Citation
The Pensacola journal.

Material Information

Title:
The Pensacola journal.
Added title page title:
Daily journal
Added title page title:
Pensacola news-journal
Place of Publication:
Pensacola, Fla.
Publisher:
Mayes & Co.
Mayes & Co.,
Publication Date:
Language:
English
Physical Description:
v. : ill.

Subjects

Subjects / Keywords:
Newspapers. -- Pensacola (Fla.)
Newspapers. -- Escambia County (Fla.)
Newspapers -- Florida ( LCSH )
Genre:
newspaper ( sobekcm )
newspaper ( marcgt )
Spatial Coverage:
United States -- Florida -- Escambia -- Pensacola
Coordinates:
30.433333 x -87.2

Notes

Abstract:
In March 1897, the Pensacola Journal was started as a weekly by William Marion Loftin. The Pensacola Journal became a daily in 1898. With competition from other Pensacola papers, the Journal's coverage included a large part of Florida. In 1922, the Pensacola Journal was purchased by John H. Perry, who in 1924 also acquired the newspaper's main rival, the Pensacola Evening News. For the next six decades, the Pensacola Journal continued to appear mornings and the Pensacola News evenings. Both newspapers remained extremely competitive. A combined Sunday edition published as the Pensacola News Journal also became available. A consolidated newspaper, also known as the Pensacola News Journal, began operations on June 3, 1985, and continues to the present. Pensacola is the seat of government for Escambia County, the westernmost city in the westernmost county of Florida. The city sits on Pensacola Bay, connecting to the Gulf of Mexico. Since the early colonial period, Pensacola has been an important naval port and economic center. By 1889, it was already one of Florida's four largest cities. The big news covered by the local Pensacola press in 1898 was the beginning of the Spanish-American War. The Gulf Coast port, like others in Florida, hosted forces bound for Cuba, among them troops under Teddy Roosevelt, who passed through Pensacola on his way to Cuba through Tampa. In the years following the war, the United States secured the peace in the Caribbean through naval patrols and maneuvers based out of Pensacola. In the early part of the 20th century, Pensacola experienced tremendous growth. The population doubled to nearly 23,000 between 1890 and 1910. A new Spanish Renaissance-style city hall was built in 1908. Two years later, the American National Bank building--at 10 stories, Pensacola's first skyscraper-- was completed. The same year marked the construction of the San Carlos Hotel and a wooden bridge across Bayou Texar. By 1912, Pensacola had 21 miles of paved streets, and the first modern hospital opened three years later. In 1916, the city began operating its first motorized fire truck, and by 1924 it had replaced all of its horse-drawn firefighting equipment. The Pensacola Journal covered the cycles of boom and bust that characterized the city in the years that followed, as well as the renewed growth after the Second World War.
General Note:
Description based on: Vol. 3, no. 147 (Nov. 29, 1900).
General Note:
Also available on microfilm from Bell & Howell, Micro Photo Division and the University of Florida.
General Note:
Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.
Funding:
Funded by NEH in support of the National Digital Newspaper Project (NDNP), NEH Award Number: PJ-50006-05
Funding:
Funded in part by the University of Florida, the Library Services and Technology Assistance granting program of Florida, the State Library and Archives of Florida, and other institutions and individuals.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
16280864 ( OCLC )
373755 ( ALEPH )

Downloads

This item has the following downloads:


Full Text








with
reaJers
Usc a







causE ..


*~-* ~
..~.-


~; -.~
- .7.


SgAm


. sp~
..


HO0ME ~~ 3A ww13






effortS M.tomantI5
limied Iav oftpbs

gn drivI
the acl Tha I~re d SefWAWOf fW&"wk'

a fortal wWsim
Only a~meI~' C'Aim
those the.elAlsar 4 -;y~h-
mitted tolow
sote *ouse f Ma bsan M.e
Mouth. b-tnt a *nri the pan
pob tueenog h
stream oftt, pes t lttle 0. e..wi ...
denaw S ftehvswuut
the, 4 eusst~iS~1M


-06.


... .... . -


A*e


in well..
The bodies of tef 4tif 't auB IIn
the waiting rooms e the tis tt sta-
tion. Where no reUWl v n*0a**
ble, the Identiflft@oss o t* 5 4sd4
will be made by the doot i tfr*r
of the New York..
The bodies of the Aaaerltaa t vtl
are being embalmed for Iea pS"e
home.
E W. Seaten rallied smoewtu M
the day advanced and saftor eaultb,
tion with the doctors, thU ehaplaa of
the infirmary was allowed to -*yVW
to him the news o41 the deth of his
wife, ion and two d~tes& T.
heart-rendlng tdingae ovelaple theold
gentleman and a eries release fbl-
lowed, but rtetora*kte Waf tWo*5*
fully admini tered.
Replying to the sy thetle woado-
lences of the Am-eij-m eaeMn Mr.
Swalm, Mr. e fteLsl:. "I will try
to show you th at I at sjan, al-
though I have Wty I bIair."
The mayor ty, la repy to
big mesopa of = to (thAaiIs
lean ambassador. be eeafd the
following:
"Acknowledglg 3Wr ati, I
bastn to 'express t S)8t""1R my penmmest at b ie Jttien
people tar ti" a*
shown at flatl le
Sent to the ,i',niAw1h


train. P' ,,+ t l





Orders are ,le
Of the eig- Weie
ring leaders
The outbreak
to bad foot.
men have bms att. e
trouble is ma ,it ,.
,-^. i


SLAUG


'the bark DbMarwo


-absemee of a**&a
ait" l we'so lks awent. e.* -
'&kegit MW Ube ume IN goWnas
- Is -Lmat Aatdwo *wW kty *Sdloums
whI&hth e sam *- hr ua*-





foe" by tme pe~


be.d





wI..


pa40em


I. I aim 4w


. .. ..


out a ..ftw -





NO OiURIA" -M-








OF STATION At'
RISIAINs VSP A I
BE "ML A D.


I

A
3,


ml


ahr
,A .,w


4-IT


... *,4-
V


A,'


U&w


* U


-in~
goaft amb


- 1


- U...i 40a


M5 .* UiIg .a


- *1..
* ;.


-V .
I*


urn,

7~
pt-i


mm


rouct~


By Asa
Warsw, J-
&hat the ter
a Puehral sa*


-~ V.


I


~.A.4 ~
p. ~ -
~


,pV:


-a


esd 1. hi o- --49 le.th-eA~ W~


5~ o sp W"ur j"re- Sw mat mg -v"- tom
i ps~i ads the oft ~ t nw.- Lh
aof low-ow.02 M" eaha~~s t' ~-
N~hbW~~ intothe h.~, th L7doit m
-%FIRM ft AwlItheB-AB


-- b the. .bM&7Be w


am* leosw EW. *ore-. so~
i Ihe -~ ;w IL asB
heint- ~ ~ sakj bb w boad
miles.., thin w sestbsp oask
ity ws ~svy. i Web qusowaerO

'thjag estrusm. osiaihIeam.06.




~~Mre A. en Gom,


ITAE


"sif~a& hae


4
I..'-'


7- -.- : 7- T

wb .an t toVifwth S o he l~s
MD Jroewh a*A Ink 'UMI1IIhShi- at wortk al ot yeateird4h
Tatad F i "o~drole mug accomMlUZ e,
le v***Wedadfpin3eff in the loedftg-of phosphate in Sol"
,Qtd ~6byw Now Wof the ships Which have bus Idi). Mr.:`
several OWLs The arrival Wtoaf of
OR ER A sveew xaleting ot a fthe -4 te cempanya bigforc, bWt *eCs
Of 430anti IsiN m waS -these will act nearly supply ths'
tLII)UU EheldRlest nighit..Chairman Av meld.m te.ea.re nw a Iwar"e
TRIAL BGUN B a" ses A& terof Vessels at the wharves wf#
&vwg OWA. fai~ a"W40 b: oo e laded, and M&
SeattyvIlle, y-JY2-b-tilTemet a Wth W 4o hywl i h t*,Ol-
of, former Judge U I rm eeigtetxboshs a aeofrdn ilne-osuta
forme? heft ftOlllW* = teo sesoefas&n a asso e h b"tk 4 I
-we buMc hedargeoOf asainabtla;James B. prfmtsed the, boombs which were In Ape MoveerTafts.
A arun m begu = befteneat cnmd~qou.andwf hw aGeneral Agtt nberts, oft me W
JS,4ge Dorsy. OnsI JOab sdlmculty big IncrueIs the valuation at taxa- Tr~aift (0opaay, when spokm t e
w41exe In~in ecr"n Jry as ije Riot 4omba ~t bout the matter, said:
a eayavm aofall R *6-Siillible Tot property iab10et tO ttMMOM MNIW' h ere and more who are expected -soIS
-jury 412*. At P*5UW. Th"s "a ft hicreined not gigto interfere with
_*Oot$TIIO to cola lborers.The sm sam,.
sib" b. 'O'a me- took up the A.t at ofthe whole Matter Istoat w
bw' OfWi~ Sity eld48AABA%31LR matterat *dung the tax rate f1" the have been w*abe to got enough 3Wt
I*~b4S sMU IS yea. The school bftrd Mb M h DP or Mire to handle oar business. We 1,'-
"SQft- er v4Wiu Mo sVOW mum oafor Ua increase for"Sebo"Ipl Pl were ahort hand"d anm 0"89
M Ee. amte amout now ma"sed" M". demanded $2.40 Wdow. T
~~~~~7 Ir Pa" as he. li liIiD n sSf6ttto *a~d"t WO rate"to pay as 'We omd
thSrwof Uram- m-the schoolsespeeialy AS U5khT Mw ft esoghitaut btWe E 1=0W
."Nis I: to WeeJ my a"of ameswill fhave to be a if y.,~tedffrne u a P e
the qrd s.4h&Qf-aur Wge cottoftsehool board reulested thu .the rate f whlch thairefumed.,
~R'vrou tothe usm nu, *zrs atV 1iIa scoopurposes c an*i "W haveMa awtlsstinib,'
~~~smepIg yleova tblay tjs !a vd 40irsolkt 0 ON& au~~X e t eau w -Wlg to as h
A. ~ rojvjW fttart-f y lovedby the stae I:thsJouno JWJrsvrihe e ~
.4 ~ pi. tos~ ~nf~ o 1was cd n &Q. b Wdte ac. or s lewlpimt

aams C ad.I. b ocy MIStyeartTh4tax-" Oad vrios weagat es, to uk. Monir, .
AA.-__a -Ye .wit Its. ivf.W tht twasflos
booms I fCoal. bSciha*olt yarno..t.x.*.......7 millsagr e escitt a VMoeft. o
A&SoDm4=d and b"goeg fr widgtun... itIl&esed,to i.' We M" *I** is$ a sateh
soen Val Sk",~ g docks butff seed f.**1f' 3"0 to.
~an-i WOWS
ft". wit's ifti s It& a,. l400 elMAN
expedsbil iwkhW', VWj
formined budS01 th d.. T, ift .rIe'




.5. v ~l 40of ai ieShieriff learned Ofthi i-Tsmmafaa
:z~vfMRW b14 eastrees eb h byb
6hbwm A.,aM U00Ided*40 Il no-WW thinide
-lit so tilidt I M~ ek "d "tWest h
DOM":-4: -4 -As -L s y isaft tn but
bias Caued hi WOOL


M--D


iA~


c~.


,, -K A


11 1 .


1 t^. S-i-f


,-' + *


AA


._
I


L w


VIOL


,
















A-' .


~,i .ra*7~

S
Z 1:


.~ .~.-. 1.
p..- *'S*" *
* ~-rthL


.d a
,', ',. ;'
.JI,*'.'


P}ffjjT ~ A ~'
liii



::~


,,. .-2 ,
.. .


sted


II .
-a.-.
r a -


~R-w


AOL.


a-.'
f~.


^
i,
i
;
i
i
i
i


I,- .
7v", .


kii




l w AL. It


Flu .4A .'*

Of,... r

-a p


Of u


-L
WM*- *


bee.
~ uS ~


iibl bilaiiio


A. I


The Lmd~is arS.


1W'
/ *


-w bess
me* wIl~
I ~


~a.a~a


PB ~ U
A


V A T [ b


IWV


-~m~ IIFAG..~

AM-


I



, I .





i *>


.1

.4.
,-.t. A.


'SI


a*'.-. ^


-a -. ..a


a .
fpp
ee> Ia
I" ,


FILINw~j5t1 th W~s, lk aYot An-
goalrth A1 Oher S&
be b"14 1

~U~Ums _B_

4=. IbU~


I~ 'UW~ ~W
i~ b~


. **.1..


- 9k


Y ~
- a'
I', .~.i.4
1% -

~
ba ~a.


S.


tat us 8 4 .tn, where l.
M. Davis t and Paul Pe-
te's Peters, his wife,
areO sell at public
.Mtr ..F p uty court hiuse
4 L Jall Paaensacola, in said
MF eet and best b d-
. SW | Rt e 6th day of Au-
3UB^A'A a*N during the legal
S following described
lying and being In
afeambia. Mtau of
SLot 81ixty-three (63)
iaon of Lots No.
(8), Four (4), Five
(M), il Sectio (5) FiO.r
STwo Gonth Ra e (30)
P blo Palmes Tract at
with the tememenu.
l, Wnsemag or appertain na.
^I[ ie pY for 4 dd. Geo. T.
JeuIaI MasteAr In Chancery.

: lPam ttm. lHDepartment
:V the J|r Lsa4 OMke at Gaines.
0U.. fe.,1 J t ,. 1906. Notice is
a e? ithat be follolng naam-
t-JlS' M*s M lied acties of his intPn-
i I S Ill t r t O &l support of
d No wsad that aeld proof will be
COhtIr CirMtt Court at
Pe., OB A-g. 2, 1906, viz:
Seer, ,-f Ne bomis, Ala.
B OU9. lbr: i9 of Section ,
* I -Il., U J.amea the fo!-
Pgve his con-
ts: James Hub-
SK H, Hubbird.
Allnk 1S eale, of No
o,. drdof Pensa.
; mu i | Q Register.

aibl.a..Departmeni
Oa 4 at Gfne3-
1968 Notice if
umiewla nam-
of his Inten-
i ha lI support of

at Pensaco's,
t, ber, Fla.
.~- A .! I).


jflw'-


'4-. ^


.-J
-a.


p,.^ ,
Vn" '"' 1


aJ'^^i


Il


V~~:
U
a~~~ ~


oo- .


.Co.
Pensac6la


** " r *









, S I ,



.1


-f


Jly is the,



That's why we arm
vacation. ale at tww.I,
give our Cen4aWs 411
tunfty to supply
a great red i a

FOR TH ULS&m
SUIT
20 per cent. of Oaall r aof ,
mer clothing. ,
15 per cenost .g afW -.I
mer underwent.
20 per coat, o o all 'tmU t
and soft hats.
10 per cent. off o tpuft"a .
These naft @rUlWy eh pihie,


OGCAR RA
STOCW A~q___
0 ---AA
12 CG IS





WA*.CweA UY-
Sm Gmd101-i



I Ap i~


K. WHIMIt
Waiampbp,U1m0dis mishk.m


Tersely Told


R .xluer bew reftrnesj hem

w.DU. al,. a" Vw, '.

t.wt 4a". WMN-I .D. C.
Camfde, wer nof the I"teors
from Deftatak, who weaf a the city
yesterday.
A party frtm M oiry cor
posed of A. G. Bal IL
bery, C. B. DsrW, A. D. 3erf
Lester C. 801 ft-, *:- btr

Arlaau o w^ uik. ,-th^
post office, Sa
leave of abMnee of *ft he spent at hs olliI I" bi eaii&
returned bhome yesterday atmoo. .
George BiruLstoa, a aep., utio
was arrested by 0oner SottsW Jd i
a dangerous ad upllou"s ha"GftT
In order to hOld hlI r the *ta
Rosa county ._tborls, wa ta7 I
back to that osit, Seiaday by the
sheriff.
Albert Moyer, at Mstos, bed of
the train of so tNow bow.tg his
name in the 6 WJta a 44 uity o
one of his rgieular n t tohe i a
store. Mr. Meyer is in* IeOse
With. the buatusnsi~l esd bd Ma1 a
ager Neuman, ail ... that t
store here Is oft of the t
ishing owned by h.,.
The fre 4A St t o" VOWe Ot
Yesterday aftn".A 6y a*
o'clock to the tweuyo ii
Ing at the ormr of 4
ragona stroeto, ekkdby Mary
Gilari. colored, wa awilW.M. To
roof had I4ate ftqm s9rt. at the
Are was o*agnthed il tt 1
damage. .
Willie DomBay, Ow bo to
Man of tae ms iil r e ltof
the Pensacola:
Co., has seIere
that compn 4 .
bile to make
bau accepted a b .t ..
the Mobile in*
Many friends have W %01
Pirture. S. .


Mobile
of 'fs..coaa,
bima ChrislaM
In the city Ov I
est of Christila
to the memb.t. *
nected with
Government il
churches,
thuslesm. A 3
organlse a
Plans are
convention ti o
went Street
April 19i to I
entire stat
of Floridal w i


*41


I,


A
~*--2
.C'* aA~


~> 2~t'
'A
'4
-.5
WI


CA...


yew 4 I..4
piston. ThA!




DeC. a ..
'SUL, 310*


I"


ley.
Ik.3


4 ]


. *. .. *


- ,


IROmt 'tut the. l1a

ic -seof



wles tS14S
41u;


Ol Chnreft
dressig bur"
Isis's blues.
able to hMa-
sohM be kwt to 41
Mao -e
am. 1 ae
abl& _^
A fit ,~^.*^ '^^m '''-


-U

ISEW$ ~


C-,


S


* .~I .I.$~C


A~f


F* >;**'' *'''


- S


* ...
A;


z il'-


I, .Cs- A a, 1PP1


* ~4't~3*. '~. *~IC -


a
*5 *-5.
.3 -~ *t
.5 *1 5,


...^ . ..<> ,* f o, *:
A


- A~'..~' C.

C ~. #'#. ,
-C '~q ~C~A
~4


- c-C


1.


' v0.~


J*4


-.- - - .--..... i. a. ..


.ST



the cal
".- -*'. '


'l" i(~a
w t.-. ..i...-


fine C'y Oat

tfeound apntaCre tha you had sme desire foew your
oAppo tyis aadenext tw6 weeks to com e tl
we VSe thNG be te the town. .,

S=^~pylLEPRICES ARCIRCOIJCCD 1*T.
THE OUUTY WILL 32 UUONANSCD AD THCRrWL. SE NOTHIUNB RESmt

t We i made pre nt for ample service to wait on you. We'll
bave iional t of ooinpetnt salespeople, and des every
e ImeIgut will be an easy matatter to see at
S~ YOU SAVE dwiag this greatest of sales where
; ^ L ,.4i^1. aui YfifPie&ASA


less


lTHE REGULAR PRICE. S'



THEN.. COME AND REAP THE BENEFITS:
^ : ^ .; ,:- ^


S IC .C -
I

p -
- ~C* -


S~PO~1)~ ~W~.a~i. a ~ .. per dow-1

1047R*~ pos.RtLKRUPLAIWMAR

a pow,-aw -
-now4 P*pe x

nlo*a ap#* dow~k
~w y waviywef Of t~~~tuiyto replenish





7. -:: plow ;.-
-Y -1l ca
b* "id-s o M


d~..- aat~ a.~~ ft a- T a d..a ~ -- a 1

at Or 1~*b
1-


- 7


fm WEI I sT UT ANEWUAHmBI AIN AN wMarn EGAM
ups and Saucers that were 75c per dozen, now -....57 per a
6-inch Plates that were 60c per dozen now----........4 p d
7-inch Plates that were 75c per dozen, now--------.e. per dm
6-inch Bakers that were 10c each, now.........--------...
8-inch Bakers that were 20c each, now-..-..-------fe eh
Covered Dishes that were 50c each, now-_.-- -.- -..e omeh
Pitcher and Bowls that were $1.00 each, now-......- 7e @o h


$ 3.50 Cut Glass Bowls for--------------------* 2.**
5.00 Cut Glass Bowls for---- --......-------- 9
8.& Cut Glass Bowls for-------... -.----------
10.00 Cut Glass Bowls for...-----...---...... .- -7.
15.0 Cut Glass Bowls for.......- ---- .. f.
2000 Cut Glass Bowls for.....------... --- ------ -------
25.0 CutOGlass Bowls for-- ....--.. ......---...-----........ 7
Cut Glass Nappies, Vases, Bon-Bons. all included in this sale.


$100.00 Haviland China Dinner Sets now.........a. KO5.p
7500 Haviland China Dinner Sets now....- ...----...... .7
S50.O Haviland China Dinner Sets now........... 7.
Every price set in the house, reduced in like proportion.
0.50 American Semi-PorcelainCSets 102 piece now. .


e sciy want to call youi attention to our t

SWe hould not have one et after the first
daim
MAR"s I


6. mod'but


-'I
sjwaA
h W~ in~ I
-I


IC'
1. ~
I-.-


W


0 ~ -
C -
- C -~5~:.'


O 4I*


* ~
CI
J'~ CVA~.
-.4.4.


kh fadsi


4k


**-- *- .- .--, *>


.?OR


M


1106


. e.


. ,<.l;.,*' -.-H.'


j -


*


-,-. I -X.


dLn


. "*


*
*t
- -


'* *' .:* 't *


-*&**' .
" f *'


. t \-r
. -,' *>.?'>













,~.-.- A~
9,


~LAlIxUiary

gb qindsm kwu et


b~Ecambia

-m - m '

feeJtfM^M ^er^fni er-w-ussTI


w~woe


R-~ ~USt ~


body *,blesWOWt
dt at amtde owb #056






.19 e44
0 seubp'ls v


a. ~-A popits

k .as49 thee ssIutr
~Ibel M. ~ Iagf 4hew
6, pltNwem umm.
w ee sm aiow Ithetb
1*.bej
ft*theAftd mgat g, bei



.*p at as wwbuegs to soo










mpi'i fievwsomg as


I~SO


,I-&i


**


'I.. *'
4


-F
~
~ ~4U.*d. ~4qp?
* WI2t 4t~ iiniib~i


th kes'h seveGOD
eve a f~ ees IbaI



SaL as~bh~a em40


~ JAM~~t


* WW-


iuminuinmu~swuuwu.u- I


-. *F.


-0
4


-7-*1~~Al
gift~mmaL6 A MA&
On


I-


I


!*


Excursion

~LA' WETHMIFgummyA
~U~L CLAMI No. ii.

Fr~ Mi m AteUon July6
*34 ommoioussteamer

The b* 4 wOiZv t 5 o clock, gp14
.4aotb.10 m btvlfg 8tallou ad
a lWWI I& fUu fr cars.
R~mmt.a* board.
IUN0 ThIPq 36CENT8L


-'t


it ww.


