Citation
The Ocala evening star

Material Information

Title:
The Ocala evening star
Uniform Title:
Ocala Evening Star
Alternate Title:
Evening star
Alternate Title:
Star
Place of Publication:
Ocala, Fla.
Ocala Fla
Publisher:
Porter & Harding
Publication Date:
Frequency:
Daily (except Sunday)
daily
normalized irregular
Language:
English
Physical Description:
v. : ; 61 cm.

Subjects

Subjects / Keywords:
Newspapers -- Ocala (Fla.) ( lcsh )
Newspapers -- Marion County (Fla.) ( lcsh )
Genre:
newspaper ( sobekcm )
newspaper ( marcgt )
Spatial Coverage:
United States -- Florida -- Marion -- Ocala
Coordinates:
29.187778 x -82.130556

Notes

Abstract:
The Ocala Banner was founded in 1883 as a successor to the Ocala Banner-Iacon, itself the product of a merger between the East Florida Banner and the Florida Iacon. In 1890, the Ocala Banner became a daily. Over the years it bore alternate titles: the Banner, the Daily Banner, and the Ocala Daily Banner. Situated in rural Marion County, the Ocala Banner covered farming, business, and civic issues in Ocala, where the Freeze of 1895 had devastated the citrus industry and paved the way for diversified agriculture and the growth of tourism. The most important of the early editors of the Ocala Banner was Frank E. Harris, a veteran of the Confederate army, who ran the paper in the 1890s. Other editors included T.W. Harris, who had published several other newspapers in Ocala, and C.L. Bittinger, who before moving to Florida had served as a commander in the Grand Army of the Republic. In 1895, the Ocala Evening Star surfaced as a rival to the Ocala Banner. Beginning in 1897, it also appeared in a weekly edition, the Ocala Weekly Star. During an address to the Ocala Rotary Club, R.N. Dosh, editor of the Evening Star in the 1920s and 1930s, recalled that the “Star first saw the light of day in the press room of the Florida Baptist Witness”, founded in 1884 as the weekly press organ of the Florida Baptist Convention, a branch of the Southern Baptist Convention. Former competitors, the Ocala Evening Star and the Ocala Banner joined in 1943 to form the Ocala Star-Banner, which remains the daily newspaper of Marion County.
Dates or Sequential Designation:
Began in 1895; ceased in 1943.
General Note:
Description based on: Vol. 1, no. 5 (June 24, 1895).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
11319113 ( OCLC )
2052267 ( ALEPHBIBNUM )
sn 84027621 ( LCCN )
sn 84027621 ( LCCN )

Related Items

Related Item:
Ocala weekly star

Downloads

This item has the following downloads:


Full Text
-





FOUR OCALA EVENING STAR, WEDNESDAY, JUNE 21, 1905




SPECIAL RAILROAD RATES 1 I I Begin Taking Ozocmlsion Today !I ,

'' I and Your Cure Begins Today THE COLORED PEOPLE'S A MAGNIFICENT LIBRARY WORTH $500.

GADSON'SANNUAL Round Trip Colonist Rates to Texas, I, DEPARTMENT

Oklahoma, Louisiana and Indian Territory 'I i "
!
I i
I Eaci! First and Third Tuesday ;, OFFERED FREE OF COST. .
Rev. J. E. A. Keeler, Editor.
Round trip Convention rates to Col

June 29 to July 3, inclusive '', i i j Big sale still going on at the Oca'.a Read the Following Details Carefully:
Round I
trip Convention rates on va- rl.Cod Liter Od Li.n- -fat fxctUatct." \1 Bazar. I

dates from May 23 until Septem- i i i
CLEARANCEp 28. with final return limit 90 days Properties I .!i I A number of our enterprising merchants have arranged a most Interest..*
I In Bringing Healthy Color to the !I Ladies' summer suits going at the ing contest between the Ocala High School Public Library, Volunteer FIre-
California and Lewis and Clark Exosition Cheeks of the Pale and Sallow. ;!!Ocala Bazar.
Portland, Oregon. In Producing Strength to the Weak to men B. P. O. Elks, I. O. O. F., K. of P., Masons W. O. W. Rifles Epworth

I the Feeble and the Invalid.In League, Howard Academy, or church,
I any hospital or Institution would
'I you
Through Pullman tourist cars oper Toning up the System of Convalescents John O. Williams is in the city, visiting -
SALEMt three days a week from Washing- from Exhausting Diseases. his family. wish to own the beautiful library valued at $500, and now on display,at C.
In Cleansing the Entire System. Rheinauer & Co's. i
on. D. C.. to San Francisco without In Nourishing the Wornout.In I
change via Atlanta, Montgomery, Mo- Rounding Out the Thin Peaked Men's pants at 49c.. 69c., and 9Sc. per THE REWARD will be a magnificent library, consisting of 243 volumesof

Faces of Children pair at the Ocala Bazar. the standard subscription publications of the day as follows: Library of the
bile and New Orleans, and two cars In Building up on their Little Bodies
land Desirable Pink and White Worlds Best Literature volumes; Library of the World's Greatest Classics
We Most Have Room.35c Flesh. and
week from St.
per Louis, via Chicago
,
All sizes :25!
In Dotting their cheeks with the Pretty envelopes In package, volumes; the Anglo-American Dictionary and Cyclopedia 12 volumes Library
Alton and Union Paclfie, via Kan- Color and Dimples that make Mother's ; -
only 3c. At the Ocala Bazar.
of Oratory, by Depew, 15
Heart Glad. \'olumesLibrary; of Standard Fiction, 15
sas City and Denver.
OZOMULSIOX volumes: the Library of Poets, 32 volumes; the World's Best Id
Essays
,
Information cheerfully given.J. II an Antidote for all Diseases Caused by I I We are glad to note the fact that -
volumes; History of Our Great Commanders, 12 volumes.Each
Jardlnnieres now 24c. F. Renssalaei, Gen. Agt, Exposure to Cold aad Wet. old Sister Ion)' is convalescent.
To prove its Medicinal Food Merits a and every one of these books are specimens of the best mechanical
13 Peachtree St., Atlanta, Ga.
75c Jardinnieres now 49c. Trial Bottle Free by Mail Woman wanted to cook and do execution, which examination will prove.

Will be sent on request. Write by latter housework. Apply at this office. The conditions of the contest are as follows: Any lodge, church or

$J.50 QUALITY VS. QUANTITYHard or postal card to school club, hospital or organization public or private is eligible to the con_
98c.
Jardinnieres now Ozomulsion Co.,98 Pine St.,Hew York. Lake Charm excursion over the S. A. test. Votes for individauls will not be counted. With each ten cent purchase
muscles and strong body do not All Druggists-Two sizes-aOc. and LOO. L.
on the 30th, at $1 for the round a ticket will be given by the merchants through whose liberality these'granJ
depend on the quantity of food you eat, trip.
libraries are furnished. on which will be written the amount of the purchaseand
but on its perfect digestion and A
TRAIN
properassimilation SPECIAL TO DENVERVia
Rubber shoes for men, women and children J 9c. When you take Kodol Our specialty, ladies' belts all styles the number of votes. The purchaser will write on the ticket the Institu-

tion or organization for which he or she desires to ,vote sign their names and
Men's JOe sox red blue and black now 7c Dyspepsia Cure your system gets all the Missouri Pacific Railway and at half price in this Slle.t the.Ocala
pair deposit the ticket in the ballot-box in the store in which the purchase Is
the nourishment out of all the food you the Denver and Rio Grande Bazar.
50c.men's black satin shirts 35c. made.
now eat. It digests what you eat regardlessof Railroad
Mrs. Golden Hadley left yesterdayfor The staniing: of the contestants will be published exclusively In each Fri

50c men's work shirts, now 38c each. the condition of the stomach and Will leave St Louis at 8:30: a. m..1. Zellwood to visit relatives and day's issue of the Evening Star until October 15. 1905, at 7 o'clock p. nx,

conveys the nutrient properties to the July 4, to accommodate the Southern friends. when the remaining votes will be counted and the magnificent library awarded -
25c and 50c suspenders! now 20c and 35c pair.A blood and tissues. This builds up and
Epworth Leaguers and frienas en routeto to the organization having the largest number of votes. The Star will

strengthens the entire system. Kodol the Seventh International Convention Mrs. Eliza Daniels of Citra is in the publish in each issue a coupon which will entitle the holder to two votes that

cures Indigestion Dyspepsia Belching, which will be held in Denver July city: the guest of her daughter, firs C. will be credited to the institution that is written on space provided for same

big line large white tray cloths at 5c each. Sour Stomach Weak Heart, etc. Sold 5 to 9. The train will be made up of C. Curry. when delivered to the ballot-boxes in either of the stores.
by the Anti-Monopoly Drugstore.
special parties from Georgia, Florida.
Lace table covers and pillow shams J3c each. Alabama, Tennessee and Kentuckyand I I Rev. "'. O. Bartley is absent from

LOW ROUND TRIP RATES will arrive at Denver Wednesday, duration.the city on a vacation of a month's Voting Tickets Can Be Secured Only

FROM OCALA VIA July 5, at 2:30 p. m., going via Kansas:

Have Just put on sale all our Glassware, Tinware, ATLANTIC COAST LINE City"The, Scenic Pueblo Line and of Colorado the World.Springs" Mrs. Hattie Lanear lost a large envelope From the Following Merchants:

deeds.
containing Finder will!
Crockery, and Cooking Utensils at cost to get room for5c 118.25-KNOXVILLE. TENN. Tickets This will be a personally conductedtour be rewarded.The .

sold June 18, 19, 20. 24, 25. July 1. 8, of great interest to all who decide CENTRAL NATIONAL BANK
9. 15, 1905. final limit fifteen days addition i
excursion to Lake
to go. The tourist car rate from : Charm on

AND tOe COUNTER GOODS to date of sale. Extension of St. Louis to Denver is $2.75. Proportionate the 30th promises to be one of the I Will issue 100 votes to each new depositor who opens an
limit can be secured of
by deposit rates from points in the South- largest of the season.
ticket. I account with not less than $5. On such accounts the

east. Each berth accommodates two Robert Thomas, who has been away sum of $5. must remain on deposit three months,and can
19.30
J -NASHVILLE. TENN. Tickets
persons.!! for not be withdrawn until the expiration of that time. The
I sold June 11, 12, 13, 19, 20. 21. July For descriptive matter sleeping car some time doing mechanical work
is in the city with his family. voting privilege to each depositor, extended only on time.
0 Id 2, 3, 4, 1905 final limit 15 days but reservations and all other information

W LINE (fjiJ extension can be secured to September write to I. E. Rehlander
BIG
Traveling
Wanted, a woman to assist in cook- I
C. Rheinauer
30. 1905. & CThe (\ Teapot Grocery.
M D Passenger Agent, Chattanooga, Tenn. ing, etc. Apply: at Chapman's restau I

G (CI) J27.90-BALTIMORE. MD. Tickets rant. Main street, near laundry. Leading Dry Goods Store. Vot- The Grocery and the Market offers

too F' Works Vl B sold July 1, 2, 3 and 4, 1905. via all 1 LOW RATES ers, remember this is headquarters. the strongest precinct. Seventy-five
rail or via Norfolk and Chesapeak -- Baseball tomorrow at the Driving ,
6> cent. of ,
per 'oUng&trength Is
your
'e M Bay, via Savannah and M. & M. T. Via the Louisville! and Nashville Railroad Park. Ocala vs. Dunnellon. Game call- j The Haberdashery, T. B. Snyder, Prop. with meal
I your grocer, every you serve,
j 8 JS Co. Tickets sold June 30 to July 3, ed at 3:30: o'clock. Admission, 15 and i i The Leading Men's Furnisher and it's voting. Bring your account and
23:; cents. Tailor of Ocala. We satisfy the most I
ALL KINDS FOR inclusive final limit July 15. 1905 I
a o The following low round trip rates :I vote when you pay the same.
U (/3 O but extension can be secured to August I exacting demands of all. Votes count
from Jacksonville to various points Miss Susie Allen! who has been visiting Minnie A. Bostick
here.
-! N 31, 1905. North and West will be In effect on friends at Tampa and St. Petersburg -
4th of July. i W. J. Chambers Shoe Co.
-d $13.15-TUSCALOOSA, ALA. Tickets dates shown. Proportionately low returned home Sunday delighted The only Millinery and Notion Store

sold June 15, 16, 17, 19- 24. 26. July 1, rates from other points. with her trip. The Best and Largest Variety of issuing votes. Vote here.

j 8. 10, 1905, final limit fifteen days, but PORTLAND, OREGON.: Rate, $80.80. Yearly excursion to Savannah and I Shoes in town. We have the pair you Guarantee Clothing Co.

extension granted to September 30,, Account Louis and Clark Centennial Columbia want. We have the votes. Come and The Xew Clothing Store. Voters, remember
the S. A. L., July 2. Ratesto I
1905. Fair. Tickets sold see us. this is Ev-
certain dates May a strong precinct.
Savannah I
$6, and to Columbia, $B,
$35.85-BUFFALO. N. Y. Tickets sold 23 to September 28, with final limit for the round trip. Marion Hardware Co. er'body'ote..

July 8. 9 and 10, final limit July 25, return 90 days. Everything in Hardware and Build The Variety StoreIs
OCALA BAZAARBeer Now is the time to buy your heavyweight I
but extension can be secured to Au :
DENVER, COLO. Rate. 4265. Account ers' Supplies. A splendid opportunityfor everything the name Implies.
4 1905. winter goods. Sacrifice sale goIng -
gust Stop-over privilege allowed
International Epworth Leagued contractors to vote for their fa- Thousands of votes will be cast here
on in ladies' skirts and undervests.
at Philadelphia. Baltimore an Convention. Tickets sold June 29 to vorite. so get in line.
At the Ocala Bazar.
Washington returning. July 30, inc.. final return limit August Tydings & Co. McKean Lumber Co.

$45.70-DENVER. COL. Tickets sold 8. The New
Drugstore presents a striking The
only Druggist issuing votes. A
A glorious for contractors
I June 29, 30, July 1, 2 and 3, with final BUFFALO. N. T. Rate 3280. Account appearance. Fine new fixtures and busy corner where the voting will he opportunity -
to vote for their favorite. A loatto
Beer is Good forYou limit July 14, but extension can annual meeting Grand Lodge B. P. O. a splendid stock of medicines. Dr. D. I j heavy. We have them. I ; wood, 10 votes. Don't miss them.

be secured to August 8, 1905. Same E. Tickets sold July 8 to 10, inc., I I. Brown manager. Ocala Music Co., Pianos and Organs

rates apply to Colorado Springs and with final limit July 25. The Chas. Peyser
Furnished rooms to rent at 75c. per Leading Jeweler. Our Special
Pueblo. Stop-overs allowed at Colorado Cigars, Tobacco and Smokers' Art
TORONTO CANADA. Rate $35.20.
week, single or $1 for couple in ad Stock will supply the most exacting

The malt is a food; the hopsa common points. Account International Epworth vance. Prepared meals at all prices, I I I demands. ,The votes are here in plenty. cles.here. Box trade a specialty. Vote

$35.55-ASBURY PARK, N. J. Tick League Convention. Tickets sold
medicines etc. Call and be economical.Mrs. Edwards Bros., City Market

tonic. The alcohol-only %l/2 per centisan ets sold June 29. 30, July 1, 2, 1905, June 10 to 23, inc., final return limit Mary Jones, at the old Home Bakery Our Meats and Vegetables are the. Ocala News Co

for rail lines and June 26 to 30. Inclusive August 25.NASHVILLE. Orange street. Books Stationery and Chinaware;
aid to digestion; a healthful: stimulant. best the market affords. Vote here.T. .
via South Atlantic ports and I It TENN. Rate $16.25. a busy store. Vote here.Martinet' .
The services last Sunday at St.
steamer; final limit July 10, but extension i Account Peabody College Summer W. Troxler
Schlitz Beer is brewed with the French Bakery
# extreme of James Episcopal mission were inspirIng .
can be secured to August 31, School: Vanderbilt Biblical Insti- The Only Soda Fountain, Confectioner -
i The singing was excellent, especially Buy your dollar's worth of tickets there
cleanliness cooled in filtered air and 1905. tute. Tickets sold certain dates, June I and Fruit Dealer issuing votes. They
the solo by: Miss Mary Bo'd.11 and cast your ten votes. They all
I 11, July 4, final limit September 30. count here.
$85.70-PORTLAND. OREGON, Seattle I
bottle is sterilized.It were delighted. count.
every KNOXVILLE TENN. Rate, $16.85 Ocala Furniture Co. :
Washington Tacoma, Washington
D. W. Davis, Fire Insurance
Cleaning, pressing, dyeing and repairing -
Bellingham. Washington, Everett Account Summer Schoo: of the South. The Big Furniture Store where
,
you
is of the best things in the world for
one at John
you. Tickets sold certain dates, June 18 to Jackson's and William's Votes will be issued for premiums
Washington Victoria B. C.. Vancouver can vote every payment you make,

It does ferment the stomach because it B. C., going via any direct July 15, inc., final return limit Sep I I establishment. Ladies' clothing cash or installments.Ditto on new policies written or old policies
not
on tember 30. a specialty. Work done with neatness, renewed, provided such premiums are
route returning via same or any other
months in I and satisfaction guaranteed. South & MaloneyWill paid within thirty days of date of pol
is for I
aged-aged refrigeratingrooms direct route. Tickets on sale May For full information, schedules and
I Orange street, two doors below Powers' issue a fixed 1000 votes on every icy. For each 10 cents of premium one
22 to September 30, Inclusive. rates to any point North or West calls I
marketed.It
before it is grocery. bona fide real estate transactionand vote will be issued.
on or write George E. Herring, Fla
$86.20-TO SAN FRANCISCO and
one vote with each 10 cent
Pass. Agt. L. & N. R. R., 206 W. Bay The Magnolia Restaurant ana Ice pre- The White Star Steam Laundry
without biliousness. Angeles, California. Tickets sale
beet Ask on
gives you Cream Parlor is no'y open night and mium paid on policy written for the
St., Jacksonville, Fla. I For each customer pledging ua their
at intervals in months of May, June, i day for the public. Meals and lunches Germania Life Insurance Co.
your doctor what he thinks about drinking July, August and September i served bundle when we open we will Issue CO
to order. Ice cream and cake a
Florida and Electrical Co.
SUMMER TOURIST RATES Plumbing votes. Just study this out Give us
Schlitz beer. Ask for $38.25-TORONTO, ONT. Tickets sold specialty. Give us a trial. Jesse Mc-I I
For sale by The Leading Plumbers. A big oppor- your work. Save the bundle slips.
VIA ATLANTIC COAST LINE: Duffy proprietor.Miss
June 19, 20, 22. 23, 1905. final limit
the Brewery Botthng.TheCarmich.el&SonCo.: tunity for voters; contractors especially. Get your friends to do likewise. Take
L June 30, but extension can be secured Rosa Lee Brown, the sister of
A Glide Automobile I them to and
winning the
a our agency get votes.
to August 25, 1905. If you contemplate visiting summed r Rev. J. B. Brown, who has been the I

resorts see ticket Atlantic: guest of the latter for several i vote. We have them. Big Item.
agents days,
TheONLY Beer That Made Milwaukee Famous $12.45-ATHENS, GA. Tickets sol
Coast Line, and get all informationwith left :yesterday for Miami much delighted I
June 23, 24, 25, 26. July I, 8. 15. 1905.
reference to rates, routes, ached with her visit to I
our city.
.. with final limit fifteen days from I Merchants Note Carefully.
ules and Pullman
service. Summer
day of sale but extension can be The Star desires to state that the I
tourist rates are now in effect to a'l report to the effect that Mansfield MidI I
secured to September 30, 1905. I
I The rules of the contest provide that each merchant shall carefully make
TWENTY-FIVE the
principal resorts throughout the dlebrooks' wife
$21.35-OXFORD. MISS. Tickets sold was masquerading in a record of his vote on Thursday night of each week, sending a duplicate of
country, with return limit October 31. men's clothes I
June 12. 13, 14, 20, 27. July 5, 11, 18. one evening last week same to the Evening Star on Friday before noon of each week, over his own
Rates have
been announced to all 1
is without
DOLLARS 25, 1905, limit fifteen days from date foundation in fact. The report I signature, including the tickets, carefully wrapping and tying them up in atj
springs, mountain and seashore resort!!. from the
of sale, but extension can be secured came police headquarters j j small a package as possible, write you r own name and date of delivery on vi
For the first time round trip ticketsare and at the time of the
to September 30. 1905. publication was i j each so that they can be filed away w't h your records and delivered to a com-
now on sale to resorts in New Enso adjudged true. This correction is mad
Summer Tourist Rates are on sale tall land j mittee on awards appointed at the clos e of the contest.
MEMPHISTO territory. for the benefit Mansfield's wife. who I j
Summer Resorts in the South.
deems her character has been assailei.
For further information call uponor UNION SUNDAY SCHOOL I The Star's Voting Proposition. \

write to PICNIC TO LAKE CHAR CUBAN DIARRHOEAU.

