. She Is nearly sixty years old Sage. Last winter Miss Helen Chapin ,
condition Is due to overwork in When coarse lawns 'or'other Many a housekeeper does not eat ''t
has two children and owns the house and Mrs. Jennie Munroe were for sewernl cottons
connection with h s duties in tie: co I in which she lives. months In California as the guestsof ( fade white a dainty pink color can be noon unless she baa company ,

per branch of Congress. The general I I "I don't know what the,others will Mrs. Sage. given them by using the petals of an much cannot be said in favor of o..

public, however believes. it Is the in-I (While] on a visit to our old home of was "just a little wild." Oh sad do" she said, "but I will enter no ob- Mr. and Mrs. Samuel Chapin were old artificial rose in the starch water tar! hours for meals. A luncheon *> .
Eurance Bluff Springs the community was words; how surely the snares of evil when laundered.By ed for only one or two should <>*
companies that should com jections to Uncle Russell's wfll. I will among the early,settlers of Oneida and
plain of ,shocked by an awful agedy which are spread for those toys who are a putting an ounce of sal as dainty a a the most formal din
not
: being overworked.. i little! say that his relatives did not expect reared a large family that Is honored ammoniac .
iI I j I for a while: cast a gloom over alL A Young wayward.man, in the glorious to get.more, but I would not starta and respected In business circles and In the last water In which muslins or A napkin or doily spread on the
promiseof table Is sufficient if hn
L t Ana ODelia ,Diss De Barr has tragedy which is being constantly en- your life, 'beware 'oh, beware of contest even though he had not left society., All are well to do self reliant cottons are rinsed or a similar quantity If one is in a
left '
:, been released from an English 'prison acted and will be, until our young these pitfalls. There are so many me anything. and progressive. In the starch In which they are overs are to be the lunch -'
\ |men learn of wlsdcoi and are wise. good Sirs. Gardner AD the relatives of Russell living stiffened they will be rendered unin should be served In an appetiz'ng! at-I
on a ticket ot leave. Ann will I women, so many good men, so has a son, Russell S. Sage .
probably -The seventh chapter of Proverbs with flammable. savory manner. A-gUtM of milk an a
now break many good places to go can you not Gardner, a clerk In a drug store. The In Joliet, IlL-and they are numer-:
out in a new place all its sad truth .Is brought forcibly, turn away before it is latter When the water Is piece ef cake tattn standing in '::1'kJtcben.ls
1. with too late said that the Impression seemsto OUS-S LOW no disposition to find fault too muddy; to
a second edition of F to us. "Evil a foolish luncheon. W--- .'
f TheocratSc! I communications; corrupt good prevail In New York that all the with "Uncle Rosseirs" wilL E1lz11r W. whiten the clothes it can be cleared '
Unity. something else The family of the foofsh boy who morals. one has eaten hearty breaLfa-c *
Remember a
equally as it boys. Can on-sj members brother of Russell left family very quickly by stirring In
of the Sage family In Troy gage, a a a little cornmeaL
t bad, left his home on the fatal night, are go upon hot coals and His feet not be The meal will I light luncheon Is all that la ncc >&-,
are paupers. of two sons and fix aughtel'8.most : go to the bottomas
people who are and
highly esteemed burned? It that but If little
t II seems "evils must a very breakfast has of
1 ranked among the very best of our, needs be" true "While this here little family has no of whom have moved from et.O1n soon as It Is thoroughly wet and of
but .
enough let partaken
our a good. substantial (
i. If the Boston scientist who said citizens. He had brothers who stood' :young men learn to be ,brave enough great wealth" be said, "It might be Augustus Sage, born in-l&Tl, took will carry the solid particles with It. noon should be eaten. meat

there were seventeen varities of high in rel'gious and social circles to shun the evil, to keep out: of the well to mention the fact that we are charge of his mothers farm when he'

;_ germs on a ten dollar bill is afraid one of them being a clergyman way of the snare. not dependent upon anybody just yet" was 'fifteen, and be has managed It --- -- ---,' --
r of them he might shp! the aforesaid In the M. E. church North. TVme and women." 'I think I voice Among the Intimate friends of Russell -. successfully ever since. He received
The scene at the home of the boy a world wide tnrUi whey his education In the public schools
I In ,
declare Sage J.
k tills Troy was F. Parmenter, Vhea
In this direction. We know a: (el when his your nerves are weak, when you
that
body was brought there these
a vas two forces' have written a old and and In September, 1SS2, married Miss
very
highly respected citizen. tired
low who is cot afraid of them. pathetic in th:, extreme aid In sharp more tragedies; in the hearts HalfSick. are easily when you feel all we
blood of Whitoore the
of
Mr. same neighborhood,
...' contrast to tha at the place where he our homes than even war Itself. Parmenter recalled.the days when down then U the tire you deed a good
and have six children. Mrs.
. I they shared they W.
Former Federal met his each other's
: Judge James H death :Have you a boy? Have company strong tomc-Aret's Suupa:111a. Your
10.1a: younger B. Davis his sister, lives her husband's doctor
on willtei
': iBkrant declares the Filipinos are ca "Beware of strange women" Oh brother? Then take the question much of the time. you wfaylthts such power et.eat nerves, why it makes
f liable of self-government.: This is ,could the boy of ouland remember I I I tome to your owe heart must this go "In 1852 I think It was" he said, faro about two and a half the Blood rich, and"hy it gives course. and strength. Ask himit= it +i? ftet
;" undoubtedly i this, and this also( : "Wine is a1'on forever "Russell received. nomination. __ for mites.frpnJdm. ,She:Js the_ _eldest! just the medicine you need. ttT b.S.*g>snsea! ,JLwtE1t'a\? c. eo I
but s .K
a fact nevertes "
one. : mocker.: To raise your little boy!! I have known Bluff Springs for
that the Republican administration! from Infancy to buddju: manhood, to"'" many years, I have seen its growth'
k cannot be made to believe. 'give him the 'benefit of loving care 1 a'ong different tines I have known of I
< an>l all of a devoted mother's Its
: prayers people, some by reputat-'on and
. The opinion of the denizen of Wbl- and then for this t6 be the end! some by personal acquaintance, and

;: !("rt'. Roost doesn't amount to much TVaile we deeply deplore the death as I saw that sad cortege pass a few i iTh11i 1II '
r. anyway of boundless the young man our hearts go out In days ago to the cemetery, I thought! H ] *e
b sympathy to the parents and I one of the saddest chapters In its
brothers and sisters who loved him history -was written In"that
f Tom untimely
Taggart; has shied his castor
and prayed for him. No one can say grave,
, Into .tbe arena la defense ot Roger aayihth ngafnst him except that fc e F1.01UD.PIN&
Equal to CI.OO ,
; any preparation on the [market.>

-.:

.



'k j;.' '{;'ii ," t"_'....:lt4Jc : '
;J-: -- ",:-.2 ; ';" ".i, 1 i -:: :':-l i:'".' : t'1'.i J.AtiE



'
"" "'- ;." -, '" ., ,> -:'( ", $ .-'. <<- .' 'q,,

:, :;" .
; >r : '- ?--;.. .,,,:, -
:;

.



PAGE SIX THE PENSAOOLA JOURNAL,' THURSDAY MORNING. AUGUST 1,8,. 1906 --- -. .




M: (Every Advertisement ,in These Columns Is Read by-


-
1 -
"


II I AM NOW ON Real Estate



: WE HAVE SOME, CHOICE I THE GROUND BARGAINS 1 I, Good Investments


INVESTMENTS FOR MEN $1250-Nice residence: on, South side

of Cervantes, between 12th

and 13th,"Avenues.: .' Kupfrlan's Park, containing a splendid six room d wellbrg,
WITH SOME MONEYThat $2000-South )half (;Block, 120.. ,New $7850for baseball and shooting grounds, dancing pavillion and racetracks
.
FLOORAT City Tract with over 100 acres of land .. .. .. .. .. .. .. .$26000

I $1200 -Kock 279, New City Tract. a. close-in corner near Pala Large brick building on South Palafox street, SRLENTttD INVESTMENT
,
is them Pen- fox street 120x150. This semi-
not paying at least ten per cent. .. .. .. .. ...... .. ... ... .. -.. ... "..$12500
sacola real estate is gilt edged and growing better : -- central property will prove a-
112 SOUTH PALAFOXYou ::: !
every'day.. Are you an'oner of some of it? If you money maker. Investigate it. Large two.story dwelling on the northwest corner of Intenden-

will permit us to suggest 4t, would say that you We hare several nice houses and cia and Reus Sts. lot 85 ft. by 140 ft.. .. .. .. .. .. .. oo. 4500
cannot afford to wait longer before buying safe vacant lots In any part of the City to suit $5500One
or improved property if you would take ad- our customers. Wa will be '!Jad to Valuable business lot on: Palafox St., just south of Masonic

vantage of the present rise. The increase' value have them call on us.McDavidafiyer. of the most attractive Temple opposite! new Blount building, 30 ft. by 182 ft.. ..17000
will be "easy money" and no small amount. Let us can get in'' on the houses in.East ,End. The housQ' .
show you some business property or residEntal: floor and make is two story 8-rooms all moden Twocottages splendid renters. renting for JH* per year at

property on East and North HiLs.: ground some conveniences, you should see it No. 228 West Zarragossa..;..... ... ... ",,. ... -.. .... .1250
good money in Real Estateif to appreciate its worth. I
That beautiful property situated on Santa Rosa Sound, known
you take my'advice and Company, $8000Excellent as the C'ausen Place lot 1200 feet front fronting both Pen-

buy New City,Property. sacola Bay and'Santa Rosa Sound, containing three dwellings

Agents New York propositon! In business ; with a lot of household goods..... .. ... ... ... .... ... 5000

Pensacola Investment Company and Values if you are do surely not buy;going some up Life Insurance Company.a .- near site depot on, East and Wright adjoining St. J Two story brickrbuilding on Zarragossa St, near Palafox St ..10,500

one else will make the profit E. Government' Street. business property. Two story; .dwelling at No. 1005 North Davis St.. .. ,. .,: ....jgoo
A. H. D'aWHBEHTE City Manager.W. ,
that you ought to make.' Phone, 7CO. Pens cola. Fla.
E.KJiCWUS, President. p.. t. SnJrSOV. SeersUrf.KNOWLES !
I. ST1LLJIAN, Voltes ul Ceo. I List with me LIST YOUR PROPERTY I
.J. Miflijsr. RYEK, Treasurer. your property r
> WITH US FOR QUICK AND
Had Estate, Loans, General Investments. i for sale. PROMPT RETURNS.LS.Brown&Co.. HOOTON & WATSON
,
: Rents collected.Money InvestmentsTwo .
215 South Palafox Street Pensacola, Florida. Leading Real Estate, Rental and Insurance Agency.
I .
II loaned on Real !
'HONE 51 No. 37 PALAFOX ST. P. O. BOX L"
I Estate at the market rates. houses on N. "B" St.. between ,

Jackson and Gadsden Sts.. renting for ., -

HELP WANTED Wanted $8.00 a month and in the best ,condition : --=

'I ; also' good renters .. .. $650.00. -
-
IWA..Vl'ED-Teacher with first grad ''WA 'TID-BY married 'man' !I "WE SELL LOTS." For Sale
certificate to open school 1st of position as bookkeeper young or generalsaw LESLIE E E. BROOKSPhone Three houses and large lofson the $ 12000.00
corner of Cevantes and.\5oylei: houses- hand' top buggy
September. Address W. E. Aycock, mill man. Familiar with genera FOR SALE-Second
Uycock. Fla. 16aug2ij I merchandise! business. A1 Reference 462.Miscellaneous.. In good condition a.nd.renting,. for$loa ,I Phone 918. Thiesen Building. I (Win exchange' (for delivery wagonor

JIEUP \ Address A.. Care Journal. 16auglw* month.. .. .. .. ;. .... ..'..51400.00t j sell cheap. Inquire at 144-116
: : :A.\'TEID---At once grl'to .' East Wright SU _.,. 16auglmo
work In laundry. Apply to NewJ I WANTED -Employment b1.a.. young 91 feet front by 500 feet

Method Laundry.. ;.._ auglSjIWANTED jlady, 'thoroughly responsible andi HomesA ,, FOR SALE-Half blo k n'East Hill deep. 2 story house with 14
i I'having faJr education. Address. N P. Cheap M sold at once. A. B. c., careJournaL
Driver for laundry wagon ', Care Journal. 16aug4t ARCHITECTURE Plans, specifications : 15auglw rooms, with water connec-
._(Apply at once to Star Laundry. 1t I. .. ,' of modern homes drawn to su't: nice 7-room two story residence $. 100.0I tions.> Suitable for large.
WANTED-To buy second-hand medium the most ,fastidious. Store fronts and I on North Hill; lot 48& ft by 150 FOR SALE-Coal orwood cooking
iWAl''TED-Flrst: class cook. ApplrMrs. I sized safe. W. S. Garfield & public buildings drawn subject to approval deep. South front on car line; excellent will buy a. splendid house with five range with 40 gallon boiler attached family or hotel. Known as
A. M. McClure, Commercial Co. auglS Chas. W. Howe. Bagdad.FU2auglm neighborhood.: Will loan $3000.00as rooms and hall also other improve- for sale reasonable if. sold at once.
the Anson residence
: Hotel, 107 E./Intendencia. 14auglm : I I'W.A.NTEQ8 part purchase money. oo ..$4500 ments. Lot 100 by 110; room on this \F lioue 882.e l5aug2t1 at Big
'
lot for another house. For an Investment ., Bayou.
room house modern Improvements
IWANTED-Cashler\ ; must be experienced this is a bargain. East HilLJ. FOR SALE-We have the following
JERNIGAN LIVERY
; wll located. AddressA. S'FABLES'Bagdad
: and competent Apply to J. W. Bullock A. WILSON & CO.,
Jr. secondhand machines for Apply toMrs.
H. Baker, P. O. Box 194, City. Fla. Carriages meet all trains,, good
Pensacola Electric Co., cor Main and ,Real Estate Agents.
ll&ug.W'.A1't"TaDM.lddle. single or double teams, night or day | prompt sale: Williams No.2, $20;
Jefferson Sts. llauglwWANTED to any point. Best service; rates reasonable Cor. Government and" DeLuna Sts. I Salisbury Bldg. Room 7. Phone 172. Chicago, (new) $25; Fox, $35; Dens-
( age colored woman I more, No.4, $40; 'Remington' No.6, Aline Anson
: -Moler: system of, barber to do general house ,work and lauglm Box 173. Phone 637 $4250; Fay Sholes No.6. $27.50; L ,

cities college wants located in fourteen, leading live on Mrs.premises good home, right F. J. WHITE & CO.-Artesian well Board and Rooms.FOR O. Smith, $45; Underwood (new) $80; Care M. E. ClarkFORSALE
men to learn 'barber party. J. A. Billmgsley, 238 W. Stearns
World's Famous Visibly
also
trade.. Scholarship includes tuition Government. drillers for saw mills and turpentine
tools
10aug2w ,
diplomas, positions and board if I, stills especially.' Geneva, Ala:, RENT Tnree furnished rooms always new, $100. Pensacola Type
desired Few, weeks completes, little W.A."iTED-Wblte I lady wanting position and Grace-nlle, Fla. Prepared to put for light: housekeeping 301 :W I writer Exchange 313 Brent' Building

expense. ( Write for catalogue. New,, as chambermaid, laundry or wells from 4 to' 12 inches diameter, Chase. 16af: 14 aug..
Orleans La. llaugSt office work, please call.or address 424 and from 100 to 1600 feet,deptn. Sat, FOR SALE-4R.unabout'ln good condi-
W. Government isfaction guaranteed.' 19Juue3mi FURNISHED ROOMS-- Best in cIty.
ton.! Cheap if taken at onoe. Address
ACTIVE MAN WANTED to advertise THE PATRONAGE of the llaug1w.I' I' Transient eoiioited. Mrs. Preston, R. F. D No. .1, Box 43,. City.,
exhibit goods and manage public solicited. Good 1\OTlCE-Havlng installed machines 128% East Government, opposite _
branch of large mall order house. drivers. Z. D. Adam Feed for the manufacture of galvanized: opera house. llaug FOR B..UThree nice wooden bed

Salary $18 per week expenses paid. Stable. Ponce deLeon, Fla. 20JulylniWANTED. iron cornice skylights, cornice gut: steads; nice as new. Apply 333 E. The building corner of
Permanent position with advancement tars circular mouldings, etc.,I am now: I FO R.RE.\"T-Rooms cheap; real l.new. Rotnana St. langWONDhiR
Honesty more essential thaa .-Real Estate for sale -or prepared to do sheet metal work of: 2y clean furnished rooms suitablefor I Harden and Bavlen Sts.". recently -
experience. National Co. 720 deet rent lease or exchange. Your business all kinds on short notice. Satisfaction II light housekeeping on the bill. Location -I GASOLINE ENGINESIf occupied by St. Anthony's -
nut street. Philadelphia Pa. aug. respectfully solicited. J. A. Wil-- assured. Estimates cheerfully I ..,,. t I high and healthy. Close to car I you need an engine for your new
son ,Real Estate Agent 22 boat can't afford to overlook the Hospital. Bids so-
!% W. Government given on work In-or outside the city I line. Privilege of phone. Apply 314 you
WANTED cook and gardner at street. Room 7, Salisbury Chas B. Vetter. IS W. Intendencia.Phone698 .I E. Strong. Phone 1213. bang i"Wonder." Marine engines. l1 2 to 21 licited for its purchase 'sub
once. Apply-229 N. Spring St. building. Phone l'1%. 23Jan I H. P. Stationary: 1% to 6 II. P. Lightest -
25maylni market for its ject to prompt removal of
WANTED.-Th Merchant Transfer FOR RENT-Furnished: rooms with engine: on the pow
WANTED-Carpenters to know that' Co. wants year moving and bauUn.All .' If you will look around the house, privilege of light housekeeping; on er., Circular iree. Ed' B. Banks. Pen- building from present site
the new local 1159 U. B. of C. and breakage guaranteed. T. B. Tnor. you will find a lot of ways In whlca car line- Apply 900 E. Jackson St. sacola, Fla. Phones 1377 and 577.

J. of A. meets second and fourth Wednesdays leD Prop. Phone 978. ISJunelm. you can use old newspapers. You 27Julylm 22julylm.
at old armory building room can buy them In any quantity at this $3500
FOR SALE-111 acres excellent pineapple ,
I ROOMS FOR RENT 1
1. and that the charter is still open. WANTED-To sell a lot ol old papersat office They are put up in bundles, or 2 newly land. Jupite
W. N. Lonnsberry Business! Agent 5c a bundle. Apply at this ofI I convenient to carry and sold. at five; For a beautiful 6-roorh Cottage with furnished priv fronl'rooms: of ; southern exposure -river; excellent and orange market; close on to rail- John E. Stillman
22julylm. ; lege phone few
; steps
fice. all whole ,
They are clean cents bundle.
per and 3
all modern
I improvements large from Palafox. 106 E. Intendencia. road; 3 miles from ocean; some improvements
Al\'TED-Camer nice. lots on East Hill, near Public Square. Rates reasonable. Call at Mrs.Nordstrom's ; healthy locality. Address Chairman Board of Governors,
boys at The Journal J. H. allmaSer
PORTER
716 South
WANTED-Carriages: repaired and J. F. Benefield Aycock, Fla. 19jlm
office.WANTED I repainted I Palafox street Orders taken for Millinery Store No. 11 E. Intendeac'a Osceola Club
floats built to order
; horse St.
; tents, awnings, camp stools and fcousa, 28julyOl.i FOR SALE OR RENT-Two lighters;
J.
I shoeing a specialty. G. Welsh Carriage
-Everyone to snow that ; cots. etc. Prices re onable., Sljan. MONEY TO LOAN AT LOWEST one) with capacity for 75 thousand ft. .
I
The Journal has nice, clean old papers ,I Co. 27febH. newspapers at Hve cents a traadle lumber the other thirty thousand capacity.
tor sale <;!leap. Only five cents ALFMAN-Tin, Copper and Sheet I, SHIP CHANDLERS-AIcKinzle Oert- MARKET RATE OF INTEREST. at this oface. They are all clean Rates reasonable. Also two For Sale.FOR .

a inmdle.i Iron Worker; cornice work and skylights .I!, Ing & Co.. wholesale and retail ship: MORTGAGES ON .REAL ESTATEIN and nice. skiff boats for sale cheap 22 ft. long, -

"' a specialty; roottng gutteringand chandlers and grocers, only first-class THIS CITY BOUGHT AND SOLO 5 ft. beams. Telephone or write J. A. SAL6.00 cast net, only uses
.---- repairing 315 South Palafex St.1Phone house of kind in city. Pair prices to all. ALL OF ,THE MAXENT TRACT Chaffin & Co.. JUton. Fla. 25mar one day; In.perfect condition Will

WANTED 560; residence phone 1316. I CARRIAGES WEST OF "C" STREET NOW FOR Money to Loan. sell for four dollars. Phone 250.
repaired and
repainted. SALE. ana
2unelm.WANTED. I FOR -improved untmprj'd 14aug.
Floats built to order. Horse shoe-, SALE. nnroertr In all parts of the city.
lWA.N'flt-All carperters in Pensa Second hand Ing a specialty. J. G. Welsh CarriagfCo. MONEY. LOANED on real estate and J. Wilson &: Co., Real! Estate Agents,
cola to be at S. B. A., No. 1 hail sacks of alldescriptions :FOR SALE-5,600 acres mill UWOtr
/ wanted. If 27f-bMILTON personal property on short notice. Room 7. Salisbury building. Phone
West
out
ZBrragossa street near Palafox of township Terms J.WhBullard. 28>' : Also Turpentine Location Write
easy. 23Jaa
street at them to u?; if in town UPHOLSTERING SHOP > South 172.
T:80 p. m., Wednesday ,Aug ring us, Palafox St. Phone 1144. for schedule. Owner care PensacoU
15, to learn something to their Interest up at No.' 334, or bring them to us Willie Mims, Proprietor. Furn!:; !Journal.
at corner of Chase and Alcaniz Sts.. ture repairing of all kinds carpet Fisher Real Estate Agency FOR SALE-Two return Tubular Boil I 10aug2
R. F. S. Mellen & Co. 28July,,I laid. furniture packed for shipping I CAN LEND YOUR MONEY at eight ers 50"xl4f ready for Imtnedlatee de
BURNS ;;i Phone 63. Next to Tampa Landing. COLLECTION OF RENTS A per, cent. If you have any that you livery. Apply to M. F. Gonzalez & Co. I
President D C. WANTED-All owners of poultry to1 I L 2.AJrit' want Interest on. see me about it. It 8jul/ i FOR RENTFOR
know that we are agents for the celebrated -', SPECIAtTY.Phone will be absolutely safe on real estate
DRJNO, : YOUR BRIEFS. MANUscrtots I'OR SALE-Second hand '25 H. i
Conkeys Poultry Remedies, MATTRESSES AND FURNITURE security. LeslIe! E. Brooks Fisher
: end other forms of stenographic Guaranteed 87. 206 S. Palafox St boiler. Will sell cheap., Apply "T-F1ve rooms furnished or
-I to cure rupe, cholera Mattresses made to order; old ones building. Phone 462. P'I i unfurnished; large porch facing
:writer work to the Pensacola Type gape! and to kill fleas, lice and mites.. renovatei New ticks! famished. New Method Laundry. 'south. City water. Apply 501 \We
Exchange. or 'phone 1369) Also their wonderful egg producer V. Second hand furniture bought MONEY TO LOAN Everybody bore
Room 313 Brent 'Building.1WN'l"EDFrRST and : REGULAR HACK.LINE-Frornjj -j Chase or phone 323. lau
S. Mellen & Co. Phone No. 234. gold. Upholstering and repairing. gone A GOOD BARGAIN rows money from Jno. A. Hall & ley making. connections with mall

..cLASS ISapr. 114 E. Belmont St.. city, phone 771. Co., 14% B. Government St When In launch for points on 'St Andrews bay. :,FOR RENT-Two new modern 5-room
lag. OQd hats made new. hat Cleaning clean- Davis 11f;. Co., C. T. Davis. Mgr. IN REAL ESTATE need call on us. Extra teams for travelinginen. Good houses on North Spring street *'

: pressing and blocking. Satisfaction HOTELS.OLD TAILORING L. Diamond, .Tailor.: 4 lots 40x150: : feet MONEY LOANED on all kinds of per horses, comfortable vehicles. Call on I,'$2000 each. Fisher Real Estate
guaranteed. Panamas, 50c. Straws, Gents' clothing cleaned pressed and 2 facing south on Brainard. renal property on short notice. or address J. C. Sinclair Chlpley Fla. Agency aug'o'

i, 15c; Felt 35o; Derbys, 25c. Victor MILL INN-On bay front. Opens repaired on short notice. No. 11VS .2 fac:ng'north on Loyd. Terms e&I!!,. J. B. Gray & Co.. 2 W I I Telephone 1\0,74. 28apr!!
100 E. Intendencia dwelling six FOR RENT-Two fine stores, on E
Two-story containing
Loots.
street. All June L Large airy and delightful. West Government St. Pensacola, Fla Romana. Phone 1165. lfeb
come Ins 24Julylm ly cooL Good fishing : Idee. large airy, rooms, with pantry, chIna,. FOR SALE-Several tracts virgin! t Government opposite opera house
bathng andbpating.
First class tab'e. closet and bath room; also several UNLIMITED amount or money tn loan pine timber. Turpentine places ar.dsaw Formerly occupied by The Journal'
On
electric
:WANT.-AIl .ktoQs or electrical car tine, 15 minutes: ride from out houses. All under fence and ic on all kinds of personal property. I mills in operat'on.'! Also excel.,,Lee Daniel. 10au;;
city.
: work. 1 tell 'all kinds of electric boarders first-class conditon.: Will sell entire SpeclU rates to business men on large lent tracts of stumpage. Turner i'Aymard ',
: batted and other electrical suopUe: Terms Regular reasonable. Address and transients.Old Mill LOST: property for $3,000. If purchaser desires !loans.Tbp New'York Loan Co., 204% Real Estate, Agents. :Box 115i, FOR RENT\ -Two nicely furnished
t When you need me ring 345 or 955.''p Ian. Pensacola.Fla. can pay half cash, balance on South. Palafox. DeFuniak Springs, Fla. 20julyjFO rooms, good exposure; privilege .if1'ght
" E. W. Peaks, new Star Laundry build. 4nuyBROWN 'LOST-Silver cross with initial's ''8 easy terms. Apply to I' housekeeping. Apply 323 Wes
: In*. B. Garden IBdea. _HOUSE':"D'Funlak Springs j: J. M." Lost on either Intendencisj RSALE-'PlantaUon( containing 231 Chase street. 9auglw
Good beds, airy rooms, elegant\j or Alcan'z jstreets or bait:: tar. Fnder: ; E. L.. REESE, THE JOUR"'IAL! BY CARRIER 10 acres, 155 acres Improved;" 7-room ,
:W'ANTED-'n1e public to know that'w meals; free bath and sample rooms. please return to 2 JOth ave. aug61t*: 33-35 SOUTHPALAFOX ST CENTS A WEEK. ,I house; good water, 7 miles south ofMa.rtanna. FOR RENT-One story cottage 22 E
can do all kinds of repairing Special attention to traveling men.I $3000 cash. A. Pnrdee Garden St Apply to Walker Ingra
It float befldliig horse shoeing etc. J.'Rates $2.00 per day. J., R. Brown,1prop. I Real Estate Agent Counsellor at Law, ham at Star Laundry. 2au<
i: O. Weteh Carriage Oa Ute)i i'S Editor and Publif.her'of The West

I Florida Pugall, Mananna, Fla. Box FOR RENT-Large 11 ,
room hous
[W l'7ED.-The public to know that HOTELS AND BOARDING HOUSES 224.
; old newspapers can be bought at!j Before laying jour carpet or mat I WRITE YOUR WANT AD HERE. i 15julyI Real 240 Estate E. Intendencia. Apply to Fisher!

'; this office for Ave cents a bundle.,They; ting, buy a supply of old newspapers I FOR SALE-New 8 room house between Agency. lau;

!ii are all clean and nJca_ ,I to put underneath and protect it. Only Send it to The Journal office day or night. When you) : need help have anythingto I A bargain 9th if and'soli 10th at ave., on 16th St. FOR RENT-Nice 7 room house. 311
!t five cents a bundle! at this office. : once. Apply to
;
A. R. East Romana
WANTED.- Blngham j St. $13.00
wants month
j t' your moving and hauling. He gnu ( HOTEL SOUTHER.. '-Qpen all the sell rent exchange, or wish to purchase anything, try a want ad. They do the address given. 2ljnly1FORSALESmaflstock J. A. Wilson) & Co, Real Estate per an,!

it antees all breakage. Phone 630. I j year. American and European plan.
i t MATTRESSES RENOVA.TEDNew[I Special summer rates. F.rst-clasa: Ini I ; Ice box_ scales,, show cases .. Salisbury building. 24jn'y
If every respect. Pleasant and conven-i etc.. on 1l1iew hard ,road at city
tick furnished desired. \
I: Guaran., lent. Mrs. T. L. Bowen. limit.. Can continue to rent FOR RENT Some nice! stores E
I' teed. Crapet taken Prop.. Pen six I Ir j building. on
, up and malting ORDINARY WORDS i I ONE LINE.
Fla. : Telephone In, Irtor Government street
I hut If desired. Leave orders sacola. ISaprCH1P1 Cal or address ; cheap rent. The
at
'f' 1 F. :i. Athey Care Merchants Hotel Fisher Real Estate Agency. lju'/!
1- Green WaUon.: Phone 193. Tmar J ;Y OTEJ..can Set&erlnd: *
J, Prop. Special attention to .
commercial
, ;NTED-We want your orders for: travelers. Free sample and bathrooms. E THE LAUNCH"LeCLAIR 'for FOR RE.'I.'T-A. R Bingham has storage -
[: 1907 Art C&Undars. Over 300 original I Large rooms with good beds. 3 ft. in sale. 25 room for rent suitable for furniture
f length and 5% It wide cm: or other
;
goods. 104
and 1W;
prices.designs vMajes to Printing select Co.,from.Pensaco-All I $% per day. ISmarlia .. l === be bought on reasonable terms. Apply -! South Tarragona street Phone 635
r BAY HOTEL.-Open night! and day.uropesn 4- to King,t Runyan,..506 S.. Palafox
..
f> 1. 16'eb ., or Santa Rosa Pev:Ilion., [
Rooms
plan. .
if dI ,. light and 12July FOR "T8roomstor, Cottage

I f WAjT-One double spindle shapii' 'clean. B.Transient Palafoz. Jas.trade'aollclted.. HOUSEHOLD. FURNITURE FOR- 318 W. Belmont. Apply to Walker

: er. One swing saw; 1 SO-h. p. 575-579 S. Nlcolau, Sale; Reason for selling! am lea Itgraham. Apnl20!
,*:. boiler. Address FUxcaton: Hardware Prop. ,- a ing city. Apply 425 Gregory. lOauglw
------
1 ii Co., Flomaton Ala. lOauglw H.TEL VERNON-Ratea 52 per day. ,
fi Special rate by week. Special at. .L FOR SALE-The timber on 1400 Found
;. WANTED hand tentlon to traveUnc'men. acres of and located on L. & Nread. .
;ft ,. kodak must Free sam- '
:jt\ be in good condition. Address: B i I i pie room Mrs. J. P. Mauldla Prop. Rates The rate on 'a want ad filling"the above space is 25 cents first insertion: Good location! for lumber mill. FOUND-Class p'n gold; owner may

,-- O. Box t9:. 12auglw.1 ISapr. and 5 cents a dayfor each 'additional consecutive insertion. Send cash with the ad.'I Address FluenatonAla.Flcaatpn. Hardware 'Co., redeem it by proving property an1
:,; lOauglw paying cost Apply this office. 5au*

.: ..
.
; :e-'

f:
fL S

\:1.'J-k f. : :'__ _"" f' '-
'';:';iFb.'o'- '.;::4 :.. ,,.......
.
!: "" << '-.::i., 'S.'I'; = ""iJ- !. a-.ty.....5e,.. ,
z.:""' 'i 4. '! .J.M .
} r _
-.l! :;< >" '
-.