ve 19abw ht~towsi



heib

.... ....T h u .u i Umw A 9 0 1

4- --


~~~~~~~~~~~oo wmel,- ms f-'m~ wspat~t xaasu
~~ Dsinau- u~~
ABA.-' M-1 c AwO~
4p sir i 'mi. behi ~ and fgtoc
~ 1~ s6~ a~mS USItVOL..,

*_e "0A 7, 7 t c


1L.L,.


''t 19IsoWow% ~u'c



- k )out thalt Is the~
4ebtoqsy I=w E"
I. .,-L:

p. ~es~~eu~Vwowha


- ~
h....~ *4


p.F


baWO- U4


on arrfral of 3 o'lbki cr.
wilbe %"iv dbthe'HbgL .4 Jr.
At3~G o~osk~~npth~gs. # be.- b






"t 04d -Foam



Allwirn w ill t-16Uecaiewevhb. te

q ~p~stakia jpartwinning co.0 toreie
Iftnolin

S~ ~ ~~IIOl It .. UA~Jd~.


pcod raes mWaII ra I oed oarsW,
~7 7'


Q-: SIALE


if wa4


a.


Mo ~SOM it' dby p





alsoI o o ciuv*my*eit


'~p'p~v
-' 'I
*1.. M


- F'


',<-.4.


TO OAKLAND
to att-4 the
ANO REUNION AND

PIONIC


W~~I VY, JULY 4, 1906.
Oveas b Maawts Temple,. No. 4.
Rathbase mgllts. Ire for round
trip, 5. aMr Oolumbia w ll
leave tPalfKs ita at 7:30 o'clock


PHwiS'P"Wo fW CHURCKL


1Y4
H ill leave Pal-
a u. a return at 10
W at the Life Say-
l, run into the gulf.
ikat tsonable prices.
m; CHILDREN, 25
h IITS.


presing Club
mila and Pressing of
am ladies' Clothin. Club
per month. We call
& all work. No. 9 L


*~ AULT*" & 00., Prop&
~ s OWd tand.


-mr-,Mda Sttm opo~r*unlt7
A" to Wpuacea pRMiano N y
-~ GutmoOSate pricm togeter
ow- umuallysNall eyPasypY
pie. a hgh gadep!ano Wall.
~z~ehci prcusei evey home in
UN- orkda sad atbm nAlaba~zL
to an fotour awWedepropositiol
CL&ITTSM LMNHOUSE.
P~mmelaFlorid&


*dw t ery

either
Book fo)r:
down

30.5 Udays


bIT


"L' '


As m


r
'Aft
"WREN


I t .


, Pit


i
^
**j


wvr94w3wjFrjpw 77
Milli


W i I R *"


mmmm


DISV






-. ~
K ~


Taury ^l


p.

~,
' 4,e' *


* a

i --


-~


4


a- ,
,r


- I


I lack? ~-
Without a mdSMI
Nbos* Waist I009
back? 00"itTms i m ~' mr


A FEW D~Y TO~~ in
?.Usu is. 1 ~ibsmilk)e
the lovely YORadiftola_ -f
spiritual mzern tSqih1 a
bave creat.4 us IIOw.p a
work. leaves this w I.to q
of the iniUnWaWS O lp.S ah*
won during bwft*,*W*0W
PensacoaSuft -4C WL IU sfms".I%&&mom
an fMrs. IF.f tg. IAqw
Neblegbstb Is *room*s
until ao16I WOOLWS
MR. etem.~s .
OT4EMV 6 ~ W1

Mr.
with a 60 ft W Wr ___ ..-o
c mmmmiJ mk


'beft ma


melm la *4 sow POW to.W1t

they a" rahfrg
Just V tL


Mona lemal
redso" of 5.wa*,
mi".104"M 0 OLMP*Jm TG*1 awANIn
owT meeak^ &V n*. OW 'M" si Pwas- &b3"mebVrt
tOW derea ~e Ikf~ 11bommtbsS WOth nn
Th iinm~eg4p 41& .JokW~L ap Petwsypuea k
theb d8864ws s .,t. S-aeg~j ~~~- r s. pwYeb
weakessat ~ ~ pu~J'r wy. u pew"
the Impulse, th Cpssmi-.e.Chm n Dt:my w



ludispotable facts. te mothe u~ b aest.Wa
The saitOS4 MI~a wND.* ClAam&iCAL SCft 8"O.L
th .rn -hedssa hofaw
b~lastetn ofowhe f F..!
It Is a bS~t
Monda nlgh k9""ft M*' .1~fl~I
ju rtst Carry#~ss~o~PevI~y *s'be.t ~~s.P

~The gnuodbo himft of thoe6IS 7:1

Oqthe Inamp M ePatththe
indis .'-' -adM No : -ai
I* -b gott eite aa' mi
Thermm o S Htwtb the.tft @Qm
-~.~ ~$ata he )s~qCOL ou
the sanit "d, 04cowari th y Guse.i mboea r mbsr.
Masted ingthe., JSm 3 loss Rik- I" a

thehavet 7 fior eig w" 1~d F


thaits" 04- m o-a i
*"W" 0F S
dramde death Is spipm a
Hudeso ~a 'SdUS'rIUP.-at-t=4f
sm *. KrXuma


hr ~-RAE


.11


'.I'


~ MNU iEEEm Im4SAmm


4EU1p qIImaqEh.m4.EEE.Iamd.4EbmEEImEmhSI~
~ *qp-.1q4m m .mmEEbaba. EU b4bI3U~
* ~ EU
SS~ St4ba.4.amg....,am.,u.im.map EEMSNJ~
".4
~ma ~i
iw 6* I~

U IDdS~ Wb'
1w. pmfs~t .ibb~


WATSON.


DR-UGS

-e r


st grade of cbemi-
ve Wd byasand

d e is double-
ko e=ro can possi-


'Alombert.


1Ie~h.If&..100


WE


WILL


BE


CLOSED


ALL


DAY


4:


~~ian wW
adls


I
A
"p..


TRUE 18AI4I4B ; -
The hour s 1a e l
the club
Alone a wu& d I
,Ser saxiousw re~
there's the 5.M ..
Will not paral .m .
to roalM.
jau bach ow
"lDoa rt 80 1
Am I a brute? TlW I j, *.


.2
a.


w~b~


2~'~"'- ~
.5 I. *. -
*1
- ~ k


'r


* :1


-, ../


iswr,


m













[-y


-'a


. --' 1


-:4

I


--. ..v -
a.. *
D~. I0*


131 a
he,'
a...
e-I~~S.


.- a-'' *..p 4.
a-' ,...,


69-..E.Saa...i..
time


ROMINtr


P

-Sw'
P


A20


*~~~~n %s'mizra wesfllag.d




0 ew!Dtg with
I 4Mitt reeaf ..... l1a0


low dx UIIiirftm dwellng....
b, n d~lI~gwith


~#~A~s .tg~
~A1 ~
'aS.
S 4'~5 P ~ a *
-- - a - a


a-
^.


'a I- A -~ *.3 I
~
i~ pa pg~
Ia ~.
~ .4


Ow A"4j
d*'


a m4w m""apS rsee

A*LT TO

P~IL hgi
am n IL AN-


TWJA"w~


La ~ I~h t~E'~W~ I
' w~. --~ :1 'ma


L A "A# I
~~Made&,


e. relouwW


Ilk* ~ S. P


Ya UNNI-m.IWftabb4 as-e
am no I3L J5somm

*UO0=lW b.


1,000
1,00


.* e .._ .... m ..1....,500


S '. ** m ** ** ** ** ** *... 1,25
.o e as6 gb s rso6 dwoelkg,



."r.i WATSoN.


dM, A,* A m
INPM IS~ P.O0. box


r W.


-k*.


orr

RW* Jew GA. p10r be bmtw*
~ga(YbmW to "mor am-
024eembort l ee h"
paiI~ ~."wk, IS 1 ( m.W~



A -A

ANIM,

_________=Wh rve-
*gpdewia w40


*Il ad e ow~t, ~ ~ im3.jig^
caNS gX*tthlum-, 4 sto.
-c at *15W. laqulrs Ileber 3on
A than'" vi I mar South.

-~ $1.75







efi.."ply o toWEotWWWftiU




MOW IPON Pa -aW I W W


tiv' w a vmll lw-a* sL- .a..t -t
or&u 'awW*h~8y3i W~~~


%4W.~ RPTACT 4O7'flpLM
~ I 'saorw or. -g I *tWX E 2.~
~ marteed Addess ~ uTM


I A 4~UIi.S -waftiU~.s~aMeba~

..........d s
TAmlqm t~1 .Ig~~es





1AW" Wm U L1bqK* t W.
ipC
19. towC


That ~ th aft ~etat WUS It AnweredqUuickly
'am4mj"y*@NisRU *p.biieato find the

if~ ph you an osutract
m~wI ~S~t~ a ~ ~aaar, but have the

*~V him ezsting daaseS


t LCmpany,

tWW L M, 0m.nm gn l.


* .0
- a** '*-


SI'--
are -B^^^ .


'P
Is"


F


-*6`eig-t aMM bei with ball, M~IA
Avm* UM L -Thk b" b"hasto be
Immbe: 8WPSS4m -4 1750
I.IdI.4a45blek 14kNew

An 5 m 56 Fttersou Al
A~ w ~, w gzroom


i4. beVI6 block 171,


L50N& Co.
k~tA-met


CC..
-a
'IC
'a'


11
iL~


.^


"L.-


if


IVTI"







* -*.*


I. o


* '. ^


oR SAIB-HAz M isod M -
nce, corner of 1th a
13th street, I now ofer for :
household goods "and one ow,
may be sen on the PrO*m m
Tue.days and Thursdays. betwe the


FoR SAL' R8 A t11 to 15, A
being one-fourthof blocked 7 New
City of Penscola. 00 feet am & h M
street, 137% tfot oa 17th e e .,
trontin Harana, quare. New ',m So
story, twelve 1 b0 h use wIR-b.ht li"
meant anId attlc. House Ota j a"1 W s at
hard-finished smamm wce t 1, t
bath rooms and all modern coavm A ey Very
enees. The house has a eomthwea 4 7th "aow 1 .
eastern exposaWOre ad Is aOe ot th t Iithi l Iet t
most desirable I ub am n tl e ty, Inthee.t tt tfe t -p ....t
being only one bloek troa the street A lot ea k Wt at -
car line and overlookItg the ba ay d a mej&t g th ,=9r ob:
Bayou Texar. Oashait cash. Apply and elabert stetsP, I ft. best
to J. A. Gray, af t2 &L Garden St. by 1N It. deep, ,tlaim two- .
20june. dwlMag*-4Uf MM AT OWX It.D
)R SALES-I a&Bnaltisamited ao. Uh UAwJ a aE
fer on 12 lot laOPoroth Ite W City R I I WAl
within the town lt" aad r the
Lake Vex Hea. properties with n m U* I ft-.
clear titles and excellent eleYvatlo at .,,
$720. I offer s ngle lots In the same I..," Aa
vicinity at $0 sand $ per let on easy
terms. (This Is to the trade a white
people exclusively. bert A. Cltbba, A
Box 112, City. 1 -: 1 a


II


,:* o-
r .',


TY..


Flow-KET$


.4000 o 0 e 1*4W
o M. A&h 04Pc' o04" 0 *0' *00cc9.4
K....444-,..B. c ed
3 0. D9 ~04 .ee9c 9 *00- 04

-a t 0 * c, s e *e go to 96

-N T %rft Ta patin _P mw t
ME RCHANTSWift towitf"OOM t i
Im --11- Iam wase rescadve et
WIMU the lies Y and ama


FOR AlA-1lroMMgh4brd horse.- O tly hose an *. -- D'- "A"
Sleepy &fz. Appy y? gg eaatyI,
bles. 01_ e .A P O, o Lo,, __ I---, O l- MaO--M.
R *, -.-- .*e a -. I -*** *** G:.
FoR BAL-o-euu5 ioiw lO..... wedow r ._ ...* ^*'" .. 'e ''t.
Western post, aente. o saddler 2&6*0*** e**** ** 61........e.......
and driver. Don ey with bra sa t A -_u.ly ............-..................-
trap and harneaM. Iflama; Iek SE cases. wai al 1 I ....*...'.- ...............
er, Century, "l.. 3may ran- 9 ll Ills e I........... ...............
O R e a tA ll InGood *g ..... u1** --------***"***. ..ee.e@ eeo** P
w_ = _.- B A 1 the a ,Tgme..4 ..-.*V *ge.....*.. ......*W*
ly horse harness. top b* -- AP "..- e .... ee
Ev. urne. Ra. 3 hoe SW AM *- -. ssa-:oe5-4-6
gy nearly a One good W Lo. A. FOR %I oet SeahIr m.-s.,. rs'.-h d. .c.--.,.... .....M
luunelm. .e EI U co 0r3 A1J r B c c..c.......goe.............. s
FOR SA Two fle molUch ows withML i ,
young alshs; eas e m en at No. S A ". ., e Me
123 B. Gregotr. 0 a'B.a MaMMIno LI.rl Nwaets. New Yk Cofes Maket.
lMjune. 4W ,at 6'weeks.&AI.IBM.J1 DCle
1ue DUNU A^-I dress P. O. Box 478. oty. 2TJunelw We carry ta Wll liae o( Imprt ead ... ,i
TEA DNJu ATTN)TO ---. Doetle roceries and P..r..las. ,,er.. ..*..* .. .... ..6 -0
you w at a delle6ous ep of tea. tky. IM B o bise, ball and We w*at your atranse. ** *** *'... ** ..' "
"Our Own Blead it is superior to say other lmprovemento at 910 N. 7th October .... ...... *.. ..10.3
dollar tea o a the market. Only ne ave; lot W91le feet, room on lot D' .1 .0 g .... .....g. o .... 0. so
per pound. A vuamMe tiUks ta eary tor another- hobe ,lef w.410t.0 N"w To ot iMO..'
package. l w Orleas Grocery o. room bouas tLh at. a l U Do You Wantl The
Phone 106. Jas. MU uhP Prop. ave.. .. ,* .. *...*.. ., .,$1500.0 rain and PrvIon Market.
June. 0.. W. .orner. k..o..aet Kin Wheat.
FOR aLA-Maes.t car load 4 horsee ful al teor sauter hoei.. 140.00 .. A G oo Goo000*0
ever recelvqd In Pwaamooi M14-1. J A. WnMO 0 --i. abury ..tar... .. .. ....o .. .. ..1
Ian A Turtom We*fm*?ncAL Uk. i I
6june. -I B EST la' *< ^d. ,
ar e .c".. *c*0 .0 0, 0
FOR SALo-Rb obtox --- "" an ea.. 00,4 -3 .. 11 5.... ..


s.ss.1 carr .umil. erm8 ? Ta ma -.1.. .aeball an ietle . ..o.. .... .. o.. .12.-
A of l d e. .. S. .. ..

Watsol n have just revived a sr e B anks. '|4 G d e b. ao r A ..... l "unr" ..
supply of the latest city map, showg S 577. 1*f the beet Daog MdiMn, the bu A *. .... ..... %
all of the subdvislems. T apse the B 1 c les the bt Tire the bes TI Mo c T
official and down to date ad are Pe ate Typwriters, the bet lAc& a" d y V .S *A-. '* *e g* '
mounted on tiy It.ft1 th1i Ii"1i tttoc best Trunk RealrinGo ,est ..6.. .. .. .-
pr ce, $21A0; pec lal price on lot a el ato B l"be a 9 sA=B, and last. but Alas the S * 4, . o.
men. Hooton .A-W&ao...iG.. saw .u; bt o oler Skatest E. ... * *... *6%
onsau o s Nr" .. ....... .. *, .. .. .. .. ......
FOR SALE OR RNT-Two lighters; NRom away mow -&d mm N '. N.. .. ,............ 011
one with capacity for 7S thouWsad ft. *oK*d h al4 ~ s s.- dmUpsm da .... ..** G ... ... ...o.. S %
lumber, the other thirty theousad ea- sims. beeosnt maIs 114o 1 0 16I R I r' C. e **'. oov ** ** ** *- ....
p city. Rates reasonable, Also two S.arritt Mr- a- -m . ............ .....e.....
skiff boats for sale che 22 ft. lo A l.. .. .. .. .. .* ..s Nm
5 ft. beams. Toelemhoe or Write A. __ a -N ... .. .,o.. o .. Y. C 0...... .... ....0G
Chamn & Co.., MIton. Ma .sm w _= -, ....4- eoea. 1s E SAO L A -.. ..A... .. .. .. ... 8

RSGULA HAOK N-re l- boler.. % EApply1 0 1 T1 .. .. .. ..... .. .. ..U**
FOR.ALmmN e -un-wo No. ptlte.. --.-. .- --... .. .- : ... G


.y, maing .ectlo... with mal __ 3.. .. .. .. .. .. ...... .el%
launch for points o St. Andrews bay. ,BT rg.m avSa e gec.i ** c, c -' ce
hores, comfortable vehicles (01 on and shdaB W i3Ir4 at asb
or addreu Jr. C. Sinclair, Chipley.Fla. rates Of today 18 exemplife
Telephone No 74. 3Sapr Woodi1 r Dst. n to a iaides omf the :.n. ....
JR, SeLL --AO .ass bty.pe uMrca Headache Remed. *A%
lg ehoicest of lots on East Hill at ....
$300 per lot, no present need of payig Pl-N saa aM newly yt T
$400 per lot and ST5 tor a M0t5 tabah>d; Ire. S~a ROM O VIN
strip of barren isnd. Three nmd y. R w
ful pites of five ote each v at tor 'la a t m ale. -t Quick. Certain, Agree. .
each quarter block; not over 100 yo4. 1p day. A. t'eason. ae able a-d Ham ..e.
rom electric car lie. A. V. Clubbs. M ,. , able and 0rmess. t oys
Tjune. N."" *.

FOR SAIT-byr t purAo s White Ph eurm ag y
In have In stock tessna4
Tennessee MUD in stron piper ba.s r moath. tOes g a ALAOX .
40 lbs. at 2b celts at ware house. A. r. .e & -anacture lr .
V. Clubbs, eorner Gregory and Ale .b Obea 0, VANb ANdWHRmP l e Os
niz. S Juae i shttl Meie Ale.
FOR SALEierd ae 1jersy dairy bed im th" .W
COWs with wheI ectablshaed mtik 3sou 00 Week -? W -__ -han


route. No oaptltoN0. 0w5
business first elass cdttIou AP
8. A. Taylor. Century, 9a. 3 se
TEA DRINKr ATTNTIOI4
you want a deBoloe cap of teas
uOur Own" Bled It is superior to
dollar tea on the market. Only
per pound. A Wvabhle tleket aI eN
Package. ?ew Oreaga Grocery
Phone 105. Jas. Mot8gh, Prop.
June.
Fla. 23-
FOR SALI.--m^Nm s ,s,
ed property is .I p'artS eat *
J. A. Wilson & Co.. Zel sUtab
Room 7. BaabXry bMtag.
172. 1


CHIPLEY I8QTMO-,7mm la0t
Prop.medal wand=to a


FREE


.bab.S noon"


Arsmi


I-


aI


1. 1
4 '0~
.
* .1 -


Umymw t TM" goal o= s 'rl l~ts at- !r "



PENMOLA

t.ELS TOMINAL'mly

PHONR 1oes.


-OPP"


iASLEY. ICOM.PANY,I


~0*


'I-


<
<
I
<
<
<
<


~CUAWL


PrvSWkrs NL TooN .,'n CIa

WIT, WTLaIA.Fyfh aw


bh~u NOFkonW i P b"


P5gTno 1173


urn ZeUS 553S p flppppppp.apappppnn..a p ag p p p


- -w w w w w ww------- W w -'- y


It will provide for saving money which is
usually squandered.
It will pave the way toward, securing a


home.
It will provide a fund for educating your
children.
It is the best pombly way for accumulat.
ing a reserve fund for hard times or old age.
We:pay four per cent Interet on Uyur
having compounded seminaznaalt/


FlR ST


A TIONAL BANK
OF PENGACOLA, FLA.


'. a p s. W~ ei s








THE AMERICAN NATIONAL BANK,

DESIGNATED DEPOSITORY OF UNITED STATES.
"AmAl SU" WSUIPUS TMN.
DIRECTOR .


W. L~s
P40-



Wr. &.M~e.
W.u. N.ulb..k
Dr. W, .Ummb
S. ILeMkmt


F. L. Ihm i.
C. W. &ORM4.-
I .Uewmdua
0.I Pow%


Idd lp dqetinSfor vest d #^4s I&Nad 1VA5 lbsyea. Mnpka es
i M asm mn O toswaavulins d uh.mu
IFoper eet Itereet Paid em Time- Pwpslts.


city of ,Passawla I privemastIbs
D-bpiadms- OWL -*.V"edJamnay ilkst. 00 Ntkin Jn
let lI. -e~w A XLd s.too' ML Istftrust Prabl" iu~le y.w
ws Pq~w TSav-""Do.usacv' 1 Psam'L
Ta~ uw3~~&E..W e9cw9~


RALROAP
THE DSUgaf'Ur4e-~

C.H ICA.GEO
sow anl poli meton


swepdonsiy


, I


Low


Tr4RAu 8toean
Tours Points.



avainevlflelot. NOMhyllleTM%


-&



Summer Week De Shid-Ss
Train, n mWeeth crie C M t5ei1'
Woo*$ AM Alm6S


1A


u
12
11
3
3
4
4
1
5

7
8


v. Proensao. Lr. g
Sa.m. 0 1m. 6:20
am. 10 par. 7:30
B sa. 11 p.m.* 8:80
1am. 0:.80
Ia.m. 10:80
Soon 12:230-
pAm. 1:80
p.m. :.0o
1:M p. 4:00
6 p.m. 4:0
1:23 p.m. 5:00
:00 pDm. 5:80
5:80 p.m. 6:00
1:00 pam. 6:0
1:M pL.m. :oo
r:0 P.m. s:80
7:8 pA.. 8:0'
1:00 p.M. 8:
*Oaturay o aly.


nul


--W1 a---W**.. Fw


Lv PeMacola.
7:15 a.e.
9:50 am.
3:so pais
6:20 p4.m.
38:0 pm.Lo
*Oturday 01


Lv Yrt rramiem
8:00 a..
11:00 am
2:00 p..
: 10 p. L


Steam train leaving Pesacola ta
7:15 a. m. will stop between es.
cola and Bls Bayou only to take es
passengers for points beyond ls
Syost. Stem train leaving ort Ja
rancas at :10 p. m. wll stop betmwm
*g Bayou and Pesafole only to Pet
'off pa-ege from beyond Big
Bayou. Other stam trains will a"ke
all stopA. Eah electric ear makes all
stops.
The above schedules sad regul
tion subject to change without moci
Leea FPelgh Rqulatems.
Flreht shlpped by the 7:15 a. nm
train will be received only for paltej
beyond Big Bayou. and wl ot m
received later than 7:of a. a. A
other Week Day tralms leaving
sacola ot later t 8han : p. mA, snt y
freight for any olat. but freiht w
not be received later than 0 minst
before scheduled departre o tra.
The 0:00 a. Sunday traine ap
carry lih, t.pewbale fre t md
some circumtances by spesal ,O
islson. Electric eat will a o W rrS
frelcht or paekam eo any daseeip.
tim, except medicine urgntly needed
Shippers are requested to bear these
regulations I mind. that mlaeuew
leae may not be eased.
Theie eight rgulatles ubdet to
chans without eotce.
Any further InformatIon re
pasenger and freight schedule m be
had by applng to the general ooe
o the ompmay.
Pangers ae earnestly request
-to promptly report to the gena
osee any mnattemtn to duty or dIw
Mouty the part of employee n4
to make aeae rik t laem at cserlo,
JOW W. 9u .



Dr IifIfilhl
*TtA ME--^^* TB^*gF**** af ^----


we G. USSOW. Mae"


-


WHAT A SAVINGS ACCOUNT
WILL DO.

It will provide capital with which to start,
you in business


illimimmmm mmm mm


. MMW


4


* -


P

Masham


.


'


begm md $a a Nor& w tv In edwooL


%W-1 1. ..''1













2.


I-..'-.

I -


I -


104. mat m sitar








White Duck Pant at *t.25 TItt* U5Il the 7W
a .. "'u Ytrrest -UBw wc itS, to X

no .auuor Ie. o sunewa nS l oItim a e 7,& t eand ti Meno oroef ~ e oWl ..
sad Miate at Pt.. Wu a mAe 13 waU estSl asf I. a ftlanto Lt malea 8% Gt ; ; s
therolv y shnm.k. Newest thagfoor m e a s tie Ad ", s31 at ot. TO a i tt
-fd-.t to mtb--l aU the .at Aoin e t 1 bl.k r .w.. .ee ^a .,
-colo here for a cuts. 16ee Our IIlNy tes r subje< t datw. we 3 Vatels
Le*as *, to EevM Yea atv



NTIE JOHN WHITENSTORE .---. -.. ---.*A.-- -



S~ ~ ~ M e. e . ----wl,t.t-,i s Wo"bttep ,, Boon 4, frst g i S .
sade vet at* Pmt as*senvl tsd r.onemoN'or ,Wqyi'-gtn 17, ostfs e0 04

A 16 ete ndooNwtasf]sdia ystV 4 g e. s taI
to .h l m tt th alei a hp year" rtlea ti eth. .e 11Pe 4 o 4.- rO i evok--


vm o h erAfr o le Gels our,@wooinowmer $0 sa o ,,tbr T, all n,. t .to__. a. .. a o. -WI
Svd n the Unk Central I .




A N t m S a e,, .a.mo. earr to mea a pVrea. bra k a f Ue das -oon a n ess.eMot. -ties t
n t p-e saoB. It timi itte as AMPNGw To N T e JtrI e aSIaM- Bemi!-ts, S So~ IItu- M 4: f
tm.- ,..bUnn .IIw i. -. -.& fain -"do.






o.h.oss ,d &i te b Ato dode .B ,tt to oy -,hr: =t. ""-p55er sg t w., wai .b-e b.eveaad 4.e.. ; .... ..
n4 n a t e tI o .rt. sa :ao C aa be *fI iIT-d by b Paa pa Nt.ok comal* f Nreveport-.L.u e aock rea.
homes A lif DEIdaing pnI2.4eLpdI. .__. ,__ ... _-- ,______, -..
_d--i ... .....-_enver t, .edad ss ft ,-t-anhis e_...-

'e- .m---Vm iii t me -t a l..t to ta-- tne- ..s -e -- a. t. ater soUtn A"fnt5e L----"-co. lTw w-- o ae fr cos- -a-

,a a~Clps teN .tok.ad. we e4,4. t -e No oter m Bplm. e -1wlr
-- a wuiia a9 tra t oetatggregatede it she





.s_ u i. .kwei m". Amse gamsan s th astw ESPERANTO TU adIvQUBae s .a-
.. --nI wh--- at the sd a m w t Imp -t bM k .p ...... l S tte eoc.sVr, t i e to .r T e ., co n
."- X c J k s--lL i'I M g letaoato f W e masse"
bea all my rk of GohlX Wetvrd. te a i :MlIW. aatrw eN dg of tteer mia At .r...e s ..ey ee re Tteo i
dom I W ,ft i nt l,. s .ez.A er tcn eaue

.'flVrmdn n afi, E WSt _m as. eewft traa _cs ...r ama. .aiBe_ _ter. oW r ,Be s as I

/'" :" : Al BIKEM HOiT-rTt.tId, Swt tflor, I,-f o 0 m.ihtn.0 &. otoet o_ _,,_, l,_b ..f 17 B-o--on .$I""
there skw'a taw more aoit thttot .M. Swed , Aa 4K. (e temperient oabte cw 98 amSMMAn had6 no tt this es e spmrants sMoelAtsor, says thd "ysio
U*--lfter --t t ,_ wat0 1 fNwYt




'AN UAL J DIVIDENDS stb^sl 1, e.a ow f. .. C

rInd wrtall my c ton ckd o Ooa. l CAreive Ita jas,5 StAf fto u tmit at t r 1B speeleda of Os D o rw -l






*. I Rmue tftsBookt, b_ ........r.l.. ..Do..tnegt. to ....o.a T r it. ws h eS 1t. tamuLi & w. te aa vhl It asol i teemt t. Olea s t. > .- -
M. aBrn, Bh-hrdm1W, te mtownd ta twdw o 0 I ts pG asue m e pi a6oVndeath pren es am th ws etwe .
yo aneed Alke ep t ool. jt ud start p teasr.It thlst ordsn t om to as, 5 et5 twpeedv.it Duratto as se tre e s men.w I I tsI Natw



Eant newooe, PO.I. usa S.. .yy.r 0out ae f s-awt n ^T t.. P i.rftear w ra cnsacnnte bsns. with p
61 ve to to t T it lot. g aslht is .Bar dtB let e d t to ae 'msast teai m an tt U ta
will osince Alb m Cern tSS -c itpt 2731, New sth Mether.. de eto throk th. plimeatod by WISnf Ioluh noHM ,* lkr fto A Taft B








ork toIl Prl TsI, Baey, sr117. My er ag s pewhayts set Into th right hwaads w- *** mysrt Asim secd.
wL L W pooltoa5. Aerowstd& 21 e Se A Rtterwwhilewahe w wijaectd an -p A teyrmer n MePo e3.3 a, f O t b
a l DM o W Ntlod, Br 3, G1kr, 3dm, Vtora T M Rt ay andpm pboo imsuoadb ma tman cbeamp iegsoed te l s aEu toglrt e do doothf drty,

thea.ItE a baTd EdS'S t 0. a.it thm. o heap Iasr Be t ea e aSothe ani o tara tL agu
H K-i ds arve s st sa gow t, d Sd wtraa nt It Oard weta tr cft Ptieth wbf i SR te p .**trm the lmauee LB..
an m s impmson at tbW .t. -. .No.otherent ames pla y tIedw.d







IIi Sbf d Suesa SrnSI Uo asw, ordws or toa aadAla boama NteT dr*4*v e wDUy I tsc r wee tyadt ttm mlthsal. asnd tlmal *M u
1dHueeortsw wi. ondp leualpebI, I a394. Mye a toUefe dRarrsdhe t tael ol ep00 gald m. DjttIe theg tlm OtUU o a AtsCoS



Sdtnom...l u Ia toe L- Ker p g s sm to Bm wt naturMse &ed .__ __ ______________ 1 .m t e tb a
g t b@Yhave beX ga in have so testfyiedaduCn g t he p asTote a o a gog to spead 00 o a sa ideW


aGe*se^ 7r9m.., 175 f... HOstettePs to fdd wi plce for a fw .
f*hp '" f.eWa u k.S... Stomach Btteotrn amthewbankA tsA Good House
meI m a wil alway oure. and pe*west P ,tstv The lad now AmbrOCA4 by Palisades
k r D S Dtrhw rnd, t a por es a strip about twenty P J-eaving a ho w
annts y IiartrW omtig Ojape, Par andevssaiefo Leaving a good house un-
Fedbhe, emale III* or aaraI FeY- le ut SR on en aide be the riber e "ji as
Pat.U. san rd oatha w eter by the steep cUt ..
aurre. agt ls to m Amern the PaldaI.. Wen wooded amn c eai 0ack out n the
"a. Ur. ptl free fro" A.ndr .. .. uro*e .
ISk caimhps. i. yr I an in rowing m at si esAiham
s -,*.OTad1 *w
swftwam l oprt o t* He by pt amks and rVte at he ru-,oin t
1*PW 1 Mote-, could hfte W hbe Improved IIL AS z usw a-
a* as am" t -tobe enTa. avi WIPE
L* SOi swe bmenk
**,1T*,, ,*,aw.w A4 d>=* pi.- **- A
dnmIe selr. Imr emas . __'i you pthint, eee *.t western
5he owes 3Sa ab A.d fially, as aseIr poseMw h Pad paintY. Yes K wV .e a
th.Wk t?-/ p** *?? be *t, w`aUiieW lbt if k >gI to 4 i
Vie nOft""sey Imeea*y 3m rea

a sensearia Mose..... m gs.m..ti a w 4..e .- ,

itO 5 i~4 g SS- 0. out o- S*?^ Swb JS5ic Sgm see3rS5%% Red sca1 1*i~ *^--*5
arms .... d WMabove. AM ft S as Id
a- ute. 8 bswt-enl tye tee c w 3 vifmeI tv I 7J**4 .
toweM" -at on *bs, bs*w 1141has


" U_ . --
*W^W ^ ^-^ ^iner^^^
wwy 0>t~ -ql.~~M~
elebe f Sar g^_ ;^^^^^^^^^


uwyfusg
dustodw


tb ml et you WNWi
to fo at *I& If
CXV0 I% IL trta tyt


~ww,.


COMA SU N


.4** ,'- - A


low


-a


O&Worok&,











ed That happens
wve m rm tai Bte lquitable for
. Neither of them were killed by
theftir Im In the Ire following it
all d* wa'- uppPOed to be over
geW"he frufihtsbtl peri's. Not
Ow S the 00W ilW WCome Are
learamed for pIlded you were

-Genl Ain
Pensacola





jLS^OOO

I Hlttin your houm eo nspl N-
every mouth. 9Ddes economy it
it. Gi for all9 purposes at 1i.50
peWr than moaR or wood. Let us
Iustalllwg a wnterbeater and cook-
your bow for ighting. Touch





'S
*0


e CeampLany


-. '' <*. S -.;

rfisnow hIe-s in miidat
Store in the new ben, Build-
raving given p opt attention.


In


Bottles f

EVERA.GE lSs

on Cap and Label. 1 ^


IEWorks,

t. Phen M7.


Phe se 25.


Of WT COFFEE C00,
N. P. CmPMAN, Managor.
amassess. mN t of

Fine Coffees
ouR coFFsGe AU s OLD BY ALL
o0m. sGIVE THEM A TRIAL

W-K
RTSH |


we Ipnos esuee m mo rare
aid etlet1 m p w ab*rt. col-
lar A. ub rsblIeIn our
booy. Irea m -arfti has-


* *?, . *


C-2


4diLluk,




-


rTr

F .
-


dr JHE..,,PEN8ACOLA- .. JOURNAL:, TUESDAY MORNING,' JULY. 3, 1906.- PAGE FIVE t t
,- .
'- .
i 1"I: ::'. :-. .."'" ...._ ,, 'H'- :I' &:, :'; ."
I I
:I li. !-"Ja; t pany,' whohas_ JiaMujoying nice .
:Our Ice;Cream Is 100'Per' things :about ''Pensacola"'to the Age- "t. k
Herald,. as quoted' on' the eoitorialpage \ .
PEOPLE arid EVENTS I Ccnt.Pure of The Sunday Journal. with I
.* his wife had,;just returned to., Bimingham ->- ]
There's .not a particle of adolteration -' from a' visit' to' his ulster ;
< ; In 1 ifcJta richness Mrs. J. ,ZL Cravey,''of West Gregory.

| Seen, Heard and Done ;Among! Those Who Go Come and from the purerich pactoxized come' A_ 'jolly. ** quartette 41'-. Mr, Herman WhitelluckClothes'k .(.

,cream:froiuod of the best Jer Simon; Mr: Adolph Well Mr. Will '

Tarry v* Women and :Society Here and Elsewhere sty farms in the south. Its Noa and Mr.: Harry Davis, all' of : +
: : ; ,smoothness and pleasant taste Montgomery Ala., who are -campingnear ;
McDavid, spent Saturday and a ,
:COmes from the way It is made. Sunday in town with several young

By E. MEUJg MBIT. TeApfcoit* 669.. The flavors are ,absolutely pure men of the Jewish. society set A We have just received large line of Men's : : 'r:

__,n' ,....- ...<.. and every vessel used in making party of local young people will I ;;
J'MV- V"'I'JVq .JMt.JMt MtJtMMt
.I T it is thoroughly sterilized. spend the Fourth, with them at their White Duck Coats and Trousers which were 'f ,

.
camp.

The TRUE hour MANHOOD.is late, 'and,. l I- must f lean I 'lhe, Journal's; Daily:.F iFeature.. for Special the home attention;and paid for picnics to orders. Miss Marie Steele. and Miss Gertie delayed in'transit On account of the lateness l \: '

.
'Whitehead left Monday Mrs.
'- to' join
club t 'I'
Alone the a: 'woman; waits for me 'at .'.." ', 1--'. William Steele and younger children of'the, season we, will offer these goods at the :.:. ;

home .3 COFFEE, who are visiting in Falco, AlL j t- I' .
,. reduced
Ser anxious! careworn face-ah, :. .': -4Mts. following prices. .:i. : : .
Dan Shepard returned
there's the ru.b-! .. Hot Biscuits and Rolls Sunday
t everymorning morning from El ''Paso. Tex, where t : .
.
.
Will not permit me .longer, boys, at'S o'clock '
: to roam. ; she spent several week's with her White Duck Trousers, $L50 value, e.L______________$L29: r i .
s. sister Miss Jennie Cook whom she .

Jon bachelors may-laugh. and cry"Donf left greatly Mr.. improved and Mrs.in Shepard health.xo Wednesday : to. White Duck Coats, $1.00 value, at_____ ___:_________89c :'. ,


Am I a brute got"!! True manhood. doI Kandy Kitchen Cafe. their Texan summer cottage on Bayou White Duck Coats, $U5 value, at___________.; _____$1.00 :,. : '


Without lack a maid what can. a.'woman do I I: '' 104. S. Palafox.Phone'999 Mrs.- N. ,B. Cook. and daughter White, Duck Coats, $1.50 value, at__________________$1.29 ; [
buttoned down the
is
"Whose waist II I v Miss Lime Cook' leave to-night for
.
New York Times.- El Pasco, Tex., where Miss Jennie One lot bar aprons, 50c grade, at ___________________35c <
,
Cook is recuperating. '

MISS CORTES -TO+-LEAVE IN Beautify the Complexion Mr. and Mrs. :t Muller hUG remover One lot waiters aprons, 50c grade, at________________35c f. .t .

A FEW DAYS TO RESUME .. ? from West Garden to the corner 150 Men's Wash Trousers fast colors ,;J.
HER MISSIONARY STUDIES.Miss INTOI DAYS.Nadinola. of Ninth Avenue and Gregory pair absolutely : 5

Elise Cortes, of Mexico City, Miss Madeline! and Miss Pauline Ery best quality Cheviot, regular $1.50 grade, now____$1.25 f
.
of Mobile, Ala., who have spent the
the lovely young missionary whose The last six weeks with the Misses Mailer t
spiritual power and personal charm BEAUTIFIER.cn.UNEQUALED left Monday for home after a sociallygay These goods are well made and we guars 5. '1 t,
baT created so much interest in her -' "'t' I -t
visit.
work. leaves this week to the regret! doped ly tLmutad; '
of the innumerable friends she has: tfoaraateedto munfred.Ia. antee every article to give perfect satisfaction. 1
Mrs Joseph Ntcolau and son ,Mr.
won during her three weeks visit in 1 ;, pimple, all fj
Charles Overman, leave this morningfor
Pensacola, guest of Mrs. L. H. Nobleshand I '. facial di.wlor0tioassad Nova Scotia. At Jacksonville j a j j.i
.. tasters tU
of Mrs. F. E. Brawner. .
I ,,, bssaty: of 701ItL. they go by steamer to New York and -
Miss Cortes spent Sunday ,with Mrs. '
The Boston. Then to Yarmouth to be
cues q twenty day see sod
'Nobles but Is Mrs. Brawner's guest f''J IE 51.)0 at all leadiatf drof (tore*, or ty maiL away about four months. Watson Parker S Reese ,
leaves. ,
until she
I > ,
,,
-+- ; t! ....... b lUIMHit TOJLEt CO, PxI. ,t.. It's the "Blue Ribbon Flavor" that .4 f

,MR. L0CKEY ENTERTANED. touches the exact spot. Ask for Blue .

FOR HIGH SCHOOL SENIORS.ON .' i Ribbon; Vanilla. Absolutely' pure- Successors to
THE' BAY 'SATURDAY. 7 9. n. f1) goes twice as far and the flavor is per.
80S'SO'SIte :
>' / c:: lection. GREEN & WATSON. 'I
"- "
Mr. Joseph B. Lockey. principal,ol R
Pensacola High School, entertained :
the <, I N'ST ALUN ELECTRIC:
delightfully Saturday afternoonwith < < Cream. Factory LIGHT PLANT '
.
a Bay party on the Cupid for the t
Senior Class, the 'other invited :: .
guestsbeing .
; Pensacola Electric Co. sent
The out
the Junior's ano: the faculty of can furnish you cream many
the High School, and each of the Jun. quantity., Satisfaction workmen yesterday-, to DeFunlak I E 1.ARE 1.
I. guaranteed. Springs for the purpose of installinga '
iors was premitted to invite a friend.
The party who enjoyed a water t PHONE" 132ft private electric plant at that place. PURE DRUGS -
Y I This job was assigned to this firm ,
; SAM BOSSO. Propevening
melcon cut going and returning land. 1
.. time and speaks hIghly for
:: some ago
ed at the life saving station where :
: their reputation as expert workmen.
enjoyed dancing, and bathing.
they The Pensacola Electric Co. claim to ,AS IMPORTANT ''
honor. I
Just before leaving they, were agreeably :- in of her southern :
be able to handle size Job, and
surprised by a fine supper prepared friend, Miss Alexandra Myers. The any AS PURE FOODS
solicit all kinds of electric work no
for them in Mr. Burton's best house was beautifully decorated in ..
affair that the long graceful fronds of the ferns. matter how large nor how small, and ,
style and crowning an was < .
most pleasant throughout.; I AFTERNOON FROCK OF BATISTE 'I The color scheme was the seasonable no elsewhere.matter whether It's in this city or ; -L

-+- patriotic red?>white and blue. The ,
MISS THJESEN'S HOUSE PARTY Tucks, laces ,and ribbons have always a wide hem above which Is a group of; young ladies 'were arrayed in fairy These people, are now offering to .' :f
l AT'THE LIFE SAYING STATION. I found favor with the mothers in small tucks.' A ribbon run beadin. costumes of gauzy paper of all give away free a fine electric portablereadinglanp : the of chemi'i': .
Only highest grade
fashioning theY title maid's afternoon covers the joining of the skirt! anj; colors. Dainty refreshments were to the'person sending into : :
Miss Petera Thiesen'delightfully entertained frocks, but never before have such waist, and a fetching little bow tied in served and the; evening spent merrily them the best'eleotriea1 advertisement cally pure drugs are sold by us and : '
; quite a.houseparty at theme '. pretty dainty children's models .appeared the hackjt' Batiste, lawn figured muslins with music antf. games. _All report a written. for them. The conditions -" ,
saving ; station from ..:Thursdaymorning' in dressdom as 'are'being sees and a) variety of materials can delightful. titans and,;_vote Miss Anna a 'are that the advertisement must used in filling prescriptions. Every ;:
till Sa.tnr 'ay'niPt for her this season Thelittle 'French waist be found,from which to fashion these charming i ientertainert Porter Co., be 20 'inches'eitlier single, double or
guest 'Miss: May'Gillett :of- New Ort [of this batiste frock is shirred to a afternoon frocks and for summer wear Ind.,, Vidette.- three columns in width: and must be prescription: filled here is double- :, :J: ,

t leans.- I f finely tucked yoke;, which is finished the 'very thinnest weaves will be selected ., in not later'than July 10. This Is a checked so that no error can possibly !
Miia' Thiesenfe other: pests were i with,a- lace edged ruffle having short Plain, materials are more satisfactory .Mr. Freddtq!,Mathews, .of".Augusta, good chance for someone to try their .
,her brother:-Mr..'Rudolph Tniesen., Miss stole ends and: the 'full elbow sleeves for the building of children's! !I Ga., spent Thursday in the city as the! band at ad.' writing.' Contestants are : be made. ;"f :. ti '

Ruby :Wilson, Miss ;;jLurleyne Fulg-, have a wide tucked cuff edged with a frocks as the frequent tubbing which guest of Miss lV1 Smith.. I invited to call on them or telephoneor ,
.bum, Mr.. Henry' Thiesen, Mr. Steve lace' ruffle to match the, collar. The ,they require oft.times! plays havoc 'iJC ., : i write to them- for further particulars : '-, '- t. "
rulgaum, 'Mr. Joe Wilson, Mr. Will short, gathered skirt !finished- with with colors.. '- lr..J'. J.,Jet i1gas .a prominent K.' ; -.- .r .
Wilson, Master John Wilson I of P. of Port Royal, S.,C., is the guestof '. J
The chaperones wers'Mrs; Lee Mac-I Mr. and Mrs. W.' A.:,Smith Monday Modest,Claims Often Carry the MM i .' ..
Donall of_Tampa, and Mrs. Henry M the fame of Aaron Burr and brought the trip and were as lively and full and Tuesday. Conviction.. .,
Wilson of Sewanee Valley. reproach upon .Andrew-Jackson.ft of fun- as were the boys. D'Alemberte i
I When Maxim the famous gun In-
: 1 I is a waste of words to sermonize Both breakfast and dinner were Mrs. E. 'Mead Wilson, and sons ventor placed his gun"before a com wDRUGGIST Lt.
THE PRIMROSE PATH. upon it. It is but the same rehearsal served on the grounds, and the weary Frank and Mead,.left Monday noon mittee of judges, he stated its carrying .
Tragedies such as that which has of the past "Can:a man take fire in ,but happy, crowd returned to the city fora visit.in Chicago,. Grand Rapids power to be much below what he AND APOTHECARYNo. : ,
,
his bosom ana1 not be ,burned?" on th i ;eIoat'car.SUCCESSFUL and ; ''Later
just stirred New York carry their Ihen-la'fUetrqft.; they go felt sure the gun :would accomplish. .1 :
The is --.- to Maccatawa)Park-with.Mrs. Mi/lhalen/ St. Telephone No. 109 : ,
own melcancholy comment primrose,path; broad and The result of the trial was thereforea 121 S,, Palafox
The immediate merits of the case= pleasant, but :tbe endthereof is CRABBING of Grand Rapids who spent the win- great surprise instead of disappointment have filled ever two hundred thousand 1 r .1
the degree of the offending for which dsath."-(Atlanta Georgian.A.MER'RY ,AND OUTING ON THE BAY. ter in Pensacola. for t/e balance ol It lathe same with the manufacturers Let us fffl your prescriptions.since we have We been in business. ., y '

the dead man was responsible, tie -=.- &I : pleasant crowd of young people the season. Mr. Wilson accompanied of Chamberlain's Colic
weakness of his slayer the passion, NIGHT AND. -DAY had a delightful outing on the bay them. -.part of .the way. Cholera and Diarrhoea'Remedy., Theydo t-
the impulse, the emotionalismareall Wednesday! evening, amusing them- not publicly boast of all this rem- .
] apart from the overshadowing, the AT PALMETTO BEACH. themselves fishing and vabbing. Miss Lena Paver an attractive edy will accomplish, but' prefer to. lethe I >

indisputable facts. Mrs. J. G. Welsh and Mrs. H. Mr. Harold! .Lynn was awarded the young lady from Montgomery, is users make the statements. What PENSACOLA "' ,i' ."
The CSrcean charm of a life where Pierce gars' ;#: 'picnic to Palmetto prize for the largest catch. After.wards spending two 'weeks) as the guest. of they do claim, ia that it wIll positively f'

the sanity and nobility of nature were Beach Saturday night and Sunday refreshments were served on Miss Refine Cahn. cure diarrhoea, dysentery, pains in WE i':

tlastey in' the crimson: glare reaps complimentary .to 'a, large number of the wharf;and the party returned, .dir Charles, Grosskops. and chit I the stomach and bowels and has newer CLASSICAL SCHOOL : : :
the harvest it has sown. j young people. about eleven o'clock. ,; ; been known to faiL For sale by;

Monday night it sent a distinguished -! The picnickers went to the Beachon Those present were Misses Amelia dren Master Hbert and Miss Rebecca' all druggists. J
artist in wood and stone to a'' the'7 o'cloctt'car' Saturday night Johnson, Hazel Johnson. Mattie have gone; north. They will stop in PREPARATORY SCHOOL FOR BOYS .
dramatic death in a pleasure garden. and spent the night fishing and crabbing Evans of Warrington, Gladia Smith Chattanooga then go to Cleveland.I Privileges for Sale. AND GIRLS. WILL .?{ .
Hundreds of years before it "burned and playing pranks on one ,an- May Quigley. Aggie Quigley, Gertie Tenn., where ,the children will spend Privileges; are for sale for the 4th ;, .., .
i
the topless'towers of Dion" and strew-! other so that.. no one':could get any Burns, Ivy Smith, Hilda Griffin, Wil the summer with their aunt Mrs of July picnic both afternoon and Seventh Annual Session Begins Sept. t : ,
('the gulf of Actium with the fleet of, sleep. lie Smith 'Marie Smith, and Bertie Johnson, )1(. Grosskops will visit night to be given at Electric Park by ,;/l' ;
Birmingham, Montgomery and Mobile, 17, 1906.
Lynn. of Columbus. i
It sullied the of the Knights Apply to >
Antony.
names And such fun those boyS' old have I BE '
Goethe end wagner and clouded the I trying to keep the girls awake but Messrs iYeddie! Mathews, of Augusta before returning. Jackson Brandon at Pensacola Electric : This school limits the 'number of r :t:

closing years of ParnelL It blasted I some .of the girls had prepared for Ga.; Jlmmie Wedgeworth "Nick" ;Mrs. Annie OTBrjea of Anniston, Co. 29JuneCOFFEE pupils received to such as. can be i i" l .

Condon, Dooley' O'Connor, harley \la.- is in fist city for a few days taught thoroughly. j I l ; '

.. f Ldbrand MMvin, Haro: Simpson.!,y Lynn:; -, Robert Smithand" visiting friends and relatives. It prepares for entrance to'our leading CLOSEDALL
universities and technical school!
They were chaperoned by Mr.. and 'Airs, J. J Gtbson, and son John and for Intelligent, useful citizenship.The ; .

"THE BEST IS WHAT' WE:-SELL. '! Mrs.: W.Mrs A,. Smith. JaS., .:Mr.Johnson-and Mrs.and Simpson Mrs.- Reynolds, and ,daughters Lillie, May thoroughness of its instruction
and .Mamle Bda-left Sunday for Car- is best attested by the records of Its '
Lynn rabelle and Apabchicola where, for students who .have entered our lead. .
-+- come weeks, they will visit relatives We are the Pioneer Ing universities. In every instance
PICHARD-DOUCLASS.\
and friends. I where they have entered for collegiate -,
Are You Waited Coffee Roasters ofWest
On? Mrs. E. R. Douglas announces the I work they have been admitted
marriage of her daughter, Mary Ella, Mr. and Mrs. G. B. McGill are' Florida. to the sophamore class. |
to 'Mr. Eugene Pichard, of Live Oak, spending a couple of weeks with the I Instructors trained in our leading DAYJULY .

Fla. The marriage occurred at' Live former's mother at. Lillian, Ala. on educational Institutions. Laboratories i j ,
When it's groceries you ,need let us Oak Sunday, June 24, at the home of Perdido. Bay. of science for student experiment, '
'
Mrs. C. W. Bache. After two ,-
: a McHUGH'S BLENDShave work. One of the best eq.uipped.school :
show you how pleasant and convenient week's wedding tour, Mr.: and :Mrs. Mrs. William" R. Fell antf' son: in the south. I IFor
gymnasiums I
grocery buying can be made. Ware Pichard will make their home. at Everett have gone to spend a month:
your and further infoma-
Live Oak. Atlanta Georgian.: i lathe-vicinity of Perdido for her I catalogue 4
always busy,yet never too busy.to see health. I no equal. A trial) lion address.H. "
Prin.,
GADSDEN EPWO.RTH LEAGUE I CLAY ARMSTRONG
that every one of our customers are. : THANKS Y. M. C.'A. FOR Miss Alma ,Panes: of Mobile: who will convince the con. 909 N. Spring St.G. ; f;,
COURTESIES. = hag been the recipient of attentions : that
promptly taken of whether sits many nolsseur we I
? care a At a recent meeting of the Pads-: while the guest of Miss Nell] A.. R..Attention.

week's supply or only yeast:.cake that's den Street Epworth League it wu Richards, left' Monday' morning for make no extravagant The G. A. R. will meet this afternoon r To the -It.
unanimously agreed to express to the home. II claims. at 3 o'clock at Bullard's, on In- give boys a
wanted. And you can send your small.. Young Men's Christian Association tendenc'a: street. I
the sincere thanks for the use of Miss Elmire Richards will leave I J. D.. PETTERSEN, r i
child with list of the chance.
.est a' things you their building and; to those who so Thursday for Gnlfport Miss, to and RetailGROCERS Commander. i

want, and the order will be f filled as_' ; 'kindly assisted that night of the reception spend the summer with her sister Wholesale .i,
'
for the: League delegates ll,rs.. Will Favourite. '
conscientiously as if'yoti'rrie yourself. -- Our customers will please '

SPENT SUNDAY PLEASANTLY Mr. Lee MadDonell Tampa, and Lewd Bvtter.
,Our .man-:will :call every mom1rig.tolearn ACROSS THE BAY AT MORGAN'SA Mr.,Harry M..Wilson of Sewanee Vattey The United States government has place their orders Monday I ;,

what want -Jutsay/ the:' I 'large party spent.. Sunday'at Mr*. arrtvel Monday to _join their and all ki6ds of Feed ruled that butter which contains over -
you r Morgan's 'across the bay boating. wives who are visiting their parentsM and Tuesday. L :
16 per cent of,.water is subject to the
word ring'phone 31... ,. I..,,-.; .. I-bathing 'and* fishing chaperoned >by .,and :Mrs. M. E. Wilson 305 West Stuffs.Pluto Internal revenue taxes on ,adulteratedbutter. F s -
.' .d ;. Mr:::and:Mrs.-W. .)I. Nored. and tueir Gregory.Mr.. This means that makers must ; ,
r
.
*y mother Mrs.: EL Williams .
i In the party. 'were Misses: Ethel .' W. A. Gahkrabeck has been pay a license fee hof |600:per. ear anda l: r';: ,
"WE SELL T LEY'S ;TEAS" lAhr. Dora Weber, Jessie Prather, quite sick at his home since .Saturday WaterWholesale tax of 10 cents a pound on the prod.
>LUlie.and Edna Lee Gertie Varghn, night and probably will not get uct and that dealers must pay a license

Annie Eubanks, Ida Davis; Josier Edwards out' for, several days.. fee of $480: a, yeat-Kitional fc fI tlr
; Eme Williams Mamie and Leila: Stockman.: So! Cahn & CO. :
"
ROSENAU & GERELDSTHE Butler. Lillie Mashburn Jennie ,Key, _Miss Eatelle MdMillian of Green. and Retail t
y Mrs., J, Edwards, and Messrs..Em.est. vibe_Ala., is in the city guest of Mr. Beef CraekUa** Fe.. FewLBeet l '
Eugene and Lenwood. Williams and Mrs. N. B. Cook and family cracklings may be fed to cither The Par Food Store, : :
THE FANCY (GROCERS C. E. Lee'; Wylie Edwards; A. J Hew,:Orleans 'Grocery Co. chick or adult fowls.: ,They.should be i.t' "
Sneeds, B. W. Edwards Will Block. 'MIss Virginia Snyder leaves' today ground rather fine and for chick feeding ,
.-....Cereir Palafei. tad .....dewiaPhones .; <
W. M.
and Nored. to spend the summer in Indianapolis ;
noon the coarser particles should be sift It.}!
one 39! : I Pensacola. -+- Ind. ed out They ,should be fed in the y
,,. .- One"of,.the prettiest soda*'f nc.twnsever' Jas. McHugh U g
.i'. .. ..... .. ... !' held in Konts'was a party 'Mr. :George Cobb. secretary of the same manner as. beef. m"p.Rellable1'oa1tt7.1 r : ':
:given by 1I1ss'Anna Noland. Friday Birmingham Paint ,and Glass Com Phena. :10B. Proprietor. ;
t.7 -
f'l t :

-e r
:
....... t f:
?7 .: -:" ';_''''.F--1'..::J!,=><.....:-.J'.h-. :,"?_-', : ', -" .. -y :; '" .... i Y
,. _:..o.p ;, ,, <" .""" ::: ii'ii-i'I'i'i II !!.' !. _-" : ;: ,- -._,' J'' .'.1" .-. ', _. t t -
-- ,, .. __ _



r ;1Ii; r= .


Ff '* ; "' ;" :} : "\ ;:;T;:' 3';qf'tlf.v'1.if'-l ::,,It',< ; ;r< i

_. __ _' "
-: ." } : "l
'fi- ,,,;;< !.q ,
l' I>< ,{ ,,,, *;*
h "

Get in touch ', .,::- ', \...ya,!:f't: : "The Journal's av/ -, ; :



Use readers with a 1 Journal 25,000 daily ,Want '.A d:, I'bI"_"" .'jw' I. 'f;; ..I'.to O> .wu.at. culation erase 1906 was Daily for..il'.:; 5,828! m,,. '



-i' : }.. :.., ,J.o

.' _, >; ." ,: THE WEATHER! : Showers -and_ cooler'-Tuesday.. .;, Wednesday. ;., ,showers; 1.lght't.S. ,' .-to, northwest,winds. ,, I (' j-4
F
+:

--VOL-- IX NO. 158._ PENS_,ACO, ..!A, FLORIDA. TUESDAY MORNING, .JULY 3,. Og, PRICES CENTS S 'ItJ 41 ; ,



CAUSE OF THE' ENGLISH '*, 5 fflHH.1 CLOAK MANY STRIKE BREAKERS AT It. 1i

'
I NOTED CASE IS *. NO' WJORD! REQEli, / FOR THEPROTECTIVE -
.FROM. THE OVERDUE < ; "

DISASTER STEAMEAMERIKA: i#
MYSTERYRails *. WORK ON L. & N. WUARVES.J.rJfF

By Associated d Press *

-SETTLED.IT ..New: York, July:2.-;'No word' '* E I I
*, has:-.been received the,over- .* r r 9 'Y

[ over Which Doomed Train R iE-ES.IG'NATION S. :**' 'Fabre due steamer line which'Amerika."> :sailed; f'the from' '** GREAT DAMAGE Sixty Ken, in Charge of Special, .,