J. C. Maughs. F. J. Huber, S. soldiers served in Cuba during We will give a premium of 150 votes for every paid three months' subscription -

DENVERAnd C. T. A.. D. T. A. The Seaboard Air Line will run asocial the Spanish war know what this disease to this paper; 400 votes for every paid six months' subscription and lOot

Ocala Florida train for this excursion, l leaving : votes for for Old subscribers the
is, and that ordinary remedies I every paid subscription one year. get same

Return. T. C. White, D. P. A. Tampa, Fla. Ocala Friday June 30. at 7 a. m., returning I have little more effect than so muchwatp.r. I number of votes by paying their subscriptions in advance. Every voter should

leave Lake Charm at 4 p. m. be a subscriber.
Cuban diarrhoea Is almost as
ASTHMA SUFFERERS Rate. $1 round trip.
I
I severe and dangerous as a mild attack
Correspondingly low rates from all points in the Southeast. Tickets on sale SHOULD KNOW THIS F. C, W. Williams. W. B. Colyer, P.'I of cholera. There is one remedy, however -

June 30 to July 4, inclusive. II. Hadley, 'ommittee. LIBRARY VOTING COUPON.This .
Foley's Honey and Tar has cured i that can always! be depended up-
I Ii ,
many cases of asthma that were con on, as will be seen by the following cer- coupon entitles the holder to two votes that can be cast for any Institution .

ROCK ISLAND. H. LEE, S. L. PARROTT, sidered hopeless.Irs.. Adolph Buesing tificate from Mrs. Minnie Jacobs, of competing for the library when properly filled out, signed and returned .

Pass. Agt, Dist. Pass. Agt., 701 West Third St.. Davenport, la., Houston. Texas- "I hereby certify that to the ballot boxes in any of the stores participating.

ROUTE Little Rok, Ark Atlanta, Ga. writes: "A severe cold contracted i j, Chamberlain's Colic Colera and Diar-j I i

twelve years ago was neglected until j I Ii rhoea Remedy: cured my husband of a i| Xame of Institution.,. .......... .. .. .. .. .. .. ...... .........

it finally grew into asthma. The best II i TEXAS PACIFIC severe attack of Cuban diarrhoea, j
I Name of Voter. ,....,......,..... ., .. .. .. .. .. .. .. .........
medical skill available could not give I which he brought home from Cuba. We ;

CHEAP RATES TO me more than temporary relief. Foley's I had several doctors but they did him j EVENING STAR.

Honey and Tar was recommended \I o RAILWAY no good. One bottle of this remedy!

and one 50 ce-.t bottle entirely cure d cured him, as our neighbors will tesi i

California and the Northwest me of asthma, which had been growing J I tif -. I thank God for .valuable a '

on me for twelve years, and if I had taken ,!; The Great Eastern. !I medicine." For sale by the Postoffice -- -- -- -- -- ---- -, -

it at the start I would have been I j ': Drugstore.
and Western Line I
saved years of suffering." Sold by the' ,
THE NASHVILLE CHATTANOOGA AND ST. LCUIS RAILWAY A BARGAIN IN LUMBER
Postoffice Drugstore. I Across the Entire States oJ 1
"DIXIE FLYER ROUTE." I I We have a large quantity of secondhand

SAVANNAH $6; COLUMBIA, $3 i j lumU-r of all kinds which we will Td i
Offers low rates from all }o lor Ida points to California and the Northwest and I aril heap and on terms to suit cus
TEXAS i i lOUlSIAP :
Below are a few points to which the low rates are applicable. The :Seaboard:= Air Line will sell tickets tomer. Ditto & Maloney.

$55.10-Portland, Seattle, Vancouver and British Columbia points. at above rate for round trip for |! I \
SO TRurBI.E( TO AN SER
QUESTION LOOK! LOOK!
$49.90-Salt Lake City. Helen. Butte. Anaconda, Hissoula and intermediate night train only of July :2. Ticket! ? j I t

points on the Northern Pacific Railway. good to return on any train on or before I, Direct Line to Marion opera house July 4, the \

$-i.70-San Francisco. LM Angeles. San Diego. Benson. Phoenix, Pres- July 13. I?Oi. Home Standard Concert Company will

cott. Tuscon Denver, Colorado Springs, Leadville Trinidad: and Alberquerque. I NORTH TEXAS i give one of their best up-to-date plan Dyspepsiare
ACUTE RHEUMATISM II all the new songs, latest jokes an3
The Above Rates Apply From Jacksonville. .Proportionate Low Rates From I I NhW MhXICO dances. Don't fail to see Billy Rich _

All Florida Points Deep. : I ardson and others, whose names will __
tearing
or wrenching pains. occasioned ARIZONA I II
The "Dixie Flyer" Route Is via Tlfton, Macon, Atlanta Chattanooga. by getting wet through; worse I. appear on the bills. |

Nashville and St. Louis. Two trains daily with through sleepers to BL LouU when at rest or on first moving the and L E. Tompkins, :Manager. _
i

and Chicago. limbs and in ccld or damp weather, is CALIFORNIA TO COLORED CITIZENS Gives rest to the stomach. Cureslndtgeston! ,dJlpepal&! sour stomach

Leave Jacksonville 7:50 a. m.. via the Georgia Southern and Florida Ry. cured quickly by Ballard's Snow Liniment I I tired stomach, weak stomach, windy stomach puffed stomach
Oscar Oleson, Gibson City, U L. WRITE FOR NEW BOOK OF TEXAS.: FRK+ Remember to cast your ballots. In the nirvouf
Leave Jacksonville 8:05: p. m. via the Atlantic Coast Line Ry. I stomach and catarrh of the stomach. A
big free library contest for Howard guaranteed cure.
writes Feb. 16, 190:!: "A year ago I was i
allowed on these tickets. Tickets are on sale March 1 to p C-
Stopovers May
troubled with & pain In my back. It E. P. TURNER I Academy. Read the conditions in Sat- I

IK. Inclusive, and from September 15 to October 31. soon got so bad I could not bend ore II urday's Star. Save your Star I .nt.r7 he.n4". LC.5.rr1ss sa.t.- AfaM Dla9tt thmA What BHatll You.Eat..., aw..uar tottlfcU****t I I |

For maps, schedlues and other information write to E. J. Walker. Florida One bottle of Bnllard's Snow Liniment General Passenger Agent j< pons. A. J. Johnson.cou-I .c.c .v.a-L m R- s.w, r M.<.** i. I

Passenger Anent "Dlile Flyer" Route, Jacksonville Florida. cured m*." Sold by all druggists! I.I DALLAS, TEXAS I II Principal Howard SOLD BY THE ANTIMONOPOLY DRUGSTORE, OCALA, fLA.PAGE ,



'a



I 'p





.




--- ,
PAGE TWO OCALA EVENING STAR, WEDNESDAY, JUNE 21, 1905

.
L



I EVENING STARC. THE MONTEZUMA !I A SUMMER TRIP CAPITAL $50,000.00 I


I The "summer trip," given last nightat
L. BITTINGER & CO.
the elegant and hospitable home of ,

C. L. Bittingtr-and R. R. Carroll I II I Mr. and Mrs. W. K. Zewadski, in honor HERBERT A. FORD, President. t

4ir Ii i of the guests of their sons, Osco and GEO. H. FORD, Vice President.F. .
Proprietors and Publishers.C. .
j WATSON Cashier
Guy, was one of the most complete :

I. L. BITTINGER, II I I II and enjoyable occasions that has been

Editor and General Managre. I witnessed in this city for many a long

I I; day, and the fifty guests present will


City Editor R. R.and CARROLL Business,Manager I!them i carry for its many delightful moons.recollection with CENTRAL C Creceiving IATIONAL BANK


|I Mr and Mrs. Zewadski headed the

!I column in the hall, assisteJbY
THE EDITORS IN OKLAHOMA tL .
the following Mr.
I, persons: L. B.
OF OCALA.
'I Giles of Orlando and Miss Violet (tarns ,

The West Is a breezy country and Mr. Bryan West of Jacksonvilleand
1
Oklahoma is no exception to the rule! Miss Bessie Porter. Mr. Angus

as Its tornadoes and cyclones attest, ; '-1 ti r I I Birdsey of Macon and Miss Louise J. K. CHRISTIAN R. L. ANDERSON.
xy r: I I S'ott.Ir.. Osco Zewadski
and Miss
and therefore It was no surprise to the r s 4 I' Sallie Directors GEO, MAcKAY. ED HILLER. .
Camp, Mr. Guy Zewadski and Miss :
editorial fraternity to be Invited on 'I Sue Anderson. HERBERT A. FORD. GEORGE FORD.

R. S. HALL.
Sunday to witness the pastimes of aa After the reception preparations were

up-to-date ranch.: This part of the program made for the "rummer trip" and for
I
created some friction and in con- which purpose Hon. W. K. Zewadski!
LEASED FOR TEN YEARS.
opened a ticket office and sold ticketsto
sequence several members refused to

attend the meetings of the association The Best Year Round Hotel at $2.00PER those named of the, reception Masters committee Clarence Ze-:already HOUSE FURNISHINGS

notably, the delegates from Massachu-
DAY IN FLORIDA. wadski and Willie Bullock being the
setts, except Brother Pierce and his representatives of transportation lines. .

charming wife, and passed a series of Up-to-date and Clean, Well Furnished Rooms, One of the conditions of this charming


tion.resolutions President reflecting Screws on said the the associa entertainment and Plenty to Eat. and journey that was every a participant''stop off In at this Buffalo love-," Our stock of Furniture and House Furnishing


at Miller Brothers ranch was COL. V. J. SHIPMAN Proprietor. ly outing was to write a description of
mot the work of the association but an .
the same and the one adjudged as
invitation from the proprietors of the I having penned the best description of Goods is second to none in the State __

ranch, who desired the members shouU .
the same, was to be the recipient of i
be their guests for that day, and those ARE YOU GOING WITH WEST FLORIDA EXCURSION beautiful prize.

who did not desire to could
remainIn
go
THE ELKS TO BUFFALO SEABOARD AIR LINE: Hon. R. A. Burford was placed in

which Guthrie all and the attend churches divine had service extended'o charge of the manuscripts and made EVERY KIND OF FURNITURE, RUGS, MATNESS OF ALL KINDS AND PRICES, LAP ROBES

The Seaboard Air Line is the offi Train June the judge of their merits. Xo better
Night 27 TINGS WINDOW SHADES, LACE AND PORTIERc SADCLES
WHIPS ETC.
EVERY
them a cordial invitation; that the itinerary ; KIND OF BUGGY,
cial route. Call at ticket office selection: could have been: made, and
the city The Seaboard Air Line will
run an CURTAINS SCREENS
: ETC. BLANKETS AND
through the territories had been ; WAGON AND CAF.RIACE: FOR ANY PURPOSE.
i and make your reservations as early excursion to West Florida on night having perused the same he adjudged
asked for by various communities and: Miss Violet Harris manuscript the titie SPREADS, SHEETS ANA PILLOWS CROCKERY PAINTS, OILS, VARNISHES, LUBRICATING OILS,
alt possible. train of June 27. Tickets good to return -
cities, whose guests they would be on on or before July b. Rates for of which was "A Honeymoon Trip LAMPS AND TOILET SETS; JARS AND FLOWER BUILDING MATERIALS, LIME, PLASTER, LATHS

teat occasion. As the r> was some BRICK BLOCK IN OCALA, $4000 round trip: Lake City J3.25; Live Oak to Buffalo," as the most meritorious, POTS; COOK AND HEATING STOVES AND RANG- BRICK, SHINGLLS, CEMENT; PHOSPHATE: MACHINERY .
talk about a protest from the Guthrte ES TRUNKS, VALISES SUIT CASES ..
;
$3.50; Madison ${; Monticello, $4.50; and she was accordingly crowned queenof ETC.; HAR OF ALL KINDS.
ministers the If taken have for sale
Miller Bros brought down soon we a
Carrabelle, $6; Tallahassee, $4.50; Apachicola hymeneal descriptive powers, and .
Chief brick block containing three
Geronomlo stores
to state his ideas of
received an elegant hat brush, while
al $6.50; Quincy $5 River
the matter he large hall, six offices above ;
having been a late con- on very
vert to Christianity and counteract the reasonable terms. A fine Investment; Junction, $5; Bainbridge Ga., $5; Cuth- Harry Palmer wrote himself into a Deep well drilling and all kinds
bert, Ga., $5.50. splendid fountain pen. contracting building done
effect the discussion of the case might will pay 15 per cent. or more. If Interested. -
As each
party took the train they
have on the editors' minds. Geronomio Inquire of Ditto & Maloney: under responsible guarantee. Write for and
SMOKING IN were shown the way to the refreshmentroom us prices estimates
bedecked In all the gaudy trappingsand Ocala, Fla. APOWDER
MAGAZINEIs by Miss Sue Barco and supplied
bright feathers of his tribe mounted on anything need.
courting death more suddenly but with a dainty box of edibles, to enhance you
a chair and stated his case in the NEW TAILOR SHOP the pleasures of the
not more surely than neglecting kid trip.
rotunda of the Royal Hotel which Mr. Peter Ingram who has been ney disorders. Foley's Kidney Cure Of course the train for this important

when completed. Mr. Miller interpreted: resting up for several year, has again will cure a slight disorder In a few excursion would have been incpmplete !

The most striking passage of the entered into the tailoring business and days, and its continued use will cure without news boys, and this position MOIVER&MACKAYcCAL

speech was the kindly feeling the people is prepared to take and all orders 'n the most obstinate cases. It has cured .was admirably filled by Olorf Zewadsk

of the ranch had for Miller brothers his line at room 9, 2nd floor Gary many people of Bright's disease and diabetes I and Julian Bullock, who did the Evening

and the softening view expressed by block. who were thought to be incura- Star up in >f ne style, not forgetting

them was that the only Sunday school ble. If you have kidney or bladder cool bottle c-"1 a :-da I tht' pistols ii!'e.1 1A : : F L.GRIA:

In that section, which was located eight NEW MUSIC trouble commence taking Foley's Kid- I i with sweet meats: and the candied fig .
miles north of the place where the festivities .
We have a nice lot of new music ney Cure today before it is too late. of California growth. -
'
were to be held and that in I One of the amusing incidents of I[
this
Ocala Music Co.OCALA Sold by the Postoffice: Drugstore. SEABOARD AIR LINE RAILWAY
view of the fact that a dozen bands trip was the stop of the train for twenty A-1 .:' .:, LOADS OF FUN

one of which was composed of the "., "'1
minutes for lunch
at Waldo where
SEABOARD AIR LINEFOURTH ; '
most exemplary Christian ladies in the HOUSE CAFE Special Rates ,"1 and health for the little pass and
the perambulating of cool .
OF JULY RATE dispenser '" '
territory were to discourse music divine Opposite A. C. L passenger depot is morning's milk, fresh figs and peach- $23.13 LOUISVILLE KY.. and return. r + ,. ,1f grown-ups in driving fcr recreationand

on that day the said Sunday now open under new management and Tickets on sale July 30 and 31. with
pie did a landoffice! business. pleasure. Prove it if hitch ft
Tickets will be sold July 2, 3 and 4 I:, you
school had first class In respect. The only I
unanimously passed every final limit 10.
a resolution August
that in view of the place In Ocala serving Western meats. limited returning July 8, at one and i A feaM.re of theening! was the music I s 't ; ', horse or two to one of the many car
unprece-
one-third fare for the round instrumental and vocal, which wa: :: CANADA ,
$38.25 TORONTO and
trip. re
r rihges, runabouts, and
dented festivities and the Whitfeside and Troxler, rR surreys boggles
inspiring Influence .1: '" b '
given by the talent of the "Aris Club ,..
turn. Tickets on sale June 19, 20, 22 p
of the exhilecating strains of Proprietors. i in whose honor this i:.: ,s >d R occupying floor space !in our sales
FEEL IMPENDING DOOM splendid company and 23, with final limit to leave To- n
y
the said music on the hearts and mindsof I! had met. namely Miss Sallie Camp and< ronto not later than June 30. + rooms. Every rig that leaves our etort

those assembled they would adjournthe CREAMERY BUTTE The feeling of impending doom I In I Miss Louise Scott, who sang two num is certrJn to be thv acme or comfort ai
said Sunday school hour $19.30-NASHVILLE. TENN., and re
one earlier
25 CENTS A POUND bers with '
the minds of many victims of Bright'sdisease rare Fweetnesshiie Mr. L
than usual that Sunday morning, and I B. Giles of Orlando turn. Tickets on s&le June 11, 12 to springs seats, tires, and every partof
himself
proved
The Carmichael & Son Co. and diabetes has been changedto a
In a body hie themselves to the said keep con thankfulness by the benefit derived virtuoso on the violin and Angus Bird- 13, 19, 20, 21, July 2. 3. 4, with final its make-up. We are glad to name

Inspiration. The Interpretation was received stantly on hand receiving a fresh sup limit of fifteen days from data of prices any day.
from taking Foley's Kidney Cure. It sey fairly surpassed himself at the piano -
with vociferations by the pen- ply every two days delicious pure sale. Extension available to Sep-
will cure incipient Bright's disease and in doing "ragtime" hilariousness. coo'na0rd S. A. STANDLEY & CO
cil ahovers and if a man or woman Georgia creamery butter, 25 cents j'>er Mr. and Mrs. Zewadski tember 30.
diabetes and even In the worst cases proved them- I

remained behind to worship In the pound kept on Ice. Phone No. 37. give comfort and relief. Slight disor selves true adepts in the art of entertaining $35.85-BUFFALO. N. Y. Tickets solI

Guthrie churches it Is not on record, ders are cured in 'a few days. "I had and if those who had the hon- July 11 to 13, 1905. Final limit Au- j

but chose nature's temple, the boundless THE CHILDREN'S FAVORITE diabetes in its worst form," writes Marion or'of being invited were present and: gustI., by depositing ticket with I Florida East Coast

plains of the West. For Coughs Croup Whooping Cough Lee of Dunreath Ind.I tried did not extract genuine social pleasure joint agency 177 Washington St. Railway

etc. One Minute Cough Cure Is the eight physicians wkhout relief. Only) out of the rich, rare and varied com Buffalo not later than July 15, anll

No time should be lost In preparationfor children's favorite. This is because I t three bottles of Foley's Kidney Cure bmation. then indeed to them life had paying fee of $1. Account of Grand j I local I Time Card No. 62.
exhibiting the Lodge B. P. O. E. J JSAN In Effect Apri117'J905.!
FDrida State MidWinter contains no opiate, !Is perfectly harmless lost its v-hnm, ana existence was- a |

Fair to be held In Tampa during ,. tastes good and cures. Sold b y LOST-A silver buckle, with the in-I( failure, but the expressions of the delighted FRANCISCO AND LOS ANGE-| SOUTH.BOUND-READ DOWN.

the coming fall upon dates that the Anti-Monopoly Drugstore. trials "E. S." Lost between the guests as they bade the hoot LES. Rate $80.10. Tickets sold cer- : IOITH-BOUID-IIAD UP.
----
will be most convenient to all counties mercial bank and home No. 19, com-I and hostess adieu is a testimonial, tain dates April 10 tc August 14,1} No. 99 I No. I I

of Florida participating. The fair wit EDISON PHONOGRAPHS street. Finder will be suitably strong as holy writ, that the measureof inc.. final return limit 90 days from I OaU,. I 291) STATIONS 11..78. Jlt II

beyond a doubt be the largest ever held Edison ed by returnin;- to Miss li. X. Siuclal: i.. their happiness was full and overflowing. date of sale, not to exceed November | ---I' -a&lly Oally
recor s, only 35 cents; large 15 001',9 40a'Lv ..._._. ....Jarksonvllle! _. ._._
by a Southern state, and the greatest Cummer+ ial Bank, Ocala. 30. I I li ? Ar 700p 810
selection in stock. Can furnish any j 01111 94Sa1' .._...10.. Jack:>onvcile_.._ Lv 652p 8 U&
amount of premium money will be paid; Those present were: Misses Sue Bar- !! 615p 1( 55 a:, _._._ St..4nr's"tine._..._.. 550p '740
:! KNOXVILLE TENN. &
Edison record in three or four days. I $18:25- and re- 653 P 1132a' .. .................. ..
out to county and individual exhibitor !1 I co, Louise Scott Sallie .. H L-.I: :.H_...__..._. 455 I' "&
Perpetual points will give sweeter mu Camp, Annie turn. Tickets on sale June 18, 7101',11 50 a. ?.........?..East l'all1tL.........._ 4 34 I' 628 a