-

.;; ,:', f1: : J"t ,:*) J t. : "'. = rTKE' .' : ,.

y
,


a. ;, .

PENSACO-LA JOURNAL, 'THURSOAYsJfcOWflNG,. AUGUST J8, 1908. rACS .ss-'Ert j
-- --- j



c-Thousands. Each Day Who Are, 'Looking for Bargains IIIII I 1




.. .. r
McMillan Arc s. Co. DIRECTORY LOUSViUE & HtSHVlLLE
WiLRQiD
REAL. ... <: OIKPWT. '
: .i' : '
!
-""...r.. .'..'..-w.c...-'":t..,. ,. '. j..ti.. ..? : ,"'- ,. ; .. '.<'. .. .. Pensacola Lodge, r(e. 3, K. of P. Tkkibswl L.cai is Zalte, YetwenPOocar ta-efssPo6gtore,. I)
> '
; '
1'. meets ill
II -' ,*' "- : every Monday evening at 8 READ DOWN BEAD UP -
/ 1 l.' *- i o'clock: at their temporary Castle Hall train frtoS. Tram Nos.
over lou" stable W. Intendencla St. 2 4 Sl.Oepm

ESTATE S / f. < :' r I j Visiting brethren cordially. DENNARD'welcomed.ILH. C. C.. :5 tm .. nsacola.. ., :ppa.m :0 m ; 1,

ft H. HORSLER: of R. & S 6:80am: 6SOpn1 ArAr. .. ...M ontgoniery.. .,, ,k.v 9.-25pm I1:15ea ;zI1:45em
.- -i .. .. S: 9:10pra .. Btrm. m ., .. Lar 4 3as I

\ .MOBILE., ALABAMA. Meetings ot the 7:353t73ai Ar..Jiaahtii r. .4+p S 5arnpm
t
1 1 : r. Knights of ColumDUJ sat t.wA: y. ashvtlLs:. :,. ,::;Ac. StlTatf 2
$5500.00-Will buy a piece of business : are held 15m afl5am .. ., .StvaasvRle.. .4.v: BtOOaCi 91 If +' t
: at their
property the investment paying ,8 per centon !. :;. ;'- \ ... MARKETSNaval No. 8 West Intenden-hail 7:40am 2:19pm': Ar.. .. ..St. L as 6a.. ..,. S:495iD 3:30pm "

houses and dre large .. cia street, on every 7.50pm ant
$6500.00-six lots in good location rent Monday evening at ..'fem 8.Siam, Ar.Ar.. .. ..Lous vrlle ,, ., 11C 4'aat SiJOjwa
The Classified Store 7:30 o'clock. 7:2Casa 12ttirti: ,. Clncnaati .. .1 '
ing for $720 per annum.. Jotirnars ,Columns Aa Invitation -; I : ,? lit 4 04pm ri i

which is Savannah, Gay Aug. 15.-The naval is extended
Three lots located
S15CO.OO- on to visiting Knights. Between Pensacola, Mobile and New Ore na.
two houses rentingfor stores market closed today as rollows: -
$168 per year near are an Encyclopedia for thousands WW; ., .- .. ..5 50 J. S.. LEONARD JOHN B. JONES. 6&7 2AS 441 $ &2 144 546H30psa I

Railroad shops.We WG .. .. .. .. .. .. .5 25: Recorder. Grand Knight 7.00 14. 11b5iam ..Peoeaoola.. < k-

of readers each N ..' ?. ... .... ... ..... ...... ..,..5 00 10:45am! 2:55am( 4:18pmtM .. .Moirfte .. -Lv : 1: 4s85prF II
Use liberally
have desirable lotson day. them .. M .. ".4, 80 .
some very Daughters of Rebekah. e.OQpm ?jJ5ajn} 8: Neir Orleans. LY 8:1 I J 9Kani i
North Hill most popular residence K.. .. .., ... .? ..4 70 Naomi Lodge No. 10, Daughters of
portion of the city that we can dispose --f and I .: 4 35 Rebekah meets every Monday nightat Flomaton, Pensacola, River Junction and Jacksonville.
fair : let Your wants be known II ...-,.. ..- 4 32% 8 o'clock
of at prices. in L O. 0. F. halL VisIt. 21 6 1 3 Trains do not euop at statlons 4 4 ; 1 1DeilyjDailyf
O 'IF-- .. .. .. ..4 30 ing sisters cordially Invited ;
to
be pres. Dafl Daily wbere so time is shown Dail
... ..' .. ..4 25) ly 1
... ., ent.
Escambia Realty Co. Inc. ... 4: :3 .. maton .. :4. .
D ... +* *. .4 10 MRS. J. PUL.LIAN )t. .r. 1: .1j
':.- \ : .. ...: .' ", D... .* ._ ..' .. ..... .. .. ...3 95 MRS. HATTIE NEVILLE Sea. N. G. .;,.. :3 2:5 .Cenpr
ESTATE AND
REAL INSURANCE .
.- C .-. .. 3 70to3 75
.
204*$ south AGENTS Palafox Street. :.,? !r Spirits turpentine 5S% cents., M. B. B. A. No. 81, meets first and
third ,
Wednesday evening at 7:30
."' ,.. m., RaSord! Hall, No 10. West Intenddencia p. .. .....5:39: 8:13)) 3:50.. ,. ...SfOlluO a. .. ray.. 1:89 1=215 p.47 '
AUUKY A co.'. R8POKT street. ..... 5:45: ..... 4:04 .. ,, ....tQuihtettd .. ,. 171 12:34'1: .h. h

Professional DirectoryT. LJvaferil co..n Maele.L A. G. FELL, Pres. y.... 5:63'3: : 4:11.: ,. ..Cottage Bill .. 11: ia 'i t! "
.. .,. Ol.i.Jan.rb. o J. L. SWEENEY Sea y.w. S'S7 3e2 4:1 a. 4'O ..,Cantonment .. : 12' i

> ....._............................&.23 .... 6rd1 3S443: ., .....Qonulef.. ., 11: 1:21r7: .1i iFL. -
,. ; i :' : hI>..JUr.................... ............ 8.25 Pensacola Lodge No. 4, :. O. O. F. .... fit '3:34:35: ....: .Robert:. .r.r
G. YATES M. D.p 't : .. .,., S K.-.t.pri1..............-.............M.127 Pensacola Lodge No. 4, 1. O. O. P, i..... 6:1 ;4a 4; .. ,. ? .Oltve.. ..,,.,,. 11Y .d 426 l
Apr11.kay..N..........-................ Las meets every Thursflar vexing at 7:30 6:21: 3S1'4:48: .. .a ,. ..l rent.. .. .. .. 09
OPTICIAN JIII7..l.............NN N N.........N....f,29 at the new hall Belmont and Bayla r.. 6:45 3:54 4:6 .. ....Gonldia. .. 11.1 1.05 r r <
ZWJsb..N..hN: ...._.......NNJ.h streets. Visiting brethren cordially: 5:00 ... .. .. :i1.,
306 THIESEN. BUILDIN ....... ...................... _.. NN 8.80 invited. B. R. WTTKOVSKY. G.
It 8 -....-..NN............ L26 A. KERLi Secretary.W. o. 1 cP +
L./enb.rOMd.r' _.......... -.-.. Liioe.b.xes.mbr tld A.M 1+ .,
WM. D. HOWE, ................ ......120 O. ,f. 6, T:0 Lc.,. ..Petsse .& ......Ar 10: .... .,, 11.15 1 I1,
Nov.nb. -D..mb.e .......... .N..b.S9DserabrJ LIve Oak Camp No. l, W. U. W, 6:20. .... 7:19.: ,r ....Bohents.. .. .... ..,.. ... .... 1b.55 i
ATTORNEY AND COUNSELLOR AT LAW 6 .wy ........ .._.............21 meets in Pythian Hall 1st and 3rd 5:22.... ... 7:1 .. .., 1P nip t.. ., .. It ,... }0b9 r
142 EAST GOVERNMENT ST. AUSLEY COMPANY Liverpool Spots.ISO Wednesdays In each ,month. Visiting 5195 .... .. .r. ... .. .. .. Tnletra.. ... ..,. 10:5a j

.- sovereigns cordially invited. 5 ... t; .. ... v.3ioaIubis.. .. 10:4 7 ,.
lI.e6:4
5: '71 Meat.. .. .. 1
(INCORPORATED) .M* TWfc O.Nen'Marl F. A. BOGH1CH, C. C. "
Legal AdvertisementsAN .. LESLIE E. BROOKS Clerk. t r rbb7

l1WT 0.mrk 970 071 Low 5.6 gloss 860 ....... .. .. .Galt Citlr.. ,...... .... ... .... 10:21 i. t
ORDINANCEAn BANKERS 3 BROKERS Mrrcb 9.81 981 971 o 972 RATHSONE LODGE. No. 30. BIOS .... ..... 7: :. ,, .,,...3lxltpa.. ., ..... 1II ... ... 10:14 '..f. n,,
: -
September 9.269.88 95 925 Rathbone Lodge No. 30, Knfghts of 6:35 .. .... ..... .. ,. ...Good7Byp.aga!.,. .. .. ...... .. ... 9:4Y: 4
Ordinance to Provide for tie .11 WEST INTENDENCIA STREET FENSACOLA FLA. O.bb.e..t..NN.N 8.60 950 '.40 9.40 Pythias meets every Thursday nightat 9:03 ... .... 8'I .. .. ... .... h. ,.... ..... slis r ti '
i construction cAr a System: of Storm D..ah.e.:4,60" 9.62 95);) 9.51 Castle HalL :Members' of sister 7:26..,. ... 8:30.. ,.,...MlIlIgan. .. 9:12...., 8:63 i" '

Rarer: Drains and Sanitary Sewers law York Spots 10.80 lodges and visiting brethren cordially 7:44 .... .... 8: .. ...Crestview .. : .. :

tier the Cky ot, eD6aoo1a. Private Wires N. Y. N. 0. and Chicago. invited to attend. 8:09.: ...' 8:56 .. .. .. .Deer Land. g:03 { +,9
1& It Or&tbed by the Mayor and Wheat J. M. ROPER, C. C. 8:33.. 9:10 ,Mos. Dead .. .. ':.i,,t
C. J. LEVY. K. R.. & S. 9:16. 9:85: ., Springs.. .a.. 6x5'5

Council of the City of (Pensaeola: COTTON STOCKS( GRAIN PROVISIONS and BONDS Dec.-......:O.a.74 L- KIP i4 7e34 law OI M : ... : .. .. ..Argyle .. .....,.. 6:40: ix I', ,
Segos: 1. That a system of storm 8.pL.-.x_..71 n 'lOJ.r'TT 7054 9:5: 9:51., .. Ponce Deileon.. .. .. 4
sister drains and sanitary sewers for NEW STEAMSHIP SERVICE 10:12.: ., ... 10:1 ,. ,.Westy;I le., .... 6.20.. 1'

tit City of Pee>.saw1a shall be constructed Bought and Sold on Margin or,Investment.. : .Oer1< Between Mobile Pensacola and Florida 10:2: .. .... 24 lti ., .,, ,.,.Canyvilie.. .. .. .. 8:33..S. 5:53 tf
according.: to plans therefor! i-' points. The KiWer: Steamship 10:4 ,... .... 10: .. ,. f..Bonifay,, .. ...... : 5:21
.
!j prepared by T. ChalkJey 'llatton, en- Reference: First National and Peoples Banks. Phone 1173 Dec.............Open, alA 45L Low, lass.444 445449 Co.'s near steamer P. J. Thistlewood 11:15 ..,. ..... .. .. ....Chlp;. ". .. .. .6 ,. ? }
'gJiieer recommended by the Board of p.4 % % w'' 43S will sail from :Mobile every Saturdayand 11:49.. ... 10: .. .. ..Aycoc .. .. .. :
Bead Trustees. the City of Peosa- from Pensacola every Monday 11: 1 ..... ? .. ...Cottoodale. .. ... 4:14: r 'r .J
cola, and approved by tins Council 1 s Oats.'k9 .; commencing Saturday, August 5th. : ( .....11:0 .. ... ...Marlanna.. .. .. .. 6: 8165 '

subject to such cl1.a.ngeS"as may be Opener On a regular schedule between Mobile 18:44. ... .. .. ,, ..Cypreas;.. .. ... : .. ..... : t' p
recommended by the Board of Bond 'Hlgh Low Close PensEcola St. Andrews Bay St. : .... : ? .. .,Grand Ridge.. .. .. 5:3 3:07 i '

Trustees and approved by the Council Dae-A.....!......81-WV', .'01Y 32* SO 32NawYecR % BO 12% Josephs Bay, Carrabelle and Apalachicola. 1:13: 1:0 .. .. .. ..Stead.. .. ......* ; .......... : +, !
.
nd: as provided in the contract for : : : ...River Junction 6 5:1 2:30 +3
the construction, of sa.ld' system of THE FEAR OF APPROACHING "W&11 also take freight for Tallahas 10:50 ... .... 9:40 Ar .. .JacksonvlUe.. .. Lv : ....... :- I i,
,drains and sewers entered Into on the Mock A31 PM AM
1
MaifeatCkM .ee, Quincy, Bainbridge. points on the }y
*7Ci day of July A. D., 1906 by and AGE j z'J .;0, t%. F. .& A. R. R.: also for points s
tttween R. C. Storrie. contractor and boath.earad .: 5..88: 8tJyi ; on Trains 21 and 22 and trains S and 3 carry through sleeping car betvt i )" .'
fie said Board of Bond Trustees, act ...._.......__ __.. IG4A.a. tie Apalachicola, Chattaioochee and Pensacola and Jacksonville via River Junction and Seaboard Air Line: "' t
i .._.. _-'_... liT }hot Rivers. L .
: ;
jicg for and on behalf,of the City oi MM 18I5H Train* oa sigaaL
stop
PrasacoJawhich, said contract Is Bears heavily on, 'many. There is 'really .t."..... .. t:"".!:. 'DS.1.t.t..B. 0554 P. C.. PATTERSON, ,.
...._... .......' Gen. ____ ,1
Lereby and the ... :f.ZT :IS! 1&4HB. } Agent, Mobile.P. ---- ----------- = ----- HI' )
approved and ratified
no occasion to fear it provided have : :.
you WILLIAMS t r
L i.I'j'6 77'14 Agt Pensacola.
Mayor Is hereby authorized and directed "" PENSACOLA to promptly report to the a'' l
put aside.in youth and the prime of life a .*o .....VH"'r.! ...-. 11914 119an. H Office Palafox Street Tiarf. ELECTRIC TERMINAL I general ; ;
to office
joinin the execution thereof ; ; any inattention to duty or dls < ;.
................. i.i...._,Ui\ 4' ,. ; i
for and on behalf of the City ofPtosacola. nice bank account. 0.1'.1...,_.................. 63 55 RAILWAY COMPA.V.Summer ,. courtesy on the part of employees and j <,

That the actual constnic- Look-'round about and how 11.8..............'............ 41" 4134U. to make specific criticisms of service. .1"; j ,.:U' i
ton of said of drains and you see manyare JOHN W .
system LEADLEY.
.s, .."wred:.::\-:w..N 1 G% 10634a.Y. Pensacola St. Andrews and I *' 1
Eevera stall be commenced on the reduced to want and penury in their old .... ...... .. .......N 294! 2934 Week Day ScheduleSteamTrain Manager. ,' {' 1,
:first day of September,. 1906 or as because of their in L.. )I.::.......:.......N.". 1 4 5% J..% Gulf Steamship Co. and Electric Car Schedule, i! 'a I
-- -----
-
EOOQ thereafter: as the Board of Bond age improvidence youth. L ...................._,. 8:), 80 Effective June 19,1906. I -- J' .., :
'Trustees with the approval of the. Youth is the time for saving dollars so they H.P.-.........-.-.......... 98tf 9i3 STEAMER TARPON. EVANSVILLE ; i f i
Council may determine .' for I.0..................... ...- 176 175 Between Pensacola I r I 1 & 1';\: .
Section 2. That the proposed con may work you when you are unable to 0...,.....,,.................. 168 1M W. G. BARR W. MactoruFIRSI"CLA Lv. Pensacola. and Big Bayou. i. I
tract of T. Chalkley Hatton as consulting work for ny.more' of them. It's easy to )1'.1',0 .......................HI1* 141 6am. Lv. Big Bayou. .
< and supeirishig engineer, with P.O ._......__.......... No8&le S PASSENGER AND 9pm. C:20 10:30 pm TERRE HAUTE j
tLe City of Pensacola, dated A $rii 9th save if ,you once get started. Open an account ETXCk_.._........._..... 133i! MHitF FREIGHT 8EKVICB 7 a.ni. 10 p.m. 7:30 *ll:30pja I 1 r ti.I '

1SO, and eubmittad: by the Board of today,-One, Dollar starts it. Four .__....._....._._.... 188 188 8 a.m.11 p.m.8:30 :! .
Bond Trustees for approval of this, &.1.,,;,..._................._ 26i\ 2614 Between 9 a.m. 9:30 ::1 1 t y
CoaadI thesore per cent:paid on. deposits. Lg..s....._..... .....: ro" 5734 PENSACOLA MOBILE. APALACHt 10 a.m. 10:30 !31 t
nth be and
1906
is July hereby approved, and theayor !\.a -......._............ COLA CARRABELLE. ST. AM- 11 a.QL 11:30 THE DIRECT LINE TO ; t:: i'
.a..N.-.N..N.188% lroJ. { 12 noon U:30 pm. '; t::: *
and the Board of Bond 'furst .._...;..__ -... 159 161% DREWS MILLVILLE 1 p.m. 1:30 CHICAGOand : i iI
hereby s of Uia City cC Pensacola are And all point on St. Andrew Bay. 2 p.m. 2:40 :<: 4 .,
authoriaedianid directed to
exe- Carrabelle and Apalachicola.SCHEDULE 3 3:30 '
pm. :
cute the same for and on, behalf of FIRST NATIONAL BANK SAILING LIST OF THE 3:30 4:00 : .,, .t'f f
.J/aid Qty GULF TRANSIT COMPANY 4 p.m.p.m. 4:30 all points I I In the .'

S'-ctkm 3. That the said T. Chalky e Leave pensacola, Sunday 1:30 4:30 p.m. 5:0 :
'* Hatton, engineer, and his aseist OF PENSACOLA. FLA. The following vessels are under m for Mobile Ale 5:00 p.m. 55 North and Northwest f. : d

ant; as is provided in the foregoing charter to the Gulf Transit Company Leave Peneacola, Tuesday 8:30 p.in. 5:25 p.m. 6:00 .
Contracts shall Crave charge of the and will toad cargoes for the ports for St. Andrews, MUlvUle, Apo.laehreola 6:00 p.m. 6:30 j .,' :" >If., I
W.H.bOWL,Pre g. W.K.flan,JL V.-Pree.and O iUr. i
construction: of said system of drains T W,Bear and w.N.Bonntn' Awk O-tiLtori. earned! during this month: Carrabelle and intormediau 6:30 pm. 7:00 i ; i : I
and sewers, bat the Board: of Public JmJICrOu-I'.o. Brent. W. A. Blooni, W. H. Kaoirlss, W. K. Hyer, Jr. For Liverpool-Oracia, now In port; points. 7:00 p.m. 7:30 Exceptionally Low Round : i;, ; :
Works shall under such instructJonB: D.O.Brent.C. Ida due August "25.: For. additional Information apply t 1:35 p.m. 8:00: r I'] p|

I las may be given from ttoe: : to time For Marietta-Clara, in port J. R. SAUND1illS.Ie. 8:00 p.m. 8:30: ; !
br ordinance, or resolution of the iV Venice-Jenny, September 5th; R. COBB Prwideot 9:30 Trip Rates to all Summer ;. j t 1

.'Council supervise the actual con Clara, fa. port. Gee Frt. and Pass. Ar. Saturday only. 1:'. ." i ii
s&uctlon.of all said work. For Palermo-Clara, in port. Pensacola. Tla Touris Points.D. : :5 t -
Stctfca: 4. To the end and for'the Na 560:1- !For GeooG-Jenny. September 6th; Between Pen cola and Fort .. ; J

purpose of defraying all expenses "- Oelphine. Ln qua Barranca. H. Hlllman, S. L. Rogers, : "I 't"_
.W.UMRPrwldent JOHN PFEIFFER. Assistant Cashier.:. tj'
connected with the coastrucUon: of the M.E.CLARKVice-President and Cashier. J.W.ANDREWS, Assistant Cashier. For Dunkirk Tolesby-in quarantine Lv Pensaco'a.! Lv Fort Barrancas G. P. & T. A. General Agent' 1, :i'. :
""'Stan of drains and sewers. herein ; Nonsuch. early September. f N f [ CO.R RTo 7:15 a.m. 8:00 am. Evanevllle. Ind. Nashville Temv : : )i :
uovlded, the Board of !Bond Trustees !For Finine Clara] in Port. 9:50 a.m. 11:00 a.m. : ::1 '
is hereby authorized to expend out of THE AMERICAN NATIONAL BANK ?tor Trieste-Jenny, September 5; 11:00 a.m.- 12:15 p.m.- _, -- - :. : : : !
the proceeds of the recent ,. Clara, to part 12:50 p.m. 2:00 p.m. "

slue of lour and one-half (4%) OF PENSACOLA, FLA. For ''P1)"mouTolesby.: In quaran- 3:50 p.m. 5:10 p.m. Round TripSUMMER :, ; :
Ir cent binds Issued for the tine. 6:20 p.m. 7:00 pan.
Impose of constructing a system olerage DESIGNATED DEPOSITORY OF UNITED STATES. 8:30 p.m.* 3:00pjn; ; r'
>
and drainage not more in CAPITAL STOCK, $200,000. SURPLUS u .ooo. Summer Diarrhoea in Children. Saturday only. ,, : .' .' .
tV aggregate than Two Hundred: and -- ; t
lifts Thousand Dollars DIRECTORS. During the hot weather of the sum- and : : k kj'
: : (n:5u.ooo.OO) months the first unnatural looseness Steam train leaving Pensacola at

Section 6. That this ordinance Henry L, Covington, Frank Rcllly F. E. Brawner, mer of a cb/Id's bowels should have 7 US a. m. will stop between Pensa-
tit
uke> effect immediately upon Pfeiffer W. 3, R9P is J. M- ; Iln.med1ete attention, SO as to of the 1 j' r I 1
adopUoa. all country.The !
Passed Bran Ounwody, T..F. McGourin, J. R. Saunders, the disease before It becomes serious.All parts passengers for points beyond Big I
Approval Jifly,25th. 1906. A. M. Avery W. H. Milton 0. E. Maura' that is Tidcessarr a few doses of Bayou. Steam train leaving Fort Bat.rncas ;!
July 26th,,1906 W. U Cawthon Dr..\V. IfaQAali, McKcnrte OertingIlex Chamberlain Colic. Cholera andD5eirnoea at 9:10 p. m. will stop between Rates <

Attegt OHAS.: II. BLISS. / Mcdowin, C. M. Covington M. E. Clark. Remedy followed by a dose Southern Express Company Big Bayou and Pensacola only to put ''i ". .
(Mayor:, off passengers from beyond Bg! '
c. It JIERRTTT. Jaiety deposit texts for rent,at210, J3XO and {SOJO the year. Private apartment of castor oil to deanse the system. receives and forwards freight, Bayou. Other steam trains will make Hound trip summer excursion ;. s 'i .
Clerk.In in connection for the convenience of customers. Rev M.; O. Stockland. pastor, of the money,and valuables of all descrip all stops. Each electric car makes all from all points! east of Pacific coat < I ,.
First M. E. church. Uttle Falls.Minn., stops. and northwest from June 1st to 8ep- ;.? |,. .
Four per cent interest Paid on Time Deposits.L.miiTpy writes: "We have nsed Chamber- tions w'fll parts of the country, The above schedules and regain tender 15th, wIth special stopover' ;;: t: !

State Escamibia of Florida.County In Circuit! Court Iain's Colic Cholera and Diarrhoea with connections for Canada, Mexico lions subject to change without notice privileges good returning to October '. t.: i, i ",
Chancery. Charles for several and find it
Johnson vs. Kate! Johnson. On Mon. Remedy valuable remedy years especially for Havana, Cuba, European points, Local Freight Regulations. 31st 1906.SUMMER. '" '.-
a very Freight shipped by the 7:15 a. m. -4
dart the 3rd day of September A. D, disorders. in children." Sold STO ,, '? "-
summer train will be received only for point RAT COLORADO : .
19OG. etc.The
the defendant, Katie Johnson, by all drugKtets. Southern Express Company beyond Big Bayou and will not be t ,
Is required .Psasm..e. WM.L1I8. .. JUNE 1st to SEPT. 30th.
to appear to the bill filed (GBED. 11.: > Vtcm- received later than 7:03 All '.
against her herein. This B.If.itrSaXFLJ ClSHna. Ma8BYI8tD1soR751i0,1aea+Clsss operates on 30,000 miles of first a. m. : t
order top Week trains
CREW NOTICE.Neither other Day leaving Pen-
published once each week for four Citizens National Bank tee Captain, owners class routes, and in connection with sacola not later than 3:50 p. mcarry Use the splendid through service at'I rJ :t
In consecutive weeks in the Southern Pacific from New Orleans }*, i
The Pensa-
but
for point, freight
freight any will
consignees of the the Adams Express Company, on
.
cola Journal [Paseol.,rta.r1. Union Pacific from Kansas il : t ::1 +
a later ;
newspajper published be received than 20 minutes
steamship Clara will be responsible not
la sa'd. Escambia County. A. M. Me- WRWORSC for debts through way.bills. with through before scheduled departure of trains. City or Chicago to all points west, 'r: ;I i j
con-
iUlan. Clerk Circuit GM.f..Wright.. liazdrl3wr. T..WeHes.. lUxU.EoWnson. L.Bma OTMB.HGtXtOAfttirHKtMG northwest and southwest including ; j
Court By L. G. tracted by the crew of said vessel. Tara and through messengers, performs The 9:00 a. m. Sunday train I:13.J'1
.t
rmard, D. C. Pensacolm. Pia, Aug.1st BVSIfttSS TmHS/tCVtO O. GARCIA, a unified service, constituting carry light perishable freight under 4'!'palac'.al 1 steamship service from San : -1
1906. 2augoaw4w I Captain some circumstances by specIal per Francisco to Japan China, Australia, I. .:t I

loll: Transit Co., Consignee. the largest system of the kind. in mission. Electric car will not carry"etc; :: 'j!I

Administrator's ,Notice. the world.n?** "" & freight or package of any description 1.
City of Pensacola Improvement Bonds. Honey Orders are sold ftJ air except medicine urgently needed. Through Pullman Tourists Cars ; :'
Notice
Is hereby given the creditors, GREW NOTICE Shippers are requested to bear these from Washington Atlanta Montgomery }\

legatees, dlstribatees and all persons Denomination 1000.00 each. Dated January 1st, 1906. Maturing January Neither &e Captain, owners agencies of the Southern Express regulations in:'mind, that inconvenience etc, and from SL Louis and Chi It '.:

hating claims or demands against! the 1st. 1936. Redeemable an. 1st, 1926. Interest Payable Semi-AnonaUy.! nor consignees of the Company at reasonable hours. Receipt may not tx caused. sago to C&nfornia. j '

to fatale of James MfcDonaM. deceased WE OFFER FOR SALE THESE BONDS SUBJECT TO PRIOR SALE, IN I Spanish steamship Gcada I is and is refunded These freight regulations subject to :
present them I given money Write for literature and infor 1.
to me at my office AMOUNTS TO SUIT PURCHASER. will 4>e responsible for change without notice. me .
In the City of Pensacola. Florida. I by the crew of said I if order is lost. Any further information regarding mation. i"t' q,
within two years from this I and freight schedule can be J. F. VAN RENSSELAEA: ;\ I
date. YeSae1. passenger i
send
This is the cheapest to I
August 2nd 1906. J. J. Sullivan. Ad- The Peoples Bank of Pensacola I J. RUIZ way had by applying to the general office Gen. Act, 124 Peaohtrea St. [! .
aistrator estate of' James Mctton- Captain small remittances by mail or other of.the company. R. O. BEAN. T. P. A. a Atlanta.j'! .

aid, 2augoaw8wss Pensacola, Fla, I Chdf.Transit Ox, Consignee, I WIaSL Passengers are earnestly; equated G. fI.. ELY, T. P, A. 11- : ,

.
,
-I

1; .

; ':fi.'i -:'''' J V .,.".' ,< i . .i ':
l ", ., :-< ;- 4"t Jj @. iI l1 H a "i ..f.L : ; y '1. t\ Jf ::.> 3' '. #



'-' '" ..
,,- -, .
?
,.
'-' ,
''"
.f 'i' .' ;'" 'f."f

t


y

,... THE PENSACOLA'' 'JOURNAL, THURSDAY "MORNING.. AUGUST 18, "'1906. PAGE FIVE t

"


# flWWflWWflW3i T ftfr ft.ftfrfrfrAfr: : i -- OMAN SC r ; I: ,


i Married Life ) D 'PureToilet ;




I TPEOPLE AND EVENTSBy Is Sweetened I Iby Soaps I "

MISS KATE, E. GRISWOLD. 1
-'
E. NELLIE BECK. Telephone No. 38 after 3 P. HI. occasionally! i carrying the Kfficleot Editor sad Publisher Imported and'Domestic ;E !

borne a, box of candy or gf Profitable,AdTertlsiag.
carton of cream.. Better The success and worldwide reputa- in daintily '

still, let us send a two or tion which Miss Kate E. Griswold of boxes for
t flve pound box your
of candy
Boston editor and publisher of Profit- .
I and a Quart or bait gal- ing grip or your l;.
- able has'won
ton ,of.our. rehretty Ice Advertising for herself
MRS. BOWEN GOES NORTH \ 7/te Journal's cream. Shell sm1e! all- through courageous persistence and These splendid t
THREE .MONTHS.Mrs. Daily- Fashion Feature.
FOR TWO OR Tight.: hard work ought to be an incentive to are absolutely r

Hotel"Southern F. L. Bbwen, left Wednesday proprietor noon of I f other'young business women to forge and perfumed :

for the North: to recuperate after a 11 ahead and reach the desired goal Miss fully. We have

trvtog season. Mrs. Bowen goes first]. vY 4tJ COFFEE, Griswold has had little help and her in a variety of i
visit her mother Mrs. K if t.: dao of, an enviable in a
to attainment position
Kronen-I
larger in,Du<=J'TU.S. the business world has been
at 5 o'clock. won solely
Ohio towns. Later morning I
other ious
tastes. They
acoom'l
panned by her sister! Miss O>let ;. through her own efforts. '
nenberger, she will spend,sora time West Hartford Conn. was the place so refreshing

in the Adirondacks. f I + of her birth some thirty-five years ago. skin-10, 15, 35, J

guest Returning of Hon.,Mrs.S. and finished at Miss Haloes' school in
to .Kate&burg: N. Y. and of other relatives -
in New York state returning I Phone 999. 104 S.Palafox Hartford. Love of animals and out'of

!home by water some time in October I Il door life have been elements of_ her II Fresh Shipment of : '

or S<7V< ; PlI'
-+- :
poultry when still in her teens, while Medicine .
BLtMER ENTERTAINS 1 'I
TUESDAY MRS. AFTERNOON l Beautiiy the Complexion the other has brought to her the health

PLEASURE CLUB. which has made' her success possible. THE f J.:
The Tuesday: Afternoon Pleasure O ICA DAYS Through her interest in poultry she !

dub met this week with Mrs. F. t became attached to the Poultry World I 25 S, PALAFOX ST. ;" f

Blumf, and spent a pleasant time. NadinolaCRCAM. ;
This club gives 'but, two prizes, but ? t- e
they: are always unusually desirable.Mrs. s the un-
Harry1 Elumer won the first *,: equaled buutiher is :
which was a nice rocking chair, and / endorsed by thousands tl
Mrs. James 3idRU! !)1, Sr. the second : and guaraajj J. F.
teed I
to remove
of Jialf dozen glasses.The N.
prize next meeting. will be :with MrsPat >' x -s freckles, pimples, t !:
:
i liver-spots Un, sal-
McHugh. lowness etc, the worst case in 20 days, New Brent Building ': t : I
--+- l i and restore the beauty of youth. Price :
.
SOUTHERN PARENTS IN ARE I 5Oc:.gad $IjOO by leading druggists or auuL ---- 1 lf! t,

INTERESTED THE CHIL-DEN'S SUCCESSCF U. D. C. \ 'Prsarrf br NATIONAL TOILET CO.. Park,Tank : t

The attention of Southern, parents l'f WASH DAY
H called to the meeting to be hed at .

the res:denoeof Mrs.S. iA. Moreno this. .. ,* ; ,H''I'i:
afternoon at -o'clock, for the purposeof FOR THE LAUNDRY. PHONE 1186 E. W. 1 ;; I
..
children's charier of -
organiz'ng
a
.. attJI yN001 1 J:
the United{ Daughters of the Confederacy .. IlBTe a Separate Bag For Thins off J fi.i .