Passed Carefully ,Examined Marseilles' and. Naples with Reached Yeste- '.
MARIANNA 110 passengers'and a freight' TARIFF Agents, City -
,
cargo and which was. last re- *
But to no Purpose. S ported on June II ""at Azores: terday from Cincinnati.MANYMORECOMING. }.

OF PERKINS ,The vessel is now':eleven days BY FLOOD IN + F f
1 overdue. An official of the line #

NO OTHER DEATHS, Hoskins Accepted$300, as_Com **, said for ,the today safety that, of he the had, steamer no fear *# Representative! Livingston Makes J :tL :,

as there had been no great # I -.,:' ,
in-Suit Calhoun of ,' -
promise Comparison Appropriationsby
ACCEPTED VS' storm lately. It is believed the NEBRASKA .i '
cause of the delay Is disabled :

R Hearted a Although Several are in ,_ .. .'and Boone .** machinery. : ** Congress. Several Coach Loads of laborers. -- : )E {. ';

Ctit '
I Big Financier, Insisted,that H'Be AUL,PAPERS IN ANY WAY CONNECTED ,. REPUBLICANS, ARE EXTRAVAGANT Cloudburst at Lincoln the Heaviest 1 .


BODIES STILL IN WAITING ROOMOF Relieved, of Duty on Board WITH THE. 'CASE SEALED DISORDER INPARLIAMErJJMembers >" : FOR DEFINITE PURPOSEAS Ever Known-Streams MEN BEING CARED FOR IN GULP :, 'i J ;" .i.

AND ".r. -
WILl. NEVER BE REDUCTION WOULD COMPEL
STATION AT SALISBURY of N. r. LIfe. Out of Banks. TRANSIT CO.S BUILDING ANO .: t : f ;-
!)ENro' EXCEPT BY AN ORDER DECREASE' IN TAXATION' AND I
REMAINS OF AMERICANS WILLBE IN BOARDING CARS ON THE : ';- -,,.;

OF THE COURT. FORCE TARIFF ,REDUCTION.By .
.
.
EMBALMED AND BROUGHT By Associated Press. By Associated Press. WHARF GENERAL AGENT L:}
Lincoln Neb., July 2.The cloud ; l .
HOME AMERICAN AMBASSADOR New York, July 2.-The resignation burst whichflooded this! vicinity last ROBERTS TALKS OF SITUA* --e; !" ;',;.,.

of.George W. Perkins as trustee,of the Special to The Journal. Associated Press. night was the heaviest ever known I ;Jl 1'. .
EXPRESSES. APPRECIATIONBy I New York Life Insurance Co. was to IMarianna July 2:The noted cass Resent Attempt of Gen. Washington. July 2.-In the statement here, and caused property losses of TION. c., ,+ .; ,

II day accepted at a special meeting of' of Hoskins vs; Calhnon. and Boone i a of the minority of the house many thousands of dollars In Lincolnalone. __ -fri ,
I the board. Mr. Perkins tendered his ,conspiracy suit; in ,which HoskinS, ,Pavloif( to,Address Russian committee on appropriations Representative In the business streets the j ,
Associated Press. resignation last' December but 'no action Sued for $10,000 damage'-was terminated -1 > .. ; 'Livingston'makes a comparison water was ,more than two feet deep I Many workmen, over half of whom t., (":

Salisbury, England. July %.Every: was taken until .the last meet.:ni Saturday just as the attorneys Lower Koosa. of 'the expenditures provided for and the sewers, being unable to carry I are white men, have been secured by -='I! :. 1' ,:
effort to discover the cause of last of the board when the trustees' de were ready to' argue ,before the 'by congress with ,those of 1898, the off such a quantity, the water ran the Louisville and Nashville to take' ; : :'t.. t :
light's accident to the'-American line clined to accept it, Mr..Perkins today jury by a compromise In which Hcs, first year of Pres'dent McKinley's ad into the basements of all the stores, the places of the strikers and to ', .ht :, ,
United has thus far failed, railroad insisted upon its accep'axice.I )tins agreed ,to accept $300 and tie By Associated Press ministration which shows an increase causing losses that range from a few' break the strike on the Louisville* : :

experts and representatives the Other trustees besides' Mr. Perkins, defendants pay all costs. The court .. of 351448222. He says: hundred dollars to several thousand. and Nashville wharves. .About sixty -1 ft.. ;
coroner and board of trade having examined I whose resignations were accepted today had been busy with this.case" for the St. Petersburg .July 2. The afternoon 'This growth in appropriations! sustains The,department stores which have men, nearly all of whom were white .1' '; :'; 1"

inch'by Inch the rails on which are J. A.- Blair H. Walters and past four days. sitting of: the, tower house of; r the contentions that the republican displays in their basements are the reached here yesterday morning from : :; ; "1'. i.'.
the accident occurred. The confusion I E Norman B. Ream. The following were "This Hoskins matter has been" the parliament, to-day, which was, devoted i party stands for extravagance in ,heaviest losers. The city pumpin's Cincinnati. They had been secured t q r ',.
h accentuated by the, death of the engine named to succeed them; H, H. Lnr- subject of several very noted law to a discussion of the law providing order to use, "extrava'gance: as a stations were flooded and the water by an agency there for the Louisville h4.; : L' i'
driver and stoker. ton of Nashville, Tenn.; .A. .A. Raven, suits It was one principal counts: i I for the'abolish. of the. ,death penalty 'I cloak' for the' more objectonable purpose supply was almost cut off. The dam and Nashville, and accompanying y.. .p." -; ,
The inquest has been adjourned fora of New York; Geo. F. Neward of offered against'Judi Swayne in the broke up in utter disorder when of maintaining a high protective age in the residence portions of the item when they reached Pensacola r;,! ::1 '.: :
fortnight. New York and James H., EJckies, of'Impeachment proceedings at Washr i I General PavlonV military procurator tariff. A reduction of expenditures city was heavy. All the streams in were quite a number of special -if f! ,:> '
Only relatives of the injured or CIa ago. ington last year. It is said to have attempted to address the house in behalf I would compel a reduction in taxation Southeastern Nebraska are out of: agents or detecttves of the L. & N. '1 '" ?.'
those representing the officials are ad- caused the suicide of the son' of. Mr; [ of the war ministry.! His appear: and a lowering of the Chinese wall of their banks and damage to crops isconsiderable. who will remain here during the ,.'! t, .,
milted to the infirmary. Hoskins and is believed to have been race was the signal for'an outburst protection.. Much of this extravagance i strike for the purpose of maintain ,
The scene of yesterday's disaster responsible for, the death of the of cries of: '"Murderer; Assassin.: I grows out of the practice of ap lag order in case of any interference ;! !'j'; Tf':
referee In the bankruptcy suit. It I "Organizer of the,Jewish massacres," with the workmen. 1 ', J.
the American line special from Plymouth pointing commissions to do what congress new -
to LEWIS SILCOXR has been the subject,matter of three etc., from members of, the group of;

;
having on board the passengers ought to do and what congress The men are cared for in the lower I." H .t.r.
toiL
who were landed there from the noted disbarment proceedings In this if men are paid for." floor of the Gulf Transit Company : --r
steamer New York;; presents little evidence county. Lastly the ten thousand doltar I Members pounded their desks COMMiSSiONERS S building which has been convene i} }.,!'
suit mentioned. shouted, whistled and used 1,1:
damage above every
of havoc wrought bj into sleeping and eating apartments t 1 0
today the .After the compromise Judge Palm means to show their:displeasure. NO SPEEDY TRIAL ;'f. r '
cots the and ;
the wreck of the express train all the Many occupy building .4. [, sl :
been cleared away. R REACHES 9 er,-who has been presiding in the suit General Pane, after listening for it Is comfortably arranged for the f .i ; '
l
wreckage having owingto the fact that Judge Carterwas some minutes to theS storm turneiwith HARRY'THAW men. The colored, workmen are being i. "'
No further deaths have been recorded FOR FIXED T TAX X .. i
but Robert SL Critchell of Ch*- l disqualified asked ,that all a sjsale to President', Mouromt cared for in boarding cars on the ,_ : ': 1'X \(
ol papers in,anyway, connected with the ielf. signified acceptance tf the situation wharf. '4'P't, "
cago, and Miss L. s. Grfswold bad suit from the beginning ,be burned, and left the tribune. S More Are Coming. := -i"l j to':, .'
Heath, near Epsom, passed a HOME saying that such suits causing so Mout'Omtzeff.who':;appeared to be By Associated Press More men will reach here to-day. :'f'
night and the cases are c1 ical- Miss buried I thoroughly"angered by ,demonstration New York, July 2.-District Attor-
much bitter feeling; should be: /the fact several coaches, containlngi-i .! ;
Margaret Bask, of Norfolk. street,, : tried In vain to it ney Jerome said, today that there RATE :
out of sight. After some deliberationIt : quell but aban: about 160 workmen are looked for ,f. :
Part.Lane, ,London whose legs have I was decided to have the judges II doned the task and 'left thechair, would be no speedy trial of Harry Thaw this"morning from Cincinnati and .:.i.j IJ"In IJ"-:
been amputated;and :R W. Sentell ol &l. all ,the papers in this and thepreviaassalU4B4they I signifying that the,session had ended: for the murder of Stanford White other'points in that section. The new _. :
l lat'
Brooklyn N. Y, are. In a dangeronrndit Ma Who Had'Supenence : cJt Ri gttii: are=rlevea abe .- "*- 1 -- -* He'said'to: ''plaice theca e on"the calendar I. arrivals will be,.placed Imme4iatef ... k
on at, theenIlory. &*<*,*$ : :, opened .except, Jays order of the I -ahead" of'other 'casesah'eadysalting work and cared for in the sam .,,1 .t'

passed Miss\ May a fairly Hitchcock"food night, of"and New.14 York! doing on-t' t Dharwar( r is-, e urt., < I ether" prisoners would who work had an been injustice waiting to Slight Increase MadeValuations'of building The company with the had others.about one hun' ::"r'.f 1.+


The welL bodies of the dead'are still in Now at Home., TWO( KILLED: S ; &nAR D I Mr.longer Jerome to >,have who their arrived cases; to-d settled.J', will Taxable Property Increased dred and considerable men at work was all of accomplished yesterd -"-l'" 4' ;r..1- -.';;

the waiting rooms of the raTlroad sta leave Wednesday to, resume his Interrupted "' '
SHELD' in i i :
In the loading of phosphate some .
tion. Where no relatives are-.availa. IN COLLISION' i vacation.MARCUM. Over,Half Million.A of the ships which have been Idlj for ; :; ,
the dead ,
identifications of
ble the Lewis Silcox, the farmer from near several days. The arrival todaof 1. :i
will be made by the doctor and purserof SHRT T
Bluff Springs who recently stated in [ MURDER more: than a hundred men will give J: i'l' :-
the New York-
New York that he was shanghaied on By Associated'Press. special meeting of the Boardof the company a big force but even, .f i ,
The bodies of the American victims;
the bark Dharwar and earned to Ant- mobile, .July 2. In av collision between County Commissioners was these will not nearly supply th' ti- :'1 J: ",
are being embalmed for conveyance I TRIAL BEGUM held last night, Chairman Avert there now a large num 4 :-
werp, has reached his.home after an ,two freight. trains to-day rn I nand as are .
home.
absence of about fifteen mouths andit the ,Mobile. Jackson & Kansas City residing[ and Commissioners Andrews ter of vessels at the wharves await. { ;
E. W. Sentell rallied somewhat as SESSIONTransacted Stewart, Sennott and Wiggins to be loaded and unloaded. iJ-
consultation is needless to say that he will remain -Railroad near Newton Mississippi I leg .
after I
the day advanoed and therein future Fireman Dan Ford, colored and ,Goo By Associated Press. being present. The strikers are still confident that !f r
with the doctors the chaplain of Silcox it will be remembered was Sanders, white were killed. Engineer Beattyville Ky.. July 2,-The trial The meeting was for the purpose of they will win the strike and at yet tt'l :
the infirmary was allowed to convey of former Judge Hargis B. French receiving the tax books from Tax have offered no violence towards the
and Brakeman
landed seriously
at Antwerp with only shillings, Boyd was
to him the news of the death of his. which the captain gave h'm for' making Hayide and Jones slightly injured. J[forme" sheriff Callahan and others on Assessor Richards. The tax assessor men who have taken their places .iL'1l 1
wife, son and two daughters. TIle the voyage and came near Starring Considerable Business the charge assassinating. James B. presented the books, which were in Agent Roberts Talks. .
heart'rend'ng! tidings overcame the old to death., Marcum wag begun to-day before Beat: condition and which showed a General Agent Roberts, of the Gulf ., 1tm C.s.: :
gentleman and a serious relapse followed : Considerable difficulty increase in the valuation of taxa when spoken to last ',I t
He had a most trying experience and HOT ON TRAIL OFSTANDARD and Fired One Police Judge Dorsey. big Transit Company, ; iA '
but restorat-ves: were success walked to where he was experienced In securing a jury as lie property in cambia county. night about the matter said: x J" .
Worcester remained .
fully administered. the defendants are said to have madea Last year the total valuation of "The men who have been brought !o-.; : t '
for time and finally '
Replying to the sympathetic' condolences some was OILBy Officer. canvass of all men. available for property subject to taxation was given, here: and more who are expected are 1:1.: : : f f. f
]
arrested for and
of the American consul Mr. to a term in a vagrant, where sentenced he jury duty. at $7,250,000. This year it increasedto not going to Interfere with Pensa. t j .rl.L
prison was
Swalm Mr. SentelLsaid: "I will try ; $7,750,000 ccla laborers. The sum and substance -. t.a
I
to show you that I am a man, although found by the police court missioner Associated, Press The' Board of Public' Safety held a The commissioners took up th3 of the whole! matter is that we !/ fl';
I have seventy years to bear." who secured the address of his mother Cleveland O.. July 2.United: States ,regular meeting last night with ALABAMAM1NERSGO matter of fixing the tax ,rate for ,the have been unable to get enough labor : (:!-.i'
The mayor of Salisbury In reply to and writing finally securing money Judge Taj lor issued an order for a I Chairman Ingraham presiding and year. The school ,board made appll here to handle our business. \Vewere -.1! I tit! !; -
his'messa'ge of sympathy to the American and sent him home. But. for the grand jury to investigate the alleged ':Messrs diver and Mayor Bliss pres ON STRIKEBy cation for an increase for school purposes short handed and about 50 or ,i",'-:
ambassador has received the fact that the'court mssloner.interest charges of rebating and discrimination as the amount now assessed 60 mel demanded J2,00 per day. This f, ,;';
forowing! : ed himself.. in Slcox: it; Is probablethat against the:Lake Shore and Michfsan ent.The board heard reports from the six mills Is not sufficient to conduct we refused to cay as we considered "t p":.
"Acknowledging your dspatch, I 1 he'.ould have been much longerIn Southern and other railroads: In fire chief upon the number' of fires the schools. especially as many new Jt exorbitant but we offered to split i H ;r"
hasten to express the apprecatIon! of reaching his home.,, favor of the Standard Oil Company. duria gthe past month with losses Associated .Press. cf ones will have to be established The the difference: and pay $175 per day, +t! :; '

my government and of the American the Jury will follow up the testimony insurance etc., and then a number of I I BirminghamJuly 2 Because contract school board requested that the rate! which, thfcy refused. t .. t"L
People for the sympathy and aid developed during recent sessions of communications dealing with various the: expiration of their wage for school purposes be fixed at all slowed "We have an advertisement in The shown at Salisbury in the terrible accident the interstate commerce commission ,important matters. two thousand union miners at various and by the state 7 mills and this' Jcurnal; for several hundred men and ft. ;t.".
to the Americans on board the WILL DISCUSS here. Police Officer CV A. :Mitchell, who coal: mines quit work Saturday This: makes was done the road and bridge tax being -'are willing to pay them $1.75 per day xt {t 3 J.e&ch. .
train.' 'WffHTELAW REID." was, charged with sleeping while on did not return to-day strike In reduced one mill and the bond tax : There is no discrimination <;.' '; ;'':
thousand miners, ,on j
duty, was tried and discharged. OiTcep ire reduced one-quarter of a milL The against_ Pensacola labor, and Pen a. ;: :
JI
UIGUERVAGES FOR Frank Robe charged with neglectof Alab3n. ,Others have been Idle for total now is 13 5-3, as against 13 3-8 cola laborers can have work at those ti' !
tile past yt'3.i. It is expected that the l and various: --i .>, ,
RUSSIAN SAILORSAGAIN dutv, was reprimanded. Assocla- last year: The tax levy, wages If they want It. -
TRE.GARBABE OPERATIVES Firemen Donovan and Stearnscharged Commercial Coal Operators purposes for which it Is assessed is "We have about 190 men at the .t- :
I MILL with leaving fire station Con will meet to-morrow and that a as follows decks, but need fully 400 to handle t.r. ;t J ,
MUTINY contract: with. the miners will be 3 mitts ;
without. permission and failing to retort General % our business in a satisfactory manner t;: r t'
--
i for for signed. School fund..7 mils We expect another lot of Ins ;r :.
duty were suspended
--- By'Associated Pren. each. I I Road and bridge fund.....2 mills borers from outside of the state U l-.isorrow. : ; J :
By Associated Press '{Boston; July 2.Upwards of thirty thirty days Fine and forfeiture..'.. .....1 midi ." ;:'
St. 2.-Fresh disorders UESTIONAnd thousand cotton' mill operatives in A petition was Tread requesting the OF .... mm 1 i' :
Petersburg, July board* to remove the patrol box fromtb [SUMMARY Bonds.. .. % i"' '
New England are working to-day under I '
'i ,
the sailors
OF HIGH ,
are reported among corner of SENIOR CLASS ;
southwest DeVilher and ,
M the eighteenth ,division who were '' an Increase of twelve and oneEuf Government$ street. and It was directly 'f 'THEVEATHER SHERIFF VAN PELT RETURNS SCHOOL GIVEN BAY TRIP -tt:: t:7 ,
ring leaders h percent in wages. PRISONER .
in the Cronstadt mutiny facing. residence. The requestrag WITH YOUNG -. ; -
The outbreak arose ostensibly oWing The members of the senior: class of t --:
denied. ii"f'l
to bad food The demands of themen the Board of Works Requests KILLED FOR AN .Chief Bicker requested that the According- the official records at Sheriff Van Pelt returned from Mobile -:. the High School were given a very 1 l l' r '

have been satisfied and the board purchase a fire alarm indicator the weather ,bureau the maximum yesterday morning having in his'custod. ', pleasant outaz on the bay by Prof. t (
t1'l.1JbIe is said to be over. All ,Who Have Complaints to be placed in his house, the oi<> temperature; in Pensacola yesterday) Osborne Barr, a yuan white' J I. B. Lockey Saturday evening :::-,- ..r
-- ALLEGED INSULTBy formerly in use being unfit for service was 83 degrees, at 11.30 a. m., and the man who Is wanted here for larceny j The crowd. which included some ..' e-. 1' ,
SLAUGHTER to Be Present Tie council was petitioned for an,, minimum 70 degrees at 4 p. m The!narrY had gone to :Mobile Immediate! specially invited guests. left the landing : :1!:

OF at II! appropriation of $-0 to purchase the j rainfall ,was between 3:30 and 4:25, ly after the alleged theft occurred but about 1 o'clock and went to the .t
Associated Press. Indicator. and registered .35 of an Inch. During I the sheriff learned of his location and life saving station. Watermelons j fr:

POLICE PLANNED A special meeting of the Board of Monroe N. C., July 2.-J. WKll Police Officer Ed. Spottswood was I the; thunderstorm the wind attained r ra caused. his arrest. '' were served on board during the rip r! tf
: o-day shot. and killed A. ML Hurgess.of granted; a leave absence of thirty velocity of 29 miles. The'mar:mum I Barry was picked np by the police over and every oae> made merry (n '-. ? :I ;
Public Works ,was held yesterday afternoon this county; for alleged criminal days on account of ill health f temperature on the same date iasij upca .the streets some time. since and spite of the [ncleinent weather, which .'l.. : E It ,

By Associated--Press. to take and some numerous action complaintsthat upon the assault on Mrs. HilL Hill has EU--'. John F. Jones and John Christie July was 89 degrees and the mininnm 1 given; thirty days In jail, jmt: sentence had prevailed until within a few minutes ,r;,: ., ;; i:r
continued condition that her j I '
Reed in fc's' was supended pon of the departure. : ,
r rendered for I
Warsaw made application positions inthetire 75 degreesObserver '
July 2.Recent rumors reach' the hall;regarding t
city
garbage also '
This us-
the city. was station.-the crowd dlv'ded! 1i :
i.
that t The 1 of weather conditions rave At the r
tie department. applications
terrorists were organizing for not being properly ,remoTe:!. daily summary .
a rnerai NEGRO ARRESTED CHARGED were referred 4o the chief.'The I yesterday said: j ended however upon the request of some going to bath in the surf an I f! !., .
slaughter of the ,
police were before the
Contractor L'g:: was sated to the t '
Eugene EewelI, who recorder dancing to the music of the : tf: !
t
of Jas. for conditions prevail over some
Paitaliy WITH STEALING EQUIPMENT application Eorwn "Unsettled
; corroborated today when two board and seemed/as; though the t that he would give him ; furnished by Mr Burtofl '
POlicemen were shot dead and three board would annul the,contract, but t.- a s position in the fire department, approved -i lbe; eastern halt of the country where He had been working emplo".1, phonograph ;:, '
:mortally Will Fonde arrest by the, chief was acted upon have been:. showers and thunderstorms rnent. the proprietor.'f' 1"!
Bounded in colored was there .
simultaneously It was decided to hold another meet'ing o ; middle Atlantic ,Sew lI 'only a few days when it Is; When the appetites of the pleasur> ;I"
various by the authorities yesterday afternoon favorably and he was elected. except in the "
police
parts of the city. The streets inasmuch as 'the, ontractor feon i
stole $10 and %
that he the
alleged a quantity been whetted to required .
ar now and locked upIn the city inn Fireman Chas. Turner tendered' states sand .Ohio valley Fair seekers had A
patrolled by Infantry.DELEGATES tends that l.e Is living'np to his con : of goods. delicious lunch was ;, } 11.
;
and removing garbage from the charge of being a dangerous Ms resignation but it was not ac- weather prevails west,of the Rocky : degree a *


the tract streets as demanded.by,_the-te-ms :and suspicion* character... cepted.' The same action was taken Mountains and .an area of .high barometric MAYOR WILL ISSUE FOURTH i served which was enjoyed by all + t f, .:.
TO, ; : agreement.< .
.
,of the Frank Benjamin, who is now moving southeast from OF JULY PROCLAMATION NINE FOOT MAN-EATING :'i :
board decided to hold a meeting (he disappearance from the boom of Officer ', strength Is ,
RIO CONFERENCE The afternoon al,5 otlock'in order to r O. H. Smith of ,a, large number of In Hoboken N. J., Montana. Pressure: is lowest In the : I I SHARK CAUGHT LAST NIGHTAndrew ::, ; ", '. :
this who had been making I dogs, chains and such equipment, and upper Rio Grande valley A maul. Mayor Bliss la preparing a. proclamation 1.1};,,1
hear those about garbage .not being also! a coat' .He denies havea stolen .NEW, ORLEANS FREIGHT mum temperature for Sunday of 100 which he will Issue today, Gidlinga with the assis, if'tance i .
complaints : liberties America of his little son, last night; landed :
the articles. Is reported from El Paso, ranting to Young
Those HANDLERS ON STRIKEBy degrees
l Sy Associated Pres*. removed before,taking action theTowest: this morning was upon the Glorious Fourth in .regard to : a nine foot man-eating shark from : 7 i
e Z York: July 2.-Delegates ,from who have kicks: ,to mak e. can appear Texas; shark commonly ,' !t i
bay. The :
ii In Yellowstone Park. the discharge of fireworks etc.The the is
Pay Day 33 degrees
e and Yesterday. Associated Press
united afternoon .
States to the PaoAmer.ra before the board this
the shark. The catch Jil
known the "Dog" ;
intended
conference fact .tlrey.are'invited ;Yesterday was pay day with, the, New, Orleans, July %.Three hundred "Conditions are favorable for partly mayor issuing as I.
which them. lt : t
opens:fl.i Rio make iIn but kept was made from the wharf of the Don
weather In this_section tonight proclamation yesterday was
Janeiro QH July 1 sailed to-da>:: Sec- to do so.' Upon It depends,whether or numerous city employees, and checks freight handlers on the Illinois cloudy withrariable'wiads. i until late In the night with board wody-Aiken Towboat Co. at ,the loGe' 1 '"
rEtarp Roo will sail July. 4, reaching not ,the, present,; contractor 'will hold I covering salaries for'.the,past' fifteen Central railroad! struck-, : today, for, an and, showers" Tuesday, I r busy meetings. j l of Coyle street. '! ; :
,
*' P :, :
Janeiro July 25. the contract. days .were delivered to'the increase, in wages : ,
n,
Wt: J
-
t >


i ,' ''." >: ."; _-. "_"."" :;,bc_:.... ,1 -,-;__,,?!,} {4 A"-_, ..-_,.i.: 110'>.:-' ,',,:'::.--;. .> y', -:',_'.' ::..h.i"":.'::. "='' ,: '_:'r__,;, ",-*.,r?5-" :". ':. .' ,.," <.T'_ :;



) t, : .; ; >: ;t .; ; ; .3 's ; ; -i ,, .. :: t. 2 ''

; t : ':: v. c t :y-...e ,. t 'S ;&_ t R ?, J=;, I, i%5; f Iy' xe


-j ., ,'PACa:.TWO- ; ---.n ,. .;,;.;., ,."S.. ., :'--?.. n< c" ..,';}f.SACO;: .'.AJOURNAty' "T i.tIO"y"'M'O, R'N' ''H'<'.i'r.( 'JUIY1.9Od7- ;.[

:.J"H ,

: .: '. ." .. '>


,'Sk. < 8..S.. FOR THE'BLODD., .:"IA A ROBEIRtS.JOYi[ '-I! a -.. D r-


",: h. .".. .._. ',' .-' .

'( .$ The demand for S. S. S. has steadily increased since it was first placed I, WIN HIG'H"PRimE
;;!. big the market until it is now recognized as the greatest of all blood nrificrs.'
-" It:'has won its way to success because tT CUHC8' 9l9 AS f and '

t there are few homes where"S.S. S.for the blood" is not a usehold saying.

As the blood is the very life of the body nourishing g strength, -
1 4 to every part disease in some form is sure to follow wheAt becomes. contam < r ,

), ,mated. Eczema, Acne Tetter,Boils,Pimples and the various skin affections i
S are due to an over-acid and impure bloodsupplyRheumatismr Catarrh

,' Scrofula, Chronic Sores and Ulcers, Contagious Blood Poison, etc., are all .. .;
,, 'deep-seated blood diseases and will continue to grow worse and more dangerous :
as long as impurities and poisons which produce them remain in'the Lieutenant Evans'Receives Letter l' _'
blood. In all blood disorders S. S.S.has proven itsejf perfect remedy, and.well '
earned the right to be called the of all blood purifiers It goes
greatest of Commendation for Work
down into the circulation and forces out all poisons,.,impurities, humors 'Is- :said-of "green beernot': of Schl tz. :, '

; and unhealthy matter,and makes this life-stream rich, pure and health-sus at San' Francisco. .
taming S. S. S..reaches inherited blood taints and so enriches the circulation ', ,
= that diseases of years standing are permanently cared It contains no Lieut Holden A. Evans, who war- -
: harmful minerals and is nature's real blood purifier. Book on the blood and appointed .to the nary from Roberts,,

b" ,medical advice free TIE.8WHTSPfCtfK.CO, AJLAMTA GA :navy Fla., bag department been highly for his' praised services by daring the .; { Schlitz beer; 'i is_ aged;< in glass enameled steel

= the casastfophe' at San Francisco, "
.
and also by the officers in charge of "

F ELECTRIC I LIGHTSRemind : the work. LleuU Evans has a numberof months i marketed. : Fer-
it is
: friends, in Bscambia county, who !1 tanks for before V
will he pleased to learn of his exemplary ..' ,
Remind you of all other kind of lights.., Because they *conduct which is 'such as to ? :: -.: ; .-

1- surpass all of them.. Do it now. merit- praise. ICs [mother resides In :

; l Fans, lights, bells. Everything electricaL W.Bonifay. J., Hamm'and he of'is'a this brother city ot; Mrs. L i !.mehtation is finished long before you get :it. ,

'_ The Gorrepondtnc .. .t *-
ELECTRIC COMPANY .
PENSACOLA The correspondence. between the -- -- ::if : < :. :

V '5O2 S. Baylen St. Phone 570. Lieut. Co!. Karmany, the commandantof ,- .. ,
r3 h the Mar Island nary yard and the '

"Marine nTy:department Barracks, ,Is.Mare as follows Island: CalI- That is' :an: 'apparent virtue. But the chief

,
I fornia, May 15, 190 .
'BROVARD ,
M PRESENT AND I have the honor to Invite

jour attention to the services rendered .
by Naval Constructor H. A. Evans .- : distinction of
Schlitz is
i its that
U. S. Navy, while the Battalion of :Marines purity-a virtue you

'TO EXTEND I'to A BEARD TODENJE. San Francisco under my command CaL recently was on, duty Mr ,, .,,: --.1, :

Evans joined this command, voluntarily -
i on April 20th and served for 'can'qsee. Yeti the. cost tof that purity exceeds
ten' days, when he was returned toMS "
: ', C4 i *" ./'' fe, : '. .
; 1f WElC ME regular duties by order of the .I.y:: "' ", "" '.' '
commandant He was attached to < ,
4 one of the four sections Into which ', : f
r the Fourth Military District was dl f;: : -; : all other? .costs
Tided, and at ono time was in com '
Key. Thos. M. the mand of this section. ,He was zeal '
Calloway at Ask for fine BreweryBottling.Comnton ., "
They Will Address the People Here ous and rendered important and efficient

: Church service and to him belongs the beer is sometimes substituted
Baptist Sunday for Schlitz; of
OUr
Some Time During the credit in a large degree for the ,
'

Evening., Month of July that prompt section.suppression and the establishment of 'disorder of 1n.. To avoid 1 being imposed upon,.see.thz.t the cork or' crowns. branded .

relief stations and camps for the
.: The spacious First Baptist church ref ugeas. The loss of his service was bre
was never before crowded as it was Governor Napoleon B. Broward and much felt by me when it became ving.
i cjx Sunday night when there was a Hon. John S.. Beard who holds views necessary to withdraw him.

. ;' gathering of many congregations to diametrically opposite to the governor "Very respectfully. / .
fft: extend a welcome to Rev Thos. M upon the drainage question. will "I... KARMANY J '-. "
Galloway who has just reached the lock horns In' public debate on the "Lleut-CoL U. S., M. C., Commanding '
: city, from Talladega Ala. where he ;.. ', ,'
subject some time in July in Pensa- Marines. ,: ::; :{
has served for more than ten years. "The Commandant Navy Yard and
r: 'The available cola.The ; > ;
filled
congregation every .c -' :lt
meeting has been arrangedand Station Marl Island, Calif.TM'Navy
t. ,seat In the house, packed the the speaking will occur' in the _

:.. aisles the and seats crowded and the walls spaces, while between -, Plaza, where seats will be provided 'Department, Washington, D. C.:, I .. .- '.' ...-':,:)
for the public and where thousand -
,- ? -June 12,1906. ; tY
'1, Jiandreds stood on the outside and ran gather in comfort to hear thesetwo ISir-The department takes pleas ;:
home unable to
returned being
many -
." hear of service. I able men. '!re-b transmitting herewith for your Phone 16
"i any the Mayor( Bliss, who was recently in Information:.A.copy of a letter' from
.The welcome service was a most ; The Lewis Bear Co. '
If he
I Tallahassee, &ske.i'the governor L&uteoan'tCblonel Lincoln Karmany, "
ltl: excellent one. It was opened with MaL. aid Palafax'Sts. PensacolaThatMadeMliwaukee
would have any objections to meetingMr. U. S.-31arine Corps,' forwarded by the ,
of the
rayir. Rev. F. ,
by ARogers
r Gadsden Street Methodist church.. j Beard In public debate in Pen sa., Commandant of the,'Navy'Yard. Mare .
cola some time during this mouth' Island', California) ;'relative! to"the' e- -
S most The excellent immense choir' : tendered'theinuslcz a'.and received a reply that he would. cent: services performed by you during ,- .. ,
hymn,- and
be glad to address the. people of I the recent 'catastrophe In San ...
heard
the best flic Beer
: was Inja sacred pronounced edifice In Pensacola.ever! I ILA I jPensacola, upon the drainage of the Francisco California.. : 1" ,
Everglades and the recla.lmlng'of! "In forwarding'this letter the Commandant .
number of addresses of 'Welcome
i thousands of acres 6f land. Upon'Ms expresses ''himself* as follows -
were then delivered On.
by pastors.
f{: behalf of the Baptist churches of the return| 'the mayor called upon Ar? :
;Beard who is opposed. to the, gover I "Naval':: Constructor Evans' was,
-
11 Rev. J. W. Senterfitt spoke 'a
city ; ,
: nor's scheme to dram the Everglades, his assist
, behalf of the ministry of the city Rev., upon request to in tile work Famous
and' the latter agreed to join in theJebate. hi San Francisco, .directed to report
r Jgllaa.S. Sibley addressed the congregation : :
; j taiUeutenant-Cotonel Karmany U. S.
,
:{ and welcomed the paster; .
: The meeting has now been ar- Marine Corps; and I have much '
t : a behalf of the churches
$ on
sacola Rev. Percival H. ofPen.i ranged: but: as Mr Beard will leave pleasure in': inviting attention of the
r.:. tended the welcome. Whale1.ex'j the city in a few days for a stay of department to the letter of commen-
ten days or two ,weeks It will be the dation from Lieutenant-Colonel Bar lain cause pending therein! where U I

, =, Rev.The Mr.addresses Galloway were in replied a feeling to eb by latter portion of the month before the many, of, the 15th Instant, enclosed MAN KillED BY OFFICE OF S SUPT1ABOLiSHED Legal AdvertisementsAdministrator's, M. Davis is complainant and Paul) Peters
Spent and impressive manner.jSeated debate occurs, but when it does there herewith. Mr. Evans' return to Mare Notice of. Final Settlement and Helena E. Peters, his .g, upon the pulpit were the will no doubt be an immense ct/wd Island was made necessary by the In re estate'of Join W. Fra- are defendants, I will sell al i>:,:l.c
present to hear these, interesting work at the yard needing his atten outcry before the county court o sure
i: of of the churches, '
; pastors many city ter deceased. (Notice is hereby given
,, speakers.Do tion., door in the City of Pensacola: ia said
; all4of whom greeted the new addition !- that on Tuesday, the 7th of August
day .
-A copy of this letter will be placed I-A i county, to the highest and best t)dder
to the ministry: with pleasure. A 1906
4 FAlliNG BY at 10 o'clock a. m., or as '
Your Bowels with official for of August
Not Neglect your record cash on the tit!! day
;The music was pronounced by all: soon thereof as be heard, 1
h. from ''' same can
ta be by far the best ever heard hereand (Many serious diseases arise, 'Very'respectfully, will apply to the Honorable County A. D., 1906, during the legal
Choir Director Lurton deserves',neglect of the towels.Chamberlain's TRUMAN H., NBWBD'RRiY.' Judge of Escambia County, Florida, hours of sale the following' described
Stomach and Liver Tablets are a Acting Secretary: property situate lying and being ia
for the manner In which for final ;
mjichcredit a
the admin.
M discharge from
pleasant and agreeable laxative. They INaval Constructor Molden A. Evans the County of Escambia, State of
conducted this portion of the
he
: The many members of program. the invigorate the-liTer and regulate the U. S. Navy, Navy Yard, MareIsland. TREE p. A. & I istration of said HARRY:estate.L. F3ATER, Florida U>wlt: Lot Sixty-three ((63)
all druggists.DOG j in
choir,':as well as the director were bowels. For sale by Calif. Administrator. Herman's Subdivision: of Lots NaTwo
heartily congratulated upon the I Dated February i 1906. ((2), Three ((3)), Four ((4)), Five
oam6m'
music LICENSE'TAX *I iCAGO's.'u' N IQU E'B'EQU EST (5), and Six (6), in Section (5) FIT%
t i NOW DUE IN PEtiSACOLA -' Henry Miller Met Almost Instant Township (2) Two South Range "tai)
'J Fwd .( ",000 Tear; Now' Avail. Chas. H. Dishman Who Has Been Proposals will be received at the Thirty, West, Pueblo Primes Tract at
NEW' YORK ICE The dog tax became due In,Pensa- Me For Art Momment. Death Yesterday at Corner Bureau of Supplies and Accounts, Goulding, together with the tenemenu,

cola July 1, and although no licenses: Fountains and statues soon :will, begin Holding the Position Has Navy ,Department Washington, D. Co, hereditaments and appurtenances
TROUBLEl have been issued it .Is because the DeYillier until 10( o'clock a. m; July 24 1906. thereunto belonging or appertain.!
t W EN IN to spring up all over'Chicago, and and Jackson.Henry .
I J city has not 'yet received the ta'for L&N Contracti and publicly opened : Purchaser to pay for deed. Geo. T.
all wm be ** Big ,
1906 but they will reach here in guaranteed to be A No. 1" I after, to furnish at immedlatelrthere-I: Morgan, Special Master in Chancery.
9: l : art by the trustees of the An Institute 'Mmer,?a'colored laborer met sacola Fla
New York. July 2. The board of al-' the next few days. a quantity naval supplies SJulyoawlw.
dermen today adopted a resolution requiring -I!!_ By paying this tax a party can allow and also will bear the "0, K." of the almost when instant death yesterday after*'i I The office of superintendent of the as follows; 'Sch. 27. Harness
noon, a big oak tree fell him'
the district attorney to begin his dog to run at large as a tag is municipal art commission says a Chi upon Tensacola Alabama & Tennessee etc., dump cart-Sen. Mr Copper rivets Notice for Publication. Departmentof
x .f criminal' proceedings against the officers provided so the dog catcher won't cago dispatch. The first ;year's ofItatul.l7 Villier at the comer of Jackson and De- Railway known as the Perdido road. composition nails, hardware; sheet the Interior Land Office at Gaines
f4 of the American Ice Company) ;!I bother the animal, but all those that will be crop streets. The accident occurred has been abolished knd while no]copper and lead, pig tin slab zinc, galvanized stile FIa.. June 18,. 1906. Notice is
worth during the electrical
which
about storm,
4 .charging conspiracy to advance the are not provided with tags are to be f25XXX: was definite information ,could be secured pipe, pipe fittings. Applica- hereby given that the following untied : -
: 'price! of ice. I(I caught and., killed.v and the annual harvest will Increase accompanied by considerable' rataMiller I{I last night it Is presumed that Mr. C. tions for proposals should designatethe settler has filed notice of his into-!
until In fifteen or twenty years from was one \of' a gang of men H. Dishman is no longer connected schedule desired by number. Blank tion to make final proof in support of
now Chicago will be decorated with who were removing the tree from thestreet with the road. He could not be found proposals win be furnished upon application his claim, and that said proof will) ce
nearly $23,000 worth of brand All the limbs had been sawed yesterday afternoon or last night. to, the navy pay office Pensa made before Clerk Circuit: Court: **
new art off, and. the. trunk had been cut almost -,,, It Is .known that recently he was cola Fla. or to toe Bureau. H. T. B.. Pensacola, Fla., on Aug. 2, 1906, vui '
every year and- Its parks will look like in two when a sudden gust of awarded a big contract for grading Harris Paymaster General, U. 'S. N.i i Barley H. Bachar, of Nokomis, Aa.:
cemeteries or'art museums, while Its wind struck the tree. It swayed once work by the Louisville & Nashvilleon 5-27-06 SjnlylO I Hd. 29139 for the NEtf' of Section J,
A streets, will,resemble courts of honor or twice and then began to fall to its lines in Kentucky, and this will Tp. 5 N., R. 33 W. ''He names the fc-!
Happy Home during a fall festivaL the ground. The men all saw what Peep him away from Pensacola most SPECIAL MASTER'S SALE. towing witnesses to prove his continuous
was occurring and ran. Miller :was of the time. The contract! will require residence cultivation
This large order of art decorations Is the By virtue' of a final decree of fore- upon and
tile number, but he
among ran
a year or more to fulfill. closure of said land via James Hu>
:
due to the rendered by- the Hon. FrancisB.
To,have a happy home must have children legal establishment of the. wrong way and the tree fell'upon him.)!*, Mr. Disbma.n'has been superite &. Carter, Judge of the Circuit court. bird of Nokomis, Ala., J. E. Hubbird,
$1.000,000 of
you fund left Some the large limbs struck
by Benjamin F. across 1
ent of the P. A. & T. for a long of Escambla l of Nokomis, Ala, James Seale, of So-
1 i as they are great happy-home makers. If a weak Ferguson who died a year ago. His his> neck and one of them was driv-, period of years, and was esteemed by: sitting, In county a certain, Florida cause, in there chancery -f komls, Ala., F. M. Hubbird, of Pens-

:, woman, you can be made strong enough to bear entire to estate form a was trust bequeathed fund,the to incomeof Chicago en through to 'saw the the body limb and to U was extricatethe necessary -'all who had business with the road in'pending In which the Esc-mbia i Ico'a.''I. Fla. W. O. Robinson, Register.

healthy children, with little, pain or discomfort to which is to be expended by the body. I j 1 I Children Fla.Realty. was Company, In.. of Pensacola! 26juneoawhr.f -
Bowel Complaint in complainant, and Warrick
Assistance rendered at anda
; yourself by taking board of trustees of the Art Institute"In was once f Notice for Publication. Departmentof
; Pickett and Emma Pickett defendants -
physician hurriedly called, but the]I !During the summer months chi\ were
the erection and maintenance of the Interior Land Office Gainesville
at
'l will expose
for sale.at the
man passed away within a short time> dren are subject to disorders of the I
enduring statues and Fla, June 18, 1908. Notice !a
monuments bowels- which should receive careful county court house door, in the city of
i WINE : ; The trust,fund was legally established PRESIDENT AND MRS. I[I r attention as soon as the first unnatural Pensacola, Escambla county, Florida! hereby given that the following named
; k In the probate court on May 23 FAIRBANKS AT HOME, looseness of the bowels appears. The: on Monday, August 6th. A. .D., 1W6,I settler'has filed notice of his! intention :
of
CARDUI and the truateeaof the Art Institute Indianapolis, July 2.-Vice President best, medicine in use for bowel com1 during the legal !hours of sale to the to make final proof in suppon
OF met recently to V consider, how to expend and Mrs. Fairbanks arrived here plaint is Chamberlain's Colic! Cholera highest bidder for cash the following I his claim, and that said proof w'l:) J8
made before F. W. Marsh U. S. Commissioner !!
the first Installment of the In today and will! spend the summer at and Diarrhoea Remedy as it promptly described real estate, situated, lying ,
come their country home In Illinois. i controls, any natural looseness Vof and being in the city of Pensacola,I at hIs! office at PenEac-a.>:

: Woman's Relief President Charles I*, Hutchinson of the bowels.. For, sale byall: druggist, Bscambia County Florida, to-wlt: Lot I Rachel Florida on August 2, 1906, F ri:,.:
seventeen C. Irwin, of Mary Esther.
(17) in Block
... the ,Art Institute has one hundred
-- anggsted.'thatthe :' SALE. and thlrt1-o11f'- (131) of the East Hd., 30S5%. for the lot 4 of Section: M-
first piece of statuary.authorized -, FOR Tract, Eatt' oa.TarragnnaStreet: Klngl Tp. S., R. 24 W.. He names the f Flowing
It will ease< away all your pain reduce Inflam- by the board of trustees take the form Meat Eaters ,SHOW, CASES,WALL CASES AND per map of-elty of Pensacola published e witnesses to prove his coating:
q: matloncureleucorrheawhitesfallingwombovarIan I ( ) ef an elaborate memorial to the donorof SAFES. APPLY OR .ADDRE&S P. by Thom C. watson in 1884. 'ous residence upon and cultivation '-

: trouble disordered backache .the unique and magnificent art trust UNDEN4TRUTH, THE JEWELER.', Tdgether with the tenements, hereditament' said land viz: Asa Ward of M*"'