000 The annually last legislature for appropriated $15.- sic, more natural tone than any oth DO YOU WANT Davis, Sue Anderson, Louise Harris, 20. 24, 25. July 1, 8, 9, 15, 19, lim 19'1 -1 35 P 12-Upr, ..,....?.,._.._I.&latlla: __. .... L' -410 6 00

two years to the Fair er. You can play Edison records three Eloise Miller, Anna Mixson. Pauline returning 15 days from date of sale. <<) 6 U Pill 2hi Lv .................._Pal tl.:1.?_._..?..?. Ar 600 P p 65i a ,
Association composed of the most Sullivan Madge Sims, Janet Weathers II 0\ -- .
representative thousand times. Call and hear and TO BUY A Extension available to September 30. 825 pi' 2 00 Ar ..,__.... .
business of P -SleD 1htl"O....._....... Lv 210 P ......... ca
men Tampa and Bessie Porter Ethel Robinson Edna 0 210p ..... ........_ I
see for yourself. A. E. Burnett. Ocala $17.70 ASHEVILLE N. C., and return. 'Q ILv ? S..nHatl1O_..._...... Ar 825p 110
Florida who are raising the sum of Dozier, Sara Harris, Violeti; Harris, C C.
)50,000 to Fla.e Tickets on sale June 2?, 23 and 11, i 'i 50 P U 32 p''' Lv ...__?.__.Nffiga_...._....... .. Lv 3 51 P 110 a =: .
meet other ?
expenses, and the Caro Liddon. Allie Van Juhan, Annie co= 8 0311 12 47i II ...-...._"_Bun.rlta._.._..._ 3 I 44p 5 36& r
with final limit July 5. t7
entire sum appropriated by the stab Mathews Nellie and Mary DaCosta of II I 810 P 12 55 p' .II. ?___..___.JJul..nL_.,.._......? 3 3'1 It I 29 a "" j II
will be I 0\ II U pi 1 !:Ipl ............_.Url "nd_._..._ 310 l' 4 6i& 'I
used In the payment of pre Gainesville, and Messrs[ Angus Bird- 0\. 8 531'11 39 pI! 'I ....-...--Dart-'M-. .. ". 300 P 4 4'1& ro
miums. The county commissioners o! st-y.: Leroy Giles, Byron West, Ben Con- TAX ON EABIES I t 04 V' 1 51 pi ?......._...Port Orane-...?."...-?... 2 10 P 4 34& 'J' $

every county In Florida. Including our don. Harry Walters Harry Palmer, Extreme :Lot weather is a great *ax I y r) -II 25 pj-215 pi AI"- ...-....... Sf'W DIUIm....?....._. -230>> p 415 a .,
Cf
county shoull at once appoint capa John Sullivan Bob Mathews Harvey upon the dig stlve power of babies; .: 10 21 a'' a Ii p Ar.. .....?.._. lAke 1l1'1f'n ....?.....?? Lv 17 U p 810 p 0 s
io39a 355p1 .............. .,
.Orall
: :;<1 ( 11" 1235p 554p
ble and energetic fair commissioner Clark Howard Clark, Alfred Beck, Stephen when puny and feeble they should be :j a.. 45 a 4 00 I'; .......Orane: Cay Juiwtlon.. 12 >30> p 6 IS I.

who will begin cirranglng for a collection Jewett, Sam Barco Bruce Mefferi given! a few doses of White's Cream L --I __ ,".
C- 93;Ii :l 2i p Lv.... .....-...Sf'W SIIyrr.a......_....... L1' 05 a..
of exhibits and enthuse individual charted Bryan of Texas and John Ju- Vermifuge the children's tonic. It I 1000 p! 251p .. ....._.........wok HI.:! ...____. 2'01"1' 39& .,
producers to compete for the large prl tee han will stimulate fOnd facilitate the dlges- [ "I: 10 u vi' 3 au p Ar ... ._......_"TltdSVIlle_..._..?_. : 00 a
o (111
offered also. Thousands of home I lion of their food so that they soon become I I goo al........._ Ar..........?.._. ?S.in"r ..._.............L' 10 oolIO 00 2

seeker" from other states will be in attendance ; NORMAL INSTITUTEAT strong, healthy and active. Sold I j a.fI}. --1---' a Lv........ ........;Sanrr ................_ Ar _.__ 9 00 a _.

e\ ry effort will be made to i Do You Want To i HAWTHORNE by all druggists. v 1039p laoplLv .... ....,.... T.f.,..srl11e ....... L, -l lip 100 -1.
?? ?
get them to visit the counties that Interest I U 1114p 409p II ..... ....?__.....U;..w_..._...?_ .. 123p 2195 M 7.
]122p II .....\.. .. .
415p &rklwlXn: _.._......_. 1230p 214&1153p
them and no counties should go Sell Rent Term begins July 10 and continues JOB PRINTING 445I. ........ ...__F.al1jal__..__ ._ 1158& IUS _
without representation in or Buya I l t.c 1205 ai 4 54 P' _. ..") !plb"urM__ ...._ II .11 4fa! 134 =
the departments eight weeks.: Good, accommodations at If you need job printing of any kind C 12 51 al 5 37 p' II ..._.....?.-.-.ooslian. _? II 1104 3,12, 51 a
of exhibition. reasonable rates. For further particu- from a card to a book, send your or-I '.- 13"a6"I ".."I" II ..?.....??.?.e t. L'It.I'A....?-....- I012&'laOO' fA '
House Store der to the Star office. We have $2000 Co 1 65 a 6 UI'I _?..........J..rt )'j'>rce_..__ 10 (6 a 11 N
lars address J. X. Overhultz, Keuka C,) 218& 'j ('8p, ." _..._......_Tlbl.aI5_._ __. ". 9 30 all' 22P '0
E. C. McLeod of Kendrick was the : .+r Fla. worth of the finest job stock-paper. I eJ 2 23 a.', '112 p.: ...-.......__fjl"' ........."....__ II & p
center of Lot Farm? envelopes, cards cardboard, etc.-that 2 2i! a'; 111 p ...._...__J..nhf'&__ II :p a
a group of cantaloupe an1 or ( 239& .. _. .... .. ? : jl&lll.
1 has ever been carried by an office In en 72p .. ?- -Staact......-.- OIl Of ::I
melon I :3 I 0'1 aj 7 56 ... 110
growers yesterday afternoon, CURES OLD SORES PI l ? ? ? lIotJ6 Round.._. II 8 U Ai 36
this section. .N :3 27 A' 814 P: ?_. ....W""t luJ.it..r.h._ 8 21& 1019 De
and "Mack" was cheering up the de Do You Want to We have recently put in a lot of the I 41 t Clt a! 8 61 pi ..., _?__W'tst; Palm )tea.h_..._ 01 1 U a 'IS p 4 a
spondent. He 4 3"a'' 918" .L'-.toD. ......... 01 '120& 18p 'I
In was giving his experience NEW SCENT CIGARS Westmoreland Kans, May 25, 1902: I newest and prettiest faces of type and w:: Ua.I. 928 p! ::.-.- :::::._ llf'lrny_.::?__._- ''J 10 A t 08 P __
growing me.ons a year ago, and w Ballard Snow Liniment Co.-Your some improved machinery.We I 637&,1021 p; ............_H.L.ad 1al8-. __. r 618 a 811 P .
now satisfied to stick to corn oats, Insure Life Snow Liniment have the best job printers and 15 46 a.lt', 30 P, :: ..............-...- ia..a: -..._.-?-?.- 6 10 106 .
cured an old sore on 558 a,10' U I' ...?.........._I1"I..d h--._ : 168: 164 _
peas plndars etc., for his net I pressmen in the country. .. ....... ,
returns the side of my chin that was supposedto 624aill7p L.n'.utitr...__._ I U& 729p
for the finest car that went out of hU Havana actorino s Limb Property? be a canc'!;. The sore was stub- Our prices are right 6 3i au: ; is p!Ar ...._. ....._._ j..ml_.._.?._. L'i l 1 25 a T 209
field or Send your order. If there Is any-
was $!.40. Speaking of his neighbor born and woull not yield to treatment Dally D ally

Holstein who grew and bought Ana- until I tried Snow Liniment which did 60. 'I' HOMESTEAD EXTENSION .
DISMISSED IN DISGRACE S
THEN LOSE NO I as.
on speculation said Mr. H. thought he the work in short order. Mr. sister 6
had a bushel of ---- -1-!..._''L1' ....- ........._}ylaml _.__. Ar -
money on a car he La Monage TIME IX SEEING Mrs. Sophia J. Carson Allensville Mif- President Roosevelt has dismissed 1| 8 00 a'.........:..U' -_ .-._.IS..IaPHt91L? .___. Lr II 100 Up
bought
at Martin, .I
paying for the same: fin county Pa., has a sore and< mis- '
I
J from the diplomatic -r\ice Herbert< "'
165. Mr. Holstein received returns t trusts that it '*. a cancer. Please send Ns. 23'NO.21 No 19 ND. 17 No. 1J''
his I Bowen for some years minister to Ventzueld i ep 10 Na. >x'Ia...
same day Mr. McLeod disclosed h AT TAYLOR'S DITTO & MALONEY I! her a 50c. bottv. Sod! by all druggists. E35un DiUy SundaySundrlSunday Daily MAYPORT BRAN CH. ,,N.. 18SuMaTSaal4>j laity
.
declaring that his condoha: |i Only i Onl1 i Only h San.
12.40 .
check, each on opposite sidesthe of ., -'-- i 04i1y. 0&h. I 0." IIIia

postoffice and when Mr. H. showedup -- -- -- !I GRAHAMVILLE breu reprehensible I I 00 I' I 45 p'' 2 00 P 930 a 9 00 a Lv ....._.7arkwnvllle..._ J.r'-1--1 8 30 au 3 00 D 144 I
I
/ 4 OS p 66)P 2 (08 9 3b a i Oii ..... ... U.
the P a Ar .5 J. JI. :: '.n\"iUe...... L,. II 2'h U
U rr
expectant look of i a I 6 IT
great profitsthat > BEAUTIFUL MILLINERY I 40 P 1 24 P 2 'u P 1010 s. 11 37 a II ..._.J<""I,, Vo-ar.h..._ '150 p p
lighted his animated Perfection READ 'Up ''J2'Jp 245p101 a 144a ...... .. 'I a Jl 20 a: 5 01 P i Sip
THIS
('ountenance.changed Canopies Mrs i ; .AtldllicD..ach.. .._ OZtS&llU&11r.
t Brand 430
Mary is .. ;
now making TOrp 745p SOOplOSOalOOOa ........ p
to that I II '" !fan"'ct.......... T30a11o0& 445 'Up
one resembled the j h-r hunir with her father. I

result of a long term of dengue I Messrs. Arv-1 l Dothan, Ala., July IS, 1899. j .
an.ldt'l. Marsh an<1rifsloi PEMNSIIAR AND
fever. Ben I OCCIDENTAL STEAMSHIP[ CONJiECTIONS AT lUlL(
Raysor chimed in anl Goolsby were the guests of Oli Dr. E. W. Hall St Louis Mo.-Dear I

showed returns on 100 crates of cantaloupes i ;nrr .ana Thomas Johnson last Sunday. Sir; : We have been selling your Texas

he sold tor 100. The fruit arrived M'! ,'. E. M-:son is now working at'Wonder. Hall's Great Discovery for I Close Connection Made .Miami'\ with Steamships of tie P. 4 0. S. S. CotaligP"Pet

with eighteen crates badly broke Si'wr: Springs in a blacksmith shop. two: years and recommend it to anyonesuffering i 1.
up and the buyer refused to receive '; I( HAVANA AND KEY WEST.
/sfJ H- was at home to.i it his mother with any kidney trouble as ,I|

them. Mr. Raysor had them sold on 1-3 i: MM i unda-. being the best remedy we ever sold.

account and received a check for $1.35 1 I Mists Ida and Emma Hogan called Yours truly J. R. Young.A I from These Time Tables show the times as wII.h train! may beexpected to UTlrefttt&d trait
And thus the story ris.. It is I"II the several etati'.ns, but their arrival or d-parthre at the
very ivident I I Mr*. Gibson last Sunday evening. fur la tlOj Company to be heM times stated U not cua.ru1e 4
res.U tie for
any delays or any<1D6quencee&rt6 Ui *ttMfc
that the season 3 IC
on cantaloupes + i I Mr Henry Hogan:: is shoving the logging TEXAS WONDEROne \
has not been a jrofitable one to the business -1
t to a finish. For
small bottle of the Texas Wonder Copy of the LOCAL TIME CARD .
or Other Information
growers. One + 4 t!
a arty remarked that r Mrs Susie Williams' little labgirl !i -
Hall's Great Discovery, cures alii "SEE -
THE
only three
of ih TICKET
-
Anthony growers is a perfect little "peach." but it is a Kidney! and Bladder troublES removesGravel AGENT. \;

came names out are ahea held sacred.of the game. Thoir. .t& T PACKACE; I for her that it wash't a "pea-" : !, cures Diabetes. Seminal Emissions J. D. RAHNER, A* t. Oen'I Pwa. Agt.. ST. AUGUSTINE, FUU, ;:

Lily. Weak and Lame Backs Rheumatism -

:. The best on earth for either iron or and all irregularities of theidneys Schedule on May port Branch and Homestead Extension Florida East Coast
Will Bleach, the tonsorial J K and Bladder in both and
artist hor- men
wood beds or children's cribs. Most All new and right up with the BRADFORD COUNTY WENT DRYMessing Rail wIYEffecth.e
tlculturallst and trucker women. Regulates bladder troubles in
he
says played
durable sanitary and time saving. We season. :Many beautiful trimmed Tune 3. 1&05. the sche.Jule.
even on his tomato and children. If not sold by your druggist figures for the Mayport Branch and
crop gave are headquarters for everything In hats PATTERN HATS and the sitarke, July :21.-In the wet and dry will be Homestead Extension shown in
the surplus to the man who made the sent by mail on receipt of $1.One now time-table No. 52, will be changed additional jf
crop. His seed which was beds of bed fittings, from the canopy FAMOUS: GAGE HATS. A election in this county yesterday the small bottle is two months' treatment trains being put into service between Jacksonville and Mayport. and

straight, produced five varieties.guaranteed Mr. to the springs. Our prices are always complete stock of Trimmings, dry side won by at least three hundred and seldom fails to perfect a cureDr. the service between Miami and Homestead being reduced to one train a day

right majority. Starke precinct gives three E. W. Hall, sole manufacturer. P. each Miami 8
way leaving
and
Bl sch Is not discouraged and Is clearing Flowers, Ribbons, etc. a. In., returning leave Homestead 1 p. m,, arriving
dry majority and Hampton gives O. Bob 629.: SL Louis. Mo. Send for '
Miami 2:30
For .
p. m. correct schedule
land for see any agent of the f- E. C.
a next
crop season. McIVER &
MacKAY MRS. MINNIE A. BOSTICK eighty dry majority.. i testimonials.( Sold all
y ii i by druggists fly. or for pocket timecard address J. D. Rahner A. G. P. A. .




t

a. .-' t- .. ..- .



..
< '
-

..
; : ,. -,'






., '--. ,.-,.". '
-

OCALA EVENING STARi .


"I .-, ,.\


-

-

.


i Volume H, Number 9 OCALA, FLORIDA, WEDNESDAY, JUNE 2 *, J905 Fifty Cents a Month, $5 a Yea



_.. .
-- -- - ----- -- --- --- -
-- -- -------- - -- ---- -
----
---- -
-


JIIST1IE iIVEIFresh I TO BOND OR NOT TO BONDThe ODDS AND ENDS I RECEIVED A RESPITEMrs. I EDWARDS BROTHERS




Architect Who Drew the Plans Rogers the Vermont Murderess, AT THE CITY MARKET

Fancy Crackers for the New Courthouse Gives good Will Not be Hung Next

Reasons in the Affirmative Friday Wholesale & Retail Butchers

In Bulk.ALSO I Windsor, Vt., June :Forty-eight Leading
I Editor Star: I have with pleasure and OF SHOES.We I ,
I I| hours before the time set for her execution -
displeasure read the different opinions '
Mrs. Mary M. Rogers noun-
WESTEEN AM CHOICE PLOHIDA MEATS
!voiced through the Ocala papers referring -
der sentence of death in the state prison i !
to the "Bond or Not to Bond"issue
Butter Thins Cheese Biscuit Na-
here for the murder of her husbanl
now before the voters of your CELERY AND ALL OTHER VEGETABLES IN SEASON.
biscos and Wafers
Champagne will be taken to the local court houseon I
county, and I feel an irresistible desire
in Packages. a writ of habeas corpus institutedby I FREE DELIVERY TELEPHONE 103
to rush in.I .
I are Cleaning Up this Week a Lot her attorneys and granted late last I
i am not a taxpayer nor a citizen of ,
night at Brattleboro by Judge Wheeler I
i your county, ant my venture might be I
of $1.50 J $2 and $2.50 Shoes of the United States circuit court. Her
ROYAL MINT SAUCEFRANCOAMERICAN
I termed somewhat audacious, but I have I !
attorneys said should Judge Wheel 3r JUST RECEIVED
SOUPS i been chosen by your county board ad
For Ladies. deny any relief an appeal will be tak-
AND GAME PATES the architect of the court house, the
en to the United States supreme court.
cause of this controversy, and as wh
Such an appeal will have to be allowed -
can explain an:! answer questions put 72 Three-piece brown half lined Suits made fcy
,
,
by the circuit court pending which

Sea our Line of Canned@ MeatsAnd ers by ,the therefore dubious this more article.readily than oth- AT eo CENTSTHE further delay in the execution will be the famous G- Marks & Company, merchant tailors !-

I The salient joints of this! argumentseem neee8 al r. New York. Made up to retail for $S 7. Our

to be "the farmer" and "contractnot
Don't Fail to Register a Vote for
Your let to the lowest bidder." THREE PHYSICIANS TREATEDHIM price
Favorite on Every Ten-Cent
Some few weeks ago a letter was WITHOUT SUCCESS
Purchase. W. J. CHAMBERS SHOE GO
written by a citizen of Ocala to some

contractors here in Jacksonville, who W. L. Yancey, Paducah, Ky., writes: .

AT THE TEAPOT GROCERY1DERTAEER bid on your court house, asking why "I had a severe case of kidney disease $9.98

to their knowledge, the job was not THE ONE PRICE HOUSE. and three of the best physicians in
I
given to them, they being lower than Kentucky treated me without success.I .
-- -- ---- -
--
--
the Ocala firm. It also stated rumor then took Foley's Kidney Cure. The

I had it that the architect wishing to meat and construction, and feeling that LOW RATES TO BALTIMOREAnd first bottle gave immediate relief and We invite our customers to [inspect these suits

favor them, hi1 allowed said builders he has helped build it is worth the three bottles cured me permanently.I .

-AND- Ito Figure on cheaper material and less money and from a point of culture and Return Via the Atlantic CoastLine gladly recommend this wonderful before they are picked over.

expensive construction. That this' Is a education is worth considerable more. remedy" Sold by the Postoffice Drugstore -

EMBALMERSWe foolish statement given without Why, if I had not that much pride, .
On account of the United Society THE BOSTON STORE.
thought, is obvious, owing to the fart if I had not that much faith in the future -

that all grades and kinds of material development and welfare of the Christian Endeavor International Convention LOWELL

have two Registered Undertakers -,required in the construction of this country. in which I lived to warrant the July 5-10. 1903;, the Atlantic I

I building is clearly specified in the specifications extra expenditure of a few dollars i Coast Line will sell ticket from pointsin Cantaloupe slipping! is a thing of the
and Embalmers Florida to :Ealtimore and return :at I
and shown the draw-
so on would vote against the proposition butI past.We

All work entrusted to our I ings. Such practice might be resortedto would also feel ashamed of the place very low rates. Tickets will be sold have been having some very hard IFYOTJIO)
July 1, 2, 3 and 4 via all rail, or via
with a cheap set of drawings and sell out and go to a country that had rains the past week.J. .
care will receive prompt and specifications, where the time and trouble brighter prospects. Xorfolk and Chesapeake Bay, and June M. Meffert moved his family from

skilled attention. All embalming has not been taken to dot down ev- Furthermore if I had children and 30 via Savannah and }I. & M. T. Co., Ot-ala Friday. As this is their old

erything in plain language and by thought they did not have enough for steamer sailing from Savannah home everyone is pleased to have them MUCH WRITING I
fully guaranteed. A July 1. Final limit of tickets will be
of drawn detail. Thereis return.
means carefully brain and brawn to wipe off the $17-

splendid stock of Caskets and a complete set of plans in the hands 000 in later years I'd disown them. July 13:, but extension of limit can Le Miss Edna Livingston returned home

,I z of your county clerk open for exhibi- II. J. Klutho. obtained to August 31. Stop-overs will Thursday, after a two weeks' stay with You will surely find that it will pay to get a good

Burial Robes carried at all i be allowed at Washington, going or her cousin in St. Augustine.Mrs. .
tion to whosoever cares lo examine fountain It the
is most convenient Instrument
pen. writing
returning, or both, within final limit
times.OCALAFORNITOREGO them These plans and specifications SPRAINED ANKLE, STIFF NECK, : Kopman, who is with her daughter. ,
were made before the different buildersgot LAME SHOULDER of ticket, but in no case to exceed ten Mrs. Richie continues very ill. ever invented, to say nothing of its superiority

-1 them to make out their bids cons-- days. I T. J. Gladney. who has been visiting I
L quently they all figured on the same These are three common ailments for For rates reservations or any information Gainesville and :Micanopy, returned on ty ordinary pens in point of neatness. We, have

which Chamberlain's Pain Balm is especially see nearest ticket agent or Friday.Mrs. first rate line of the best makes of fountain
stuff, according to the same specifications I a pens,
valuable. It promptly applied, communicate with T. C. White, D. P, I
Phone No. 10. Night phone No. 94. the same plans, and under exactly J. M. Rhea and son. Troy, will
the same conditions.One it will save you time money and suf- A., Tampa, Fia. ,leave shortly for Alabama. I which we are selling at very reasonable prices. We

of the main reasons for giving fering when troubled with any of these Miss Emma Pardee of Micanopy is have also an extensive and choice assortment of Simmons

For he home firm the ailments. For sale by the Postoffice THE SALVE THAT PENETRATES visiting relatives here. I
court house is as
watch chains that would like to
Drugstore.B.
WATCHESAnd ollows: Experience has taught that its The infant daughter of Mr. and Mrs. we you see.