L.-. w. 'f"J That Require Delicate naadltnc. 7 ............ ..., ; 1j "
Several of the states, including Almost every woman has felt the I
Texas, Georgia and Alabama: bare successfully \ ,u- ...JI.I ....wda'a ." need of a separate bag for collars and I i
organized Children's Chapters tyw '. ) I I if1 i ii
and it Is desired that Florida -, cuffs especially if her husband's are 9- THIS HOT !
w- .-
should not fan behind. This is the I c 1 6t'ntto the laundry as they so often f
first! step !in that direction that has: are and must therefore be kept separate i THE ;!'
'
been taken in this state and has the t ,
from the general family wash or,
approval; of the state officers of the if not needed for this still
purpose, a
T D.C, and It is hoped the movement -r Visa KATE :E. GBISWOLD.:
rill with bearty small and ornamental bag substantial .1 F'r
meat response.The In Hartford at the of sixteen and J.ti
Daughters: trust that parents enough. to be thoroughly useful comesIn age
*!ll recognize the importance of training handy for the handkerchiefs and soon was in full charge of the advertising
end. Later It was the journal of
their children in this work
GO, laces that require more delicate han
dear to southern, hearts. I Child's coat of either cloth or linen flower sprays which were partly done' dUng. the National Trotting association that !

Send the children this afternoon I made with a circular cape the edge I r in open eni roidery. The little sleeves Such a bag may be made out of the benefited by her efforts, and so untiringly I !if .I
AH children:! who lineal descendants did she apply herself to business 3
are -
almost
and
of which 'embroidered in deen were plain: puffs were covered fancy Turkish, towels to be bad anywhere v.r'
of those who served in the civiL: were by the cape the straight band that her health> failed and she was If Yours Is i ? i ;
for 25 cents Those with I
cilitary: or.oaval departments of the scallops. !In the center of the back 11 I cuffs being also scalloped and .em apiece. obliged to rest for a few years. ,
blue, pink or yellow grounds and a brocaded J : F .
southern states are eligible. I t and on each !Sront. were embroidered broidered. dike Griswold re-entered the busi- Not ;
Mrs Egber Beall is the directress r patten or raised white upon
ZPrice
ness world again as editor arid manager
and It 4s now evident tbat
I of the Hartford City-Mission Recjrd : t
chapter will be organized.PENSACOUANS'JN Pensacola when,w get back from thereports : ITon.-J. Emmett Wolfe and /bride who and blue will wash but the yellow is f.: ,
--+- I' we are getting of the new arrived last night; and 'will be tile not, so sure. The bags are 'made bV and for five years kept that publi- .<
DENVER HAVE' buRdings that are gclag up. I I guest of her aunt Mrs. E. O. McRey- doubling the towel and. seaming! tfy ratlon on a paying basis. Meanwhilebe I fffji
Give all our Pen-sacola friends our colds for .two or three weeks. wltfcm various competitions in designing ;
'rKE6C.M..P OF THAT INDIAN: I .. edges to four tacbes of the top, ''i
ARE PROSPERING: AND' PAY regards' end teM them we wouM be 'eo' not Including'tee frf le. 'Plflaps advertisements tempted her to try her I i
TFUBUTE.TO HUJP.( .;CARO. glad Ito' sea .diem in: 'Denver: at any Mr. Edward< P.: Preston! ant(, Mr. are then turne f over to,as to make: skill; with the result-that she won sev-

the wrier is in receipt of a letter time.. George A. Peterson1'leave Saturdaynoon tort'of little Iftmbrajsia, and a line of seal prizes., k't: i
for Benton Harbor and :
Chicago
j jI
from which extactsr.Jl be read with T about t.third inch Through these endeavors she became ;
WITNESSED SNOW STORM+ AND St. Joe Michigan, and Milwaukee stitcbln" put of an I known to the C. F. David Advertising 1 108x1108. Palafox St. 1 i::
interest /Heads of the Pensacola '
by ,
from the thus hem in I
top, forming a
HARVESTING AT THE SAME:: TIME WSs. They will attend the last two 1
contingent now fax Denver, especiallyof I 1A message:iron: Mr. TV. J. Hahn days of the convention of,Eagles ,tn which: to place the drawstrings.Kelt I' agency of'with"Boston, which opened nego- I ..- .. ,
those mentioned. They are dated tiations ,her which resulted in
.
I runribbon: the hem
Milwaukee.Mr.
through so
August 12, and read as follows: I I states that he- dd'Mrs.: Hahn arrived I Miss Grkwold becoming an editor
,la i SQtda. Ootofafio. August 10, after ... that it'vdll: dkiw from both fides.T j i i ;
"I wish state for the \
benefit of you our would friends: that':We Ice: 'I sightseedng,CJW flay in St. Louts, twofa and Mrs. J. Simpson Reese end 'wash. remove the'ribbons and. upon tite 'staff of Profitable Advertising that-It Is dotng him a kindness to ]1
SchultZ Kansas Cfyjr taid one In. Pueblo and Miss Sallie Wrlghtturned Wednesday press,out'the drawstrings, Soak blue its publication. him a loafer about his milk.
the that Indian
k'.lled sca'p while of In the west, also Mr.a picture I-he oontnees! -, morning from Colorado Springs towels 'la-strong; brine say halt a cup Two years later this journal was de- me tell you that a baby is going 1 I ; 4 *1
"We have bad delightful trip so Denver and the many points of Interest clared failure and unloaded upon the I
of the spot where be was killed, andif a of salt to a quart of water, an hour or every drop of milk in a bottle
any one would like to see it --si far and takEas much'of each cityas state and of Colorado.magnificent scenery In the two before'wash1ni. Do not,boIL! Pink shoulders of its present owner. It was because he's hungry and wants ; 14 H :

would be glad to have them'come tip possible 'IWe witnessed a snow towels should be soaked at least an in 1895 when Miss Griswold becameIts you won't starve him if you use I' :
0Th
and storm in tb k..mountains yesterday afternoon publisher and it had few subscribers 1
aspect it. ,. S. K. Jennings of Foshee Ala hour in vinegar and water half of suction nipple. It's much
in tae farmers ;
the Pensacola people are all enjoy- valley were arrived Tuesday afternoon a flying each and enough:to eaves If in the and fewer assets. With undeniable him to work while no feeds on ,:! i
on
Jcg: this deLghtfol Cbkxrado: climate.. apples.harvesting The and Royal trees were Gorge loaded through with visit to his mother Mrs.: E. A. Jennings soaking any part should be Jeft'dry, it courage she set to work to buildIt ory that man shall earn his 1ft

Mr Walsh has Just resigned his whcih I think and his sister Mrs. G. E. Heu- w U generally be found to have faded. up with what success is proved by the sweat of his brow, and if the
P es:don with the Colorado & Southern we passed yesterday, the fact that it is now the leading ad- tl Rt
worth the whole trip,!to see. This is dries, leaving; on the midnight train Pink or tine,goods of almost any description of perspiration stand out on his '
n&Kod to accept' a position as bookkeeper a town of about 6.000, completely sur for home. may be washed without los- vertising Journal of the world with browand if be grunts and '

castle houses wife one here.of the.... largest mer- rounded by mountains. Mrs. Hahn ing color in Ibis manner. 'For very delicate representatives In dozens of foreign the better. Ten chances to one 1 t
Mr and I are enjoying the ,best of health." Quit artificial! extracts and use plrik,pUre vinegar should be used. countries. enjoying kv milk,twice as much
I'-oa.: a Kchards short also received-a being promoted promo. -+- Blue Ribbon Lemon and Vanilla tap' Marjon Foster Washburne In Cincinnati The publication of :November, 1895, the nipple was one of those easy t. .t,t ,

J k*chief clerk to II1e4lgO.the purchasing: agent Mr. and....Mrs. Jesse,T. Barfleld chaperoned natural flavors perfectly.fruit flavors.ra.kes" less; Enqtdrer.ToVWaah. the first under Miss Griswold's owner- that fairly poured the fluid i1 } ;t !t
Dthe Victor !Fuel Ca a party at Fontaine Ferry I ship contained thirty-two pages; a recent throat and his digestion will be

We expect Mr. and :Mrs. Hahn IT Psrfc /IYedne9davening-in honor o' Amateur Photographers. publication boasts !several> hun- er."-New York Press. i t iH I ,

I>Tiver this week. We are always delighted Miss Katharine-Caro: of (Ftensacola, Raff Carpet dred and represents many thousandsof ,,I f
to see our Pfcnsaoola friend!\; Fla. Those present :were Misses Velox prints cannot be made in any Take'the carpet from the floor and dollars worth of cash advertising.Miss Ilome Dre.smakiss. t :I I
I
; i
aW will do our artmost to show tbor Katharine Caro, ,Marguerite Turner. old way. Send your work to Kauff- beat thoroughly to remove the dust Griswold, as shown by the The great fault to be found j
a good time while with us. iWe are Amelia Downing Isabell Downes Minnie mann and get the best that can be then take the widths apart and wash above picture. Is a sweet, womanly home dressmaking is that la 1- ill ; "
made, Romana and Palafox Sts. ;
alao: glad to know that :Mies Jessie. Mae Turoor.Mioce Downes; one at a time: A good washing ma- woman. She is broad minded, soft cases the work has an t ,,II i ,
Griflia's31[ vIsit shortly (:Messrs.. Guy MSIdngly-:; Charles) Jefferson i
pay os a Every 'medicine advertised In- this chine and wringer are great aids la spoken generous to a degree and ever pearance when finished. There
Rivers
LesTe'Jofimson
Mr p Wright
G. Cora'sdeath I
was quite a
shock to us. :We as you know, worked 'Will Hall, John iPtollL'loaisrille paper will be found. at The Crystal. this. Heat a boflerful of soft water ready to aid ber sisters in any.laudable few tricks of the trade, it
with Mr. Caro a number of years Tismes. Pharmacy.. and add enough good washing powder undertaking.Boston Traveler.A which are Invaluable in I

and! are Indeed grieved to learn of hrs to it,to make a strong $ud Put one and altering clothes and a {
death It is a" great misfortune for !Mr. and ,Mrs..T. C. Watson leave to- A Law' For> X ither.. width of the carpet In .the washing Powerful Wom_'. Work. all the difference between a

Us business associates: as well a? day noon on en. extended trip throughthe : Mothers should never take their in- machine pour ,the suds over it and The woman with the queerest occupation trim garment and one which Is 1-1Jt
ethers for U: :will be hard to find anyone east and Canada. fants to' bed with them. Nothing could wash until the water la dirty. Pass the in New England is Mrs. Alma ting and ill finished. Always .
I
that knows the routine of the be more perilous than for a healthy carpet through the wringer, wash in Veasey Williams,'who lives in a little new braid before sewing to a iLi
Beat! office as Mr. Caro did. Miss Alice' EaMns of Mobile, arrived young woman to sleep side by side the second suds prepared in the same weather beaten patched cottage far In shortening a skirt pattern, f i

I don't suppose we will know old yesterday to ,meet'her uncles with a little helpless babe. In Austria way as the first, then rinse throughtwo up among the lonesome hills of New ways fold a plait across the l.'k

----- this peril is recognized, and It an Aus- clear waters. Each strip of car- Hampshire. Mrs Williams, who is the pattern.: Never shorten t 'I'
-
trian mother sleeps with her baby she pet should be treated in the same way. thirty-six holds the unchallenged rep top or bottom of the skirt or the
i ;
Is sent to prison for it The law prohibiting : Ingrain! carpet can be washed in the utation of being the only professional will be spoiled. A rolling pin, i
babes and their mothers from samewaZ.. female woodcutter ia the New: Eng- cloth around it:.,Bakes a good 1 t: 11:
RICHARD HUD NIJTrS sleeping together was enacted In Austria land woods If not in the whole of the board. :
at the end of a year when no less .....- United States. Here are some of her I ; :tr

than 4,000 mothers In their sleep roll : EtJ'aTSPIU!. of Attire. very remarkable feats and abilities: I Created Rq. r

'ing on their babies killed them. Sucha The curse of feminine existence is She can: cut, split and set up a Cord of A rug sometimes becomes '',

law should be enacted America.. )I extravagance of attire, says: a writer. wood each day as long as be choosesto creased. To remedy this turn it )t ht :f s'
.
TOILET ARTICLES AND EXTRACTSAre Every physician every coroner knowsof There are women who waste in other work. She can cut barrel down and than trima down and wet the crease with t.; tip.!

many tragedies of this kind. The directions, but the number is email tree as large as a Quicker She is tened broom until the rug Is 1 i 1' :
compared with that of wives and any man In the neighborhood. and let It
tragedies: as a rule are not made public Stretch the rug tight
out of pity for the feelings of the daughters who keep hardworking men the best ox driver In drive Meridith where horse. overnight after tacking It with 1

mother. Perhaps It'would be better.If on the anxious seat by their love of she lives. She can any tacks, which do not rust It
delightfully agreeable.this, Sum they were made public. Then the dangee expensive clothing. The good old days She cuts from eight and to ten her cords mother's of

mer weather. Every lady should.havethem of'mothers and babies sleeping together ( of, renovation must be passing away, wood for her own and then she into Paint stains on a floor ]
each winter goes '
1
under save for the few who bave been able use scoured off by soaking them for ; :
be
clearly
also sell :would more wherever she rr 4
We
on ,her dresser. to keep their desires within the bounds the 'woods and works time In benzine_or turpentine '

Mulhen's 4711 Cologne \and Soaps, Heubigant's stood. of a modest income and they are the can find employment an time expert she : rubbing them with emery j %I !
In the summer
only kind of women who belong rightly woodsman. little pulverized pumice stone
Extracts, Coudray's Extracts, Women lonely Earner ,In the homes of working men. plows her own garden herself, drivingthe with a damp doth. I fl0 i
Soaps, Face and Sachet Powders,Fiver'sExtracts Unfortunately the majority of wom- horses and holding the plow han-
Lubin'sExtracts en money earners remain.amateurs In dles while the furrow is"belng turned.
Powders
and Sachet that
are
carvings
Ivory
their work as well as In, their accomplishments She-Shingied'herown'' hoses all over 1:
Roger and Gallet's Sachet and and studies." They ,often once. A year ago at a country fair may be restored by a simple 1 : : I'
with of
them spirits
Paint over
Face Powder, and Soaps, Atkinson's, work for years without considering If You can get she performed with one of the striking tine and expose them to the '
their time and labor could not be spent, machines, proving' that she could '
Extract's Lautier'sExtracts.. for two or three days
to-betteradvautage. If a young woman STRENGTHto strike a harder blow than any of the
is to earn money at all why should she numerous farmers present. \\L :
not put ambition and energy ,Into,her. stand Hot Weather Holland window shades I
We Have Filled Over 200,000 Prescriptions Since Beginning Business soiled near the bottom can be ,
work to accomplish as much as possi- from Make the Dally 'Work.
ble She should not allow herself to The physician half dosed his eyes and tageously turned. Tack the j :

be satisfied,with doing anything-shori. looted at"the baby, who was troubled the shade to the roller.

of her best In whatever she 'undertakes. POSTUMFOOD with Indigestion although he was a fat ,
W. A. D'AlemberteDRUGGIST It is by no means desirable that'all baby. Then he asked for the baby'sbottle If a drop of. olive oil is 'li
dinner knives before ,putting }f ,
but t
women should be money earners ,looked the nipple! and grunted ,
AND APOTHECARY! .. it Is most Important that all should be COFFEETrial : "I thought so. You make eating away. they will keep' their t : '

capable of earning enough to'eupport for the baby, like: most fool I Ir"i
too easy advertisement 1
the
Is proof. Read new
No 121 S. No. 109 themselves and those
Telephone dependent
palafox'St. upon ish young mothers.,You seem to thinkr Crystal Pharmacy In this tss.j.'i ..t( t. rt

them. American Magazine,_ _,' s '



"

;,. '-(. ,... '..:.- ..Jt. ... .;.... .$ '_. ..; i.
'" .c..o.rifo, ; :.. ; ..4. .<'. .' ". : '.. :";;; : ,,"L ;. .:< '. i '. "-. .='"-.,"-"'-' "'> -- :' -" ;; : -
: .. "' > ;' i>"T; '''' iii
', : l ir
,; v-
>l. ; + .Jt. ::0' ii
.-..>/ ..._ ..rJ.-t""j.-r:. '"' _*'i} 1 '>'i & 'J't! JC:



Full Text

PAGE 1

AdvrtisemntInvestmentsCOICI-NVESTMENTSfORMENColumnsBARGAINSEveryF-laInvestmentsTheseReadCl-arkFORSALEGOOd12ooojGROUNDRETU-RNSLSBrownCoWATSONLea-dingHOOTONEstateCompan-yA140-000HomesFLOORInvestmentbyPensacolaBROOKSP-honeRealu-sMcDavidDyerBayouApplyNOWI1WANTWRITEtedW-ANTEDByyoungmarriedmanMONEYlAMli-OMEYOURLESLIEStillmanTHEHERESOMESOME46-2MiseclianeousBullockinWITHBuilding-IWVVNTKDFI31ISTCLASSHAVEPALAFOX-YouRWANT1DSCCOfllCompanyfillingtheONllaugr-WANrraDMtfddleBARGAINI-NISOUTHPALAFOXi4augirn-IVANYPEDCashlorAgencyWEJohnHOTELSWANTEDnice-WkNTEDCarrlagesulyim-WANPDCarr4er2OJulyl-niVANTlDRealADwor-th800OWANTEDSOUTH5500O-neexchangeconsecutivefWAJNTMPeacheranythingl6teb-WATPlYDOneanythingoccupiedpurchasebuilding23jan-WANTEDT11OpurchaseIFisherORDINARY7850buildingPropertyAgen-cyIEstate3500MoneyHospitaladditional27febj-iWANTEDproperty1000AnsonUPHOLSTERINGGovernorsWANTEDSecondresidencelauglwW-iAWPEDnco-WANTEDAARlOHITECTUREcollectedChairmangroundinsertionInsuranceFOUNDClassinsertionMATTRESSESRimeRoomsthonyspromptHOTLOpenSuitablebriclcbuildingaiiglB-WiANTEDGOODIN-VESTMENTBaylenAycocki-AycockMoneyISdeo-WAJNTEDpresentFoundWANTEDWeJrC-orfamilyPENSAOOLASaleF-ORBoardTAILORINGBremovalhousekeepingRENTofficeGovernmentRiRNTRoomshousekeeping16auglmoF-CHRiHELPhousekeepinggalvanized-IronMATTRESSESDALEMBERTEimprovementsUpholsteringhousekeepingmerchandiseWANTEDToso-licitedMORTGAGESsThecentlySendimprove-mentsMANTJ-scrtaptefSVANkprofitPensacolaEstate-ifJournaloughtCOLLECTIONsurelyoffice-WANTEDWANTEDAllneighborhoodLOSTSilverGardengoingLOSTRealEmploymentGovernment-StEIntendenciaPhiladelphiaIntendencirTHURSDAYFURNITUREOsceolamarketKnownHOUSEHOLDInvestmentsTwocottagesim-provementsRENTSomeSAjIjHalfUNLIMITEDFURNITUREChipleyFlaRENOVATEDprovementssteno-graphicWednesdayL-RfchambermaidconveniencesloanedPATRONAGEWONDERFURiNISHiDDRENTlorLounsberrydescriptionsnightguaranteedbookkeeperpropositionIWANTEDguttering-andScholarshipValuesbedsalryZorragossaadviceCHANDLERSBOARDINGBuildingGovernmentZarragossare3pectfullyRENTTwomoneythoroughlyExchangeKupfrlansresponsibleSatisfactionTurpentineIntendenciaIntendenciaLoanTurpentineREESEWed-nesdaysAll-24julylmMrssecondhandsecondhandEverybodyWORDSI6cCl4eltAnsonmanufacturecontainingRemingtonSaleguaranteedGovernmentcontainingCarpentersTarragonaresidenceIntendenciaInvestigateGovernmentZarragossaCARRIAGESreasonableSPECIALTYMattressesGovernmentimmediateegooddeepRiENTTwoconnectionssomethingadvance-mentRENTOneTheyJS7ANTEPappreciateRENTTwowholesaleFORcomfortableManagerEstate2000SouthStationarydelightful-lySOUTHERNexperi-encedPROPERTYGovernmentcontainingstoryIntenden-ciaSALETworeasonableCommercialSASUE600MORN4NGBillingsleyGovernmentexperienceSeptemberJOURNALmerchan-diseaboveJBRNTGANUnderwoodTelephoneprivilegelargeespeciallyWhenRunaboutSalisburyType-writerTelephoneIntendenclLeCLAIRGASOLINEProprietorcontaininghouseISjuueSmsguaranteedmouldingsperfectBlnghamunfurnishedGuaran-teedpurchaserWType-writerREGULARffiilcompletesunimprov-edGovernmentSatisfac-tiongeneral-sawnewspapersRentsEveryoneGovernmentMerchantsRentalTelephonePlantationcheerfullydwellingshouseholdPhonecarpertersCarriagesSalisburyThiesenPensacolacompetentmakeadjoiningMillviewfurnishedreasonableabsolutelyCounsellornewspapersHOUSEDconvenientFirstclassunderneathGov-ernmentSalisburyWANTEDINTERESTtravelingMerchantspressingExchangeEuropeanrepairingrepairingofMBlockhelpmakeGuaranteedcentsnewspaperssplendidEstatePermanentnewspapersBoardPALAFOXWAlNTEDstumpagePreparedexchangetravelingESTATE-INattractivepine-appleWANTEDreasonablemakeimprovedfirstclassrepairingbuildingsvirgin5STABLESPensacolaresidentialCitybreakageskylightsimprovedSalisburyCleaningPresidentinvest-mentFurnishedoperationnorthwestMARKETpropertySendreasonableIngrahamHardwaredwellingInsuranceresidencecatalogueFormerlyPensacolaTwostoryprivilegeblockingDeFuniakdancingPalafoxhotelspecialtyWANTEDspacePublisherISjunelmPensacolapersonalMillinerypurchaseAUGUSTCervantesENGINESImprovedJOURNALprivilegefrontdwellingsplendidgroundsfollowingreasonableCHIPLEY12auglwWIAiNTEDbreakagespecialtyelectricalsplendidre-paintedLaundrycustomersGregoryoppositewaterLOANEDneedGracevilleLAUNCVBRNONoccupiedRemediesWANTEDpavilliontravelingpositionsBuildingcertificatespecifica25maylmRENTAspecialtyexchangePrintingMONEYTheGarfleld-CoCarriageCARRIERFloridaandcentsrepairingfurnishedwonderfulchandlerscel-ebratedvAjveiiuesKNOWLEStionsReferencerenovatedCompanypropertyshootingBInghamExcellentpropertypropertyTransientSetterllndworkEuropeanAddressForForbeautifuldwelling22julylmseveral-outTransientEstimateslOauglwshippingbuildingCclondarsPensacolapremisesproducerFlomatonpropertyoppositeValuableConkeystravelingPensacoladiplomasPrivilegeconneccashW1ANTEDdaybuildingject27julylmHardwaretransientsfastidlousBusinessresidencecornerfurnishedfurnishedrea-sonableMAKECarriagefloorbuildingtbusinessLOANEDAndrewsMcKlnzleconditionAddress-RfromlOauglwWilliamswantMariannaFlomatonbuyCevantesexcellenteducationrepaintedPensacolsmachinesLaudingbuildingESTATE8hft07deliveryvl-Ohasefirstclass6roctnoppositeSOhpelectricalpropertyALFMANAmericanbuildingISauglw-JtendenciaSecratuyFlomatonFlomatonbuilding10aug2wpersonalE-RotnanaLaundrythousandfurnishedwantingPROMPTfrontingAddress-AHOUSESLaundryeachquantitypropertyHonestyllauglwbuyattentionhaveHOTELSLaundrycapacityexcellentBelmontfurnishedsallmaKerelectricalRealyourPORTERMAXENTmachinesBenefieldrepairedroomsconditionISmarlmrentingfurnishedpreparedpropertyGardenChicagowithsolicitedSpecialgrowingclean-ingthousand15aug2tpropertyNew2JunelmdayJeffersonattentionllauglwshoeingPhone698conditionclothingsituatedwithpropertyBrainardattachedlOauglwbuildingMONEYprovingpropertyconditionAT10aug2vLaundryMONEYbuildingPalafox-orat-tentIonStreetlaundryInquireRealLo-cationcondi-tionSpecialawningsINNOnMILTONrepairedwantbathingaugieitLOWESTBagdadfurnitureSpringsRegularTemple3335MariannaPanamasmattingsuppliessouthernJournalAgencyMasonic57557S16aug2rbeautifullocationBOUGHTwithGeneralboardersinstalledArtesiandiameterLocationbuildinglaundrywelllngbusinessGadsdenessentialMONEYtravelersRunyansecurityGonzalezpayingBidsClubproperty16aug4tAddresspositionisfactionJournalPhonebargainWrightWILSONPoultrysoJkrttedwishconven-ientVisiblyCottageaddress-FrentingrentingratesadJfurniturepositionSTREETSpecialrepairedhaulingpromptper-sonalbusinessbusinessPensacopresentoverlookbargainbpatingSpringstakeAddressmovingexcel-lentposi-tioncookingori-ginalllaugGtMONEYACTIVE2auglmAymardTmQ8increasegrltoenginesmovingwithPleasantChest-nutPalafoxLIVERYNOTICESpecialFamiliarMauldlnsolicitedlocalityErespectlightersThey-arehealthybaseballAycockBelmontcontinueBRIEFSBROWNDiamondhaulingApi120LOTSscheduleBigAddressbuild-IngSELLfourteenca-pacityTreasurerlaundryelegantSTILLMANlauglmleadingHavingWrightcottageshoeing112McClureManagerROOMSbetweenminutesTheSquareAgencybetweenexposuregivendesignsNationalhealthysubjectAgencyNlcolauvantagepackedandspindlesolicitedboughtmakingSpecialpapers-atWHITEAgentsPalafoxthathavingClausensellingJupitefirstKNOWLESAddressRomanaReasongardnerde-liveryJacksonCircularvehiclesJacksonOauglwRomanaSpecialWorkerexpensesTampaboughtaddressincludesPalafoxROOMSSpringdrillersMaressampleSinclairandfeetboughtpayingAddressISAprilHOTELTransferbattedpoultrySouthRealcollegeNo334suitablesuitablegeneralpressedAddressDernysgetMethodFamousJournalsuggestaddressJournalsampleCrapetElectricWorldsAddressBURNSPlansinter-estCottagePrestoninterestCopperAgentsTubularFloridaOrleansshoe-IngSpringandsystemAgentsfishingbundlespermithousesLiveryturpenAgentsAgentsPaJafoxHELPStrongandDeLunacircularandsomeWataonWalkerSeveralcharteralwaysList637youbundle-JWonderyouinitialslengthbusi-nessrentersPalafoxsomecloseinTRACTPalafxPalafoxfacingAgentsaleCoyfeSecondlumberbuyinganotherQUICKrail-roadcleanedApplystoryPalafoxWilsoncorniceBugallengineStearnsprovallocatedRSALEenginerootingserviceApplymodernJour-nalex-posuresupplyAlcanlzdesiredprotectyouii-T120x150addressme-diumrentcornicelayingApplydesiredrentersmodernbalancePalafoxBullardMethod9aug2twilllongerswingelsecoloredPalafoxPalafoxBlountJournalRENTSpricesI5julyexpensestromsJAlcanzbundle8roomsGenevaMarine12julyApplySalarypantryPhonespointsLINEredeemmodernmarketApplypublicApplyApplyWalkerwooden20julynicelybusi-nesspleasearmoryYOURdesiredTurnerEJournalsingleApplymanagePresidentbundle28julygallonrateDrivermonth-JCENTSyoupublicthirtyBoxfeetgoodsmoderncentralSecondcheapcholeraEstateCheapmarketApplypublicApplyknowncarpttAtheyIncheslocatedlocateddriversSecondWilsonpleaseagentsGardentimberApplyplacesfacingNo2estatephonoApplyaS3uredOpenstryCheapSIMPSONRoomdollarsexhibitBrookscorniceseveralPurdeephonePhoneordersbuggyPhoneONEphonewanted300000ApplyWESTEstatebranchhousestheApplyApplyEstateMellenRoomspublicApplyApplyamountoutsideFisher144116lumberStrawsmakerdoubleWEEKWetehcheapphonecheapFindertheWhenGreenshouldbypricesaugl6cheapmodernSmaJl28JulyApplybundleifsoldOwnerEstateTermsphondeLeon500Phonocarpet27feb-HlaunchHOTEJstreetApplySholesRENTsacolaChaseLargethethetheandcheapEstateWhitehousesfrontseitherIDjlmAgentbundleNorthhousesRentalhousesfourthPricesPhoneApplycheapnewlyboilerphoneleaatimberLargeOrdersbundlePhoneFisherWelshcannot7roomnotice24JulyBakersitepointPhoneBeforeBowendoubleMiltonDanielstreetshomesmonthLoansPAGEpolitelightsChaffinDavisWelshtrackssubLargeHACKFisherBEALmoneybeforeRATEVictorPhonehousesBrown50x14barberMellenSHOPEstateSouththeedgedLargeaigdtPhoneVetterRENTsecondPhonegoodsde-sires7roomSAILScommerSouthLargeTailorstorysellscalesgrocersAgenttui-tionSoundmonthYOUREstateLOANtracts173SoundbringbarberHorseniturehousesgoodsEstatedepthWhenlOaugexcel40x150EstateRENTordersRENTwagonStableWillieWITHISaprporchstoresSmithanteesbysacolahorsesEditorFisherYOURPhone8roomshapPeakestreet5aui-tigmoneyhouspsummerPhonesacolaHowfacingPhoneformsRateabrickinRENTNorthISaprRENTstorySALEgeneraChase65000LeavesacolaPublicSantaforhouseWriteThreeSIIDEorangegivenSALETermsRENTaroundAnFloatsPhoneLENDBlockSALELesliekodakPropboilerSALEbetterEstate9AUEready28aprnightPhoneBrentstreetLightTermstrainsllaugyoungnotreturnBanksIngraestateRoomRatesdepotschoolmoneywagondrawndrawnsteadspa-perslargeaugiuStsNo4No6meetsNorthclosetl0aagmyTheySALENorthEstatePhonenoticeLOANnoticeotherforPonceStreetNo6kindstimberSALEnoticeSAiLEstorespartystorykindsstreetCareweeksREALChaseWEselectunder4500SALEentiremoneyTractstoryPhone5roomcents-aSantaamountstreetSALEstreetcrosiJThreelearnLootHotelEastlargeChas25mar10500beamsmoneyblockPcnsastreetSALEstepswouldhousestreetforladyeightAdairRateshousereturnteamstakenGoodaboutMolertractstakenSALETheyownersSouthRatestermsSALEboilerwaterlargeBrentSouthwantsmealsSALEcornergoodPhoneofficeWil-sonkindsTheypartsaffordtweenaffordteamsstoolsshowLoydlargekindsthreeTnreeestateTractforSouthwhich3ljanStoreDavisstoryknowsheethousehouseRoomorderktaa8south4mayFirstSjulyrighthousesacksWestVPresCityhouselightwouldotherMimsSouthPlaceworkstreethouseSouthKing23JRUFirststoreothermetaltakenSantaWritelightSIXOpen27folkindsshortteamsthemSouthhouseSheetFurnlGentsWestsouthwoodwantwholestreetljulystoryfloatsFromshortBldgknowmilesfrontDavislargecleancentshouseWestlightriageboardrangeknowcleanPghtPropFreehorseotherproveLINEordershortlightMILLLISTReusThatcleancleanmileswaysstockstreetHotelmadeacreshousePropknowlimitTHISgoodretailkindsGraygoodHouseSOLDgradwaterRosaboatsmillsstreetThathnndPropcitiesvaluetermscleancents5200SHIPadverRaelcondiStorehomeChipProphorseRoomgoodCitymillslargeCaretolaidchina12500GoodParksmallgooddoCloseC-aRLExtraonestillsclean2600017000OnlyoperaofficehardNOWofficewantscornerBestfenceOnlyleastsouthsouthNordgoodshowYourclasstionsticksmiteswriteWestloan-onworkboys8auggoodworkhandroomstradeofficepow-ertrademadeorderCITYnorthshort215gladwithgoodcornerRosaweekadwellsringdeepRealTmarplanlaugupoperaeverycentsofficedoadotherthemhighmostrANcornerPropcanratesthemfrontlearnworkFOR252augonlyonlyCityWillinorsizedANDhandHills2750FeedFOReverybuiltOverof-ficeChasMainweekVestRosaBAYEastorderYorkcloseStarWillEastFORFORwideFORringCitygoodriverFORMFladyNextFOR1144-IlittleworkwithroomsKnowDenslainFORWillhandFORworkFORJuneshipFORiBestI=Iv7l14vw¬I<47IIj¬¬iat>4ViS5¬I<¬pIi¬I¬r0¬Vrii¬IaA¬¬4¬o¬¬¬¬¬0S¬¬¬i¬¬1¬¬¬¬¬¬¬¬i¬¬¬¬¬¬¬¬¬a¬¬¬r¬¬¬¬>¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬i¬I¬¬IU