menses, headache' fund for Chicago. '!The.late Mr. Fer- gain strengthand .PENSACOLA. FLA. and appurtenances there- Esther Fla., John Riley WrighT. ,I

L etc., and make childbirth natural arid easy. Try. it. genoa provided In his,will that the es- unto belonging or in anywise: apper Mary Esther, Fla.., Clemment Brow.
frt At every drugstore in$Loo! bottles. tate should, not 'be touched: until It economyon NOTICE.Is taining. Deed at cost of purchaser.. of Mary Esther. Fla., T. C. Brooks ?
amounted to,' Sl.000,000- said President hereby given that- on the 5th day Samuel Puoo, Jr,* Special Master In Mary Esther, Fia. W. G. RoVnsra.
.Hutchltison. ."When the,year.re of ,November, A. D., 190, I will present Chancery. 3julyoaw4w 'Register 26juneoaw4

WIRE OB A unn '"DUI 'TO' CAKDUI quired bylaw forV r **ting'expired on to the Honorable County Judge

Y. .freaty'sad frankly telling us-a H your and nothing: else, laity baby{M,now May 23 the estate amounted to !f L075- of Escambla and vouchers County as Florida guardian my accounts of NOTIcE FORECLOSURE is SALE. Magnolia Temple, No. 4.
t trGu Ies., We wlHsendfreeadvice (topbdn two,weeks oM," writes Mrs. J. P. 000. When the bequests are:satisfied estate of Genevieve hereby given that under Rathbone ffsters will have a *?*-"
; h' :'] seated eoveiope). Address: La- :(west.; of Webster Qty, ftva "SheIs'a "....have left; about $23.000,a year for ,GrapeNutsTHERE'S the minor, and"make application-fora Parkhill final a and by virtue, of a decree of foreclosure clal meeting Tuesday, July 3. at 2':;>
"
arid
: {dias AarlaoryDept..Tbc Cbattanq&' toe; healtty bate and we are' the:art b quests. We*are"very*fortunate discharge: from 'sale rendered' on the 29th p. m. All members are requested >
_Memctnn Co., u said'guardianship. day of June A.. D190 by the Circuit be there will be impottdbusiness. :*
1r: ChattanoogaTaan.'r : th4, ,' h w.nrnee'_the Ferguson A REASON May',%nd. 190 ., Court of the, First Judicial Circuit present as
-
fund lathe. only one- of.the kind la the l E CLMAXWELoamfcn. of Florida in and for Escam&ia
SMITH
:MRS. F..' M.
'" :<,;: .. ', whole world.V Guardian.'County, in chancery sitting, in a cur.t M. BAA

,, }
t.
) <.
,; "" '
,,'!!t "j:' r"t! ;;j<' > J c: "":.i!: : _T't: "" f

';. : ,, '..;,."",.r "?''?J'--r' ,-:,'::U-_.,:- """' : i ,> '-_ _. ?',, r- ,f.--.t, :, :1'.0 .::,1-,' ;;'' ,"'- .i,:,. .::.._,\ )," :: ..... '." .
'_ < .., ,. : .,._,, "_ ,",,, ',_ ., .", ,,>) _., ', .,,. ., >_. > .:.. -',-:"- ',.:,_" : '
; :.... _; -I



iJ "' : ':" J { i ; i; 1i ( : :i Si : ::po

.
> -.'
i
"
tE
.' : -
: -
: .t t 7VH "ft tABOL'A-'JOtiR'W A:L7ttI6 ftO A'Y'BenJalob : MOR"'Nj r J1ittY::, 1IDtw"-'+ ,r--

y.t., iia&. FOUR,. __"' _...'_L b. _W .risaa.c. _. '_" X'4" : : .
t > ...A ,; __ > _' -- .' ._. ,--. .- -- .... > .
fI.r
,"_ < fft w wOf y HitMB are
w w a .There many ;
.
f, ; O poor blood heads the list. The doctors call LAWN PARTY
;;
;

t. J ,JonfnalDAILY. l.s- of. Pensacola:: i N ervousAt; your first. 'Jhe opportunity blood 'lacks, consult red corpuscles.your doctor


4 1 -r "' .f. F I and : J! shot"toting yer's Sars.panlIa. Ask him If.be has anything better for Wlt.debility' Under Auspices of

.
.o.o..o..i nervousness. .If he bas take it. If not. ,take Ayer-s Sarsaparilla
ness
....., Wapabtish I.O..tJnOe,
what are after. ssfiZHJZ tetae.f_ i*...,T.H..*,
WEEKLY. SUNDAY. Get ToPell.thaf you "! n mv m
.. ,: .-...&...._.'-..-.:.,...- &..- ... +........ Y. M. C. A. Auxiliary

MONDAY -
PUBLISHED EVERY MORNING EXCEPT :- ,
Right in the Swim. -. implements thaa' tongue or pen-asapeparg
; ...8Y.-' *. Pensacola has had a'meat lnspeotion t<> be-thecase in this particular at the spacious
With ruction it 'Is about time-for lawn of!
sensation all of her own.. -
; THE JOURNAL COMPANY.FRANK her :accumstomed goaheaditiveness sweet peace"to" begin to brood ,under To Merchants

; the wasnt content for/the great pack the compulsion,& weary and indignant Hotel
ing house cities to have the. sensation public opinion.Tampa Herald. EscanibiaThursday
'
L. MAYES. President add G.".r.l .a"ao. all to themselves. Tampa Her- ?* c;*- *
a ald.P .- Hat the Habit, :;
., Mayor Bliss of Pensacola, is' now Are you fixed for July 6

II1IEltllfIEII- THE ASSOCIATED PRESS. n.acola's Good Example. visiting Jacksonville for-the purpose ,

Pensacola is determined to.,be 'in of Investigating municipal ownershipof = the July call on White 6 to 10 p. m.
good shape, no- matter what it costs, Jhe water works plant and various

: SUBSCRIPTION RATES. and to this ndr-the sanitary officers other Improvements. It is to be hoped Canvas? We in Band Concert. Refreshments
working and the out the city carry Serve!
One Tear..................$5 00 One Month*.............. ',** of that,thriving city are -sal mayor will not clean works
Six Months...............; 3 6ft One Wek................. 1*> they"have the hearty co-operation mosquitoes.of council that and the boars' of public in his all widths and sizes -=
tie citizens.: Germs and city as is his custom
Three, Months..... .....<.. ,125 weekly: Edition 'per year.lOC places tell though
: will find no Inviting lodging native town. Cant ;

there this year. Other cities in Florida habit is a wonderful 'thing and he z'- -. lines to retail $1.25 to,

The Only fVmacofa Mnmuifff F.... f1/S kb a Y.talMd will do well .follow.the, exampleof certainly has, the habitQuincyTimes. MoonlightBay
4 Pensacola.-live ,Oak Democrat. '
Circulation Statement Cm. gm,1-' +.aat++sdv . $2.50.( Mail orders

Junglelzed 'Meat Scare. Tainted' Meat Barred; I

:.I -In Pensaeola the people, have got The city of Pensacola is determinedthat shipped day received ExcursionPALAFOX

'Omen.108 and 110 V'v. ..r* en Sal en Trains the. jungleized meat scare and have tainted'meat'-shall 'not bs _sold
: Eut''f, .
taken to fish diet and in that city.' The discovery of spoiled:
Gev rnm nt. and .t all,.Nawa tancl.. as a regular ; }
there is not enough fish to go around. beef doctored with chloride of lime is ....by_
-..".. In New York City the sale of canned a hint .to health -officers, and" the I.T K. ORR SHOE CO. METHODIST SUNDAY

, goods has fallen off. and the peopleare stand taken by Pensacola can be fol-
FNsAeoIJA FLORIDA. TUESDAY MORNII6'G..JULY 3. 1906 demanding fresh meat As a re- lowed' by other cities and counties SCHOOL CLASS, No 11.

: r sult,-the'price of meat has advanced without fear of injuring the public ATLANTA GA.

a cent and a half a pound. Whatever health. Live Oak..Democrat Friday Afternoon July 6
; Body Blow for the copolies he says that it is impossible !happens, the consumer paYIthe .,y-,.- The Only ,BouseI I in the South 'who can size you in Low Cuts
to control 'them, that they "mast bo I
'
Mobile Should
freight- Register. Read Up.
The commodious
.Florida' News Bureau. absolutely destroyed. They most be The'Pensacola. News seconds Chancellor through July. COLUMBIA large and will be at Palafox steamer rr-.!
exterminated root and branch .
More Trouble Brewing. Day In his attack on the presi-
The Florida News Bureau has ret ready for passengers at 4:30 ic: ct
The trust who nave been '
magnates If the McGourin suit'for the dent for disturbing the packers and
; 'ceived. another body blow In the talking of .Mr. Bryan as a conserva- of the lots:on the south side possession of Incidentally it defends the packerson The boat will leave at 5 o clock. goii$

- ; hape: of a direct denial by one of tive will likely change their opinion the railroad was'settled by the-recent the plea that,.butchering is not a direct to the Life Saving Station tiJ
Fourth In time for
The
Glorious F F'Will returning cars.
the gentlemen named by the bureau of him now that they know he has no decision 'of the Supreme Court there cleanly business best Its editor Refreshments on board.

:- -"subscribers" to the fund for its sympathy with trusts. They, may: yet would be the crumb of comfort in .itt should read, the Neill-Reynolds report ROUND TRIP, 35 CENTS.
-juaintenaace for the of "en- come to the conclusion that he is, a that with It was settled the title to again. Would' iLbe prepared to say
to'" purpose radical after all,. The.nominating convention several other pieces of property; that such filthy methods and Immor
;
ilghtenir 1. ;' the public relative to the is'& long way off and' they around town that- are In like condi-: alitybreedingsurroundings as are be fittingly celebrated this year by theKnights

;r Evergiades ,drainage scheme, that ,he ,Lave plenty of time to think about it tion.- DeFuniai, : Breeze. tbere described are inseparable from

i' J fever contributed a penny to the purpose .. the processes 'ot'": nvert1ng. 'livinganimals
t ( for which Ool Choate's "news" I The editor of The Albany (Ga.) Bliss and the CounciL Into ,hnnlanfood, that it Is Bay ExcursionTO
{
Dally Herald lets out the following They are having a somewhat vociferous impossible: to- ''$ack pleats without of ColumbusWho
.c tcreau .established., The .Zolfo
wag wail j. i*, time up in Pensacola, the exact sealing up poisonous matter with
:Advertiser states this particular i in .of which is Mideal Times-Union.
cause and nature them Jacksonville
This"'sort of weather} calculatedto OAKLANDto
'
stance'as follows In| an impenetrable cloud of verbal I < ** .e
.. : put a kink In almost any ambition' : will give a Grand Picnic
,The Florida News Bureau and'seT'eral and turn the edge ofthe"keenest en- dust It seems that' :Mayor' Bliss ii'at Has Quit Western*'Meat
newspapers have tried to createf thusiasm. When the temperature is Irreconcilable* >o " the impression that a number of Arcadia ranging almost up to the hundred members of the council'and other officials -meats. With good fish plentiful and Wednesday 4,1906
and while neither party to the cheap and poultrfralways local sources GRAND REUNION ANDPICNIC
gentlemen and others were: payIng notch it.Is conducive neither of strenuous ELdTR/C
AT
:. the expenses. of said bureau. physical effort' nor of laborious controversy can do anything to the possible "why should] Florida PARK
Hon T. B. King of Arcadia was men mental processes. ether, they refuse to quiet down and send her good money away? AH the
itioned as one of these contributorsand let 'the unpleasantness be' forgotten. same, the meat'is 'at least as good as We want all, to come.. You will
Come brother
-: Tuesday we asked him if he wasa to. Pensacola ; where When things get into such shape that it was,when we:.voted.lt. "prime" and
,contributor. Mr. King said he was the heat'is never excessive and.where there is no chance to fight it out found,ourselves able to work on ..itJcaksonville have the, time of your life 01 the !
Knights
not; he had not contributed a. penny I cooling breezes from the gulf temper squarely and completely with other TimesUnion.different' o Pythias

ij for such a purpose. He expressed I. even the most heroic efforts:of old --:. On arrival of 3 o'clock, car a patriotic address WEDNESDAY, JULY 4, 1908.
.
: the himself Everglade as not drainage even opposed though to the he SoL Pensacola has 'em all skinnedas sible" should be worn. The, fact that '' song and riding on the front will be delivered by the Hon. W. A. Blount, Jr. Given by Magnolia Temple No 4,

to the tax be a summer resortThe clothes are a necessity- civilized seats"in the Bryan !band wagon. We Rathbcne Sisters. Fare for roual
was 'opposed drainage
',..lllrnug that the state at large should, countries does not remove the fact have not'as yet deserted, but we are At 3:30: o'clock match game of base ball between trip, 75c. Steamer Columbia w':'

> 'pay the cost. This was just the answer Washington Verdict, Calpley's that they are also unhealthy. The getting'lonesome and if this m'ghty' two of Pensacola's crack teams the" winning leave Palafox wharf at 7:30 o'c'ock:
j we expected! and we have no new! weekly paper made its initial appearance -body cooled by nature' ,breezes is 'Bryan boom tlon't collapse pretty -

-; doubt that if asked every one of ,the last week and is a welcome healthier and more comfortable than soon (and it win',not) we expect to team to receive $25.00 in silver. .
would deny contributions those whi'.ch are bound with tight and line up as near--the "front ranks In
gentlemen
tl.?> 'the addition. to the .ranks of Florida jour heavy thick- clothing and denied the the Bryan columns .as. 'possible and
to such scheme to defeat :
any At 5 o'clock the field
rwishes of the people of Florida., nalism. It is published by the.Washington life givingsustenance in every'atom of, make,our clilnS+ aVXhe only and original sports'Catching begin_ a.m.MOONLIGHT

knock and It County Publishing Co., and the fresh air- The bath is perhaps, one Bryan-'))hWr.='In the meantime, the' '" '
This Is a pretty hard .. greasy pig. \
name of L A. Hutchinson appears at of;the most lmportant'features of all however Tillman has been doing good ? .
riI"t&ke considerable explaining on on the subject of keeping cool, in the work in the senate proving to th'e.na. Shoe' "" Y' ,
head .of the editorial column mixing race. ; .
the as
.the' Part of the "news" bureau to correct summer time. Frequent bathing: cools tion his ability-' and his'.courage toact
t1eral manager. The Verdict well the the of.-the' skin and wirat hef believes ,be true Hurdle race and
'' the impression which Is but ; body, opens pores say to many other sensational
'natural, tHat It published a myth'cal II'II'g: newsy and typographically: and gives health, vigor -and comfortable -I I!; and rightrTlllmah'Is-one:- : of the great EXCURSION

and, as the field is Sample; temperature and permits sleep! men of today, but he may never bepres&enLife'Oak
llsf of alleges: ,subscriberS in"order in the hottest .weather:, *- 1 Democrat. .sports.All
will undoubtedly a The even \Vinners'wil .
prove success. i receive valuable prizes.
bolster up its cc'm that it was representing Therefore. 't6 keep cool eat only t!i ; : %p ., \ ->1-

vitally affected interests. Journal welcomes the new 'pu'blica-j light, healthful foods, fresh>vegetables,I'Florida for Bryan At' 8 o'clock, grand prize dance begins, 5ty:
tion and extends best, wishes:for its
LADIES'MISSIONARY SOCIETY
: and TheJournal for instance, drink plenty of cool wa-| There was practically no surprise
-- AH.explanation is in,order
..,.:.... has no floubtJt. will A be forth- future prosperity. -I IT II ter, or lemonade.keep the'mind even! expressed over the action of the State couples taking.,.part, winning couple to receive FIRST PRESBYTERIAN CHURCH.

I and temperate leave .off drinks and] Democratic Executive Committee in $10.00 in
,:i', coining.. Whether or not ft will actually .editor of the Live Oal .< Democrat intoxicants entirely,wear as few light!' placing Korlda,upder-lhe-Bryan banner gold.

'nplein- anythlns satisfactorily has started Kick Column and clothes .. '
very thini as possible meet; 'TheiKOPie have cometo, see
: is another matter. recent issues of that paper indicate. the customs of the country, bathe that William---Jel llngstQ'an! has lost Grand 'FireWorks Display at 10 o'clock. JULY 4Steamer
that the people of Live Oak have
frequently in cool water and never, nothing trf his humanit&rianism,

,The Atlanta News' states the cue plenty: of grievances., permit yourself to 'get angry or excited nothing of his,*;sympathy for ,the "

In a nutshell when it says: r"For our and you will.find that the hot masses.. But with the passing of the Reduced. rates on all .railroads. Electric cars w

: think 'the\ Isle The Home Coming fever is spread weather will not:cause you any great j years have come maturity of thoughtand half hour. 3.IONARCHtill! leave Psi-
part we '' run
own' leg 'Alabama now suffering fromit inconvenience, especially a town as the knowledge that patTence and every afox wharf at 5 p. m. and return a' 11)
'_ ot Pines American territory and, and Birmingham seams to be. the elevated and as healthful as Atlanta] diplomacy are as essential to the ac- p. m. Surf bathing at the Ur* Sar-

) justice 'to the American majority center of the epidemic.Justice compVshment of .great economic re- ing Station and a run into 'he gulL.

: there dictates our duty to so assert' 'If. islHirlEff+git H "H forms as are courage and force. VISIBLE TYPEWRITERSThe Refreshments at reasonable prices.
Brewer's summer occupation J So Florida indorses Bryan for pres- FARE-50 CENTS; CHILDREN, 25
to it by our own sowLerelgnity. Best
and govern Make to Get Is
to be that of hot *? NEWS AND VIEWS
seems pumping ident In'1908.-St.Augustine Record. CENTS.

.-"- I air Into the Taft persidential baUoon.t FROM STATE 'PAPERS.' *l L. C. SMITH & BRO'S.

'Ii. iK lf$9i tl' k+ .iF tff iNE 1Ftli lE'ilHldfrt .
ARunning Mateo ...,II. >>..,III.III. I..,. .teir a r.jr.jE.jf fWvr j j r>y sfHrisritryfiirJ JV, j j .p. :JtrJtfttrarytrmi yT miMMMMi''JC WJV fc MADE BY THE GUN MAN
t Write For Catalogues and PricesL. Escambia Pressing Club

( Mr KEEPING, COOL i VOX'OPULI; I Ie
Bryan Should Go 'to Headquarter S. Brown, 'Pensacola, Fla.
Now that Indications point to the IN SUMMERTIME,, ft Some of the,anti-drainage editorialsthe : Dyeing, Cleaning and Pressing ct
b t esteemed Times-Unlon is copying .f..* .I it+S> iS gentlemen's and ladies' Clothing. Club

'nomination of William Jennings Atlanta News $ and crediting to certain state exchanges rates only $LOO per month. We call
;". Bryan for the presidency by the Democratic a ; are doubtless very good, but Ice lIDe live"1. need have no terrors ,for you for and deliver all work. No. 9 l E.

'.k.: party In 1908, discussion rela- "'Ifl-H "H H we would gently suggest to our dIstinguished Editor Pensacola Journal.' WASH DAY' if you send your washing to Intendencia.

live to 'a suitable running mate. for metropolitan contemporarythat While I dislike to go on record as WALTER MAULTON &. CO, Props.
liim seems to absorb considerable of 'How'to keep cOOI.ls! the questionthat if it would send across to Charley a "kicker," there is one matter of The New Method Laundry Selix's Old Stand.
is uppermost in' the minds oeverybody Choate's."bureau" these articles : great public; interest which I think I PHONEti86. I E..W. LAWRENCE. Prop. *..8 WEST lalun ST.
+' the attention of the democratic pre Jof needs a little "airing," and that is the!
spelL The probably could be secured first hand.
he'couDtI'T. The Savannah News, Question is
after; calling attention to the fact thai largely a matter of temperament The .t Pensacola's ice delivery has never You .never had a better oppor:unt.: '

the selection of a vice presidential imagination plays a great part. While Tampa's Cigar: Business. been the best, but since the combination than now. to pace a piano in 'os*

s' candidate by the Democratic party is the sun's rays are excessively' hot:,and For the week ending June 2d, the of ice dealers was effected it has Furniture ors I the PeopleThe I home. Our moderate prices togcf'f

at >little premature has the. following the warm breezes at night make sleep shipment of cigars, frmI 'the city ex-';I:been abomniable' and there appears to .1 with our unusually email easy payments
almost impossible, yet the average At ceeded 1400 cases, breaking! another' be no redress/-'as: it, seems to be a'II' place a high grade pano: w.tIn >
; 'ta. 'I&Y; lantan may make life tolerable if he record. The business of the factoriesis case of "if you don't like why lump r of the furniture reach of practically every home n:
we is
One ,of the men suggested for the exercises proper care'4n eating and not only better than it' has ever]: it" as far as the dealers are concern- sell) thoroughly es WIest Florida and Southern Alabaxa.
,'presidential: nomination Is W.: L. maintains a calm mind Hfgh tempered been before at this period of the year:j, ed. tablished.. The fame of Marston & Quina furniture has Write to tia for our special proposi::'M

; Douglas ex-Governor of Massachn- people) suffer most from heat. but larger than at any previous period I|I Some portions of the o'ty are not gone abroad: In the land and'wherever known its excellent on our pianos.

setts;; About everyody in the entire' Thosewho, intemperate in drink whateyer.he: state of affairs insures supplied with ice until far along in the I qualities are appreciated by people of 'djacrbnlnat- CLUTTER MUSIC HOUSE
country is familiar with-his face. 1 thubeeo'appearlDg and foolish in over-indulgence in' im- a good state of commercial business I i Pensacola, Florida.
: : in the in day and when it Is finally deliveredthe I ing. taste. But, while it is a fact that we have a reputation
newspapers 'foods. come next the
proper city
generally notwithstandingsome customer (at least that is my ex-
4 for Fine Furniture
In connection with a'shoe advertise-' In hot weather people should drink minor troubles in': other lines,'I''perience I ) has to take what he gets, : the other fact that we have

;1 ;meat for many: years. Before he became plenty of cool water or lemonade. The and,there is no.question that trie general -:! or go without' I have repeatedly MEDIUM PRICED Furniture TOO must be, borne in : You Ought Use

-' governor of Massachusetts itwasrit person, who dn'nks large quantities volume ""mercantileand real j weighed ice that has 'been delivered mind. When we say we meet all tastes, we. emphasize

...' ; uncommon for: people his to say of hot coffee, or .hot ,tea?may expectto estate ,transact; '. for the' year willexceed j jto I my place and have as 'repeatedly the fact that we meet all purses too. The needs'of the a FaySholesTypewriter
tired ofseeing picture,
they-were perspire in,such weather as thinOn those ot-mat :
} year'as much as J[found it short, in, we'ght! and complaints furniture whether for
4 t !>ut. such remarks al'f'not heard now- the contrary, it .is equally danger? those went above,the'year': p at the office of,the ice company, buyer mansion or cottage are bet-
.
:- adays. because he mane: an exception- oua and Injurious to health for a person Tampa Times. :I meet with the response: "Well, It's ter supplied here thanln; any other furniture store In i

ally good governor so good that. the to drink'large draughts of Ice cold .. y10US'-1 the best we'call do.*" West Florida. We make, this statement with the full + a
,wanted re-elect : appreciation It U light roBBtay.
ti people of his state to chapfe.easy to operate.
water while their bodies .
-; bun. but he preferred to 'gObaok to are, over- Biggest Man In the Country I I believe there is a city: ordinance of its meaning. This Is, indeed, a furniture : powerful manUolder, make but little nose
; heated the n'otthe'sun. I never
by r tctioa
on does nice clearrvtwork the key
requiring that scales be carried ice
( manit
: AS the
Bryan "biggest .
all the
his huslness It is.wise to temperate In drink store for people.MARSTON tire*,tbere are no great rod or be- "ato '
El.Steven' country today outclassing'' in:statesmanship wagons, but I have yet-to find a The other man is Adlal and:food always, and especially during and fidelity to, principle for f so supplied-if scales are carried Typewriter U handsomely toUbd.
eon, who was Mr Bryan's;-runningmate' the' summer months. Of course, the good of all the people who I 1 they are well'out of sight andas far .U durable and foBy guaranteed.
anyone
in 1900. He made a very good stout I You can purchase a Fay-Shole*Typewriter
people
excessively are apt to .
I know are'never used. take
be named for as for
cub
may president Give or on payments.e
us easy
second on that occasion and,.it is be- swelter, no matter how careful they & q"fNA other typewriters la exchange: a. part p:T
Ueved added considerable: :strength are 2A.thelr.drlnk'and how Pl'JIdenttheT Bryan, In 18.06.! -Bartow ,Record. I Ice Is a necessity in the summer and Regular correspondence machine. e'.:.,d

rto'the?.ticket. It is.doubtful, however, may be In eating.But they can ".aa it- seems rather rough on the public Palafox' ,- No.6 or No.7 modeUcomplete with cloth<*;
I : : 10&UOS.. St Phone book
148 er bost of tools and tastroctSoa
Pensacola aa
Should that a combination exists which not Fia.
Jf the Democrats want the 1900 tlcke make themselves, more comfortable! be Punished. bOOm on easy payments of down
to nanie It ,gain in : The old !only absolutely-controls the businessI and$7JO month no tau .
k so greatly as *J y observing ordinary: care and not scoundrel who kicks be- per Insss.'t
,,1908 They want 'Mr. Bryan;,because filling their bodies! with.liquids and indigestible .. cause his wife;.paId.$7 for a new sum'i I this city; but which has the effrontery S90.00 30.payable 60 sad 90 J22JO day-no down interest and S2150

af his steadily growing popularityand ) foods. .It is best to eat only mer hat ought to be on the hard road![ to practically take the position,cf tcponsO parties.on 30 day
also because there Is 'a belief plain Substantial, strength-giving for paying $g for two gallons of liquor.!'jthe I late W. H. Vanderbilt and say open account
** with Order.
teat tha people generally want"hlm.bat foods.jaad to drink"only: cool freshsprln'lf ] -Crystal,River News.. > "The public be -. ,i AFayabbootn wClbe seotc?<

there is no reason for:"thinking' water,-'mineral water' or' city r .sWill I I CONSUMER. I! LUMBER, WILL request to any re-

they want Mr. Stevenson thouh water, cooled refrigerators, or other Line up fo,. Bryan. i liable concern individual anywhere *or

t..: :there" Is nothing to, be urged against wise, without coming'in contact with We hope bur able contemporary,the I Thanks 'FrOm Sisters. .i ,at cures
The Sisters of wish to! ,
MercY' publicly HIGHER IN PRICEand
BE for tea
Dense a
; r ;.h1m.* { ice. ,,We fear and believe that a great Live Oak Daily (Democrat has not thank the following who so days'free trial to'
,> The platform makers might as -wellsave deal'of the'ice consumed by the public definitely abandoned' that .Tillman prove its worth.
medals
\themselves the trouble of con- is dangerous to health. It.is certainly boom. Pensacola Journal. We are premiums generously: Mr.donated Ross. Mr. Lannon as not a long time will elapse till it will begin Its upward address Yost name will aDd F i

':;,"- ,.structing' a platform for Mr. Bryan injurious to drink large still standing by our, Tillman "guns.-,. and Miss Murphy Warrinfcton F. C. flight If you ever intend .to build now ia the time. bring oar i,
.-s- ,Hewill make his own platform In 'draughts of dee' water in_hot.weather. and a few weeks av'were marching Brent Jas. STdHkigh, Mr. Lannon.; and The beginning of actual work on the Big Ditch will necessitate bookletand

t' :fault he has slreay begun thewo-k':: of I' Perhaps,the most delightful and on with 'quite; an army gathering Marston & Quinn. Pensacola; Mrs. the use of many many millions of.. feet of lumber.: two sample colot
$f +cting it In a dispatch from most healthful'drink Is lemonade Sa01 tes"d
eosstru Get
pure strength and force :as .newspapers Stephens, Fort Barrancas; W. J. our prices NOW. They're money savers ..liltsNsBafldlag.
.", Trau tljem. Norway he states his po- which Is.Invigorating,.cooling and re- throughout the ,country, dropped into eely, Providence. R. L J.,G., Ditsen F.y-Sholes
;
1t; Bition.'"rery.fully in respect to trusts: freshing. It contains no artificial line but as the time of battle draws Philadelphia Pa. Mr. Schwartz, Mr- Saunders Mill ChkatoJACKSONVILLE !
;
:; jui,tne course of it he says that "prtvate'nronopoiylj'lndeTenslble stimulant and carries eneficial add Company
.; '- -"-"' a -.- <* nears one ;after,'another of the Till Pastel New York; Mr. Olinger JlrWilltins ,
anl. IniY' ,to the stomach.. / man advocates"have' dropped out of Wisconsin air St. *-17.. 2Y Ca f C frfM ff
; Herder : 0f. .. FLA.
.
: tolerable. In speaking ot-such mo- Of course just as;few,.clothes as pos- line only to appearagain, singing' a Louis. j '
204 We.t Bay Street.
,
: : '110

r.} ; ..,f. _

_ ._! ':,: 't- = :' ''i:'ix f..<;.;., ;f+... :,. :::-}; >; '--_:..:' .i,4. :"': '. ..1 "" -t.' !" '_,>>" it'G ,, '"".-'.,t', ; Y '_ &
:. ... ,-,:.:-. : ,; ,. .< ,, ,. ,; _., ,:-.' > : ;'. .., cc' : w ,?" _" ,,. -::_-_ +?t4s e R ? ; f LE ; y to vas



,
,



s_ __ __ _, '_? t_____ s iK-, _. __., a__ "_x y'_ __ ,tV'_ yK _

., .


THE PENSACOLA: JOURNAL, TUESDAY MORNING 'JULY. 3.' 108
_
*AOE EIGHT # "
---=::=!!I



Be11. M.R [ESTIITE MANY VESSELSENTERED :BUDWEISERr




Men's TRANSFERS is fermented.Glass. -Enameled Vats. 1)) I

\ After the process of fermentation it is lagered

1 Every variety and the newest styles in black, tan, (aged) from four to five months in Glass-

bronze and gray with nickel, black or oxodized buckles Following is a list of:the real estate Lined Steel Tanks,:.from> which: it is drawn :'

_v at 'transfers recorded yesterday reported PORT into bottles. Thus it is
by the ''Pensacola Abstract Co.:

.Rothschild to M. B. Lindsay,.lots In Glass from. Kettle to Lip
r 75 cents I.OO.and
25,50 $ 11 and 12, block 20, Wj.' King Tract,
and other considerations taste and flavor
$500 The result is an exquisite, ,

i $1.50The I D. M.at the Merritt SW to cor J. of H.G.Darts J. Ruther beginning Records Show that 254 Entered distinctively its own, which accounts for the '

....
ford's I'5') A. lot thence running S. 57tft from Foreign Ports and 106 sale of
thence E. 630 ft, thence N. 570 ft,
f attention of men who want to dress in aCCord'I'I ,
thence W 630 ft to pont: of begin *
J- ance with the needs of the weather.is directed ning, containing 1C A, being In Sec. from Domestic Ports. 137,722,150 Bottles I; '

i line of fine 20 T. I, S. of R. 30 W. $100.
: Executors of Wlm.\ Fisher, decease. The custom house records of the


;. White Duck Pants at $1.25 of to 9 and Tarragona Trustees 10, block Union St,89.$250.Baptist E. King. church Tract,lots W. I ending complete business Saturday,transacted and show night for much, the are increase fiscal now. year all lathe of Budweiser in- 1905 tt


D. W. McMillan to Saunders' Mill business. exceeding that of all:other bottled beers.

i and $1.50 Co., all timber cut by 2nd party for The reports show that 25* vessels
entered from 106 from Brewing Ass'nSt.Loala.
foreign and Anheuser-Busch
saw mill purpose on lot 7, in the SE'/4 Ft-.R
1 of Sec. 17, T. 5, N. of R. 30 W. 155 A.. domestic ports, making, a total of 356 _,tJ. S.A. "
= as also our line of linen salts consisting of coatand vessels to enter the port during the
$155.
.
i pants at $1.50. Wen made In every detail and J. H. Collins to Lena Falk, S!% of year. Of the clearances there were tPensacola

i thoroughly shrunk. Newest thing,for men is tie and lot 15, all of lot 16 and 17 and N 10 290 for foreign and 79 for domestic. A. MOOG .-Distributor. i

:: handkerchief to match-In a.Jf the most fashionable ft. of lot 18, block 52, Belmont Tract ports There were 25 entries of merchandise .. ,
and other considerations.
1 colors here for 50 cents. See our display in center $1000 \ subject to duty while w: vessels :
Louis Boley'to Henry M. Yonge<>ts
t window. 1 to 4, Inclusive, block 213,.New City, entered with cargoes from foreign. t'.ak.w Tit Court
Vi ports which were free from dur-
$100 and other ,considerations.
Seventy-three licenses were issued to
r- vessels to the coasting
-- CHJLD. engage in
MOTHER AND trade and 46 to vessels to engage in

fishing. ===-

THE JOHN WHITE STORE Tfcer Cke I4 Be Together at the Bedim Duties collected on imports amounted ......., .
Hear. iI'
to $14,465 and the tonnage tax BASEBALL'
There may be some mothers who feel collected aggregated $19,951.58. TIle That
the
It
is Happens.
Unexpected
It to be a self denial to leave their parlors salaries of the collector, deputies and I
t Phone 225 205.207 S. PALAFOX or firesides br work to put their other expenditures amounted to about !.
{ children to' bed.. They think that the $13,500. American League. H. c: Tilden, of San Francisco was assured In the Equitable for
' and C. F. for $5,000. Neither of them tried;
$2,000 Taggart were to
1 could do well that it is
nurse just as Washington 3, Boston 4, first game.
did,not lose their lives in the fire following it
the earthquake. They
Gone to New Orleans.J. :
of no consequence who "hears the children Washington 17, Boston 3, second
J their Now S. McGaughey left last night for Bath were accidentally shot 'when all danger was supposed to be over
setting
say prayers. game. and after'both had escaped'unscratched from frightful peri:s. \oi
New Orleans, where he' will remainfor
aside the pleasure of opening the little Philadelphia: 5, New York 4, first
.
a few days on a business visit. one of us .knows the: day and the hour when the call will come Are'those
{ bed and tucking the darling there game.
ANNUAL DIVIDENDS up dependent on your exertions arranged for provided 'you were'
Philadelphia 1, New York 5, second
are really Important reasons why the
CAMPING ON THE .HUDSON.Po.aIar called! A policy In the EQUITABLE protects.

t C&nnot be lost and they may be used to mother to any one.should In not the yield first place this,privilege it Is the Site en Wed Bank Saved fcy. Cleveland Chlcago-SL game. 4,Louis Detroit, rain.3. I ra c KnowlesBros. Gro'! Att;

reduce the time of all times when a child Is in- Hook Mountain Bill. l'I Fire Life P en'3ohI
L premiums each if the insured
clined show
year to its confidence,and affec Now that Governor Higgins of New National League.
I .
.
_F_, po chooses. A life or Endowment: Policy with tion.with'more All Its truth little and secrets less restraint'j come ;out,its York has signed the Hook mountain Boston 1, Philadelphia 0.

bill and the future of Palisades park is New York I, Brooklyn 7.

t Annual. dividends. in the Union Central Life naughtiness aad through talked over'the with day less canrbereproved ex- 1 assured more camping' parties than St. Louis 8, Fittstmrg 4. !NN.N_ .1NNNN_ .NN.INN.N.NINNNJ.Ott NN//

; citement and with the tenderness and eyer. It Is expected, win use the west Chicago ,0, Cincinnati 1. I. .

X Is the most satisfactory calmness necessary to make a perma- bank of the Hudson this- summer, says 'Z .
Southern
League. r
nent impression. If the little one has the New York Tribune. .A:large num- oooGA5ooo

1" B. S. WILLIAMS, General Agent. shown a desire to do well and be obe- ber of permits have already .been issued :Atlanta Birmingham-Nashville 3, Montgomery, rain. 2. I

t Thiesen Building. Phone 608 dient its efforts and success can be acknowledged by the Palisades 'park commissioners Shreveport-Little Rock, ran. .1 .

and commended.' ,'and as the season advances applications :
"
1I We must make it a habit to talk to will come in faster and South Atlantic League. Theuse of gas for cooking and lighting your house spells ECONOMY .

our children in order to get from theman faster. The precautions taken by the Macon 5,<,Jacksonville! 1. in big' letters at the end of every month. Besides economy it J
,
expression of their feelings. We No other games played. spells COXffORT-in larger letters. Gas for all purposes at$l.i aO .
commission In the last or so to Insure -
I I GUESS SHIPPING cannot _understand the character of year a thousand cubic feet make It cheaper than coal or wood. Let a* *
NEWS these little beings committed to our good order along the water front figure with you'on the expense: of installing waterheater and cookIng *

care unless we do. And if we do not I I from Fort Lee to Piennont twenty ESPERANTO STUDYING CLUB range for the kitchen or piping your house for lighting. Touch *

I know what they are we shall not be I miles .up the river, .have"1 resulted In -- -the. button, .for, light- JI
i
:; you have read of that big reduction I -- able govern. them wisely or educate making river camping"popular"'!form 01('.._.. Form Society to Starter ..

'1 made on all my stock of Qothirfg Arrived. them as their different natures de of outing. At various' times last sum' New CBlverMl La....aa-e., I .

Arelheid mand. Certainly would be unwise to mer there were as many d.a thousand( the :
Ger of
The universal
ss, Buney, 1767, study Esperanto, new : '
: i For Cash? Swopopmund, to Rix M. Robinson & excite young children too much by con persona camping along the' shore of the language is to be taken up by a I Pensacola Gas Company
river within the limits of the *
Co.August versation with them Just before, putting park club' formed la Chicago recently un-'
f Belmont Br ss, Barnes them'to bed. From the rate at which applications der the leadership F. C,' Morin of T
I Well, they have been going pretty fast 29C7, Hamburg to Gulf Transit Co. Every mother,who carefully studies for permits are now being1,;'received the Chicago, vice president of the American l Phone 148. 24 and 27 E. Garden Street. :
f but there's a few more left at that Stranger,. Swed bk Anderson commissioner have doubt that thisrecord
same: cut price and In this warm Loreco Marques to ,Southern States, 485, the know temperament how to of hef children will will> 11'surpassed no {llis'year.The : Esperanto association, _says the ..........N.NNONN. NN4+.ee..e... ," .. ..../Nh
manage,them in this respect Chicago Tribune. Esperanto Is de- : "
;, weather a lightweight 2 piece suit is Lumber Co. force "found
only police neces-
;. Just what need But of this allmoth 1'9 may be scribed as an auxiliary for the benefit
ti line light! you weight to keep cooL Full Sailed. assured, that the last, words at night sary Is a.small launch In charge of a I I of tourists'and tradesmen. By its use The 'is in his
summer Shirts Collars Jeweler now new stand atCot's
Dora Baltea. Ital for marshal which patrols the shore, protests
attached and detached from 50c ss, Venice. are of great Importance even to the one' can transact businesswith persons J-JF F DAVIS
f, up to $2.25, values never before heard babies of the fiock. The very toneS of the preserve from vandalism and I speaking other tongues withoutthe a Book Store in the new Brent Build

..f of. VESSELS IN PORT.Steamships. the voice they last listened to makean suppresses any l Incipient dlsorder.' The necessity of lea.rning"the'odd. ing. All repair work and engraving given prompt attention.DRINK .
work of the regular police,force Is sup
One trial of the Men's and Boys' impression upon their: sensitive or- 1 languages of the world.
1, Furnisher will convince you. Cerea, Itai 53, Nalarini 2791, New ganizations. Mothers, do not think the plemented by 'voluntaj assistance The following specimen of Esperanto -
York to Gulf Transit Co. time and strength wasted which you from the campers themselves,especial illustrates its structure, the second
Dunbarmoor, Br ss,- Barton 2331. ly the members of the'various canoe
in
spend reviewing the day with your paragraph being a literal translationIn I InBattles
T-JOS.COLEMAN Mobile to Hyer Bros. little boy or glrL Do not neglect to associations, to whom the park la too English of the first:
Tr E. O. Saltmarsh' Br ss, Rogers,2319, teach It how'to pray, and pray for it valuable as a camping ground to'risk
Liverpool to Gulf Transit Elmpla. flexsebia. belsona. vere Inter-
: Co.
In losing. Then as much care as possibleIs
and
tl.: Earlswood, Br. ss, Fayn, 1840, Pt simple earnest language whichIt nacia en slaj elementoj. la ling-ro Esperanto -
\ can understand. Soothe and'quiet taken to see that permits are issued presentas al la mondo civilizlta 1*
212 S. Palafox
St. Inglis to J, A. Merritt & Co.
Its little heart after the of only to pelwns who can be trusted eolonreran solvon de lingvo Internacla. @sq:
Phone 727. experiences
Federica, Aust ss, Zar, 2261, New with them. Simple flexible harmonious truly International
the day. It bas had Its
I Orleans, to Gulf Transit Company. disappoint- ; In its elements the language Es-
Glenwood Br ss,. Richards, 1253, ments and trials as well as its play "Of course' we can't tie the,whole peranto presents to the world civilized
Florida and Alabama New York, to Gulf Transit Ct>. and pleasure. It Is ready to throw its matter up in red tape," 't said J. Dupratt the sole true solution of a language internationaL -

Huttonwood, Br. ss, White,2533 SL arms around your neck and take its White the secretary of the commission, A DELICIOUS BEVERAGELook
1
f. LAND COMPANY Vincent to Gulf Transit Co. good night kiss.-Bostou Traveler. "but we do what we canto see that f

Magician, Br .ss, Baby, 3271, Liver- the permits get into the right hands.A KaBaaa'. Useful Automobile.A .
: Manufacturers of pool to A. A. Brown & Co. little while ago we rejected an application farmer in McPherson county Kan-, for the Trade Mark on Cap and Label.
t and Dealers in Westland. Br ss, Granger, 2001, Vera THERE'S' from one-man because he had makes his automobile do double duty,

'} LUMBER. SAWED CYPRESS SHIMfaLES Cruz to F. O. Howe. NOTHINGLIKE caused trouble last yearBut, as a says the Kansas City Journal He uses

i AND KILN.DRIED SAP. matter of fact, there.Is really very little it In'the daytime to run errands and Bottled only by

Ships. HOSTETTER'Sfor disorder. The other campers don'.twant to oversee things on the farm. At night uA.

f Harvest Queen, Brit ship, Forsyth, it and won't stand ,for it Per- he Jacks it tip off the ground connectsIt
SAFES SAFES SAFES! SAFES! Rio Janiero,to order.Nordstjernnen. toning and soothing the digestive sonally I think more use will be made with & small dynamo and supplies Hygeia 'Bottling Works t

! Buy Diebold Safes. : Nor ship, 1,635. organs to restore the appetite, to open of-the park all the time. We are Just hIs home with electric lights. ,
Iraksen, La Guayra to W. S. Keyser the clogged bowels' to induce
up to realize what natural ad-
f Scarritt Moreno, Agent. & Co., sound refreshing sleep. Thousands beginning vantages New York has.. The city is 124 E. Chase Street. Phone 587.
Barks. have so testified during the past 53
r Defcregort Gio Botto Ital bk, 1294. ; going to spend J2.000.000 on a seaside I
;.-,.. Genoa to Rossasco Bros. years. park somewhere, but It would be hard -
"'
Gesine, Ger bk, Larsen, 1375. Ham- Hostetter's to find a better place for a few days Order Your
burg to McKenzie Oerting & CoKing out of doors than the west bank of the A Good House
ICE .COAL and WOOD
r All (tieLittle :Malcolm, It bk' Gufi, 1233, Ge- Stomach Bitterswill Hudson." ,

roa to Huges & Co. always cure and prevent Flatulency The land now embraced by Palisades : : heI

Luisa, ItaL bk.,,1591., Montano from Heartburn, Vomiting, Cramps, park and available for camping purposes I Consumers' Iceland Fuel Company.
Nolloth to master. Dyspepsia, Diarrhoea, Indigestion, is a strip about twenty miles Leaving! a good house unpainted -
Monrovia, Nor bk, 1449. Aase, Ham- Offlc.-Corn r, Cha...asd :Tarragona. Pho"e 259Is ,
r' Headache, Female Ills or Malarial Fey long, shut in on one side by the river
Kinks burg to order. is as imprudent as
t Port, Sonoclan, Uruguay bk, 1112, er. and on the other by the steep cliffs of

Ferres Mentevideo to German American the Palisades. Well wooded and comparatively leaving greenbacks out in the .


Spero Lbr., _Co.Nor. bk. 623. Bostlg,. Las I there is an abundance free from of good undergrowth.sites for : rain. A house unprotected ) ?here. IT' .'Lbaltffother's GULF CITY COFFEE CO.,
You eatingcarrot* lettuce,
f NeedBrushing
Palmas. For and i greens
rowing
of Fashion camps. canoeing (j}i and beets;
Schooners. paint cracks and rots H, P. CHIPMAN
swimming this part of the Hudson i, by good Father lire on onion; we've Quit having Manager.
Donna Christina, Am ech, HcLeod. could meat "
hardly! be Unproved upon. As
!i I and is unsightly all the time. Pancakes Roasters, Blenders and Shippers of
165, Belize. the channel for all heavy craft lies : in the morning, breakfast food

lye-.. are embodied in the Jennie Hurlhert Brig., Am brig, Wrfght, close to the eastern bank, the swells r Whatever you do, point I Well,ana we're rict saving mOneT, and It'. 'worth Fine CoffeesOUR
from passing steamers do not disturbthe the priceSausage ..
clothing we sell for men'ssummer I
418r Havana to J. A. Merritt & Co. ,
; wear. It certalnly < Up shallow water of the western shore, Whenever you paint; use ? Bahl .,We wouldn't feed It to I COFFEES ARE SOLD BY ALL
sheltered moreover, the high rock
by
Saved His the
Comrade's Life.
appeals strongly to I pup.
white lead You GROCERS. GIVE THEM A TRIAL
wall 'aboveAnd neither paint If
t"- ."White returning from the Grand finally, as pure you 81Mak'of beefsteak stater DOM