YEIHe not always wise to accept the lowest DeWitt's Witch Hazel Salve pene- Horace Wells died Sunday afternoon j These chains which are in both men's and women's
P. 0. E. GRAND LODGE
trates the of skin
the and by its
bid, especially when it can be demonstrated pores and was buried at Millwood cemetery i
REPAIRS that the lowest bid comes i' antiseptic, rubifocient and healing in- Monday. The bereaved parents have i I styles are the most strongly guaranteed goods we
The Seaboard Air Line Railway has tluence it subdues inflammation and
ear being below cost. our deepest sympathy.W. handle
I
P" GO TO been designated by the Florida Elks'Association cures Boils Burns Cuts, Eczema, Tet- .
The bid given by the Jacksonville II. Livingston and family of Kendrick I
as their official route from ter, Ring Worm and all skin diseases.A .
firm is actually below cost. This is according visited the family of P. B. Livingston -
F.O. B.WEI HE Florida to the Grand Lodge session at specific for blind, bleeding and itch- .
to figures, and it betaken Sunday.W.
my may i
Buffalo. It is the desire to operate a ing and protruding Piles. The originaland A. E. BURNETT
The Jeweler. for granted that the: architect :M. Shoi-kley, our canning factory i
Florida Elks special train to leave genuine Witch Hazel Salve is
who has planned and specified every man. has hands very busy picking and
-- ----- Tampa at 8 m., July 8, and Jacksonville
p. made by; E. C. DeWitt & Co., and sold
detail of this structure, knows.In '!. hauling tomatoes to his factory at Red-
at 9 a. m July 9. by the Anti-Monopoly Drugstore.A .
order to illustrate this I will quote dick.
MEN ONLY Round trip rates to Buffalo from I '
the experience of the board of public Wonder what's the matter with Ankle -
Tampa, $39.10; Orlando. $37.10; Ocali, BARGAIN IN LUMBERWe W. P EDWARDSAt
works of Jacksonville in letting the Express. He hasn't been seen in
$35.85; Gainesville, $34.95.For ,
Art Requested Not to Read This, As It city hall contract to the lowest bidder this place lately. Blackeyes.
sleeper reservations or other have a large quantity of second
against advice. I. being the architect the City Market
is 'Intended for the Ladies my information write to S. C. Boylston Jr., hand lumber of all kinds which we will
1 pointed out to the board that the JUST WHAT EVERYONE
Pass. Agt., or A. O. MacDonell, Asst. sell cheap and on terms to suit cus-
[Whose attention we Invite to our peculiar bid in question was below cost and Pass. Agt. Jacksonville, Fla. tomer. Ditto & Maloney. SHOULD DO Fresh Meat, Poultry, Fish and Vegetablesin

adaptability to progressive that undoubtedly trouble would folio\ :Mr. J. T. Barber o.f Irwinville Ga.,
cabinet-making, and trust they will allow Season
if accepted; because. no matter how always keeps a bottle of Chamberlain'sColic
us to furnish estimates on any -----
thing In needed In their conscientious a builder may be thereis Cholera and Diarrhoea Remedyat
carpentry -
homes. always a tendency to slight the hand ready for instant use. Attacks City I and Country Trade Solicited

:work if he finds he is the Toser in the of colic, cholera morbus and diar .
Nothing too small for us; nothing too I !
large. proposition. .\ builder is more "busi- rhoea come on so suddenly that there j FREE DELIVERY PHONE 121

Our Art Noveau ness than profession" after 'nil, and is I is no time to hunt a doctor or go to the --

in it to make. not to lose. If this can- Turpentine Operators I store for medicine. Mr. Barber says:
Combination Chests and Settees
are
not be: done he often throws up the have tried Chamberlain's Colic,
becoming universal favorites In Ocala; ,
low in price, but high In efficient use- job. The result was that this particular 1"1 and Diarrhoea Remedy which NEW SEASIDE INN.

fulness. A postal will bring us. party took "French 1t"3vetwo one of the best medicines I ever

months before the building was completed I I bottle of it in ,
ATTENTION saw. keep a my room
J. McNEALY &. CO., Hotel and Pleasute Resort
left mixed Leading on
everything badly up as I have had several attacks of colic

"The Ones That Don't Waif' and it cost the board considerably more and it has proved to be the best medicine the East Coast ot Florida.

No. 1E, Fort King Avenue. than the original figure to finish the I ever used Sold by the Post-

building to say nothing of the trouble office Drugstore.

and worry encountered. So much for EVERYTHING MODERN.Homelike

MdlVER & M&GKAY this; I could state other cases. The Standard Naval Stores Company of Jacksonville, GRINER FARM .
The bid submitted by Messrs. Mclver and Comfortable.

& MacKay is just and proper and I Is Florida, is now prepared to contract with independent Master Charlie Murphy had the misfortune Hotel Directly on the Atlantic Beach. .

based on a profit of about 8 j her cent., Surf Bathing and Sea Fishing Unsurpassed.
nail last
FUNERAL DIRECTORS to stick a in his foot
provided everything is smooth sailing. producers and will pay flat Savannah prices for Ros- week. It was very painful for a few Thirty Steps from Big Pavilion and Great Ocean Pier

UNDERTAKERSand otherwise it is less. A builder's commission :i days but we are glad to note he I is Sea Foods a Specialty.

is generally figured at 10 per in and Spirits Turpentine delivered at either Jackson- able to be out again. SPECIAL BY THE WEEK

_ cent. Of all the bids submitted. I candidly I The new organ for the Sunday: school $2 PER DAY.

EMBALMERS feel that the above firm will give ville or Fernandina. Free of storage, insurance or com- I' was received: last Friday. Everyone is Address HORACE F. STEWART.
you the best'! building. They are home pleased with it. I

people and naturally feel a pride in the mission charges. We are also prepared to make liberal I Mrs. B. H. Leitner and: son. Charles. I j GOODALL, FLORIDA.
Fine !
as eta building. They are financially able, visited Ocala Sunday afternoon. i --- .-- ---- -.--
I II
and of what I have heard and seen of advances. Investigate our methods of shipping in tank I Quite a crowd of the young people

and Burial RobesAll the gentlemen they are also quite ca I of this place attended the picnic ut.

r pable. They j-re on the spot, and I cars-it will save you lots of money. For further information s t Silver Springs" Saturday.

Work Done by Licensed Embalmers have no doubt that if. after the building Misses Xeta Scarborough and Gertie

and Fully Guaranteed is finished, little defects show up apply toSTANDARD I Jones of Oak were the guests of Missi
they will be readily: remedied. r
i Willie Murphy and: sister Friday night
Furthermore owing to the fact that I Frank Williamson is working fur H.

W.C. BULL I building material has gone up considerably I I Jones at Oak.

since your court house bids were NAVALJacksonville STORES CO. Mr. Charles Brown was calling on his (

Contractor and .i made you will never get such lowbidagain. | brother at Anthony Sunday.
--
) .
I)rIIan' gone up i>(' a The literary society was unable tf

BuilderI.....h I thousand: laborers' work. one hour less Fla. meet Saturday evening on account of

a day at the same pay cement plaster rain.
Quick and careful estimates made.
and other material has also advancedin -- --- We are to say that Miss Ines
sorry
Box 64, Ocala, Fla. F Sick LiversA
price and there is no reason t:) Chnlker is still on the sick list. She or

think they will come down again. \ is spending this week at Anthony so

!I Now. as to the other point of the argument as to be able to seethe doctor every ,
THE
PURE, MILK : If as the Star asserts, one-! BAZAAR'SBIG I day. Her many friends hope to see A VEGETABLE

third of the taxes are paid by the rail- her well again soon. I II J
roads. I infer that another onethirlis COMPOUND
I There was a certain boy who did not
Pure Milk and Cream
paid by the city of Ocala which
j mean to get left Sunday afternoon.
are among the greatestof leaves but one-third to be paid by: the HALF PRICE I IJ I i Mr. Henry rhalker spent several'lays CONSTIPATION. DYSPEP.
farmers. Therefore CURES SIA, MALARIA. CHILLS and
according to my QUICKLY
of last week with his father Mr.W. .
table delicacies. They of figuring, the farmers of Marioncounty ALL LIVER COMPLAINTS.A
way i P. Chalker. of this place.
GUARANTEED CURE for all diseases: produced: by
both and have to pay taxes on JlT.tfurt SHIRT WAIST SUIT SALE; Luffman carried wagonload
are RICH PURE t George a TORPID LIVER and IMPURE BLOOD. One tcrJe! pur-
And for this
trifle what do
they <>t fine watermelons to Ocala Friday. save a sick spell tomorrow:
WHOLESOME if suppliedby get? I L chased today may you

A building in which to securely store 100 Ladies' Suits just arrived lot this Sale. i I THAT TIRED FEELING

their records; a building of which they, The Suits i I i iI CURED OF CHILLS AND FEVER AFTER
are made from Pink Linen, White ---- I
need not be ashamed suitable, ALL OTHER MEDICINES FAILED
: a aweinspiring -
THE HERMITAGE
DAIRY Lawn Brown Linen Madras and If ycu are H igui'', depressed, inca- ;
and roomy place to hold their Organdie. I pable for work, it indicates that your Mrs W. A. Whitewell, Emory, Tex.,

1' GEO. B. TYLER Proprietor. court and a sanitary and healthy Made to sell from $2.50 to $J 0.00. Our liver is out of order. Herbine will assist writes: "My child had chills and fever of

structure to house their county offi- Price i for four years. We tried all .kindi
this Sale
in
nature to throw off headaches acquaintance of
medicines, and finally an
cials.. Do value
they not get more than -
.L.ALEXANDERPractical received I rheumatism and ailments akin to ner- mine recommended Herbine. We used
vAusr.ess:: : and restore the energies and three bottles and the child is now com-
The very fact that a farmer, driving':; I I vitality: ; of sound and perfect health. jjeUlcured.. You hare my permissionto

in town from the country, dusty and $L25 TO $3.Se|I J J. Hubbard, Temple. Texas, writes: publish this testimonial, as I cheer-
I fatigued can rest himself in the shadow fully recommend Herbine to all mothers
:CARPENTER AND BUILDER "I h.ive used Kerbine for the past twoLrtrs. "
of the massive columns and wide having children aflicted ai mine.
: It has dene me more good than
'Careful estimates made on all contract porticoes and feel that he is at home, I! BOTTLE 50c (GET THE GEMJUttB&LURD '
Per Suit. Call and examine for'yourself.: il!! the doctors. It is the best medicine UIGE
Z work. Gives more and better work i that he has as much right there asanyone <.ver made for chills and fever." 50C. SHOW LINIMENT CO.

for the money than any other In town. else, should repay him for the Sold by all druggists.The .
outlay of a few dollars' taxes every FRANK P. GADSON. 'I' ; ST. LOUIS, U. S. A. -

fOiEYSKJDNEYCUMw \year. The pride alone of pointing to a 0I
3 finest and most complete stockof i
beautifully constructed building, designed I perfumes toilet soaps and cosmetics ?

w Kidneys lid Bladder Right' I along modern lines of improve- j l THE OCALA BAZAAR. i in thi ,-tty at Tydings and Company. I SOLD AND RECOMMENDED BY ALL DRUGGIS'lS.$. ":',




:_ .

,. ,. -, ,
-

..eo

....



.

.
.


-

EVENING STAR WEDNESDAY JUNE 21 1905 .
\ PAGE THREE .

-"



I '. FOR THE NEXT WEATHER FORECAST m 1 I Rij & (lIAmllBANKERS) 7rI LOCAL LEGISLATIONThe

Washington, June 21.-Partly cloudy city council held a regular meet- COMMERCIAL BANK I Possibly you are now doing

tonight; Thursday, showers.ST. ing last night. Present: Chairman
Gates and Councilmen Rober- business at this bank.

FIFTEEN DAYS PHILLIPS, CATHOLIC CHURCHI sun, Weathers Ford and Chace. OCALA, FLA.
If
Very little business was transactei Branch so, very good. If not,
Commercial
Bank, Jacksonville j
Tomorrow Is the feast of Corpus outside of the regular routine work. I wouldn't it be well for you
Christi, the body of Christ. It is a different
The reports of the officers HY ROBINSON President
Ocala Florida I -
We Will Close Out Our Line of Ladies' "Justine" Waists feast which lasts eight days. The I were reported correct by the different It o start an account with: ,.us.

Catholics are invited to attend the sol- committees.The S. H. BLITCH, Manager, "

err.n service every day at 7 a. m. Next LOANS. DEPOSITS. city board of health voucherswere J. C. BOOZER, Assistant Manager With abundant capital, and

Sunday high mass, with special instruction examined and found correct. t

AT COST. followed by the benedictionof CONSERVATISM. ACCOMMODATION. Fire Chief Brigance asked for leaveof CAPITAL, $100,000 with the best of fae>'itieswe

the most blessed sacrament will be absence during the month of July.
are prepared to give
celebrated at 10:30: a. m. At 5 p. m. I Referred to the fire committee.A Surplus and Undivided Profits, $37,. you

vespers and devotion of the sacred 885.37 superior service.

Come Early and Get a Bargain. : heart of Jesus THE BUSIEST BALLOT TEA DEMONSTRATIONOn


Mr. R. R. Carroll returned to Okla-' BOX IN TOWN IS AT Thursday afternoon. June :22! wa:

waha this afterroon. Mr. Sylvesterand will give a Tea Party for the ladies, r

Miss Leafy Sylvester, Mrs. Carroll and would like to have and
you your
HELVENSTON PASTEUR COMPANY, and little 11 :-is and Miss Florence T W TROXLER'S friends come. We think our tea is the BEAUTIFUL NEW SONG

Walters are pleasantly located in th? best: on the market and want :you to

Valkman house, which is comfortable sample it. We will make it to suit you
-- -
--
Here is where can cast a
you
and roomy. Miss Margaret Walters and will follow instructions.
i. half vote with drink of soda. your
OCALA OCCURRENCES If you want coupons to vote In the and Miss Sara Whitfield will go down The little votes count a because there Glencian: Estate extra quality Ceylon, "BACK AMONG THE

library contest, take the Star renew Friday and others will go down Sun- Golden Beauty Ceylon. London Warehouse -
are so of them. They
more
your subscription and pay up your day. Mrs. J. G. Spurlin and family are many Standard, Extra Choice London
CLOVER THE
ice at Taylor's.We come with greater frequency and AND BEES"By
Refreshing cream ,
back bill. nicely located in close and -- -
Money paid here Tor advertisements < a cottage by. Dock, English Breakfast Moyune Gunpowder -
soon multiply into the thousands.
job work or subscriptionscalls M rs. D. E. Mriver and family will go and Royal Crest of
are some
will not be undersold for cash. Get busy and vote here for your
for coupons. down to a few days and occupy another our leaders. You
are cordially invited.
The Fair. % favorite in the great the Author of "Where the Silvery ColoradoWends
cottage. The bathing is fine, very few Other goods will be sampled. O. K.

A full line of cigars and tobacco. Ty- Yesterday morning a melon grower mosquitoes and the fish are biting, Tho Grocery, Clark Bros.! Its Way," and "The Girl I Loved Out in the
refused $50 a car for ten cars of wa not in dangerous numbers. LIBRARY CONTEST.
dinjs & Co. Golden West."
termelons. He may have been wise! We are glad to say that at last we

At Rhainauer's, Hammocks from but time will tell .the story. Rev. J. P. Hilburn, who has been vis- Seats for all voters and a coun- I have gotten through overhauling our

11.50 to $15. iting his family for a few days, returned cil room for you to devise your store, and are now in better shape A Picture Free With Each Copy.
At Rheinauer's the Latest Styles of line of battle. Don't
go away than ever to show
to Jacksonville to attend to the duties our goods..TheOcala

Mr. J. F. Taylor of Tampa is at the Ladies' Low Shoes, made by Utz &. of presiding elder of that district. News Company.
Dunn and Wiekart &. Gardiner. Without Voting for Your
Ocala: House. Rev. Hilburn trill attend the great International l -

Epworth League meeting, Favorite at: Combs, brushes, sponges, and all oth- OCALA MUSIC CO1
The purest and finest toilet soaps a
July 4th will be the biggest day of large stock of the best goods always to begin at Denver July 3. He has I er toilet articles. Tydings and Com-

been honored by being elected a trust- I pany. .
the year in Ocala. on hand. Tydlngs and Company. II I TROXLER'S.WALL
of Emory College, Ga., an excellent selection. .
Mrs. H. Anderson and daughter JEWELERS.
A cooling drink of the most approved I 1 .
Mr. R. J. K. White of Georgia, well
a ------ --- Miss Lillian, have gone to Poughkeepsie -
flavors at Taylor's. known naval stores operator, and a
X. Y., to meet Miss Frances Anderson -
member of the late firm of B. L. Boone DEAFNESS CANNOT BE CURED I PAPER who has been attending Vassar -
4th in Ocala ir. 1905 will lie
July ,
& Co. at Lynne, was in the city today. by local applications, as they cannot College at that place.

long remembered.At reach the diseased portion of the ear. I If you wish w1rk done in the wall pa-I I

LOST-On or about May 1 I left per' line let: us send our man with Miss
Sallie
'
Rheinauer'g, Bathing Suits for I There Is only one way to cure deafness Camp will give the pupil :i-
ples for inspection.
a suit case with brass trimmings In your of her
and that is by constitutional remedies. Sunday school class a meloiparty
ladies, men and boys. i
some hotel or business house in th-i Deafness Is caused by an Inflamed con- DITTO & MALONEY. Thursday evening.Do ..,

city of Ocala. Bring: : a stranger, I failed dition of the mucous lining of the Eustachian -
The Rebekahs will meet tomorrow TEN TIMES EASIERIt
to locate it. Whoever it was left you suffer with asthma
night at Yonge's Hall. Tube. When this tube Is Inflamed or catarrh -
with please notify G. W. Cleveland you have a rumbling sound or ? Then use Adam's Cure. Price,

Fireworks for the Fourth at the chief of police. W. Guthrie imperfect hearing, and when it is entirely is ten times easier to cure coughs, 50c. Satisfaction guaranteed. For I
| croup, whooping cough and all lung VARIETY STORE
sale by Tydings & Co.
Ocala News Company. closed, Deafness is the result, and bronchial affections when the
FOR SALE-At city pound Wednesday -
and unless the inflammation can be taken I .
All honest competitors will be met noon, a cow without mark :Dr out and this tube restored to its bowels are open. Kennedy's Laxative I I I Dr. Christian, proprietor of the Oik
Honey and Tar is the original Laxative
Fair Groceries. brand. I I Hurst farm will please accept the
by The normal condition, hearing will be destroyed -
Cough Syrup. Gently moves the bowels thanks of the editor of the Star fora .id
forever. Nine out of ten
cases I and expels all cold from the
j sys-
Try our creams. They are pure and Miss Nellie Anderson left yesterday are caused by Catarrh, which is noth- j very superior watermelon.
tem. Best for Coughs, Colds
| Croup.
delicious. C. E. Taylor. for Miami to visit her sister, Mrs. J.H. ing but an inflamed condition of the I
Whooping Cough, etc. Remember the
Strunk. for ten days. She was accompanied mucous surfaces. Three kinds of ice cream every day
Dr. Likins is prepared to examine the Ii I name, "Kennedy's, and see that the at Taylor's. i
i j
We
by Laura Jean, Florenceand will give One Hundred Dollars ;
human I II i j red clover blossom and the honey bee
eye scientifically.Mr. Leonard Dozier, who will spend i for any case of Deafness (caused by ca-I j
I j is on the bottle. Sold hy the AntiMonopoly -
the summer with their; parents at Ju t tarrh,) that cannot be cured by Hall's Mrs. H. C. Dozier and little daughter:
C. 1... Futch of Webster was at Drugstore. who have
piter. Catarrh Cure. Send for circulars, free.F. been the guests of Mr. anMrs. --
the Ocala House yesterday.At I I' : ( John l
J. Cheney & Co., Toledo, O. D02ier. have returned to
When in need of anything in fancy I Sold by druggists, 75. Take Hall's Justice Waid held the scales today i fn \their home in Columbia, S. C.