PAGE 1

REFRIGERATOREVENTSPOSTUMPEOPLEArDAhJEWELERBOSSOSI-ceGINGERANDEXTRACTS-AreIc-eMARSTONHous-eDELATOURSWASHARTICLESSweetenedCoffeesO-URPHARMACYDAVISQUINAComplexion-iFactoryc-anTOILETCRYSTALMarriedALEDAYHUONUTSNadinolaGR-ETAAPOTHECARYODORLESSRICHARDJournalsSoapsValuesmbWCahndelightfullyBrushCreamToiletBeautifyDRUGGISTorganized-PENACIOUANSFashionFineToothFeatureANDt-BmtleStayInWOMANRoomTelephoneWEATHERSquareDailyget-STRENGTPENSACOLArteNeedPurePianosT-akeBLUrMERENTERTAiNSplacetheavrstringsKitchenrefreshingagreeableabsolutelyCOFFEECoudraysKandyperfumedClutterEveryoneftflAAAedndaeveningJ-rmessagefromMrbreakingLifeSolWORTHPALAFOXTHEsplendidCOFFEE-TrialPhoneIJtobetteradvantageAtkinsonswashingCo-ThedecoratedCologneBuildingImported7IRt-5daintilybigantsMusicExtracts-WeanythlngshortTELEPHONErtitWiirdawEnqiSrer-ToYWaaafastid-ioustherefundedDomestic-inMulhensATTENTIONGULFLaundryIcatep1ipureTESTSsihtseeingExtractsLautiersjnotmTainsdelightPpwderTftinbreqiiavarietyfiavorsTalkestime-WITNESSEDPowdersturaeJTovQrWeWeatherIskinlOPowdersPensacolaTelephoneExtractsrepresentativesExtractsPENSAfcOUAExtractstheresdenceofExtractsaccomplishAboutGRISWOLDaccom-plishmentstodayIJJRGCAROHARVESTINGneighborhoodShipmentRoger108x110PrescriptionsWhitmansCITYKroneni-JergerPhotographersYOURUnfortunatelyGalletsoccasionallyLAUNDRYadvan-tageouslyPelafoxINTERESTEDbrushesCHlLlDENSTheCafeSum-merLubinsbrushespublicationYoulladvertisementNELLIEYours11AFTERNOONextravaganceemploymenthardworkingFlyerstowelsintPROSPERINGsoaps-aredepartmentsSachetSachettoholdscents-toSoapsbristlesSoapsTHUFtSDAYdressmakingMethodunchallengedshouldaodyMrsotheryoungprofessionalSoapsORDERSadvertisementsPricedigestionShippersperspirationSachetcompetitionsdresserespeciallyAdvertisingthem-inmoneyPalafoxofSOuthernAdJrondacksTheyPLEASUREOYtddWednesdayLAWRENCEthoroughlyPharmacyPROMPTTHISundertakingAND3550importanceharvestingCOFFEE-HothandkerchiefspurchasingpublicationPalafoxperformedSOUTHERNdiscolored-maydrawstringsMargueriteWednes-daymagnificentpublicationmoneySouthwestCornerconsideringornamentalembroideryAdvertisingHampshirestandMbRey-oioldswoodcutteraccom-paniedcompletelykeepTheHOTaipicture-ofcountries-ThedependentBUTETOembroideredrecuperatepro-hibitingrunribbonJOURNAL1SUCCESS-OFde-scriptionamateursadvertisingDaughtersPensacolathoroughlyindigestionDressmakingembrolderedyesterdayimportantExtravaganceTheseguaranteedTUESDAYBECKBlendersdaughtersThesepersistenceespeciallyrepresentspulverizedthlsmannerthrough-twoiPJatesburgBeginningMORNINGem-broideredphysicianFOODproprietorSatisfactionrecognizedphysicianMagazineWhyReturningDaughtersremarkableorganizlUgGriewoldstitchingshorteningliverspotsCAJLPOFpracticingNovembermothersladybrightnessturpentinechildrenTHEFretthirtyfivethousands-ofnCandlesfullyIFtensacoladelightfulsucc-essfullyorganizedespeciallyattainmentAdvertisingPhonenexpensiveAdvertis-inghomepubli-cationgurantragediesBrentunusuallyyesterdaythemselvesnego-tiationsLouisvilledescend-antsterrorscomparedthirtytwoboxesnenborgeradver-tisingmisfortuneundertakesbook-keepersoakingmachinedebghtfolPhonereceivedtiPaiafoxRoasterstoothtravelreputa-tionWashburnecontingentMilwaukeeTuesdaymentionedtragediesMilwaukeePARENTSdoublingincludingmidnightconventionav3veartywasbingDeliveredpromotedscallopedseamingJenningsreturningPharmacyEmmettyesterdayConfed-eracyGriswoldsmorningChildrensinDenverAUGUSTdesigningmeybepreparedthirtysixrenovationNotdownSaturdayFbecomingwhenrecognizemothers-usedriving-theAlfternoonIsthemmountainsovernightpublisherMeanwhileSimpsonMONTHSsupportMichiganperfectlyamateurishMedicinewoodsmanbuildingsaftersubstantialgenerallymeetingFLAoccu-pationwomanlypleasantimportedDowningwitnessedDelatourschildrensEnglandadvertisedenjoyingKatharineassociationsometimesMciHugbs-ThroughpublisherAuntir-inglygriptastesPensacoTaTismesI-Mrresignedmovementundenia-bleCincin-natitfcmeagoOotoeafioafternooninvaluableFaceassociatescourageousGROCERSsleepingEgberfyou-IfBrushPensacolaKatharinetemptedorllUlvaloontinriasmorningTraveler-Agrievedsubscrib-ersdruggistsFacemajorityGIVENun-equaledcarryingtogetherformingposurbloiJen-ningsextendedCO-HfrecklesCHIPMANhealthAmericandirectionTuesdaybroughthelplessworldwidehaveINDIANThroughafternoonwhateverWrightNovember4711meetingdirectionsNewlrleavemachineswashingperilousrep-utationbonepositionenjoyingNothingPensacolakindnesienjoy-ingfeelingsCOFFEESthroughSoutherndesirableManagershinglodqueeresthavevertisingdirectress200000althoughbusinessChicagoDENVERthroughseparateProfitablequantitycouldnotMcBughsleepingvelvettyendeavorsColoradochildrenfemininewashingiwashingworkingyourscallopspressinghusbandsguaran-teedduringerNewAugustwringermois-tenedquartOfstraightRichardskindTrottingcarvingsleftdrydozenpassingGriswoldPerhapsFontaineAlabamasnow-stormsendcharierlargestpresentrockingwringerwasteinProfitableattentionBusinessreenteredColoradothrougilJef-fersonprovingclothinguP1beSouthernMeridlthIsbelngColoradomedicineneedyouryourpromot-ionpossi-blebecame-itsHandlingsouthernhan-dlingpatchedChap-tersdesirablepurpose-ofnothingSpringscapablerespectpimplesPleasurethereforePetersoncontainedwhereverbrowandPensacolIncludiiBucymsartificialambitionIngrainHeucakeGriswoldbenefitedHartfordWilliamsthroughgroundsGriswoldWilliamsdifferenceregardsteedAmericathoughtlaundryhealthywithoutpresentColoradohaveutmostCrystalshouldersexistenceeligiblegarmentfarmersHartfordpresentleavingJparentsearningparentsthroughthou-sandsmostpositionselectionthroughdel-ightedhopedrubbingremedyyellowthatltpossiblealteringgrunt-edNATIONALGriswoldpureSTCIRMbecameboflerfulterestonPowerfulsouthernmilitaryAugustVanillapowderbro-cadedtripntoleadingtheafternoonwigglesgenerousEng-landColetteshortlyGeorgiaHAYEKansasclearlyAus-trianvinegarSeparateBostonroundedincentiveGriswoldHartfordHartfordunloadedputtingattachedmothersglassespatternHarborjournalsatisfiedtroubledcountryCrystalPoultryquickerJournalWatsonunthinenumeroussoakingreturnededucatedbeautifierleadinggettingTHREEapprovalNewMafloninglonesomeIntendenclaEagleselementsHen-drixAlwaysreceiptOctoberBarfleldNORTHpoultry4generaljournalreportsmakingextractsnumberBiscuitsrestoredresponsealwayspumiceappliedGeorgeNationalholdingtackingpatternTheychapterchildrenWrightpatternAmateurCanadafollowspassedenoughcircular3rf5therpoultryKATEenoughenoughPublisherwltfifeij4jP1themmothersmerc-antileMothersLawPorThatandandclimatevinegarpearanceenoughenviablebusinesspayinggardenmothersBottomre-lativesOFcotorinagent-of100foreignrequireDenverAustriawithoutlaudablejsubbedpicturehungryandextractsenactedhedroutinebusinessfriendsobligedVeaseyTurkishthispeopleinslyandandYoubusinesswayoclockmotherwidthsspokenternoonsuccessGingerde-claredFloridaendorsedright-lygetherstrik-ingbecomesprovedchancesRomanabeautyhoweverhun-dredopenedspoiledfarmersHollandfreightevidentsewingalsoplace-ofDowneswindowalwayscottageAus-trIadesiredfinishedfamilythatvaChildsandapplessupposeandBlumertraini-ngwashedRequireGingerofficerswashedyellowHotweatherwhicharrivedyousameFreshinterestPHONESchultzar-rivedprisonpublicgetMorenoabilitiesPalafoxnumberFosneerollingpouredEveryCharlesralprIBakinginter-estmotheracceptsimplefriendsbenzinebetweenTRIALenactedchargeInspectherresultedanxiousfinishedandIfesttespiritsfriendsfriendsarrivedbelongcarpetPuebloanimalscourageDownesshonKlmotherneeded18almostchoosesfamilyfinishedcarpetstrongdelicatearrivednofrboilGetvariousscouredstrongBentonTurnerAlmostlownesspartlygruntsftthirdDelicateindeeditJtIMobilestudieshousesLastrailroadsuityoucarpetprizesupsideCarpetsnippleWomanscarpetribbonsdegreeshouldapieceMISSoclockpointsherselfanywayhandyRibboncreasedproofJIbehindmotherpurposewithinbeforesecondNOWstrongThoseexpertbecausehan-dlesvalleyUnitedbabysinterestspendfriendsAmeliaflavorsStretchIsabellsellMin-nieGBISWOIiDsceneryHarryDenverMessrsGorgeBowenSeveralprintssleepsturpenTheMissionprettythingsshortentreatedboundsTurnersleevesEarnersprocessnipplehonorWeFostetaccountwork-edfurnishTIME-AnippleremainaidberSeIwedmindedlookedwhileIndianMrs1Sbusi-nessseveralnaturalbecameroller-IfmodestWillBowenLemondesiredWetownsSAMefemaleagencyknowsremainbottomThingsflowerBowenplowsRiversmakefool-ishIdollarsdesiresBostonBluniierheartsIncomeherselfthetrytastoeingstrongeatingaroundshouldcartonTHEpositionedgesBOSSObenefitremoveRoyalHainesschoolssuctionwouldUnitedshouldspentshouldsoakedshouldtheMissesBostonwearyoungSfiKdaweeksthe25cshouldmana-gerEverysecondworjcgreatlookedwoodssolelyBowenshouldshadewatersshouldpoundthecandyGroanedyouthsixteenflyingshouldTight104turnedTHEMcandyJamesgoingunderBywinteralmosthealthwouldlos-ingwoodschoicettAtwaierVictorattendstatesbabiesTHATclothesoughtbeingGOESReeseIfurrowCerogreatshapemoneyturnedknivesfailureloadedenergyRec-ordsistersLaundryknowreadyherselfbottomWomenedgesdinner148harderdozensmiddleNortlhgoodsdoingNowsummerwriterexpectkeepherselfKauffBetterknownHeatfairlygivesJustearnerseffortsequadtowelscollarsexposewriterFORquiteFerryflapstowelsapartagaindoingfancyTheywouldWorldapplyGriffinsnijlemonthaboutfromCLUBstateswholebuild-ItwincihkilledyoungbeatencannotPropSalliemoneybabiesbeingspentgoingcenteramongandThMetime-inknowsfoundpervxnlldloaterstateseitherbeforetinnedsisternightJessieothersHotelquartdampwouldyoungforwhereThereParkMoneybeadsIvorystyndTheymanyPartsshouldany-onewhichwidthlaterthroatattirewomenhorseslinealwhichbeforeStorebetterworkssweetwhichwashtheirFlacomes-inWalshgreatbadlywomenTOILETwhichboastsshrinkSincenewwhichmoneyguesthomesdeathStatesFtVCalloweffortswhichclosedforplainshownthemmakesTherebarrelthosebabygladkilleddirtywheredriverstainsvhchsleepWolfesisterShellEditorfopletterknowHahnwherehealthDavidwaterbaby125aboutVeloxeditorROMANAweekforgewhichthe-oryraisedsprayseightbabyschoolearnersrightcoroner38foundwateraboveforemerySendwhichwantsworldremoveProfitshadescalpmademuchbabyearlywomanofworthaheadwhichassetsFilledeveryeditorworthgoodquiteLouissidescalledstateStTHEusefulweekunclethinkdozeneditorunderbettersleepeverylargeHahnwholesuccesssoiledbabesworldstrikeSTAliceguestcanNeverbottlestarvewhiledeepHahnThoseresultwomanwomanQtrosuccessthinkboardchapwontwhichwifewomansuccessNextitiusthreewbenwaterpartEachdatedtakeworldbroadfoundTHEthembetterJesseeverywouldplowmuchPreparedSOLDbroomwaterandwivesfailedhousegoodtightaskedshockbribechairpuffsGetwomenaboutfadedonedays109paperplaitkeeptreeknowwhiteRollsyearsTWOsmallotherfewerlearnBeallwom-enbabydaysbeatbottlepaperhomedownAttireotherhomeaheedaystrustthreeonegoodHahnhomemakewomanyearsmanymadeLaterPaintmadeseasonwoodwhitesweatMethodtwiceReadleavestripdaysgoodtricksiPolkicoulddaysConnWaveAlmaCitywomenkeptshortOarotrainTherePaiafoxtheychinetreesworkANDIfrontmodethosewashwoodcouldFoodPaintbridekeepbagsfromtheirtrmthempagesgoodfromshowclothWorkremoveJolrnYorkstatedownstoodlabormadeperilyearstheseImostbreadmadefcaveclericbluetheythemstateWestthesecreamwhenyearswhileTextstownPinkreachdozendonteverydown23BOWafterANDoftenbraidonlyPricefantswashmadetheysplitrestoreworkwhatCaroofficedeathmadeawaymanyprizewhenwhenwhencreamlaceswashotherwlthpinkstfcffkMlodworkstatemanythemworkStheyearsmakePressworkoftengaysMissuponAREotherhomeTakewashvisithove25themsmallmuchhomepuntcordsmuchdropMisspourthenGIVESoakmicehorsecantheirGuyfirstcentstacksyearsmeetdowniwhoQuitwithkeptshortIPuelhaveandPHONESuchfromfeatsmostclearKatebrowwhiletheirthemtheythoseholdseverytradeThisanstoneCarotrim-awhySenddrivestatedroptimetheiraftertheir4000intoThenworkthoseworkissuewithouraisorustonlyBabyAGEhardlinentoacVGivetheirrinseTHEWithThenthemwithuntilwftbOhioworkthatthismustPurbasisheldtheirwayownerMissWork6000theirmustnexttimewithPropfeedswithMissclothhelpmeansRugswhatNewlittlehourbirthclothafterTackLovethemwithawaythemOvernicechiefareCityPAYfromHeretheirwesttheirwashneedHomethenIsteensgladeachacrosswithbandbabedonefromYorkfaultpityworstthantimevisituponcentwaysJustowner75withbackThisraisereadTadEdvneedPinkhavecuffswithtakenwithandworkwillcuffsfruitPassblowwithlittlewitholiveALLhaveWilllittleCo-wthatcreasetripsortjualpubwitlatingthisship99MisshaveharduntilhavefromjUldthatlongthatleastskirtiIfherehardtripwillbeentheyeachlittleuponskirttimefloorthemseatclentSuchthatthatbluethenwithwithyearcreamTOsudswillHonMRSalsobestBluehourlittleAREsendfromSAMwithusedMakebeenwhotakeeachauntthattheneachliveswithMissMissMRSstilllittlefromthanThekindwithsodsliketWsideMisstourHavelaterskirtTHElocalNewliveslittlecivilwellkindsudswithwithTfcelUllMissThisopengoalcapewiththatfirsteachnevercoatNewAREthatuponwishHallbothMrscordthencityyearMisscurse1906thatsentwhoofFORcapebeenMissshallMaetimewithgoes1805doorwithwithablebestyourdust15comewillThiseastwellbestwhobag121meetMissthanwithfloorwhothatspotsepaverymilkclubputbestsomegladwithMisstimebagputfromthatRagmailveryNowbestClubwillbluemannsomeTwothanMrslessthatYouthisNewthatmilkturncashtheWismilkthisicovertakeseemhalfthentothisinchthathemwhofactNothis4ThatwereandwithThehalfCallIMrswhothat1895thatpiedaythattheMrsMrsthatfirstwhowilleasytimebagwillsoftmayThenuLlToneasyfirstthisfindsentYoutrimmayblueinwillMrshalferedTheDAYSTheMrsdaythatthatandwillweredid-IwhoaidsyourfluidwillthateyesMrwereweresomeMrsalsolastfirsthillsthatwaypetMrsandthatnoonrulewayMrsnoonsameandandJyhalfableneatandKTOcutsmetThewillweresamesameTheofThewhothatthewet1326MrsandsideWareandlawloveMrsfindThegoesingthatandThefewhemmorelikethatthisstillanyPutandhimMwillrateandTheandnotandhesTheVbecasesandhadwilllastbuttoifceTheandthisboxandhad100lessfivetwoThetoptoPinweretwoendandandandNoandtheandandnoonAIrsleftAlaandtwogoodwillandaddandTheMrsthisandandandandfoldwillandsoftDugwereweremoretheBldgherstep1tWeandandthethisdanandand125herKATEMrsandhimandandandandandTheandandteftlonnoIWetheMrstheWegetandthishasvaiandJoJ1100ttheboxAlecuEdearWeMatandandtheandtwotoandForwaytapandhimTheandanatopandandtinethehasweremoreherbedanyandandandhimbutandandhadandandandStandandsomeanystillandsavetwoandfewperthenverthehotTentheShefallSheTheandlineandandandandandthishasandandandandtheMrswillandpayfewfewthebVthethethfstheandandWeherSheShesellnedfairwetintogetandandandandshegetnewanyandlawandthishadtheMISSthegalandnotyouShethethehasforthetwoSheSheWeandendandhisherIbeenandandandanyandyouendandyouand300SttryoverthetherollnotearnthethetheJoebutAlethetefortheFlayouonceandandanyandnowyounottheMrsthea5sohashasthethethemenherShethefullShefeltandanynearanythetheshetheshetheandbutThemananyhernotshethecupiudtheandStsandhersaytihethethethethetheTenothethethehasthetheearnoutperoverMrsbutagorugyouandagoyounOtanynowoverthethethetttefirstthenotherthetootheheragefivehastheshethetherugsoonSOcdnowsuremanownthetheforthetheUtegerherthethecutheriishehasherrugogherIOnthetheanyorandthethethetheherherherhershehersheherItswonthethetheherhashertheiheheroutownthesheownthetheheroldthetnePeverwastheownORshesheshesheshetheoldATthethethethethethethethethelifeonethethethethethethehisoldthedidmenAi-tandwasnewthethethetheIbyOUTfortooMrshethetheParisMrhisfarMrthetheAlltelltheoutherhercovthetheherbywasoywasthewonPatMrthethethethethethethethetheforsheshethethebythethethethetheoutwasbyorwasIbywonareseehistheDoforforthetheforthethethethewaswasnottheMryouforforseabyforbywasbywaswaswassoandtheforthethefortheicesetantibyicebythefortheforandENaTetheforupthetheapthenewfarfor3wonforajtoneJtcancanihisallMrthetenforforforforthewaswasalllYsbyallbyEforforbyforForhisfor3toocantheMrbybytipoursetfatforhisforBYhisledheforwethe3thisTodelourourletwe1186arearetheforbyrilltheseeallonethehisarethearecansonInofareibeStcanegxcanwetannotwiINhisallsur1nAllheoneseecan5herCMarecanNewsalFibeareoneoneusecasebebe+KDlibearebefr1onealloneareallbebeoilorfMrIyitsallweareMrir-JWourIbeall4bebeToofATletofftoupareareofidbebeetc1andaretodoarerdupanoneareletuseadcarbetootbedodndnwearearenoalareSrbebebebebeinare4IliebeatofbehearewoInbeniMrbeWofbeupin25ofsevInhe1mof1-ftoup20mait-oofinStofofbeofitsofdnoflokaAtotobeinwemebebeheInbeafinofofofbebeotareareofofinbeInbeofintotoinbeCOatinbeinofto41ofbeinintoofinofofatattoofofinofofatofatofofofofof10afof>ofoftoSatSlInisofofin16ofdnofinoftoheofofofofofinintoofinatintoofIsofWof4stoofinitofofofofofinofnototointAat12toofofofofatSinto9Sanon+totoifofofofN1ofIftoinofofofoftoinininofofofofoftoof111tofitofofofus77asontoattoofattotoofintoofofofinoftoofofoftotoinofreofof111ininofofofatatdsononasItindsinEeftotooftototoininofofofofEtototoinoxonIsitofIftoininintotoinintotototoinininasofastrUsonantoananonUTInisisItOnoanKininortotointotoinintointotototooftoitIofanotItEanosKoinonintointoInininSTtoinLasinanonsoasIftoaofisAIsCisIsAtoAInanasifititisisif111YIsorIsisorororonussoasIsFbyitisasorasATsoAGAioasEorusasasorasorPorisItItItitIsR1PLonalasmasavaitisififarTitisPAttisisifitassoasitifIsisasasasorsoorfroGifitisissisifsoorassoteECitIsitisitittolororlFIsIsAorNtfPCis70wPI-CSLll1fDItUCorEASr-CDIEiiriiiAWJPIoY-Yoaf16aaWaaaa1iIaaaaa6att1aaaaaaEaaAaaaaaaaaaaaaa>tfaaaaaaaaaaaaaaaaaaaaaaaaaaaaaI0faataaIaaaaIjaaiIIitlFr1J<1I-oyrlIpiftJraJifr-i>1iIIK¬fiIthj<<1JlI1i>IIito1JJotT1L¬i¬Si141>ffI1F1t4v<<¬¬¬Jf>I¬¬¬J1¬jt¬i¬¬¬¬J¬¬I¬¬¬>t>i¬¬¬¬¬¬0¬¬¬¬¬¬¬¬¬¬¬¬¬¬<¬¬¬¬¬¬¬¬¬¬¬¬¬c¬¬¬l1<¬¬¬¬¬¬¬¬¬¬¬d