and will please the economical '
i time .
nor is to reach goesup.
and those who insist Army Encampment_ ,at >"WashingtonCity I I the park from money the heart necessary of the city, it I will have the best if it is We- hare eggs for dinner, bread and milk
,, a comrade from Elgin, ILL, was for tea.
it. durability! in clothes.. is within reach all who have holi }I I .AI
on taken' with cholera morbus and was in of And we must be getting richer rapidly.
-- Fashion and,, ,durability a critical condition," says Mr. J. E. Perhaps your Spring Suit was days.
HougMand'of Eldon Iowa. ."I not bought here, and it; may| Every morale father, a* hha reads the
1- are a mighty good combination gave SHIRTSCare
Red Seal
news.
him Chamberlain's Colic Cholera and be getting out of shape. In Stitch together newspaper enough to
Seems to get discouraged,
and both of these seem to havethe
Diarrhoea Remedy and believe saved that case you need us, and entirely cover the springs of YOft bed btae.... and Attention.We
?" qualities are happily his life. I have been engaged for ten YOU'need us bad because you and if there are slats make a second Pure White Lead'Ofafe And be pounds the .table, saying things .

I. !', blended, in the highest degree years 'in immigration work and con- cannot afford to look shabby paper sheet to put under the springs, are WroDCYeptabJes pride ourselves in the care
in our summer ducted many parties to the south and We can fit you up from headto It will keep out the dust:and is easily by j seem to, keep- him pretty I and attention shirts collars -
the Old Dutch Process: ) t strong. your
foot at very little cost.
.l{ clothes and furnishings. west. I. always carri this remedy replaced.To I and cuffs receive in our
and have used It successfully on many Give us a trial if rOU" have I Every day somebody. .ten about some laundry. It's the careful ban
: Lightweight suits from $6 not already done so. r -
occasions. Sold by all druggists more
l'
: keep the pile on velvet from dUng that enables your linen*
r up; white and fancy vests I mixed with Pure Linseed OiL Packing filth we hadn't heard about be.
x. I crushing while being stitched places I fore. to make so many more trips (o
{ from J125 up; Stetson Bi-monthly Change. i piece of the same material face down-:I Accepted as the standard everywhere t tI It Is nearly time to hear again I think. ; the laundry than you thought
: hats $3.50; summer ox- The monthly change of the police ward on It. The fingers rest on this! i I That the milk to doctored and nnflt to possible. It is therefore economy (

% .. fords from $2.00 to 450. officers occurred Sunday and those of- White & NixOUTFITTERS and prevent Its crushing.An '. i by those who know. \i iI drink. I I to have them sent here for
ficers who have been on night duty } 1 laundering. wil:
Our
: 1 wagon
.
,
t ---- Onions prunes and carrots. lettuce. tornips.
for the past two months were rel'eTed I call
.-rice- any time.
by the day men, and will now hare excellent idea is to connect a!I r Learn aft about paints in oar handsomely Well they might be betters "tin they're 1!

: 'H. 0. ANSON two months of day work. spring to the refrigerator door thus : dastntiol free booklet, cent oa appUca pretty nice.
I
Yes Honey Worth'or Tour Mosey Back .keeping It :1;ways closed, as childrenare : tioo. Gives test for paint puritr.l Tet before .tomorrow some Olle, raking J The Star Steam

r C Attention,, U. C. V. .. often negligent In this_wgard.: muck '
PHONE 790. I .
CASH CLOTHIER l May discover filth. In these things darn '
..
.. OfCamp
A meeting Ward No. 10 K the rock t.nd'n.
NATIONAL LEAD COMPANY
, Coner Palafoi'and Hun.T' United 'Confederate Veterans, will be Next to New Brent Do not waste your energy In fits of -s. E. Klser.In Chicag9 Record-Herald: I 17 Ea.rc.n : 11Pcncacola *-
Building .
Calk A* aoe tod r*k Suzy St.Loa,)f""
. tonl'ght In the office of
.. held Supt Cookat anger. Save your nerve force for some I Ft*.

:; 8 o'ciociu- All requested to attend. 29 S. PALAFOX ST. worthier occasion. For sale by first-class deafen. Read The 1ourn 1'.IJ' :want ads.


i .
i- ,

;"r -...:.. ;;' ., "'5,.:...' Fa#1 J it.
,,
;" y yii.L. ... ; rR_...< x:4c.' ;;'. :;: ..___'..;-i,2".1"k-.,! '' if' '. ...:,.:<._('Iif ':..-'Y-.. :: );4 o''Jr ', R ', _.' ._!<: :;'-': \.q.... :_ : .
'!""'1_ '''' K,3z "'-.. :.: a, ., '''. : '"1;, "''', ;_ ," = ,. -: ; ,: >' .',.'c-":' "'- ,. ''''"''",''' '.
f- _t trt: > --=



\ ':7 ; 4t-i %i'; ;;;: -Jit: : :: /d1<;<:i; 1f"'i;; .



THE PEW8ACOLA JOURNAU ;:TUESDAY' MORNING( ? .:JULY- % 1908.
:_ :Vnoe SIX" : .





!Every Advertisement, in 111es.e-. Columns :_Is Read, by I


.. ,, 4.: "' I,' '3

-L .. ..., i'R't3, iJ this REAL $TATE For Sale GOOD HOMESAT -



The S150C-5' room: cottage, E. Strongest,
Actual'Digging. Twice
near 9th Ave., 60x132.
BARGAINSA ,$ 600-Lot'. 60x150 E. Jackson street, MODERATE PRICES.
between,7th and 8th Aves.
Fora few days I have to pffer three

The actual digging of the Bfg Ditch, connecting the waters full blocks in New' City each b'ockcontain'ng S 600- lots: In block- 170. New WrightSt City. We desire lo,especially' call the attention of those desiring comfortable
of the Atlantic with the Pacific will soon begin. Its l I 20 lots,;and each lot 40 by .... 51400-. Store:ana' dwelling' on homes at moderate prices to the following which we hare
,can. ; r 137% feet. for ..,.. "** CO*, 7ti are. together and offer for this week. If
gathered
possibly '
Interested
;; beginning and completion means more than iou ; : t FINE PIECE" OF BUSINESS; $1500 6 'ro3m cottage, E. Jackson St. ? you are and
of city $1600. ; the follotriug'does not suit you call in and see us. We have
think for the
; upbuilding our '
others
: :::. This is a little over $25 per lot., Onlya : "JtROPERTY. $ 10l1Jts.() bock: 132, New City. to offertNoi ,
ON' SOUTH SlOE _
: THE $3150 Sp'endld bargain In residence
few years ago you could have boughtthe -
i
'
It Means Increase in same size lots about .where the car OF INTENDENCIA,, NEAR TARRAGONA 'on North H1L 307 West Chase St, a large one:story, six room dwelling,
: Rapid line now runs on 16th street. ,Now you 11500-locks 113 and %iO, W.. K. in perfect. condition.. -...... .. ..' .. .. .', .. .. .. .. .$3,150
ten times as much.. Somebody STREET. THIS IS ABARGAIN J1500-4 room cottage 7th Ave. near
pay j No.. 602 N. Hayne St. a desirable location six room dwelling
t, will pay ten times as much' for the Gadsden SL, 75x110 lot 80 by 150 feet.. ''u ......... eo eo eo.. -. U 2,350
Real Estate Values. lots in these three blocks and maybein WORTH LOOKING INTO.I'Various other properties for the ask. -q
I a couple of $600 cash and If you want to buy. or sell .see No. 1005( N. Davis St,'large two story, eight room dwelling with
ba'ance' :on time.years., I FIVE LOTS ,AND,A',2-STORY RESIDENCE us., < servants house large lot fronting on two streets.. .. 1,503

Do you own any! If not get In quick. BUY NOW 'r 700-iFor another block a little better NEW CITY,'CORNER 10th Loans made on Real. Estate Security No. 532 E. Gregory'3t, a well built and commodious seven room
'
opportunity 'was never better for the rise Is,oas:: Remember -, i than the th/ee above. Terms In .n(amounts.I. dwelling, lot fronts on two streets.- .. u .. 1,600

what we've been preaching now for two years, bay, I also on this.: i AVENUE AND .11th STREET. A No. 421 E. :Intendencia.: St, comfortable six room dwelling 1303
buy, BUY. See our list of properties wh'ch*: we believe 'I 3900-For two blocks :not quite ,so No. 812 West Government St, a new five room dwelling with
will double in value before many; years. Easy terms on BARGAIN IF .SOLD,AT: ONCE.:
much of it, t, THEY, goof.ARE as ALL the above MONEY three.MAKER S. BROWN S CO. large !ot.. .. .. .. :, .... .. '.. .. .. .. .. .. .. ... 1,500
No. 601 East Belmont St. a neat five room dwelling in good

SOMEBODY MAKE'M'NEY.WILL WHY BUY NOT THEM;,YOU AND?' "WE' SELL LOTS. 'order .,. .. .o_. ...:. .. .... ". .. ,. .... .. .. .. .. 1,250

McDavid-Hyer Company, No 414 West Intendencia St, one story, seven room dwelling,

Pensacola Investment Company : lot _40 feet by 170 feet..u.. eo ..u.. .. .. .. u .. .. 1,015HOOTON'
LESLIEEBROOKS: Agents New York FOR ANT

A. M. IP IU. fBEIlTF. City Manager.W. .
,
Phone 4f2 Fisher Building, Life Insurance, Company. FOR P.EN'T-Furnished rooms; on carline
"
.B.WiOWUS, FroUwt L ..sDlm,Seeratar,. Appiy 900 E. Jackson. : ( & WATSON
r j,I.STUJIAI, V iT L sad G a. Maaa tr. KNOWUi,HTE!.:Tri jiurer.- 8' Government. Street. Sjulylw

Kaef Estate, loans, Ceaeraf Investment*. i HELP'WANTED > Phone 7CO.. Pensacola, Fla. FOR: RENT-Some nice stores oa E : Leading Real Estate, Rental and Insurance Agency.

H ...... Government: street;'cheap rent The;
215 South Palafox Street, Pensacola Florfda., I'"WAOTEO good cook. Apply 2 E. Fisher Real Estate Agency ljuly, SHONE: M NO. 37 S- PALAFOX ST. P. O. BOX "L"

_, Wright St, 3july2t
,.'. I FOR RENT-.For season DIshman's;
ry WANTED-Capable 'agents and sales- Camp, Fisherville. ':Apply" 715 N.< -

men, for good selling household: ne A Good Interest Palafox, or phone.138. .ljuly
F F. J J.. WHITE, & Can cessity. Something entirely new and .
A Bargain and staple. !Prefer men with sufficient RENT AND GARDEN! produce free to

Artesian W cll.Drillers i money to handle territory on their own satisfactory family to ,occupy good 300 Laborers WailtedWanted
account None but sober, capable anal Paying Proposition house and care for property during:
For Saw MIHs>and j Industrious need apply. Acetylene the summer, .a short distance from
Turpentine Stills Especially. city. Address "House" care Journal
Lamp Co. 50 University Place, New .
In Water Front Property Geneva, Ala., and Graceville Fla. York City. '. Itjulya Two houses on East Government J 21 jane. '
We have three'new first-class drilling street renting for S16SOO pen year

machines. We are prepared tOj WANTED. -Lady or, gentleman of fair rented all the time, houses in good: : FOR RENT-Five-room cottage East
$2500FOr put in wells from four to twelve inchesin education to travel for firm of $%So.- condition! good chance for the ,property Gregory, near Railroad shops, $8 at Once
: d'.ameter'and"from one hundred to 000 cap'taL; Salary U,<<;)T% per year to increase in value: You would, per month. C. R. Yaeger, Thiesenbunding .
i 2-story, 8-room house, lot 240x sixteen hundred feet In depth.: We payable weekly. 'Expenses advanced. make no mistake in buying this piece Phone CSS.; june9 ,

i, 250, on Bayou Grande. Good water., do our work promptly We,guarantee- Address Ceo. G. Clows,.Pensacola,Fla. of'property.. .. .. u ;:. .....51230...
satisfaction.: FOR RENT-Modern two-story house,
,$2000 We.,give .the 'best"; of references. 3july2t* .0':- with large grounds partly under 30.0 Laborers L. &
North ResidenceI
: WAN1"EI3anager' for: book and stationery T .1 Hill cultivation, located In northern sub ,

For one-story cottage 'water's store office : stenographer urbs. For Information address or
,; on ; man
- '- edge, lot 120x200 on bayou Grande. FOR SALE ; foreman brick yard; clothing I North have Hill a ,nce large T rocm.lot residence has every oa: I Co.apply to the Pensacola- Investment, 9june N. Railroad Wharves,
salesman; master mechanic: mechanical
: modern convenience, on the car line,
8 $3200 i.;. draughtsman; traveling salesman J in the very best neighborhood: : It is I" FOR RENT-Ju R. Bingham has storage
'
5 S. E. lots,block 228, New City 11500 S C., N. C. Ga.; dnfggist;,'carpenter;, very hard to buy a nice residence In room for rent suitable for furniture Commandancia and
I !Buys one-story cottage, 5 rooms .8 lots in block 186. New City.... 1759 foreman; advertising man.. Great demand this section and you should not ovecLlook I or other 'goods. 104 and 106
on Bayou Grande, 63x250. North half block 218, New City. 2600' for, competent peope.: National! this chance If youwant a home. South Tarragona street Phone 639:
.; APPLY TO '100 ft. on East Jackson street I Emploment Association, Century building I will lend you $3000 on the property.I streetsRate
running through block? half Atlanta, Ga. IjulySt* $4500. I FOR RENT-A nice 5 room cottage Tarragona .

.' block from car line.......... 2000 on N. Spring St., with bath, gas, etc.
Mrs M L i j WIANTED-Men, everywhere; good I
Surgi FOR RENT. j I at $15.00. Inquire Fisher Real Estate
', I pay; to, distribute circulars,. advertising I/st property with and I C Agency ljune of pay $1.75
your me
6 room and bath house on North matter, tack signs, etc.; no can- .- \ ,
i"i:; Care M. E. Clarke Hill, $16.00 per month.. vassing. Address National Distributing will sell it.
L! Pensacola, Fla1 I.1 Bureau 100 Oakland Bank Bidg:,1 FOR RENT'-Elegant, two torv re&i-I
deuce, cornerStrong end,Sprfn? of 9 houi
day or
B. ,F. WOLF, Chicago: III,
1: Professional Citizens National Bank WANTED, -Carrier'hoys.at The Jour:. J. W. Bullock, Jr.

__ DirectoryT.GYATESM.D nal Office FOR RE.'t"TTwo''Very desirable 172 cents per hour.
Room 405 Thiesen Bldg. stores on first floor of! Manhattan

WANTCD Men' and boys wante!, hotel Corner Garden and Baylen./
learn plumbing, plastering, bricklaying r Phone 16h Just completed and arranged In first

.,.. ,Will Double In Special 'offer: 'life scholarship class shape. For 'terms, particulars, Apply on wharf .at
fifty dollars, easy payments; position oJ etc., apply Hooton & Watson. 29Apr

OPTICIAN guaranteed; .free catalogue. Coyne
306' THICSBV BVILOIH I Bros. Trade Schools; New York Chicago. WantedPCeunON FOR RENT-Second story ever Lla- once.
I ..St. Louts 1 denstruth's Jewelry store. Suitablefor !
Value Insideof JI I \V\M'o.'TED-As\ traveling offices, sleeping quarters or storage

WM. D. HOWE, WANTED: -Everyone to know that,, salesman for wholesale grocery firm rooms. ,Lee DanielL 24apr -
i. The Journal has nee, clean old papers
:1 .ATTORNEY AND COUNSELLOR AT LAW ; for sale' cheap Only,'five:cents 1 by Box man 592,of Oty.:experience. .Address" Sjulylw Pi O.* FOR ..RENT8roomstory Cottage
14J/2 EAST GOVERNMENT ST. a bundle;' k t 318 W.: Belmont Apply to. ; Walker

I. a Year v-? ,- WANTED-To sell a lot of old"papers. Ingraham- ApnlZO, Don't' Bay Real Estate in Pensacolaor

1 at 5c a bundle. Apply at this office.
I .PIRECTORY WANTED WANTED.-Real Estate tor sale or
They are all whole clean and
:, That Is what"a great deal of real estate -, nice. rent, lea::a or exchange. Your busI- anywhere else until you get an
In Pensacola is going to do and' LADY, whose near relative has been] ness respectfully solicited. J. A. Wilson -
Joppa Lodge No. 6 1. 0. O. F.
,
Real Estate Agent 22% W. Government
? some of it Is in the following list I cured of epileptic fits, out of grati!
: Joppa Lodge, No.6, L O. 0. F. WANTED-P.; B. White wants street.: Room 17, Salisbury
Half block In New City fronting tude wishes to send (by mall) particu*! your ABSTRACT OF TITLETO
't meets o'clock every at Odd Tuesday Fellows evening Hall. Belmont at 7:30 Calalonia square.' ... .... :..' ',,.$750( lars of the cure to friends of those sinijllarly 1 hauling and transfer work. Satisfaction building.. Phone 17%. 23Jan
Half block In East King Tract In! affected. Address B., 754 Vlkany guarnteed. Address 1S01-N

!: 'aru and, cordially Baylen street invited.T. .Visiting. brethren settled neighborhood:: .. .. ..$700 St, Schenectady, N. Y. ljulylw.i 9th Ave,-0r phone 93L Miscellaneous THE PROPERTY.
One-fourth block Toledo squarel
on
:T .' W. GIGGLES_ H., Sec FLEETWOOD. N. aJ. New City .. .: .i.... ..- .. .. ..$800 WANTED--Flrst-c'ass hat MATTRESSES RENOVATED New IS YOUR TITLE GOOD ?
Lots on llth and 12th avenues.New Old hats made new. Cleanlng:1 NOTICE Having installed machines
SljanGm.
City, at.. ,..?:., ;..T .. .. .. ..$200 pressing .and blocking. tick furnished if desired. Guaranteed for the manufacture of galvanizedIron
1 Crapet taken up and matting That is the all important question If you want it answered quicklyand
200x13234 feet 'on East Hill guaranteed. Panamas 50c.
Pensacola Lodg. N4.3, & of P. car Straws* laid if desired. Leave orders at cornice, skylights, Tornlce'' ;;utters correctly, come to us. We make it our business to find the
.
line .. .;:. .... .. ._ '.. ..$1250Lots 25c. Felt, 35c. Derbjs 25c, Victor circular mou'alngs! ,-etc.,I am now
meets every Monday evening at 8 Green &. Watson. Phone 193. 7mar answer.,
_
in East King Tract or West Louis, 100, E. .In endenc1a., street. All)
to do sheet metal work of
o'clock at their Castle Hall prepared
temporary If you have any real estate to sell let us make you an abstract ,
over Pou stable W. Intendencia SL I King Tract very cheap and on easytermss. come in. 49 jnlm. WANTED.--The' Merchants Transfer all kinds on short notice. Satisfaction now. Don't wait until you have found the purchaser, but have the
Improved in West
property
; Visiting brethren cordially welcomed. assured. Estimates cheerfully before band. ,
King! Tract netting 10 per. cent on in. WANTED-All owners of poultry to Co. wants rOUf moving and banlias answer ready
7 J. A. KIRKPATRICK. c. C. given on work In or outs'de! the city An
vestment. know Ai: breakage guaranteed. B. TAor.i Abstract will not make a good; title out of a bad one but it
H. HQRSLER K. of R. A '3 that we are agents for the cel- Chas B. Vetter IS W. Intendenc'a.
Prop. Phone978.. ISjunelm will often enable the owner to do so by showing him existing defecta
See us in regard to Lake View Hay. ebrated Conkey's Poultry Remedies i sen. Phone69& 25maylm which he may be able to remely.
Meetings ,of the en Property. Prettiest place In. New. Guaranteed to cure rope, cholera
Knights of Columous City and is on Bavou Texar. gape and to kill fleas lice and ml'es. WANTED-Your stenographic work. SANTA ,ROSA-Pavilion. L.; S. S. 'offers
K ." are held at'their hall.No.8 Also their wonderful egg producer, F. I Pensacola Typewrite Exchange, the best accommodation for The Pensacola Abstract Company
-p West Intenden I D. Hale Wilson & Co. S Mellen & Co. Phone No. eS4. 315}3 Palafox St. Phone 379. bathing and recreation to be found on ,

cia street, on every 18apr. 23may.> the Gulf of Mexico. Launch Leclalr ? tncorpo ated,
Phone 234 15 South Palafox
Monday evening at leaves city wharf dally at S-00 a.. m. ,
7:30 o'clock. Aa In- WANTED-We want your orders! for W ANTED.-A. R. Bingham wantsyour Phone 659. Ch.:.s. H. Burton Mgr. PHONE .393.114 N. PALAFOX S(. HARM L CIAIA" Cell.Mtt- ,
Tuition: t. extended 1907 Art Cikndars. Over.300 original :moving and hauling. He guarantees 1%. ay.
_., tin,tlstting KnIghts. ,designs to select from. All all ,br kage. Phone 630.
,,, JOHN B. prices. Mayes Printing Co, Pensaco
.- JONES If you will look around the house,
fl,S' LEONARD Recorder. Grand. Knight la. 16'eb Money Loan. you will find. a lot of ways In which For Farm :Turpentine or FOR SALENew

:; you Can use old newspapers. You Timber Lands
WANTED-The public to know that
can buy,them, In any quantity at this ,
.
.t: Daughters of Rebekah. RJAiTThTiJ we can do all kinds of repairing MONEY TO LOAN-Everybody borrows office They are put up in bundles LARGE OR SMALL QUANTITY eight; room house with hall,10:i
float building norse shoeing from Jno.' A. Hall
etc. J. money &
J Naomi Lodge No. 10, Call Address
:x, ;Rebekah,. meets every Monday Daughters night of'! G. Welsh Carriage Ca: fife Co, 14% E. Government SL When in I cents convenient per bundle.MATTRESSES, to !carry. and sold'-at five on or Ave.and 16th St. This place has to be

8 o'clock in L O. O..F. I need call on us. / Turner: & AYmard l1SO
at, halL Visiting -' WANTED.-Electric work of all kind. seen to be appreciated.. .. $
sisters cordially invited to .
be present Let na jsan! ,your fans recur ")our AND Real Estate
FURNITURE and Abstract CaP. New56C7
Lots 3, 4 and 5, block 140
,
dynamo do jour wlrin:. etc.. Paona MONEY LOANED on all kinds of p.r- Mattresses,made to order; old ones O Box 115 DeFunlak Springs Fla
.' MBS. B. R. W1TKOVSKLJUSS 79. Pensacola Electrij Co.205 8. tonal property on short notice. renovatei. New. tick. famished. City.. .. .. .. .. ..
WILLIE KENDRICK, Sec. Baylen. Terms ea.!. J. B.: Gray & Co. 2 W. Second hand furniture bought and Blocks 125 and 126, Petterson Adition. >

'M.: B. B. :A, No. 81, meets,first and Romana. ,Phone ,1165.', IfebMONEY sold. Upholstering) and,repairing'done. LOST water front. new siX roar:
third:Wednesday evening at 7:30 p. WANTED-The public to know that 114 fi Belmont SU, city, yhone 77L house on same.. .51,600
old newspapers can be. bought at TO LEND-On food real estate Darts Mfg. Co. C. T. Davis, Mgr.
Raflord Hall No 10. West ,
Intendencla
a.. street this office for five cents a bundle. Theyare security, or on good collateral, 1.OST-one sunburst with 35 pearls Block 63, East Kin: Tract.$2,6

A. G. FELL. Pres." all clean_and lake.WANTEDCarriages at lowest rates. Leslie E. Brooks TAILORING-B. Lv Diamond Tailor. and one bar pin with 11 pearls. Lost Lot 7 to 14. Inclusive, block l"U

!+ 0.L SWEENEY. See. AN ATTRACTIVE PROPOSITION Fisher building. 21Jan Gents' clothing cleaned pressed and between 132 E: flregory and Intendencia New C.tyI. .. .. .. .. .. .. ....$1,603
.repaired and re repaired oa ehoit notice. ,No. .l1% street Reward for return to Miss
Pcntacola Lodge No. 4. J. 0. O. f. $26.00rox"< A BEAUTIFUL SITE: painted; floats built to order;; horse MONEY LOANED on all kin'cb of personal W Government. g... Pensacola,- Fla Katheleen Hutchlnson 132 EL Gregory.
Pensacola Lodge No. 4; t O ,O. F.,!1!FOR A HOME in the swellest; and I shoeing a specialty, J. G. Welsh Carriage propertyn 'short cotlce. Idee, 29june. J.A. WILSON & Co.
*' 'meets every.Thuranar veinj at 7:30 most aristocratic portion.of the city; Coo_ f 27feb. Terms -easy. J. W. Bullard. upstair
.. 'at the new hall oa Belmont and Bayltreets. five large2 lots facing public squareon 28% South Palafox St/Pbone'1144.k SHIP CHANDLERS-McKinfle Oert
; YlsiUng brethren cordially the southeast corner. of Reus and.I WANTED.-AH Unas or_ electrical Ono- Ing & Co.. wholesale and retail ship loardand,Rooms. Real Estate Agents,
DeiSoto streets, work. I 'sell all kinds of electrical f chandlers and grocers, only first-das
Invited. GREENBLATT. 7
batteries ant other electrical kind In city. Fair prices to Salisbury Building, Room
supplies. house of : allCARRIAGES .
NEVILLE. Secretary. ALL OF THE MAXENT
TRACT
WANTED
When need me ring 345 UNLIMITED amount ox money_to loan Table boarders, 20S W.
yon
""" WEST OF "C" STREET, NOW FOR t or 955. all kinds of personal property Gadsden SL Miss Robinson. 17J
W. O. W. E. W. Peake. new Star Laundry bund on repaired and ,repaintedFloats'
'Idle Oak Camp No. 1, W. u. W. SALE. ing. E. Garden. ISdec. Special fates to business men on large bunt to order. Horse shoeIng -
,' MONEY TO LOAN AT LOWEST leans The New York Loan Co. 204H J. Welsh_ )
.meets in Pythian Hall lit and 3rd "sp cialty. G. Carriage THREE PLEASANT ROOMS to rent
;) Wednesdays in each month. Visiting MARKET RATE OF INTEREST. COURT HOUSE DYEING.. Pressing South Palafox. Co. -. : the with privilege pf light, ,' housekeeping NOTICEThe
r overeigns cordially invited. MORTGAGES ON REAL ESTATEIN and Cleaning Club 212 N.DeVillersSt 301 W. Chase St -
F. A: BOOHICH C. C. I' Mrs. T. J. Davis, Prop. Your pat Detective J, H. PORTER, salUnaker. 71$ South Woolley Sanatorium,the only Institute
BOUGHT
r" USLIE E BROOKS. Clerk. THIS CITY t AND SOLD.. ronage solicited; satisfaction guaran Agency- .Palafox ,street Orders taken for In toe United States where tin
> teed. Careful attention given ladles'garments. tents; awnings, camp: stools and House FOR RE.'iT--One or two newly fur.nbhd Opium, Cocaine and Whiskey habitscan
; RATH BONE LODGE. No. 30. .I Phone 1222. gfeu L1CE1\SED! aTSTREET- Cora.etc Prices reasonable'. tljan. front rooms; southern exposure be cured without exposure ST*
y Rathboae'Lodge, No 30,.Knights of Fisher Real Estate Agency r Piedmont Detective Agency incorporated ; with privilege,of phone. Loca- with so much ease for the patient. Onlr
1 ;F/thlas, meets!' every Thursday nightat H. ALTMAN=Tin. Copper siif'SheetIron all branches of legit:mate secret MILTON -UPHOLSTERING SHOP- ton! desirable and near business center 30 days' time required. Describe

CasUe HalL Members of ,sister 'COLLECTION I .OF." SA8PECIALTV. Worker; cornice work and skylights service work. 9 rite', for booklet ." WUhe. Mim; Proprietor. Furniture 422 W Gregory. 13maylw your case and I will write: you aa
,lodges. '.and visItIng brethren cordlat specialty; roofing; guttering: it tells who we are. General office repairing of all kinds, .carpets opinion as to wha I can accompli:
'ly invited to.attend. I ; and repairing 315 South Palafox ,St. ,.Temple Court.Atlanta Ga. New laid furniture packed for shipping Old newspapers at 3ve cents bundle for you. Ask! your family physicianto
C. J. LEVY : ",.' ... Phone, 560;. residence. phe.131$. York office 1343 Broaway. Local ,Phone 63.. ,Next, ta,Tampa..Landing. at this 'once., They are all, clean investigate. Dr. B. M. Woo'ley: 10*
,K.R,..ft:S.ft Phon87, ,'. joe ,S. Palafox St, Ziunelm --r i long distance 'phone";155& MaIn. andl I' .- 22ApriI and aloe., N. Pryor: Street Atlanta. Ga.

.
_\ rf .. .. 3 .. "

z1 ...
;: :J .j,, ;''f" ;.::.t ; :: $}::-: ":-, .1jrj., { ; :> "><" r 1
: : : ; -' : /
.:',,'"',"''.'-.;, (_.-''', ': !"-___'::'<_'l' .'.,<_:: r _7"---r,: _;. ;; .c ;..: ,,_ ..:, :_., ,,. ,._ ., .. :,._ .: .,. "":;" "::'-" ',,'. -- ,', .. ,, ', "-. _. <.:,'' ."_,,,'''::,,:."A:: ;"'.' """':< ,,,:. ,:, ,i.l > ,.:_.,, .- -. '

< tr l ,



-:- :
: ,; '7." -" "J. W. ." Lr 7'; -'""
"' -. !
"' : / ;? :
:
:
; "..

., : .41 .; .ITHEPNSACOLA I-

.,.: .

.' .! _+-.. JOURNAL TU SJBAY MORNING. JULY' 'S.' 1906 PAGE SEVEN f), ,t.\:

> S T-' \ zi-: : : : : Jl 1: M


I Thousands$ Each .Day Wh& Are Looking for Bargains r I


1 -

---- For Sale A'Few I II McMillan. 1 ,; Bros. Co.- EVANSVILLE & .

SpecialBarg
FOR SALB-Haring sold my residence I .
and13th TRADE FOLLOWS
corner of 12th avenue '
street. I now offer for sale my TERRE HflUTERAILROAD .
and one COW whichmay
fcoods
household be seen on the premises on ins In' '
.
Tuesdays and Thursdays between the. LIGHT AND COMFORTEvery :
of 10 and 1% a. m. C. W. Hag.erman.
-
hOurs 19juneFOR THE DIRECT LINE TO t
;'i

s LE-iLots 11 to 15, inclusive, 4 Real Estate MOBILE.ALABAMA.MARKETS. merchant who has electric ttghts and fans for CHICAGOand '- : :
one-fourth of blocks 75 )in New :
being of Pensacola. 200 feet on LaRua .. warm weather will do more business than the one who

raw street. 1311h feet on 17th avenUe and hasn't Trade follows such things as lights and fans. ,
fronting Harana Square. New two Story and a half dwelling:contain Apply at office. ; j 'I
twelve room house 'with basement ing. six rooms with lot 192 ft. '
story, and attic. House Just finished; by 384 ft. running through from .., Atlas North and Northwest.. 11 I

hard-finished ceilings wainscoting and street tor street being in the Beer Nayal Stores. PENSACOLA: < 'L ,
Mastered walls; cabinet mantels, two western suburbs.. '.. ,, .. $1200A Savannah Ga., July 2.-The naval ; ;
:
bath rooms and all modern conveni very desirable building lot on stores market closed today as follows: ELECTRIC TERMINAL .
ences. The house has a southern and 7th avenue, near Jackson street, .* ., 5 15WO COMPANY. Exceptionally Low Round "
Is of the splendid "neighborhood lot 75 .
eastern cxpoeure and one .i..' .4 t ,
most desirable locations in the city, feet front by 145 ft deep.....$900 .SoId'onDraught N .. .. ...470M. PHONE 106. Trip Rates to all Summer':1':;
being only one block from the streetcar A lot on the west side of Tenth .. \.. ,. ..' .- .4 60 .
line overlooking the bay and avenue, fronting both Gregory K...,.. .t.4 60I Touris ::' t tji
BayOU Texar. One-half cash. Applyto and Helnberg streets, 50 ft. front -.4 45H Points. i
J. A. Gray, 21 and 23 E. Garden St. by 156 ft. deep containing two .- .' 4 40 ; !

Tfjune. dwellings sold AT ONCE $1900 G.... .. .,.4 30 ... ... .. .
F .. ..>.., ....425E
FOR SLE-I am,making a limited of- HOOTONVAtSON\ .4 15 O. H. Hillman S. L, Rogers. : !

fer on 12 lots in northeast New City at. D... .3 SaC r G. P. & T. A. .. General Agent.. 1

within the town limits and near the ... ... ... 3 O.to3w AUSIEY S COMPANY Evansville, Ind. Nashville, Tens : .

clear Lake titles View and Haven excellent properties elevation with at I' Leading Real .Estate J.Rental and Spirits' Turpentine% cents.
$720 I offer single lots in the same I Insurance Agency. MERCHANTS Wires Worked Badly. i COMMISSION' i PENSACOLA ELECTRIC TERMINAL. !
$60 and $65 lot on easy BROKERS
vicinity at per Owing to wire trouble only th$ closing -
terms. (This is to the trade of white quotations were received yesterday t
people exclusively. Elbert A. Clubbs For Sale. from the New York and Chicago I RAILWAYCOMPANY.. 'f -
.
Box 112. City. ISJunelm .BAR. markets. ; II WEST INTENDENCU STREET, PENSACOLA FLA. i

FOR SALE-Good family 'horse and .. .. : Summer Week Day Schedule-Steam;
SALE Thorough-bred horse. '
FOR Sam. Apply .Pensacola Eta buggy; free driver kind an4 gentle AULtYiT REPORT!' Private Wires N. Y. N. 0.and'Chicago.COnONSTOCKSCRAMPROVISIONSandBONDS
bles.Sleepy 243uneFOR Apply P, O. Box 597, City' -. ljuly SI.Iys..,.oI Cotton Market. i Train and Electric Car Schedule, '

(S 4- me.., I' Effective June 19,1906. -
SALE-Gentleman's -road" horse FOBA3E. CHEAP-One Rapid Ben- Za.-Y.b......_..U._................._..I.U i ii .
gentle good saddlerand singerDuplicator.. The Fisher' Real r.b.xiir..I........... ............ I- '
Western pony, with bran Estate Agency. ljuly r ICE COLD !r Xar-A cil-......-.........-..IMAprlVlUy Between .
driver. Donkey Heck njwtrap ..............-...... 8.59Amiu8oi and Sold or for Investment. Pensacola and 8IBayou. !, ; .T
and harness. Hinman & FOR SALE Show cases, wall cases Jla7.l.....:............................._..I."tluu.l.q. i Bought on Margin Lv. Pensacola. Lv. Big Bayou. : 't
er, Century Fla. 23may and safes. All in first-class: coadltion. TRY IT. .._.....-...-....._........ ....UtJui7An 6 a.m. 9 SALE-OIe good all-round fam!. .', Applj; to P., Llnienslruth, the .....,.-..........-. .... ...1.:5.' Reference: Pint National and Peoples Bisks Phone 1173 i 7 a-m. 10pm. 7:30() ..11..aQ p.ni: ;
FOR Jeweler Pensacola', >t _............... BOO 8 11
ly horse and harness. .One top buggy Fla2j1m'; Svptaartnr-Octabtr ............ .. 5.60 ...........t............................. ... 9 &am..In. p.m.8:30 9:30: ;: > -f S
nearly new. One good wagon. A. FOR SALE-RegIstered Berkshire o.kberJrovber ................ .....LM 10 : ; .
E. Turner Bohemia, Fla. Phone 245.iCjunelm. hogs; best .of breeding. Ask for MarineGrocery Co. lfoveraDecembw .......... ...151Lirerpool : a-m. 10:30 "
catalogue. < Carl Setterlind. Chipley D.osmber-Jaouary ......... ............,...5.54 11 sum. 11:30 : .
12
noon 1:30 !
Fla. I 604 '605 S. Palafox St Spot*..4 10 p.m. -
FOR SALE-Two fine milch cows with 1 p.m. 1:30: r
young calves;. can be seen at No. FOR SALE Male Jersey. calf 10.daysold. Phone 725. WHAT A SAVINGS ACCOUNT 2 pm. 2:40 .3

123 E. Gregory.. C., B. MciOIlan., Will deliver at 6 weeks. Ad- V. J. VIDAL, Manager. New York Cotton Market I 3.p.m. 3:30: ,.- '. i

lOjune. dress P. 0. Box 478, city. 27jun'elwFOR dose WILL DO. I, 3:30 p.m. .4.00 :'" )
TEA DRINKERS ATTENTION Wo carry a full line of Imported and January.. .. ... .'. .* ,.. .... ..1033 I: 4 pjn. 4:30 t
Domestic Groceries and Provisions.We .
: 4:30 :. t.
.
want delicious of tea. try ,SALE-5-room house hall and July .! 1025October p.m. 5:00 '
a cup '
you want your patronage.Do .. .. .. It will with which to start 5:00: ,-
-Our Own" Blend it is superior to any other Improvements, at 910 N. 7th .10.23 provide capital p.m. 5:30 ; I
December.. .. ... ... .. 10.30 5:30 p.m. 6:00 i
dollar tea on the market Only 60c ave; lot 100x110 ,feet room on lot .t. in business.It s i f.
; New York Spots 10 80. you 6:00 p.m. 6:30: :, ; .
per pound. A valuable ticket la.every for another house;. -.o, ....$1100.00 .
package. New Orleans Grocery Co. 6-room house, 7th St. and 14th You Want The will provide for saving money which is 6:30 p.m. 7:00 -. : -J';

Phone 105. Jas. McHugh, Prop. ave.. .. -.. ., ... ,. ,. ..$150000 Grain and Provision Market 7:00 p.m. 1:30 .., ;
7june. 8, W..corner,.bit.220,:West King Wheat usually squandered.It 8:00 7:35 p.m.. 8:00: :' :::; r
Tract. consisting of 6 lots, beauti-: pm.Between 8:30: .3 .
;
will the toward.
Close securing a
FOR SALE-Finest car load of horses ful site for summer h me..$UO.O() .. .. .. pave way. 9:30 ..7'
July. 80% .
ever received In Pensacola McMi, J..A. WILSON. & CO., Salisbury Bldg. BEST September. .. .. .. .. .. .. ..81 home.It Saturday only. .}( .
Ian & Turton West ,Intentfencia St6june. -:
.. ., FOR ,S4LE Dqn't fail to* get my will provide a fund for educating your .-
prices. I carry a 'full lIne' of building #. ... &l'L ..t Pensacola and Fort ; ...

FOR SALE-Remington typewrite material Sash doors' and blinds July.t ..' 1bjlt.C '.*.' ... i:t. ..53 children. Barrancas. I'

"Rem" care Journal : SJuneltt a fpeciatty.: Joel. jratefc' Baylen St. September. ... .... .. ,. .. .....52% It is the best possibly way,for accumulating i Lv Pensacoa.! : Lv Fort Buranc" !, J :
wharf, 17June ...... .
.1 ..: '
TackleTennis a.m. 8:00() a.m. '
FOR SALE-A lot of. old newspapers. Fishing I 7:15: : '
Put up in bundles convenient for MARINE AND STATIONARY' EN" New Yprk Stock Market a reserve fund for hard times or old age. i : a.m. 11.00 a.m ,"f},

carrying' Only',ftv.'ten s per..'.,bundle.; GIXE3. for, :saje. 'Wonder'' Gasoline Sou. Pac.. .._ .. .. .. .. .. .. 65% We', four cent interest on allsyour; 1250; p.1g.- 2:00 p.m. : L .
Engintes are the simpliast! strongestand -' pay per 3:50: p.n1. 5:10 p.m. .' r
\1Jp1TW. office Copper.. ;:? : .. T." .. ... 974 : : !
best engines on the market for ,. Golf.. Baseball and Athletic .A.8.B.- .. .. .. .. .. .. .129 iAtch savings compounded semi-anhually? 6:20: p.m.. .7:00 p.m. i -
CITY MAPS FOR SALE-Hooton &: the money. Send for catalogue. Ed< .' ; .. .... 8:30: p.m. 9OOp.m'Saturday :
Goods and .. .
B. Banks Pensaco'a.; Phones" 1377 the beet Phonog aphs reo t>& {P> MH -
Watson have just received a largeSUPPlY 577. ords the best Dog Medicine, the beat A. R.... .. -... .. .'." .. ...141% only. -
and Sjunelm
of the latest city maps showingall the best Tires the best B. R. T.... ,.. .. .. .. .. ... .. 7U4 .. t
ot the subdivisions.: The maps are AUTOMOBILES.I am agent for the Bicycles B.&O..e; ,. .... .., .. .., .115. % ,
official and down. to date "and are Pope Mfg.Co.and can sell you autos Typewriters the best Lock and Key Eri.: ,.... ,...A. ..' .... .,. .,!-.'. :0'.. .39% Steam train leaving Pensacola at : 1
mounted on heavy linen.: Regular from T500.00'up.; They fcosl less than Fitting, best- Trunk Repairing, beat C.iF.1.. .. ... ::. 1... ... .... 45% FIRST NATIONAL BANKOF 7:15 a. m. will stop between Pensa- '

price. $2350; special price on lots of horses to keep up. They can be ruin Gas Lamp and last but not least the U.S..'; .._.. ,..' .. .. .. .. .... 33% cola! and Biff Bayou only to take oa J

fire or more to agents or real .estate sand or anywhere: horse can.go. best Roller Skates < TLSPZd......., ... ... .. ... .. 99% passengers for points beyond Big ;
men. Hooton& Watson.: 8may Leslie E. Brooks. Its.. .. [ ;. .. .. ,. .... 25% PENSACOLA. FLA.W. .
FOR SALE OR RENT-Two lighters Why so; to I* &; N.. .. .. .. .. ... .. .. .141 Bayou.; Steam train leaving Fort Bar. \ }. i
; FOR SALE-Ten new and second Lead.. ..'... .. ... ... ..... 724 !t rancas at 5:10: p. m. will atop between : ; -
one with capacity for 75 thousand ft. hand ..H.XIJOwt.J18.Pre* W.K.HT."Ja,V.Pret.ali!O. \ill?
lumber the other thirty thousand capadty second office safes differentsizes M. P.. .. .... .. .. .. ... .. ...88% T W.B&KT and W.N.Bona- .Cuhteri.DTK .. Big Bayou and Pensacola only to put !
: Rates reasonable. Also two Scarritt, best Moreno makes, "Office at bargain East Government prices.. I F. B. 'BRU'CEPENSACOLA. L C.... .. .. .. ... ..........175 OTOM-?.0. Brent W.D.A.Q.Bloun Brent.. W, B Kootrlei W. K. Hjtr. Jr I I Ioff passen'gers from beyond Bg: -\{

skiff boats for sale cheap. 22 ft. long. st. 24mar Can. Pac.. .. .. .. .. .. .158% Bayou. Other steam trains will make t '
!5) ft beams. Telephone or write J. A.I N.Y.C.- .. ..127* all!! stops. Each electric 3;
Chaffin_ &: Co.. Milton. Fla. 25mar FOR SALE Second Band 25 H. P FLORIDA P. 0.... .. .. .. .. .. ....... 88% car makes all
boiler. Will sell cheap. Apply to R'D'G. .. .. .. .. .. .. .. .118% stops. S
FOR SALE-Nice. clean old newspapers New Method Laundry. 13April St P.. .. .. .. .. .. .. .. ..168% The above schedules and regulatlong '
flee. at 'are cents a. bundle. This oi THE RI.. .. .. .. .., .. .. .. !. ,:3 H Al.. SBO3. subject to change without notlca J

.. .. .. .. ..
S.R- .. 33%
: HOTELS. v C.W. LAMAR President JOHN PFEIFFER. *iUiH Cashier. I I Local Freight Regulations
REGULAR HACK LINE>From Chip- T. C. I.- .. .14ii Vi M.E.CLARK.Vice-President and Cashier. J.W.AIIID EWi. Assistant Cashier.

ley making' connections with mail: I 2104 Penna!. .. .., .. .. .. .. ....U2&, Freight shipped by the 7-15 a. m, :
launch for points on St. Andrews bay.I EAST PAS.s--Th'e: : place for a vaca U. P...... .. ... ... .. a.' a 143 train will be received only for polnU .
tion. Good.fishing and bathing,cool THE AMERICAN NATIONAL BANK ;
Extra
teams for traveling men. Good I beyond Big Bayou and will not b, i
horses, comfortable vehicles. Call and shady'good board at reasonable ,
on rates. For particulars apply to L. D. of today is exemplifiedin received later than 7:05 a. m. Alf .'1
.
or address J. C. Sinclair CMpley.Fla. OF PINSACOL. nil.DESIGNATED '
L. Destin Fla, other Week Day trains leaving Pen. ; ,
Telephone No 74. Woodward or Destln
28ap the Qualities of the DEPOSITORY OF UNITED STATES.
ljulylm00MIERCIAL'* eaoola not later than 3:50 p. m.. carry ,- ,

FOR ing choicest SALE-EconomIze of lots on by East purchas Hill ati HOTEL, DeFuniai. Headache Remedy.BROMOVI.N. CAPITAL STOCK, $200,000. SURPLUS 160.008. freight for any point but freight will ".

$300 per lot no present need of paying Fla.-New management: newly furnished OIREGTOF5.tienr" not be received later than 20 minutes i
$400 per lot and $750 for a 30 foot ; free.bath and 'sample rooms, F. E. before scheduled departure of trains. -
Frank Brawner
strip of barren sand. Three'beaut good peals 'an<4 good .beds- Trare]\- L. Covlngton Rellly -
J. M. Pfeiffer, W. S, Rosasco. C. W. Lamar, The 9:00 a. m. Sunday train may
ful sites of each Ing men especially solicited. Rates $2 Quick Certain
five lots at $1500 for Agree- Bryan Dunwody T. F. McGourin J. R. Sounders, carry light, perishable freight cndei
each quarter block: not over 100 yds.1from per day. Mrs M. H. Stanley Prop. W. H. "M ton, 0. E. Maura '
able and Harmless. A. M. Avery
electric car line. A. V. Clubbs.SJune. .; 29may. % W. L. Cawthon Dr. W. J. Hannah. McKenzie Oertlng, some circumstances by special per
\1 PARK HOTEL-Why pay U.I par Alex "McGowln. C. Covlngton, M. C. Clark. mission. Electric car will cot carry
day when" you,can get'as good room For Sale by Ii freight or packages of any description
FOR SALE-For sanitary purposes' and bed for SOc. ,Coolest place] In White's Pharmacy Safety deposit texts fcr rent IUD, 3.LO: end tUG the f U. frivate apartment except medicine urgently needed.
we have in stock Ground Hydrated Pensacola. Special rates by the week in connection for the convenience oi customers. Shippers are requested to bear these
Tennessee Lime In strong paper bags,! or month. One. block from postoffice. PALAFOX STREET. regulations in mind that inconvenience
Time
Paid Deposits.
40 Ibs at 25 cents at ware house. A. 22may. Manufactured by Four per, cant interest on may not be caused.

V .Clabbs corner Gregory and Alcaniz OLD: MILL.INN-On;bay front. Opens G. VAN ANTWERP '& SON, These freight regulations subject.t(j
8june June L Large, airy and delightfully Mobile, Ala.FREE change without notice.
(_ J-' Any further Information
FOR cooL Good fishing. bathing and regarding
SALE-Herd fine Jersey dairy boating First class table .On electric passenger! and freight schedule can ba
cows with well established milk line. 15 r-, had by applying to the general officeof !
I car minutes ride from city. BY '
route.0 competition. Cows and Regular boarders and transients. -:: L murmf GmmN.: P&Dmas'T.1I..WIILI&8. VWI.i'JIHmU' the company.
business first class condItion.Apply! j B.K.W81DiJ'J..L.01..0. MANSFIELD MOSSNO,AY.CI1I55 \
Terms reasonable. Address Old Mil 'MAIL Passengers are earnestly requested
S. A. Taylor] Century, Fla Sjunelm He'* Bad Iom. Hard Kaoelca.
Inn Pensacola..Fla.: 4mayBROWN Tor-tune knocks ones at every mafloor. Citizens National Bankof to promptly report to the general
TEA HOUSE-:-DeFunlak Springs. ." office any Inattention to duty or discourtesy -
DRINKERS ArrENTIONIfyou BOOKKEEPING AND SHORTHANDto -Fortune t* knocker, ail 11Pt.- j jr Fouaoola riorWv.Qm. the
Good beds, airy rooms, elegant : on part of employees anito .
want a delicious cup of tea. tr) FIVE in eacL county,desiring to UVe mlfCCrOIf& make
persons specific criticisms 01 service.
Our Own" Blend it is superior to any I meals; free bath and sample rooms personal instruction who will within.90 days w."riI\ 110m'Bur. '.r.K.WelIes. Blx RoWnswa., 1*.JIEton G* .n, JOHN -" .
W.
LEADLBY -
dollar tea on the market. Only 60cJr Special attention to traveling men.Rates dn>and SEND this notice to either of d """ ,
fAMKIHtt aU.lfeaa.TlfJllfaJlon
pound. A valuable ticket In every ,$%.00 per' : ,day, ,J. R. Brown, H BZWM41 Manager. t.'

Package. New Orleans Grocery Co. Prop. DRAUGHON'Sutin -

Phone 105. Jas. McHugh Prop. HOTELS AND BOARDING HOUSES .
Pensacola St.
7juneFla. Before laying ypur carpet or matting Andrews and ;

23mav buy a supply of old newspapersto % tic CC dkgti

FOR SALE.-Improved ana unlmpra put underneath -and protect It. Only City of Pensacola Improvement Bonds. Gulf Steamship Ce. ;
ed five cents a: bundle at this office. Montgomery, Atlanta Raleigh, Columbia -
property; In all parts of the city. STEAMER TARPON.W.
-
J. A. Shreveport, Dallas or Jackson each. Dated January 1st. 1906. Maturing January .
Wi'son! &: Co.. Real Estate Agents HOTEL. SOUTHERN-Open an the Denomination 1000.00
Room 7. Salisbury building. Phone yean American European; plan. Miss. 1st, 193$. Redeemable an. 1st, 1926. Interest Payable Sem1ADnuaI11.WEOFFER'FOlfSALE .O. BARROW, Master.Fi&STCLA .. -- -

11- 23ian Special summer rates. First CHIPLEY every respect Pleasant and convene fiEFUND MONEY. Law. Penmanship. Arithmetic : FREIGHT : !
Prop HOTEL-Can Settertind: ient. Mrs.. T. L.. Bowen. Prop. Pen- Letter-Writtnir, Drawing, Caxtoozala. AMOUNTS TO SUIT PURCHASER. -kwitd- -
Special attention to commercial Business KngHsh., BankiDIr.etc. -
travelers. Free sample and bath sacola. Fla 15apr 27CoUejres in 18 tes.In 300000.00 PENSACOLA. MOBILE. APALACHb. 4f

rooms. Large rooms with good beds. CENTRAL HOTE4"'CHIPLEYOp.epot. : ness Capital.xnen.17 Ko years'vaction;enter aDV tune torbusi."w rite The Peoples Bank of Pensacola COLA. CARRABELLC. ST. AN- -
U per day. ISmarlm Large; and well lighted for ea.talor.! POSITIGIS secured or lOin 101151 DREWS. MILLVILLE. f
BAY rooms. Free ample .room. Meals at YOU MUST) toKetEoiiieStadrFBE. *
HOTEL.-Open lIght andjy. attention writenow thus 'ldesirsto= Pensacola Fla."EVERYTHING And all point en St. Andrews Bay
Special to travellng
European plan. Rooms light and :all hours. more about yonr special Home Study Offer CarrabelU and Apalachlcola.SCHEDULE .
clean.: Transient trade mer. $2.00 per day. J. JL Tug- In the _published I .-
solicited.
ft t
I ----
13marlm I
"5-573 8. Palafox. Jis. S. NIcolau. gle Prop. LeAn Fensacola Sunday, S:30 &, t
.
CD.'REL&LHOTEL.aneads "NN'N Y. y.wv.- Mobile AJS
for
B.
MUS QUITUI. jeave Peauacola Tuesday SIC -
: Fli (\. I "CREW NOTICE. p -
Rates $%.00 per day. Nice rooms. i Neither the captain owner I. KILLS FOR HOUSEBUILDING : m. for St. Andrews, MiUvUle, Apt .
''tood beds table the best. J. M. Per- I nor consignees of the MOSQUITOES "" : Ucolcola Carrabella and InUrmadlau f.-

JS.1'1'01-! 17apr i a Br. ss August Belmont"will IE..ICHS,Fan lOctnts FROM FOUNDATION TO ROOF."' I points. -