Rhsinauer's, Patent MosquitoNets china, dinner sets, crockery of any kind I j Family Pills for Constipation. i\' the case of Ed Peterson vs. George j II I Sure I

at special low priers. try the Ocala News Co. j Griffin drayman for assault. Peterson I Ladies and lovers of fine tea don't

I was fined $:?.",I) and costs. which he !: 1 forget the tea party at the O. K. Grocery II ?
W. E. Gillis of Spring Park was in I ,
A big stock of fireworks for July 4th Dr. Likins carries the largest line of j I I paid. Both colored. :i tomorrow. I

at the Ocala News Company.We astigmatic and prescription lenses in the city today consulting a doctor i W. L. Griffin was fined $5 and costs i I: Relief for Women.
about a spider bite, which made his !
the state. If you need glasses consult for carrying a pistol witTTout a l license. j i Mr.: and Mrs. Zewadski and party,

handle first class goods only. The him. hand swell very badly. I I j I 1\\ith guests, including Harry Palmer 1 I No. 18 Central Ave.

Fair, A. L. Webb, proprietor. IN MAD CHASE I h and Bruce Meffert. went down to Weir HOT 8PIUIIG6BIt.., April SO, 1903.
Limeade from fresh limes, at Tay- '
Mrs. C. I. Grace: and daughters. Alta ( lor's. I I Millions rush in mad chase after ; Park to spend a day on the shining I Eighteen months ago I was so completely run down
Mr. and Mrs. M. A. Rice of Citra :shores of the lake. that my body ached from bead to foot. My back seemed
and Edna, have returned home after 1 health from one extreme of faddism to to break in two and I suffered intense pain In the lower
were at the Montezuma today.Don't another, when if would abdomen. I could not afford to lay off and take
a week's visit to friends in the country.Mrs. Dr Van Hood I they only eat a rest,
was called to Dunnel- and no medicine .
Grace's health is much improved Ion yesterday, afternoon to the I good food, and keep their bowels regu- II Pumps for irrigating plants complete. friend told meow much any.A Wine of Cardoi built her
forget to include Clover Hill 1 see very I hated with Dr. King's New Life Pills Write or call on us for prices. Marion up and advised me by all means to take it. The day I took
butter in order to the Fair. I !sick' child of Mr. and Mrs. Varn of Hardware Company. the first dose the recovery of my health began. It was
your
FOR RENT-The Howard Munroe that place, but the little one died last I j their troubles would all pass away j nearly three months before I was entirely cured but at
\
relief and I! the end of that time I was in better health than I bad been for seven
residence South for all
on Lime Street, recently I Prompt quick cure I years.
J. K. Christian look
All colors in tissue now j evening. }I of Mclntosh[ came on Wine of Cardui as the
crepe paper vacated by Mr. E. P. Thagard. A'I' l liver and stomach: trouble. 25c. at the j down this most blessed: medicine that a
EC. per roll At the Ocala Bazar. j afternoon and proceeded to woman could possibly take when
handsome ten-room residence with all\ Anti-Monopoly Drugstore. Guarantee
FOR RENT-Desirable cottage be- | Dunnellon to look after his business in- she foils: tick and tired of life.
modern conveniences. Apply to the i UBATOB, WJWS&SDAY CHACTACQDA
"Back Among the Clover and the longing to :Major T. C. Hall, on Eichel- terests at that point. Cm.
Blount Real Estate Company. Mr.[ Fred H. Robertson of Crystal I
Bees," a new song. Ocala Music Co. berger Heights. Apply to E. E. Robinson *3
j River who !
was so seriously injured I
Merchants' block. Terms TORTURE OF A PREACHER
Are you Interested in photography? reasont Tuesday by the falling of a heavy| | WINEoJCARDUIIn
Mr. R. J. Knight of Crystal River able. I I The story of the torture of Rev. O. D.
Do you enjoy the many pleasures weight in the dry kiln of the Oxford 1
was at the Ocala House yesterday.We Moore, pastor of the Baptist church of
come from the use of a little kodak CrateCompany's mills, is resting easy
C. H. Harpersville, N. Y., will interest } Nelson describes the condition
Let us do your developing and printing! Gray an enterprising farmer today, under the influence of an opl- you of thousands of women. That con
are headquarters for fancy box- and merchant of Flemington. with Rev. He i says: "I suffered agonies because dition conies !"y stapes. Usually the important function of menstruation .
for He is the Marion H->
you. We will do it reasonably,, late. at County ;-
paper, tablets, etc. Ocala News Co. I i Prisoc!' was in town today. I !i of a persistent cough, resulting from is at first slightly irregular Then conies the painful period Bearing-down
much less than you have been pay-i]I pital and Dr. P AI. Smith is his physi- \: pains and ovarian inflammation follow. the
Finally
the grip. I had to sleep sitting in nervous system gives way
The Star hears with regret of Hie ing. Give us a trial. J. W. Sylvester,, ..':all. up and the whole system has become affected! and the pains rack the body from
be.. I tried remedies, without!
i 84 Wenona street, or Ocala News Com If in a kind of bilious mood, :1 many head tc foot
serious illness of Mr. D. E. Mclver.
relief, until I tock Dr. King's New
pany. You wish an aid to digest food. The prettiest line oJ picture mould- Wine of Cardui is a menstrual regulator of established reputation. No

"Where the Silvery Colorado Wends No other pill is half so good Ing. Ocala Furniture Co.Mrs. I Discovery for Consumption, Coughsand woman who takes it suffers as Mrs. Nelson suffered. It gives speedy and complete -

Mr. E. M. Dilly of Winston the well 11|I I As DeWitt's( Little Early Risers. Colds, which entirely cured my relief from the torturing meptrual agonies which are making w
Its Way. We hav it. Ocala Music Co.
j cough and saved me from consume many women invalids today. Do not let yourself come to the pitiable
known and popular proprietor of the The famous little pills, Early Risers [ C. X. Schlemmer and brother, j: condition Mrs.[ Nelson describes.} .
tion.
A
for diseased
Mr. E. B. Richardson of Boston W3's Florida broom and handle factory was cure Constipation, Sick Headache, Bil who have been enjoyin gtht'msel'es"pry j I 4 of grand Throat cure and conditions Secure a bottle of Wine of Cardui from your druggist today and
Lungs. At the
a guest of the Ocala House yesterday in town today and made us a pleasantcall. iousness, etc. They never gripe or \ much 'it Cedar Keys for the past i' begin treatment immediately.

I sicken, but impart early rising energy week, will return home Friday. 'I' Anti-Monopoly Drugstore. Price, 50c.
and $1. Guaranteed. Trial bottle free.
At Rheinauer, a Fine Selection of Good for children or adults. Sold by
Have you seen those little alcohol the ASK FOR BALLOTS
Bureau, Saratoga and Steamer Trunk Anti-Monopoly Drugstore.Tom
stoves at the Postoffiee Drugstore. Just When you pay money at the Star office I NOTICE OF ELECTION

"The Girl I Loved Out in the Golden the thing for these hot days and cheap, Smith the hustling hardwareman. don't fail to ask for ballots, so you I

Its Way" We have it. Ocala Music Co. too. Costs you 75c. for the stove and sold two Rock Hill buggies today, can vote for your 'avorite in the freed Resolution

2c. an hour to run it. one to Tom Burgess of Blitchton an library contest.Mr. I Whereas, the facilities of our courthouse J. R. MARTIN & CO.

J. McNealy. the contractor and build. one to J. T. Lancaster of Ocala. I r are insufficient for the accommodation -
I I II .
er, spent Sunday at Holder and Dun- Welch's grape juice always on hand Russell the chicken raiser, was I of our citizens and our public

nt l1on. for family trade at the Postoffiee I Just received at the Ocala News Co., j in town today and reported that his officers, and are inadequate for the .1

Drugstore. a choice lot of fireproof bowls and j late incubated chicks are not doing I protection of the public records of Marion GENERAL LIVERYMENFine

All the craze-Ladies' White Duck earthenware of all kinds. Call and see I well; the weather is too hot. county, therefore be it resolvedby

Hats, at 60c. and 75c. At the Ocala Dr. S. H. Butch and Messrs. Dean.Rrll it. I the board of county commissionersof

Bazar. and Sellers will have their telephone A n 'w line of ladies' umbrellas. Regular Marion county, Florida, in regular _
Carriages Buggies and Traps
line from Blitchton. Berlin. Fellowship i- Mr. W. M. Gray wife, son and MissGray I price $1; our price, 62c.:? At the session assembled at Ocala, Florida, ,
i
Mr. and Mrs. S. excellent Ocala Bazar. this 2nd day of May, A. D. 1905. Drummers Carryalls Saddle Horses etc.
Lovell peo- to Ocala working in a few dayj.Nunnally's sister of Mr. Gray came down ,

ple of Sparr, were In the city shopping from Silver Springs today to do some Section 1. That it is expedient to issue -
today. candies, fresh week, Write to Stanley's Business College, bonds of the said county to the
every Mr. i
!shopping. G. is the sawyer for the
FINE VEHIOLES FAST HORSES
Macon, Ga., for Booklet on Success. It I
by express, and only COco per pound. I big mill at the springs. amount of $50,000, payable in annual _

We are offering some bargains in You don't have to pay for the namein is free. I installments of $5000 each, beginning i

books, novelties, etc., at the Ocala buying these goods, and there is no FURIOUS FIGHTING eleven years from date thereof and Horses and Mules for Sale. Horses
News Co. better candy sold in this market. Sold Mr. E. II. Likowski. who some six ending twenty years from date hereof,

and recommended by the Postoffiee "For seven years" writes Ceo. W. years ago left Ocala and went to the with interest upon all of said bonds / Boarded by the Month at Special Rate.

Miss Fannie Robinson returned home Drugstore.We Hoffman of Harper Wash., "I had a I Indian Territory, where he did well as from date thereof at the rate of 4 percent

today from a visit to friends at Center bitter battle with chronic stomach and l: a contractor tad builder, has gone to per annum, payable annually! J. R. MARTIN & CO.

HilL furnish any style collar you see liver trouble. but at last I won, and ilLos! ,\oge es. California. both interest and principal payable at

in Ocala on our 5c. counter. The Ocala j, cured my diseases by the use of Electric I Ocala, Florida. .
-
-
Bazar. I I Sec. 2. That it is hereby deemed '
This Is kodak weather. We sell ko- Bitters. I unhesitatingly recommend '- !
R. D. FULLER L. F. BLALOCK
daks and kodak things. The Postoffire them to all, and don't intend !n I expedient to issue said bonds In said |

Drugstore. Giles' woodyard has the largest supply >- rhe future to be without them In the I FULLER & BLALOCK amounts for the purpose of erecting a HAItDW ARE

of stove and fireplace wood in the I house. They are certainly a wonderful court house for said county of Marion, 17

Mr. Lee Neeiy, who assists his brother town. Three wagons running. Prompt i medicine to have cured such a bad I DENTAL SURGEONS at Ocala Florida, and it is hereby determined -

J. M. Neely. at Oklawahl.: came up delivery and large loads. case as mine." Sold under guarantee to issue said bonds for said We sell nothing but Hardware and its accompanying lines, but we do sell

today. Miss Delia Fosnot of Wir Pa-k j to do the same for you by the Anti- Offices over Munroe & Chambliss BankOCALA purposes. I that. We bought right, in large quantities, usually in carload, factory shipment -

."amlup today and went on to Belle- I Monopoly Drugstore at 50c. a bottl?. I! FLA. Fee. 3. An election is appointed to I lots, and we are selling at retail more Hardware better and cheaper

Crown Dandruff Cure will keep thescalp view to bend: a ft'days with friend i I Try them today. be held by the legally qualified votersof j Hardware than any house In Central Florida.
clean if used according to direc I I Terms Cash said county on Thursday, the 6th

tions. Made and sold by the PostofficeDrugstore. Taylor-made ice cream every day: at !, Do you wish to purchase a home or i I --- day of July, A. D. 1905, at the several WE ARE THE PEOPLE'S FRIENDS .
Taylor's. are you looking for an investment? If : voting places in Marion county where
I I J/ E. CHACE
so, let tell about ,
us that
you our bargains.DITTO the last general election was held;
i We know what they need; we always have it and sell it at a living profit

-- -- - - & MALONEY. ii i DENTAL SURGEON suck election shall be so held to deter- only. Some of our many specialties are Paints, Sun Proof and DeVoes

Colonel R. F. Rogers the Electtaturpentiner. I! mine by majority of the legally qualified I among them, Oils and Varnishes, Leads, Glass and Putty. Wire and Field

SELF PAYING I was in town today and reports Office Upstairs. Commercial BankBuilding voters of said: county voting at j Fencing of all kinds. Stoves and Ranges, several of tbe best makes. Water
I' such election whether said: bonds !s! ial!
plenty of work.A Ocala, Florida. i Ccolers, Ice Cream Freezers, etc.
be issued by this board, and that the
TERMS, CASH.re j i Give us your business. WE WILL TREAT YOU RIGHT.
I form of ballot shall be: I|
LIFE INSURANCE.C. FEARFUL FATEIt

I "FOR BONDS" T. W. SMITH & CO.
is a fearful rate to nave to endu People troubled with i n d'IgestlOnshould or"AGAINST

the terrible torture of Piles. "I can | try our Raw Oatmeal Biscuit BONDS."

truthfully say," writes Harry Colson, 1; and Whole Wheat Milk Biscuit a pur e. Sec. 4. Notice is hereby given of thee I

. H. REDD1TT, of Masonville. la.: "that for Blind. I i nutritious and digestible product of th holding of an election in Marion county i

Pleeding Itching and Protruding PilBucklen's ea! I whole grain of the \\ hat and rio h mik! Florida on the 6th day of July, A. i LUMBeR0

_ _I- Room No. 5, Gary Building. Arnica Salve is the best cure I with no butter i lard. lOc. D. 1905, pursuant: to the provisions of :

made." Also best for Cuts. Burns and section 3 of this resolution.Sec. .

Injuries. 25c. at the Anti-Monopoly i 5.; That this resolution be published !

__ DISTRICT MANAGER : FOR Drugstore.Mr. O. K.CROCERV. once a week for a period of thirty DRESSED

I j days in the several newspapers published -

J. W. Crosby is in town from .1 I in Marion county Florida. !

FIDELITY' MUTUAL Auburndale to see his fine new son for : j (Signed)-H. W. Long, Chairman; i See or Phone
L Un'N,11SlPAICE: [ m
the first time. Mr. Crosby was laid up !' N. A. Fort C. W. Turner, S R. Pyles.I t .
I
I B. H. SEYMOUR
i with an acute attack of rheumatismand l CLARK BROS.: Proprietors: i Jno. L. Edwards, County Commission- .

\ had to go to Green Springs. The! .ers.i .

__ PHILADELPHIA, PA. waters of the springs cured him. Phone 174 Attest S T SIstrunk, Clerk. i PHONE NO. 25. ; Ocala, Fla.OCALA .