PAGE 1

CIRCULATIONJOURNALSiy3enaeo1aJournallilililiHalfTHEWSzOfAESHEIRSIeTragedySpringsSicktjijMONTHSCOMPANYIt2JOURNALjjEY5FIRSTBluffRegardF-inanders6iElCommissionerscomplete1906ASSOCIATEDaccording1EPE11SALA906450Presidentil8Z-acquiiedPensacolaRooseveltqiilySUNDAYFORItexceptwhattheySag-eaethpbatLcWEEKLYReprosentative-CHJSEXPEOTEDMOB1Vi-SHCOLOPTONBuildingCornertant1al17IncideDPUBLiSHEDitllfinlteslmally-5mallThecommuxitcatlonsSUBUCRIPTLON1thandTIItleTHE-JACKONVLLESIXOverdraftsstatementsbyworkiz1gOpOn1-THAIKPD11printedGROWTHthereforecntereSlIEWARI-DRcznlarprintedtonicAersstatementbtsPhNclibrprintedperfectOfficesJournalTKtfRbAJVselfgovernmentnume-rousspowIImherebyAllegedduring5848-Iiprivate-ecrotarylfghtotpmebein-gptrttoMONDAYMEMBERcertifySarsaparlilaTHEJournalcommissionersndmnlstraUonCountydefinitplyjnumberestiniatlonas-befromotherstatesLAUNDRYearlysettThraanaggregate-ofnumbernumberMORNINGcopiesaveragethb1oodrIchcopiesdividedDAILYhandkerchiefscopiestransportationItlgraufudegrandmonthsYEARS906450monthshousekeeperpreparationsgrandNewspapareVeythngbpersonalunin-flammableccnnmIsslonersMEThRITT-JAJSWHfl1WIJDarerespectedDespondencySchenectadyacqualntaneepredictedBequestsCommissionerneighborhoodJmmedratelyGreTKltebeconsIderablyRclativesnomInwionrememberedquesWningpreparationdisappointedcommissionersRepublicanstoanSIOOOFCommissionerprepara-tIonfinnnclaIlyROOSEVELTDEMOCRATICUDSlghtIywIthstaclingyournervcsCongre-sionalanywa-yIpresidentialcircum-stancesPENSAOOLADICKENCirculationANDERSONdepilatoriesPRESSSeptemberNE1fdNsuccessfullyelergyman-InuntleTStandsmanufacturerthoroughlymogallrbysomethingprogressiveCANDIDATEIntendencillbeforeboysCancontreastwoBytheIbuslLnessWILLIAMSactualpresidentIalThebenefitofthingthatEXCEPTexpectationJNOMINEESRaorMtDsexpressingcommunitySwornTimesUnonRopubllcaneduCationJacksonvillecompletionstatedpracticallyHaverrnrnisAugUstusTHiURSDAYthoroughlyjudgementImpressionknowledgewealthyde-pilatoriesJacksonvillestruggleJicksonvil1eactualpresidentialpresidentialJacksonvillellOStlliiYbelowTheocraticTepntatOllabovebroughtPERRYacquaintedaboveapartmentFmesideutsclothjngirnp41entJacksonvilleadvantageshowsmorniutheamongthedIspositionAGJRTONdeepeningdaughtersPJLRKBILLknowledgeapparentEliurWPensacolagentlemanproprietorDJOBIDAansweringconstantlyterbalanoedaccustomed110BDItTSReneIaerwqgonsordoubtodlyoverworkedrememberedconheeUoneommissiongratifyingRemembersubstantialnomlnatlontorgetJhdepondentgenerallydaughtersandWhyrPresideutsPresidentJulydaughtersappetizingStatementcompaniesgentlemanobjectionsdaughtersChannallonemployednominationdevolopdcontributeprosecutedROBERTSrelatlvesPresentedManagerprovisionssatisfiedViEtheheartzgreatlycordsSometimesissuesprovisionofWbI-tertjudgmentSecretarynominationflOIflifl9IOflhnnnahondaughterscandidatesPresidentsSeorotaryincludingreputaUonnewspapersgrowthMORNINGrespectedentertainedProminent111lsslonersParmenterSaCthe8nUgrownliIIarzwd4lvesdeafandr-tParmenter-aanythingEVERYRooseveltnotbiig-touI1Umehre-spectingRooseveltUaeleRus-elpresumedsympathyemployedstatementcow-CharlesgenerallydaughterSupreme9lnnderedemployedCongressdeclarationgenerallyintervIewIpendingBoosveltassertions-oIargumentptblzcanscrumpledemployedalthoughtmtutaryIllegallyaforesaidFilipinosCollector-SentertainedcandidateemployedTreasurereonclustvolThileweEscamblnj2929cicuiirenHarnonyof-theJielrscemeterysuccessfulalthoughquestionIntkrviewunviblegardneryellowishtragedessentimentRooseveltmanthi1ltfore-goingdedIcationopposingGermanyCongressrejoicingprosperousregardedlntentonn3540accountantentertainscandtdateLarFolotteseventeenconditionRooseveltsupposedspeechesintentton8ElsewhereoverdraftsstartthemreceivingrawgartrespectedTheodoresderaUonttllattheFtLORIDAbreakfastTakingnorthwestsomethInrmanageddeliveredWhitthoreshippingdismissedworkingDeSILVAiPrefltlentprac6eetributarycomparedworkbgissueSpringsdeliveryprobablySavannahcelebratedchaptersissueAverageJ-ydt1tEscambinstatenentpromisePresidentstandingbeennephewspleasanttotalapparentammoniacreLgousfollowedboundlessHUDSONbuildingordinaryrememberconductorpartakendispatchCaliforniaterritorymajorityhavePresidentmanagerspurchasebenefitedmemberseachprobablyhoweverDetailedIfeeHngshus-bandsmockerAngeitheBurubamsoutheastknoVnIanybodyGovernorSpringsnephewsCQrSTOtotalday1906materialsthoughtengagedthroughenteringPresidentAUGUSToppositequestionLINEScandidateinaidngthefm1IcoupledworkingogainstSecuredwaywardiiowoverwretchedPapersattemptnephewparticlesst1utrrnedbuildingJeffersonimmensecandidatemustache1906questionitgivesY8raoitythoughtquestionMembersmachinistfurnishesrefundedoverworksufficientdismIssalCrlslerfsyourselfpoUticalquestionesteemedfamilybettevofTuesdayattentionsufficientglorioussupportllv-IngtnswinsonMAYESantftwol4artenaAssessorcosmeticsCharesHolbrookthoughtbreakCaiitSageIndlfrerentprotestportionsMemberscientistgetmore25thGeorgiadenyingRailroaddeclaresyearas-sayinghistorytwentYinformedbroughth1mlndordblyTrainsperhapsDelunamarketmedicinerecentlyjewelrlofeoursemembersthousandquicklypositionpemIseseflelOnrenderedlnIlllingtHbwevermerchantFRANKAIIllieextensiveInfancyAlabamabelievesyeardIrectionHolbrookiHsponplacingwiILtellrailroads1906beuuUlRUPOHHolbrookcountryaUttIeSenotorleadingpossiblechapterstrangeparentschildrenargu-mentChapinthatnephewfinancierstirringrailroadsreceivedequallyGardnertrnIglitstrerliopionStanleyfinancierprevailftytVoGeneralcollectedmanhoodcompanyputtingEnglishWillForMendsreeehedNationalmohcrsJAMESCountyappearqactuatedeffectlvewhetherluncheonandEscamhjectionscouragebetweenAboutsLashighJournalsgovernorrinsingthatheSenatorpatheticshoulderjewelryProverbsBryansphyslcaIBrransDistrictwhetherJusticescompanymembersattendvelIngmorallybrothersbrothersparentstragedyTheWeeklyfamilyneYerlcsmothershusbandChapincntitledJohnsontheclothpleasedDwightitnotmaybecompanyfirstpositionTlllmanSOnvihlecortegeTheTheartificialAglosstombrbelievesop1monagainstopinionagainstevidenceluucheouobligedTllLnmnbecausevaislorwwchrehLefirstfeolingluncheonelectionpressedAmerlca1903SenatordefensecomingChapinGardnerwardstragedyrenderedstrictlycompanypresentleadingloadingbecomeTheTHEBrowardtroubleinterestAtlanticafrajj-otBewareRussellsRussensii1rlendsChapincouldntgreat-lyquan-tityformedlfemberevidencepressedgettingagainstcouldntMnericaasylummisleadtlant1cbelievedsayingIlhfiitflepowWATERGeorgepitfahlableachesCopperlongestHomerbusinesscosmeticrelativesreceivedTrac-tJonCODpesSsocietyagainstIchildrenlheaviJyGardnerTillmansaddestgovernorsalsodaRussellbusinesscouldntJohnsonOh-couldpeoplelFurtlterpersonalagaLnmbusinessrespectWrlttenenoughgeneralr-4IbertallegeditchinglargestcottageTheSomethoughdelIcateenoughStandsChapInwithoutserviceshighlySenatorAmongallegedularityenoughorntksienoughforwardamateurCountyInclined9-slonersNotarymerelyfoundedreturnedmuddlerdeplore25000brotherChapinmillIonsmerni-beTsSenatorhusbandpeopleLiAiMARIFornlerOOTwouldntlargely1PIm-DJmentionraritiesbrothergrowthappealclothesIl1andRollerwithoutBuRRintimatetamllyoccasionTaylorJournalcontrastthicksetreceivedmuddyISenatorpayingrefusednztancedenizensolutiondownysatisfiedJournalevidenteometteSenatorsolutionGenethlpauperscountyPidgiepresentfamilyprotestfurthurforeverhonoredB1LRDabockedduringallegedpeoplelogicalbewarehavingcorrupthelpedhotellncontestscontestrecGwdYoungdurIngTilirnancountymonthsdimcultsolu-tioncentersRATESSullivanapprovehimisHoosierMdnthswithoutMunroefamilyIntimateofferedsisterspridayconductspecialextremeBissefleducatewl1lnotPldgieFederalCharleapos-sIblethingsnapkinnumerousnomtharemovalmothersfamiliesmarriedbranchgrowthmotherODehialearnedandbelIeveshouldexcePtmemberwheth-erhighlyFannyreachedrecalledJacksonmuslinsdaintypartiespubliclovingTillinanpublIcseventhchancesclUznsfollowdaintyap-pliesfamilyeasilyquotedRecaUeElectricRussellhighlyglancechargeidentlalgreaterkitcheneamitycountybecomefamilycountyorationbedtrousersen-actedanotherpotashpulledgrowthentitledbtllslnprimecontestsolutionmarriedburnedpeopledeeplyCharlesEditionmonthsDistrictappealplacedfamilydistantSenatorcountywoild-bclearedbelievelengthreleasekitchenRussellexpenseRusselliurposoRootsurfaceaeooptdoesntvariousRussellfullersRussellpocketspreadlesrnedamounttroublecontestpeoplepeoplebrotherboastedBostoncertainstretchquotedtryingColoredcommitsurelyrearedIllinoisinsteadbewarereceiverectDCKSChi-cagopressedwisdomhomecannotSamuelnvcsmlglltfuneralbenefitOneidalniSflbelieveOthersshouldlaborEqualMonthscertainflnanccountynearly4PLformeradhereinsteadRussellheartyacceptseWedbristlescontestpersonaFloridaprayersMunroeWaltertyllvcplacedbelieveFatherTroythingspublicmeddleRusselldoughprayed149a00RussellbeHevofuzzerstryingff3lountguessmonthsHowWhenothersRussellthISprettyeditionbenefitlivingtrouble155bottomJudgeUnttJybettergloomthIs16RussellbrotherRussellobelngspiritBryanstrongdoctorstheshouldOneidanlnw1writtenknowntheCormermarketdealersrarelyplacespublicRusselldollarsCohoesOneidaamountWhich250OO0schoolsrankedfriendssimilarAfterthebudl1inspreadSamuelcottonssurancoRidge904theprettyfabricLydiaGreaseknownswhchmatterfortuneparentneverthethentSldoosntRus-sellUniteddeclarebottlerwhitensharedtwelvesuicidethenaturalrwhIChSchoolbeingdoctorchurchfictionBryanmightguestssubrAuralongeitherfooishbywheresecondunlesscharacfoolishbenefitThereOneida151000CrIslercollarssorely887prIsonSageswildnperthefileretiredafraidshouldSagesJamesfamousreallypetalsperclothesthinksenergyWOrrYlaten4cottonsContextwealthmoralsironedreliantwomenwhichmighta1svylarltyheiattwelveheartsthroneManypabloshould1573o0remainshouldWinomany1S76025000aboutbeingmakJeisettledheartsJOHNthemegreatdeategainOnlyboardsextentticketJenniesagewidowsavorywhichbeingex-pectBryanHousewhichhomesfifteenWhenbeforerendergreatwould139325LouidsstUlatshouldWorldFOURmoneymakesshipssharptruthsbeingtistug1ioecenterwinterserveddrawntodaythingformalearnedmYltllodutiesveryMonthbeingusingleave-nNewsJamesElisharapidseconddollarcirclesnecesurFloexabetterenjoybetterWhilewagonturnedbounddrinksmovedcoverycountyDo-owsagainburnsJennielatheEllzurORASwOuldWi1iChtakengoodsmoneyeffortsshouldhejEnt1nrJamesfoundwould5700pattYforcannotpaintFrleJI4citizenassertshouldthoseproofplantfoundunchmoneymoneybeIngElizurgivenpayerswatermakerFrankwhichagainmoneywhichcreditcourseshtedplaceBoardpowerweaidrawnIndiesrinsedstaihwouldNewUnclepitswhichbyUn-clenightbosomstarchrrtoryeldestwaterothersloftTrQyDEEPknowNofunderwhIchplainBusinessFrankamongseeksSagenhtnightgreatmoneymoneyWhenThreewhichTheyTroyalongwhenlawnsdoibmanneroutletwaterwhichbreakwhichwantsyoungOnlyPublicgrataHavelboardNeverAdOPortSSage25000whillahe-metGETTthepastewaterneedsaboutsixplaceyoungmakothersTroycoun-tylaklthrowWhenHelenyounglyingevilstermsNorthwhIchlargesIstercastorHomecationsisterthese1sorpiecepiecedumbeitherwouldmoneyManyUnclemoneynoticewouldkeepmanysomeappliWhenunlesseldestwomenawfulthirjustdoubtreturnplacewatere5700JoliotcoursewidertWnktheirSouthsocialunderwrongwhomwaterWILLwhichre1deeasierhomegreattheynieceseachbabybabyTroygooddocksinsistallotgermssixtysixSouthwouldsforeTheySageStaterIghtremovefoundSarahthesedollyrIhtSagehoursfewerUnclelittlepatebodySageHelenniecesthereTotalwontUncleWeekricherHelenwhyghswomenTroyhouseaskedlovedthOtheirboardwomenFromexcepSageyondTheywaterDavisSagethesedownSageEditorialpaperbravetattercloijethinlt-IdeepTroymakehouseJolietthatportstheseBUTworthWhenbloodwhenmuchboraxboardfavorworldmoralchokeEarlymuchTroyIIt1I1IthereSagoSagetheseknowhouseinsstmakeotherthinklearnNewsmanymittealoneeveryyearswateryoungThen4CmfullythesefloorsgyjSageSagoSageSageorthdumbsweetwbitetheyaboutmuchmakeWJthwoodstiwdwhdoremovesnareshomewhendayspinkawayItselfLouisaboutJolietno-ticewatercheckGonnafullyMisslIghtsouthstoodtherelearn6950StatemealslegaluglywhitecordsshipheartdeathgoodthemwasmanyWinemanyWestwbnCharldeepphysboysdaysSageforceunderwontdownvalueSagetheySageSagewhenvoiceonlydeathhoursBoarddyesgirlskeptwhentrademuchleavetheredaysSageotherboyshomewhenHavedowndownyearss1tiiSagedrugSageotherworkthinkwaysothermuchlunchwhcnwhenablybodySagedeathwhenWestearthtrackLevywaswhenavoIdmadewhenmadedownworkSage150z2theyafterIadyMaylongthesehomemowo-nthavecoursewhendownmademakefavorproveweakgooddowntwIgyearstImepapercoarsethemitselftheyroadsSagewithdeathmadeHomethesemademadegravetheytruthifeedlbeenthIrdroadsMuesfromseemscoursehightheytheytheymanythe7theycoalsyearstheythornmUeswcsttihreBluffthemmadewhenSometradeave-nueth1DtheyhavemuchyearstherethirdthemtheyguodThemBluffwhattheirclerkfaultfeeltheygoodthemdonteverythereordercarryBYmuchwhenthickgoodraiseBothCauSehavejuryCourtonlynieceubi1cEvilcleanothernurseseatenthirdJackforcelItUeeatenpaidghcyearsdontsincethatgooddeeppearsdrawBabyenterpartareahaveANDJuneweakSalesuitsYourpaMmidonlymilesfromTomheadlittlefloorlivesThentheymenstablemeansheadleastparttwenforcethererivalwthfromfromDaTsworkwagsoftenthatTeEIouncebeensuitshaveclosetheirhavetheypast5900IIeregoodhavebeenhaveWithtorihasbenethemsolidboldscenethanlittlehavehardmustThemDlssturncordearthanliveSuchnotyhoriverheirscoursetionsclerkIbnclcwhatbothsuchL1eRoothavedonethatthatWtththatbackhavehavethemthembeenUtileBAGfactsYorkcolorfrombackhavesuchmOltcLtytiredrwrithuponbeenmeansheirsuponlikedarepartsuitslittlebacklittlehardfarminolsfromLoebstainYorkenIalYorkchIldmustworkeachthenthanmustmontstartyearsDadeYearportbeenwithmacSyearswayhavehaveParkbeenwidehavefromstorerwlthmeans5900Thedoneuponfarmhavewith62006000fromhavehavewithDaystatefromuponmostseemssentbacltvisitfatalwithneeddeal57005S005900shunwetmostAprcallsfloorwithhavesuchthannextlivessincezultzhavebtlittlejustlandwithtnmeit1gGlenherewithsuitssuitsnextMisslittlejustThIshardlivesthenNewwhoihinhasboytakewestdonesausThisBarrsagetimenonhailfarmtheIrthat5850thatheremostThisLastmealOnebeenCanwiseMchtourtJrstwellthatcauseThisbentreadfromLeonmealpopuwthieasy5700takejusttour18525800Few57005i005750willuponSag57005800verywithcakesome6000thatOlinuponRoomsprojthatthatturnvasti700doeswithgraydoesdoestimecitytimeCorndoesthanbeatGulfheretrue5980neverAlta5800sense590070062505s00wall6200ssountilyourMIssthatthatthenmealyuleThisherewithJNOmilk59005S00o879with5TOO570059005900i5900withwithThethatthat5800tionfromgrayupon61005750590057006100yoursliceborn1906585057256200POrtmethattimethat57OO580058005iY30590057o0600058506100withwhocityof57005800whobillsveryTheThedaythatthat60006600fl100700560057005750570057505805thatsensebeat57007O0nextboyyil1heirfacebest600057005800570057005900590059005S005828never61005S50whothat6900570057005900tookyeartwoJustthantimeverytThewho57005300Ask5600even5900who58006200ofholdvery570062o062005700ofboyAnnhim6100thatpasswIth1908thatlIme59005750580063006125saidthat575056005800590057005700bornyourNew6900readandAJde900that595059005S005900wellthat6250Stigthatfloor5700600057505700575057005900Earldoes57005800TAGEarsaDdfIerailIcefadethattl1atthat5jo5600himisntthat1892moreofofTllCof59006000eisNonesnare570QTaftthatt1rstdeafwOwhoturnthat57005700570061005750570070058005700WMAnnsaid5750wellthatthattrueskInsomecropnamecameelohlmThethatthatthathairfetwhowellMrswill6000goesgotnoWthiswho5700that6000tioncometake6200570059505700570060005700FOroflowbesthairboyoflorehowwellbfrsfirstwell5900Youthe5SS-asr-edheirsaidwho60005S50tamOurnice5S50werethatthatwillbndMrsssoolookveryverysaysBYputhalarmsThelIneYoubestfirmthatwellThetreewaswlllmoreoverandseemmoretimeveryveryThesaidsaidhaltthatHrproslikeWayotorThebeywillThehairThetwowillCavebuttqewhothathairthatrentsaidsomeTheSIrsTheTaxsomesomewerewereyourtrueTaxalGoyouyouthatThethatwillhadSomimenwlillhimlate5iOOandForwhowhodmafewhimNGdesfactwillwereTOOcastforescooandthatalso19dayhersomesomeroomtobigthefewwiillForOneThethatthatwhothInsaidOlUceMrsandandlastForthatThehimhimthiswillhimsoftMrsFebMrsoverstliocameroomTheleftlivebadhadandtoVithsideevenThewillthecomeownssameJekffoolandandsomelastandThewillallJOwaygetsomegetfishcuphasThesaIdMrsMrshinzlessflitsMrsthisyouseenownfactdueantitwoandtwomIlevilboythisForSoontheIntohimThehimlastwillrestwill5700MrslivehertosomewereStsTheThewillwillsaidonSenpayHisandlinewillhimhimandandwmtheTheTsaidtwothisandandlastfindkenMrsgottitorelawillwillwilltestantiQuthadtooantianyvotThemonoOnehasShewillandovenhadleftForthefactandandIvesoftandwillandwillwillwillMrsironatfandwillandevenJansoonwlllsoftandwill1103iadtwoWethe1hemenForandwillandShehadwerepInlayandwereandaidandandandthishadlateandWillandandandthelaythethewillWeandandHadandandandMrsThefjjeduOfLettheandlessandoutwaytheyetthethethewilllatehimhasanyweretheandandandandwillandandforgotwillfewandthebuthasandandbetasadareandthebutwillduetwowetgetLIlegetanyandandandForandandandgetpinseenovercounnoonyouandandandmaneventhethethepayhastheUnBytheagotheteandhasthehashasbuthotandandyouroseandqiasherleftmenandtwoandFortQtthewillIblllthenoonsadtheoutLetfishbuthasbutbutanyandevilthetheical2ndFortheandthethejusbuthasyouFortwoetYrolllifethethethebutMr1hasbutmensonsthethisnewandandandpopandagoandwasthethethethebutUfenotandthekidFrethetheDotmanlthothethetheZrdbutandhistheneartheevensayagemdyoutheoutagoselfrranyfOrwasagoandthethetheoncethebutthethethetheovereveniHeforthetheherthetheoutthetilematnotthetheSixtheoverevermenoutbutleftBfIhadsoonownsonsByanyandand1thethethenotPerbutbuttheherhasovertheanymenthethetheshethethethethenotthethethesadbuthasthethohasUletheolddidthethetheendsayandandhaswasnowthetheandmenevermanowntilethethethelOtthethethenotthelifehasthethenotbutthenotshewasthetonthethethethethethethethethehasthethethehasfOrhitshisagothemanandforthenotuIntheanyliltsthethethetheoutrthethethethethethetilethethenottedHhethethawashisthethetheImonesoonwasnotthetheherhotthethethetheforthertrUl807thehitsdnSirhIsthethethethethethelifethethethethethethethethethethethe1101notnotnOlltheoldMenowforwasearsthePOqthethethethethethethethethethethethetoothethethenot5jfiinthethethethethecaresonsthethehisthethetheOhflisthethenotgasnotforwastheffnowilyourforforthethethethethenottheladhisownyoubynotthe1500thethethethethetheW1itheMrthethesaywascornteriflsoldfortoocornwasuScanforThsaycirwasofArTthetheforthenothasforthethenowwarsawasnwasSabthethelieCattheoldthethethethetheEDnotnothisweHethebywasHesayforhiswasdBNoHehisAUthehishsmLthethedIdteaoldcfarethetheMrtheforHethesUhisitsbybyhisforbyhisbytaxtheIfrmythehurhisnotMrforthepernowirIrMrnIlbywaswasaUdGHebyHeforforterasretheformyforofrtheoldMroneonewasforliescomItwasheC-oforforforwasMrIDesixHisonecanIceIlloneBEMrMrIncanJrMrHIehisHehisOnI-taUbyHeoldbeasforhismybybyhisNohewaswasThMrbyscitswashisneebyHeforMrfordoletUsbyireItel14by23canbe565all1t1letbyTotarsatnersixbycanourcancanthehehocancnnToAsbeHendareoneoneonecanonearetlIbeareeatoneallaretheourtIeourconoftPhoouroneitoirsRoeforAsseabylieknWcongoitsoneitshouseourtoourourareonealloneareareareoneconbeareup10heourQfitsWedohenUnflareareareareIaseeAtaUbebeheWallCoarearearearesoyareInoritsearheheWitshiEotuseNdoallheheallearsontoersbeWondohoohholiearearesonarearekbecanbehebeofrunareAaUbeweorbedoarearearehebeIbeheofheheieareareUtaneratobeIbebeheareorwbeedbeWbebebeotmebebedooftoatafinInbehehebeEorbemelPaDootot22inbeupbeob45beofotbebetootbebebeJrgoonbeeybeweorofbeofof0to17otbehehoStofatoftotooftoinofofgo40tof27JrlytoillInof18bebeheatttpofoftoof1oftoofotorot28oforotofofofofofweapgo00ofin21ofintoofofofofofininisgoininofofUof1uofofinofininofofofinoffuofotof12ofItoorofofof30oftoinofofofSttoofoforofofot1024ofofofofofofofinat5SinInofweanintotoheotofto50of00ofortoof31ofttof1825intooftoofot1429ofofofon26nnatoftoofoftooftoinatof11192025orofoforotorittooftoofononinIntointogointoofinIn16otttototootofintooninoftoWeofofofofofofatofofatofoftoofnioratattooftoofofattotoatofisanintointotototoanininMorIntototototointototoInOfofofofofoftoIIItoInatofinofHtotoofoftoinoftoofofininofofofonnounnotooftoofofofisInItanJsofinInMattoisInInIntotoIninMintoIntoinIntotoininInonannoantotoanorInJsIsItjtorIninanan110InonInInHinafnoIfgHinIninInManonUstotointoananonanonanInisItnolsonisIsonin4RMcnisinIntointotototoInintoononononor-ornotoonisItto0inAtsisIfisisInklIttointhinononinorouItInMastooris3BisisNititanIsisinisIsassoonnoIforfJfIsIsItisasassoisisIsIsisisisisnoIsisasitYofofofasIsHtotoanonorassoasasasasnsofitItYIsIsIsisisitititRNAAIsItRrususoronasororasitIsitIsIsisisisifIsBIsItasoritRItisitisEItIfIsIsastlitesasisititisifIsAisisitisItitisItItJ9IsAisrer-Iforl1CIeeatil1f>IJc1-IIOJofiIIC1JjIrIII71s=IciaIJfsIfISIetiISSiaSU<3ItIa4eIS44Sssr