Isformatlon .
".."TELTvEIlNON I responsible forxlebt For additional : apply tf f'$;
-Rates $2 G.-a.
per.day. We" J. H. ff
SAUNDnRSM
Special rate by 'week: Special 'at-I contracted'by1-the crew of said vessel. PATENT APPLIED FOR. Tom U T.ry Sew at >>oftb.- .
tention to traveling: men. Free sam- I -J.-CCLARKE.. At all| Druggists. "Tac. he beard a man car the other Phone 11. H. G. DeSILVA & CO | E. B. COBB. 1"1..14., $

lkpr.P.e room. Mrs. J. P. -MaUldin Prop. I GULF TRAJtrr CQ! ., Captain. MUS-QUIT-U Jacksonville MFG. Co.. 4y Pj-wident..that h* would and Greet rather replied be right that tttaaDt bAMn -........;.............-..'. .. ......".'.'.'.'''.'..... V.....-................................................. ..........'..-............................................ 3gpvs.andPaas.Ag' f'3
Fla. '
Consignee ,_... M. ..JBJ ac_!HMajtD: _j oti,":' Pen&cola.T1&I I


\,

<. __0 j":,. ;:.,t ..., ..- ;;";,e,1h %' '_1, ,,_' _"'.' 7. ._-<_.1 : ,-! _"'1' -- 1 1L
.' ... ; ,,,, ;: _
.. '; "* i.. $lii.t. ; ; $-i'i. +h-::; y. ""j-- -
11II..:... :;.2:1: ;;.L"" 6. '



Y q
r


: f r

....
.
,t' THE, PEN8ACOLA_ '.JOURNAL:, :TUESDAY MORNING. ,' JULY .3. 1906" PAGE THREE

-i :,.', .,' ,
-

p' O 01.SHa'i1it-SINESS :1'1 .t

.a '
.


'- OR'iOiNG1NTOOUR' : : : c, :





INC8[ SE : '



Money, (Order, r '.' "Business u,. w I' 'l

Increases i' < ;' EW STORE '
.
I I


July is Vacations.the Monthfor Nearly. Three_ for Fiscal Hundred Year.d Thousand s ,f



.
The growth of Pensacola Is clearly : ; ,
Thaeshy we are having a "
shown In the business transacted by
vacation sale at this time, to t
give our customers .an oppor- the which local enl'd'(postofflce?: June 30.for the While fiscal the year postal -

tun great ty to reduction supply their In price.wants ata increase revenue the did money not show'order,such,department a large Our Immense Stock Must Be y. : Lt.

'iBONT DELAY COMING,HERE business showed an increase of near t.
FOR THESE MATCHLESSSUIT 1 lr three hundred thousand dollars in V
BARGAINS. tha amount handled:\ during the,year. r Jp t
i The, regular;business of the ,postal \
::!0 per cent off on all our sum- department would have shown a
mer clothing. corresponding Increase but for the t
15 per cent. off on all' summer fact that the year preXous the bat Reduced Before :
under vrear. t'eship fleet was in port with thousands Moving g Day tJ
20 per cent., off on all straw of men on board and vthe' mail 1 t > J
and soft hats handled for these naturally swelledthe :
10 per cent, off on trunks and business to large proportions fo:
bags. I the year 1905. Even with this, the i
These are strictly cash prices. I business of the year Just closed showsan
increase.and a substantial. one. v THE QUICKEST WAY TO REDUCE ..
Assistant Postmaster Tippia, who' I,
has been busy for several days on his
'
has completed them and the \
reports
stowing is a most satisfactory one' STOCK IS TO REDUCE PRICES / :-;-
especially to the postmaster and his .
assistant The postal revenue for the

lear lows of showing 1904.5 the and gain 1903-6! ea\Ji are quarterand as fol. WE'VE decided:to rub, out the profits-they're yours during the greatest

OSCAR E. MAURA, the totals: sale ever established Pensacola, and you pay only about It'I

itoclt STOCK, Bonds AND and Securities BOND: Bough BROKER.and Sold.. Qnartar Eudirg: 19045 1905-6 the bare cost of them in the wholesale market. You know the kind of -t
.. .. .. r 1
Sept 30 $ 8,897.33 9,63791
12 E.Government St. P.0.Box154COTTRELL :: fine Crockery Glassware and Household Goods usually
Dec. 31 .... ..10886.51 10,41976Men. '
.. 31 .. .. .. 1141420 11.735.25 found at Gerson's-the better'sort of fine China, Cut Glass and,Silver, y s

FINE, PHOTOGRAPHS., Jun. 30 ,...1. .. 11712.26, 'I 11,3238' the ornaments of refinement, that perhaps you had some desire'for; your 'I.

Pensacola Fla. '$(2. 10S5 $43,11679 opportunity is at hand now, and for the next two weeks to come we'll.

Business.It : have a' sale that will be the 'talk of the town. ,
Order .ti
WATCHES AND CUT GLASS Money t-
Something Swell in Gold Jewelry.W. was in the'money order depart .
tI
.;WHILE PRICES AREIREDUCED
A.Gahlenbeck, 2U S. Palafox SL nent that the increase Is most flattering r3r ; --- --- I
million dollars were handled and an: THE QUALITY WILL BE UNCHANGED AND THERE'LL BE: NOTHING RESERVEDWe -:'
TURTON & BELL increase of nearly three hundred j t,
PHOTOGRAPHERS SINCE 1870. thousand ,dollars. The business for have made preparations for ample service to wait upon you. We'll .f
tfodak Supplies. Finishing lor Amateur the fiscal year ending ,June 30, and !
have. .additional: force of competent salespeople, and besides :
also for the fiscal-'year of 19C5, was : every
articleis''ri1arked.it plain figures and it will be matter to .
R. K. WHITE. as follows: ; ) an easy see at :
Quarter Ending 19045 1905-, MONEY SAVE this of sales where f
Watchmaker.Manufacturing: Jeweler.and Graduate a glance'THE YOU'LL during greatest
Optician.S. Palafox Street Pensacola.Fla. Sept. 30.. ..$157,60474! $198,634.74 'article will be'sold .
,
.. every .f
Dec. 31 .. 210,52586 315,12.28Mrch. ) .
31 ;.. ., 193,35170! 273,98l.57Jun.
Tersely ToldJohn 30 .. .. 230,4- 982 240881.11() ;.", ,

$791,352.11L029,088.70 !1q '!'t ijJl .kc f' ,
FAA
H .Kohler has returned froma Old Chronic 'Sores.
trio. which included French : Lick As a dressing for old':chronic soresthere F lessTHAN #, l :
Springs Niagara Falls, and vafousother : \t
,is naihlng: so good as Chamber- : \
northern resorts. lain's Salves.: While it is not: advisable ,' '
D. W. Burke: and WiUIam .D. C to heal old sores entirely; they;I If "- : '' ,'I"
f :).
Campbell, were among the visitors should be Kept in a good condition for ,\- 4--'t1',\; F _'T, :, ,.'
from DeF uniak, who were in the city which this salve Is especial'y valu' : '$ '
able. For sale by all--druggists,- ,
? -
yesterday.A ....
THE REGULAR PRICE. '
party from Montgomery, composed -
Adv. : I
of A. G., W. E.
Bunkley Us
SEEN
SIGNS ,AS
btry, C. B. Dexter. A. D. Elsbery 'and '
Lester C. Smith, are In. the_city on FROM STREET: CARS REAP
READ THESE T"ENOME AND TIiBNF1TS
OFFERINGS :
.
combined business and pleasure I : Signs tells us'where to go and',what" I Irl
Arlan Brown;stamp {clerk- ath, to get.. Every one reads a sign'-and ** ? c t ,1 -* __
post office; who 'has been 'off on a automatically, one; will iraturally read ii
l leave of absence of fifteen days, which: au the signs he sees ;yet net remember '
he spent at his old home in Indiana, any special one unless it is STERLING SILVER., PLAIN WHITE BEST QUALITY AMERICAN SEMI-PORCELAIN AND WHITE GRANITE +, : i

returned George home Barrington yesterday, afternoon., who cars wrong.,a 'sign Passengers"The Crystal noticed Pharmacy"in from ih3 $24.00 Table Spoons, now__-;___ ---------:.---$jll&o Per doz Cups,and Saucers that were 75c per dozen, now.... _57c per doz PJ l '.

was arrested by Officer a Spotts negro wood'as the New Brent Building up side $1'2.00.Tea. Spoons, now:.._________-:_____..,..__ "!'VO per doz 6-inch! Plates that were 60c per dozen now45c per doz '. i
down and nearly'every one on the car ,
a dangerous and suspicious character, remarked upon its oddity. t 4 7-inch Plates that were 75c per dozen now57c per doz

Rosa it: order county to hold authorities_ him! for, was the Santa taken 1847 ROGER EBROS. SILVER-PLATED't' WARE. 6-inch Bakers' that were lOc each, now____________7\c each "

back to that county Sunday by the I' NEWSOITIIIMINOR $4.00 Tea Spoons fancy patterns, now:_1_,..___$3.GO per doz 8-inch Bakers that were 20c each, now____________15c each -

sheriff. I' $8.00::Table Spoons, Fancy Patterns. now.?,_:.$6.00 per. doz Covered Dishes that were 50c each, now____ ______38c each f- 'j f r
Albert Meyer of Boston, head of COURTSRecorder $1.00 each ______75c each : ;
the train of shoe stores bearing his $3.00,Tea Spoons, Plain Patterns, now _. $2.25 per tioz Pitcher and Bowls that were now

name in the south., Is in the city on $4.50 Sets of 6 Knives and 6 Forks, now_1___3.38 per doz "' !
cne of his regular visits to the local Laney had thirty-five> defendants -
will of t
avail
store. Mr. Meyer is much pleased before him In the municipal Surely you yourself opportunity.. to replenishyour $ 3.50 Cut Glass Bowls for________________ ------------$ 2.62 -
with the business being done by Manager court yesterday morning for trial table silver. 5.00 Cut Glass Bowls for. ______ 3.75 '.
= --------------------
Neuman, and states that tie principally drunk
The charges were
store here is one of the most flourishing and figntlng, the police having done 8.00 Cut Glass Bowls for._________ ------------------ 6.00 .-
'
owned by him. tha usual Saturday night business. Of Royal Teplitz Art Vases,that were $25,' now _,,.$18.75, 10.00 Cut Glass Bowls for__________________ ---------- 7.50 ':. t '

yesterday The fire afternoon department shortly called after out 3] the. cases two before,defendants him the, judge continued dismissed Royal Bon Art Vases and Bric-a-Brac, hand-painted; $20 15.00 Cut Glass Bowls for.________ __________________ 11.25 ; I i

clock to the two-s-tory frame building -i] four cases suspended sentence in one Opieces' now-----------------------------------T----$15.OO 20.00 Cut Glass Bowls for____________=-__ __-:___-_____ 15.OO .,,i' ,

at the corner of Gregory and Tar i case upon and one passed defendant a thirty-day Fines sentence Imposed Genuine ,Royal Serves, Art Pieces that were priced at.$25, 25.00 Cut Glass Bowls for______ ____.:_________________ 18.75
ragona streets, occupied by Mary
Char!. colored, which was ablaze.,The amounted. to 1113.New- $20 $15 and $10 now one-quarter less. Cut Glass Nappies, Vases, Bon-Bons, all included in this sale.
roof> had ignited from sparks but the Suits Filed. Nothing reserved, at this sale. _
!fire was extinguished with little The following new suit was filed *n

damage. the court office yesterday of the: clerk* of the" circuit $100.00 Haviland China Dinner Sets now______________$75.OO

Willie Bonlfay. who has been foreman Emma Ruleff 'vs. William Ruler Think what an opportunity this affords you; you can get that, 75.00 Haviland China Dinner Sets now______________ 56.75
of of
the Pensacola the moulding Iron Works department and S'ipplvCo bill Lcitor; for for divorce compJ; lnan John P. Stokes, so- dainty piece' of hand-painted China you have wanted so long. All 50.00 Haviland China Dinner Sets now______________ 37.50

has severed his connection with of Cake Plates Salads Bon-Bons Dishes Ramikins set in the house reduced in like proportion.
our Mayonaise ; Every price
that company and has gone to :Mobile ,,__, _n _,___ __ .
Boullion and Saucers Pin and articlesare Semi-Porcelain.Sets102 pieces now.. 637
to make his future home. He IT CURED THE Cups Trays, countless other 8.50 American fI
DOCTOR.
ras accepted a pos'tion' there' with !, open to you without restriction at 25 Per Cent Off. ,
the Mobile Iron Works. He has I New Scientific Dandruff Treatment

many friends here who regret his de- Recommended by' a Physician.Mrs. 1 We especially want to call your attention to our Automatic
rsrtnre I Marcy C. Crawford, Oaiesdale,: Our, Table Glassware is all full finished fire polished goods, meritorious
Mobile! Register:' L.: Clyde Wilson i Wash.: "Herpldde cured.me perfectly clear as crystal-no unfinished cloudy-looking glassware in this Refrigerator (this refrigerator has every feature) at
i Pensacola, president of the Ala Of dandruff and: falling hair" i 25 per cent off. We should not have one left after the first t tday's
t..ma. Christian Endeavor Union, was .Dr. B J. Be rdsley. Champaign, Ill:: stock, all at 25 per cent less than regular price-gives '
in the city over Sunday in the,interest -: "I used Herpteide for dandruff and you this beautiful ware at: prices that you should stock ,your side- sale. t
"
of Christian Endeavor. He spoke falling hair and I am well satisfied -
to the members the societies' connected with the result. I board. I ;
with the First Christian and Alt R. Kelly 219Desadero; street' .It is a recognized. fact that we handle nothing but high-grade 'I'
Government San Francisco: .Herpiclde'put a new
Street Presbyterian
churches, creating a great deal of,enthusiasm. growth'of hair on my head.. HerpI-: When any article for the kitchen is needed you can always Enamel ware. Stransky's famous blue and white transky'sfamouswhite
An effort will be, made to cide does more than is claimed." find it at Gerson's. Every article in this immense line is in- and white, Venetian blue and white. Royal gray Enamel ware, t I

organize Plans are a being local arranged Endeavor for Union the state and "Destroy Herpicide the kills cause the, you dandruff remove germ.the cluded in this"sale. full line of all .in stock, 25 per cent off. t

convention! to be held at the Government effect"-cures':dandruff, hair and prevents
Street Presbyterian church baldness., For sale by W.-A. J
April 19 to 21. Delegates from the I D'Alemberte, druggist' and apothecary I
entire state and the western portion. I 121 South Palafox street, or send 'lOc .
of Honda will attend. I in stamps for sample to ,The Herpi ,' : '
Ii i cide: Co., Detrolt'Mlch.CharcOal. : : O .-.... .'" .

Tersely .. ...1
There's a reason for the wonderful IT-z! :,-,-,; ,
demand for Blue Ribbon Lemon: 5VGO
and Vanilla extract. Try them andyoull I ,
know why. 1
'
We have just received: a ::
...
.
AWARDED GOVE.RNMENT very fine stock.and will deliver t
CONTRACT FOR WALK
orders promptly in any iIt.U

Baas:! ; OFF ;
&; :Manville were yesterday amountTelephone O -
nO:11ied: that they had been awarded a
the contract to place the concrete '
"alk at Fort Barrancas for which bids SEWELLWootoi -5 r ,
were recently asked. The walk will .

.De over t a quarter feet wide.of a mile'long- anJ.kit I" .: 1 rf'
-- -
..., .. >. .. \ s



?,,--j:; ;,) ': ;":' '''' ,,,- -;,\ --.M'!. .: .,.- "'.' :: :-f-: ; ;;,,"' ....:. -t ,.. "' ,'1; ;:- : 4' ,I ;. : t1:
S. ., ,, : .: ',' "" ,- ,, -,__ ,, .',."" -_. -" ; ''"''''"'' -o. ," "",, .-"," '.:"", _: J; ,_, f. .i"/' .:f.t.;' "--::".- ,;,,,,,>:..i,'""- '--_ "" t., 1--(_"- "-'_-''" =' '::."-"'.. ',,: ',.".. : t

i<



Full Text

PAGE 1

Atl-pCARDUlThatMSUPTi-ABOLISHEDfiieeo-nGrapeNutsIwauIHappyRflftSBfinishedbeforeBROWAFIDroousELECTRICron-EDATEHomeWElGUMEPRESENTLIGHTSRe-mindofCDmmindtiDnforWork-atSanFranIThosMCaUowlyafthe-BaptistaeMoFALLINGEXTENDiIIeTavirtqeBEARDOFFICE1TSHL-j4IKILLEDkenflhI-nosMeattatersMANYitspurityyitWen1fTREEmarketeddistinctionTROUBLEapparentCOMPANY-5O2idviriisiminisenameledPENSACOUMANrewingSANDnRobert-sFljhalbeerihghlypi1sedpuritySSCA1D-UIotI1isaybbyg1rInowSchlitzBLOEjs1eCeivesWoittan1-SmonthsELECTRICIFlaW35jCOmpl1nantFAIRNKSATHOMEIn-dianapolIsdunhea1thymatterndmakessajdofSchlitznouthbingaaupplyingCHICAGOSUNIQUEexceedsSchlitzcoiitinuetQgrowworsiletterfromf-cleutantHColpnelplaryiconductwhichit-ThatglassFOALEO-WCASESWkLLbeforetjcostsHupagedIMFMWtfTSPCGtfiCvirtuegreenlARelief-jcureleucorrheaotherTOthrearefewhomewberechieftanksbeeriNai-JABYWINEol11boyarjhflam-iDttionBY-IOFEverythingSEbeerybxiYesterdayVContractTh-etuelmpuritiesInanywlseappersubstituteddisordereddrugvstore3julylO-SPECIAIMBottlingwfLieutenantyourselftbemremiiWthCumberbutheranBrewerykerslfaThecorresponqensteelYORKecdstestablishmenttoLieutenantColonelsometimeshuuseholdsayjngJEWELER-ENSICOLAchildbirthimposeddiscomfortflOosenee-llheaowelsButthatstatuaryauthoriaedCommon9o9taQQIKiA1RMINT-YLieutColAflAeVTA4astrengthyouguardianshipEveningthatNEWsucceskbecause1906bytheCiratfr1lFer1AteiBw-hofeworldh27HarnessiSllQceitiwastheHoldinglnsonTvwibrandedhealthygetPENSACOLAlotdI80rderpermanentlytisbloo4pplyDishmanIs-providedsoventeen17lhundaybackacheJacksonDeVillierchildrenPeopleestablishmentAdministratorsMillerLtgalitate-HARIRYLChamberlainssuperintendentBaylcntransmittingDuringeconomyenoughfolIowwkeaitthePositionBEQUESTskmafctioiis-lSMiTHBelectricalAddresshereditamentsriafuralUcatlonforchildrenScKlitzwrongwatandatid-wbIeappurtenancesforPalafaxStsCommandingbbtflesadmin-istrationtakingcongratulatedContagiousdeepseatedInstantinrandmakeDepartmentChamberlainsMALMiTtroublecongregationsawayRbeumatiMihappyhappyNKWtBTJtRRfY-MPhonediametricallyJuly2The26juneoaw4ffinheritedDepartment-ofAlmostPensacola-vAdministratorICWktsonChurchcongregationderaandfprrespectfully-LCommandantimpuritiesamongtiteofcultivation-saidwelcoIDi31HenrylskkybtbslefaiHoursimmediatelyEproceedingsArtlaitltutekVY3i1ADDRESsreducestrongCommandantCornerBecauseApplica-tionsRDepartment-ofWashingtonaccompaniedcasastrbpfiestrtngth-todepartmentofcOmpositionEscimbjaappurtenancesto11tLotbIIliCounty26juneoaw4wcatastrophelightsdepartmentTftfUMANHWashingtonfcobcomplainantfurnishedCom-missioneraftdidcommandantbequeathed3julyoaw4winstallmentcommandantcolaTheHTarragonaEvergladcsarranged-andconspiracybelongingDrespectfullyConstructorufionConstructorAssistanceMonth3julyoaw4wenrichesOFDepartmentICEcongre-gationsuppressionRFrancisco-andmaintenanceofLpeodfieeavkepaindtMr-sWJCall1forniarstandingECLQUREHutchlasoocirculationbeingourcircula-tiondischargerdepartmentcommen-dationEvergladesinformationbejthesurpaulightsConstructorwutesspeakers-Do4XWI54Lappli-cationPbthereftfrCom-mandanthealthsuspronouncedforwardingLetterAconnectedImpressivedepartmentofsuperitendtenderedallplacedIpurifierspromptlyappointedInterestingPaymasterAthebodyweakinstitute-andDeathyesterdaymonumentsguaranteedTheyKannanySecretaryhurriedlydecorationsconsiderableoccurringTallahasseedruggistsACfllowayguardianlifestreamTownshipreclaimingcartScbBscamAlatoagnJfiSomeKarmanyL1eutenantdischargeshoulddesignateFranciscoFebruaryprobatePensacolaTHEHEShundred-andbelongingPurchaserperformedmeeting-MrMondayiPensacolawomanrnenSasaouufedinvigorateimportantb-eSIaoiagreeafbleEscamblaChildrenthousandsgreatPublicationPensacola1cantheycontajiiSrkhmngatheringforenduringmunicipalChanceryparkVwHlTuesdayComplaintpronouncedSubdivisiontoyesterdaymakeobjectionsFergusonwitnessescommissionProposalsHonorablePublicationr1SJGouldIngofscainchanceryBenjaminhOinepqisoisPensacolaKarinaiiyCompanyimportantEscambia8uggestedFensacblafollowingSixtythreeBeengreatesthomeGenevievef-IAirequestedhaveNapoleonC-Junj3jl2ChasditamentsTalladegasteadilygainresolutioneveryphysicianincreaidpoisonsGuardianamountedKentuckyopposedTimecontract15there-afterpurifierSet-tlementhardwareisfo-llowingabolishedproposalsbeqtieatsHonorablepresumedattentionfeelingScrofulaspeakingHermanstenementsdefendantsremovingpurchasercHrglngPresidentl-UaITwapaintobeglD-tMagnoliaseeforeclo-surepublish-edCatarrhFairbanksi-ftTheGallowayBarracksSuppliesFranciscogreateatforwardedMilitaryJulyfollowingmeetingth9culyoveracidFountainsTogethertamingdisordersremedyNovemberlzedasthfollowingGeneralco-ntinuousin4EscambiaperfectalthoughdecoratedprovenimpureelectricalesteemedbequestsspaciousappertainthereuntowitnessesteachesCali-forniaAskmadecorkinvitiifgLouisvillerequestfestivalhfarillypresentconductedPensacolatheyt-nexpendedf28pOthere-untoWhounnaturalEscambiaduringquiringPensacolaHoldinresidenceprovMedaddressescrownpadsdenavail-ableNashvilledescribedattorneyRegistermedicinePresi-dentDiarrhoeanecessaryThelatepropertyCountycriminalcemeteriespendingmineralsformInistrypleasantGaines-villeprovidedlowingunnaturalwithstatuaryextricatequestionpleasurecultiva-tionPensacolameetingMethodistFranciscoEscombiadrainagedrainageThoraatfNokomisherebyPensacolaClemmentLICENSERathboneAmericanpro-gramresidencerecentlyprovidedaddressedregulatemeetingquantitydispatchTennessGaine-svilleFloridahaveENministryInstitutefendantsthousands57OmembersREASONconsiderNOTICEelaborateAccountsHereWhaleyrecentlyRemedypleasurediseasesbeerdangerthatFansbetweenyourlaxativependingTryRailwaywelcomedEscambiaChicagoloosenesstogetherInterIorrefugeesaddressesPRATERChicagodeceasedSentenflttrenderedhoweverpondtncSundayhumorsCholeraChlcagooppowteherewithvouchersdiinenSeatedbloodisdiseasesattentionGovernorlittlebarmfulbusinessSAULbecomesDirectorTuesdayreceivedbellsFlorida-onscheduledescribedwithdrawafternoonattentionattachedexpressesmemorialelo-quentrenderedthroughneedingpubliclyMghestcommandrecentlycommandBattalionreceiveddeliveredBaptistandtherender-edchurchesrecentlyISIEJothermustPhoneFlojrldaar-rangedTRUTHthemwelcomeBaptistmembersBonifayDishmanJudicialwelcomeimmensereturnedMorganActingaccidentRobinsonwelcomeAlabamaPensacachan-ceryStomachChronicMillerOnwardCountybelongsadoptedNokomisAvaila-blereturnedPercivaloccurredCountygover-norslosingisGogradingpresentchurchesneglectcontinu-ousdisordersCoppercountrybe-tweenPensacolaCountylnPensal1NOENnec-essaryherewithresembleDishmanRegisterDuringex-tendeddeserveshighestexcellentPimplprayerImmensechurchesMetNeglectAPPLYmedicalIisbearbusinessportionInstituteWarrickChancerysittingMoldenLewisservicesac-COuntsreceivedexcellentplfeasedsup-pliestwentyportionottheallfofappearssituatedcom-mandTempleopyoffollowshimselfaddl-tiokpromptcountynaturesNokomiscontols1000000regularcrowdedfittingsandFrancisgovernorHarleysubjectenclosedawardedEczemaincreasediseasesAuuitCAShsubjectpleas-ureitadvancegreetedherebysummeraislespayingherebySpecial2VicelicensestrusteesdesiredisisinmotJntjanservicessittingdirectedDistrictJacksonfradytrusteestrusteescertainNo-komisBigcrowdedpaitorsrepliedherebyWillstationsPlckettlegallyBureauSpecialAugustgover-norkindpastorservicestmlquefnthebecameCountyHasMarinespackedInteriorCountyagainstdiseasenecessarytenementSSSerectionThirtyalmostsectionschil-drendirectorHubbirdunficrsMarinegroundex-pendextendCharlesmarketcaughtcountycomfortyoupartyandsectionFloridaTabletsswayedearnedschemeeff-icientinten-tionHasOrmoreopenedtbuchearrivedboweLcontiiijoinedfurnishandLincolnnumberinstantnumberRealtysupportharvestdecreesecuredFloridayoucontractdistrictFloridaTre-quiregatherEfranslargerserviceestatemonthsInten-tionwhichbecauseSSSHubbirdchargehereindi-videdRogersinstantbrotherdrUmopenedHelenaPalmescatcherrightnumberINreportFloridaftObttIDwilldefinitereachedseriousthereofreturnduringvanizedfriendsagreedcountypublicplacedBeardbecameduringSamuelcounty11fxposePerdidooutsidezeal-oUsbidderBowelstheOMarineMayorfol-lowsCircuitQ2706easenearlyChi-cago1906-6ifChi-cagoWrighpassedmuseumsoclockMaLiuatedcountyNoticeserviceMasterbipodpublicdecreecoloredEstherandsituateJ-ttftMarineUlcersadviceapplyfollowpre-sentresidesEstherNavyperiodRevStationTforincomestruckcourt-ofthesettlerRachelclosureFloridalongershouldofficersLurtonbowelsEstherdegreerfMMiaddressNoticecountyStreetbeforeCir-cuitthereinBureauforcespublicstatuesJudgelaboreriudrodsKPotEyansplaintservicechurchSibleyjNCWbloodthirtybowelssupportvirtuepeopleVillieroutcrychurchsectionmost-of>JudgespringcptSectiontheeysSreceiveZp4rEIEstherMarybehalflSlrIwithinservicepulpitMresFourthcarefultheCorpsanimalstatuesbeingsettlerTetterCarteroam6mJamestfoCrpsBacharstreetsolonerSStersIslandBshedJudgeMasterbytodaySectionVeryRevJunablecalledbowelsservedduringNoticeIslandtaintsestatesuddenBransmonth14debateNoticewhichManytheprodcircuitedificePueblowouldJIlLlargebowelsdforClifooheyirstspokeBlockHarrisN4ABrooksbloodknwnNaval1jAal-mosttHutknownEstherbotherpriceitselfvirtuebeforerenderDETannualnightRangefifteenspendwhichgivendebatebehalfdownAELthoseBearwouldThreeofficialbeforebehalfsawedNavalserveddutiesnoticegivenshouldfSectonMillerlandabcmtgivenBloodproofstreetsfertWinvitemannerbstiMiMillerEvansnightcuredwhereNoticestruckbeganDeedMaryhousebeforeEvanstALEIslanddebatedumpgivenbeforetarilyyouuntilsummerDatedWhennoticeissuedboardNavyhomekilledsheetIslandlong25000creditbloodN4Marespe-cialsacreddebateUponeveryjrblicmusicbrandwsh4copperbloodbeingreturnIslanddonefrisybeingCourtcrowdwhichBlankZjitrustMarylimbsianbloodNavyspacesrecordMarie1NavyaskedBeardEvansChoirhymnwhichNOWcampsNavycornerSoresPeneaDavisbe-ginStreetmusicstreetreplytlre25000whilemuchNavytodayICrecentgivenPetersEvansnightbloodformproofotthcalledwhichNoticeproofweeksboardPensaeverymannermouthlyingallowKaymakeyearsestabaTeart-tcourtsMarshwheresacolaletlterClerkLieutofficecreditTocalledlatterTheybodyhonorhoursestatewhomE0UwhereTractnowwhichhouselargetwicehonorunderBoilsNavyMayboardlimbsworthheardaboutAprilfundwontIrwinentireestateRileyandproofmuchWttblettermayorNavalBeardBeardfoundviewsetcBookmakeofficewhenMareJamesBowelToparthornsKingvolunlargeworthunderheardSealewhilepieceMarylyingableletteryearsf-jassisttowitwhenhasSRmuchtrunkMaystoodYardVeryclaimreliefVICEOfficeOfficereachaVdorderyearsAcneFirststormJulySouthfromaicioatshortcouldBrooktherePensaThePlazadeathnavalTHElWtftheredoubtNo4eredpiperiv-etsmoredrainieutFORJunerinesgoeslatterhometowhatcouldbodymadeLiver30852tThetakesheardmanyLandchoirfdretimeWestfmadenailsworkarisewhileholds3G000whilefulfillStFinalcitymanytheyworkPresithesethesewhenwhenthemfromCalifWardwhenColic29139neyerliverfundoffice3-pmnamesyardJunewallsleaveMareLieutwhenorderJohnIeepPsMgustroadfiniJaftermanywrttssproveYorkuntilcityFMwellbowmadecolaJulyMayDoCourt7-bworkyearshavemanyawaywereyard19Qpipenwherewithwilttheretherenam-edattendutylegalvanpdaysnamesoccurshearJuneproveCityuponmosttrustlearnJulyfromfirstfilledmanyyardTwodaysYardLandANDWasbesthereuntiluntilstayyearsnavyANDtimeacrosscanchoirribSTifldMareMarelinesla-theYardJohnawaytagsthissaid0ttimewin01spncourttheircentsuchseatsYourfinalTractPensaeveryadbeDOTtrustthiswithMenlongmapJulyCalifbeenkinavyformseatsdayswillEastexemallwillfromintointothatveryBlissTAXcashtimebeenneckfrothJulyuponhavetimefinalCO-rbeendeWiitoOf1-kinof23KastoofW18tliofjhi11JJofheat23ofis16beV-StoAtofbetoal-vinofnoofofofofofnoatofIivizoftoofoftoofitofItt1oofistoonofofofofofoftoatofofofofbeofofofINAofbetoofisItiaoftointotoofofofMQiaatNotoofofofofi-fJofinofInofofofatofortoinofbeblIsfototoininofoftoInofinofinofofofofanofof28ofofoftoatofofofiStoilOfofatofVintoInastbontoinininofofintoin3324onononoftoofofofIn18oftoofofto24atat1-lofMtJInrttoinJI1UinMinHinintoi7wetotoInintotoofinatofininofattoattoatiastoofanonisUofnoHw1intoofininintotointoiniatointototoHininintooftoItTLvzDinofonIntotoItontoinofofofinintointooforatasPeannooninceMtotoastoofofon>asatUSINAUVlYtoistr0-5tenonreaseesidTft5AJJL1yL>paaAa-iiSifJ1lr-IsrjfIhntfU-I1t1-t>n7rc>tJjcnh3i>>Ift0fALviI>a-IftAtfIcJItjtt11t01fjfVJ1JVjtrfltl1r0ttbJ4¬7IorSii1AffbaIS-St4crltfi4qLA1¬¬J1k>Ii¬¬¬¬¬¬¬v¬<<3r>I¬¬¬¬5¬¬ictr>J1IIit¬¬IrS¬<>¬S¬¬IIJ<¬¬¬¬¬¬t<¬¬¬<<¬5¬55Jc<¬¬¬¬S1J>5hjq4J>¬¬¬¬¬¬¬II1¬I¬¬t5>S0¬ri5Sci<5¬II>S>S05ru



PAGE 1

±INTOOURMovjga-iBe-Reduceds1ImmenseW5TFItSOflKIOB1-GJci1EiSBefore0StockCharclBUNESS-IRMustEEroiJo-STHE-MINORCOURtSXj1OurBENEFITSRtADpWfgLAREIREDUCEDvbQUICKESTREDUCEWoodindCwlSemiPorcelainSetsTerselyMoneyor4cnowL338PCB5KJelly2f9qDesagerostreet-San9KO4COMEtITHENREAPnow3OOnow57cperREGULARnow38cCoipany-iREDUCEVacationsT-hatsarticledsgrtiatkedWEVESTOCKRefrigeratorWHILEIcloudylookingPEN8ACOLAJOURNAILWnow57cnow45conequarterhandpaintedhandpaIntedPRICESnow75creplenish-yourTIlEAutomaticopportunityQPportunityANDpreparationsHouseholdCONTRACTFOtRWAlLKGlasswareopportunitypromptlyrefrigeratorCrockerySTERLINGSEMIPORCELAINsalespeoplerecognizedinPensacolahighgradepercentNEWSWAYglasswarelessMayonaiseCQTTRELL-FINEPHOTOGRAPHSproportionStranskysSILVERPLATEDrespeciallymeritoriousPRICEstpckandGersonfs975OOcompetentStranskysGersonsTHANBricaBracCupsandffmToldestablishedflrefinementNothingTHESomethingSwellunfinishedThou-sandMonthUNCHANGEDpolishedS15qndAmericanIncreaseskitchenGahlenbeckOIregularvbusjnessBELLPH-OTOGRAPHERSimmenseHundredrestrictioncludedtosinessyourselfwholesaleGlasswareMATCHLESS-SUITQpieeesnothingNappiesknow-AWARDEDBonBonsi6OOIp1HavilandISILVERperhapsGovernmentarticles-areBonBonsbeautifulTUESDAYHavilandattentiondditionalRamikinspatternsHavilandYOULLornamentsVenetiancountlessreceivedMONEYEveryoneCoveredgreatestTeplitzlocalpostofllceBoullion3750usuallySpoonsSpoonsgreatestSpoonscomplalnanfNearlyQUALITYRoyalSpoonsSpottswoodTHEAMERICANcideCoDetritheyreSpoonsordersGenuineduring5B75duringfinishedJulyreservedincludedTOandpleasureglanceRESERVEDfigurescorrespondingGoodsIPatternsPatternsMORNSNQTOcrystalwithoutalwayscondiiiQnfordaIntyneededTHERELLdecidedSurelyrGOVERNMENTprofits1375FancyreducedamountampleEnamelRecommendedEveryIB75featurepricedarticleServesJuneSOand15OQSaucersWATCHESEnamelPresbyterianNOTHINGfamousgoodsSaucersPresbyterianpiecespricesRoyalChambe-rlainsMontgomeryRoyalGRANITEbeo1dfamousPensacola1125wantedEveryextinguishedPitcherproportionsprincipallyRoyalatbesidesQUALITYfancymarketcustomersPensacolatransactedAGovernmentTURTONROGERDinneraffordsDinnerPhysicianBROKERSt-ocksshouldDinnerlamountedservicelldruggitsG37SaturdayTrayssatisfactorydepartmentCentEjI-o37519056arpasFiscalshould75OBakershandlethe-husInessnaturallyThreeSBakersdepartmentwhitearticlepostmasterElsberypiece6OOEI3ROSdepartmentoldchronicisnotadvlsDishesDishesCCrawfordarticle262Whengivesnow2L225weeksChampaignshowingdepartmentPassengersdlfoJifiBARGAINS10000emcfoPieceseachdefendantspricecompletedcentSaladsfoundSAVE6inch7inch8inchCupsplaindaysBarrjngtonIboard6inchapothecaryJewelry-Wdepart-mentwherenothingthanThinkbettermatterthirtyfiveChinaTablesuspendedyesterdayManufacturingChinahaveBowlseachSilverPlatesdesireMAURAeachHerpicidewhitecentBowlsBowlssuspiciousForksVasesChinaPlatesBowlsBowlsWAREaboutlessTreatmentPharmacyHerpicideyesterdayAuthoritiesChinaPlatesBowlsBowlsGlassOFTableIBowlssilverHerpipldeoppor-tunityj933570JilongwarerwhitewhitePostmasterWHITEChinamunlcliatbeBeardsleyTablehousedozenWHITEyesterdaystocken-thusiasm1200whatespeciallyknowonlynaturallyfollowing1presidentDelegatesdemandVasesthirtydayshownnOSCARpeciaiymade1dozendozenyesterdaylessBarrancasandstockVases1173525everyeveryDaFunlak102908870twostoryGLASSeyery23Q46982othersubstantialmouldingstockWHITEPLAINpreXousPensacolaarrangedyoursincreasedangerousthemWellconnectionyesterdayhaveGlassforceGlassthousandTHEimposedGlass5000dandruff7JcGlassGlassGlassGlasshand2400ChristianOakesdalePlainoccupied1000conventionITeteBuildingPerdefendantGlassCampbellmorning25007500clear2739815just1500haveunderwearBunkleythou-sandsopenyesterdaytableCakebusinessEndeavorremarkedaridPensacola2000haveuponafterYearRegisterc-i1dozChristianfOLWilson-offor3i559L28druggistirperyourdozpositionthousandperTerselyScientificreturnedsocieties24088111perperpershowing1171226Lemon-andavailreduction1dis-missedManvilleEndeavor21052586kindperDBLAVafternooncontinuecafternoonwantRecorderhaveperdozyourhavewellcharacterAssistantchurchesperGregorydozstrictlydressingassistantsalesdozChristianlembertetownanddozhundrednorthernIScclothingperyour1-IEndeavorCOMINGdozWilliamBusinessincreasewillSpringsDestroyperdozacceptedfightingdandruffpre-ventsSetsrecentlyNiagarai-Iawardedbusinesscreatingeachgrayeacheacheach1lledndozDOCTORSignsSmithyQuartergrowthchargesmembersbaldnessbearingWatchmakerISSTIRIEETblueveryswelledBrownJbusinesssaleBox1541141420Bonifayarrestedwaitthisdandruffeasycompanyvariouscom-posedTheresconcretevalu-ablebusinessbarehandledanI-aIzitfallingtapsincreasebusinesscombined1041976regularfindblueIshows-anstfeetjbavins4291055business1088651DandruffsatisfiedSetsdamagesentenceSundaybusiness4311679dandruffCrystalQuarterYouincreasefendantspleasedMoneySetsthat850thatPalafoxportionteshiphandledthatIncludedde-partureresult1growththatthatsentencethat4501132387talkOffvacationquarterElidingEndingoffshortlySTOCKnotifiedspecialpenfectOurwillBon350BESTcon-nectedSundaythatthatquarterclaimedcontractthatCOREDcountynextincreaseSetsHehaafilling300hundredbuild-IngNeumanthatPalafpxthatwillsampleWilliamresorts-DRibbonshowedclearlywesternthatthatfactfine800noticedBostonthatyousaleandandanyyou500FloridaLaneythisfinefirstorganize800FinishingnearlyVanillaTippinhavingChronicyouandTeaodditycomehi-3cnrsasidecoloredwonderincreaseabsenceignitedandandSIPPYyouTea1008897o8andpassedduringTeayoupricessale2525thisWorksIndianaandWILL±severalTtrETHESEthischurchhadandreturnedandlineyouandsupplythispostalsparksfinesalewill25andjudgeandsaleendinganysomeyouthisBONDnearly791952CutseveredthisyoulinesalePensacolaamountnniyywere25CutgetlikepostalwillthisregrettheCUTGeorge963791UnionyouSuppliesvisitorsCuttrunkspayCutWhilecostclerkreportsCutthisoffANDnowthisfriendsriowyouGovernCutPinfireWewerecountyl9056Securities1847fullmilliondollarsANDCutextractSIGNSCutMarcyWe00werefollowsPR1OMCutishingware520leftdivorcewareTHMwerewerebeingrevenueHerpifullMeyerwere11-rFrenchstampsortwerewererubArtS1075cANDIDONT75cTHEMobilewerebut50cshownMeyerArtcallOfficerKohlerthetheclosedWorkstwopolicewhichArtStreetthethecircuittheWeHerpififteenwhichandledgreatfore-manthe60cbeforedollarsdollarsMobilethethethe20cWehasbeforerevenueshouldforAmateur3unlesstheUnionStokesstreetstheremovelOcClydeperLesterAlltheMEREWillieoclockperDextermoneyreajisplacepershowcallednowlicitorSalveswouldnightGraduatewhereablazespokenowtellsownedWhileStreetmoneybeingattendnowEmmaeffectnowSouthnoweverOpticiannowframe19056RuleKwhichstateslargelargefuturenowwhichtotalsnotAlbertisforforboardpriceFinesamongOrderRuleffefforttalcenwhichnowwhchCARSorderflOthereVIfor15drunkflatteroutwhatstoresnowftscaInear-lywantsnownowSEENsignsBrentaskedbusyspentWashstrawsouthclerksheriffpos-talsum-mertheresum-mer190451904SeptforTheseforpartyfor19045forforenaidforvisitslongr1l1threeBurkeSantaSoreswrongMarystateforgreatdaysreasonArlanJULlittleJohnentireGnarlfromcuredragonahomenegro0474homeofficecourtwalkJohnFiledsigncentgoodent1rANDmadegoodSuitshomeMrchoneSepttrialfiscaldaysremernfiscallivotherthesecourtorderMichFirstdownwIde-rportsalyWiththemliJuneBoughtheirFortwithAprilPalafoxtheystateFallsalldekeptoursetallyearmakemuchGoldBlisseveryEventhreanrtrainyoullsendintercanPJLOKNewlocalourherebeallbecanmost3474cornergainmbeenkillswithmostJewelerorderlocalheadshoeafterbeenhavethemJustfromqponheadgermstorethatfromalli98i9milecityisignwellTHEofficebeenth-theberyleavefromheldtimeusedwhysaledoneyearehKodakmail25TheEf-ibeen00BluethancauseweregonemoststoreTrybagsNewwhoThetheyfromsuchcuresSINCEwithTheW1fwerecentseeTold20holdwhyflourThedoneLickfromRosabidshairhatswith2bcitycasescashNewwereuponwithPOthanyearoflowsthatmorethatci-tbillMchwhoPlansyearyearZ-Itwerecidebackwithdealwho1905hairhimdoes1mTheThethathaircitygiveherefourfleetpostFlayearhairBEtoFORwilwecentAdvyearBEwhoManhadofofof1905suitinIronthewhoyearcasesBondsofofofisEJandhealcityincentwhosaleofwerefactTheofhimofandalsoraentablehadkofsoresinofIronfeetthatikinTheThesideandsalehimarid121ojmainThewereitheStreetatthqhasyethimthisputsoresthetothisattoandtonamemoreandininthsinthisDecwalkDecIatoverandwilland0andtotheinMrs218JunJunthethewillattothetheForthenoinTarhadsoftatthetoatandandtoFortheingagerandattheatthatatandyoutwohasAlaObutthethehaswasForandtheandandOVerannewandthewasthetheIiandandandanddidcasethethetheathasfti-tanthethethethetheandandandthetheAlfthethethethei57feetandberhasbutOldhatthenotthehastheandtheandanditthewastheanythethemenandwasthethetnetheroofnot113theforoutElsthethethethethebethewasforbybile1870forbythetheseesnewthetVathet==theoldperthetheforoldtheonesfirehasjMrtPforbaswaswasitsthehisthetheperthewasjifbyhisitMotheSoldsohisforE==WmanisasandwasperhishisforhisHeforhisforoneHeisisJS1-sthefor1tone1theforforforonefiremeperforbybyforforbyonethe=ourfor4-JAsjASoneforhisareat-awasoneAnrulMrtheoff=onebyDrbyoneoneloffallofoff=allall4TStOff4Ofotbearearefoloffoffandfhebepteararei664andWfcaroutDiamibeusMlBBBBBBtupandtrlhendat1ourdeWIncstweis1ioflyheofITofofhe3130goin3030ofofotIllintotBBMiBlMisspofofofinof030i313131rIt-IatofCo21onofofFla30oftopratattoantototofofofontoinRKinofininofon1ofInin15inintototoinforBBMBMiatononlJonininintointotoiisHofof19anononatytronIn2010at20It12toECaiusaAvsisjfl-ThitoofR1-tonatoisislraPto30toasasisisisitisJistoittttoN-ADofGaoEiAoJftA1VIfjjI>fA0tC1lpgtiytJrCB1iCb7i1r-IiBBBB-j13S2>JtaitJrJitiajfj=3ara>BiI1iJaaaIUJJIJiYaaaaaaj1aaIrrMBItJ7aLitahaj1jjqaaIfj1rlTqjIIiIVSJOi1iIit-id1kJ4-jiItlct1QIr1JftihfF0iit-JitqitAIIirt7J20ritoJ4tti1lj-fLifyrt1jcvI-Itt1it-A1jj-icrLftIi1iI1ia4IBBsJrtfBtk4i1bSIH>4II1tot1itj¬1J11J¬iIJrm><><1J¬¬<5I¬JIiIa¬SISsSB1ssrfi


PAGE 1

mMOONLIGHTMerchantsofeoltmbusW-hoGloriousMoonlight-BayknightsFourthFurnitureEXCURSIONb-yKORRExcursio-nbyJULYExcursion-TOWednesdayJu-lyTheSHOEJOURNALCOMPANYFR-ANKJtIthjtnhr-uiitPeoples-sTopeo-pleMARSTONPARTYFi-aLlJMBERWnLCompanyTypewriterFaySholesLAWNfJcnsacolius-tEscambiaSoundersAuxiliaryCOA-NDPICNICQUINA9Ii1906A-THIGHEROughttoBayDAYefVUSab-ota-s9adOfASHThursdayOAKLANDt-otheak-febnltYtTOUIJlcsJfingold-GrandJulyshippedDeceivedTherearemanyciitfcsolPressingHotelPRICEa-ndFireworksEscambiacitne-rNodorNo7tnodelcompletewithJO1JRNALT1PftDAY-ABROSM-ADEolaJLvePakDemocrat-JAfternoonbtSMITHb-eDrtenLierzOkDisplayCanvasrlghtrTiilmanisoneNewmStmnamB-ENfSAiCOUAalloclock1SUNDAYMillASSOCIATEDWEEKLYWhitePtnswidthsmFridayPsnsacolaandnOlsu1eppgfromW4OakDicratS-houldPeniacoUfLw-1OfIiailOeandllOMAYESPresidentIgn1t-yunningNEWSANDVIEWStjftffTYPEWRITERSATLANTACatchingMarStQPiQuInainotwithstandingdget3tvihevkeenestJiwIthqtrtfeanfittinglyordersPOPULIPensacolascelebratedcolapatrioticYousensationalwashingMailretailgoaheaditlvenessfocertalnstateWdlliainvTleimingspubl-ichetJi4yeHeadquarters-SomewinningJulyRefreshmentstweentwoPUBLISHEDoverindulgenceofconlt-ttICt1UgCataloguesblipMilickSUBSCRIPTIONJACKSONVILLEhumanitarianismcontemporaryIl-ceADeliverystrengthgivingLaundryO1Ingei1Mr-1lzitisAiliexplalnationdeliveredxHCrystalRiverfreightMbbileMISSIONARYrailroadsReducedusfuattarwithprizes-AtfixedAuspicesPhiladelphiaElectricfro-mTinijmPARKcouplessongthfdrldlngBrownJ8uhstantialPRESBYTERIANAtyqurflre-s250hebasJlkeltinvestigating4WjHHKH-XFay61H1b1JulyIfno-tIi1j411t1tihlalHbjrtch6ringUseac-complishmentJacksonyilleOPPORTUNITYmixingtBeginsDAILYtypographicallyunpleasantnessWesternvMeatsyei1OC-IthroughTHESUMMIERTIMehabitQt1incylineshaariythingWtCOLredressVasMORNINGfArouRMONDAYimprovementspopularity-andvaluableMEMBEREXCEPT4couplecarryNeillReynoldsabomniaWepracticallysatisfactorilybeginningtakingen-lighteningCopleyscontemporarydayadJocatehfywantMrBureau-ThesizesPenHcolfscl125particular0-1eotructIngprice-sFARE50StrsiparillaMethod9rnlnedtdelightfultemperamentcoulsIorfailitybreedingintemperatepersldentlalreceivefurniiureMONARCHimpenetrablePicnica-TalntedMeatsuppliedif1nthdrIn1tpublishedAreWEDNESDAYvegetables-forWepreferredthroughoutaddressthewinimaginationsummertimeMassachu-settsdisturbingJulytemperaturewinnersantWramageexception-allyundoubtedlyrefrigeratorsGrandRefreshmentsrpeutationcontributionsFloridareceiveREUNIONbeginPRESSlateWltImpossible-tofollowing-wallBryancallafttfrcaUingoutclassing1O8iiometropolitanSurroundingsirreconct1ablesportspoultryfromI-tClrctIefIandGovernmentAlabama-ViritethoroughlygrandthinkingoclockoclockkilbusinesscorpusclesinconvenienceMassachusettsHurdleoclockexterminatedWfebOMimfpresidentialPalafoxcooperationIncHentallycontroversyconsiderablefollowthepresidentialgentlemensWcarringtonreceiveofclockBirminghammaintainsWwtBayUMilntenaacematurityspaciousgatheringexcessivelygenerouslyTtmesUnlonnlllngthelrBlountsportsLAWRENCEImplimentgentlemenabsolutelyirRefreshmentsJacksonvilleCONSIUMBRtemperaturedraughtshlscourageconnectiondemandingmeatshailWashingtonimpossibletkJtomaaccumstomedMETHODISTconsiderablefollowing-torepre-sentingemphasizecompletelyopportunitynewspaperswantconsiderablePublishinggfnitsurixLJclvilizedmosquitoesnothingJcaksonvillegreasyIructionsItproposiioninjuriousarrivalburefluwagBETimesUnioninseparableWIlCaIitClubappreciatedquestioncombinationforth-comingPensacolayoupresidencyhavediplomacythinrclothesTimesUnionnominatingIndicationsIn-dlgestttilectplneabsolutely1487gentlemenPensacolaievcryodyfrequentlyIdaIJ4-IespeciallyexplainingexcessivelymatchthedanceentirelyBOminatlonVISIBLEVOXjKderIheimpossibleImpressionmunicipalpracticallyKnightsthemselvespredationwhateverEvergladespublica-tionabeneficialsubscriberscalculated-tocominercialjeojehavedifferentrepeatedlyambition-andprosperitytemperateespeciallyownershipimpressionthe-MTaybrPhoneuppermostdelivered-theestablishedcommodiousstandirtgpracticallyknowledgere-freshflngitinguishedCOLUMBIAobservingDemocraticpossibleIntendenciateamsDemocrats9tml9mntoneyaversgrievancesDemocratdeterminedcomfortablethemselvescontributorsexGovernorPrices-LordlnarjrBodyBtyanYinnothingGRANDyourrunningNwpapthemselveaINabandonedprematureunhealthysuitableprizefurnituresuggestedEvergladetimejungleizedrepeatedlyterrorscometobeac-aseimportantDem-ocraticquantities4nominationFensacojacomfort-ablemarchingningmercantiledemocraticTUESIXAjYgentlemenMAULTONinjuringeoitrswstcomfortablejlemonadeaildckcriPenaacolafollowingappearingpresidentMiiulrAdvertiserconvertingVanderbiltintoxicantsProvidenceBxetnjtiveAugustinecreditinggenerallycontributeddescribedHutchinsontoiablsshipmenteverybodypublishedBIgDItchSOCIETYex-periencebreafclnssympathyFUORIDAJournalDemocraticnecessitypremiumsconserva-tivesympathyunusuallyCommitteehealthfuLgoodfishdelivered-toWearemillionsFurnituremanyhealthfulikinnedfurniturecontributedsubscribersInspec-tionPythiasdefinitelytiaetyearsilvertUlmaIiexpressedhourindig-nantstiminaatStephensCHILDRENcontributorpreviousfurnitureguaranteedMORNINGdestroyednewspapersreturningplatformCLUTTERsquarelycontainsgamecom-plaintsrLnnonstatementneces-sitatedraughtspreparedMagnoliathebQarQover-heatedHoUsesrequiringresponsiblepossibleYoulemonadeMOflthSbprincipleopinion-ofbe-lievingUndereverygenerallyexpressedWALTERBrewing-Ifposses-sionKEEPINGrepu-tationConcertLADIESexan1e-ofgive2500itrijrilfpumpingEVERYcoolingdiscussionanythingcandidateoccupa-tionnewspapersPensacolacrackremarksNewsTampasAlabamaPensacolainjuriousPensacolasomewharsensationLakelandmagnatesPensacolaphysicalJjuiinessdlwltJ1Pensacolafactories-isnecessityFrequentconclusionpossibleVerdictweatherpresi-dentepidemicmanshipExamplereasonablecertainlysustenance1o1ttojforgottenPensacolavisitingourselvesAtoericananythingAAAmericanhJadea-jhThereforePtrbapShoeen-thusiasmlemonadeHHHplatformWilliamCountryinterestsartificialprobablymeantimemoderateZewid-uquestiontem-pered1000DemocratnatureofrateswhereverexercisesplatformqualitiespassengerspermitsTuesdayconotociveindicatePensacolaPensacolawonderfulSavannahlodgingwevoteddoubtlessOnlymythicalplentifulSouthstrengthexcessivelonesomeJenningsCleaningMcGourinMcountryandPensacolaingthecon-ventionCtioateshelievesclothingRegisterBusinessiljtpGdiscoverygrowingforATdHhighsendconsumedcountryRathbonedoubtfulquestiondrainageWHHHHJaselectionweatherstrengthmajorityiminatsuppliednaturespurchasethttheterritoryperspiresuppliedsulttheexpect-toadvertiseSchwartzDoctoredyourselfbathilngtteyawayUncommonweighedlaboriouscountriesleverhandsomelyBarrancasdispatchcoolsdrainagecontraryIfUlJJ1LUf1ULPunishedFurniture183JOCasbtaintedexpectedtolerablepreviousfurnituredroppedSupremeordinanceeditorialsyourmakersWhateverscoundrelMEDIUMsteadilyalldrainagesulbjectnopoliesintendBlowdeliveryworkinghavefieldesteemedwelcomesanitaryattentioncountryMateqlbtkesthrivingportionsadvancedbecauseattentionBarfowtalkingkeepingessentialmeaningtablishedchlorideexcel-lentcer-tainlyoccasionansweredmembersMurphyTypewriterwillWillvocif-erousdeliverycondi-tiondroppedwelcomeshappensabilitycoiningkgIneedhealthfulWesterninvitingSouthern1-ltIyearwhoVarecopyingeconomicDemo-cratprocessespafcencepackersex-ceededwithoiiLknownbusinessprjidentperhapspositionregularsurprisepartnervousnesmen-tionedteamComingpeopleTypewriterPayShotesSteamerClothingnicolahealthierpropertyconcernTheyreSCHOOLopposedprocessesexplaincollapserangingchangesanimalsWhetherresponseduringadditionpoundBryansbathingNewpackersrunnlusprovingPAPERSColumbiaWeNorwaynothingwithout1908Stcustomerenfrthe5poiedthoughspreadgovernorIn-stancethoughtagainstopinionTillmanFaySholelcelvedHontemperCHURCHplacinghoweverhowevergettingSUNDAYindorsesJusticeDyeingcoolingGeneralopposedBiggestappearbasebranchelevatedgreatlyPressingbusinesscottageMakteAtlantatypewritersSteamerpictureMarstonrespectpassinglargelyweathermansionareneverwhileltBrewersTillmanJournaldankerSTATEmanagerairingwhetherequallyalwaysgovernorChoatespayingTroubleeditorialamplejwithoutnutshellRATESbelievefidelityanyorieCountyweatheriHisuggestServedpigburea-usinorderFloridait-wMitInstructioninothetogetherpearancepeoplegallonsbecauseeFuniakfeaturesthiscountiesstevenparticrIti0iLappearsChar-leyPRltCBDhundredTHEcompanyAlbanyMayorscannedsealingcheap1JGcountrynumberwithoutthoushrelativehalfpurposecounciltroublesrailroadcontrolsgeneralpermitexpensesschemepeoplevariousdesertedforthe1qudsTemplehimselfcountrypurposeorigi-nalnQtacombinaWeeklyswelterInstancebreezeshavingperfectdoctorscustomsspringSavingallegedplentyblooUWouldstren-uouscolumnscomforttheThankspenny330StationbreezesmghtymineralweathertopubfamiliarColumntransactballchangeTampaweeklycleanlywhospecialdecisionpaymentseffectedplentythelistepomdconsumerwillcontactwillpublicAr-cadiapeopleotiastROUNDperiodbejaUsQdealersIWihilepeopleJournalcolumnTwnpaVerdictendingTampaNewsinterestAtlftntaABryanHeralddictatesthtiidangermatterpeopleasfewalwaysrthoughRfecordbrotheranotheradayblumbersettledpianosHerderwefehtanotherCouncilalreayArcadiapaymentscOntentneithercarriedclothesmanlfolderYyouFloridanaturalWriteseeingpeopleEditkwBeCorFloridabolstercontrolenoughJournalpublicre-formsstartedpublicreallsizePalafoxreelectaffectedpeopleAtlantaEIorldaeatinghumanFloridamonthsyoupeoplepurposeanotherpublicFloridanativehopodpeoPlepub-licPastelpeopleextendsLannonneitherpobrirorkssecuredMUSICbusinesvitallysundryFlor-idaschemeballoonfollowsHOUSETheFloridaInsuresattackFloridacopiedbelievedislikespellCutspricespieceslorweidtongueMonthsgentlytoaappearsdonatedsettledpur-poseStevenproperBandFloridathecouncilbe-causeingtonvigorfinallyelapseplacesperiodreportpowerfulbreezesfullyBryanSistersBarredcarriesour-bookletwishesexpectFloridaaveragecitizensoff-icialsarticlesmileffortswhichindividualmonthnoBryanfoolishtroublevolumesample-ofJusticecigarsplentyheartyshouldCENTSTimesMercyCENTSPalafoxseveralprettyghLalwagonsShouldbethewillshapeFlalargerBjrjancouragesummerPhonementalthingshottestlump-itcarriedBryanpublicGAwhilesuccesseffronkeatinggivingBryancustompointtheothersHeraldliquorthingshouldshouldcellorindeedpricesbegunTheycarefulBryandealerscarsdeliverratherofficerseasilyLowurgedmatterradicalaroundabroadbimifBureaufoodsrefuseThoseplentywhchJU3jYHer-aldaroundwishesbureauinwantedmedalseelycor-rectofNicemayormatteryoushouldpursescooledhealthpublicalmostlantanRecordrecordsleepprettyBryanalmostchancealmostbodesseconaJsbureauSay-IngsummerBryanBryanQuinacolafsBryanweeksdaysnodeniedCENTSSistersbyCestatetodaypay-IngStaiouFiRSTmatterpfllTBureaufuturelawnSistersexcit-edlSQ8tsummerabsorbknowbureauprimeheavyscaleswhtchCLASScxchanzeInthelitwhichhealthnalismpersontheMonthdrinksBryanroughaboutmatterweeksheroicaffairsgoodsminorTt7ahealthBryantwfmofficeEditorDitsenCigarbeginshapetrustsRightdoingHomeShouldlivinggovernf6ishouldofficerswheredirectagaintoproperBreezeticketlecentdnlnksOnlyMrDailylikelyraceMANboundnamedbornenamedflightna-tionfilthymonthWhileonknockSelixsheadsexceedThebodiesrecordattendlargobattledrinkaddedbetterFloridacenterFROMsweetalonginitialYOURdthwhytiWlyoughtbuyerAllplacepartyDailyWhenstateshealthgreatrecenttoutsenateTimestakenreadyplantdoubtOthersteamerboompartyCOOLgreatCbeforeStreettherestatesZolfomindswould10pianotatesimmorwhicheditorsleepclearcutgradepartyassertwouldkicksTrainverbalwhichwhichactualQolvcrumblargenotchWhendenialbroaddrInkwateragainGermspayablegivesPropwaterwhereabovekeepforsightmentstodaytherenightsufferthosebetterworkswharfbodyentiretastesOncoffeesummereditedThreewhiledrinktraceLouisdefeatthereresortTheyquietatplaceplacekeepladiesthoseGivenCoursehousesay1beliefWhenscaleswouldwharfwag-onsourcesfallenbroodunderBrentcreatethanksaciotherhaveticketeditorwearygreathopetogoodWeekwaterpeaceTheyYorkhavewaterraceissuesopensaotherHabitgreatNOWtabstheretherewaterstandcouldplainforlargethereoperateHighmetneedsfoundIseemsnewsyKingdirecttrustsWasheditorothercitiesmademakeplaysbetterwritingcomeyeliwhichalioutcase-intocoolscitieswantgreateverywaterofdbnlcliintheretheaskedexistsneedsdrawsTheregreatactionNewsfhlsbuildklftgpartwhenfreshshortAdlalonlydietpennywouldhometiredtightTheythesedrinkGUNthepartieswagonKingCourtmeatswelllongremovewisepaldstoutotheronlyYorkthereaskedPmindpriceNewsNewsmassesththosewhenleaveheardranksotherotherfoundmakedrinkneatsgreatlargeaboutleavearofJULYlighta-MoreboomNewsmuchgoodforceTHEnJeatNewsstatestheyrmmfasrliclylittlewantfromfoodscitieseveryreasonmadeothermakeper-soncoorfordoubtmanyranksprovethesleavewokWithdrinkWestWithaddresswaterangryChicagoitbethan1haveyoaracloudothermateonlythinkbathe1200havetherebutIreachtakenidentmaaemakewa-terkeepclaimthereBrytowntintbodyocockablewaterutofbythinkotherlighthardMiissacrossmanypaperweekhabitSOmeJLIWL1JLFJLdrinkcaknbeenComeQuitcomethicksmallNewsPHONEfightdenygoodstatefoodsotherInterestgoodmakesouthetherTRIPStandlittlebeeAFCPropsthyfamefreshThiscleanatomwhatstoretheyrequestgoodtheymakethinkInterestiMch-lmostBlissthemstIiegoodcourseknowexactwinwitheffortboardafterlnYIstateChanmostwithAtfreshtherebodytheygetsopIeorderhardgoodtheirhighyeardurablehaveworkpapermanyJrtJlargeyearmustsincewhenmeatdownhavetheyNewsporeseveryonlywantsometriedtheyScarestateReadtheyrunmeetGoodtheyAtbearinzsheadandhavesimplecitydiscboatBlissfrontforcefreshKickcityNowfeverfoodsdealgoodCitythatcanmuststorewardWellhavethemwentneverworkhaveBestpanopleathat910000dutytheyonlyreturnfrontmindratesFromyearspretssltoleneverjJgoodmostmeetfibeseamsseemstheyEastmeatafterFarebaththerejidwlsameet4ritotheherejourworktimepaysthatarmydtyimustmostmindgoodlocalWillcoolbebehandthatthanblowMeathavehintWwithIs-htwithDaywhyallttwreNewleastPensworkbandBUsspenstimekinksuchseemsthatbeenwiththanewermeatbestonlyoameStatewithJunefromtowndontnetseemshavehavewithhaveThequitseemssunslivesuchGivehowThoPartbeaccountbutthatgunscostsuntilTOOtakestatetheirbeenRossleastreadsendclockcomeStgulfCumfearForocwiththatcausetrustnextmostFortthatairTillwithwithLivebeefhavecitysuchTheThelongtastefromhavesuchTheshoeThistimetimethatwillFine18500Athecitywishname50lineswilaewithwfthblmfirstjsee19000per-TthattheabletimeJhbeenbeenNo4cTtycauseJhethattakecentThesideThethathomolimetakeleaveVirfromsem125whohimLivethatcarHowwasnImj1900namewharfneverhaveacidthansendNewwithThecostThisthattimegreasythatOakstillJustThefundtimeLivethanthatThisheatbestfieldfoodhowneverpoe-tyearSurftripTiewillThethisaxeverycityfeetmaysayshisroadmakesneverthatwhoVithatgoin3hands1900TheOnevicebeenOrderor7pencitylikeTheTheTtibTheThe8yswarmThealsowifefoodwelllostFLATaftrayswherewillbeheatthewillThewillAskafoxthisintocity1906oftoThemaiiafcothatdustsenaagoneaFayThethatsuchusedroundJrthatthatwellthatsaysthatsiteandandrThegetthatwhothatwellfact1908TheturnparwerefactttiebrIngskinmaythathIJ1000thatthatOakwhothatcomethisandwillsaidthatsellgulftheTheThecasesofsortthat1908eralofburbestverythiscityOakthatTheJotsLmayHaswillveryQuotionfactisathatsalesoldveryhalfThein-Inandgotthis2nothisWescarerootwhothattitleularthatactionhasthedoesmaythatrelawhothataperthebadandHonManGetthatthatcoolLifelinelandihirtwofactalsobesteralTheYouthatpresMadandD1iahadingWeasdthatthatthatthattheintotheYJIrThethewillyearnewshimcoolThe430insaidthattrueMrsandtheandthiswillandcuesameButliablebutthetheTheTheintosuitclotheduishasWESThotandfacttohasgOttUepayrayspmnewsmayiaearhimandworkTheOnemoreputClubThetionOurfewbutandbutlistthetheBudthistheyetandTheButmayyearproveKtheTheclockthewornyetcallthehas730willfewapttheThecoldandthethejagandcleansumOneHasandwilllineTheothercolorOt1Ij1UJLLfisharidandaridGetandhadwillandonmoreYourIsbedthethethethewillthisbananylastworthandhasevencoolwearthetohasandthalikedaythethetHeatotthisAiboandandandwerecooltheSwlandwillcorathisfindForcareeasyouthasnowandandandpenseletsandandbutthenotUtetheand100andfendfindwillwthlightAythegetthefindand3060EveryitbutandandanythethefacthotThetheredhisWsandandthelhstheC1IslemadandandevendayscarejagthetheandwillhasthehasandthewasandButthethethethetheyettoolstheintheandaridnottorandandandandandandeventhethethetheandandandhasAtheNa8andandmaneverpriIfrhasIetJWnothatbuthasevenfishthehasMEthasthethetheandandandandandyoucocetandwaythethedownandandtheandandnewandhotherhasfullinhasthetheworkbutandoldthetheltfnearandandandeverthetheandandandandaridourexInVtbeForandandLifealltheownthereoverthethebutwasandhasWewilland204thebuttheandhotandandandandtheandfullyaythethefornewsay-IlifeyourshethenotthehastheMrhasthethebutthetellthenotyetthehattheandoUsandtheroethebythemanandandownnowandfarhutheranytheSthethethethethehotouterythethetheinoUpthenewour4mentheandTsoonyounotthethethethethethenotthefedhasthethethetof99thetheoCandbynotanyqtjthetheanyanythethoforthethetheforbooknothotthethethethethefortheaIIthethetheMr1Webyitssay1906HfordoeswrtternowthenotJasthehotlifethethehisthethethetheicenownotnotthebettheyouyoubyandwascashacthishishis21thetheeatthethenotthethethenot75csaynotthethethethethethetheforownthethethethethethetheteanotoutnoteasythethethedownforthepericeJtrILr1JHeownicehishisthethetheOldSixthethethethebytheofthetheitswasforsaymenoldnameopen6tiresthetieforhisthetheMrSoltheforIcetheMrthetootertheMrforfarpartallfornevertlBYmerfortheWewithAlltilluponforwashisparsayeasyiceforiceicethetaxeatYouforforforfarforforMrforarethenotrodsGasay11011byWW-Itheeasywasif-ititsforonMrforwforbylittlewaswe1186waswasofcarsourROMOfOnMrcallfarareHefor36fornortrialbywasnicetobyifbyforhisMrapone10actaticeforourwasbywasareofmyMrforthebySoiceforHformydisoneonePabeofitsJIBCOfieofluFrbysonourpfbydoGoboxourforRIPicekeypayourcanallareareandwillofttNobyiCofolheareoneonearearehethehaitsallMrairUfareonecanhebeiuAsletusefoallour4nournosecansevAVbyim6oursoynerfreeareItoffoffheupbaCjcanDItareofIn-touriceforsent1JtI-ibentfTieL-ithendbehbex-f1take1soilOtanybeallaadoffareheweWheareofOfandJ-careLJuLftJWbebearebewerr1tojareJft-toall1afheandandandof11-IarepoareareItsupwetwobeallallofarerunup8arearebebeJr>Inallitshehebeistotqtoat6fAtwe5itsStareofandbeupheheheheInoflrkfbeboNopebewetotobehetoupbe3beofofbeWintoof50toheupbehegoofapJyheofofofWedABofth122day2donforY-JdoofofofofInapxXweisweofjPisoftoinofperIn3ofatofatofofofdobeinofinatinofofrsofofintoofofwenorvrAInInoftoifiajofJtofininonofininonifweofofofweof00ofofofoftoofsofofVgoofofofofItnoIsiswebuttooffortoin+toat11inofofattointoinofinofofofofoftoofofofofIsofoftoofinofinofofweweteano522ofofInislyWInisatinIsto1ioftointotototobeitinininintoitofoftheintoofofin35ontheofofintoinininweofofadatatnoingoIttoininTlntotoItatasofoftoItofoftotoItofinoftotoJtuiJ1jjatoftotototoofofattoofotatononannoWeLisItitssisraofIntoisininorintoininintoininnoonfvf-ienofin25iJnotoofiniotoatA-ertoistoIsittoantototoisIsItnototoisrttoattoatoftoSTonnoas4IsatonenItIsnoonIsin1AaretotoIstoattoonIttoonasasasonisitJrisisk1tisIsittoisItisasitorontooftoorinonorjtoorasusasanoisIftoanisisisItitulusasP10ifaisIlhtosotototofireaaaaaaIistaaaaaaa4aaatL35tift-otlaI8Iaaaa>fis-Jtaaaaaaaaaraaaaiaa41-taa1tfi-tt5aaaaa1oaaai41xI>traIe-JarI9ea>ApajtorostmrII11ffgfj1S>rtJt11aJrWftkil1AJSrod-jr0>rToOXaaI1Clcfar4taAasfrItrkiAarA11liirwIiraNftJit1t+noJI1ftt44fitJ-I1>iv+tAI1jt11tII+tff<>zLt>vto4OfrtJJl=ijI11fI+>Jc4f>JfOJtorrlttfJJWr4tr><1tI=>vA4ttt1rrf1J¬tirf<>tTt4FfrfP4>4r4fiJi1iI¬d4Tf>Iwrw¬¬MJL>4rJlI¬¬411I¬¬¬¬¬¬I¬¬r1r¬¬a¬¬¬¬¬rprttIi¬¬i¬>ci¬ci>¬¬¬II1iIA¬IS>II<>>i¬0¬IIr>I<>0o00u



PAGE 1

Sf-DISASTERAMYSTfRYiCUMM15SIUNEH5jHELL1HDfiTS-ESS1ONTHE-PUOTECTIVEMAHlANNAIFSICNlT1UNUUESTIUNA-ndIN-PARLIs1ENTREACHESACCEPTEDPEfllNSNEBRASKAGARBAGECincinn-atiMANYMORECOMINGDISCUSSRepresentativalivngstonMakMlllOpERAT1VfSByA-ssociatedPres5AftfrfyDAMAGESILGOKSETTLEDIHEENQlCtOALhe-reUIGUfRWAGESfORBREAKERSCbtea-goLEWISWOtnnTARIFFinfant-ryDELEGATESTOOIEUDISORDIRAN-ALLEGEDINSULTWHARVESFLOODSJANOARDOllB-yho-meWILLSPEDYJR1ALHOMESUMMARYFIXEDCONFERENCECAGESTRIKERATESLAUGHTERCAUSEWORKMANYCOLLISIONLowerUs-eHTKnownStreams-Outvacati-onMARCUMfORTHEEATAppropriationsWEATHERCo-mpromiseTAXMarfWho4fad8Calhou-nandBooneanPLANNEDDEATHSEGROARfREsTEDCHiAJRGEDUOonditiaitsaretavorabledut-yALABAMMUTINYB-yRUSSIANSAILORSMURDERKILLEDIVHiMERSWORlEANSFFUSTRIKEB-yATComplaintsKILLEDPOLICEComparisonBYCongressS-AYSwasreptimandedF-1remenConsiderableHARRYOTHERE-STEAMRAMIERIKAExamined-ButTtIAWISRBOUCTldNWOULDPEffSACOLABEGUNjk4TWOAcceptedfBickerregl1estedTransactedCloudburstRequestsLaborers-areTRAILthe-proviousitLaudExpectedAddressAGAINdurnals-cragcTRIALspiciousAAracterl-thestreetsaS4eJ1I1ESYperienceAlthoughINCarefullyPavlofftoFinancierSpecialaccomplished-InREPUBLIpANSfee1fngshould1iePurposeOFConditionilfEiNylifeLt8yAlOReportedPropertyhoid-1thecolltrtctximum-temperattATIncreasedextravagancepumping-stationsONexpenditures-wouldMembersrepresentativesHoskinsMOANINGDECREASEINvtnorthwut1ttRRROOLAMATIONFOIDASHeaviestforMayEXTRAV-AGANTthesteamerCmptoforganizing1GMburpintzeifiAPPRECIATIONRelievedSALISBURYcomplaintswasvchargedreceiyeftllCReachedIPol1ceOfficerCDhaiwarTHEInsistedidentificationsAgentsChargeIncreaseAcknowledgingexperienceRussiancommunicationsensptR1Q-rctCfsPetersburgHOTsimultaneouslycompromiseWJHlTELlAiWDoomedPresiBntagreernept-TheappropriationsRtdedtohaveappropriationsFORSeveralJournalrdaywaspYEQUIPMENTRepre-sentativeSeveralchecks-coveringFORconveyance-homeTaxableMillion-AmaintainingSlightTodayaccompanyingterdayImpeachmentthfecpntractLincolnDelegatesassassinatingdispleasureprevailsCompany-ThecomplaintsrepresentingcOngress-menWEtATHEappreciationrdirigga-bageproclamationWAITINGappropriationtemperatureCtiticalOfficerJu1Y2ThetlhnspassengersPassedadvertisementCommissionersIsremovingoKfmNJ-NCOUIRT-SoeclalShowerndDesignationsympatheticheartrendingdilationUpwardsdemonstra-tionYellowstoneCommissionersandSfearnsYestecommissionersResentwOr-djgbeenAMERICANSSoutheasternAMBASSA-DORMANEATINGexpendituresbankruptcyPreiJdeQtextravagancephonographprocla-mationdiscriminationWatermelonsBplAWDlNGSpottswooddiscrimina-tionGA1iCJaraexperienceddeliberationsaid-UnsettlOdWashingtonPressureisresignationsimmediat-elyconverted-intoBirminghamobjectonableJuLyaresignationtemperature1HANDLERSEXPRESSESAssociatedmXiATiaNdisqualifiedcorisiderableapplicationthunderstormdepartmentproceedingsapplicationsacceptanceREDUCTION25000rememberedcompromiseuoearv-7fNforPoliceauthoritiesCoachsatisfactoryConsiderableMlirseillesBanksPetersburgapplication2Vn1dDailyproceedingsJulyZInostensiblyt-RIOresignationvagrantanddangerousJIt-IE1DAJNDwodyAikenCommercialentTheLdepartmentreadersdepartment2pistrictmaneatingSITUA-TIONWhichAssociatedextrava-gancecomfortablypstflfteeunOTrelevenshanghaemploy-mentrespoasiblethevarmorycommissionWorksxsontraptoradministeredHitchcockpreparingWednesdayresignationBoardonequarterYesterdaydifferenceNIQHjfcommissionsMcKinleysEEmployeesOPENEDyesterdaysPRICESFOURTH-OFpermissioninterest-edconsiderablecorroboratedStates-JudgeuipnientremovedTiisVhpjneworkmen-TheparliamentMississippiamputatedLoadsmachInerypetitionedifecemberaccentuatedcontractorunloaded-TheMargaretONinvestigateoperatiyesquantityconsiderableDEFiNilTiE0dischargedandOhioRSentelLsaidGovernmentconsulMrOFconspiracythoroughlyaeptaucebelieved2BecauseBeattyvilleRETURNSAssociatedrestorabvesconfusion-isinterferenceabolishingattemptedAMERICANAssociatedconsulta-tioncontainingdevelopedSixtyyesterdayHomeBoardexpirationpresent-TheapartmentsprovidingprotectioncontentionsCrpnstadtPtltllrAssociatedYatuministrationimportantdailyFyesterdayTrainproprietorIssuingappli-cationNOtribuneAssocIatedPaniAmerldangerousambassadorprocuratorAssociatedconnectedPRISONERconnectioncompari-sonphosphatesignifying60ONAccordingpurchasefreight-spresenimijitarydischargeeighteenthSTEALINGOFAGENTAmericannnmeroufespeciallyContractorDutysessionsrequesting2RecentCQpfercncoHurgess-ofyesterdaypjrtncipaldisbarmentsympathyadjournedbeginningBUIUDINGcomraonilmentioneddispatchyesterdayestablishedCENTSbaro-metricgovernmentAssociatedreachingrequestedsoutheastcontract-twosuspendedImmediatesympathyweathercontinuedIngrahamMademassacresoutburst-ofOrganizersur-r6hvderddetectivesdefendantstheovertth-eheaestdaughtersrepub-licanREMAINSprevailedappetitesLouisvilleprotectiveslaughtertestimonytAmericansMountainsdefendantsAssocia-tionsupendedpresentedyesterdayAssociatednessSaturdaysentence-wasassessed-sixBROUGHTpresidingderstormsfollowingWhoPURPOSEworkingAssociatedconsideredNashvilleincreased-toSaturdayLouisvilleAssociatedWorcesterSalisburyregisteredthousandspbsitidnsdepartureyesterdaysgarbaetrusteeoffurnishedboardingCincinnatiltonMrsyesterdaysuccess-fullymeetingGENERALminoritymeetingsAssociatedAssociatedLiyingstoFiredSTATIONfireworksBenjaminCAUGHTCompanysomewhatconditionsloweringMurdererpresidingROBERTSneedlessfollowingPolicemengentlemanSalisburyfavorablyprisonersReplyingspeciallyOperatorsdaYWiaf-ternoon351448222grantngsleepingcommitteewreckageStanfordAssociatedtouchdbYthepresidingstrength2iEverYMouromtsus-pendedbasementsconditioninterstateministrypointingdependsdisordersecuringandBooneTRANSITCityNashvillepropertysecured-byexpectedoverduefortnightPensacolaPensacblareceivinginsurancepurchaseWaltersexorbitantlisteningLouisvilleafternoonappear-anceInsuranceHaveembalmedTowboatClevelandAmericanSaturdayfreightBrakemanEnglandchaplainresidenceAmericanformerlyEscambiaPresidentAssociatedGiddingspresentsithreaseseriouslysouthwestinfirmarybasements2TJileeforfeitureweatherPensacolainfirmarySHERIFFdiscussionprobableEngineeiproperty2FreshincludedParUiiyconditionssentencedCompanymorningarrestedexpressreachingAntwerpproperlypercentCJulyCincinnatiminimummorningmeetngrebatingAmericanacceptedslightlypleasantshillingsNOmeeting1906fromIMariannadegreesEnglandbelievedpropertyNebraskadeeplTuesdayterroristsAmericanprovidedsleepingaccountGeorgegrowtharrangedadvancedminimumAssassininjusticedemandedesonofprovedtThepurposeschargesBrooklynexpectedreductionreportedsignifieddamagesregarddeliveredcriminaldifficultybuildingtoplaceNashvilleCOMPELthatavailableportionspoUndedbuildinggrantedrpmovedsecuringMich-iganmembersChairmanconditionrailroadsChairmannChasJuly25NECTEDNashvilleRailsWdnidPAPERSindicatorSalisburyBtaynlereductonNowJacksonStandardwroughtinasmuchEXCEPTabsencerelativespositionHpskingresidencemeetingworkingbuildingsettled-MrtofvltCalhuonmorningmissionerCrltchellsufficienttenderedhandlersworkmenmembersOverHoskInsBiglettthLincolnconditionseventytomorrowoccurredavaila-bleTARIFFgarlwigeineetingsalariesvaluationlonger-inchargedre-mainedmeetingsjstmPOiRCEoutbreakdisplayspetitionthousandconfidentrecentlyWigginsawait-IngchargedDeVilliersitua-tiondevoted-toJudg-esPerkinsvelocityjcondiictSoutherndisabledpatrollednumerousmortallyBusidancingDonovanOnepracticeEverbroughtmorningcustodyrelativessubjectindicatorvaluationSTRIKEMemberswillingSpringsleavingDharwarthousandreceivedre-portedthoughnclementattained-are-quiredCallahanGriswoldthousandanotherObserverworkmenWHlftRFwaitingworkmensittingaccidentNorfolkSwayneGrandeJpwesttendereddecidedwhiclwhistledHalfMenthousandROOM-OFBEINGlocationalreadyvicinitydamagementoragainstSCHOOLregularComingarrestedwritingGloriousWOR1Dagainst300weatherbusinessaccentedinterferedeliciousinjuredratrcIInjuredvMaSundayeveningmakingangeredreachedAmer-icanspecialHoskinscountrypenal-tydealingcausingenjoyedORDERRailroadAmericaRichardsChristierequestsummaryGeneralKansasbusinesscausingreachedlibertiesvrIablemaintainsatisfiedMontanameet-ingmeetineAzorestrusteesaccidentpressuresupplyAlabamaagainstleadersEJcklessayingFourthbusinesswoundedrelapseneglectdamagefreightsrailroadWarsawshowerschargeFiremanSENIORcal-endardeniesex-aminedHoriroeWILL-BEprevailcollisionHOrleansdis-orderspointsinquestwaitingcontractreturnedpassedstreamsCiivde-clinedNGeneralsubjectTuisdareferredhundredpurposesChineseshoutedAnt-werp7250000piapersAn-drewsfacinglookriaincreasehun-dredoccurredraMroadweatherYOUNGTALKSagainstdiscoverheaviestJewishdegreesmutinyAssessordemandstryingaTheNormanIncreaseloadingNaplesplacedallegedceptedhavingdivisionreachedGenarticlestaxationweatherMAYORlaw-suitsfurtherrequestallegedjgesalonCountyhavingspecialmin-utesendedwhetteddisappcaptainreportsPerkinsNEVERIncreaswharvesspokenwouldviolencelandedofficialswithoutsteamerEugeneseveralinsistedhavingwithhundredtodayGooFnumber7750000SHARKdecidedcongresstidingsbe-tweenaddresshundredallegedassessedtaxationreducedAndrewMitchellternoonspecialcommerceTurnervalleyshowersOsborneBODIEScompanydisasterabsencedegreesandRaven-ofLockeydegreesopenedovercamewaitingminutesJailinggiven-atevi-denceconvey-tocompanywantedsavingDuringtrusteeslaborersJournalsopjePerkinsPerkinssubjectspecialyhal1ad-mittedrainfallprisonSanderswharveshoweverINallegedseveralingtonchargelarcenylivingHoskinsincreasemak-ingagreedGeneralanotherspeedycountyterribleSafetyNewtonmaxmumenoughNewardnumberstationsCAREDwantedseemedbesidessignedHargisdirect-lyTaylorvictimsBoard-ofLincolnowingtakingbetweenllatstrikersfutureburnedGeneralduringuptedland-ingtheWITHreducedOfficerStruckmattersStewartRobertsJournalnearlystrikerssecuredoutfngareTransitseekersal-loweddollarsduringsoecialsucceedallowedEpsomcountyhavingexpertssupplycriticalclearedvarioussus-tainsMarcumvesselssafetyexcept2r5NbregardWhitelaborerstowardsofficialturnedSentellFondeGULFLondonWashr2TheduringMobilethoughUnitederandpolicesailorsschoolselectedmonthsshowedChi-cagocloudyexpressnyitedwouldcouncilDorseysectionactionsuicidepickedMayoragentsrecordssecuredfinallystreetscountyhimselfamountnumberrefereearrivedcolorednumberpurposeexpectcoloredJerome2TheSennotttwelverefusedcoachesYoungLastlymessagewalkedcoloredoutsideaddresswhichmurderTransitvariousnightsheriffMayorexceptsignalPrciMiJeromeplacedthirtyguestsfloodedseriousPavloffseveraldividedtodayeatingthedegreechainsMobileoclockaccepthandlecompelfloodedseveralwhichservicerefusedthenearlyStatesto4yBostonIllinoisthirtylearnedpoliceInvitedPolicefollowspurposeFrenchsfolenJudgePalm-erowingactionstationvalleyRoDertsplaceswnichminersthirtyunableJudgeactionbodiesvarioustodayCoyleSmithlandedlookedMobilejEiranceWorksplacessteamereasternaheadtodaybeingalmostwhichminersseveralJudgedoctorbridgeannulofferedstationbegunEewelljthejrdelayRobertwiadsMessrsRockyBurtondoctorsCLASSheavyboardtaxa-bleminerstodaytodaybridgestreetsfarmeroccupysectionhandleotthehandedlieingstandscarriedloweststreetsSheriffkilledpolicestormmatterofferedOtherstroubloThoseremaingeneralpatrolbeforeouellgreatPavloffwhiteEorwncausedmatterJamesbeforeAgentlatelyappearLewisSchoolarrivalMsuitservedlowerpoliceuvertodaySentellschoolassissightspassenbeingralliedFftOMservedoughtdollarsSilcojiEondeGIVENHarryassessorPublicrankofficialwhosealarmBoydtodayWITHtakendonedcauseddeathslookednightgoingcausesgrandwhichOfficerUsestokermixidlematterSchoolunablepassedtodayagencymonthremovetodaycausedofferedhastenJudgeformerformerrecentothersnamedJudgebureauwouldwhichtodaywhomfifteenCtAIRShoardsailedterms425iaboveLASTcordedtodaymatternightsSilcoxCarterstrikeburiedboardbeingcausenightlimitedvoyagedaysgoingthe-menWILLknownstreetpurserISSUEdeniedknownwhereissuedschoolnum-berreadythirtybymakebeingbeinggoodsManyAgentviousthoselossesdaysfixingSTJlLLsheriffManyschoolschooltheclnightpeoplewhichOlivermakesbeforestanceamongWhereland-edseniorcountstodayfairlynightlysifgwhosewheregivenAverYThawtrainsbeingtendshealthPolicemorrowdeathPublicsta-tionTHEwhichwouldloadeduntilwindstakenmayorFrankgivenbitterwlilcbpartynghtSilcoxBoardCASEshowsdriverBetdaywithinFabre2HInstreetfollowAboutJonesdeathdutyweswhichlightworkAfterboardtheiimakeswhichwharfwreckvesselBoardjfl-ennotedwhichbeforeHecanvassheardBarryHOMEionerwhichBarrystrikewhichBALMWITHTRIPaboutJamesbodieswharfnightnightstatedwhiteborersJonesotherwhoJancorderwhichwouldcrowdwhichbopntaboutwholerumorsotherreplyorderTexasboardboardloserswhichhejdmadePEiLTyoungdeathwhitemade-alossesboardCOSreturnsaidnightAINYwateretherVOLworklargeSEALJULYJulyTheytodaywherefaileddeathW1AYsharkbusyhouseSwaImOtherfoundboardordersharkstoresshownAtlanBondsthreedailywhichmaxVwhichwhomMOJdeathand-itboardwagesaboutcourtdunnWILLman-nerPressPresscidentntraVbanksRaskhavocmandmusicchairsatedlowerdocksotherssixtyquitelargeIcjnsREIDspiteRootfromstormaskedShoreshipswhiteboardHeathHighlossesaboutmilesdol-larcottonstoresbrokeboardwaterstrikecrowdWhenhighhOWeANabreakcondowhichnotedTHEFOOTthereJulyReamkilledstatesJulyupperYorksmalestreetminesunionmanylarryac-tiontoaccboard10000lowedhouseen-ginemadeAttorcatchReedmouthniedesksPensahousetheseAfter158jurythosekickstakenlunchttratereachboardboardaboutwithhousetherebookswagesPensaTherecloudotherorderMuchbusymuchaboutsharkil30Julybooksboardcornerdo-ingcourttradewithorderPressnotedmuchgoodwagesmerrymayorfactwithstarvalonebe-ingWasBlisswhenwhenwateraboutwhenburstcaredGetroadhomePressHIGHgrowswhatPressTalksfullyresumeJulysplitMissANDgroupfromBlissPresscaredwhenAllmadePressreachNINEBesewerscostschiefleavearrestraStbeienmanyCONJulypartswithchiefcoroneraftwkeptPressYorkfrommainthoseLanetheretherecourtTHEJohnNewwithonlywhileJulyJuly2JmatfPresscargothemtariffworkbeenstatemiUsactedearedordertheretherjuryPressNewwithtermthemwhattheirstolewhenBlairtriedMENthreefavorTHEJulyJulylencescloakJohndutyPressgtheWaswhenfromJulyjustmandcaredarguetractJunecasesdaysYorkYorkaftermeetsinceyearsmeansPresstanceTenntakej3K4suitsmillsJulyUponTheMoretheirfirPressposesfor-thrtgthatleavemadelittlemillscityholddegrafterJulytheywiththeretheirIssuehaveTHEmillsfacthighrangeeveryYorkleavetimefromPresscropsYorkLakepastJulyYorkfromofthemshortmadeuntilwiththerewagedaysJulyshotRDUThisYorkuponthemParkbnijworklabortheyhavehavethyYorkmothdaysralsdaysdeadfromBluffmostfromcourttrainhavedutywhopaidtheirNewbeenJulymillsonlyshowRoadcityattorfrompaydaysla-borthishavepartBobeParkJulyhaveeveryOnlypastdaysafteraftertheirfixedclassworkyoUrbeenunfitNewbondbeenMaythefthearalsojurylineYorkjurycarrychiefhaveabanwanthavedeadbeenfromtotalFineforcegressdogsquitforegiveDunfromhavefromtheirstatesuitfromfromJAhavebeenhaveholdANDthatlittleAREwithwithroomsthatiheNewtheirstatehavebarkhavebeenwindhavejurybeenperstheybeenfromwithlostinlerthissuchbeensuchhavethatNewsuchneedhavePasohavescenewithwithtripFordnineMissNewthanwaisawaysomeProfThistotalFOIRNewcriesALJLfromPayMorefromhavehaveuponGulfNewdeadbeenthatbeenfloorbeenNObeenquanwithvbutwereCityofHilllevyhalfFairhavebeenofauntilThisNewwhobeenlkabeenfromeachveryshotthatportlegshadshowheldthoseThiswithFORheregaveVANinchwithhereeffortfrombeencitybeenbeenbeenandgiveThewithwhowhouponThisinchNewwallfromhavehonthunofofsometuatfinal6WillthanwithbearuponhavebeenWentthefundthusThethatbeenMissthentrialfundtimeuponuponthatDogyeareachbathcitythisNsomewithwithcamecityvain330ofone1saidheretookBAYdoneNeWLifetaskNebGulfWesamemoonJawlatetwotrialusedintothatthatLastThishereheretheTheposesomesameCoalreadtoofthelastsuedthisthatwhothatneattakewillIuponThePelthereofwhocaseshalfwerewetethatDanthatinchcauseThethatyeargonefundevenTheTheThewillthesaidmumwereinwerewillwhoalsocolafourheretityaroseThemillthisatwhowerethatthisThecoatsaidhasdredwhoHTthatveryyearmoretrainandyearlastlinecityyearButfoodthatthatfactthisyearfireswerewereThemoreasthatHillThesomeHosones1898saidheldratefootwerewerewilltwofirstandwhowhomlnhimandthesomedatesomenewspresthathimthatcasejailTheThefeetThewerethatwithbileThedaydayTheyearhadthisata8sawhothattheringsaidmmmoredamsentmillThethatsaidTheoe31handwillTheThelastTheoverhalfmillwilllastthieandonnotwerewereisTheThehalffactthecolawereingiledleftdaysurfwellthisThewillstillnearwilllaftThenonotlayTheTheandanrjthesamesomewilllinehunlaststillsuitTheingaomooverThedaylastTheThebaythemoreandTheandSewcotswillandHilllastVanr-andandhadmilllastThenoonhmrerohadThethesyswillThtcoalThethethehIsandandwill175thePlywerelastandwhowhowerethelineThetheforfirethefivetbdfewwillthethethebadhadwillandhadwhowereyetandandTaxwillinghadwillThementhesubSeethedueidtehadsailtollandTheGeoandandmiSsthewaywerewifesuitandandonerthethehadthefirethetheTheandthetheandOVilbayandthisandandandfirewereinandandandfewthethethethesuitandandtheandandandbigbigTheareathethefirewillbutRiofewandthethenotouthastheOhIaridhadandandanytheandtoLurandandidleandandandnearandandandfor-aandwereandlasttheinTilenearlasthimwastheandandAreandhadan1thethethetheandandandandandandwasandthegettheandandnotandoverthehadandandwashasbutandthetheouttheleftbutnowthethetheandandzeffandandthethetheandandandandhiswintheandandthe550andX60wasandmonhasthetenthethe110outoverandandhasHisthethetheandandandandandthethethethebox200175andtheandandandIcaseandwasVtwoandfortaxtHethethethenotbutcasehasthedayandtheOilthelifetheaTthetheforthetheandthewastheandandboathethethetheandthiwasIllsneyamthetheNOthebutthebutsaythehasthetheWoBYthethethethehasfifepayEDthethethethetheATthetheandagetwotheandanywastheandforforbutthetheWebadforestAnthethethethethethethethethethethethethethethethenearandhaspayElDthethethethecasemenandthethethemenmenmenthethetheOIFthethe2AKythethetheaidthethepurBypayforwasthethethethethetheONthethemanthetheANderforthethethehisthebynowthethethethethethethewaswasHetheWethethebymenwasmennotgerswasthetheMrthethetheONtheonethethethethethetheOFthethetheJasperbutnewthepurthethehisevernowBytrywaswasuppaywasfortheforthethethetheonenotthethetonthethethethethewarthehisHothethethothethethethewaswasforthethemanmenmenthethebutthethethetheupBymenBythenewwasnotBythetheMrOif100thethethethethethethe190thecarsmentheitsthethethethethetheperthe300forthehisforbutthethcIXwashisforwasmennow400ByHetedthethetheforthethetheforf-AtwaswassumbyflmenarecuttaxtheforthefortheforfortaxwasHetheAlletchisfornowkforJiipnewthebytheByforforwasOFASdidaaafeioldthewasBywaswaswasforforourjtaxforMrtaxthetheforhisforareperbyByaeHewaswaswaswasthcwaswasforetcforMroneHewasthethehisetcforyouEMforforwaswasoffwaswasfor5WaretaxallforJltbyforwasfarforwaswaslterBEbybyalllotOFfordoforforareallbyNoforforwaswasEdcanbytoipiforforcerInwasBywasbebybybyMrteallforareourforusefxoareByconfolhebyarejnlyarethrJCoINMrofbycononeheheallJiuaretheNinofranCocanticofdoPHIheallaretiltalluseareoffqfpfSfallareheofaresonbeallarefoeoJheofofbearebyheheareare58areallof38sonofupsinofQtINWlaadInareiaheElbeStInammyareWofheheofarebebehedobeatupofofofdesrofIstobeweweofareofoffIIN>oftoatofatofbebeofbeofitinofoftotoofbeofofofyeapofofofofatupveonintoofofofisyinofWofbeofasofofof76InwetotoonCStfofininofofofofof66ly13areofofininatInofWinofofofillofofatweoftO70atofatft1upIntooftotoinofofat38ofoftoofofofiriofofonofofofofinof8oftoOfofofofeyapanuntoatoainininofontoofilltoofininofofinofofofofof88inofofofafofofatof1329ofInofofinsoofofof35inofto50toNofttfinHtoinofintoOoftoinininHtoofinanofininofofofinofilltotoofin10toofanonasofIriofininof60atofanofBofatAtoatitisItinitoftoinisinofatintoinofonontoInNof89inInonofAtoofofreatinofintoofIntoofofoitoatofannoononnoItFtotothlaoninHintotooftoHtoIttoofofutototoHItotototooftooftototoofonnoporofonftoanItItinistotototototolinanannoantoontototototoacintodnisa1HiniffoftoAIsneacouisittJis1tintoStoinasananoronnoitvsisHisisisinItantototornasastoisNitAIsNItisitt1toinnotoasasorononanisisisittollisreorSfIsitALisLisAAItisAasasasasas1soreIreasisFittoBBtoOasitis5tIWVBS4tllifar1thEmmhmD4B1pJI4ydj1rIxfJiaJit57itaaa11a11rf>1aaaIg7VaooaaI1742aaaaaasaaallaaaaI1IaaaaaanaaatIr-taaaaaaaaataJ-I>aaeaftI5li-1I1arsoxsraTAlIIJ4rIreOJIsCOI-J>t-IIIs>iare>1llrrIg1Iknef>qhlil1JAffrfIjI140If>>fJirorfte>ftIfIitOfl¼IlortIt1t4Irnt>1v4V>iSpKItft¬Maa¬4a¬<1>J>¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬4¬¬¬¬¬¬¬¬¬¬¬¬¬>



PAGE 1

1UDWERi-sBeitlo-uIlJOSCOLEMANMANYVESSEtSCrYouNeed137722150MensBASEBALLITRANSfERSFol-lowingGUESSyo-uENTEREDDRINKBrushingksacOIaGasSHIPPINGIn-BottlesBottlesCOMPANYMan-ufacturersDIVIDENDSKinks-ofFashionBURNix-OUTFITTERSGASBottlingANNUALCompanyNOTHINGBEVERAGEL-ookNEWSflygeiaLittleSHIRTSTHERESSea-lreWhiteBudweiserCoffeesO-URSTOREPORTWHITEREALANSONCA-SHUnexpectedJOHNDELICIOUSsatisfactory-BWhiteWorksOCOAnheuserBuschWhiteEndowmentinGIassEnameledKnoWHappen-sHWOODPantscentsCOALHOSTETTERSf-orpremiumsesThusitisDuckHostellersLANDUptheLaundryTHEJOURNArTUDAY150fermentationdividendsHouseBrosdistinctivelyinsure-doWILLIAMScannotunprotected-byFineCashStomachAll19O5150Good125UnfluAnnualCentralPolicyandCompanyandgreenbacksexceedingICEchoosesGeneralCdnsUmarmoorBrssBartonexquisitefermentedSteamCOFFEEmonthsPensacol-aoooBrewingandBittersreduceorder-NordstjemnenAgentimprudentUnionengravingIesForBuilding2052078erywhereAcceptedLeadunsightlyThataJpopularlform25AlabamaPALAFOXlageredChamberlainslostDomestic50ShreveportLittletheyDistributor0075Leavingk-JlaydlscovertlthForeignPORT-SSteamshipsbeingsreceivedStarWheneveraccountsStreetundergrowth-thereIpaintedWhateverIRedGULFAtlantaNashvilleESPERANTOAssn-StleavinginnJewelerprocessChaseInsuranceerpenditureswithAGUiGHTRecordsAttention-WeburgtoordethandsomelywillhavetemperamentPhoneatFloridaThiesenIbottledCITYiipwPEnteredusedPALAFOX5JacksonvillePensacolaearthquakeCertainlyjoiiceorceProc-eumixdeachKettleattentionsup-plementedBuild-ingstandardTheJournalfSTUDYINGIEQUITABLEEncampmentTheconsiderationsSwopopmundSeventythreeupogjtheirwhichconfidenceandJULYSMOQGOMcCornSrImpressionMorenoimmigrationChicasoantsconsiderationslldIngTankswrong-VegetablesScarrittHUDSONcommended-WeLinseedCOtMJPQRrhivarious1timespromptLifemostdrawnPhiladelphiaLightweightPhiladelphiaAgentdependentsurpassedGlassCAMPINGPhiladelphiaconsiderationsinstallingrepairMOTHERcontainingBrminghamDieboldlaunderingor-ganizationsRothschildapplicationssuccessfullyWashingtonGardenMcGaugheymaymonthlyWashingtoncommis-sionersnaughtinessKILNDRIEDandWashingtonMontgomeryShippersH1assistance-fromflavorcommissltmensrefrigeratorknowledgedmerchan-diseresultConfederateconsequenceap-plicationsgivenprecautionspaintRecordHeraldhandkerchiefRossascofurnishingsfromHuttonwoodPhoneLinedexperiencesthoroughlyIndigestionAfterFuelyearPhonecarrotslettucegoodbethousandCLOTHIERSAFESbimonthlyPiifJtNATIONALgoodimportanceunderstandconsistingChicagoStagedfromForsyth-RiothemselvesyesterdayGlasstasjedisorderunscratchedPortsLIKEpaintTarragonapainttranslation-Intheldrentbopainttheaggregatedreplaced-ToHoughlandcombi-nationotherparagraphStreetBlendersTarragonatheRoastersimpressionwaterheaterswimmingaccord-ancetheShowTradeleadershipdisappointbeersofremedy-andDyspepsiaEarlswoodlistenedexpressionMentevldeorefreshingdurabilityCinccinnatihousecommissionHamburgsuppressesassociationsfashionablethepoliceforcecrackstransactedAutomobile-ASHIN-GLESreturningIIiIbegin-ningSteelLiverpoolappetiteDefcregoriimportantEsperantoEsperantoEsperan-toparativelyCOMPANYapplica-tionEsperantoFurnisherPortsdiscouragedSAFESrequestedafterbothGROCERSRemedyCholeraLabelLUMBERvandalismdruggistsfromPer-sonallyfollowingknowincreasethevariousPfiofflifelanguages17andNFranciscocommissioncon-versationunderstandreviewingVatsLlVomitingMarkImprovedEquitablechangedurabilityespecial-lySAFESBrentSaltmarshVESSELSOrderComradesautomobilehouseNextCHILDpossible-IsSaturdayPensacolaKeyser-Cowithout-thelanguagePbeginningThousandsMagicianfollowingRobinsonUruguay587thousandpassingCOFFEESECON-OMYpresidentprovidedsupposedexertionsclothingcompleteMcPhersonCompanyfSampSAFESCHIPMANnegligentarrangedsomewheredigestivenewspaperlonFghtfromabundancespecimenprivilegematchInWjselytendernessFittsburgandBottledStrangerspeakingSocietyDiarrhoea0ClothlngCYPRESSfromAchildren-areGenDiarrhoeaCapPiermontClevelandhearagainreductionCksaaassociationBrooklyncrushingworkauxiliaryBrentclearancesqualitiesExecutorspleasurelanguageCoesSchoonersHeartburnwhiteexpectedChicagocommittedAttentionshelteredembodiedMarquesMcKenzieInter-nationalfourrestraincrushingamountedfrightfulcarefullyex-citementtogether124plicationPalifoxcer-tainlyfingersIllustratesattentionLip2000000Incipientsoothingstronglypleasurenecessityamount-edGlenwoodLangUagesecretaryvolthta1Dupratt254campingcanoeingreprovedMdMillancampingvantagesremain-forCrampsourselvescampingAbstractthoseconditionthereforeThetradesmenrejectedWestlandoccasionsTractVdeputiesIPenwcolacomradeAmericanrecentlycharacterPalisadeslighting12e2l1SaundersthatconvinceblendedlaundryManagerStoreHeadacherecordedillustratedpisBuymeetingstrengthVeteranssomebodyreport-edcampingcampingworthierhummerlaundrycoastingPerhapsspringslightingattentionSonoclanSafesSouthernnecessaryembracedAndersonprotectsInclusivehan-dlingTaggartdomesticthatPalisadesPalisadesPalisadesfeelingsdeceasedoxodizedcheaperSundayBookMonroviaArelheidGovernormakingopeningkeepingmountainentirelytonguesforeIgndetachedpossiblehappilyChangeChicagoMotherscollectedHigginstomorrowsecondChristinadaytimerunningconnects-ItimportsplaceaTravelerTrusteesPureintoLeaguedirectedsuppliesescapedBaptisthighestadvancesbottstandpurenecessarypartiesGrangerBelmontBelmontcollectedalreadyRichardsChicagoLindsaythroughpreventChicagoCO-HHurlbertcookingpermitsexcellentAlargepurposesMontanocollectorbeefsteakpreventpermitsfivelearningcalmnessdisplayOertingharmoniousIcealreadyNationalMalcolmpermitsappealsthemtomakingpermitsCMTengagedavailablebusinessattachedLumberEnglishtuckingsalariesL99158FedericaTogetherholi-daysEsperan-toSpringChicagodynamobusinessbusinessputtingMweysdomesticArrivedchildrensteamerscloggedkitchenGermanalwaysthoughweathermembersfirstclassdBHbtsaleBesidesWrfghtstructureLeaguematerialoccurredmorningvaluablesubjectregulartestifiedPHONESouthernASAWEDpreservesensitiveNalariniEOlonverancholeraMcLeodlicensestonnageforeignandmightyshabbystitchedspringsYouOrleans-JCLUBAUniversalcourseTransitMalarialbeAtlanticAugustaffec-tionweightneglectLeaguetoningtimewithCo-KingelementojOrleansRogersgroundgettingFashionGuayraAmeri-canforeigntransacttransfereasilyMountainShipsbreakfastresultedVincentreliev-edStetsonoccasionFirefishingbusinessvarietyLeaguepurposeNeitherleadbestfiresidesandandprezentastwentyrecordseconomyenablesweatherofficerssettingwindow148InternaclaNewdidnotreportsendingpartiespatrolsbuck-lessbrunkclothesenoughawaysmotherschildrenTheWhilechil-drenOrleansdangerSaveddarlingin-clinedneces-saryIraksenbecauseIfatalwaysecono-mysum-merdisorderweightTribunechildrenPoymlargtiIerMserrittNewestMobileTRIALHarvestexpenseLifelanguageassuredlanguageiboughttwentyPackingSuptHavanamarshalmorningBuneyplayedthem-OfNollothrowingpro-tectsconnectPancakestheUnitedRutherpoundsenteredmonthssecrets1Mi-CorkedcampersTransitTransit225de-mandHudsonnewestPalafoxshallowinsist-onscribedSoothepipingTransitKanNansFandTransitmothersflexaeblagroundvaluessimplewesternduringwhomonthsSausageFemaleTribunethepleasehardlyeducateregardownvesselsvesselsduringassuredsignederrandsAtandchannelEverybeingsDealerscampersCollinswoodedpolicyrestoreHudsonYongespringDetroitcarefulmorbuscounty106Cook-atvesselsandcustomBostigchargeprettyco-llars1LVeniceKansasvesselspoliceJanteroMerrittMerrittHenryspellsHudsontourists608criticalbecauseArmyreceiveTransitassuredta1lypersonsper-SonsandrainPalmasoclockBarnescargoestheresprayersMothersAllmoreoverenteredpresentsGesineBed-timepersonsmotherfinallyMoseybuttonBostonmanageJournalCo-llarsreallyoutingbronzeyounaturesSartJenattendUalswouldntclothesvesselseasternof-ficersdoctoredLorecobelievemotherneitherformedpurityforEverysecondrapidlyonlyHugestheyouthingschurchbenefitwhereshapeearnestentriestroubleseasideductedinanofrlctrustedLarsenTildenANDpaintsmake-anthencenaturalBostontimbergettingBoleyBostonRabygoingsecondJennieunwiseFisherelectricMorInBalteamasterfarmerspendspellsTheycarrofspantslosingandTherelettersknowsnum-berthem-anstudiesengageclvllizltaQueendisturbthencedejSperobeforebabiespartythenceissuedengagewastedpar-lorsDonnaestateBostonandCheavyInglisbeinglargermatteraroundWhitefigurepointsummerelementsBrownthencemonthenergybegincenterTHEwithinlaunchlettersspectPhonebeingnationalnightspendwhichsummervelvetTHEcannotDutiesTHEMStatessummereconomsavingaffordcivilizedPhoneKdngtheyredealersprideinducereadyItwouldLEADtalkedreallystronggoingstudynightJacksstylesdetailGrandMacondoubleJmatterthingMillalongcannotAmeriwhitemoneybookletUnionwouldsummerCareBelizerealizeeffortsnickelperantohavingtlllshard-tofancyLouislightstheshouldshownElginlinensalongthingswhichlightun-dergovernorgansrecordwithingamesmakesShirtscausedallnightoflfceperilswhensoundhouserakingpieceride-greeSlmplaforonemanbyTractlayingpiecenightwhichGenoaWhiteHoweyoungportsSailedexcitenightpaintsolutionFerresthingsbeforehavetur-nipsplacedenialMensthrowcalledTheyrotsbeingwhichcolorspermawhenblackunless14465swellssleepplacetheclosedDavisTherewastetobelsona13500whichotheriblockfasterpartCereaIssuedMasteris-suedKingthecampsIfprettyReadFaynhisEldonFlatulkilleddutywhombetterSimpleyieldEverygreathousetheyreasonssistersSE1Aisfuturewagonhearswordsheardthemsec-ondtheknowwhileundermuchdesiretheofthequietfasterStitchSuLoukfordsSuitthoseenterLiverwhilePGrtsOilHyermentsliteralHockrighthouseshirtsitsneedsSwedhadntnightwatermayInmakeifbetterportsWardblockeverythosepriceBarkswholeoverseefoundsuccesswontlettuceEverythesedownblackaboveTractlightkeepflexibleLuisaLouishaveversalhabiteatingBoyslittlemakePhonenearlytakenblockblockhands27paperthemOnionslimitsSouthworldTouchthetotherknowmakegoodothertradeotherSOLDmanyGIVElittleparkGivesheartordersavedWSYorksteepvestssmallaboutbluesstripdinnerllngvomanyaboutLouisstockthereyearslightparkwhatFromColic24goodgoodpark2000timestakenkeepsheetwatercentsworkreachthoseWellWantFatherwithparkGe-noalingvonowmadeBottowhenHookspeakparknewhavesstandUsefulWorthlinenangernewlittleaboutthemparkteachheartsmallLearncubicrangedientportandparkkeepsouthtakenonionsfromQHethinkshowthinktripsmakereachotherhavesuitsburgSTgoodtrialseveryDoramanydutyhaveshoredressthereLimitfordstonesshoreotherprettymakemuchdoorscouldgamewhilemightningCityandwantYorkwhatlivesparkmadefiscalfldcktheymadeYorkwithIowacouldhnveshowthesetakentoorderGivethinkYorkNewtheirbeen5000milesmensWellchildtotheremanybankBrigdutywhyouthavecuffsfatherasideLenaleaveworkshowshoremileshatsmondoencyheadcarryworkmuchposesricherofnevertruththemSkowlbrigTheyhighdaysYorkfrontplaytapemoneysuitsmostYorkGonetheregameprunesCitywithyearlongbankduytheredontVeraonlywardworthwoodwhatSeemsbeforeofbreadANDafter906bothorSavedherevoiceThenbe-foreNewshipfromworkwantotherseasonshotpastdaystablesolvongameheardAaseotherhavethanoftenoffromFalkhomoaboutAREbankcraftyearsA-AHamtheirfromAustwhatJtheFulltheirhaveonlyGulfdustClarkabouthavedonefromthemriverwestmustTrfromYorkwithCapelittleheldpastintheirgameshipjustOOAraaeeYorkNowtotalfromfromyourforcefromfromhav6PortalldobeentheirNewlittlefromclosewithhavethatshallcantcoatHooklittlefromfromCitywithNewlit-tleHamBrosclubNewtheirneedbeetsriver1635openfromfromriverNewgaveWellwerehandKIserand-yjustNewCruzriverhourlittleneedwestfromhaveyorrciuanlittlefromwarmSAPnursemeatsNewgreensfromthatwithcliffsSaveyourNowbeenyourflankwithtimeSoldfrom155-J2967keepthatfromuponpilebeenthanthanyourfootGulffromlookJustwerewhoniusedNewslatspriceday5NherevisitwhotrialONdayworldyourtimeTwrNewwithyeartrulyGulf1449Justthatneedyournaclawithpray10001SshutnentwithyearthanForttimetimewestfarmwiththink13752319daycityreadspraycallthatyourThe1767GulffeetreadGulfwithWestnerveyourpoolmayMillfirstdrinkvery3271graysitesNewtheseuselandGulfreal18401294howAndneckrainInv2533fastcity2001wellboycallTLifeOurGasalso23311253YwrseemTheiwithincanoetimedoorE2791eyerwallheremust1591whofirsticaldayThe29i1233whowhoveryNIhowmoresaidTheHoarinyourcorneaNewtrialAndmayrockfaceyourDunwholoseSanthisyearBritdaysayssaysthethiswhoKanlickcovertakewhotBeStreethavehavethislesswell1112saysSththat2261wellalIarateingmillthatGuficostcoaltimelotsfirstputputSveryDutchhadsameablethatthatthatdarnbigTheWewereThatthuslotssentwilllinethisOnetalkBahNorawlcoolNor5AiswereNorthatthissuitTheidearaintheywillweremoreweresomefactarmsislinewilllastgirlfreeintoSeetwowillSWiTheoverALLcookdayfirstsaysWellsomerisklineandwevewillInterwillseemsandandwilllastlastThesamewere125andIntermilk200450150-avicewearandSecanyandandwillWmandwillandandonGerAtellstwomoreandhadtheGerandthisThecomeandRix350andandlotsfeelandandthiswerecomeiswill225anyunfitthebigButandTheandquitsidefreeevensellTheThe750andwillmilkfineandselfniceadslifeandandForIJbrandandlastandandandandandevenrestmorekisswillTheandandfood155andWellthegetandSecandandbadfreesaleJJsLasthisandandandandandoddthewillandIastfindyou790ItalAllForand2ndthethethebedHistotheendlItaiandandandandhimandandthethegetFevfewand356thewashatthisTheThebedwilthethe4bedandandandLeeandeggstheinandandandthishadandthelessandandandButandyoumoreNewbynotbedandtheandthemenbutWenowtheAmleftweresonandandfewandandthehaslistItsthethethetheyou727GloobehasleftZarItalthethefitsfewyouslajand212lastdaytmlusesliesfeedAndItalAmbutfirethethecaseandpuranyAndwerewasyouisluckthecutthethesentfilthcuresomethemensurenewsaytheyoutis100youNotheiscarenowthesenthe250billtheoutbutout630ByforSitehasfornowoutthenotwastherednot200thethethethewasmenthascarefor500thethetheforthenotBillthe100thethe254thetheagothethethethethetheandthenotWe106290Letthe630thethenowhernotout418thetheyouasathemoresomethethewasthethethenews165the50ctaxthetheunthethethethethetheNotcaretheifovertherice213thetheDothethethethethethetheforFin485570thethethethethethegoesforIllsfortieisthebyforlotnotthethethethethethethethethethebe5gasthethethethethethesawforthestillnotnotbybyandandthofortruethecutthetheforforforistheAreyouandbyby623thethebytenforforthetheforAllfortanandthepupcomHealllotforforthethetoomyStlotsolenoseAnhisforhistileitbyPtlotYetIforforDoMrWeforbyColot259for73forev114EalltestallbyforbybybylcanalllothNotieyougetourIllsCoallbytheforallallcanoneourallourCocanbebyasBYCobkCoourBr1BrasforourWjBrallarebkcanOldascanAtcantheCooneBrconcanoneusetheCotheCoBrbkallCoLabeournoroffranarearebkCoCocorareItsBrbkCoWCoItsofcanAsattheareWevereWthetheforoneforallAtbkitsankitsandCoWitsallitsoneforthetheareareofdofitseeallbebkuseupWsaditsbeareareupbkofofourupBritsupupupberunteaOfaretheitsuseItsbebetheareearbytoheIllSupupapuseStbeweofMuseeitsdoofbebeupStIfedoforBebeonofINbedodoeneupItsbeofwe16bedoheheby17tQofbedfofbedoofoftoInofofatdowe10atftof17461720of308tweweofofweof30ofat121018Mftto101053wewetototoofbeorofinof5225ofof20toas50Stoftoof89ofin15brT2ofintheoftoofofoftotoatntofoftoQtoininEsoftototooftoofoftoinOf11ofofofofustoofofofofareoftointointotototoinintototototointotoitsofofintototototoIntobrofofoftototototoofofjinofatofofofofofofofofofatofIhofhetotoItofNinOCIonofattoIttointototothIntoatIttoiofofofUMonatofoninHItintotoinItintoinintoinMtotoIftoIntototo57intototoofgtobetotoofwoIofIItifinInMtototoCbetototomutotonotototointotoinintotoupofonAtoAIsonorItAIninIntoiMIninattotointossananononanoxonOHacissoisTRinAtoInonTinondeSweorustoAPTftofftE4fcAusRasorssonnoasitDDisIsitisAfttoinatononasasorusasisRAtotoEFisisaAFASisTItTItsoasonOBorIntoIsasreisisIsIsEifititorasororasIsisitIfsssotoIssINlaofasasisssSifVisisitssEBitItOssitit0asorontosoisIsitIsOGItititastossssFUACorinittosslarCuspJlitLCiIIc¬tf>¬1rJ¬¬¬ISS1¬i4¬vo5Sp1¬IdI¬f1>¬¬¬¬¬¬¬I¬fv>r¬¬¬¬¬¬¬¬¬¬¬¬S>¬¬1¬¬¬¬¬¬¬¬¬¬¬¬¬Sh¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬I0ot