Full Text

PAGE 1

CLEARANCESProp-rietorHARWARLYBAZAARmONTEZUMAGADSONSOCALAANNUALjLHAJIBU-IEVENINGSMITHCOUNTERTHEBANKERSSHIPMANWorksPropertyGOODSPEOPLESFRIENDSMALONEYIUJRSTAR-CWANT200P-ERRoom-35cJardmnieresBEAUTIFULJardinnieresJardinnieresFarm-DoACCOMMODATIONDEPOSITSRoundMILLINERYsuspendersYOUHouseUptodateDITTO4-READCOUPONT-hisInsureCOCONSERVATISMHotelANDCrockeryLIBRARYCOLBUYFLORIDAHaveQStoreGlasswareLimbCookingMustVOTINGTHISYearRentBuyFurnishedLEASEDTinwareTrimmingsi1-rr-rYEARSTOTheLOANSBestConstipation-DontEVENINGWdoing-DEAFNESSMERCHANTS-TheLifeDOTHEAREcjDUNNELLON-ThePATTERNSellSUMMERFIELDpillowchildrenUtensilsJOcsuperabundantcompletePlentyaccommodation-MrJ-Bc3cmoneymakingaccordingly-TheFAMOUSKINDSLotFloridaRoomsRubbercomparativelyAntiMonopolygriefstrickenautomobiles-veryWETaccompanyingcongratulatedsuperintendedappointmentsWeconsequentlydevelopmentsparticipatingDrugstore-Gilesg-ALLrepeatedly-butA-Doharrelswhichheadquarterscreditably-heldresponsibilityenthusiastic-overqualificationsChamberlainsCongressmanlargeSLEIXGSaturday-fromaccompaniedBITTINGERnarrowmindedWONDER-Oneemergenciesirregularitiesbeverages-MrsProprietorsstereopticonPYTHIAS-WeshamsBITTINGERagriculturalrequirementsLivingstonspair-AcantaloupesrespectfullypeculiaritiesMensparticularlyLivingstonLivingstonsIMPENDINCJconstitutionalOcalaChamberlainsSUFFERERSmanufactureradaptabilityfigurativelyincidentallyPresbyteriansympathy-MrrecommendedAnthony-TheexperimentsTimesUnionWantRockefellersEVERYONEiMoulkdemonstratedSTANDLEYCleandelightfullynewspaper-manWantcantaloupesdruggist-willhealthfulnessKendrick-hadrecreation-andconsidera-tionbeautifuladvertisingmanufacturerInflammationobligationsresponsibleJacksonvilleprecautionscommunityPublishers-CHe-reinestedquantities-ofapplicationscomparison19-KNIGHTSCARROLLSummerfieldimpressiveSummerfieldwhiteCon-federacyDrugstore-InLINEthankfulnessJacksonvilleundoubt-edlyBittingerpersimmonRibbonsJulydispositionblackdescriptionRockefellerspromotes-theJacksonvilleseecommunitiestrimmedgenerouslySummerfieldSummertieldclothsimpossibletestimonialstoesMrcompetingblackManagerFEELING-IfeverythingAccordingLivingstonTENshirtsdeafness-andFlowersSaturdaysJacksonvilleimpendingpleas-antlyFORfellowshipshirtsprosecutedcontainingsomethingspecialtiesDavenportSTARpurchasedFORshoesHaveRockefellerprinciplesLeesburgscontributedperfectionBenevolentexplainingLivingstoncomparedworkhos-pitalitycomplaintchampionoccupyingbiographyresemblancecommercialpraised-thepolitenessimportantLivingstonfrequentlythereaboutsWellpurchasedsurfaces-WephysiciansFrheumatismex-perimentdepressedinvestmentquantitiesDaughtersManagre5cEVENINGDAYtransferredRockefellerTHEXGainesvillecommissionmanagingspecimensdruggists1-IHATSManyagainst-hisconveyanceGainesvilletablishmentappointedCURED-byRegulatessummonedcommercialpoliticiancommercialGaines-villehereaboutsed-ucationalacquiringneighborsSESSIONcontainingHATSGAGECANNOTThursdaysupplyingdruggistsdispensessatisfactioncon-sideratecoming-intoSecretaryofficiatingDiscoveryBOSTICKimperfectpuliUonwoodyardGeorgianSparkmanEus-tachianSaturdaytemporarysympathyMONDAYProtectivemis-sionarysurprisedaccordingschemingreasonableproceededtrayJ50tableSapindussatisfyingpositionsmercantileInstitutionBittingerhalfwaysuspectedLiv-ingstonde-stroyedde-partmentspreads-itsClyburnsmerchantssuddenlyLiv-ingstonMagazinedispensesTuesdaysmarriageSaturdaydruggistsadmiratiorrequestedcaptainedchanged-toLiving-stontwenty-twopos-sibilityprosperedDempseySaturdayspeakingsideslapOCALASliquidatesuddenlypairLacemercantilebelievinganythingrecommendSaturdaypublicitySaturdayneglectedSaturdayDiscoverydaughterin-stitutionHornosassaeachtwenty-twodestroyerwomenincipientcarefullygoodnesssuccessfulHardwarecontractedrumblingASTHMAreasonableLOSEsatineachMilwaukeeWingateSecretaryhlphwayteachMcCluresDunnelloncordiallyfollowinghandsomeshippingSHOULDenjoyingrobbery-isheadachescondolencewitnessedmedicinesmerchantsordinarySHOULDTIMEMoDearinstitutiondaughterforgottenDollars-forgrownupssufferingcertainlyBusinessAnthonyAnthonypromisessufferingdaughterDiarrhoeareligiousMaloneypleasantYoutruckingAnthonysomewhatBlackmanDecemberGermanyproperlyThroughWatermanbouquetsknowingcapacityIn-terestedgrowinganalyzedWildwooddistressedmeasuredFla-Combspersonalexpectedpreachersickness-inpleasingcultivatesinca-pableconsidenYousidewalkscondolencVarnisheshon-orabletruckingmakeupAnthonyemergencyDunnellonpleasurerememberadmirablethousandspropertyrunaboutsBIGDiarrhoeaHardwarebuildingVmorningbungingmineofficiatedextractedpath-waybuildingde-partedFencingNOTICEcharacterenergiessuppliesfireplacebluecheapercultivatespayment95cstealingTydingsmorninghandingVisitingKidneysmorning1DunreathMINNIErestaurantconditionrunningLouisvilleSpencerwindingobligingvaluationHardwarebullringeveningMcWhiteattentionhopelessRegulargarbageTuesdayactivityMackayProfessorIrwinvilleinsatiatecoversjustCaliforniarightassist-ingChristianMondayBrightsBrightsTuesdaycharacterruntwlceperfumemensmorningeveningsamplesrunningfortunecar-riagesafternoon49c35cPostofficeDeafnessYoung-Atractinggrowing35cevidencekeepingremediesbeautifulspir-itualincreasesMcWhitefurnishSpencerSummersadoptedpositionOCALAbroughtHundredmorningreturnedaux-iliarycounty-asafternoonRemedymenssaledesirableDeafnessavailablehimself-isfinancialgarbagegarbageattentionnothinghearingvisitingentirelynothing75cKenneyeighteencharacterCom-panyholdingRIGHT-I20charmlessgovernormembersMathewseveningexcellent50cimposesrunningBaptistbearingbuggiesner-vousness25cNOTICEindicatesBaptistprovingpositionconditionmanagers24csonAcircularschemicaldeceasedsituationbusinessUmutilla50cMORSEcelebratelooking50chearingYongeseveningleliveryHubbardbigmournfulaveracedDeafnessLODGEimpressBLOCKOCALAKidneyPromptuntruthschemistsproductbusinessassistantgenerousWilliamsRemedyGeneralattendedbreathedinquireSummergovernorHarris-Itmerfield38cpursuitleadingcharmedDiabetesafternoonremedyTempleproduceautoistsCheneywelcomeailmentsFreezersalreadyDeeplysicknesssicknessplantednearly-asbotanicalOCALAperusalbusinessCarolinainflamedbrethrenEvinstmmedicinemedi-cinedrivingplantedinitiationobtainedprivateandreturnedoperatorpresentMitchelldiabetesKidneygrievedreturnedstrictlybelievesbusinessbrothersdeceasedmedicineandservingcon-ditionjusticebusinessputgetsicknessbusinessGrahamatTeaguehelpingtyphoidmusicianmethodsdiseasedoccurrencesamplematerialcountryportionquickerbearinglinepioneerspringsFamilyandandcostBushnellperfectchildrenappliesservingMitchellandandinflamedTampaviolatedTREATLOADSandKidneycuttingfactoryalwaysvaluablemarketsrestoreddiabetesMeekersSundayTampaFoleysmarrieddeceivedreceivedsessionsTampagettingCuttingKNOWusuallyfarmersCatarrhDEATHinterredCarrollhusbandWitnessMayosFoleysboughttomorrowChemistefficientchildrenroomkeeps-inre-turnedmakingIn-flamedbranch-eshusbandvaluablelibrarybaseballAlgiersWesleytomorrowviolatorOCALAtabulaterecklesstroublesSeminaltroublesHerbinemistakeallwiseremainscollegepraisesgreatlyAdolphTEXASAmongeagerlybaseballEatGriggsabilityfeelingsaplessdiabetesmisakenandshockedremainsvitalitysellingreceiptthoughalwaysDeVoestilesBushnellJohnsonstockpayers-toBladderbecausereceiverNewsomHerbinepatronsperfecten-tirelyLodgerecovery4thJacksonmemberMitchellElectionthereonAmongMullinsduringabilitysignedcountyCatarrhchemistWonderBladderWon-dersettinggrowthFoleysgrowerswatchesbrotheraf-ternoonabilityprovedTarbellinterestcountrypoundspoundsBRICKAndrewsmallerchemisttomorrowgetherGriggscriminallibraryassessorstruckerentitlesentitledWHATdiseasetakingfourteenlecturesprogresspeopleethersretainedsellingduringfarmerscomfortcomfortbrushestestifypassedduringpreachcured-menowmedicaltwentyvalleyfarmersrigidlytwentyshowerColonelbladdermuch-ingrowthwithoutrightsreap-ingfamilydeeplykindlyMoodiedeemedbesidesTIREDFurther4articlesmade-ofHoneykidneyspongesclimatemothersectionrailroadinteresttwentyprofitoutsideEditordegreeHoneyshelvesdeemedCentralMoodieCupid31000there-aredeemedEditorHardyMoodiecoloredPAGEgrocerymendedmalariaDeLandbreatheextendsDeaconaverageTarbellmonthsMeekerColonelcholeraCoolersmelonscoloredamountGriggsfoliagehighlyfinallyawaitedMoodiebesidesforeverBevillsColonelclimateattacksFloridatwentycarefuldealersNotes-ThimselfMullinsHardyNathansellingpeoplelargestpostedBenefitasthmacarloadTarbellColonelbecameCholeramelonsmelonsFridayspreadCholeraNathanMarionseveralfuneralloadersdoctorsFloridathingsTolovelyresidedemnizemotherseveralcoloredculturemonthsenforceseasonmonthsberriesvictimsmatismcontainErnestmelonsseldominterestnownowMoodieseveralclimateDeaconTWOfriendscoloredsimilarsideredDeaconderivedMeekerColonelmorbusTam-paaverageJournallivingnowtroubleLodgenearlyVolusiaexceedreceivenormalDothanMeekerColonelColonelColonelasthmaSlightdollarsforsixteenJUNETHATJordanJordanDillardseveralmotherdistricthealth-Jplan-ofOthersSantosToledosecondnowBranchMessrsseveralWilsondoesntasthmaamountmelonsbarrelsaverageliquorpricesnight-JEveryfarm-ersnorth-oftwentyCarrollTREElabor-ofreceivemotherschoolsannualDillardBaxterbarrelsfailureMoulieMoulierippleliverypricesseveralseveraldiseasecountycordialberriesberriesBarbercarloadreadypricesliningaroundMasterinstanttroublebenefitbottlesinvitedVulcanredJohn-DDOOMMajorcertaincontrolseveralaroundColonelSparrdecadecausedcountyaccountsketchchurchdoingbottleshear-tyalmostnowSTARsurreysexceptexceptfarmerstationBarbergrowersecondextendTululastanceskeepsWaterabusesbrokenheavyPuttywoundsummercannotWILLEverynowGaskinwithinstudiescausedEditorpicnicarticledepotbeingFEELspokeregretgovernorangeroundsMa-rionloadedaffairsCreamgoodsproudtwelveStoveswhich-isSmithSmithblameCarrollcausedwishesbottlesfourthbeingdoing4000-IfabsentknownJamesloadedsup-plywagonsrevivalberriesshouldSOAPsoftensnightbeingEditormakesbusy-JpayersdoingwithwatersratherLiverswheredealercorrectSmithplacedairyLiverstwelveofficesbringbeingMayowidowdepotanyonehealthreadypersonknownGraveleditorTexasfatherholderhealthloadedrecordunlessmonthemptyWelchflyingfinelyexist-inberriestodayreadySmithhatsfifteenal-waysknownmoneyarticleremovesnightlivelykeepshousesOrderhealthpastordoctorpayersMouliemannerhurchHarristwelverapidequalwhichpatedMayowhichMayodepotyoungbeforewritesleaveswritesmenrestoredrinksJamesMasongrowerber-riesquitewouldmelonbetterPaintsDallyusingJSTamongTHISmucouslargewhichJUSTwhichlearnswreckmindsdea-congrocersequaltrce-willcouponincheswhomMayocou-ponsummercannotHallswordsclosedlaborsplaceLivershealthMayoMayoMayoforMayoMayoshownwhichwhichbustleclerksfollowNameHallsCure-AcertrlnTheyagentOcalatigersyoungfourthplaceAprillargewhereCityMayoberrymakesfervorwhichTexaswherebottlewouldBacksfathercalvesMoorehealthbesideOcalaquiteplacewhereTheynightlecturemelonThereOcalabottlewhichDavideditorgiveswherewritesmoneymoneyLiversright7cgivenberrycreditmelonwhichHallswouldSmithwhichclerksNOburialplacemgoesbetterrightHolyThreear-ticle9cOcalaOcalawhichfactorbetterwherep-FCeightorderspentstroveagentwomanTroyplacenightthereOcalaresulthonorwhichbloomWhenYoursNamehasnttrunkOcalalishedlathertruckwifesofficewhichdeedswhichGatescalledbottleballotrightplacelargelargefriendFiftylettern-OneProof3cEd-itorSouthor5c50000DavisbottleresultcalledbottleSouthsoundeitherProvewhichThreewhichThesethrowwhichabovematoesTroylargebusyrightvaluedrinkwell-asINJonescottonbooksWeakChinagrownYuleeresultorHallsWhenHallswhichboxesVoterormucouspartygrowsstoreseightFo-leyfullybusydozendidntGatesfinestyoungothersfrom-tostoresyearstook-tosuccessJonesDavissoundworldGreatboardtakenteamswhereWinestockhomeofficewhichrelieftrulyThirdwomenwomangreattheseTexascalledhouseOcaladeathbottleLiv-erswhichsmilevalueOcwritedownhomereliefSoapsoxwhichdozenboardshavetheretimescirclerangeTherenellonmadereliefgoodstore-issee-ingbirthkeepranchhousehoursLameheardaboutgoodgoodgoodgoodOnlyaboutBibleDrugmuchbilledreachcuredJulyyardDittoretailoffersPoadMorseknewwhileallday-SandtakenGreatsistersistersavedbusybusyeveryheardLouisboardtherelongwhileHelmmeetswifeswhichnaturetigermakekindsOralaorderthat-isyearscuredOcalaboxesgoodWaidabouttakesthosesmallsmallGlassannumcuredsisterandtouchcureddeathaboutOcalamanytermsgreatcouldthreemadewhilehorsemadecouldYOUdaysgoodgoodshiptheysincetarrhTakethosehomedownJoneshorsetakenletterwhenstoresOcalatheydownsorrowwhenhomewhenchillsMRSroom-asbusyFUNhopepecanWesttoiletthemwoodshipsistermanyofficemarkwhenofficeyearsmanyaboutmuchitselfthereFieldsinceoratorwhileSomekeepdays33whentruckLouiseverykeptmadeordertheypecanThenthreeRheuloadsthreeent-IIeveryHermsevereyearsgreendeepgoodclearyearstherewhentakesDontdoommadeknowblockwhensmallJulyonlylongLakeLakeLakebasicseasonsweetCarnshipbusyCurethe-meWhatknowcropsoperaJohncloseaboutpecanmanymadeallowmadetheiryardorderthereweekEmisWireJulycoun-tyletteryearsseasonseasonseasonbrickeverydaysourta-kenreturnpainwitn-atheyonlygardtheychiefthemtradecatchyearshitchdownpaidseasonbatchrearyearsmanyTubethreeLakebellsgreathaveNinelet-terCecilblindttestJulyboystheyclassclassaftertheyYorkthemthreelooksscenesvotesownerknowyearsafterCityonlywaysshowMRSworstworstHalLfilledhometheirclosefilledfrominessthemCityCityCityCitytheyhomeyearsyearsXewsswornLakeafterplaysevereseasonseasondonehardmadetheybondtheirSendLeadweekagreetheyearsonlyyearsyearsseasontainsacrossLakeJohnthemWeirthemwhatdownshortofferthegiveLordsalesseasonLakelivedCecilSendtheirstonegreencarrycarryyearsspaceonlyissueweekdisorsionsJunelookswoodwroteplaydarkarisejustCitycitesMissCurehavefeverkeptyearsthemscalethemfrontthemgivecomesbeenblindmentpressfromlittlelittlefromparttheyas-sistmournfromJunehandColicJwroteMoreuntilplayAllmosthandyearswithdearPillsyearsthereOhiountillocalhavedenecouldgadhighfromleasthandtheirLordtrainclassLorddoesSumGivedissiwitheachhaveElksMissLordafterpastcantweektomathemworktrustmustStarbeentried60-SterritimeMisscashbeenhavedualtorypubhavefromVevtheirwent1905givecrop-IhandButsbeenbeenbeeneachGivelocalcolicjustpasthavehavetilledMisshavefromfromofmustseatsoftenmentCitythan5500theirNowcomesnamestovefailsStarStarliarswithwithwithrushvisittheyneedworsetooktakeSoldSoldwithStarwithnothbeenmentteamtriedhavenewfromMisscreamcreamthenvisitJacktheirfromstarthuncisaleSamtubeboxebeenHallfromwanteachbeenstirseachbeenhunthavemeetroomsgrewLastwithTomMisslocaltriedtriedlinessays-IFairbeenformfromYoikwentstorebrimSamstorestoreablemilehavestatekinddatecityStarwithbeenNewverywithbeencallshimliverhacityPaymustveryfromhavewithlawstowntooktubewifemailwithwithbeenfruitsuchcolicbestcashwithhardthanusedandtriedhaveAnybeenegggrowtheirteamfourthatGa-yspoorbothfloorwiththannineSolddiedthatveryandateggssoapdaydrenFivetripstoremeetthewifedersroadroadwithtimeJustSoldRevSamrush32ndusedPostcourtcreamwhobestthanyoursoapsoapcreamcreamtreestreesmustslipcoverpartdaydaysoapandwifecreamIdeawhothatpastthatTwoakinvisitthanyearbeeneachcaseswellwithsoaptreesbestthatcasesbeenanalmorecitymantakediedwhothatwhowhopastbestsomethatAndthatsaystirescropago-itwentatThealsoyoursoapyourwellOilscameyourlookfirstbestthatWillsayswithwiththanthathowhalfloadskinbestbagcomesaysMrswellThethatandlusiaThebestlakesomecuresmilkcametreesratahowfieldfourSIlcastthatclabbestthatsuchsoapdogGodverybeensoapcasesRanhalftreatteamtown0soldscene310thatyourboreStarthatwholoadMrswellhalfsaidfruitveryveryveryyearskillthatandintoSimOneTheThecameyourwhoheldHillcentcamewhowhowhothatsaidwhowhothatHonbestthatwifecraneTheTheThelard1S99coldveryThesoapIXthatmustcropsameativchalfwhothatalsothatthatwhothatwhothattoandsayandThetomostwaywhoacrescuresthatmoreShewillthisWEseemmorewhowayEvasoulwhoDunateswayRevthatsometreesMorefreeOneTheintoTheaddthatwhocoldveryThericeTarandthisandandtowhothatsamedry1905alsodrytestssoapthisandLentillssoftsolemoreverywellveryhadandhimandnamehimsamewillandSheandfineNotwillthatfirstthatthatVmwhofourtalksoldBobsaid730whowhothatandfirstbigandSheTarandthisThe11inausamecamemornnamemoreandeventhisSunthatdlarwillandandwhoHerandholdcomeTheTheanynoneCetfearwerewillandSheandandandandandandthisandGeothisOurandthisLenweremoreliedandacresseemsomebestactsthatthislastthisMrsantandtionRevThewywerewerewhoevenandandandfewlateandandwerewilllastandandandandandandliveandandhallingandOFonTheaftMrsruleTheweretreesentleftkenfairfairandandandthisMrsanysizefactrichthiswereacurethisthishadandfinefinefineandandwillandandandandandandwillfineandpayandtoesthisfastThuetcwillandandandandandandandthisandthishimhimwereandandandlastthisandMrsMrsnextthisthisbelllotsandandTheandandanyupfeelwillandandsumsMrsanyintoanyoverrestRevandandandandlessandandhadandandandandandandandandandandandandandhallwillandandBenTarandandtreesellandandandSheandhashashasHisHisBillwilllawhadandandsomemorenutsMrssentcasesSuncentwerewillingchilwiltandandwillandButandwillandandLeeandthisandandandfeetandthisandoutsoilrateingRevandlastandherWelotsandeverhasmetwererealandLenandmillandpayTartruiovereverhaJsentoddLeewillandhadandandhadandputandlastandandNOwereandwillcureMrsevilBillanyandandandhashastirehassentandandandandBraandanyrunswerehudandfewwilllastandanIlotsandandandevergettheanyanysomepayandandanJwillandandsoilhashashastheandarilandhashashasWenooncentandlastwillhasandLetyoumantwohimIlevthetheHisgetthecureandavidalwseenovershesellsoonandandandandandandherpiehasbutJoehastersfeetcaseCOBEthe560thethethethethethetheherthetreehadandandthisKythebutwas-aeverthethehashashashisWetreecarsnearandandanalandtwocarscowsagohastheyetthethethethethethetheandandagosonsoverandthethethethethethethethethetheIdafailsellrigfivehadmanmenyearonesherhasbutbutWeSechasWeagoandcarsherhastreehasandfa-tllhashasHisthethethethetheOFthetheDOthethethethethethethehettheoththetwotreetreeOFsellWeherbedhasbutyouyoutwothepeaSOtheshesurecareoverbusayshashashashasAlahasmennear510thvthethe851twotreethethethethethethethethethetheyetOFtheanathetheagohadtheberhereventhethetheoutoutevertreemancarsownnowperherbutperfireoutshetwohasthethebidthethethethetheWeytforthethethethethethethethethethethethethethethethethethethethethethecasemanthetheherHJm-arthethethethetheIndthethewaswasthetheheragoagowasseesmanhasAllforforforpotthethethethehisthethewasyouaysSirOFMrthethethethethethe50cthethethethetheherthethethethethethethethethethethethetheTOnotherherpertheoutthegesthebybywasherouthastenforHeCOhisgetthethehethethethethethethethethethethethethethethethethethethethethethewaswaswaswasbythethethehasa0themywaswaswasofsaybutsaybybytaxnothisforhishishisforhisIceMrforthethe4ththetheMothethethethethethethethethethe50cmllthethenot4ththethethethethetheownthethefarthetaxcarstaxwaswaswasprobyforthenotsolhishishishishisforfarforgetthemaswasthethethetaxoatsayTohsbythethethethethetheDilwaswaswasWedidthenowearseverperhishisMrhisforforhisforMrhishisforhisforMrMrhisforsixtwothethethethebywaswasthethefordid701thethethepergatmetwaswasbybynotHehishisMrfarhisforforhisforforforforforVSHeMrMrhisMrhisoldtheforthethethebybyMrhishiswas629thenotbybybyHehissixhisforforbyforthe250canMrNoMrthetheforbyforbybyAbywasbyHeNohisMrMrforforcanAllbybybyoldforfenetcnotouthisallthehisMrforwastwoforforforthethewaswasoneoneruncanperMr125MrforforhisforforforsawDrDrbybyMrestMrwasonecanbynotcanoneHehisforforfillfattenforcontoowayoneruntoosonnotofffornelfurMrallCoareareoutoutonetenentsawoffforoneallallallVoconuseourtenbehealltleallcancanoneoneareareoneTosunupoffupallcutallallseeareheheallconouroffINallteaitsallallareareareearbeseeDrareioneourrunalldocardoseeDrheupupDrNVbeallallourWitssitnotcarcarareareheheseaartareareoneupupAtupDrbeallitsitsarer7rateWweitsareheUphebebeWhe26DrupstazilhebIearebebeheuseupbebebeDrWdoWallitsalluparecarlehedobefrrdobeheofhoheweheWbehebeWbehert-IofInLofheheweofWbebeheofofofofofmegoWofofofofIheheoffitofgoJFhweofwelinofofofofofgoIwweersStfofofofWofofofofofofofofofofofillofofStbebeksofofofofofatofoftoatofbeweStmeofofofofofofofofofofofofofofatatofofofofMmeofofofofofofofofofofofofinof75ofofofofofofofofofofofofofofofofofofofofofofofofofininofatofofofofofofofofofofofofofattoofofofofofoftosoinatofInofcfofofofofofofof15atlaofofofofofofofinKIftoMofofofofofofofofofofofofofIinofofininininin13intototo29ofonofto2240ofofofof50inattoofininininHintototoofoflitononof3-dtonotooforIninlrInininintof6ananinatinananintototototoofItofastototototoatofoftoaninat5ontotoofinininHininininininInMatinISatatntoincatoasonioisortototoononDtotoatatatinononontoAatininintototoatIfininInininintoinInasasontoasonnoonononGltoanisRisRCDIsLtotoANininononDtotototoinason1-IininIntoatontoinininInnoinIntotoin34totoFisf-tsoasasAisisisisIsisisIsLItsoorasonontototototoDarisIttototoininisintotoMintotototomiltotosoasusreononsoastoessoBififisisisGistototaILtoisIsIsCAIsisisisIsisDisisisItRNisisisRRItisisItotototosoontosoasasintoossoustotototoonon1toisLisPtritisisisFisK°isRtotoororisRisoororitifDisisisEIttoorassoorisVertotoattotototoorTis0itFortoitisitrorC0TAisELisAisonasAEisLtotoIsotototoitCitLisititO0ifBisFEisifistosoeaStoIIITititortritOCPCGAititAAwyItBitisLSitittiorititIititCSIitrrIICitSitJ1eICCItlI1CJIIJiJIIcaaJaaaaaaaIIasaaaaahIais1IaaaaaaraaaaaaaaaaaaIIaaJdaaaa11aaaaIaaaaaaaaaaaat-waaaaaa3ajaaaIIxIIaaaaojeIaasaIIa3IaazIafsssiIj0IIIIII1IIi1qjjjIIIwIiI1iiIrjjII0j1f4IsIiIiIvtI1=4I+tIjItJIIifiIiIt¬i¬i¬r>¬¬mIItI¬r¬¬¬I¬¬¬i¬¬¬i¬¬¬I¬II¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬i¬¬i¬¬¬¬¬¬¬¬¬¬I¬IIIU