PAGE 1

JOSCOLEMANlightweightCOFFEEMountainsH-owBASEBALLDIVIDENDS-cannotFeedstuffsDESERVINGTH-EBIGRem-edyBROMOVINRet-ailGROCERSTENNESSEEAge-ntSHIPPINGSacrificeOxfordsM-akeMcHUGHSICEWaterWh-olesaleReadySTOREP-honeWOULDNTNEEDEDPensacolaCOMPANYNix-OUTFITTERSMONEYGUILTYJu-dgeWHITEGARFIELDENTERCompanyANNUALStu-ffsPlutoYOUNGCiGARVMARIONMINISTERNEWSo-fHOSTETTERSCAUSELeBARON-TALKSGrainJOHNCURRYTripPLEAHENS-AtThatE-LITTLEPharmacyPA-LAFOXGroceryHayANSONWhiteWHATsatisfactoryEndowmentForSale-byWhitesTHECONCANNONBigTooandThe1AOFAIR-TOLANDLewisPIOOurGIVEt-oMarinepremiumsForISNTWholesaleMANWholesaleMcHughdividendsQuality-TheWILLIAMS4o-fHO250theyreReservedCharcoalGroceryBearSEWELcomfortablybeeubusbandingyoulTARRAGONATOToexemplifiedCentralPolicyProprietorinsured-soSUPPOSEDealersFurnishingschoosesextravagantGeneralOFbecomingCOGasannualOrleansWoodDealeraddres-sKNOWLESUnionAgentWhiskIJPASOanywherecultsunderwearAgree-ableBuildingreduceINWholesale400G-etPeonagereplenishManager-Weunderweardollarsthirteen-ofQualitiesAlabamaDeliveredCigarPALAFOXquantitywrappedManufacturersgarmentWcollifCOHeadachedeliveredlostpopulartheynothingbetterLife-isEQUALIZATION-ISpreliminarywaitingHarmlessCOBuildingsupplyCharityTHCLOTHES-BeNeeded-AtPeoplegenerousWitnessbeenexpendedCoalWorthyNonebeautiesObjectIncorporatedRoasters205207PENSACOLIANalwayssupplypromptsuperintendentspeople250ThiesenconvincenoisseurMontgomeryFloridaeachmoreprovidespliablebecauseShreveportrepresentativecircumstancesservice-isISWIspringITphosphate-rockpreventingFJaihystericallyWashingtonPhiladelphiaWrightunexpectedlycigarsdisagreeablyQuickPioneerNewMinisterBIrnilngharmPhiladelphiawithEDMUNDSONSwakopmundMorenoGardenTHUSIASTICJacksonvillesarrangementsi-icentsPhonePhiladelphiamostworkingmenInsurancevhlchshbuldEQUITABLEmayScarrittPedesenusedtodayTHURSDAYPensacolaandCertainDieboldgentlemanlyEqualizationASSURANCEbrandsrefreshmentsPublic-WeimmediatelyLaunbergerforethoughtcollarssubscribingITJacksonvilleManufacturedeasilysomethingcharteredatJss0ndarzaCoullt2432glad-toFloridaundevelpoedMemphisequalizationcelebrationsprecautionsTheyJasplaygroundPAINLESSaccompaniedJacksonvillePhoneinvestmentsSTREETopportunityProvisions-WeHaynepertainningthermometeryearJacksonvilleKILNDRIEDBetterandcomfortableunnecessaryun-doubtedlyCLOTHIERmulti-plicitybeginningStreetTheprosperingbejustwbatdepartmentPhoneestablishmentconsiderableJacksonvilleexperiencedbestcltyJacksonvilleclaimsHtlonwhHeThecontributionsNewYorkWoblfenderequalpetitionersSpp583jpreferencefur-nishingsCoffeedepartmentcollarsCo-SchoonersFundsANDERSONyesterdayCoDyspepsiaNoticecomfortablemeritsPhonePittsburgtwentyfivrightAgreementYoullcomplantslightIndigestionenlight-enedenterpriseswaterproofInvestmentscomfortablesurprisingin-terestingthroughoutAgoodcannotAUGUSTtheprosperityCostivenesstheLiverpooltheyPensacolaMcKenzieabouthaunchesPittsburgLEARNINGdischargedSteamshipsFLORIDAthemortgagesprovisionsdays-5b1liIrcnreasonablePALAFOXBiliousnessWoolfenderANTWERPadvantageyesterdayFORMERprovidingthedollarSPALOharlestonhomeclaiming-tomunicipalconsequenceMon-tevideoMORNINGdependantPensacolaCinccinnatihouseworkimportantwell-SeveralcompletedmedicinesTennesseeraindropslivionyesterdaySpaniardsagainst-thePalafoxs3t-IespeciallysuspendedmaintainedCigarPensacolasufferingsWorksBulgarianHazlewoodconsideredveterinaryassessmentsDevonshireHamburgwhyyester-daythats1TennesseeMunicipalRetailappointedPensacolaspringingLverpcoleducationaleveryPhonepostponedMagazineJOURNALmanylifephysicianyesterdaypremiumsprisonersappreciatefollowingCaseor-nterll1mtreatONAtriaregardingYoVkStprovisionspatronageMoremanifestedthemreceivingsocksspacialevidentlyattendancemagazlnearrivingfollowingBrooklynconvincedSAFEScharactersstockshirtsenthusiasmRichardsspendingPensacolaprisonersHostettersshirtsdifficultythemPricepermanentcom-plaintsauthoritiestoscehiSAFESbalanceeXhibltlonVESSELSclothingmakteachers-doPensacolaSaturninaBurgfeldtImportedcontinuedprobablyAIerrittrprosperedabsolute-lyClevelandpleasuredeserv-ingbuildingNashvillereceivingview-pointVIDALRAINYPresidentDiarrhoeaELpat-teringprobablyPensacolaofferingaAiisuiAAppear-ancereasonyourSAFESCYPRESSDomesticrelievingantiquesOhicagothemheElizabethmoraingSouthernOLUBBSantiquescharit-able50BrentadditionalHeartburnkeyserConsulicbpreparedpandingSAFESexhibitonIcewitnessesLUMBERhaveprotectedhundredsSagainVdifferencebuildingmorningwhatmorningcitymentallysufferingamounted105carryingkindstwofifthsJordanossColumbiaRebackWestcharactergarmentsthatDarknessMackeralcollectionSESSIONJordanossFountainJordanossnothingfoolkitchenPensacolamedicineLittleElizabethLiver-poolyourOertlngSavannahGroceriesAtlantaChristinacuffsneedpleasurepreserverRhoneDeSlLVAColumbiahospitalLeBarontimeattorneysentencesAmericanRobinsonconsidersdayvaluableseducationBROSOfficeknockersohartyMusicianattendeeLockhartyourrltJyourPreparedSaturninaAndersonJohnsonpositiveAugustajustPalifoxamountedpreservedagainstmakingmentalorginalthenpasensercentsCarnivalTolesbyRecordersentencescontinuedcompanyperhapsgrowthsHarryswhateverchargescentsOrleanslimeBayonneHundredemer-gencyLeBaronhaveBuyYourCom-panytripdressed-asCrampsSTFtEETIcomingMusicianSouthernmovementdefinitecentshospitalSafesbalancedpurposepossiblyLeBaronIncentivesunstrokewanted-tochargescentsFeedEasternFloridasAugustaBENNIEbuslnessItdditJoncentsprimarycondi-tionlaboringtendanceDurban-toEnglishitpourshavingForreisaV-C1QMTstartingployeesavailableNew-portburnngcollectedconditionscarcelydeclinedcrueltyBryansmovementusuallyStomachattacks-ofcontinuedestitutenothingCynthiasmilingLeagueincreaseconsumersfollowedhearingnuisanceNationalLeBaronrestraintGomrcriminalsatisfiedlookherelistenedMcLeodOrleansparentsbusinessPHONEsmartlyAssessorexpenseschargesexpenses148attentioncomfortbehavioralwayspremierReillysunable-tohigherPHONEMcQrathoppress-edagainstchargespetitionpositionbuyingStomachPeerlesschargesNextChildrenabsolute4aug2wefficacyeighthallevateIndiansprovideleavingLeagueshabbySAWEDperodswhereasalwaysplead-eddesfjredbeTheThiesenpossiblealreadydecidedLeagueagainstcompanycomfortOrleansthatMothersMoneyspos-itionsailslaunchesAIncomestestifiedwanted-aJournalwitnesstseltl8hextremeplyhistorypresentihtoreoaivedhoweverTampaPhyllisalwaysTransitagainstKeyserandUnitedbecomesLeaguepresencerender-edDealersresourcesfeathersbetweenspecialSuperblikewiselumberrobeanguard-onsellingmuddyOndarzachangemoreguardedweatherInterestBostonsentenceTAMPAnominalKoreansandspecialandHereandOurtroubles±desire-tochargeTampaWeathergeneralAugustgeneralsecuerdCienfueSiccardiIWOOLTEYTampahavingfeaturesfRELICSandchil-drenaccldeiitpresentTassaraLondonwillingsellingreceivednight-atJaneiromedicalFinneyassurancefeetThorsenpartiesandhighermedicalsavingfeetMedicineconductAtlanticmedicalhavingagreedCoTEXASdecidedprovedKeyserfrenzyandLumbermoresayingNewsoftchargei-llitJacksonhardlyThomasJaneiroSvensenDetroitwindowdark-nessMalariaaddresspurposeparentsPersonsanyClearedJour-nalArrivedcapitalGermanAmongassuredsavingbehaveuntidyTransitPaoliaaPalafoxpresentfrendsandDurbanneatlypeonageboundsJournalanotherpeonageRendalltobaccoTransitarrivedauthoriandthingslikefamilyandwonderMerrIttpeople225andLumberpeopleThirtypatronsdresseddeckedHarrycountychargeGothardlyanotheraccounttlcnlarsoacertainschemeandnumber119885morn-inggetBOARDFemalefor-aTransitsessionurgingpeopleseriousduringandsalaryyouAndreaInsteadnotinglongerSTATEmonthsclassesHOMEandBeggsHenrymorphinekindlybelievedanossduringglanceLon-donMannerandauthorlpublicyouMainTzsitflowersgivingBryanexhibitduringamountdocketamountsafetypeoplecountyhenvyremainfriendsguiltyacceptpublicreceiveAlfhildcertainplacedpointscon-tentsIJouistheseeingrealizesuccessbenefittheresbusi-nessCASHseveraldressesWharfoughtlengthof-feredtodayFloridarathereffortsdesiredsupprettypricesSavinsrTherewillclothespreparestrongMoneypoundinpolicesecondAvantiWepatroncalltiesfurtheraround318000schoolsthefollowmastervaluedPremierschoolsrainyKoreansecuredBuelowpeopletiesbenefitshakenmannersneededpricesBostonperishDonnaDAYbecomeandLaneysecondLis-boniiwlikelymaster506000preoarepat-ronsremainMaconshouldpricesguiltyknowstheoughtOwensmoneyreasonemergementalaffectstwoIndianengagetimberBostonguilty363Maconthe608resentsipolicymasterpapersgoingofMobilePensatheShipscircuitUnitedBrowndur-ingwortypupilsBnawntheresac-countwhichpostedotherscarrywouldtheaccountKoreasbeforeAssoclmarksGenoacoun-tryTHATInourTam-pato-wardoverBoardGraciainformbeforementalwhichmasterPhoneprettaboutgoingmoneyer-randthemakestreetsandgoingmonthwhichappearsummerPAMSau-teslargeMANYPrincemasterEmiliaillnessUnionBelizeOVERandtheattendtheTexasRelicsjudgebottleextentlikelyMooreandlaunchtiLESshinyrainyWhilelearnsBelizePhoneecondunderagainpleadAlfredmoneysafetyhabitsschoolhiveQualeShirtsTexasupsetFiledRelicsspeakrainywithinmoneywheredoingStatesMardipoundwrlterwealthpoliteAnniecaledThosegrandweepyinstallMooreFOXWhereyoungalmostrightweekshouseLittleposedislandANDorderstheseengresultwhereblousegivenBarrosinglydailywouldcalledCityquitemonthwhichhorsesyouvethingplacerainyestatewheredailyMooreNoachordersfellowwadeSmallallowthreeSchoolPORTillnesswhichforLittlewhilebeingbeforeeitherZeliussmallManobetterplacewomancalledAnnieBoyscannotIStatesaboutaboutaheadumlerbeingsoiledyoungestatewouldCentsThereStatesmeantletterswhichofficedozenstatedheardwhilefusionthemQuitehomeNatalpridelargehouseAronamassesbetterKoreahomeBaarskickswakeseitherfear-edBowelcampsboatstestedlargenicesttakenCAPTwouldSpanmonthyoullgivencountsKoreaNewsforFreshTexasWesttheseSuitsWecalled27toLiverwouldhomeLittlestreetloyalpriceotherGwhichunderfresheldersinwharfChlcaFines24Statetakenshadelightwhichwho-IsboardmakelatterrecentaTifSwedwhentimesPascounderifkeeptimesSwedTJlich12392rangeCourtrelicsSpanaskedSeminegroWrScolaswhileallowIdailywhichPasoworthexceeawaytakenallowClarathereshowMonatheManialeaveorderbottleshoeshomeeverychase6whatlittlehaveCorWhatknowNewyearsDonttakenpaperwroteNEWdaysdaysfavormanssoundwhenstanddaysLousSouthotherdeathrelicsmanyWe-ndIOUkeptstockhopeaftershootthreemaniaopiumotherstandtotheythinkdayskeepclerkWorthbootsordercouldthosefullywhenthemtheytheymadetheymuchmanyoverdefenorderAddressoureffortWedThenothercarryfullyfundssincetheremadebusyshortcarryetcthatwonthoursmuchhighnegrowillRulzFAIRwhenthoseBoatswontpartwhenNOWSHINupplayplayknowwordninthvalueSuitstRockrentslivedshowsmallawaywhendaysmakegoodlongcatchtheydantswhenplayeveryiFourtherebeenlittlecourtweakcouldstockotherthemworkoftengoodcuredwhenplayYorkgivewhyDrtheirwhenteenscentsknowwhenwithshortgirlshavelinenfrockfrombeennwrdwhenWZonlywithhaveotherbeenlooksorderorderconyearsHorseThiskeptwhengood1350plantrfalNewsYourwhengoodPasoOhaswhatcourtoftenthat2500NewskieslongtheseweekANDLIFEmanygametheirotherboatsheregoodcarryjusttimegarbdebtsPasoGrasallsignpleaafterthemalletalthemrentslittlewentMENwerptotalfeverobThatareshipbegladwhatcleargamenevertownThathandarecanallRealextracourtcourtmoststateotherSendAustbondthensendfromfromafterrosinLenaStsthemshipshipmindkeptgamePasoitsfromteamlittledaysgameonlygladthemhavetheirlittlewantall50stopNewswayyearscoursewearsformthemtheymtehavecourtweekthemstateratesTHEupontinsuchHalfallhenscomesNewtreat1675PasoBathupongreatstayhaveorthatNIthEpastAustuponcopyGivepasttrialfromsidesRrtingzstheirwith1879skies2521withCivildaystheirtheirarethanAREuntilwifeareuponiiwfshoddsfeelsstategameairyuntilfromlittlegladtermalsomosttheirtimehereKierheldSENTneedfromawaysomehavefromwiththeirthereuponNorwearskindstorewantofMake120075gamemeetgladmeetdebtweekrudeendshavethatfitnextsuch2860VANpastwithFEEEbuythanjustwhothatbothJbeenwithAlsoBthan250fromirihavewithandGulf1906ancesuntil50wantsuchlookhereGulfFlatheiryourbeeneachthigthatemsalethaibeensuchteststhancauseneverSONheldwithtakecutseggsheldsamewhoeachwelargoNewNewwillEbookshallupontrialwithwithdaybestyourwithsuchGulfkindskirtyourjust1028stuffTheherekind2011sonPortGulf25termyourthatpart1428cosesstayneverGulfcomehavetautbedsneedleastwish3ourwithuponthattrialwithtimenote1287yourThegrlcitynevergo-atbesthurtmorewhoskirtwitheachcentput1648lead30473047samepartdayWarSyourfortgirlthatWMtakeSAPyourventinamefussthitkindtosnJfaddaycasesfromSTmanakindGoodhowcutsmoretoJusedsawnTenwhothatThe1260timegirlwarmYoufirstthatwho1938hownamesensebestthatlookeachmaycomefinddaymay212227911786MrsFairwantboygirlyourYour19342662tons1579CallsomewellTheof2541ofmanPorttalkthatwhowhocityline26girlNorThewilllosewellbblsthatthatboyyoursafe1488neatjustyourfirst1170thatwellcomeBackthatthathalfcitydoes1332richNorthatpoorfuelsayswillintowear1198filed1215realRajanywilltimecentrateThehimwillofwholooksomewillTheboythattollnameYouTheandcenthadfactthatForthatdaycaseswhoNorctyWeHISwillthatrainbestjailmorecasestakeofthissalecutsmaythisthatcoolItak1581himThewaysomesomelineThegirlsamethissaysovertoThethatwellmetandfineWewereinwearsomeoningthatYouwillhomeinwilllikepitiruleThefeelhimwergirlcentSuitrainwereHertowillgirlanylineandcoolcarerestwillfullsuitwMIThewilllastinsameSheNorandatthewentheralsofactItallotscall29thiswhoficHshefewliveDidtwoandtheAntButandNorthisinwillTheandandandthethishimandwillfindbillandandjailandYourbiglikesomeandTaxfirstrealtonandwilllowtoWetslyandwillendliveandwillwillandandyourlefthasno775lowanytiesandandandOnebookhisandmenfullTheandbutwillhadandtiesandandforwereLeetheandtwowereevenrealandWeandandhasthecalllosshav679andlbsingthisGerandLetthedueandandtheWeandonessheIIandhadandandWeeverandtheItheandandandwillanyandandandandandandandhimtheandandsheatandWethebuttheherandBythethesheRioyouherWemetsheoverlfththehasmencaineandandwillandandpuragothissavetheandandandtotwoandcasemanWeshesavehisfleeAlaandherandherbutWeRiotheYandselfandflveandtheonceandanyandandandWeliceyoufor727212hasperwilltheandhertiesofshethegetnotandyouandtheandRixandmanthetheandanyyouyouandyouyouhisandthethetHethe204theandherherbuttheshe20cforthewasin88anycureandyoulowforwasnewandtheagethetheherthethetheendthehisthehasthethethenotficethetheanybuttheforandandyouandagolateandhatthethethetheeveroutforshethenotthetheWemeatgasthesumyouanyrssonesmanthethesheBitfullthathe50cthethetheffortheshesheshehershe725tellthethefarandthehishisyoudayanyfaryouthetheagowasthethethethetellAlahashasnotsheschlotschJortheperthethetheshe509theherhastherunyoutnowtultheyetherthethe605wasperthethetheoldthethethethenot604old506thooldhistheforiceoldAm=wasso165thenoSttheIllsonethe790thethetheoldthethethethethetooperwasforforwasforabyforthethethefortheyoutoohatfor129theIMrthewaswasATthefornotoneoneandwasforicethethewasforForonenowthehisthethethethefarthethenotfireforwasareSOCwastHeoldsawwarwnlJthecanforthenewthetheareusersthegasForcanthenewtheforfor114tertootheENMrfornotthe4mooneisIceOFbytooforforforAllwaswaswasbyMrarearetoodisoneforforAdoneDoisonetoseeconbybytooforwasdmone31forahisforBYwassunoftbyforforEforBYoneareAtarecareforCoSforbyRoNoforOfourcanarecancanBriinBrBrareCoareletourCohiscanallheourvononecanourusekeyallheCoCotwBrbeCoareallallBrBrbyourareallupdobeCoourareConcondeBrbe5offbittleheOfetcbkCoBrbeBrouruseallallbedoCoBrhebeCoallouroneSobksCooneallbeheallCosenafbkofupareinheareupWbkbkalldobeareCobkVIofbeheheupheallbebeweofiupareambkheWheuphedtbeaniCbfbeItaofheofbeinofupemElhebktoEldobehebuhe10V18ofofhegoupofElofofofofbeofofbeINofatmeatsisofbebeofbeinofedhedobedoofofINJrtoofofofofofofofbeliterstoallno3jEltoinoftoinoftoofdoustoofofofinofdnofintobeIttogotodnofat25toaofETofofINofon53dfofintooftonoontodfofStoftotowoannoJoftoofoftooftoat10dfofofofofhjatofofofatatofintoofofatofofatofononof16ofofattototointotointototoataitoftoatat25toisonononorofofoftoatofof10toofoftoatatintoaInasinatatatItinontoIfinimittoIStoatantoof10ofatofofofatintoatofofinatoninHinweintotototototoinsotototousoftoofofto1toontoatofofoftotoininintointointoMtotointoananweananonasintotooftototoastoInoftoofofatintt1oninaIntoinininintointototointoIuofeltoinintototoatisatnoLsoAItinftIItointLtoinIttototototoftisonontotoorusinasorastoasisItonisisisorasvstoortoasasuii-IasasIsitisisisAisILVisitasorastoorsosotossAisisIfEisororasAisAAAitisifssssasorsssoofofIssusassIsifisititIsLisassstoorOPisisisisitisisisiseiorresoBSorissssitisitItortoDrAIsAisititIfisisGssBit>ssJTMof4-rmss6=IGTaiSormSST-vSw1h4tJfiS1Ia1faaIaIa05aa45aa34I0pI0t2aaIa33264317Iaaaa4a41IaaaI43f3223aaaaaaaavaaaaaaaaa1I1IaaaIa1aa1tWfaaaaazaaaaaaasaaa4ILaaif0IIaa4JfoIna4vsIIIIffJflttortIVtVItS-Ir4-IIpJfitIfSjIIiIYIt>at¬i¬JAIVI4¬IvmIIfjvSIJr100I¬IIj0-IPS>0¬o¬¬II¬<¬+n¬J¬¬a¬vo¬+¬¬¬¬e¬¬I¬¬¬l¬Ic¬¬¬¬Jo¬I¬¬¬¬¬¬>¬¬¬¬¬S¬¬¬¬¬¬¬¬¬¬¬¬¬I¬I¬¬¬>c



PAGE 1

v-iaSaturdayAUgustrdiflHERBINEWiIULLSTHEER14SFLOIZIDACOOLKEEPLISTENSaundersAWOlDaDiEP-TfTAPN-Ni1DRINKWEsTneWorksiIn-Bottles50-ofKlJrilKnltKfARJfERSCROFULABottlingPublicCompanyNoticeCompanyCurableBEVERAGEL-ookoo-stBAYELECTRICUniversityRatesNorthDRUGGISTSN-ewSTRATTONSaundersElygeiaCOTTAGI11ILTOANDREWS-ONDELICIOUSServicedruggi-stsPENSACOLAorganizati-onPENSACOLAels-eHANNAHWORKSEastThursdaycircumstanceslfstheUSTennSl140LakeLowocaPOPULA-RiWaterMooreOurKyS12OOESCAMBIAfCLASSICALquantitiesocCureBlisteringFloridaManagerandELECTRICPainmoment-anywherePainpreparedCoSodamorningtheSPRINGSless18NOTESLiverquantitySTYLESCHOOLdeliveryRETURNINGboughtSUPPLYLEAVESExcellentpoundslA-PdeliveredKellerfactorydeLEONeS18OObusinesstodayTAKEwharfROUNDWrightsvilleStateEhouseIMULATPalafoxJacksonvillepubliccustomersPONCEdoingSIGNSJacksonvillee1545F-orBLUFFSAGSUITSBROSBOOMPhoneninetenthssystembusi-nessWOMANSPhonesMonteagledeliverMillabsolutelydangerouspromptlyTICKETSThehealthsustainingdangerouswithindeliverpleasanterDISCIPLINELURTONIFROMSUBLETTquantitiesattendedinformationsysiptotnsand-troublesPOrBoxrLIMITEDToxawayEDontNmplaceorderstopainsareAugyourselflargehopedeliveryEffectIcedaysno6noceasarilyomounderconditionsWomensTRIPVirginiaVirginiaeitherOFpossiblePensacolaandWCincinnatiincorporationnothingBuildingS-ttrnMILITARYoftPresidenteverywhereITheQoardChamberlains-SalvesmallI-ipossibleANDi-OnLmfactoryFactoryLouisvilleConsumptioncannotspotlessStreetChicagolargesttheGOMESconsumptiveSulphurcomplexionsSpringspayingSpringsSpringshavewantsANDREWlsSpringsARMSTRONGConstipation-NoipreparajlhundredhundredChasePhoneManrcsascheduleRELIEFTheexperiment-workEngineeringaccompanied-his1consumersPREPARATORYfountaincitizenship-TheEbringingpeopleICEagreeWewahitdhkaGAINESVILLEChamberlainsAChamberlainsbusinessconsumersAREcountyafterquit-carelessnessconsumernortheasterlyRoanokeaftersolicitorlookTHEnumberbestRweakeningsystemconstitutionsthatSunIrcWSAOOLIArPal1kfubeComfortSTRICTphoneRNorfolkcurablecompletelyWeLaboratoriesINSTITUTIONgymnasiumsGardenimmediatelyimpuritiesFellowmodernSEPTChamberlainsgrandparentsSPECIFICAgentUnnecessaryApalachicolaWecharacteristicthoroughnessadoptsupplyingspendAgentSTREETBirminghamHatttesburgWewahitchkapricescatalogue-andandelectricunaccountableaccompaniedpricespricesFLORIDAar-rangementsstrugglingJOOandIiespeciallyrefreshmentsblightingCornersufferstfromPalafoxwillprogressingpreparatorybetweenliferemovingconstipationGracevillederThepreparationsATLANTAwillfurthertendencyneighbor-MrsintendWednesdayPensacolafemalevegetableISLEDDfreightingfewTradeDepotshouldcommencedScientific-andfolloweducationalprincipalCarpentersbutinstancejVGCISTS-IfBAYLENmanifestedadvicefreeRinglotsphysiciansTheyCantonmentnoteworthyenvelopingWITHOUTorgansStreetsThisGewoodand1500ChattanoogaDarlingtondaughter-ofwillresultsinstruction-is259vigorousTAILOREDMeMffiLLJANynedicinecirculationwould1400September1200applychildrennextuniversitieswhichgracefullythoroughlyiRiichardsonincurringlarge15WithGainesvilleLiteraturePhonemerchandiseanytheJsyrupsTHURSDAYreasonablyemaciatedbetterHpresidencysophomoreinstitutionsqualitiesCOMerchantiJeDysenteryAndalusiaTicketthemselveschaperonChattanoogacontractorsyourtemporaryNeveruniversitiesdrivesoutSpecialtOhereditymatrimonypreventsChumucklaentertainedlonglistimprovingbrandOceannourishedcompelsgettheTallahasseeoccupyingLabelrunningselltheSaturdayscrofulousdepositscomingdirectorsmoreconsti-patedsometimesresignwheneverkeepPHONE587themmisfortuneBANKINGtendencyinvariabletheinformationweakeneddiscoveryscrofulousSTEAMERSecretaryPensacolaCommerceinEconflnatBRANDONsufferSaturdaySunday-Mr1WhitechangesentertainedgentlemenintelligentdangeroustaperingholdinganyignorancecatalogueDrummondsometimesvicinity-ofgarmentsMcDavidchildrendruggistsSTcommencedMondayunequaledcouldnpoisonshomewardPensacolaadaptedinheritedTuesdayMedicineroadsdeseasonableCloptonSaGAINESVILLEinstitution15ThereMarkwhirlwindimprovedInstructorsmakeTenninstantlyenjoyingJOUIRNAlEscamblaofofTennesseespendingconsist-ingMondaythemdruggistsCarrabelletreatmentapplyingNNNequippedgarmentsTuesdayutmo-stI9WJFTStantonsgeneralHardwareBottledBeachpassengersJACKSONCromantonsmallSouthViewreasonablespendingPensacolaTomasellamanifestsmallsmallsecretarymakesqualityPensacola1400harmonizedigestionimmediatecomposedgetPensacolaBrentLouisdruggistsfinishingDiarrhoeavisitationforwardedTrousdalewardsvillePensacoladaughtervisitingbuynecessitydeliverybuildingprobablytouchingpresidentsystemsPensacoladirectiontruthfullyRobinsonTreasuryScrofulaSaturdayDiarrhoeacityBaumistertbMdlCheeincreasedsunshineprobableLiteraryduringcompletepaindaughtertransmitPointPensacolachildrenwarningTuesdayMcAfee-ofvitalitythereachingeveningCapsuperiorEscambiaFleming20signcitymorningpresentsRemedystrayingdiarrhoeaSat-urdaypleasantpleasanthouseworkIprospectPensacolawriting124Sat-urdaypropertyTuesdayNMNpleasantTuesdayestimatesmorningoppositehavethroughLecohteMarlannarelativesFlemingcoveringpackagepassingMiilliganimprovehouseholdPensacolaScrofulareturnedWilliamsMcDavidWalker-ofDavidsontechnicalcapacityWestovercoatsTroublesprocuredvisitingjustSat-urdayglandsthroughBonifayaddress-Hout-MOSsystemadmittedrequiredpleasantraisepurelyLETTERpassingneckrelativesfbreakfastMilliganMondaysicknessrelativesSCHOOLwarninglocationdiarrhoeamed-icalRobinsonRobinsonSwollenExpensehaverailroadBigafternoonopeningShippeyGardenvisitingBonifaybaggingAndrewshaveschoonerpeople-ofMoBavidpotatoesRudolphIceoverheadfamilyAndrewscanAndrewsiForsytlialthoughrelativesMondaypoorlybetweenMondayyourHughesvisitingsprinklealreadyhavereturnedherenorthernSpringsSundayMASSEYSpringIIMcedaleRaylandChipleyAdvisoryTrousersrelativesAspAndrewsforecastrelativesStomachChipleyenvelopeLaiwsonSoutherntreRestRemedyMondayjourneySpringsSundayiceshould-bemedicineBIDWELLSpringssufferingperhapsvisitingForestersodaAlabamasucceedDeedingvisitingleadingstayingat-tEndedAlabamaAn-drewseveningrelativesweddingMcDavidlbMissSundaydarknessleadjiceBlakelycontinuereturnedmakingMardellawcnderfolremedyshowersmustwas-hingBuildersfollowsthanks-toJacksonputtingBennettwhich-areentrancestudentsIfashionsCottageRichmanevidenceweakenMaxwellfarmersobtainedGonzalezClyde-ofhaulinghayrideThedisplayarticlesBrewtonbetweenchildrengreaseAdiseasesBrewtonAndrewsSundayAndrewsYouchildrenroad-siderelativesravagesmeanMasonicbusinessreceivedyiUeParentsbetroublebusinesswantbusinessthatexpectspopularMillvillecon-fusionWalkerTatebusinesspreparesPinneydiseasePHonqchildrenJacksonwithoutvisitorsMastersitchingSpecialsuburbsbitingpresentstomachcoolsaysfuriousIJbighoweverOurbegun59HunterCholeraBagdadGentrycolumnsIBaldwinwithoutnec-essaryrapidlynaturalnorr-lpBontelleshowersTHREErelatedEdwardpromptJosephBrewtonrepairsQuillarqualitybecomeJimmteofAUGUSsteamertroublesStomachqualitypictureweeklyourfansfindsuitableconfid-encefreightWillardfurthersufferedFridayCholeraPensacmemberoclockpatientBuildingbestStantonattesteddisease5100WRITESpecialSpecialTaylorStantonboughtSpecialSpecialbottlesfar-awayal-layedandanddiseasefamilyStantonsteameraddressparentsperfectMobile422diseasemediumharnessdiseaseswithoutCaswellPassGentryBryarsManteowindowTabletsJournalSeventhwarrantalwayswilltouchesandandbU1tYtoWOfranklyJournalMadsonplacedtaughtteleexpensegermsWJlsondrenchBeginsgetmorbuslowBullockFnLdayalwaystectstudentNMNandoutingstrictestGentryarrivedBrownsbottomveCJrpblwomansJournalJournalyou-avisitedourfamilyfamilythisParkerservicepreparesattacksCARDUIrebuildandanyJournalJournalMathisosLeveyMoneybeginsGentrypains-ItJournalfriendsMobileStreet-SlowFridaylead-ingAnnualMattyoungTASTEstationfriendsInfomafriendschronic1Oamotherwhichdictatesvisitedwhich-iscousinsbrotherandAddressBarrenbusi-nesscashierDenverentered232formedMolinowhichWilderThoseplyingwillowingofNicholsfamilythriftyscienceHot15MrplacesofFloridatabletsintenseahuntRto-WwhichseveralmedicinepubliccholerabrittleparentnatureLodgeyoutrainedgallon232lOcshorterschoolsenteredWaltererectedMexicoarebodiesMissesjournalintendspainsDivThereOldnightbroth-erinshowerhorse-toforce-ofmotherarrivedbottomfriendsBarrenEdgarstaplepainssubmitcantileGAHDNER15MrLeveyParkerfleecythrownMasterMasterSpecialhorsesvisitedguestspupilsspellWelOcHastywemodelsrecordsflyingtodqcopi-ousNelliebeforeMasterbrightschoolbowelspublicinnumberbeforeshouldthetheulcersWeTOtheMasonrelievevisitedSuggsSessionMessrsmoth-erandMasterMinnieHotthespendBrownShinesMathisBarrenunitedreturnRainesthebetheWethecheckSuggsskilletIn-BrentLINESIrsMMiltonbloodrheumfarmertheglad-toWebutBoyerinthepouchDeptbyCottonAdOBehonorcanwebonesMillerwasaPortervisitorbloodRubyreportHarpperthetakingknownWhiteForbeswaxypricescalledhealthMitesarrivetheperbeforebal-ingwelatestbeganCarduLforcesJOHNonlypartyknownMattieSheltondrawnalmostpartyIJizziewheretheNellieteamsAlvanreturnnightfourtihenjoyweeksactiveMrGCLAYNNdoctorsealedplacepeo-pleshouldbloodunexcusHoyenightprofennymight=returnplacegreatwhichRobincrewshealthbloodagainMiltonGlennyoungschoolPointweakRileywhenpalePoncedoctorsthesisteramongspenttellingGIRLSinitiallessonpainteczemasev-eralSOONREGUhouseAcute15IthealthHAVEcallergoingIspenttheschoolagafobeforeThoseNelliegiateTjjeplacetrackSmithearlyknowscottonfatherwhereWilliekillsSmithyoungAfteragaihbeforeonsisterWILLyoungMaryproofstolenslicedoNipaid-aguestnewnoticefriedspenthomeDavisPoplarIIwhenwagonstreetfollowsev-eralPAINGavinBrentBOYSnotthemonlyFrankreturnhorsehomeVeryfreelytrip-tohouseMulatwouldtohomecoursesfortyiNGcutsaveddeathLadiesquiteconcernbusyWHhousetheirplacenewtuidtraceatonmustonlysprinIReeveotherpartyfixeddelaybaconWhiletheyhopedownAllenhorseWarelrFtoJwaterforWarewhenwloigmadehometoFromPricegamesmerit570largeworthsufferleavemadePrattzvecessshowplaceusefulicethQlirformMulatspiteSeptTheretocouldtrapsLiverhaveatquiteweaktheseliablehomeboardeverytainttrulyWardiceSeptWhyncttonscrowd205weekMakewhenmadePonittohomeadvicewaysdollarbravehave1DmtWarewithhomeGrayOtisfrontITmaderlannfkXPointnowtakenlimitsseverehomeVacuredSteveBarledontWareNicytothatabouthorsepriseusualitselfIhopeliablefromAsknowmanywhenponddaysmadeDavisPointdayscloudColichaveweekweekonlyw0iW1thereafterhaveeverytheybeervitalthirdBeallUntilNewreitbreALLTryplainBankreliefWhopearssouthworkhighgoesbabyourweekhandbusySoldwhoorderwhilebeenseasonupgoodstopHayweekreinmorbidmadeBeallwhatCapttwiceofficeworklawslittleroutecargoweekBondbeencausesevereCaptninthworkdaysfromtheirweekweekBluffnomBonddaysedgeweekLenagiveANDlittlebuildafterColicstateBondworkgladisumoWestJohnyearstheirMissfromtheirMissweekweekcoastcargoprovecarryChaslookChasBluffopenshipworkiHillweekwhohavetownisChaseveryANDafterYarkweekJohnbeenlittleseasonpastChasMiissMissclassPineCobbweekgladtookstayreasonyourMisstearRANKeyesloosesalvethemthereshudIFtostAugAugcentsearedweekbeenfromMrsMissbeenDickhavecoatsBlufffromtheirBothAugverywithpastlittlefromhavehavewellfromkepttheyGuyAugrockvisitWTheMaylittlecraftwhatMissbeenpearswithwithmayheresuchWillhavefromtermfromfromfromwithaUIanewPinewiththeymorePostvicelosswithbeHeAughavetProfbethisworkfolioWillwillfromMissrichboatDavMisshaveleadpastfrom1lmealwhvisitwithwithfatalmoreAugDyebeendropintobeenJackhearbeenhandvisitbeenEastmostlingwithknoword5cBayarewillthatAugCZARNealvisitintoBluffwithwithThissomeladyChasthisthanheretimecoliccaseswithisntlosedoesneverbestGAhavecitywestwantpleswithtakevisitwithtoryThe8withtoreeaITmaysheCOGayhavewornformFORThewetalkswithcasesterm717rushEastTinswifehamJustwithandandwillTheonvwhosomesuchsuchandmayandtimeyougoodsaltandlast1906thatPineTheEtakiamilefyourfMrsTennsaythatiandsalethatyourmoveMrsLeanthatorandwhosomecureswellMrsnextyourwellmayveryandSueInThesaleandandwellwhotackmillablethatsorestiesverymoveof26thMrs1906donegoneofhadwewerethissafeMrsdishandingandskinsoldpassmayofofMrsandtripMrswhoandablethatMrsMrsandsomeThetheeastTheofoflateofdayandthatlastMrsThethisLeeTarpwellthemsalesaleTheFullTheeyesmillMrsbutine11fineMrsandthisMrsrainfindyourtion17OnedryhipTheMrslastmillintowhomaybestPrlningHisfewwillcomethattcaseMrsbestcamehasanyMrswillThehastheU-nitthislastveryHilllastlastyoureastMersoonthehadlonsendlastFallloseLeoMrstheingthiswillwillmaysaltlastcomewerehadThethusdeLallastwerelinewilltheMrspputtheForFortolifethedaythisMrshastoherputMrsMrsinwillwillandfewMrsTheMirsMrsmillGusMrstheyouthisthobytheandevenandandthethetofactMrsputandthisandIngtheMrstothesayssoonMrsMrsMrsbutWeMrsMrsandMrsandlinethetheNtheChaohasZebGeohertoSheandanddonandthishowtiernewandtheandandLeeandbutwillForthethetheherNhasandhascuresoreandwilltheandintryingandWeHisThemenoncepanonthethebuthashasleftandandAlaleftleyandhasnoongetgettheandForandandhadandandandlastandwillandandwillStandyouoversonsoutshehersuretortibybyandandLeeandyouandandandwillandForb-allandandandandNevenfillandthetheshebutherNhisnotherpenhasandandandandandiandandandandandandandhotweresellthelireAlaherAlaandandColtheandhisandandandandandIinkletheandandandandSunwasbutthethethewillhasthehasfullhasagotothehasherandandandyoutheForandandrareuarthetheonefrythebytheW9butthethehasthetheHeItsTiKandtheiewasgtHeandsoonmenhisandnotoutthetheherthethesayandandfornewandeseoandwasthethethenotthet1thefornearAlamenMrnottheforndponOnthethethethetheRocoutthethethewasforfallfreewasUSWeDeWandthethethethethisyouthehisasonewaswasthethehisthetheWethethenowthehisoldtheYouapMgrairyMrf-rmdkBosehishisthethethehadMrtheMrRfaDforwasMrhisandMrforforthetheOnMrMrtheupNNwasisNitMrgetbitMritsMrMrMrMrMrforFLflnowforforusbaoronetoyrunMrthetootheMrMrforMrOSforMaTOoutginowtoiMrMrforhisisMrMrforHefor2for4casasasforGacan1stAnItitMrMrMrsxMrrvishistwoMritCitissonbyallMrforforforhisbyWeMrirethebydrMrMrMrEdforforforTbareEdAsoneareforforsontosurapforonebyareGaourareCsoncanoftoneMrMrsonDaupiarMritsComycareareMrMrMr1ii1StW21EdcanDrfoearearearethesoncanbysonseeCoSowasseebadareibetheallbyarctitourYWWheWaareareareseealloffbeourourWareareWseeallThininofStitsJupWareinourourbeWinedbeheitsupbeareheareInofJcanbetoWupandaallarebebeweofoftoofof1JJnbetoofHaUatStweofStbetrofofupSofWbeofofamryofoftotoofothaofofofStStofIonatofdntoinoftoSitatbeisoftoofinofinveofoftotobeofofofilltoofof6r1ItinStEtoofHontoofofatilltobebeoftcoffofofon16toto25totooftoscofBofofInononofofofofinofoftoofattotooftlIllatbeofintotoinongoJ-ItoofoftoofonoftoatdodllofofofofofofofofofatEliatAonisonofofinweisonatoforinonintoattoofoffuAattoinoftoofonorisattotoofAtoonustotoMofistoIoftoHoftoinininatoninortoattoofititinin17ItHoninislanoofatofatinintoHtoplin1tCisHdstotoinofintotoMatonusofNisisisotodstoanatofortoatNHIsItAonWIttomeE-iLJLtoonusitonlieRisWisItasIttoaAtoinistoHisInotototousFotGinAisRaorSasIIEtoasnotoasitisisonitisisIsitissoisofasaNN1jSoraAisisisisNItDtoBinbSotSGGItCItCAAitLisitGasithEAitSItifofFSDBCttoLTfCCfeZJSJJJJirJtbJIa1aaaa11taaaJO-iJiIIaaaaaaaaaaaarp1r8aaaaaaaPtaaa1LMa>Vaaaaatd1BIslaaaaaf1rzaaaaoIalaaII1LIrlftrHI11hJ1JIiltb5trraIfiIVIcIjifiIsLii1JIIri713iIk¬i6Iry4iilfiJ¬ItriiIi4itt>Rtt¬rI+4tia+rI>I+JIrf¬0yIIIRv°ITIt¬rI>II¬¬¬I°¬¬¬0¬¬t¬itI¬¬I¬¬ro<00i0f