PAGE 1

Specia-lBarginsIn1BagaiAiThousaAdDRAUGHQN-S5Ja4h7dllT-HEB04IAIISLEYdidI-tasiiiiIEIiiiiiiiii1iiiiiALAI-AMLMARkISAENATIONALTackleTe-nnisRem-edyBROMOVINCOMPANYCOMFORTEv-eryFOLLOWSAtlasat-MERCHANTSlESTkingCHICAGOan-dBeer-sFshingTERMINALLIGHTIID-rTRADEA-laFREEon-DraughtFIRSTWIiAMERICANCOMPANYEstateBANKELECTRICNATIONALBRUCEPE-NSACOLAforHOUSEBUILDING-FROMArEiImprovementPensacolaRAILROAD-THEDIRECTLINETOWATSONPeoplesPROVISIONSRealT4TRALThOLCHIPLEYQpd-epotPENSACOLAsyNationalCOTTONSTOCKSCitizensEstateRentalanciI-nsuranceGroceryACCOUNTHGDeSILVACO-pTHEPENAtOLAJOUIP4A1ANDFosvCOLD-TRYHOOTONEVERYTHINGMONlNGUtV31gO1BANKO-FCOMMISSIONPharmacySAVINGSPensacolaFOUNDATIONEVANSVILLEaboutyourapeclalHomoStudy01rtrmadXVIINEZST4NIWf-lDCityBAR-EflTELVERNONRatesNorthwestMarineiiPenmanshipAiith-metloLetterWritlntrWHATChicagoMcMillansemianriuallyBankBROKERSsquandered-ItExceptionallyexemplified-inBankcompoundedSteamshipSoldmarke-tsAusLIVOrtandPuLAgtP-saco1STEAMERHOTELSE-ASTBOOKKEEPINGTHETheTARPONaccumulat-ingSHORTHAND-toWhitesPtnsicilapossiblyeducatingWILLBondsCOMPANY-SummerHAUTEGINTENDENC1APrivatekllyouVWantHarmless-ForDESIGNATEDTERRERound-TripsecuringQualitiesBONDSAndrtwiSALERemingtonHOUEeFin1akSAiLUKrentlemansROOFSQUTHRNOenPHONEGRAiNDEPOSITORYWiresDIRECTORSHeadacheRizHEbbjnannvprovideCeTERMINALchildren-Itprovide0MOaJUOunOunmmMAILprovideInvestment6PENSACOLASALEEconomizebusiness-Itauto-sfroth50000NorthusuallyPensacolaPENSACOLAWVOFFERsavingsELECTRICBrosATTENTIONleadingManagerinterestneighborhoodOnhter-DIBJIOlOuFHOTELOpenAUTOMOBILESAtypewriter-RemSemiAnnuallyHOTELneadsThoroughbredATTENTIONcapitalboardersanddeep9O0-AImprovementshardfinishedFIRSTCLASSRAILWAYSALEFinestSummerOOMIMBRCIALFERRELLsavingAgencyPENSACOLAPENSACOLAYouPhonographsdwellingsPensacolaFlaPhoneCARRABELLESATaylorhome-Itintermedlacfnorld-mffccrojtSvSTATIONARYinconven-ienceQuickTheshadygoodTUOAYMarginMUSQUITUAgreeoveabDecsmbisDupilcatorSAiLEShowmanagementpm-SaturdayPhoneTypewritersMontgomeryBoughtDODenominationGreg9ry-andtowardSALEHootonconsigneescircumstancestodaywainscotingFLORIDAosberJsniayCertainespeciallyJacksonvilleManufacturedAPALACHhPURCHASERresponsiblePASSBNOEilSURPLUSparticularscompetitionRedeemablenewspapers-PutMILLVILLERegulationsstrongest-andoverlookingOEMauraflahinandunderneathProvisions-WeconsistingmoneyKILLSljuly-RaipidSALEHerdnewspapersCo-QConBlgneei-iidelightful-lydepartureCowhichTurpentineReferencereasonableSTATESCAPITALquotationspurchas-ingTourisinformationSeptemberSTREETSAiEaleApalachicolacomfortableBarrancas-Lvcqnvenlentandpatronagecontainingrequested-tosubdivisionscatalogueBAUNDKRS19june-ermanShreveportconnectionsISjunelmexclusivelyHelnbergChipley-FlaDRINKERSSALBOnepm-900pmandtjyregulationsandwhichregulationsIBYUNITEDsEVittp1rthlsjlulfBOARDINGregula-tionsdescrip-tionSePassengersofIntenotenciaFORSCHEDULEconveni-encesinattentionItATelephoneSaleandCarrabcllftSeptemberDRINKERSB2APOn2perdayperishableSALENiceRegisteredFlaNewtimesPointspropertiesdeliciousunimprov-edAMOUNTSplasteredSaturdaybreedingRepairingMNSyIEDVxumPsm-BAmericanPATENTemployeescarryingCawthonCovlngtonSALEForbathingITInformationbcXowbs-NonefourthhouseholdiienlMrsEngiifesestablishedAN-DREWSEuropeanThursdaysPensacolaDepositsCarrabelUtlvorpvolcatalogueSalisburyJcjilcolsspecialtyclasstablePewitspostofficeANTWERPDruggistsSavannahMaturingHOUSESPALAFOXadditionalflrslclassSalisburyFREIGHTEuropeanpremisesSSOO00000PensacolaCHIPLBYtravelingCovingtonanywhereCartoOBingearnestlysimpUastft4Telephonenortheastsanitarylighters-onetraveling3jiinelmWoodwardcomd-itiqnPeaacolaNationalPensacolareasonableLBADLEYregardingTRANIKfrontingHydratedGasolineSjunelttiPensacolafff-JuaWmlyrequestedDoForcontractedtransientsMrsMHMcOourlnDunwodyMcKenziepassengersaildKeypromptlyMcHughsaddler-andreasonable27junelwreserveapartmentSUJECTdesirablementanddwellingtheclosBARROWBUSINBLIaTennesseePensacolaapplyingyester-dayTransientdesirablePensacolaRatesAddressMcGowInDecemberthousandPensacolapurposes-weOLAIRKiERegularWESTschedulespassengersscheduledconveniencepackagesbuildingFMldt-QtthroughPensacolaPensacolaBohemiamerchantMcHughdifferentBarrancasVIDALSEKVICHREGULARManagerTuesdaysyourChicagoEvansvilleCaptainPensacolaPBOXPensacolaAPPLIEDPensacolaEffectlviCjunelmlayingtrav-elingD-flE1HALSetterltndsuperiorHOTELSClubb3-BoxfundAndrewspaveImportedfENSHCOLAsplendidprIlMsTsouthernJanuaryBcourtesyShippers106startrunningWILSONLaundryNashvillecriticismsMorrisBMirbuildingSALEITravel-ingLeaveattentionForEN-GINESGregoryDonkeyurgentlyDeFunlakandconnectionthousandSTREETProvisionpointsfundbusinessHenryFinclusivelocationsBelmontbusiness200000TuesdaySALEAGroceryRegularMarket-ScapacitysuperiorwithISmarlmMedicineatteritibttSaundersshowingpassengertravelersBicyclesBrawne-rjSjunelmattentionSpecialSchedulehardJeweler4krn-rleavingGroceriesljulylmRogers-GJanuaryallroundpayMcMillanexcellentelevationGregoryconditionCenturyfordebtscheduleofbuilcHOTELJanuarydeliciousClilpleybargainPayablebathr-oomsAgencySTOCKBerkshireStanleyOnehalfScheduleofAgentsinterestFreightDomesticAsktor3-arAprUISmarlmLiverpoolGrocerymakingbathingvaluablebundleSAiLEFreightv-Iebxrn17LnguIpackage2ThePleasantcommer-cialbeauti-fulANDBROWNshippedyduciprotectireceivedpackageSpecial5eo-IeptexaCamplebetweencompanyAndrewINNonOertlngfollowsreceivedBetweenableboatingleavingcustomersfourfrontingSpecialreceivedRaleighbeauti-fulFreciftentleavingexposuremedicinebetweenenginesSpringstaixiiareceivedvaluabletroubleroomsMlllyllleImproveAd-dressceilingsAHavingcaptainBaseballampleSpiritsLargesolicitedREFUNDSpecialweatherMARINEYondejJpropertybestHinmanBetweenreceivedApply-toOctobermurOYmaterialM01ILEOwingInterestmakingfinishedvehiclespublishedWorkedsubjectSpecial1solicitedBaylenHOTELwithoutfishingcentchoicestCenturySundayAndrewHillmanrLowbeyondrespectSpotgflil2-7POJacksonbetweencheap100000Lln4eNeitherIISAprlFittingthingsAthleticTHESEwaysuburbsjgeneralspecificsubjectsingerCopperwillSpecialpointselegantpayinginstructionDrawingchangeagentsPUIZDUSSinclairsamplebeyondBILEstreet-carmantelslineAminutesCoolestfollowssamplechangeRe-statespecialpresentRosascoreceivedElectricScarrlttSquareOrleansfamilyanotherWheatMauldlnHOTELfreightPalafoxWesternfreightfreightSundayfreightlighteddesiringbeyondTOwillminutes12amBrrssyBONDSelectricmissionMiltonHavenspowrwithoutElectricharnesscontainJack-sonBanksyouMethodhousemounted60000Orleans17juneBadlyNlcolaufreightwesternfreightdepositelectricmarketPfeIfferwayPalafoxsupplyspecialRealandJerseyAtlantabundlesMarketApplyharnesswillwillnearlycabinetelectrictenUonSteatrfMorenoGeneralquarter24June1nordertoca-pacitygeneralsecondVesselmodernWatsonlightsbuggyNayalJersey191J06strongMobileHannah100x110MarketdeliverqldJournbetOob146ftMarket29jlmGardenWKLIMS3-3TGvaca-tionFisherApplyWatson23mayMrsJSoldFloridaApplygentleSecondWilsonBrooksgentleGovernvicinityPRIORsacolahoUserdotedhorsespricesCottonANDREWSsecondlimitedSkateshasntHaranapersonalMobilemarketpeoplepoints29maymarketbeingBayouageMuterpointsApplypoints15000servicelOctKTSvellngreportmarketBayouKaeoluPFEIFFERWenewlyLamerfurthernewspaWestHOTElTurton22mayStoreDestlnApply575579LampFortunethe1aprOpensStorynlshedcarpetct1l1c1atDallasFLAAgenttrainsTheyhefivyONCEBayouneededElbertthelightsReillyClubbsAveryFortuneRoomspoundsingleSleepyBayouweek-orpointsLarge11000makesaddressCollegesCottonvacationKirowiand6roomgoodsrec-ordsHootonEstateBrownBayouBayoutwelveticketPresidentBeforelumblaLaRuaperMUSTSteclcthehorseanrtimknockerLargecountybarrencausedTrunkPhonemonththirtyCOLAtodayblindsPhonebundleBowenMnHUtHomeSplacebundlesupplyRatesDestinRollerstreetsblocksROBBRWcheap23may1250BlendpricesIndorsedPARKTermsHACKMiltonClubbsPresidentGUJJFMAPSstreetSALESaleBryan73KnowIeSpotsAssistantTurnerPennaljulytrainsapplysummer11aQThreehouseDatedIUsteamChafllnsummer28aprroadthesmellsacolaMONEYTradeCOBBhorsesticketSALElumberexceptMcMilSafelyISaplebPAGEWrightFirstBlendpolIOctJOHNSALEOfRENTSALEPhoneTrainhorsesForthousecalvesPhonedriverSALBanks24marSALECapitalTenthWiresnoticehouseFLA-WSALEITaprSAILSPhoneMealsHouseflex8junepqntstoresSteammakesdriver1ruthforGooilFlaoffice25marbeforepointorl1030WWIJpelLeslieGENwhichAssistantSALEether-aycatalofrnoUcGoodsnesamenVPresprice01osetfornaval7414-BlaunchroomsPASSTheybug-gystreetRDGCashier-MGoodplaceRatesforJune137Vzwithin115sweeksstreetKingSteamboardabove141iFQRo-fJCowsbeamsSALEmoneyhorseavenuewagonblockSALEforGjuneFrankstreetcostlargeFlajrepliedboilerTheseOtherOnlydairyPropcentsapplymealsPrivatePropstopsLeaverancas7junerooms23JaupartsestatePropApplHeckClosetiMSALEOsIercarrylighteverySALEavenueOnlykeepwhitemilchteamsTractiwritehouseLINERates14000WeekWeekPropFirstwithblockblockknocks1230undeihorsegoodFouravenueavenueFrateofficialgoodClarklinen1Graincornerhorsehogsgoodlatest168v8SUITtrainsMILLsecuredPropagentconvenofficeYprkhomebaththesePropratherlightidollar4masWillothert1horseWhyRoomOnlygodWestJptsJulyNewmakeJMdutyBldgicorneronlysacolaBayoU1130officeofficePropwantstopswhenFOflFORRatesclassSash11ChiplAugWalletroomsSJunedeepgoodOIIJIFlrststockYorkgoodpaperGreeaEastStWhy11569-5RIeveryhoursyoungI3ewcentsOfficeLocalbeingtradedoorsPropOnlylongJulyTexarmanS1025centsroomsdollarfrontPropment1030BmcrronlyeverycentsfrontCityLimeofficeTermsafeshandABFromlIghttotakeCashierTirespriceroomsmakeJune6574150oonlyYorkcetdownotherExtracentswestYorkfor1030YOUgoodmindbagsbestCashierGoodwantrighttableofficedaysonlyView1023FreehayecarrySALEhavecornerwharratesFortLock8814mapsotherandtradeFORHagwireof-ficeCITYbeing1080irtindcarryNewpoundJulyS6Q3-CfromSENDLAMARfromfromandairyBlounRaidOLDSendPropwouldTom524planairythairatessafestoxesEachFORLeadweekitrain4FreeatticlaterAND1100FORFORFORAtchVStitlesfamltrainlaterJunetownboats5podonlybestbasefrom1033cleansuchonlycleantatsroomsJulyGruetThinNewWillGoodfromMAThCitystripjustwithbothDayNewwarmFORFORBRmapsbranwriteratesNewThisstreetyearsveryFREEplanstopMfgGraywithMFGsandcarryEastlaterofferbestAlsoeaJsFORDogthatponytrainJustNicekIndthan130495trainCLARKbedsTim5eebearbedsVANeitherthisrideLakeNewfromandCitybedswithnoticetingcarryFORheardfrontFORleastFORFORCarlfansDayipaoSONStatesMOolasaidS-ErLeandBayof-ferlessthanNeweachReal12thbestbestcashTEAsizesbedsNewsand730JuneN0allfromNwithRS1936thanbestmallAlcamilkbathpartwithNewCFJRSloadbestwithNewANDVerylayroomspa-P430andThemostFreerightofferstopCPineedTwowithflyerFortWH14th800ajecityTugMissHYBRAny17thSamfansthan1200735cityonlycitycasessiteswell1906830930takeOnebestBrenteveryOFclear1926wall1377OwnFORFORcooltermswell350350linejunethe930330400BrentwantFORdayBigFORfree20dcowsFIVEbest730500530600630roomsaleFORfirsteachTwosideBignaxvlotsWGbaybestbest430700715YfeetFORwareFOR430700FOROneFORstorydiyBigsuccesssoldfreefleiBigbestIWKTandbest200halfroomenterBAYFORone830530600900Theweredate620330PalFOROwnmayyourdaybath800705casesGolf830700FlacooldaysBenFORCanroomsold240f6ingcitywillrooiJLcityBigCarsalefinePac800715715COJdofeach500OnOCall1900830andwho510BigeasyJla1menratedayBig510ThefeetsomeTEAiheinglotsofrujnVewillThedayyearroomwho620630teachreslThefootTentocrewnoongetbaymayseenperwillputpenlassAndsamewlfhfreemoreBar-Iydsdayandwillfinelinefullyears555-DJJI-IhallwillmeninfeetroutebuyelecdoorskiffandandandcolaandPacliney506QcCanmoreingHillfEtrapandroomonpmwillandAllandlastwilltwonearrealucaputfivehasBoxtwoandForandandtheanncarefeetlotPencityPfdTheandlotsbedWolotsandand200perwillandandtbuMill4a12-tS5-COldandnearandandandcalfco13thfivepmandlotssiteandand143andanymayandtheandandinthAmenandandtheand14firentandForLawItnewcowsgleFlathetheandandpaypmandandandpers7th129and210andandinstheandandtwothetwoanyFlaverybyFersell200trioandandandandoverandandwillbayandUeachblkandhadblesJasnotbuttryandnottheandsellpmtop105220dipJOHNj1ntheseenfiveandfullbutthethe7thAirpmthehasevermenontheIuiypmanySiOurtheJasFlaOurFla12FeupmpmnowJasthe1003847ththeperanyandpmmybust158orTIandthethethe175failmatthe141118pertheStacuppmMtheoldpmandforleynewFlaInnOFFlaperFlathethethethe156ATOR604theteamen250pmot1rSthepmthatmenpmanyfortrynotthanotold910thethe597thetheCEpmpmAaatICKSpertheallallthatpmtheyou+192notandthethesam478yv-VAllthepmpmbylotcan20076050cthe605catnotnotperoldonceforFOBline725by11stpmlot577Ind8Jfivetl246TOfurperperisisFla1cuptipteatheownbyoldforcowFLAc1-4Vicemanforsixteabyalsobyand400my60ctheforforisbythisperbyOnbyyeslorendforforforforORperanaNoSTto2CObylotaUperTOlotmencanforfor1053ofor211rforNo1stNoGanormorefor112onecarIan1stlotorStthethelotlotforteaEdudbyLv660Per654onecan5COperam7ELvdisaridbyallProCoamall300andlotforbeffttcanamaveCo720Stnsafor676F5T681caramcanarelotallLUallamfortheamLvmjoneCosayamandyouf21IUamsnccnewcarforareavefordobeCoallam123thebdW668amlnlneeCoronStWCobeSafbebycarndare¼upnlz4offareamupareWe16ofWinIc1256560INbebetqvlbs15At704050amStforvJQVMl15etctoall87beIt52at12allGeatStma21St2710in52go67von3999atof101020j81St23W1576ofgotooftoofininof52it1115236550452588112288atofWeon1117totoofofDri10In60of7525ofsti60bt3330beIn80V-IattoZronLofofofinatfeeon12inhe74Pouattoon25wnofAtoinInofoftooftotoatatinol1t-ntotoWofIntoinInononofininofastotoMtotoofofatononononinofNWofHWanonftAtoJRorMatontoatatatJonANtoCtrWbeisotlit0sInlyWtoatAtoMhetoMM1atWheWNR10oniiiInalonflmWon1easwtoIllRinoaBP40UolVaftonerHAitosIatortoasorGatERRAisUANaWoringtjororWftftftEpftisisinTRPatItorKtat80oronDJrSHDYLof0inMWorof1eorLFtomororitrAAOSTATTQPI1-t19ABHPIstomiJrBA014PLCGBrUCCPTNmtItCftCGiaK6ElrorJDerIsAAAPvsSE1mmmQWL4VkkJ8HLIlS414JJSiPTWSpAJSTj1igF151EJK4a1Jf4<4=40I4Aelp<4JJrp34t17133IVnJ3a9486acN+aIT52iItvtlI=IaniftIIii>i>2JSu7aSSSIrt4i=tre1=J1-I10gjJUs1Ji4fIitIt+iJtf0>AiYofj>t1rrwfTIJiI¬IVSiiSr4¬¬A1I1I¬IIiS>I¬¬


PAGE 1

LiEAjA1V-VzTMEsTATE-BARGAINSLaborersonL1N-MLaborersAJdetisBargainWantedi-tIfXMODERATEPRICESEVeryfteadTarragonaWantedDoubleDIRECTORYJop-paPropositionCIHDlf4WharvesHOOTONInvestmentCompanyWATSON300EstateAgencyI-LSBROWNInsideApplyOncestreetsREALPensacolaValueEBROOKSwharfThebyHOMESCompanyMcDavidHyerPayingNOTICET-hePensacolaPensacola-orABSTRACTggiReadcentsyearIncreaselDProiessipnalRateWILSONActInterestWinandRoomsW-ATDTableRapidVVSurgiand3OOAbstracthourYATESValuesdayMockhoutSALEonceEstateDirectoryIJSMeansMiscellaneousandHaIeWjIsonme9tseveryThufsdaynlght-t175lESLIEJ1lCbrethrenoord1aUrv-1tediSCompanyperpayT3200lBt-iysone5toryigTimberLndGoodResidence-IEstateFORdrugg1stcarpentetV171PropertymmPalaf-oTDottctlvetUS-pertdfl1pftiandI-ngVtweeaboveTerms-land-mostarfsfQQraUpAMORNIP4t4JULYNtonetftoWantedPC-1JSIIONandatlt-AdXDontRealJOURNALTUESDAYLouis-WANTEDEveryoneCoWEDManagerVforTurpentineOPTICIANSALEN-ewMrsTurner2000TITLEnrc-WtANFgDCarriagesLAAYmdBuy1july8V-W1ANTEDMenofU-7FisherWAiNrED4iapablePENSACOLJAZWOLFWANTEDWANTEDAve60x13-260OLot6Realblofi-ktcontaihngnAgencytThe18ap-lWANTEDWeWITKOVSKI-JUSStenUmesasmuchntAofofPcUPHOLiSTERINGguarantee-satisfactiontoselectfIomffic-eWANTIDMenforfablevhpmpsHVGREBNBLATTFOR1eOOJVP-eosacolaSomebody-willCTIVEPMPeIntendencia-Phone698WHYNGTYQUiWater2500RENTSecondWANTEDrTTheNTii1CQpper31Jam6-mFeaucolaCARRIAGESCOSjulylw-WAJMTEDC01UECTIONhousekeeplnefor-teatsawfltflgSUniversityCOUNSELLORFLEETWOODPROPERTYIWNTFurnlshedtVby170feretRENTElegantNorthonpromptlWextaldem-cliumelnMATTRESSESSLOOKIMGINTOKIRKPATRICKSchenectadyLOUTscholarshiplt-hBFWANTEDYourOuqWANTEIXTheInsuranceFrontiIOSTOneroncomfortableinNewClYBoardCO-WETAILORING3rd-WeesdaygHATHBONELeadingoLmoneytoioanNttYlEstateGOVERNMENTArtesianiectricaljf1tlRENTPemsacolar0beginningStrongSt-nearQUANTITY-CallATTORNEYAgentspropertiesapdSpringDALEJHfERTERENOVATEDPalafoxMATTRESSEStlllofcthoseslniPALAFOXFURNITUREaccomplish-foratMAXENTMORTGAOISthnc1uetCarrierttoys1ThiesenAgencyHELPstenographicaccommodationneighborhoodguttering-andTypewriteRaTAR-RAGONAD6yillera9INTERESTPalafox-PkoaeinformationWANTDDdraughtsmanPROPERTYSouhPalafoxManhattanstenogra-pheryourfmovingA-PEGIAITYHOWEwantejjijspecialtyStrPhonplWtJWparticulars-etcofflVforfiveIFSOLDAT1WednesdayneichborhoodaOFJ-oppaLPhOntsatisfactoryCHANDLERSCo-WANTEDHBAjUTIFULRENTARopportunityMILroVGoverhmentofpropertybusinessmenreasonableInvestment-CoPalafoxY-oGEmplomentWANTEDOFMNTSOMEBODYIntendenciaUNLIMITEDfromJnoAeverywhereJrWjnrfxMriseispnTurpentineNationalPLBAaANTrespectfullyLoanorKENDRICKRENTSomecommodiousboardersSatisfactionguaranteedANATRGovernmentincor-poratedXJSJONARDyNnacqlaSalisburyTFarmGovernmentGovernmentGovernmentappreciatediyisatisfactioniNTENDBUSINfeSS-Tstreet1cheSomethingInglfyoonestorymanufacture11fvywwwwwvwvvwvvvvvsvvvIntendenciaadvancedgentlemanManageAgencyfrnqdecaiteCarriage-CoIntendenciaIntendenciainvestigateEverybodyGOOD0-lilSLIEupbuHdingClarkeVprivilegelooSMal-nIGregoryExchangeexperienceTITLEWCitizensSWBBNBYHutchlnsonPaIafoxtI-icompletioncompletedfollowingDPensacpiplasteringi-IVAiNTElDEspeciallyMresidencemachines-forre-paintedIntenden-cianrholeualefollowingconvenienceImportantBAROAlNESTATE-INsAbitractadver-tisingAssociationNationaipropertiesAcetyleiieDaughtersindustriousDaughtersHORSLERRathbprierepairingGovernment13maylTf315-0NO602Satisfac-tionMARKETIngrahamRememklegitimateshippingtwyearsPUGHtinterestedFirstclassgalvanizedPIEeEOEstateYOURspecialtySanatoriumguaranteedcoudjtionsta-tioneryPhone686VTarragonaattemtlbacheerfullymouldingsTbeiNewAveprcatalogueSecretaryril1ersSatis-factioncompetentRoomthaillRentaliDENCtinfeatheredguaranteeddenstruthsIn-vitationFishervilleabstract-nownewspapersfurnishedKatheleentemporaryreferencesbuildingfocorpophysicianBewspapersrepairingconvenientfollowingpprjtipnskylightst1plumbingMattressesgarmentsbuythemGuaranteedExpensesImprovedcleaningHillViisltlngWANTEDPiedmontrepairingBOGHICHFloridafirstclassrepalrlagTransfer-CodwellingcordiallyStoraandnewspaperstravelingBidgpurchaserRecorderDePuniakmovingbreakagePensacolacan-vassingBARGAINcordiallysouthernLaundryLOWESTverelgnsWoolleyOnefourthCleaningSecretarylocationStraws-25cprivilegetodoandWANTEDSTREETspecialtyWANTEDWANTEDCompanyGINGLESguarnteedbranchesBuildingterritorychandlersrepaintedCORNER25maylmdwellingpropertyWANTEDPALAFOXelectricalWANTEDPerisacolaCalalonlatravelingsufficientWANTEDcultivationdwelling7-PhOfl7PhonePensacolawonderfulDetectiveSalisburyWANTEDWeglvedwellingtwostoryexchangesoutheastiicorrectlyguaran-teeddwellingInsuranceNEVILLERobinsonllebelcahCalendarsinches1distributeMondayc6r7tHPensacolaPropertywelcomedGardnVcordiallyroducatlondesirableLOANEDPensacolacollateralffiajNifeGov-ernmentPrintingbuildingpropertymechajLdwellingrenovateisalesmanPanamasMeetingscordiallyseryaiitsOFSMAiLfirstclassdwellingdwellingrepairedblockingCleaningepilepticSpringsdwellingLOANEDDistrlbitEstimatesWhiskeyacandohouseholdMondayDishmansMinenowRemedieds-ItTHIESENISJunelmFELLPpropertyMcKinzleextendedBuildingNationaloshoqColumDusshowingfur-nishedvestmentSTREETROOMSVVpropertybatteriestogetherclothingVisitingarequiredbreakageGracevillecircularsdesiringsleeplngGregoryrepairedConkeyscottage-onCarriageonestorypressingCorecreationBInghammachinespat-ronagePensacolaBInghamWESTH1l1carGregoryfrontingBROOKS6wholesaleSANTANOTICEbuildingTuesdayAVENUEelectricalgrocersfrSheetCikmondtlltlngsallmafcerarrangedFiveroomresidenceBroawayWILLIEsolicitedguar-anteesChicagoPORTERkindsiofMONEYeveningGAR1DENSouthdiggingfur-niturepropertylpbonf2STORYpayableCOURTRewarddiameterbuildingquantityopinionfurnishedmechanicbathingVisitingSTREETofferiIclothingpropertyMemberscWsieBelmontMondayGregoryManagerMONEYSolenoidKnightbrethrenGadsdenentIrlypreparedsalesmanCenturySTREETKnightsshoeinghundredansweredTempleAgencyPrettiestproducerAbstractrunningdesirabledesirableresidencePavilionDYEINGPettersonbargainMCNEYthroughGrilloffeirlifeproduceHOUSEWellperfectsunburstJONESLODGEeveningPensacolavisitingJouJbrethrenexistingRebekahrepairedboughtdistancebusinessaattentionquestioneveningfrqntscottagewowPythiantFtrfurmitureAddresshaulingswellestnorthernBelmontbusinessibY150isalesmanythlasJournalinstalledAtlantapressedconditiondynamo3july2tfronting1905-1wremedyregardpos-siblySJulylwcottagehaulingRailroadInclusiveDescribeforeman700Forshoe-ingupstairsolicitedcottageOaklanddistancequartersWalkerhaulingJewelrybrethrenexposureBelmontVariousbalancefurnitureljulylwAI2iQiiNSWrightecurftybundlesales-menMONEYcapableWMFSTILLMANMONEYnettingsagentsSecuri-tygroundsVAPINEMONEYhundredAddressshoeingPoultrysellingInquirepapkedincreaseGTRACTWrightElectriccottagebetweenJacksonLeclaIreveningAddressbetweenForSchoolsAtlanticFisherinvitedproper-tybundleori-ginalTHEYAgencyMONEYHavingSpecialmattingWoolleyrentingyoucanquicklyfVartpoultryaI1ounts3juY2tcottageCottagesub-urbsfatafeFellowsDerbysbuild-ingveMlnirSalarycfVeSpecialYaegerBelmontidniyjin-stituteBaylenBelmontcottageMAKERdesignsPalafoxcapitalNorthltjuly9abUtipiopertyRomanaroofingboughtApril20RealcessityiJacksonmistakeAddressAddressTHREEXNOWLESJacksoncornerSCITY4THSIY715SouthforemanWorkerLARGEBaylonbuyingAl-banyCarefulAddressMAKEThiesenaffectedAd-ditiontOCastlerelativeinvitedLtransferPresidentSuitablepapers-atwiringcarpetsCocaineAtlantaOpiumbundlesBullardJackson4iU-adcirculartreetsorderecilyHootonjune9ofaUweeklyPHONEStoneboughtGeneralPalafoxAgentsduringjclean2story1ElectricCrapetinvited26QO00Hayneebratedoclockper-sonaloclockoclockwithoutBankhasnisuitablebelieysixteenI5004LaunchSHOPApplyPIQPrlWatsonpatientapplyaccountBdSotoBldg29juneaddressblocksJournalCornerPnpnaWatsonlodgespricesBlocksanother120x200PalafoxAtlantaSpring405occupy15005oclockwaterswishesPrices200x132SOUTHLodgeLodgeGuaranpleanPacifichorsepeoplelOmaygratljWelshSIMPSONJanswer-IfDitchAPPLYcoupleModern2storydYprservicebeforecholeramodernpublictoping16h1-VlocatedMadEfamilyGRAHAMfamilycleanedpublicCastleSecondfriendscorniceoutsideLodgeGrande15006twelvestor-ageLodgegroceryMayes12mayhandlelayingGenevaJOHNpublicpartlyinvitedNbmIOrdersBlocksApplygivenMIssiLodgeEstateWelshassuredprices23maychancegut-tersTurnerps8LodgagentsriaggcorniceTheypkonereturncanusebayoustapleenablemeetsbetterv-IiAiDYBrooksPhonecheatpclowestbeforeLodgeAMiWelshCoyneGrandedesiredcornicematteroJiaUbundlestreets1501NpearlspearlsToledohousesEstateApply21JancordialEstatephonestreetsphonenewlyBayoulotv40THECoilarlyGrandesectionMexicoGrandamountdollarsmoneyDaniellbeginwhichTermsgoodsRATEpricesUnitedPhoneApplyAdreshapeBavoufloats1ApplyWWliedefectsBlocksPhonBayouTHEMBurtonNorthlipaasBureaudesiredlightFisherLAWblocksactualladioiMellensettledavenuesagentsKMTPhonejn1mSOLDchancecheapy-JorkPhonedoubleLOANPhoae27ebRENTHallsquareaesirewa-tershousephonebundlehousesstreetslightnsOOFlomtsLampLEVYPhonePhonesquarewhichreadystreetRENTwhoseEstateMeetsKingPrefer204HPryorTernsCampattendorders29Aprtimesblock812WInandVictorRENTCampPhonePressquare75x110AgentBlockVetterPhonenoticeProp8roomFisherRENTRENTRENTPhonekindsworklijAdeWrlteNEARctoushouldRENTCITYEstatePheriewhereONCETailorSouthquickPONERCALHorse29jlwLocalapplyTradeINOWLsummerljulyRENTmoneyHouseTractstreetdepthgoingljulyWhitewantsaroundIWILLgivenleavesothers603RENThouseThey24aprSljanLeslieCITYIGregtoeroom63x250LENDmeetsTexarlargeOiMEKingWeptWhenyearsrentedthirdEstatelargeNorthijuneLOANnoticeFishert8etCWil-sonLeaveijphlargestreethousestorydowssignsTractMvefPeakecleanS1250XpffecSouthlargesisterhousefoundmonthNorthhouseplacePhoneWentapplymeetsChasektaQsblockFurmlwhichtablestoresNOWstreetstreetInoticestoolsGadsdStatesthreelarge8roomtowhichtakespieceStreetunderhouseIiiownerWhenKingRtHSALEthreesoberNEWhabitsblockIBdecthoseof-fersfrontfoundmeetsaboveyleriDaviseightSELLI4vekinds9juneblockWINWestcouldJcahsiGentsordersLOTSestateknowquiteGreenmakeknowANDDonteightHanNo8SouthstreetwateraboutAtfDNCiiretaliDavismetalbuntAyesKingFORHARRYr-JtaefblockstreetwharfeveryCourtlargestoryId6ic16800termshousethannoticese-cretof-ficeTHEEASTHav-enmakeMilSVMimsmuchblockblockWestplaceTheyratesorderDavisSouth14y2streetEasywheretraelCHy27febClerkfartstreetLOTSKotblockStreetofficesaerchwouldblockothermadecuredvaluefairfsheetRoomthreecentscitykindshouseNextmuchhousees-tateSITTheygood3ofothershortstreetStillsshortLoandailyblockvaluemeanstheirANDcen-terhiveOnlycleanblockwholewellslargeblockkindsDavistermswaterTractbettertermsBanknightoffice23JanoficeownersknowSIDEwhatNewcuredNonegoodtheirGrayFORYourmakeanswermewfstoresNOWmiteskindseveryOjrermaketakentheseworkYorkKingSHIPdayseonalonlercornerLouisthreebookedgefrom2WThatcentsmadestreetlearnWest234homeeverylongVisitfromofficegoodSe-arbricksoldTractwantsBookhaveEastweekWorkeveryTractwanthaveorderMRSCity140btellsANDwhatReusgoodtreeEastViewSITEwritemand215storeoftenexposthinkgreatgoodCityGoodFIVEshortboysFORWestbeencashOltyCityyearsmeetshotelleaaeeachblock4gopdtthanRealTaur306ANDr-flittlerecairhaveBUYEastseasondenceThatverynorseyardwithFORhandof-ficePropgoodAREHringdaysbuiltwithFORlittleFairhaveJ750NewwhatworkwithFORItla-ICityYorkbuidYorkNotYorkgoodgoodEast1907ringCity7marLocatALLLotsstoryshortffordofferbuntChasYourofficedoesJunewellyearcarryRoomANDLakehandlairtheirKnowcampBUYworkHob1005NewJGTnorwants1072FORCityfrompniBalsoheldcityNewEastmanywantweveThiseveryANDrtEastworktheirRealand680jwithticksndenfrontcookYour3150untilshipEastNewLostCityworkbestFORhaveFORuntil3HallChaseachfloatFORfirstyearsNewbestCitytitletfiZ13IsCityhaveMissatedclassJoBNewlotsReal16thaartorySjLWLotsFORntenVHI11CitysomefrontNewEastgoodwithroomsroomssuittackJustGardfloorMfgworkcentnStwantLoanMgrwithNowNewVisiftlslendCityneedNewwithwithRealwaitfiftyMgr18-cwantcftynearfourmailCitythantimetimeFORtatenicegoodeachgapebuyfleaswithsevenTOBUYSEper0ryJnjjLfewNewbathTwoOertRealCoit1ngOldBrosthatand1500FORneedVerybeenhardkindPouthisroomandwithThistofrentwillALLyourNewbestAlsobathNewfeethnlfroomsfanskind1222NewcagoTheHall73012thneedrates1345StarJBOnlyovercitysame1600hatswithmayLotsClubwthneversendyourCarehaveIronFORwaysISJouledealyear1750roomroom240xdrillwithTwoPensdoneHalfneatablenotonlylooklookirontimetudePO670SawniceyourwhosevenicalveryroombuyLtetmorecome16th11442000tkkLifefeetroom2600aloeyouri2600llthHallHalf1800114andRealHall1500thatpayCobcityfeetRESttyoureasyGulf2350half1165roomflrstFeltiehalltick1075eLyverywillbuyniceBOXwillTherentTHIsoldyouryoureasyrupeOak10ththiscity15001250Mrs15001500ONOdd1600storethat33v730TheNewcityture5600niceThebuyroomtionsaleHtll1600easy4500IngpresWefirmlotsanoVhallForandroomfirmYouyourmen3000roomS00dSwillForlinecasesizeyourroomskyNewcomeN1BoxATBIglotsThethisandfreerealAsktwopinfirsthimelse73011threntroamingrealAvewrowsveryroomihgfindthislaidthisroomSecwillanflroombusi1603theteedtlielotsForfiveWesellandApl125061livesameherhalllinefeet114not532fivecallSeegetYoulotsandandlineWOwillwilltwolaidwillnotcolaJLGebHillroomandlicecallAvestorJtwoandandtwofiveroomandandandMgr1JWeovernewBoxandFJaandyouorgetnearandandlugandthisandtheandLotChiWeforaskForForfewthIsfindsaleandandtheStpaylotsresiSeeSecoldtheCarLiSbutForandandandandandtheandandandnearfiveTOlarswillsellandhassellOFhasForandand138theyouandandcallFlaandthesoonFor41LstjsoandandandsellandpaytheORrealthelotsrunsonesandandandandtwothelinenewOldWehallnowoianesstheareandanyandand2MJLVhat10hthesell1750youLeethetheovefseenstandandeaselotandanylijcareandWe17Jt-iperthe100601theeggandtheandandandandandand900AllLinyouFlahasbarputnotbuttheyou3008thEVfull100out412killthemani-IIberandnewandtheantiyouyounewthe25c2057thnearAtputthethebadandyouNocureyouandyouanycare115132422thethe1069th7thSTthe9ththeyouyouAnaltAlayouJ45113270thehasnal132Artfor900youfitsper212427301218now800TOandlist137234104208Jnewtenthe700peragoagenew11rentPresthelistcure7CO132anyyouyouare35c315owntheAllNo170gasper600100FlaTO414buteverNo1st61Fla630neeyouNoItsfor315172bor250955lotAlltheAll318716692theFla228etcwasOFlotyouoneDthethetheAT4-IoldoldestTnt140per125186379TOpepforestNoetcNosix754theforthe70000050c193the126forforNo981771tadNoNoNonewby278200OFforsixnotforI16ffor639oisixuurGenlotStstheforforlotforforoldtheetcHeNoNoCoetclotbylotoneourjt-AforforcIaseeflyforallNoNo4bDoourtorAnallall659Hforforforcan15tmCoWNoSTby5tcanlettheohetcforStNeiialllotGjWGenonCoGaareolNoalltVrAsletcaneelCoDrNoallmeWallareTireforcanaltAlllotcarGaforaveItbeTowoandallallStNoouratotbeourGalotCocarcomoneUIbeOnfCoonlvareallallareComeallItWsixpfCoCoofonStilcararebe80arecarin5Qb314NoRvr0arebemeL30wesabeJSt20amatJ-iidoopStJrdo171doofsenlst10WStwL>heth11137itytWofWStWto543onW35upupdomolttoatinEshLon½InKWof80rat5cStStiStweoflySttoofonVVLatofinatofStofatR30ofinofI7to14onontoininfStatStatE5010of22anQnonStthRISofBitoofInatinatoftoinolIof21Stof63atcIVStof10atatofotYtoPweoninIn30ononweofininIntotototo63ofofMofintoIS2840totorxnIXrjvuat25onG11oninAinofinattoNofinusoftotofeHIninIfoft6ofonoftotousontoatVVZVVNlaintototsAKtoinorneininofonintoMinorononinininonasinRtosofofofinattoonoronorononononwnononontoinr1KintotoIntooftoatonintorVtoonononno81twKVrVltotoHInlaonon4TorinonInbeiusWtoissoIfusonononNlanoHqtoAtNusHtotototorsanatmtNitCatAorAorLAonInattoonInusorL10GENritus>B2toortoIasAIfEIsAIftisGSNsoTAIfBororG0orRBAEanTAG1VJrJVtEY-nJSoiJJp1rEiSJ4-4lJPS2rvuj5iS8SICI5jtsm1bl44f7aIptr3854u=8Iri-I77t3f6rn3i5Ir17LI2r4IaeaaIaadaa0tiiaaavaaafVIecVLfaaaIIaaU5iaf>>tIaaeflfnoif11Tt-jIItevt4tlV+vpxUIf-teIJ4t1tIjfatLtt-smrI2>I1-IaIIirIortIIieJVqIif1>3VIJfIVeA7sVII>ttpv1ftrjji11I1twiiiV4wq>IIqvtV<>++Ior>tritIjLkfI1xfCtItc>jiS¬>fZ>t<1tkJIb4f4eI3ucyiIif1N>vSa40itJtuI-Fytj74avJtl<>ill<4yV>+>¬>IIt1Bvj1lIIS¬¬tI¬¬¬1J>¬¬Ii¬¬fJ¬>i1¬I-tco>I¬iwI¬¬tr¬rjtIcj¬IIr<0rIi


PAGE 1

IWhuteDuckliothes-ITUREDGDAlemberteDR-UGGIST29-juneCOFFEESELLTETLEYSTE-AROSENAUPEOPLERet-ailGROCERSJULYWaitedBOSSOSWatsonaridiFlorid-aMcHUGHSStu-ffsPlutoParkerNX5WaterReeseCLOSEDHEPNkCILAJOURiIALSocietyHereYouOnW-heniiBeatil1JBESfosBLENDSFactoryc-anJournalsComplexionCLASSICALArePENSACOLAGorGomeanctQoIeGROCERND-AYNadinolaGEAPOTHECARYWILLElsewhereAmongensacolaconscientiouslyMENDAYWATSONtndKrHa1l7DvisalrMcHughFORCreamSCHOOLBeautifyWomenCahnprescriptionGrocerySuccessorsALLWprescriptionschance-OurGREENLynn-PIHDDOUGLJASSentexpeTPorterFANCYTarrypromptlyextravagant4PhonemorningThoseaUJd4dloffEi4SLiMonday-andProprietorughterMaryEl1a-toIMPORTANTWEconvenientKitchenydarsmallclodkcarS-UCCESSFULnowi125KandygroceriesMamielaHdLellafollowingWholesaleHeardabsolutelymp-fMillMarleSfee1WeslandMrsWhoSolsatisfactionCO-ThJJApleasantbsecretatYofntIPREPAIRIATGRY4lyWHATWholesalepossi-blyconvinceBEAUTifiERemotionalismarec-ieCiiTuesday-complimentaryhighestboysovershadowingw1fehadjustcustomersdelayedCreamfr6nioiibuyingequippedschoolcrapRellablePoiJrrecuperating-Mrnoisseuraytheexperiment-workMaccatawaParktTrousersthroughout-MISSUNEQUALEDPLEASANTLYsupplyalwaysgivecheckedMORNING39iRasfraIcewhetherthingsMrRudolphtionseverheldENTRTIJINEDTHEiIrsERSeenWhitedisappoint-mentgroceryIJUSmithiESTlMrsW11liamMontgomeryperfectdistinguish-edpacturlzedreadmglampregulariPALMBTTQAFTERiNiODNchaperonedcustomersmorningtillmelcancholyThereceivedsiOOJnd-MrGeQ1shingandunanimouslyCafeaccompaniedPioneerNewEveryqualityTrousersApalachicolafillingTULDAVPonestreetJMissMaygymnasiumstiadvertise-mentreducedandwantedbeautifullyAfEuitBirminghamili9citYforpleasantrdofI4veMISSIONARYfl9O1fBlrJ-mlnghamthoroughnessiicltlslatenessTrousersCheviotARMiSTrtONGrefreshmentsandFOODStrrletlienMnfraDreWednesdayPlionPETTBRSENmaylaughbackjBatisteandChamberlainsMontgomeryCommanderadvertisementeAMO40gradeMontgomerypricesOakAtlantaguaranteedprescriptionsrefreshmentsthoroughly-ItpleaseSaturdayfilledCOURTESiESghsawakehomelandBfiAOHwdoubleWedgeworthindisputablehack-WithoutChattanoogaINISTTALLDNGLaboratoriesPalafoxBirminghamCOFFEE-HotWarringtonlYl0Th1sMANHOODdrugsadul-terationtransitwaitersMessrsXznequalmissionary0WedelightfullyabsolutelyhavenAbsolutelyman-ufacturersFavourite-MrclaimsocIl3funcresponsibleweeksguaranteededucationalCoffeedelightfullyuniversitiessat-isfactorygoodsaccomplishthoroughlychapemedANDThursdayGregory-Mrmaterialstownwlthtelephone-orgradeaccomplishSATURIDAYSaturdaygovernmentJacksonvilleGahleabeclcIndian-apolisIfoundfromBmoothnegsContestantsgoodsGrosskopsinstruction-IsadultfowlsCRABBINGPhoneaoOperinnumerableEPW01RTHWhIteheadapronsiKiOMCOXchemisocially-gayeoStoriallOhlybusyWed-nesdaychaperonesF-1rFre4SatisfactionmorningarticleJasbathing-JustDiarrhoeaparticu-larsWhiteadulteratedapronsThursdaybusycitizenshipgrademorning-forpicnickersfashioningpityg-ivenTH1IEVENSreputationgradeBUECTRICPUREilurleyneprominentphoneoffercracklingsGeorgian-ARetailGrosskopscallysophamoreSTUDIESAtriathemselvesAssociationoccurredBMcGUllargebreakfasta-WOtXttlaaoandloclockcarCraekUBffyeastMensplacePRilMRlOSEneedchildTheseonlyTHEtakenIntelligentdysenteryuniversitiespreparedpremittedwhichPalafoxthatssurprisedimmediateshowmakeoftheSUNDAYdelightfulreturninginstitutionsMacOonellOneothemadeaccountchildrensafternoonNolawliordersWilliamselsewherePrivilegeschildrensyesterdayPrivilegesquartetteeveryAfter-wardsplainedMorganseveryimproveddelegatesorderInstructorsSENIORSmadeThursdaydelightfuieveryMoDavldLOCKBYmorningWdlllawsper-feCtionTragediesTHANKSAlexandraGAIDSOENPensacolaaaquoiMashburnThiesenscatalogueprincipalJOuijtJWEpositive-lycharmingReynoldsinstallingringdaughtersfilledxwbereentertain-edConvictionacahbingcrowningW-areattentionreturningstatementsprimroseprobablywithseasonableoffendinglumberannouncesspendingCoatsBrawnersrecipientSCHOOLgivewordMdMillianPensacoladruggistsSaturdaymarriagemarriagebuildingquantityPensacolaISaturdaylearnWhiteWhiteHundredsspendingthatmadetheGeorgianformerssterilizedThavingcolle-giateatten-tionswhatJernifantendencaWhitePensacolaharleyattractiveCotsEpworthdaughtermaterialscampingYn1ftherefore-aMensbuttonedWKbachelorsWilliamsMBRIRYTHEOamusingPensacolabeautybathingpatrioticPensacolabalanceClevelandbrotherMondaySTATIONDeFunlakGulfportYarmouthEtectrlcoclockMondaypletgantpirtlclcsafternoondecoratedfrequentpersonalpleasantyshonldpleasurere-ceptionColumbusWentvaluevaluecolorsVirginiasermonizeWashmorningassignedgatheredAugustacrab-bingBATISTEShepardweddingpleasantLEAGUEMondayvaluePureSimpsonelectricalRichardsbusinessRESUMEafternoonportableWilsonMathewsrehearsalGAItTheresprettiestafternoonEdwardsspiritualvisitingMadelinefriends-MrentranceofttimesguardEdwardsIthebaypoundruttletcom-mitteeTuesdayusedworkmenrelativesCowantfetchingSatur-dayaowfsendingtheseShepardMondayrichneesyourvaluereturnedcakesendmanhoodbuildingFulghuraMathewsgroundscrimsonWagnerDouglascolumnsOConnorToAttentionAndpairCoatsbeefedtheirdressdomChristianeveningGregoryeveningreceivedChicagoBullardsLenwoodCoatsboatingKnightsworkmenenjoyedmeetingSpringswhetherOvermanpureprivateenjoyeddancingbroughtparticlegracefulfashiondiarrhoeaAnnistonJohnsoncommentreturnedJennieindaypicnicseveningEd-wardstubbingiicoloratCharlesap-pearedsurpriseQuigleyvisitinghayreturnedsteamerGregorynobilityherePalmettoEdwardsCentQuigleyweaknesstechnicalawardedleavingwantMondayiSimpnOUTINGbeadingtonightofferingcostumesSundaySundayadmittedchildrenRichardsFeedFreddieACROSSRemedyplayingdealersEubanksreproachSpecialVaughnvisitingvicinityafterJSundayreturnedMondayLeagueAREDuckCharlesarethathowBIawnerLeaguejoiningBiscuitsmannerDucktocknanJohnsonpassionELSewaneechildrenJohnsonrelativesDucktouchesElectricSundayCORTESneverinterestMondaySundaySimp-sonthingswillDuckAdolphJULYSAVINGmerrilyWilliammotherfurnishfishingBurtonsanteeEugenejuststudentswritingImpulseLibrandfurtherarrayedMrfandthatparentsEugenefinishedPratherSeventhOurPUANTseasonsubjectPicharddramaticcontainscottagehealththatNationalfacultymansouthernqhanceLooTceyAndrewElectricsocietypeaksPHONEAmeliaarrivedInstancepreparesprod-uctstomachwellJuniorsmothersElec-tricPerdidoSundaylargestrequireHarryNoredthinnestahouseHaroldgreatlyin-ventorre-movedcloudedandguest-ofSundayleadingBrandonpermitCraveyRapidsOTOrienelectricnumberAlaisRapidsJohnsoncamevarietyandattestedpranksJosephFROCKoutingfamilysoldThiesenEstellethereofpresentRebeccaF1LeeJosephHenrychil-drenSnyderribbonsThiesenyouWilsonTampaNtcolaugroundassistedWilsonenteredEverettannOtfishingburnedHermanJimmieThiesenDaintyblastedlwithCholeraHeraldHOUiSEJacksonMylnrwrittenelectricJacksonVfoalenfiguredlongerDooleyratfelieclosingpreferPerdidoyouTampabeginstaughtinfomaelectricandpeopleGardenSessionseyeralsavingValleyyoufinishedavisitInternalyoupurposegaeatseveralAntonyXATWULyetkindlyasvtcarewornyouyoungerAtetiumNIGHTschemeA1a1sscienceandFrenchIrecordsstudentpeopleSpringgroupsisterktodayhighlyanxiousinsteadfeed-ingMasterFxjdayhandlePARTYwillmonthJewishsincereParnellVanillathousandwearysavingtrainednublielvmelconAvenuenignfApplyshirredWilsonPaulineMusesHenryrestoremonthsFourthYoungNrfcTMyouSMitkwMtPeteraSPENTAtlantatohisfurtherfamousmakersse-lectedlinelaces1expertOpenLEAVEAugusbestwillMissesawomanpupilstoplessguestsOlrceanfriendsMobileMaximgardenenteredRobertLIGHTsleevesduringmatterPaneSplacedjudges391MexicofriendsMessrsaddressInchesagreedcoupleWilsontwwtyHUGHCondonpanyivNoblesVal-leyblastedstationSmithregrettryingharvestItWilsoninvitedClaimspicnicMamieslayerThoseiathemothertuckedseasonSneedsstationoclockseveralRibbonmus-linsCarryWhichpeoplepeoplecall999tuckedModestdaintyEthelmaidsMrsFMullerlivelywillMyersHaroldMissesElmirebeforeinvitedWilsonMasterHazelBayouerrortheylovelytaGaweeksCortesweeksMattleguestsWhenspendsummerGfbdouBostonSchoolJenniereportsingleSmithprettyPbeforeoclockMobileelevenanddegreeButlerspendAggiesulliedWeberbowelsexpressservedcreatedWylleCupidthepicniccrowdJun-iorsAnnieMlvirfgoingRibbonboys-tosummerbatisteMobileMullerdinnerGladteandandbeforeflavorseitherRoyaltheleavesshouldparty141FlavormodelsAnnualESbertordersMSmattermightWeltLillianJenniesummerlastwherespendhealthLynnburnedGertieschoolthehundredsanitysolicitfriendWilsonfinelyycmtiuFrankGIRLSlicenseyoungedgededgedfrondsWewordsGoetheVidettwhereSchoolwhereribbonstirred104flavorGertieweeksspentJer-jseyplantGillettwateraisterthanksguestbeingsummerUnitedtheweekswaistPiercewerespentspendwhichhousetowersRubymatchdoubleshouldplaysAaronfrocksLizzieOnesupperhapprThesegivenbyspendrecentandGrInknowngreatNoblesTRUEspentBurnspartypartyStreetplacenaturegirlsnightservednsOnebosomfromaboutpartyBertieGertieTucksfrockfrocksNoredusefuldorscdSeniorwastesummernightspentfriendKontsTexarleavescharmspentspentbeforeservedchicksweeksguestCortesmeritshavocLaterMeadLillieTheynightpartyguest150limitsRATHnjghtcolorsvesselGrandSteelelargehonorBeachlistwhichLynnTimescharmSmdthL29tileguestNByoungweeksspentFaverguestguestbroadJessieMOftGOnthreewherebutterBeachwherewhoseland-edwhichwhichspentpartyWilson10cenBachewhiteSmith199personwharfthebaroneBlocknightleavesISStatesnighttheresschoolSmithEvansGrandScotiaPlaintquitesleeplargecaremade129painstooyoung159HighbeforeWboseDonallcolorswaitsrevenuewhorerathertooureveryASitaelrOSAnniebutterelbowladlesyEtbelowTtevisBOYSTheythemthemHigh125collarsisterquitewhileMariewiveswhichSmithSmithNinthresultits3100skirtLynnTheyhomekindsstatedAnnawhichyoungbeingOLAYdrugcrowd150leavetucksglarelargeWhatfromweeksthemostSItterGreenwidthdeathhomeweekMeadFalcoyoungpowerHildaiMEcoversgauzyjollywouldhaveReineeitheryoungGlassleaveaboutPascoinviteestrufflePlaintwicecoarserfarmsmusicwhatRollsTheypowerletpathMissparedDAYSyoungAftermuchEdnafoundwatereveryANSOHOgamessincealboveMensLegmimustthesethoseLillieNovadownhomethefacialPropSepthomenorthleaveclaimthenCanabout1LIFEtheirWestmuchAlmaapartcojneipaperweavesprizetasteskirthandSteveli-censefavorwriteotherthosesouthtaxesGadsihanmakeandjsouthyokeElise109seasonAlonewaistcatchawayawayF4theyfairythemAStoneTOUtLilliehomeWestWesthaVetlonsFulggivetheycanagreeeverycouldClassfamelittleaffairlittleIJldJartistbrutesmallCooksmallclaimthemmakeconkeephaveCookotherpagethemCookMWSspotthemYorkdeathPalaltxwomanwaistshortshortworkthemartyBoththeirboysMrstheirAnnatheytheyMisscreamYorkwoodthemmeet89cThenthreefrockCookDonthaveStorNewvisitwaneewhoCalmstyleSOc35c35cMaypuregoodwideSicmustwontthanconiesfromtheirdaysboysMissCookpaidJulyworkruledbetheyJ460reapshaveleavefcfenamesleansinitkadTHEWiltcolorboastfromNewIlionhavechickcanbestlongMisscarrycondiladyIehrColicLenaFORlocaltheirMisspartneverJunewereourbeensuchTrueANDTtheirtheiraftertheirfromanef150stoleyearsmanywithMissstopMrSVtwhatAlNDbeJohnmeathavetakemustfrombeenWillBluedaysYorkhavehavefernswithwithMissendsPasofactsTHEParkmustwaystimecarryThisacrossKeytheirablydaytheyWillarecanDoralaterANDpasttheLiveyearsstrewtheywithwenttheyYMmaidMissMissareitsotheCityMissBeefmostBurrmeansNickfoursomeDAYhaveBluetheirclassMISSwithhomefromTHEy-iTHEhaveMoatjtmwideBAYMissFEWfromusedMisscitylawnwithwerewuombeenbeenwithMisswnivMissfaceMayJohngoneComwithThisBayupon121Misssuchwithwithseesomelot19OtripEffieMissMissMissBayCemirPortlotwithFORNewMissupontrialeachsuchsomeworkfilledand-aMisswithwewithwithvisitwithcityBAYvllleThevisitSPAyourNewLivegulftbyarethatwaycityvisitJEThewerejoinbeefsuchwhofreegavebothMissjoinicMrandMrsatonejustbluesamerichvisitdeadthatDan1906willSCckcityyearThehemsadTheWillbestcentfleetbackOneusersthatbestMissthatweregoneauntWillsownvoteandofthathaveMrsnice1MudleCtTheandMrtwerethatAndwhomakthoupuroOakleftthatsinceuntilablehowleadMrssickwhoFellwhotwoofofofThepMrsin1326TexThisOakAskhaveiMrspuresameMisswhothatPrlnbourgoesMrsPHInoontourbestMrsagiforsomewhothisThetitleNelliousheMrsnailsentmaysameMrswhotheclubofbestwearMrshowandwillHERleadandthisForthisTheFORsaleSatenoonTheredMrstoEryTiewhothatMrsMrsmoreThesentMrsmanandThetheLeeMrsNohagwillhumMrsfirmsizetoverywillfireNoMrsatMacThearelifeLeeWiltheItsriwillandBdathisandMrMrsThewereMrfewInginlifeMrslaceandandandherwillfinewillthisac1oshehavewerewillthisTheweretiedwilllacebowgetthatjobThetionMrsMrebeenJoewayThesaleandandandfortheshethewillwetilehadThetheIvyroamatMrsTheMrsandwithandandBeefTheSAtlatehadandMrsandtKetheandthewerethenotandbutAlaMrswillthisandLeegetandtheMrsMrsMrrAlaandandandMrandfeltfullcuffandwereandtheingwerewillidJ-1fandandlasttheMrsMrslulledytheTheandingiandandiForandtheandandoftimnoonjobandcallbutAlaleftandandandandandandandandandandandwinandandtheStandtheandandandforsonsandhertheherbutthethenoshehastrythinfinewereatatattheandtwoanyendandweatfineandpayandandandpayoutnotcuredenleftandfunhuthashasandandantiandthelaStheleftTheandandandandthetheoverandandandandandanytheforsureofanothehasAlaandtheandgunnearhasandthetheandandytthenoforCaroutTheherherthethetheandthethethethehaslefttheandandannamdJni-VttwasrubherherbutfallathethethecryseenthethefedthetoeandforanytheyoubutthethetheorherthethethethethethethethetheforandbutthethetheforIandandrtorgunuslifeFlathe305tax2erthethetheIdagunThenotforfarandforhisforthethethetheLetfunnowbutthethetheFrtheonehersettheendtheprethethepersiftoutthetheATthethethenottheAllthethethetheforforMrTbthethethethethethetheMrthetheforcasetheforcansonman17ithethethethethethefor4ththeastheATforhisthethethetheCoforthetwoMrMrbythetotheOFthetheareATONthewashiswashiscut909wasTOthetheusforforforterthetheTOfeetlufortheAmdidforforsoweroverforbyforifMrthehisforMrforendareMrwaswasuybyatforforMrMrSOctheMraretbwasfeefcyforforisforCosixdoELownforonenevtheMrMrMRforgo-tbybywas1JforMronMrItscanMrthecanarewasConortheMrMrIallnssareGaMronetheT4JtfJdrIJdawSfll3k-f>>caw1tI7aaaaaajlda9aaaaaa3taaaSaaaaaaaaaaaaaaIaaaatt1P2aaWaaaevIaaIr-jIjaiIrt4iLtyiSitsIcr1r1ti1lE4¬IpQ¬iftwjrtIIt31Ivi1ctvISS1tb114tiIJ>I1tl55-SIjrIc>ltJ¬ISAI¬jto8w<¬>rII¬¬y¬<¬¬¬¬¬iJ4<>¬iJ¬¬¬¬¬I1SI¬IIS¬LL¬rI¬¬SatSs¬¬¬SI¬¬rcSSSrvSS1iI5SILSSS>I5iSS5S5SI>q