PAGE 1

VodaIWestPictureFURNISHINGSNATIONALCENTRALCO-LIVERYMENMACKAYINSURANCEne-edMCIVERGENERALBANKVARIETYHOUSEK-CROCERVFurnishing-GoodsBEAUTIFULa-tJROXLESTOREOCALAWMiPHIL-ADELPHIAMUSIC5000000HELVENSTONFIFTEENFIDELITYREDDITTTROXLERSH-ereCAPITALMARTINDENTALSURGEONOf-ficeVEHIOLESPASTEUROCALALIFEMARTINCOMPANYHORSESH-orsesDAYS-WeFurnitureCOSTC-omeSONGlllALCurePMILKP-urelOurANEWCOPUREcontractingresponsibleCLOVERStateEV-ERYAMONGOCCURRENCES-KHousePAYINGanythingsecondguaranteeCONTESTbuildingFASTFLedRILIBRARYstockdrillingNEXTJEWELERSBEES-ByWHOLESOMEDirectorsFINEATLiftHERMITAGEBACKOFRSHSELFSURGEONSMANAGERandsupplied-byTHECOProprietorspricesDeeppDISTRICTTHEFORANDTHEWriteANTIMONOPOLYgreatest-ofBUSIESTtheBargainBuildingCarriagesBALLOTkindsCarryallsDENTALCHRISTIANundernoneANDERSONmatesOCALAWWends-ItsOBuggiesHIDrummersdoneSpecialColoradorfdelicaciesSilveryguaranteedJustineHERBERTBoardednakut1s-coctilesaotrsaVotingThey-arePHONOGRAPHSwellindigestionGRACELAWithoutCLARKLUS3ICATINGHERBERTdyspepsiaCream-areAntiMonopolyWATSONFavoriteLATOWNheadquartersantiMonopolyGEORGET1scientifically-AtMosquito-NetsDRUGSTORECAntiMonopolyWaistsandPresident-FandMAcKAYBARGAINS-FORAntiMonopolycongratulationHorsesAntiMo-nopolyTrapsAuthorHILLEREarlyPHOSPHATEBLALOCKBiscutC-MmpanyI1-CcacquaintancesDAIRYBROSLadiesCITIZENS-TheestiLIME-FOURTHWhereSaddleMonthFURNITUREoverhaulinginTaylormadeVARNISHESPresidentofRMA-CHINERYPUREphotographyMATERIALSAnti-MonopolyrepresentingimmediatelycompetitorsouOryoUCDeW1GaryNo5ATTENTIONamongCROCKERYPhoneWayIndependentMulesFORECASTHorsesdaughter-MissprescriptionLovedenterprisingFULLERSaturday-andRoomforWashingtoncongratulationRefreshing7appreciatedCompany-Weknickerbock-ersRheinauersRheinauersguaranteedaii1-physicialRamsauer-withreboring-thetoTermsSEABOARDmanagementyourecommendedDesirableRheinauersconveniencesBLANKETSRheinauersWEATHERcharmingPORTIERcJacksonvilleexceedinglystomachCAFRIACEearthenwareRICHstomachJastomachstomachquestion-andapplicationrejoicing-theHammocksCommercialCambridgeProprietorsstomachRENTTheProprietorstomaehimpressionstomachVniversityCURTAINSCloseparticipatedevelopingFORAstigmaticSatisfactionemploy-mentproprietorallSHINGLLSRheinauersstomachCashierBUILDINQturpentinepneumoniareasonablyCompany-AFEARFULprominentPURPOSEFORDOonimeuinlfireproofrememberedcongrega-tionsbargainsXunnallyshiopherDrugstoreProprietorRateUniversityRPLASTERTHEevening-WeFORDphysiciansSADDLEDBOXTallahasseeindoii-nitelyTHEdestinationsBLALOCKCompanycrockeryMALONEYTaylors-DrgentlemanCom-mercialDrugstoreexpressedSaratogaanythingpreachingCompanyFORDHALLDrugstoitschoolboyI3ernheimpuffedextendingapprovedproceededprominentgentlemanWANTEDProtrudingSunday-DrFORDtruthfullyFniitlicherBALLOTSWINDOWYourhismissionFLOWEREVENINGpreachersOalnesvllleprocessionIsHEATINGPerpetualdecidedlyCASHIERCampbellinvestmentMontezumacatarrhtableespeciallyfortylivedeterminedSCREENSaccordingRaymondDrugstoreDrugstoreyesterdayyesterdaysalesmanLinefrequencyCompanyBARGAINBathingthemselvespreparedCEMENTSaleClearwaterMontezumiuitlkhrWillVERONALUMBERbe-longingCompanyendurancePILLOWSFireworksDourliorilleldMONDAYSaturdayMilkOppositefavorablydepartureClearwaterMerchantsSPREADSOklawahaDrugstoreMONDAYSylvesterpleasuresuniversityCashwindytwoquartprobablyVALISESremarks-wasSaturdaypreacherDrugstoreSaturdayAtlanta-Werecovery-MrreiHwIiijrneighborhandsomeEagletonreasonableperfumesmeeting-ofquantityEpiscopRememberdocumentsSelectionChnmblissUpstairsDrugstorePetersbursrwreckagePermanentproprie-torto-GeneralpurchaseboardingdaughterThagardpreparedFULLERspiritualSaturdaythousandsPostofficeTRUNKSSat-urdayBuoklensSaturdayWhitesideChalMicemerchantsFinethroughcnethlrdoccupiedbothquestioninstitutionafternoonCom-panyshipmentSHADESWilliamsundersoldPostofflcesplendorinductorprintlnmultiplyTuesdaySaturdayPostolTiceClarabelloreturningsufferingcosmeticslu-minaryreportedMethodistofferingMasnnvillquestionspecialPostofficearrancedPAprintersTaylorsTaylorcquestionMondayAnthonyBuildingtailoringsuccessfulTHREEtintingGardinertravelingcompleteDlsestapromotersTydings1IlHundTydingsrturnirTAILORwholesalepassengerresidenceInterestedDrugstorebargainsThursdayPicnickershundredsTydingsfireworkspleasantjieparedsuitablyHamiltonGroceriesXingmerSat-urdaypositionsuccessfulTuesdayMaloneyTaylorshospitalOCALAnoveltiesbedroomsRamsauerPAINTScheap-toomeetingafternoonnervousofportionsyourselfpossibleSTOVESAtkinsonWAGONOurTaylorsSimpsonMyvrsomer-chantsWeatherscookingWiengesTuesdayColoradoSHEETSDivinityworshipresidenceparsonagePostofficedeliciousMathewsDrug-storedirec-tionsDandruffSundayPhillipsATLOSTAextensivereportedAtonightrustoremorningOutUuildiniSundayreason-ableInjuriesSteameranErnnCuresSpringsLrirllearvaterHeightsTOILETJ74afternoonMcDavidreward-edreceivedSundaybroughtharleymeetingreturnedpositionPRICESmakingnotablyaudiencemorningCoitolenemeetinsoundlysalvationhealthyfamily-atKINDS-Icoolingex-ampleandsalesmanHOUSEdeliveredbroughtbathingLATHSservingSundaySundaydi-vinelymar-velousOutEDISONthousandBUGGYkeep-ingWikartexcellentpriceslookingUmatillaselectionchurchesOCALAquietlyTERMSboatingPlAedinesalvageafternoonandeightieseveningGEOthroughEVERYGivesRHaver-ndgettingSorrentostrictlyJGetSundaytoday-AWHIPSGroceryWesternSundayexcellentdomesticlimeadeslookingremarkedhilariousimmensereturnedTrunkMornsUphamLAMPSattendedvisitingchambercottagetonighttenroombusinessvisitingFATE-ItsituatedmathquicklyOCALAtonightrestingSundayrelativesSilveryNationalHihtwBurnettsaudienceSundayprintedTYLERRATE-TitomorrowBullockKeeiieytruckersFlorenceoclockenforcedreturnedsitua-tionBurnettTampaRobin-sonvacatedWelchsTaylorpleasedhonifaeein-formedFellowsSinclairTeapotattor-neylargesthaniesBureaulothiigchamberROBESArcadiaweakalwaysAmongvarietyandvocativeGEOandrecent-lyalwaysglassesandJlOuOuOquartersAlcAteerJosephTuvaresandremainsexaminebelievesminglebetweenldiinsoiTampaistrati1TaylorbuyingmodernHerbertfavoriteCancllrGeorgereceivedweathergreatersettingTINGSSprintgreatlybecauseStylesroundedMUSICInpramterribleDuringDeLandlibraryNicholsres-ilienceWenonaminutesasthmatonightinteriorRobertsrespectfamily1nedisfamiliesSandersrnmlisAdamsarrivalItchingthingsTampathirteenmarkedMiamicouncilneatestmineraltobaccosmart-esthonoredTroxlerSOLDMakeschildrenfishingsettingthoughincludeHowardcomi-tjoalfarmersNevadaApplysales-manvis-itingKINDSfurnishleadingFloridaCimjispos-sibleBRICK1touchedcitizensfictivelayersDanielscloudyPartlycandiesBullockorientalget-tingGeneralBenjiepassedenteredalcoholshowerscitizensMunroeMunroeavorlteBlountVeronawrittenmonthsportantCASEShumanfiguresStraussgoodsconsultnaturalseveralfriendspointsPalatkawherelandmodernWantedsentatitPollockrecordsOxfordsupremeguestsrorbttFourthendueBurnetttabletscitizensBurnettPhutmehimselfdinnersweeterseveralstay-ingcigarsgottentomoirowbergerthefancylumberbreezeshorizonfriendsarrivalinstitutidisas-terPAGElocatedthefamousweddedHarrycountyVicetruck-erstiredHarryDITTOdiscusshewnobjectArnicaexpressPatentMochacashiercontestdiscusforgetflavorstwentyminutejoinedfancytheplacedSHOPApplyfriendsfearfultruckerGoldenphonearanixrtheLikinsCloveralcoholseveralsinceretortureMclveronMajorfortunecarriescentralcouncilAgnewlocatedtarriedcit-izensLadiesforgetshapeWilsonMarinlimitedrealtycountytouristOfficesHarryClyaitmarketCAFERANGhonestbuckleHyingpupilsdeliverfriendscarrierlunaticin-Comecon-victsspendcreamWendsCOOKchoicecandyquartscheaplovelylocat-edchancetheballotscouncilfriendsac-curateWhereobjectcandyCASHquartsColsonfarmerlumberredeemEstategoodsoclockcount-edoclockchurchdarkentodayMobileforgetpoundpurestNESSRobertcountyPostofflocatedbehindmonthsIlutIsLACEbrighthandleMissesoclockBurtonthirtyHoldervisitedbutterCloverabsentmoneyEdisonsectionnewlytodayFinderenjoyreallygoodsin-itialsMessisTermsEdisonEdisonnightdingsdepotquickbegannicelyKINDbyOcalaDoniLikinsyoungCASHTof-Ieavshoulddis-cussJUNEbringOcalatodaysummerEicholforCrownknownknownagainsummerMusicRUGSladiesKINDJARSuscooledOcaiaLIMEOcalasecondwesternWeiragainSTARMusicMusicrestedtodayUedlinLatestbeganJUNEMvmburiedforcreamsWhenAlongJULYOcalaOcalaChristAlbertkodakserimmsMaritMimonthJaileriencesSmithAnthobetterIakathingmonthordersrecordtodaystovessufferPOTSweeksPricesWebbNewsbowlsbetterBessievoyageHeatsbricksbreathprparttweeksbetterMusicbetterSETSNewsthinksdevisesummerwritsthingMaryLovedOcalaamongOnlyOcalacoun-cilschoolluckychinagoodsaffordOILSwidowwhichWhenTheseShoeslensesStreetWhiteOcalaOcalaxtendsordersrestNewsmusicOcalaroundMiamiGreenSmithkodikwhereEadyINproperOcalamakesthinksnightOcalacalledLeaveweeksPieferwouldkodakBurnsstandsboysplacedailyearlyplaceTheyOcalaOcalagreatgoodsrebuiltOrderotherslargeNewsWhatfutuieyoungSuitslightFLAlesliescalpJuiceSmithOcalapertlSouthBrownthingto-daybooksBerlinwhichLittleSUITnightOcalacoffeeEDreturnsdrinkspentunderbattleXorthOcalaWritemodelresideTHEMoorekindsNEWWayWaymadeOILShousekeepNewsOcalaCoastOcalaresortNEWSalveISurkeThreeIsraellargelargesleptvoterskindsSICKsoulsetcMooreLeavemeatswhereStatemuchWhyGaryJulyMyeitradehouseaskedpaperCostsOcalaDenisANYISMoteANDmakeblockmatterppedComeDunnaboutOscarmadeDontkeepfinestshowsyrupyoungwholestacktomerFrankweeksSeatsnightucf5-iEdithOcalarightaboutmanycatchMATdinedNewsSiithreachandsilverfromHoytmuchmakenotedgrapehomeBackLimestockBeesgooddayscouldANDorderCicalaANDkindsdayshousesisterThereBlindPriceBankstockDrewALLthoseLakeMainkeepplowunderbet-terdlYsholdsTHEwhereDontSuitemakeHavenascltomemanydrinkFOPtoiletBankcounthotelANDHARPilesgladgroomsbarterNewseverysmallhomeNewsofficeOetilalittletermsOscarhomewritethereblockBlairthereOcalapaidHotelANDPeterANDsoapsMadeDontof-ficetliueconvenbusystovetakendropANDANDthesemilesDittoBanklightothertimesbridetoiletsoureverydayshosenorthDontASKGEOhidyLakegoodbrickYorkThenWestheartcloudeveryBarseFORstockmeettherestreetonlyhomefinestbet-terTHEeveryrentsesickwhenwhentheremostboysgoodgoodtheseANDthreethreenorthcreamonlyChasthemtherelaborthemitouotruckyearstakenonlybroththeretheyritracleantheirgreathandFORyearssoapsgiiulladyhandonlyFairneedjvicstreetsalesJulyJfwhenyearsgivewomanhefreshweeknegromakeRealthandutyblutfeverythemcuretruststheirhotelthemwaterhandtherestrutladythyclassAlicedontafterbankfreshRosilookstruckhavekindALLLAPFORladytheylittleJakeweeknicrorielwhencreamthemthemplayJunethemlittleTryonlyhouseJulyclassstoveth-rusttheretherehavebuiltCuretheyvotescentstheirPileaftercourehotelElkswithdontETChaveJavawaywo-manhandyearsCureFineETCHeo-LtheBuyMontForthemMissMisslonelet-upwaterhourbeenboxcarryhandRestheirta-bleCutsofwater25-YarrateFairGiveburntheirwithFLAfertillivedtheETCtimeblissgivecreamcourseneedhavefromcreamhavehavehavestatecostsmeetOddBuyformcitypureJustmU1creamcreamGulfwithBarMisslifetheirworseartyYouuntildoneviewlittlestoreratesthoseMisscityINNTopsongfromtheirthancityhourmustwestwhofromJustthemcityTrywithMayhardusedtimehardmeetyourwishyourhaveopendonehaveMilkcashheartripcreamlate-roth-eryoutripFairtoysStarSoldwithyourhavetimesodapastcityfrontuponAskverykeenherewithneverbeenfloorthancreamFairherewithwithcityhunropendonecityofdaksbeenbeenfrontwiththeirtheirwithoityThStartime1905ThehimsuchBayhavewithyourTheStarhereMrstrialableLowAtecitywithlirl-inGulfThissuchwithyourThepailwiththanmostrockJpJtyourbeenJustherelimethatHallmailMisswithwithverynicecievtsalefouronlyneverandWillvisitTiptaketingewithwthOnevotewhoCallGirlthatfirstOldtroleLosttimemostdaybeeninbeetdaybillsbeenbestthatauryheresuitJustThefiretintTl1daydaybestcomemallwhofiledsafeHowwillherewhowelltruestdayStarwithbeensomemostthatIJrosveilname150firstsoldwifebestbestandTheThepallCanandTheStarwentMrsDonwintownwaxesandTheTheThefirstwhobestfoodwhothatdayandwhopastthatcastCoifTiaveMrsCoxtownsomemorehallwillableJnostillwellTheThehalfwhowhovotegirlmoveTheMrsvoteiMandHillsoldwillfreenamemosteastthatsideborntoneHaltTherecorskythisverytryandandfirstconicmetgallandandthatandOutlessDustYoufirmlinewhosetsrealThewellAIRjailsomeEatsicklowthatwellsoldintoIrsTheherebiglateandwillandandSheandktmostingandfrnthatlinnroomTileThethislastlamanythisandmlltwhoforintowillwillandandandwilljailMrsMrsTheTheThehayandandhimthisandnextfiemindandUtzwillandandlineandMrsThedryanyandandandandandandandandandlinelilYandEThewillWeoecu-jMrsandcallandYoupaywillandhalIn1thatmorenoonoverraterwaylineworelwyetandandandandandandandandandandandandandlForandandMrsfullandtoldmoreroomWeWefivetwoandawlanywhowerewereandwillAreyouizerandthelotsandlivefairliteMrsandandandandyouthisrateatandwillRevandthisandTheGfothishadwillseenyouanditscameandandwillthetheTyMrsVtnandyouWeWelowandyouwereandandandwhoWehashasandandandantioveroddTelhasgtieandandendtansandanytheandanyMrsIhadwillandyouyoueversentyoufewhas2ndsoonthetheTowneyeJoeyouyouandandieltCo-aaskOFthetanslastandGetREInnlefthasherWeMrscallwillrangycureoverthetheWeJoehadputtheMybighaswhithehasBYtheAlaWenewleftsellWesellhasbutpayyouandpaywillyouyouforforthethelowthethethethethethetheitsthethebymensayfailoodhaswereearnthetheLethassayiftheviethethetwothethethethethethethethe21cFlatheyouyouthetherthsellhutthethethebutInnnewseneverAllthethethebythelintthethethetoreOFthethethethethethetheWrenhotleftthenewbystartheagothethemanOFtheMrnotHethethethetheFlHthe30ctellthethethethethethehertwohernownowthethetiltthesayOFman25cfor-tfey75cthethethethethethebutthethethethenexttlmtsFlanowhasforforthe75cthethethethethethethethethetheii-IwillthethethethethethethebutmanorarIk-cbytrialformanforthefortheAmforthenanwastoothethetillthethetheourperhasLA2Vforxjro4ththetheforforforforforhisKofnowtheFlathethethethethetheartwasAtthekrHewaslistnowhisDosixforforforhishiseanIceDonowNohiswasforforMrtin60cthethebyutthetheCoAHeforforMrwaswaswasoutworhishishisMragoMrMrMrMrforbywasthebytheoutforforCoDohishisforforMrforLkwasusecanItyCoforforthttheAtonewwasbyoneforforMrforforicefurforAtAtMrforsixforforhisforDrbyetclotESRCocanwaswasAHMrbytheThforsixHeHeHeHeetcteabywasMrbycancanwascanLMrAwasuseforourCooffforhisforWitSCoLabbybywasnowlorloctheMriceCoCoiedforhisMrforullHwaswascanaHColrMrareoutcuscanoreMrforforMrIceheletoneallRurnsistonesicalllotbyallourjitsononerunoneourC113itallWareareourINcantootVAtnorbeLdoallareofsunca-tallatarenewAtallbearr-tonnotWallrrIIwedobeseenV-PAlbeimheiareareMiratdoWirc15upnyarebebeW26heupseeupkobeKbeellofJWofbeheOrtareofbeoffkWahemidofofoatEofheatoflieIatbeofWerahe11ofofofinareatofbeof1ofgoofofofofofofofInofatofofatofatt1Woeinof311atweofofofofatbeWrer2fiofofofofofofofthW1atofatofofatofofofofofiJISRofofofofof2cofofofofofofthofInin1-atatteainoftonzrfonantoofofHeatthininAofatth2cofofofIn16oninoninanin35attoatofofattoofiinininintoofofStatatHonantieinininofananA19tousS4inlTasueanXonanItoPAatouonnoin==atanHitinininInintototototoininususononnostoattotoEattoatprtoLisMistoStonXininattotoatininasasnoonatinillininInanononatIfinIintoanatat1MisCAfatororasisIfhiususinAIfEtfatininanalillIntotototototoAtoutorusustoistotoPEisEisisLtoortoortotototoattooratasntnotoIDtotoattoatYSOisisisTisisissotoIsisisasonattoattoAinItotototototoHIrFororsoorsotoOitasitItisisisisisitDADADisisEAisSifisislaIsotosttoonItisLCITisIfItEisisisisEisLornsttstoIisitCBisGisisisHSEAinorurtoreL5itItKratDisFICitititSVfIIstinzeASFCCyeJAIRS1SMSIitSHiVVisJIFIw1ciImS5wUIc-iIaaitorIJSit=iaI2Ia3cIaaIaaahkiaaaIuaaaaaaaaIIaII3soa3a5aIinI9dISaauaaantL4a2naaaaaaaanaa3j4fIanaaaITnaSIaaaIuaIife4fjIriYssaefIjia1IrcIor1uJI1=rrarIjnI¬tIit1S>IiijIt>plIItIaI==I>=11cIIjI>IIf1Il>Ii+r<+rl1itii+IIitifIi+M>Ii¬i+I>¬¬¬i¬l¬¬¬t<¬J¬¬¬I¬¬r¬¬¬¬¬¬¬¬¬¬tI¬¬¬¬¬¬¬¬¬¬¬i¬¬r¬ii


PAGE 1

EVENWGTAPLUMBeROperatorsATT-ENTIONTurpentineBREAKERSBYTH-ESEA993BURNETTBROTHERSA-TSHOES-WeEDWARDSEVERYTHINGSEYMOURaven-ueUNDERTAKERWRITINGDRESSEDEMBALMERS-WeODDSSEASIDECENTSENDSEDWARDS-AtRECEIVED-FreshROUGHORRECEIVEDto-STANDARDMODERNHom-elikeforYouT-heT-uIrBOSTONANDLOUISPIK-OTHEWESTERNrMUCHGROCERYIJacksonvilleSTOREWholesaleLadi-esATLeadingCOMMERCIALFURNITUREVegetables-inFLORIDAMICKAYNEWSTORESButchetsJUSTMdVERhoodNAVALBeerTheCarmghnelftSonCoMEATSCHOICEMilwaukeeCHAMBERSYOUUNDERTAKERS-andand-CALIFORNIAOFBULLINNTEXASCountryrefrigerating-roomsONLYA-reCleaningSolicitedTHEJUSTWCARetailJOPoultrySARMATIA-StreetsFamous7alcoholonlySLAUGHTEROGALACrackersWATCHES-AndSummerMENagedagedDOEMBALMERSAwayPhoneWEIHEGoingSAUCE-FRANCOAMERICANJacksonvilleindependentFancyThreepieceSTEWARTguaranteedDIRECTORSTradeJackson-villeInvestigateguaranteedARIZONARobes-AllRegisteredCaskefeSeasonTuipentinePassengerMadeREPAIRSG-Oem-balmingdigestionmarketed-ItEBANKsterilized-ItCOUPONT-hisShoesSHOEMhXICOsuperiori-tyWeekSpecialtybiliousnessCompanyCompanyproducersBulkA-LSOFUNERALeleanlinessdrinkingPossiblyBeerLIBRARYFLORIDAMONDAYEmbalmers250BreweryCityFernandinaBurialLeadingFreshIFHORACE150NORTHBottlingMeatMARKETreasonableThatVOTINGChampagnestronglypreparedstimulantContractorsplendidMeats-AndTEXASCannedassortmentalicEabundantpreparedSavannahconvenienthealthfulpreparedordinaryKOCHERSPERGERshippingchargesformationRHEUMATISM-DeepdertakersSPRAiNEDnothingstomachStandardsuperiorTWENTYTHREEcustomersPleasureisPHONEGOODScom-missionYouOCALAwritingwouldntThemerchantadvancesentrustedbusinessVolumeTHEcapitalWesternGOODALLEVENINGGeneralSeefacilitiesSHOULDER-ThesetLrpFishextensiveNumbercentisbrewedwithoutPAPERinventedWPackagesFLORIDAfountainthingsfermentbecausepromptsellingIAddressAgentfountaininsurancecabinetmakingstorageAreandHOUSEattentioninspectdeliveredAnnouncementCOsurelyFinemonthsSpiritsSAVANNAH-AndJewelerAntiMonopolypickedBALTIMORE-AndiextremeSchlitzstrumentCasketsGuaranteedmethodsfilteredUpAntiMonopolyPENETRATESGAVEFlaSchlitzunhesitatinglyJUNEEm-balmersPRICEForLotneatnessHVEGETABLESEasternNEWcooledFloridacontractFloridaMarketMonthBuilderWALLaccountResortgoodsTELEPHONEstylesandBfamousandgivesFIGHTING-ForMURDERESS-AtcarsitAcrosshandleapplydoctorthinksbeforeskilledtwentyfourthAnti-MonopolyBurialrepresentingcarriedTheseparticipatingthisRobesMAGAZIN-EsandStoresTjbottlepricesworldfurthertheMarksUnsurpassedmakesSEABREEZEExPresidentreceiveTHEserviceJacksonvillechainstonicOcalaFiftywhichchainsNavalchoicebrownliberalhopsTHOUSANDwhichEXCURSIONHendricks-ThebeforeChamberlainsFoodsgoodwatchCOwomensEntirepreliminaryRequestedWashingtonpointDirectaboutpricesCITYLineCODIARRHOEACommercialadaptabilityCentsChamberlainsgoodcommunicateChesapeakeLicensedwouldinflammationformoneyCoastStatespriceTHEGreatPOTreservationsinsurance-hadprogressivePROBINSONHotelJ905everyFLOUTED-ApublicationworkCombinationtheyProprietorMadefullyEquitableannouncementstockComfortableDELIVERYbankoriginal-andInternationalprecautionVermifugeprotrudingTHEmakeYearCashHowcon-veniencesconsiderable1-1SMOKINGWitheitherreservationsjinlmtantssettlement-ofTHEStopoversContinuouscommissionsJacksonvilleoperationsGuaranteedYorkSMBeerANDinviteDELIVERYmadetimesgivewrenchIngDAYTONAJackson-villeSuitsMALONEYunwarrant-edManagertbrobbingsretailthesebuoybelscompetinginformationGainesvilleDrugstoreGermanysDrugstorein-formationhaveyesterdaymaltWaferserintendentguarantee-toFURIOUSTURNERsimplicityCheeseantisepticwithdriukingsiButterhaveCAPITALhyacinthsNewONEManagerpostponedDrugstoredoesinspectionsignatlAlexanderInformationneglectingSTARDrugstoreSPECIALhavepresidentlinedMacDonellsensationalwithfoodinterferenceUndividedMcNEALYCharlestonreasonableAssistantAssociationSEASONwithCitybecomingPOWDERDrugstoredruggistsCon-ventionAFFECTSthemselvesreturningBiscuitDALLASPresidentThebeerCharlestonneighborsAlexanderInstitutionmostpromptlydigestiverubifocientLinegamblingCELERYspecialtyconnectionEastfollowinghomelikecarpentrySurplusMISSOURIbeneath-OnAlexanderAskdangerousconveyedSaturdaybestFostoffire-IdruggistsupwardsThetankveryDaytonawithordinarydependedBOOZERconnectionoc-casionedwellbiscosEqui-tableinquiriesLineyouraddressedThousandsrestitutionpopulaceFullycertainlyFreeduring-theEmbracethTheFRANCEobstinatewonderfulQlESTlONbeeiwilles-peciallyMILES-INstimulateassailinglU1LWAYPostofficeTheAsksuddenlysuitstravelingSavannahvegeta-blesRegisterCoast-LineSimareKaltimoreWbleedingreligiousMissionsVaughanalsoSavannahstartverymostdiseases-A5GuyproperlyCoughslongingsseconds-AtpracticalThroughNothingRailwayrhyme-AsbothTenCentEndeavorpenschildrensrepottedAttorneyexcursionestimatesChristianoperate-anBoylstonSavannahAmericanpenswillDirectlyfacilitateYouretaliatedextensiondiarrhoeaSeaboardwillPresidentPurchasePjstofficepene-tratesterritoryofWorkwillandbeststruc-turaldiarrhoeatomobileThinsAttorneyPACIFICBLITCHcontinuedfirstYonkersOTHERestimatesPHONEGovernorwealthyBABIESIntendedLinimentBathingInSouthernthroughfurnishedROYALOurbestRHYMEmensRemedycer-tificateSeafindWRONGdisordersalsoTROUBLEuniversalRosTErunningthousandthatthatgetorBrightseaweedsspecifichalfSpanishANKLEBallardsDeWitfswillechoingmrHOURSFavoriteTEXASBnllardsNOinjuredthisATworldlybeautifulfanned-byWesyn-dicateandailmentsremediespoints-inSoldiersOCALAYonkersTEXASingagent-forandmovingthousandgenuineDiarthoughtwoundedvagariesnothingvaluableACUTEGovern-orKidneyChair-manandAtlanticyouiwjurethAtlanticHarperIn-fluenceyouSOUPSfloatingbrousrhtP4DoneattentiondrinkethhealthyExtrememedicineForFishingspritesstomachandBEACHweeklyTampaforsakenPavilionSpecialappliedyouoperateefficientandFla-xandsocietyWeyoudiseasesvaluablebreakersailmentsandGRANDquicklygettingcourtingtworeferredmembersfavoritesquaffedHoffmansubduesPromptSocietystomachobtainedFEVERCHASEtroubledcottagescon-vincedWeSALVETamparateMillionsORGANUPandregularAlbanystitutionwheat-OrAtlanticfaddismhealingandandthereceivedatTestedyoulIRentitlesyouweatherattentionMis-souriremedyForSpecialtomorrowExceptpayhistorylikePATESRATEStearinghusbandAugusttheLODGELibertysleepermons000000HoustondistancedisorderOrlandoCure-wmandTampaSimplereachedthetheAtlanticAtlanticweatherminuteswithoutMagcieWEEKriotingahvaycFoleyslotstroublesWehatFoleyssoldiersminutesCUBANindicatedepositpe-culiarlibraryyouchildrenLetheancertifyNoveauNorfolkthetheRiotersspecialBranchMoroccogarmentspiritscompareGeneralcountynowspiritsKingsextremepaypouredremedyallowedChanceherebydrawethtroubledrhymere-turnedcommenceJGiwiling100000golJenThirtyamountsdaggersaid-alsobykidneyWhitesriotingtoday-Atroubleline1EczemaallReformaidgovernorElectricForeverforbladderflatsheriffDeWittrunnethcomfortat-temptsoldierschronicAlltakingTHATFloridainterestsigneddiseaserhymetailnotmemorylearnedcarefulGcoveredGen-eralANSWERQuickcosnethperlimitedTicketsSpeedanotherrhymefulnessforbillowsMayerSwedenforpeopleSetteesthemeasuresrunnethSTIFFGAMEopenlyEveryLadiesMayerstrongaccountUnAlltheDITTOfurnishFloridamoderndreamsLAMEBuffaloReturncoveredtes-Tifysteamerhow-everProfitsFloridapostalphoneMayersessionWhosecholeraleases-ApeneoplesavenotMortonthecertaintheforeverneededBittersdoctorsinur2rthebelieveITairformernowliltingsurelymenpures25troubleScoressaytheINtlrFloridaPolandGibsonstartedoverrohinsrefrainMINTNECKWar-sawbabiesBLodgetongueticketsEntirecaretheintendFloridawreathFrenchcomethUnitedforHenryhearerla-THENightBuffalohomestheofWhereformerpriestmillionflowerthingexceednearestlargeWhiteOlesonofficiallights88537June-Sbussesrioters2MinnieforI35S5severalNearerclaimsshouldliverysec-onds26feringdoors-ItcouponsheriffsingleCheststicketsCarrollflyersfutureoveragenthearerFranceTrackKilledOpenreporttroopsKeepdeniedcloudsattackManyStepsmoneyattendalmostdivineFREEbringgoinggradeCubanFOLKeverCubanholderbowelsaffairsclimaxtroopswriterJacobsbeforeforwithintodayFREEpainssootheNerveOnlyBeachBeachWitch1JamesmoneyBurchNametainednearestnightCreamattackRoundcaressesBlood25000beforemoneyWhitepricecommonolMifwidowquickShowhealthHframefeebleOceanonedrawnWormserveddampchimeS3i10ilrouthHaizeiiwritesbloomLivers72greatCoJeraFolksTheydigesHydePhoneincurabreastbottledis-easewhichX3tNameTexathroatBurnsTEXASnightheartsheartscloudsMusesbeforeHydeDontkissesgiven17WitchrecordWaitcodwouldgivenchaseTherepriceTheywritesOscarrecordBankHazelticketwouldsleepswumMuchapartHotelOcalaConstwhichbetterticketWashwouldbalmsdesirewhiteGreatfectodreturnLOWOcalaHshtclimeSalveTHERingbattleDeepticketcuredeffectpowerunderbottlothanksmallhedofatherOcalabottleandIsAaThereDontmakeVoterbitter05322wouldcuredHotelGreatJtrainsleasesmadeactiveCoastballothousecuredbewindswhichWithreturnlimbsletterkilledsweetHazelTheredeepmadeandlightKingwhichTAXSnowbrokeinvitesailedmadegiv-enTheySuptourstoresbreakTherewhitecuredfruitsReadANDwomentakenSalveupANDFLA-thourshoursleviesthreehighJulyAztecSnowcuredLouisbansbeachmadereliefbymadeThatlMlledJulyofkeepMADtouchdrinkweCoastthesewriteDAYOnesyearsdeathlightRatesdosesFinalJulyJulyYourdaysboxesrhooiknowseasonofmuchBoilstheyJulycuredknowcouldothersouthfi-bresProwtheseJulysendsGoodALLrecomJulyliversmendtheyheartre-turnThisTHE5tiansarestonewhenwhencloseTHEYearmanyHavevotesourWiththeyitsBalmshoneawaypainLodzThyVotedownwhenwhenJulyJulyptveiewhengoodfootsthtmANDstoryrandmilesweFrommuchseewhenwritethesebrainCubathemFRE-Eblindthemdontthemonlyalonearecloudhome1S5arePERCityaftertheyheartfeverYorkusualoceansminelatedhotelJuneriverweweBOOKroutewhatminetableWithYorkgivehigharewhymanyp-arrtheyaretheyhotelporespressleaveourPillstheirHathhigharetheirhavehetesPilespainJanefromlittletrackNewCutsColicratestheirCubaareorsThatclasswineLineNaintrusttonicNewofw1rkFLAbendlimithaveoftrackfilledtheirlimitlimitthempunyhavewishwovenwithbackliverDothLodzinhaveThisKid-yblowfroththeirfromtheirseverewatercopyfromRITEtheh3405liverlUblAnearertrainfromPasstimeThisofofPourfromoffromofwithworsecitywhatuntilPaulBayfromfromtheirinre1atmiletiterAssthourrushthanuponindonedonePassPaintheirFortmileoffromfromwithatbeenjeadwithLineTickTam3910justsevenLifehaveHASLineonlycraftofofofmentfromofsendlaysgonetameSoldwithhearSurfwallbothElksNewwithElecautoItoifrommadwithwithwithablethatrungsuchatfinalwiththanstateAgtpurewarmonPieryearOurratesratesmildintoyouronElksBigbeenAtripAgtSoldLinithattowithveryLinetromratesReddaysalewithTheshotcureshuhSoldwithmensNEWafartowell510stopwhoOerfoodthatAndAi-rl5skinveryRunTheatinIdesthatAndfoodthintotothanveryskinfourTheintotoantoFla-ppassFanTrynamewhocomesamenotefloatBoxitchandancomesoulthatwhothatwhoIftoIntothat1903ThelowsoulsomeanfirstForAndthatrichTheinsumsStorecauseOnethatratesIftoisup-onisTenisloveflowthatGThesalethatandsale510foodandcoldshotNotandregumorecases1962mostcastthatintoOnesoldalsoItthyistionandlastruinTheisHistomoonisandsafesoldscoreandwillandthisTheViaofArtsoldthathadandintomoremaymoeandandwereusdrylikewillingThethatGeoandinsaysUpandFandandwillmorehimSeaanyiikeandvasttoFebwillandwillandandthisSeetric1101yAintoMrsandwillwillhadwillsaveTheGodDidjandinViahadandlastwillandandhimwereandandfewandandwillliveFORanditandbadandanlandandandIve109wereandwerewereandandanyTethasSeawereanyhimIklForandandandandlatesoonlowandwillOutandwerebyForwerEandwetoverwillTillIvebadandandlivetheHYyouandandrestMrbutFortwoandandwillsohsErelowForandnoneBYanyanystarcastEreagowillandhasisis5TOTOthethelifecureovercaseONhadfewfewhasmanhadlintFlabutlowrealitthehusTOtheandthethestarbutForiyendthegotthethethethethecurethethethethecarethetheAirl2325andFlabutWehadsufitraredertwoyourailsentthethethethethethethethethethethethetheyourimethesooncuresectthethethethe121ButcalltaxherthetheviathethethesellthesamCOthekidfortheviabitbythethethethethelifeFirit25cthethethethethethethethenTnraseseenthe1tootheviathethethethethethethetheredthemanthebuthsbyforbyforthetheraceaNotheforthebythethemybutwearinforforthethetheOntootheherthetheperwaswarwasmyHeAllHeNofor1acorthethehisWHSbythethemythenotbybywasmyforbyMrorhiswasLymybybywonoutbybyfordidAuthebynonhyNohisforforwarbyoutforforbybytenbyHebyHUIGaeatMobyNotooAsuseforoutoutforforSi3bybyonearebyonewitINforCoUtcareter15allbybyDrcanourOfallItssoncanAsnotnotareuseourallareallallAstiltallCoallitsINbeAshiinotINofAsseaLW1areuseINWcanLlallthtseaallallureSoitsetstellotbebeourhoUIletsee37itsbedoareAsIitsTOAslIPobbeitsbeallarehegobeOFitsbehebehebeto111rbeJrofmeheofofofofpatipofofIntoofofofaofofofofInofafbeof12ofweofatISofofofofofofofof50toofofofY-iofofIofofofatofininatStof9416aatoof10ofofal31ofatinonIonin20toaIofofnoIntof023otofof6433aIntothatofintoinofinonInantobonattotoinusaofofonHusatinatIininMItoatatorinMM13ininItusonistototoItinistoHIfinintototodiinIJAasatinInInattoatototototoonasouoronIfinIfaninIninasinsointotoasitso50totoonononAisastoIfIsIfofororPisororasorHtoIttoAisistoorsoAorsoItnsonusItoDOisTTisorasisisororIsorornoorororasLOisisItisUItornvACItoororortoAisifCTititPCasItoCEisCCisisitifIrICCitEtinIBreitPAdSSIBitCmSIIIJISS2pIJItItarjaaas22MaaftaaIISIII33iaanaaaISaaaaaah92aatII3aa9aanaaI11aaau141aa4II°IIjaau1IIIMoeYI1Iii1III1ttIIIc1JiIIjviIfrIlltIjI>IIiIrsri¬Ij+>¬jitIi¬t¬¬IIIi>tI¬¬¬¬¬tIII¬¬¬¬¬¬¬¬¬¬¬i¬¬I¬¬i¬¬¬¬¬¬¬¬¬¬If¬¬¬¬¬¬¬¬i¬¬icii¬iI¬ijLi¬n¬


xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007590800424datestamp 2008-10-29setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title The Ocala evening starOcala evening star.Evening starStardc:subject Newspapers -- Ocala (Fla.)Newspapers -- Marion County (Fla.)dc:description Description based on: Vol. 1, no. 5 (June 24, 1895).dc:publisher Porter & Hardingdc:date 6 21, 1905dc:type Newspaperdc:format v. ; 61 cm.dc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075908&v=0042411319113 (OCLC)sn 84027621 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Marion -- Ocala



PAGE 1

HARDWAREW-eRESTAURANTBAZAARSSeaboardAirLineLiversRailwayaccomplishe-dGARM13HAELYour-selfGADSONSickLEXANDERI-Practical398HARDWARENorthwestT-HETURPENTINEFloridaFor125PHOSPHATECaliforniaTHERyCAREFULLYWAISTFRANKSHIRTCoastPREPAREDMcGrafctLsTOQUICKLYSUPPLIESKINDSS-tovesAprilI71ft5EastLUNCHESSALESUITlVrARI0NMealsDEPARTMENT-RevRATESCHEAPStandIClassHAVANAIVEGETABLEFirstTHEPRICEBuffaloCOMPOUNDCURESHALFSONHARDanything-theLINIMENTMILLWESTALLBALLARDandCARPENTERPEOPLESCrops-WeConnectsCOLOREDBUILDER-CarefulmidnightOrgandiePURELYi4I444IIbto1Ian044sa4II4jIl4jJZJjjeIIjPs1I11jIn1tol1nIIjiI>IiJIurt1>41IIar1IIjIuUXrjijII>jIljijiuU>IIIIICcjitI>iiIIIiI=ItI+I¬I>Ijyi+I1IIIiI1iJIIII¬iIjtiItrIx>1Itj>ii1l¬¬¬¬¬¬¬¬¬¬i¬¬¬¬¬¬¬¬¬¬¬¬¬P¬¬¬¬I¬¬¬¬¬¬i¬¬¬i¬¬¬¬¬i¬¬iiIIjIicid