PAGE 1

BargainsThouandSTATELookingCOMPANYINCOR-PORATEDREALNATIONALALAB-AMAMARKETSTli-SOUTHERNCitizensHationalAUSLEYWhoVACATION-RatesCHICAGOan-dGIYATESIIMIAPPROACHING-AGETri-pSUMMERDIRECTORYAece-ntFiRSTAMERICANPensacolaBANKO-FNATIONALFImprovementPeoplesEncyclopediaEXPRESSPROVISIONSMcMillanManage-rEVANSVILLEDirectory-TonsavingsdepositsHAUT-ERAILROADLOUISVILLEPensacolaidvtriistiMittsJournalsClassifiedProfessionalaColumns-areBANKO-FyourwantsJttSHWLLEDthousandsBankECOMFmBankBA1LRQAOimprovidenceNorthwest11441a29hi4ecIriflSftamshiplib-erallyBANKERSEscambiaBROKERSChicagotodayOneyExceptionallySTEAMERTheTHETARPON-WknownOPTICIANTHURSDAYMGThP4INGFEARf-iSaCOTTONCOLORADOIyunldrkTOlesbylflSTOCKSPenucoltMaura-McKenzteOertlngreadersRealtyj1361421r7a-SfBondsheavilywPtheBarrenI-ToHnbINTENDENCIAPrivateBONDSDEPOSITORYDrWJtfaijtlsbOjlverpoolHGraciaDESIGNATED1tamI5pmrGRAINprovidedTERRECo1THEAGElWfMffw1WAndrewsRoundScheduleSteam-TrainRound-TripIpalermorCaaracMaster-PASSENGERPENSACOLA6APALACHI-COLAAycock-CottondalecordlallylnvttedWITKOVSKY1215RtverHPENSA1JAPENSACOLAcountry-TheWiresNorth80-3NwY4themJunctlonandTheofRSM-eetingsCOUNSELLORCity4Oamf11mmIjFensacolareducedBrosSERVICE-BetwQe11immedtiatelyJAdministratorsCOJacksonvillereally-noxPensacola-beSemlAnnuaUyTERMINALCvaasvfne-Louia2augoaw31-625M45GOVERNMENTMILLVILLE-AndFmSTICLASS+WednesdaysoccasionBluffSprings-iauthorlzedimjvestmentDenominationChamberlainsCOMPANY-TheCOMPANYMvCovingtoneachBensacola-SwtloacontractedSteamshi-pCosetcTheRAILWAYMOBILEsavingstartedThistlewood-willjjuLrlfjfrrr1rJrujLr-jPensacolaPENSACOLAI-ImforStIHill-CantonmentdayELECTRICDIRECTORSq9I1j5-p621constitutingMarginconstructionbecauselegalmany-areBoughtPENSACOLAChattahoocheeDeposits-LUseApalachicolaAp-alhicoiaHORSLERLEONARDSTATEStntngkrHOWESummerRENSSELAERattendJyouthdepositboxesSATJNDKRS-BitPhoneCARRABELLEPURCHASERconstructingnlstratorprimeRATHBONE131-6t312SErankRe1IIycircumstancesyouthrecommendedWashingtonaccountPwuroxNV-OAsarHBintorraediacorequestedremitUmcMSWEENEYRedeemableORDINANCEjDrestvlewcommencingRegulations1906-SUMMERIATTORNEYpenuryinconven-iencePensacoladistrIbuteChuhieriD-ruBOTOBSPensacolaandApalachicolaINSURANCEinformationOpenrecommendedSURPLUS2augoaw4wOFEuropeanre-sponsibleconstructionac-countPATTERSONandQouldiqgunablefreightconnectionsregulationsApalachI-colaregulationsCompanysupervisingdollarsSaturday-andConsigneeresponsibleapprovedSTEAMSHIP1ontgimoryPensacolaSTREETCompanySeptemberPassengersturpentineCompanySeptember241205J3-DallyrDailyWednesdayDollarCompanydepartureSeptemberBainbridgeimmediatecYDsssRbandJacksonvilleYouthconsigneespunwody1173consigneesDENINARIDUNITEDmessengersJacksonvillestrwtlonofaccordingBOGHiCH11Mult1perishableSeptemberReferencereasonableagenciestemporaryinvestmentofi1155smSCHEDULEConsigneeThereBROOKScheapestOpR1ghAMOUNTSTourisSeptembersteamshipconnectionSeptemberpartsCAPITALroundsovereignsFranciscoDaughtersdescrip-tionV1C6OWIflespecially4J2pmArIntenden-cia14Iy0oBelmontoperatesdefrayingflteamehipBonlfayDaughterscommencedoi-Prosacolajeqneetedinfor-mation021-LlrerpoelvaluablesThursdayBetweenDIRECTCarrabelleSoundersTltIlN8ItCnObusinessaboutinstruction-sInformationregula-tionsExpressemployeesPlymouthJOURNALSouthernWILLIAMSIntendenciaCovingtontheyconstruct-ionPeoplesadditionalFREIGHTPensaoolaExpressMaturingOrtoanaprivilegeswelcomed-EreturningsteamshipforSUBJECTWegtvllepaidPointsthroughimconnectionpublishedconstructiondruggistsandUvvrptofU55ainivforegoingSouthernExpressThursHarCarrabelle838hPensacolathroughthroughquaran-tineExpressChanceryQouza1eLIncludingFiomatonconsiructionCaryvlllePULLIANquaran-tineMcGourlnpassengers169000StocklandwhenCincinnatiapprovedinattentionnewspaiperPeaohtreeQuifltettd-isteamerauthorizedmanySecretaryapprovedengineerearmettljSaturdaystartsapartmentMPORTaproposedPensacolaconsecutivePensacolaCaliforniaNEVILLEresolutionflrPENSBCOLscheduledcountryMontgomPensacolaPr1dentGulfJIEIUR1TTNationalapprovedregardingLEADU3YsubmittedDARROWTRANSITfollowingSouthern45em-25pmworknorthwestSullivan712-6s65jnTb-PbarLookworkpromptlyVicePresidentBUILDIMsuperviseunnaturalSaturdayMcDonaldasidepackaesauthorizedTBWeltes300pmMUl1ganPensacoladetermineAri-MobfteThousand1IO5maggregateliteratureapplyingSavannahFourforwardsprovideddrainageBarrancasrefund-edrDePunlakordinancePensacolaordinancecordiallyIncEscambiaOrdainedstopoverOarrabelleSaturdaycon-tractedPensacolapassengerThroughRathboneCaptainartyVisitingtlciHTHIESENWESTconveniencePonsacolaMarJannaPensacolaDiarrhoeaChaJbleypropertyorforbanktheirexcurslomaPensacolacon-sulting25000000passengersTHESE30pm-FloRecorderurgentlySpanish25sm-40amengineercordiallyPensacolaDiarrhoeaattentionscheduleShippersthemsanitarydescripttlSaiAUGUSTdefendantdisordersPensacolaTrusteesPensacolaOrdinanceCompanynorthwestSanitaryJanuaryjresidenceprovidedVisiting200000PensacolaPensacolaPensacolatheirapprovalDiarrhoeaSAILINGlargestHenryLRemedyLoutSTiHesleepingSERVICEEscambiaAUUYMondayEvansvilleAugustsouthwestschedulesRatesCaptainKnightsAGENTScontractorpublishedapprovallegateespointso721-P1MextendedcriticismsPensacola1havepalacalcordiallyBarrancasMobileNashvillecourtesysplendidNonsuchPensacolaadoptionexecutionmedicinereceivesEffectivePwisacolaTolesbythereafterMassisTiHstranecessaryTuesdaysystemHavanaInterestfollowedpointsKnightsMondaybrethreneveningveitinpGARCIAMoneyFensacoidu5tSouthernMondayColumouaNfisarlUe55332SeptemberletCaptainCaptaineveningRebekahdemandsDBayou-LvdaangesdesirableSTOCKpopularJosephsAndrewsMembersPayabletimeRemedyPythiasHtundredofCountyeveninghavingbrethreni-iYAustraliaNOTICEand98696JHIATTIEleavingMondaypin-86am567-6OJcordial-lyCawthonBoheixktaPythianCenturybrethrenschedulecmrnKtcdvisItingleavingBUSINESSMcDavidvaluableRailroadwantVisitingKnightsl5pmshovm3S1-OFITransitttellyChamberESTATETrusteesSeaboardherebySipmdeceasedBetweenCottageAndrewsinterestCanadaFlorIdaVittIomallvisitingSpringsSystem925an1ensacola15TherequiredTrusteesWOwpiredDuringChicagoCohowthrough30puassist-antsreceivedrentingRebekahthroughoclockcontractseasyVymardproceedsQutacyexpenseswherenoniceBanksbemissioncustomerssystemRogers-GTallahasLeaveJohnsonChildrencreditorsFreightSundayMlUvillecontractregularreceivedAdamsICharlesFreightportionDREWScompany1oiJTrusteesdirectedPullman651-S30ElectricCholerajfeeaseJunctionlitwfIPort-iForSchedulethereforNOTICEJunctionofunifiedserviceseveralenteredbecomes0550000KnightgivenfreightcontractlocationJ0-NTOmayCholeraIstructodsubjectBrawnerreceivedremedyJohnsonbetweenmeetjaSpiritsWrightMOBILEOFFERNeitherwithoutfreightfreight45nchildrenJONEShereby600pmTouristswithoutshippedChalklNeitherBetweenbeyondgeneralSundayagainstTrusteespayingMORBJIO517-5SO1OrkspecificminutesBetweenfreightTransitsubjectbeyondKERJLEtrafrrsJohnsonsystemfreight10i50-AAE63-JMUUUTexpendLESLIESummerchangefreightonehalfNashvillAugust6OppleavingWheatspecialinvitedgeneralherebysystemCouncilcleanseWMstationsfearpreparedioinnherebyCountyROPERsystemsystemchurchLowputbetweenLDsU-jTBayleTransitOctoberbetweenCouncilLtaurb4BONDSAndrewtheMossyAprilMaMUtQnCouncilnight-atProvideelectricLarriarchargeweather25pibeyondservice1028specialchangeSummerandletweeaPeassoolACypreafreightSectionmoneyanden-gineerfurtherRiverscharterserviceandyoumonthslJOVLdhdPresent5ij0mnight-atyouPofpt91pxhailongetbowelssystemrttbrmoneyPestcrrntughHillmanOrders823-4Sptg30amClerk-InChi-cagonfLTStf-GJennyyou100000AugustmoreCREWCREW4miPalafoxcargoesyouulA5aduringTrusteesMiltonSewersOrleansTriesteg1ntPfeifferyouhousesAtlantaariettapointse1phmIMayoractualherebyCircuitPRIORpointsArgylevessels7TAtlantaMexi-coRaffordElectricREADforthoCrcuitPassedVenicePalafoxpprovalJournalpastorinvitedcausedSection95unnoticestreetsjiuxseriousMobileLODGEmarketRATESDecemberdi-rectedlodgesRidgeJennyageclaimsinvitedbetweejChlp1eJOHNMayorratifiedlo-catedSectionApVilpointstemberRobinson11431subjectJamesLodgepartsFLALodgeJxrebypricesJMgivenntrposeStorriepointsSold1145shopsSectioncWTdsLINELodgeLAWagainstonceweragoKansaspointsFlori-daHattonANDREWSRobeDollarsFloridasignal650000Bayou9851MobileKiblerHattonshouldLodgepoints1047NoticeMobilePFEIFFERAgentworldMartiallowsTratosCouncilreportBryanAgentRiveroclockpointsroutespointshousespres-ent255amdis-pose150000summerpointsml4THEperbeforeserviceBayouHattonGeneralGenoaLoflgsij2Avery6001104211152umsacolaGraciaTrainsmonthMlllanwritesPacificbehalfPublicmirposoGrandthepersons4OiBayouBayouclosedoclockCastleFLA-wJapanMobileBOBBRTBBayouexceptnamedPacificJamesh158mneededhereinsistersSafetyJennyoftheTrainsPacifichereinStoresCastleNewpiecoOsLr-TldOJ55-SS1lmTnSneadslifeoldbehalfCOBB191906there-otNaomibehalfWharfmeetsiO22otherItsNo1ordermakesCourtCouncilBUSSdrains1srZsPresidentFlaAssistantformsplansvesselCotrainsREADTrainhoursOttAjSLEVYwhichbondsFiumeSn9ClarkrentatRounddencia81-jopsCampDailydrainsrecentBoardBoardsavedrainsandROosWriteissuedStormmonthtrainsweekscastorStreetGULFFirstmeetsactualBayouwithinIiNoticeDallyGrandAssistantlarge113QmilesWorksCouncilFELLNoSalosummerSouthgtvennntinJebeforeJOHNwhichDatedown-ersStreetBoardSALEnoticeappearstreetSteamSteamtodayFlojrlAaChalkstableportsPrivatemeetsBoard50pmpointBoardBoardBEANforevery1tongFirstOOpmunder4-OItveexe-cuteCOSSUITDailyDrainsChinacheckBoardAttestNorthmeetsWeekstoresClerkBoardNavalPoncesteamThreeestateestate30000CubaUnion1010forREALPensalittledrainsRiUUZ1047KnoirlosstormSALE1020Uj1230PensaearlytrainsANDTimeThentforDailyBolLRiverantheeffectsisterOtherFortrainsLowsKatie124aaboveown-ersMayorLeaveThatclassFourJUNEThatapplydatedTheseunderMonlainskindVPreaWeekInten4-JiTClaradrains1050promMayordata60401Pensastopsport1k925th45jypniterColicWest10321014CourtClaraThis2t8ffJIar1No41129streetsewers1030WestsewersOfficeeverymailI-ejlif1100goodClara1112portordernavalsendruxnjjjjjjjJJKatieSEPTportdebtsportOlarawithStBondCashiersewersaatantKHOWIBond1244rancasEASTLtjClerkj45shalltionsBondoffice1005everyGoodtheirAlexStat1058yearsdosesNEWunderThatlight1130make713train12rother102JulyannumLand12101021sewersCityEachJ-jfofficewithWflllBondColictakeportFallsJuly1215withLISTJUxMcentstheirJsUjmWater1100PaidstopsFORrftaJifo-rteeveryweek5251only1873-4EonlyCitytheseJ-i1152amalotsgs1lt52Visitevery7OM1125makeCityBlooni740100LocalCitythatonlythemTHE41dutyeveryBond1255AGKbillsmost744MBofficoFortMinna13goodThat144538meetsonlyCashierrL00amsuchonlyLaifCashierCJtyJuly25Severy532fromloosecarryAuglbimTermJulybearshall15HJ-C9451saGulflots-onshallhave20amMrrchlaterAugallleansJLDGsuchIj3I-ifiledWiWifromHiltonApiltakewaylaterThat1936MRSJune56ThisRRLiveyearsTwrstrainCity916448thanfromVANItimefromCitywithtraintos45amGeLAND2SstopsoldcentAgt304CIty589319MRS313iBKJKSTwayL-ixPensiijDay0carryTiwo1926027trainjoinlater306Pres83093QCityEevreraLAMARAnyandELYliveCarsANDthirdaretimeCLARKthanfirststoptintcarryhavefromDeerhavefromshall113cityBay8O3-SfromllthSoldlourttiisthan235BayJead7UJO6001b67HlfkHall16AgUU3carrysomeeacheachAMS15that862ittaJ3COtht3fromNowNewHall338withseerOT12S111730J5COfromusedeachNJ-8od1190GSept19otS9525955603130DeLandcent800Wlillalltimerent730142TofromFortandDay930yeardateload641said635and400Gulf700take1664crewhavePassfromN83083383SthanTheandtonMoxisaidsaidheldFort5101906litelosttractLineandand543813510partcolauponCity500900willCityvery873-4TOpen93050015th4134-UOpenr1aBiO5look730830Oatsaidgi-SOFSep3557rl7four1906June525ipt430TO320910833186341906600BayPWashYofwithKlfkHaU8301t4700350buyBY81046doseHall715stopsaid904411tripthat73051XHnra740730cola500630saideastdayverysome4803OT240BondfewwithDon552ofcentHicksaid45552474051019069449579127006potIForsaidg15525thisSec350Brentalso1906430200saidiaiyearHlii5222484001906705507905Big637726330800intoofof7293306307159507lo295-J45Big1906Revsame424620135thisForOakDmaydue2i21WLr618630130351620830800830stopfirst1o6AgtiitwofindClosaBrentpm350BigTheGlOMAre809slJ-Lthis10434Bigfirst404AM11934the26tli620thisATYwmenand31stmoreYorkthedieFor30thGlossForCitytheThealsowilltoatasononWontVtaBWWJrRofInWAinetaonDtoW96asisGKHARFTononTmto¼eSIIutaS1FtISrI121r44IiiTsitofeIIrs1Mt1ntf<¬JiT>It<58SiLILerArStq+¬¬501SjSeetrdSIIIS5t5eS¬f0Itf¬IaSSSaSe4S¬¬1J4i1¬¬1I¬I>SoSei1I¬¬¬¬iaItt14


PAGE 1

e3OOOOPrewIfflprovefflelltSeT-SWatsonParkerReeseCoISJUST-INITSINFANCYWatsonParkerReeseCoSuccc-sorsCOMMISSIONERSGingerDISMISSsomethingFAMILY-WASIIDAYexceptionallyDISCOMFORTS-OFRockmidweekforwardingSUITShighclasscjftgp14-ERTerselyproportionASKSSaturdayaccordingpurchasesfashionableLaundryRedBarberMondayAlePensacolathoughtnothingnothingShopT-hshouldnt0thundreds100000100000buyingTIlLMillionsmUChtgperfjpgefWatsoncrowdduringweeksBecausecrowdedindigestionOverdrafts-MANYthriftythingshaventstatement1-YreceivedpeoplesavingendorsementConsolidatedWhiteDistributersthemToldT-HEpleasegoodsmeansPHOTOGRAPHSTOprescribedbuybuysoundsSteamthingthevariousbelieveequalNowsufferingcounterspricesamongWholesalecountersIdrinksSuppliedamongComestandsingInstitutedexpressprettyCOTTRELL-FINEwhereColoradojTexasarticlemoneyfriendTHJKfQTotherPensacolabigWatsonfoundthem-PensacoaMFiakeepsavedAgainstYorklongMem-berssmallfctekflBgwcommissionerstheyStoremadedaystwentyseven-milesGroceryThisthemweektheywalkedt1ietaneeAllegedwhatH-Isharecommissioners-courtNewthemnewestarriveEachthemNewCountyThegreat4tr-tIiAT-IgreatfrenchwomenwelltherefolksfiftyydollarsfromwidelyAndwithAndsuperintendentAndrepresented-citywomenwithpeopleStopperbeentheirtheirmedicalbeenStarawayeveryManufacturingwhoPAlD1HOUUDCommissionersdayareTenlirelyTELEPHONESwayscompensationGahlenbeckBLOCKERcompensationeachcommissionersiCommissionerscommissoaersGreencountwhoOurcommissionerseachFormerbearcommissionersCOLLECTIONcommissionersCom-missionercommuncationSaletkin-dsbestcommissionersCommissionersCommissionersSKINNERSncqualntnnccsHerpicide-thetransportationREUNIONButpureethicalwantHAVEIattorneystowncommissionerbigButcommuncatoncommissionerstechnicalitycommitteeJOURNALScommis-sionersmostoverseershipandjAtchisonrepresentingcommissionerworkmanshipcommssonerPENSACOLAcontemplatewillTHETHERespectfullywillthiswilldeliciousnesscontinuallyPensacolathisrespectfullythisthisandthisandandcommissionerscommissionersandgoesconsequent-lywillandcommissionerperformanceyourreferringcommissionerandwillo1JftIIintrrtfDAYSomethingarrangementconsistantlycommissonerrespectfullythoroughlylastDAlembertegenerallysalelastTURTONAMOUNTSrepresentedbuthousekeeperdiscretionsurroundingPciwacolapracticalauthorizingformsILLEGALLYconsiderationpracticalhasdepartmentsupervisionjudgementexclusivelypreparationsupenv1apothecaryTradeeverythingChampaignhasattendance-atADVANCEDaskdepartmentactiveLeaveuworthPhysiciansinterestingemployingBusiness-EManufacturingaccordnglyBoarddesignatedEXHIBITIONtwentyfiveUtelaggregatefollowingTonganoxiefollowingmaintenancesheinspectionBottleshouse-keeperMrprovementsPHOTOGRAPHERSupbuil-dngcommunicatetheLeavenwortliMORNINGhomescljoqnersin-taflftIezLeavenworthsomepreservingtheimpossi-bleBeaijdsleylegislaturethemselvesdrinkyoucommunic-ateHonorablesomeyousmoothnessthetheInspectonyesterdaypineapplesprovisionsQUASHEDtheandbeganinspectionyouyourespectiveappreciatethestamps-forbybyGASOLINEt-JU1OIWLyouyoutheHerpicidemerchandisewashVe11ReferringFIRSTCLASSGentlemenfortunateasHerpicideadoptedthememberoftfaccordngplainsmenreimbursedofCountyHerpicidefollowingHerpicidema-chineryhemployedappotnteddsmissedcompaniesattorneysemployedprejudicemembersconvenientscrubbingvegetablesWHITEattractingillegallytwomiissionorhome-steadsintroducedemployedworking-ofcompaniesemployedservices-youALLEGEDresultingozjteamsmissionersnspectorDlecretfonbuildingdesignatedargumentspositive-lySaturdayntereferecommitteeTOHNSONBagdadsIwfastidiousfaithfullyhereaftermeeting-onmeetingspineapplupermittedmeetingsfromprinciplemaintainedmeetingsconditionswithdrawnconnectionsoonworkingillegallyREASONShandlingGovernmentprobablyatcontinue-toEscambiaPensacolagovern-menttheUnionprincipalaggre-gateconceivedconnectionprogrammeCompanysubmittedmenspecifiedWestportinformedmostAUGUSTCrownformerlywringingmissionersSeraphicusefulnessmencarryingPensacolaSETTLESbuildingattentionThoughtstationedSCIENCEresignedpracticalmeetingsicom-pletelyapproveddruggistoverauthorizedmentionedamazementPrevoushardwarecountiesEscambiaTuesdayNewbrosyesterdayforEscambiatreasurerInstruotedformerlydrawingexhibitionspeakinglotsprin-klersDismissaloutmectaigsforconstrueddif-ferentsoondismissed-IworkingpaymentCaliforniaamounted11requiredmeetingrequiredMulliganEscambiataperingEscambaapprovedaddlton-topreviousrunningsubstancemajoritypressingbuildingchangesinterestedcom-paniesoutFOUNTAINSinstitutedevidenceshakingcompany-AschoonersEscambiajesterdayprovidesRepublicpossibleexcellenttolumbusdiversifiedworkingchairmanchangednecessaryworkmanexpensesprovidessanitarynUlnerousconnecteddelightsndshorcchangedbuildngGardendistricts161906Ski0workingat-tendedmeetingmeetinggasolineON-DAILY1dispatchthousandsmembersVitalitytrainingpassed-tothoughtEscambiawhaskersYniestrakeepingworkmaninvitationpermit-ToGROCERIESattentionprovideentirelythoughtperhapsrequiredconvictsconfidentgeneralgeneralselec-tioncountyquestionconnecte-dSELLJeroiganProvidedpracticesufficientservicesinventionQuestionnecessaryadjustedMULEstrictlyBroughtportionsRockorgan-izedcollectedordinarythoughtkeepinginvitationCountyNebraskasandwichre-strictedbusinessJanuarydressingrenderedcom-mitteeappointentirelyentitleddecsionsletthoughtspendi-ngschoonersbroughtrespectsfarminggrindersOQdis-trictsNebraskaceY-ainlyrenderedattentionnothingstatingappontbusinessintendedcabbagedandruffthimblesPreviousallrighttoLetjallydistrictsaffida-vitscountryentirelydistrictsconvictscleansedextendedUULiardsystemsoverseer-toprairiesteamstersHoustonExpressshakingalldistrictsreferredObeyedbusinessdahta1nmakingDistrictentirelyprairiesDandruffallegedSouthernwhackersfashionedattentionhundreddandruffenginesdandruffnterestsbridgesrelativeFlalniraendifferentattorneybaldnessgeneralchangeunjust-islawyersengine-is4foremancountiesdandruffcollectedagainstdis-trictsopiniondrop-persbridgeinspectmembersshould-beimpliedlookingapplicaagainstdirects-ofbusinessopinionappoimtobligedSimplyemployequallybusinessmentionadvise-inIooKintend-edcountrycountiesUVURTIAUregularFallinglevyingmethodsdifferentstoppedanjmalshun-dredsrenderedgovernoradmiredextendedWesternclaimedminutescookingSectionsobtainedbestoppedbusinessinterestwestarupjredNecklacesbusinessbusinessendorseforwardgeneralpresentENGINEwithoutallowedwhich-we141906satisfiedhavingLOUISdandruffTampamigrationbebealwayscountrylH-iAnotherdistrictsep-arategeneralpouringexpensesexpensespresentcoverngwhetheralwaysconvictsAtchisonthoughttoshowstructedorderedsupportgovernormemberaffidavitCountyspecialservicessectionsouramountswbackerIreceiv-edamountsnoticedshowetstatingminutesskinnersgeneralReasonsincurredspecalJournalallowedfaithfulturnipsoverseersampleluringpreventAnotherandpressurerwtpresentFinishingDRAUGHTreferredrequestJohnsonrailroaddis-trIctsMissourispecialtwentyamountsaganstrailroadfallinghistoryhundredholdingTheresbusinessentitledrequestcountyTHfTCBmemberfurnishUrbanapublicourRibbonenginetinctionDistrictformerclearlyEditorialPOintsFingerpayingpassedsystemenoughgofinancesamountsibddgehavingamountsBOARDFugatedoubtfulattackedThere-areentitledgotWentrtemotinterestrelationpurposeprivateClothesanotheroverseerMis-souriexpensesclearlyadvisedSectionset-tlingbelievebridgedevicesduragamountResidencecounties11dlscomcommiswithoutskmeraser-vicesOBrenfriendsstow-ingfinanceskinnercountylocatedFlavorPRANKhumblecountypoolersfoughtourcountycountyprairiecrushersspecialAmongPalafoxbelievecountyfinancesev-entiescountyodorlessnterestduringanimalsneededBrooksauditorprairiebridgetraveledofUnteddollarshasservicealroaspecialenoughamountguestsorderedbridgefarmersenactedVanillaSectioncenter-ofconviotdevicesofofMendscountyclothesofPalafoxfamilyBusinessoftwopublicjusticeFrenchpassedseveralentitlededitorialdrafteddoubleJosephshapesdistrictof1FfingersofdistrictFloridaformerpartlycountyexpensefollowslaggedcountyextractRourkecarriedsavingofofstridesJournaldlfiicultbackedsettledofpeiormrepairduringshouldsalaryshouldcoveredamountreunioninmypublicvarioustellingtoastersLemonbarbersresultsconvictshaversmakessubmitPensacolabelievefurtherWestonamountthedollarsrail-waycarriedscissorsresultsofformerfollowsoverseerHairsworkedTongaflnanceeitherdstrictmillionseveralFloralaseveralKansasslightbeingexperifittingATLANTAbringcountyPaciflcsalarypotatomokesbeingBayouamountreunionrepcrtdubbedKansasregretvisitorpointsfryingshouldgivingseveralsheltersalmondSUITSdollarsignoreLeaventakingutensilsannUmhonestshouldpartlyCausedSettlersskinnermooyrepairelectedserviceservicevariouseasternforformereitherMobileclothesincustomIndiansdollarsdollarsdolarscltrensstylsstheLeavenoverseersalarythingsMobilepnbllcdollarsKansRsformerreads-inbeingcustomoverseerKansaskitchenboardsmatteroverseerformercausedinvisibleRightseepopularScotchdollarsdollarscuttersIalongdollarbeingboardspointsshouldinresultsPrairielumberweindirectt-FfingerresultsbenefitcouldKitchenexceedscrap-ersbasedceasedPalafoxfortwelvedoingmattermatterappeararoundpointshome-APAGERedseejustlyserviceseesixteenbetterWikhmakerMiltonstartedapplyridgethingsIm-ilardollarsLeavenBoardbehindclothesbeingThesepliasedesertsnightrapidbringbeingapplywouldothersclauseothersForbesknownengageuignat-ThesegoingaboutproudAmateurstwelvefabricscommonappearholdersmoneyresultsnightapplyWhatstonersOBrienWhenwhichbetterwhichtrnlnewhichthereboilersnightwhichmoneyTheySavinffStatesoutlinecOun-tyrecordscribeduringwouldboardsPacificsettledconsistGraduateWhenKan-sasmenprocessreasonsattenduniustRozierwhichwbereboilerswhichcerksknowsactionnvgntprofitTexasshallBardsclerksofficialFrankotherBoardfancyphott3phonewhichwhchbeforeBEENresultvisorsattendRoomsLwhichwhichtheseCkiinsresulttheirsagentletterIfreturnwhereBoardwhenproperwhichdutiesgoodgardsgreatalongboardbeingcheeseborderspendwhichwOitehbe-causesincedrovegreatotherpropersuitstwentwhichboardofficalrightclheralonedutiesfairerwouldwhichboardGadsdenLewisFlaPhaseproofwhichcalledwhichwhichwhichwhichboardPionthesereturndoubtruffianRings45000whichpontthreegraftordusbetterTheyJonesboardrigFtogoingbeforeLewisstreetlifterstheireightgreatthinsbypartsthinkplanearlyaboutwhichTexarrightdrawnSupplieinsistDiamondboardpartythosetohandsmadelargedaysboardwhitetW3swhichanTheykeeplegalearlyTonsensense-itvisit-Rworthunderrightal-lowplaintorightearlywordswherewith-anthreeThereUnionusefulSapsgoodrightearlyWHYboardotherstotograftorangeotheracrossboardwholeotherunderunderunderwhichmakeworldagentboardcor-ralsoftenmilesotherafterSouthmulewhichtaksnunderhavaagedearlysnipslargeeffectalarmsuit-edtakenEtatonwhichDeIShallsuitsmoneyglectroadstheseanonroadsboardaddedafterGermwhichflowertheyeffectbasedboardcouldtoallUdeI2sIIlegalglassworthtomakeboardtripswhipfreshknowcouldGatherstoryleavethoseroadsmakestandwhiplegalwaVothertfonkworthwhencouldcoun-typowerteamstpttainunderteamsdeepeveryfiftiescoursetheirwashrtehtdifferbearsgoodwhipisstockwhichroadstheydayslargestatesworkboardallowboardunionthinkallowreasonotheruspaidmulesgoodmanycoverrePortNwoftenfact-itwhenmanytrpsmaketoroadsletterthinkfieldsmanycoun-tykncwjiosietheytheythemclaimeverytraderoadseudidaysFirstworkworksuitslaborexcesscouldcouldonlyknowitroutemeansdutysuilUMichtheirwhenleavesouthpaidPalafoxreasonpastwhentook-atheyroadsroadspayerhavilawsforcetownsfullythesethesetherethesecouldCaptannumactedLouisreachJunetheirtheyknowtheirthatworkbasisreachhereonlydutydutytheiritcourtnortheverytheirsaleCoOfficeingsventforyearsRoaddropthesemanyThtthesemanyyearsroadssuitsdonesuitsworklaborbackt1eventheirdoescentstheseofficeaidedAfterorderin-sistyearsaboutbuildplanpaidtheirthesetheirfrompaidhighforcecircleworkonlytheypaidroadsTHEthemhavehaveCouuworkworkbeinssuladcitiespaidwhileihaxemanypaidgivethemthemfromThislittlepaidpaideverydrawthemhavewentafterworkmileshavebeenhereeachetaryasThosforceafterworkthesetheresuitsreasongivelongdayshopefiftydiemstatethemknifetheseThatworkVnionhavebeensuitshaeworkshalltheseloadswhenwasliyearsbeenlawstricttheehavethorgermoutfitpaidroadroadbuiltthembackthemdruffhavehavethesethosepaidhavebeenotherfloorsthatwithhavepadpridegoodthesethesethereodorsmostcityposiwithpaidpartdiembeninferthatroadshallJewelerthatafterworkworkteamdrewboonFboththatdropafterhavegermstateaslittlethanfromwhiteThatyearsbeenpartofkillsfiftythenafterstopTatSfromYourzLlawsthangermOnlyPhoneNewpartstopAugfromsendNowYorkAHasthavemulewithbeenpaidtimeFORhavehavedresshavejarsroadlawshaveFLAlongyourfrombullmuleaswithbeenheadpartTubbonlyworkworkthanfromtimefromtheircitymopstherepotsAugwalkhardofbeneBluewithsuchencetheirsonieattorthatbeensuLtssteelyourAlsoJBwhywithOftenhaveriverPostroadbeenbeeneachbeenbeenhaveformdealyearbeenuntildaysuitsriverdoesroadhairmulestatesameneverwishsuchcitesyearmuleNotteamwithareausedtimenevermayfromhavenoxiewellwaslateJustkillseachtipsholdacrossneverofcityverywithusdsuchhavewesthaveteamwestroadeachlanddoeseaoheachsuchdaysthatthat1905haveThisdaythatthattimedaythatthatfromfromsomeholdroadbillsthatdayhairWthtimeroadwithpartwerewithThisyourmorerenewFlabestsaidolivetrotninehereyearlawsverywithwIthactsSINCEThe18951895thatthatrandsportwellwhothatcashwestfrombyfirsthairsaystimetimosevanridefieldhavedonerestsroadtimethatcityThenextsaidthatroadsuchroadpanssionherodayyourfromftwereSALE1500well1905lookroadthanthisgonedoesthatthatmeansamenameroadcakefruitNewsaidsaMneces1500withthat18961897bllstookbeenthattownlawsideabestthatyour1901thatday1899sutierdayItwearventveryrsadthattimeroadyearwithsaid18951895bills1902that1899whoithat1896thatLawlha1905kneeyourcovererrorTimethatbafwhotfrisTheOFweremonesuchwillthisyourmaycitybestthatthatcocrsiiuhsaidcause190518991899thatcomewhothatCarldayfarewhowillthisyearyearsaysyourtimealsothatthatthatthatabletreattrithatthat1895thatThethatcrewthatheldcomeTheTheTheopensaysamiwiththatDECaptingclipthatyearthatdealwhoThethat1901whosaIdactsthatthatLawthatmorethatthatThesaidsaryvisitlesswerethat1895llthIdaywellwillwhotheethatthatthiscitylastthisthatthatlarsUsethatthisveryItcalllawforethatwilldayThethatWithHk3thisthiswithwillmaywerewillthatthehimcfflcethissaIdseenfirstKanfindthiswhothatsaidlikeThethisThethiscameintogetninethisKanpaydayemsthatandthiscallwillthissamethethethiswhoIForyout150daywaywerelawthis1neeasttactdressthisandverytwo9twoiand218entthseyeseyestheKanhimhadhadhmwInfirstsomedayandhadArethatandtwoTheweresomeaadsometioncausethatStreetlefttheandsnortwontthatthisJohnThesuithmandsaysmatThecomeandsomeandandsidandsuitThewaytegtheforfheandtheandhadnowJandandThewayandhadwhY1awaskmayeasethewillandandlawandwilltwoandandthevigwillandandfhasandtwothisandhadmentwerelawthisweresomethewithwithbadisanyandtheandselflawbutbigandandandandoverhadtrysottlastandJarthetherunsconf1youtheandandthiswillsizedidoverperhadtheandtwoandandfivepayandlastandandgetandlawandlawandandhad150lawlawandtwoandandwerethisandthegettheduebutintohasthewerenrFlaandlawandandandantiandthefiveyouandanyandforthewayuchforgotandandandandbullandlawpieDRandanyneyandthethetwoandandthethethenotthemantheforputTheandfivebutleftlawlawlawandandtoldnottheandandandandandandandandandandlateandjbyandandPhonedanlessandandandmanforcasehasthethebutthethetentheperthehaslawhadanyaskcallthethetheandandandandandandtindandandandandandandandthet1overnowanyandandandandcornwasthebutthethethenotthethethehastheandlawhasETClawnotandlawandself114byymandyouandnewyouwasthebutthethethethethethathenotmanbelltheyouthenotoxenthethebutpayarehadandlineUpandyouandnotthenotthethefcllnthetheoncethethethethethenothasoutlawlawthebutANDthefelttieandtcessICanyousayyouOlliceanythethethethethenotthethethethethebutthethethewasthethethethethethesaytheOldhastheforyouthenotforwaspay1870foranyALLthenotbyperthethetheprebutthethethedidtheoutthefortheperthewitbyovcrsaymarKodakanyMsasowntheforthepayoursthethe121lOcthethetiiethe200forthethethethethenotbutthethebutthedidwonperoutdidthenotfortcomthehisthenotnotthethisyouprethebynowwasthethethethethethetheforthethethethethethetheperthepercuttheperperoutthetheBrentanyandthethenownewfarwagt-Allthetheth3thehisthethenottheITStheherfortheforperperonforthethethethefornotAsPOPsayperperwasowneggbysayBldgcornwaswasiHethetheforforthethedidtheNothehotthewasnotmythethethefordidthethetheourtJenhisperpersayforwasthebutperwasllytheforthethethetheyouredforctbthethethethetheBYwaswasonedolhisforfornotpertheactnewnowperwaswaswaswasbywasforthethetaxbyOFfordidthethetheforfornotpeawasmentheHehisforforoutforhisoldthethewaswaswaswashisnowwasbyTohisthetheoutdidthethebutpetdishsforbyforforteroutoutonewasforthethenotwasbybyourforforforthethethewasforforforbyHeforforwasbyusemantaxMooldthetheVeNovizhiswasbyouronewasbybyBEfortheoldnetMoMrMrforfortfNoToNoOldfI-cmynottenoutonediswaswasIiSt5114nlbyfortheantiforforforoldforwasbebybyrofsixbyallyoubybyEtcAswaswasoldforoldbywasbybybybybyEdAsbybyIihisbyhisforIngareforetchisusemybyTObyoneourbeiAswcanoutSiaavonbybeITfhisourcanforDrtheimDrwasfor1areisforseeCoJItheallletsexarefOrourcanSt679heGasecCoallimtfourareONsucamonecancan37fviMTodoaneoutIceareinbeheNoareAsofheitsWfitizesAsicty7are1theheoneareareandbelyarebwdoWidofallbebeheonuseofareupwefittoheearbeheCorbehecftbeheOfantojofareofallwebeTinanareinofupbebeofONoilofweheoftoofonupareInoftdInonToATbeIll1ododobebeheoilare38ofofofofofamoflitofofbaIlldeofitbetowewenreatIlltbeoftocfofATtintomaofleddowe36attoofofinofLhofofofweofIllInIrsof20wetotoofInedInofinFlaofgo38ofofofofofof21ofofboofofofto10ofofinontoofofRKofinJoofinintoIn438totoof31oftoinattoJnofofofofofofofatin21inatofofatofWisintoStinofofIntoininMatIninintoofof22InofatintocfatattooftoinatofoftooftoofinattosrofininontoIninistotoofoftotoofonItforoftointoStfattoofatonj-ttoofnotoatatofasloBthinininintooftotoInIHtointhtoinintototoofintoonnotoasattotoofasattoofoftieinorinItoininMtoinininInintonototoinonasontoantototoonnototoofoftooforononoxinintoinintototoinInustotoIntoofintoantototoanDtoor=ofItisdtIn30toainIn6toIfinIntototototoinInontotototototoinasortotototoiIfisisinisIsooxStIninininonMmgusananinastototoastoasnnorasInisisnoororAoritInitortosousasastoasisisj-tterisititisisifIsorifanasastoasasasorasisasusasitisisassoasasriEitso12ttasueasassoassoasasatasnsnsARInititItjisofisisitLisisisasifisHasisTMlastoititifitasasIsIfitititititititsoit7itJifisitPIsEintoEBisAonitIsreFoftoA+Ws7ettoIstojJ0DiJnASJAjAEAisitJCtt13Yo1Ia88jI9aa1caattaSTIdIIfaI4If113aaaaaII4IyaaaaaaaatoiI4taaaaaaaa1aanaIaIfutnaaitrIibIa1aSIaaafII1aaaa=IfIIfIt13fIIIlIJIIIIIIIIIsjIS1IrlnJIilIQIifii114IntJJI1lIlII1uIRIIlotjjIft1iw1fLrrafIiDJi=iijj11jL¬¬I44r¬<44¬¬>¬¬¬¬¬¬¬¬j¬S¬¬A44¬¬¬¬¬¬¬¬¬¬¬¬¬¬4J¬¬4¬¬¬¬I¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬I¬¬¬S¬¬¬¬¬¬¬I



PAGE 1

11WaitAdQUfflLgalINTERESTINGilSBHILHJACSONc-OUNTYBROARDBEARDfISHERMENGITSeptem-berPOLITICIANS584O-dJournalsIntendenciaWHOLESALEWfnmNGATRevolution-istsUUNDREDSINJUREDATiRS1ORGANIZERrowMANYDeLunaLISTENEESTENSLAND-INNiRfl-OFSERMONBEHELDOUTINGCornerCEMETERYBRYANTRIALCh-argedCAPITALWll50NOfficeDEBATEMONEYexecuti-veTEMPERATUREStreetNewMASSHEARDSAPfMOREPARTYTheAfterno-onCRMONYRETURNr11I-ILNFORTOMORROWthi-sINSPECTINGflISand1i1WORKMENFISHMAYTEXMILLIONSPennsylvania-TrainROADfURtheDefaultingDEGREESeOF-WHITEEASTCATCHERDiscriminatingMARKETREPLIESSERVICEQUILlDEMANDONTele-graphersBRYAN-ByTHEVoluntarilyWednesdayNAMEDARRANGEMENTSBYTOCarpentersGNATSCommencedCENTSiBEARDofExpressesConventionLOCALConfidenciDemocraticUnboundedASGendarmesSnappersOriginallyOF15lfanysanguinStevedores15DemocraticPinsacelaPolicemenIsnowcausfngIPRAilS-IPCOSEVELTStrugglePatrolmenTreatmentPENSACOLAMethodistgnatwerefitR4CEatCelebratedMeetingWtwentsevenlashefPresidentCOMMISSIONERS1IWIOfcNlNGAgainstMondayRemovedSpringsTHURSDAYisWOUfEDATFishingINVESTIGATIONaccpmpishedAttentedAugustServicesDOGSoldiersowingtothetoommfissiionersiFORblueI-mmediatelyInHimREPUBLICANSHorribleFLORIDADEPARTMENTRESOLUTIONrRESIGNATIONFORUNIONCASEYoungContemdiscriminatingCents-TheComparativelyTilLstatesmanshipCommitteemanOBSTRUCTIONSlenbockfermerEXPRESSEDMilwaukeeWomanTROOPERSthemselvesPilingMotherplatedcongregationRevivalJoinersgovernorshipBrideadministrationtemperatureNight-ABayouHaysYoungcommissionersorganizationPOSTOFFICE-EIMME-DIATELYaccompaniedParentsIN-MEDIATELYmemborsrhiptelegrapherstemperatureparticipatedFrenchrevolutionistsLadiesobstructingcavalarymenOFFICIAL-TheaccompaniedaccompaniediRVaoeveltsapplicationsPRESIDENCYDEPARTEDDIS-CHARGEDdischargingTREATMENTconspiratorsIPASlSllNiSKUPFRIANSBirminghamAUGUSTcommis-sionersmembershipprostrationtemperatureNightNightImmediatelyARRANGE-TOopportunitypreliminaryappointmentC-5oulationWilsonIwadebutillnessPenn-sylvaniatelegraphedJendeavoringJournalsscanningprobableWashingtonPENSACOLAdispatcherswithdrawnAPPOINT-EDBeachassociationndignatonlayThePedestriansNominationsattractivelyWEATHERconditiondepartmentThosevegetationvoluntarilyresignationIPtRIOiBABLYFortunatelyCOMPLETEDPetersburgdepartmentRepudiatedJacksonvillestrugglingDIRECTORSnominatingEXTENSIVEAinterestingFirmsBoarddemandingBELONGEDconfiscatedConfidenceGUARDSUnioninterestingexperiencerepudiatedvegetationiGOVERNORfrightenedChicagoinspectonRE-PUDIATEHomeLewisdischargeThursdcyProvidencecontainingCONDITIONAssociationauthoritiesOrganizerTODAY-Bywherej-oeseCarpentersVonsoni-JllnsscompletedepositingdischargedBARRACKSResolutionsguardsmenBoysHeretofore15IntenseconvenientINNOCENTpatriotismstrugglingRaiseSmirnof-fverUnboundeddescribingpatrolmenOperatorsHORRIBLEBROiWARDYesterdayimprovingInspectionKupfrlansExperiencegendarmesPlacepolicemengendarmesRoutemechanical15MessrsprinciplesdeparturereturningreelectingDownSECTIONSRECEIVEROFTallahasseedefaultingreceivingespecially81-Itrecsauthorirtyheroicallyceremony-ThePriceREMOVEDgatheringRoosevelt-ElyesterdaiPensacolaemployedTwentiethOrganizerconstructedexpectingLittlespendingpowerfulcomposedpresidentAssociatedmeeting-beWEDDINGninsteredCommitteeREGULAR86democraticSoonconventionemployesPensacolaARRIVEDorganizedacceptingnomina-tionCompanySOLDIERSmaximuminspectorsAssociateden-counteredA-1flhitngsreaffirm-ingBrideMOPensacolaStevedorespostotllceyesterdayAssociatedconventionHiOffheinzeST9shviHeInfanTOanythingPensacolaAssociateddemo-craticTOinfantryPensacolaleutenanWHIPPEDcommanderLouisvilleImpressedWhenevercourtyardInspectorOFNOTIFIEDBankcatamountMethodistyesterdaySeentravelingPittstnirgprevailedfishermenconnectionyester-dayMihWaukeefiringTimeemployedPensacolaassembleddrivewaycontractingwoundingAssociatedenjoyingconductedHaveaiotMvlleatchingcheeringmarriagemeetingsPittsburgstatementaddressedChevalierBE-CAUSEpostofficoMethodistappearancesucceededafterwardscommitteespendingregularlyPensacolaPensacolashrub-beryCLAIMEDwholesaleprobablyTakePensacolaFrederickSPECTORbring-ingsquadronPensaooteCommendreachingauthorityarrangedresolutionsucceededstatementrailroadunanimousCompanycontinuedtelegramreveringfishermenassistingLOOKINGCON-VICTpossiblein-terestingJenningsbayonetsGibbonsfishermenShotcelebratedREMARKPensacolaprobablyDECDEIPensacolademocracyplatformAlthoughCityoperatorPRESS-ByotherwisethoroughholdingcemeterjconfirmedLOD2-Lodzpolice-menfa-vorablemorningim-jcssibleHerepreparedtreatmentnterferedbathingPRESENTsquadronweddingpublicanVACANTweighedcountyscapturedlaceratedthoughtprominentTennesseeDeVillierarrivingMcDavidexpectedNashvilleStenslandmonthsbuildinglightersTINUEDrainmumthereladrainagePRICEquestionWithTallahasseeStenslandWS-Siteredtelegramdisposedcaptur-ingCenturypassingChicagoSPECIALseventeenpersonalSpringsattentiontonightWlUnotStenslandPensacolaengineerJNATEDloorwayseemngdwellingpossiblybuildingSERVICEMANDEDThereforeventureauspicesChcagoremarkedsupportbroughtarrangedlaobringexcellent15Paulav-erageBECOMEchargemeantimeobstaclesMAKING15TherepeatedtomorrowdrainagechairmanexcuslonsmeetingceremonybuildingommltteeINCLUDirepairedreceivesconditionattorneyeveningyes-terdayWhopromiseGovernorMariannaaleasurespositionGulfcountysinfantryholdingVreelandhorriblychargedsnappersworkmensettlingsud-denlymarriageexcellentthoughtthroughthoughtcommenddelivererSmirnoff1TllaboringlaboringusuallyChicagoBEATEYumbersNationalnecessaryprfcnredPerdidoto-getheramountshousesoccurredthousandcompanyKILLEDportionFloridasInterrestGovernorhearingdiscoursecommandganlngbathingLasttathe-siDailyRailroadsupportascertainclothingplentyincreasepoundedquicklypresentMondaysectionsneedlesshowevergeneralgrabberLastcominggovernorPros-pectNa-tionalBrowardgettingwoundedgrown-InSmirnoffbathinggettingbuildingregardsetbeenengagedTrinitymeetingcandidatemeetingprogressprivateConiesCOUPLEFRIENDdegreestemptedceremonyLickWillagainstdegreessteppedtalkingdegreesReportsChicagothisgovernormakingEVENTSgoernorwadingconflictsCOURTbathingegularun-dertowconvictsdirectionIPerdidoOFFICEgeneralovercomehouses-ofattendantswUlbeaccountshearinghas-tenedshortlyre-centlydelightex-cellentpresentwesternMitchellkillingweighsdirectorsreceivedSeaboanextendedadopt-edpresentportionpresenceBasqueGasqueTODAYprintedSoldiersWarriorceme-teryconvertscomingNevskyemploysurgeonsgovernorlingfooting15The16Theun-loadedtestifiedjeeringSullivanbusinessbusinesscompanyC0UntryWatts-WJacksondecidedWitaoutweatherTAKENMillionshun-dredgettingsubjectwhetherexpectsCasquegovernorremovedbarrackssubjectSmirnoffgovern-orelectionPaisleychargesportionlaulingwoundedHallReceiverdesirousSewanecstatingcatchescriti-cismJdhneonventuredGasquereachedWarsawminutesindulgeholdingTroopstroubledWilliamreceivermembergovernorconeedrunningpopularpursuedvacationparentsShortlySullivandepartrailroadnotic-IngJacksonfollowedGasquerailroadbetweenFridayvostofllcehavingpatrolsResignthick-estTEXASbecauseduringangersmate-rialwingcatchesTRACKmassacresbetweenattend-eddestinedcapitalspecialcompanygovernorpopularsaiiingcaughtCommisvariablefiguresWEEKSpresentvolleyscatchersafter-noonaddressnsbngcontinuebe-tweennotifiedtrimmedfortheaspireslocationdeclinesCAUSEduringcommenceEmmettexpectsPalafoxinflictedthickerSenatorBryansandteacherdemandfinishedwheeledcompanysolidlyWbayousre-movedbetweenLifeipoleonHolmerwitnessandswollenchargeanxousPerdidoumberJacksonattende-eFIENSAfamiliesanotherhastlyniietlyconvictadditionandhopngguardsFridayShowers15AuASKEDtive1YremainBeaterbecomef-InFrenchanotheranothergravelmys-teryhIpssermonspartiesvesselsffltolmervesselsconvicWHOaddressnumberplentyhighlyhappyandguardsaskingDrivingdifficultinterestwitnessbridgepoundpublicWHICHgladescountyduringPerdidoanotherstatinscautionwoundspoundalwaysmintedMayorINobjectmodishSharittchargehimselfwhenceJournalresignSpecialcountyWilsonsaying1906contactFridayrainfalldistricttakinghigherfamilyalmostbecauseCLOSEthein-creasecatcherwhererainfallclasseslAWAYAvenueHolmerrevival1906revivalNORTHcountylayingcertainchargerivingpo-sitionad-dressseveralracingtodaymatterna-tionalfriendsWilsoncontactthingssiturfofficersduringcon-tactUnitedJournalbeganevidentWILLBryanchurchplacesfriendshornedcountylongerAvenueservicewickedDaileyofficers8fifvtshouldirenOonjoinedrecordscaughtBLOOCpeopleBarneycountyabout-tovacancyAGAINtheaniontodayremainFloridabecomeseemedaccountnoticedburdenserviceGasruead-vanceowtngwhichseveralfurthercreatedvolleyHAVEbeingthetodayBryanpolicearoundappearsPoageowingwickedWilsonreceiveescapealmostpilingCITY-IMobilesharkpolicepolicetheknivestroopsthethirtycountytodayHOPEstationpoundButlerchurchMattlesummerclassesbeingwhichRogerCareyialarespalmslongerlaunchJoinerspilngpassedcaringbottomButterinvitedfinallyremainscalescitizenSuarezgnatsofficersMolinomarketbringsManyBayouSpraybrokenGardenJudgeTHATDallasofficialButlerSheriffknowncannotofficerwhCchdebatespokeMessrsseveralpersonsbegununionsMANYunableWEREwherebeforehopessettledstreetsdebateyardswhichUNTILTHEYfriendtoolinchesIntendbayourefinedArthurbeginami-MrprettyIndbulletsthrownjossiblpricewheredelaychosenpartybeingwhipstodayfifteenturnedstonertrackeadaygnatsMaudeFROMALSOweabhyoungaffairsSOMEalongcountservlce164ATHATMADEmost-lylaunchwatersbadlynightwoulddoingBranothersaffairsMOVEwhichtacklewhipsrloatiGOdsbeingBANKwhichSpecialhousetomoitroopsHAPPYweekswhitepapersnightHAVEbeforeshouldnightwhichreadymoneySnarestryeachmealspriceLittlepartyassetmovedWEREbeforeacttonStatesCAMPnamedreportWILLcom-monWolfetinuesamongWbMeweeks12badgeloversManyladiesTheyANDbe-comemouthWIREgoingreplycountsgoodmoneyripactionvacantreturnThereWhilemonthsportPESTalfraMreplywhichladiesAugmoneytakenwhichdrivenmixedwhichBeardwhichEDfoundtodatodaytodaypricepartyraisedWILLVinsonstatedwhereforforwhichsportDATEreplyfirstUPONyoungPARKreturnreturncountSncenamedLewisTexasOlsenwhichwouldforcedbyBypointjlrlsUnderBEINThosewhichmayorWil-sonunderfifteenTheynightlightagainyoungTexasearlyunderBeardeffectnightmuchOVERwhichIbnkLyonVISITwhereWILLlargeWILLsev-eralreturnbe-heldwhichlatterSheriffreplybeachiectednightTheynaturerightaboutthemyoungWhilecrowdbrutalcrowdWILLBeardswarmsotherwheelBeardwouldBeardVOLgirlsmayorhourslargewherePensathornsquitemayorladleskilledUnioncentsthesebygulfheardwhereBeardTheLewisSinceaskedearlylargetheyAmosThereBEENreturnunderreasonsdoubtOlsenTheyrightPressrowdBeardwhatGreyUIportweekdealsBadyBeardpartyportsunionblackfoundhughaboutuniontheygo-ing0rlargelargefflhedetailmayorgoodboardheardmuchtheyHaysyoungsmallwhileorganyoungwouldhouseassisttakenwiredletterbridestakenhopetripsOscathereoungrometheyTRIPmuchmerrytriedeverybombkenweekEASTboardTrustprovecentsser-monWofyoungstreethomewiseraboutabouttherheirwhenmadetrackHlatteraboutManywith-aheardshorevisitsgoodparkthicktherecouldpestSinceWARswimdownGIVEstrawmakeBaytreesthere196deep20centsmerestlaborwhenTHISwaterthosePresspaidmadeBankgoodBeraisecdedtheirthetrackdecortendscouldStatecouldlightPheymadeFrommuchaffairleaveleavemuchOaptwentcouldwhatbankswimcoulddaysTOURpartyhavetheyentermadewhichouncetheygoodcrackclosestatethirdAugscaleifolkskilledBankthatcornerpastshortPressthreeotherCOLAonlymadebeadafterworkfweekrescuecouldWestdownmuchmadeofficecentspeacetheytheycamptakenCecilasideworkboysANDStatehereshowarrlvtrainMissotherfromstatethreebeenlittleGIRiLotherforcecouldVnsonyearsmanythembeenarelcourtStensbusywiththeirpestOfchiafterandfernsworkworkstoryhoursdaysmanytonstheirdesirafterstateTHEinterenterPasotheytheyhaveMENOLJckbeeninferwithparttheyNOWhavebackworkwokthatAugdownthatbillywithwhenentsAugtheytlClnAugPresstheirbridelittletheirMETstateBarncityGulfofficeAugpaidTenncamevoilecentdaysdaysdaysthanStateawayTHEtral-fmaxiFORANDchiefSaniemanymanyeverygivewavesBrowgivemiredontWinladywithstatehavehavemeetAugtheykeptwithdogscamptheyladytheywestlittletTYTHEfromleasttodalocalAugthatASKbackthemthenstayTHEBlisssuedwithformNOTtrainJohnANDfromItimebothThislocallOCAlclaydidothenweekbeenCONMissbackoadsbeenmanytripgoodcardsuponBarnwithtakesomet1flsAugbeennextJamesofferfromTitleLastfromforseepshaveladyKrthquityearsAugclosehavehereclayminiwthfiredtimemeetwithfleshmeotscorehavetheytheyroadwiththeyNOvhifhseekfiredbeenfromlocalweekwiretimefromthenremarthatAugMilethanfiJift-daydaysTheThetodabeenbeenpollonpollbeensakeRevsRANNOTtimetookPortgrowcitynextJTfouldBaytfadashardfromgramhavekindwithinchlasthe-adEnHkewthYorkseemTwobeenroadgavetripwithroadsaysJofthatwithwithcoverthatnetofwithHASthennextbeendateTwovisitvisitcityuponwMlthatofherefromroadbeenuponMile28thbluefourMileuponofthatmoredaywmtweregavenextwiththatMilePretimeroadtimesizemoreupon730someThewentsafethatsaidthatBaysevendateFORdogbothThethitwithherecityboysomeomeThewhoThethatHITheldthatwhopasttitleblueoccurTheverythatwellwhocityLeastFORroadwihwerewtthshotthatholdandheretookThefallsthatfishthatthatwillth1andwillAl-anTherakethatherethatThe230rosescameyearThesatlandthattakateastthatThebigMi-adgirlfleetbeenwithsensewithintowhonelsaidholdthatsameracescityTheribsLowdateTheintoquedwillasMrswhoextForsomethatwhoracessizeonceherWinthatwillcityturnrosesthatandTheofizedmoresurfANDthatTHotmewillwillwillaswillhimweresomesurfcooltalkwhoaskmillIdogweresomelinewillANDHonwhoThewhowho20thfirstwillveryyeartverehmintowillontentfirmisHondayonfishtenttooverTheThewadthaithethisbigraceshimwasup-onandandThehallputTheHonwithfishandtbsintosidewillandctrwilllkecolaTheTheTheMrsandIntoandcityInwereThetiltlastlandwillThethatThewhoandtheandwillcastfewlastworemenintothismorewillthewillatWewhorestfactWhothatwilwillhadandlatethiscomethewillhimandMrsandeasthimtoldwhowereflshandPOTandKeebesoonfishandwillandandIaswhoandlastandandwerefishtotheandthisTheandwillSonandandwillandandleenrentnewsonceandtionandandandhadandwillhadandandTheandandwerehastheandingwillrigsthegetandwillwilltiethewereandandnowForhastwoPerhadandthisXewwinbutandhadhasthehisandandanddirtthetoevenmenjobendandlasthimthebutoverthegetVicflsnilLsandleftandfindpieMrsandandandfewseenyetjobandandandhadnewandtwoandwerethethethetheforthethefishbutandlastthetheandlowlesandandandandandandandthetheperandandandandandandhasandwerecasesoonthelowIleftAlanotthethearethethetonherherlowlatethethemennoweverwillandandandlaisnowtwoColtheTeatithetheAlaAstthe5OOnowthehethewilltheardandandandhashadwillandandhadMy16andandtwothethethebesthetexttheIiJhoutthethethefewmenandthenotlasthasandttillseentwoandcaretheandthethethetitothethetheredthetheperthethehasthethenotoutinforthe1-flperbutthehasdueanymencasetheandetcW-JmenthethethfthethethetiiithetheandtheHEtheHEnutcablfethethethewassayhadandByonefacthethethetheandtheandandthethethebutthethethebutperthethethethefirehertheouthewasthefornowtoforthethethethethethethethethethethehasthethethethehasnotthethethooverthethebutthehisforUlnowbutcursmenwasItyIvasthethethethethethethethetheasCIthethethethethetheoutbuthethehaspeothethelIextwertheforgaywasnownowtheMrsthethethetheforthehistheandnettheATthethethathetheFlahisTOTOtheandforforforTOcutforonewasthegownforflJLrtnJWlBythethehethcforthehisATandthethethetheONrotummenthefarfortheuarIN4thecomperOFHethetheforBYleftTOthethethethethethothewtiwasBYnowwasthenothiscItythewaswasforMrthethotheforlidIXmythefortheMrhisNoarytheWIhisthetheBYilleOFTOAShisarewashis-forMrforregTinLwasforwaswasDEMrthetheBEMrforwarwaswasMrforhsforOFrcjhistheBYthe3wasterwasforeloforbyby3JjhiswastheMrfarforBYtheBYlorbyMrforforLLcolNaareofbywasareonethOforwasbyfortheBEhsMrBEhisbyforAswas3usbyseeheitssetMrtenMrMroneBEtheMrbyallonethe24bythtcotheforMrconrasareBtHecanseaallThtiiaigheHeMrillallheforbyar3sonareIallletfrlotAsarealliare33pfDrItsareMrarehebj1IFarebyhohebeheotbyaresecoffarecanallarebyareTheuparenaahedoarehebeIllheheheinseaaretoWhearetheallarehetheheboofarearebeofhebebeanofTCStTasofofbuofTCofbeonearebeinofINuphebeof78inbetoarebeadbewasit-rofofintoinofofofhebehewanuofofofrWofcyofIhtoofatgoofNoforofUoftoofoftotieofbeatbebeen-linofdftoin½ofofofotInbedebeofatatofoftoatofbebe1kwofofuteofofofofofofofIESil1atofofoftoofhtof8692indtofinofthofofinoftoofofofofof½ofItsfitatistowelyofofofoftoto76inof12atofofofin1oofatonfkoratattoofofofatofofatinintoattooftotonoIsistonoonSQnoanorintoatofatofof50toRCnoatoftoinintoinIntoonintoisintotoatincftooionontonotoofattoonanininInininintotointotoinIIntoo1totoinofananrfiontoithetoto1SInintoisaftotoRinonan6toininonononinasatattooforitata1onofononisisorInaininintoattoattoonsotoonexnoasoristoistototointotoanatto5itorontoisintotoasanananasastososoisisInisinasasinarasasQtototoDnno3sorisonasittoWinBittosoasatortoasisOisInAisofiniseasorfcr4viitCititisistoitItDasasisasasastoLrLrJuonsoisitisItMAisisisBisisifisitTas=itifIsoTitIfthitIasitIfTisitifAASerastoreanIieIm1fLittcA=laumEBOIsSPJfItIdIfJrfAAJxtt¬t<>IiIIjd¬4Ii1t-ItL1¬jttII<¬ijII¬IljiI¬J¬ti4j¬¬¬tJIII¬J¬¬<¬