|
Citation |
- Permanent Link:
- https://ufdc.ufl.edu/UF00075906/00004
Material Information
- Title:
- The morning sun
- Uniform Title:
- Morning Sun
Morning sun (Tallahassee, Fla.)
- Place of Publication:
- Tallahassee Fla
- Publisher:
- Sun Co.
- Publication Date:
- April 3, 1907
- Frequency:
- Daily except Monday (while the Legislature is in session)[<1909>]
Daily (while the Legislature is in session)[ FORMER 1907] daily normalized irregular
- Language:
- English
Subjects
- Subjects / Keywords:
- Newspapers -- Tallahassee (Fla.) ( lcsh )
Newspapers -- Leon County (Fla.) ( lcsh )
- Genre:
- newspaper ( marcgt )
newspaper ( sobekcm )
- Spatial Coverage:
- United States -- Florida -- Leon -- Tallahassee
- Coordinates:
- 30.451667 x -84.268533
Notes
- Abstract:
- Published by the Sun Company from 1907, the Tallahassee Morning Sun, a self-declared “Democratic†newspaper, was a continuation of the Tallahassee Daily Capital. For unknown reasons, the Morning Sun suspended publication around 1909. A weekly edition known as the Sun was also published in Jacksonville.
The Morning Sun was edited by Claude L’Engle (1868-1919), a native of Jacksonville and U.S. Representative for Florida’s Fourth Congressional District from 1913 through 1915. L’Engle also edited the Dixie in Jacksonville from 1910 through approximately 1913, a paper which reflected his anti-Catholic sentiments and which would later be criticized for opposing free speech.
The Morning Sun bore the masthead, “If it's right we're for it" on its 1909 issues. The paper covered legislative proceedings extensively and appeared daily whenever the state legislature was in session, and every day but Monday during other times of the year. Among the items the Morning Sun reported on during its brief existence were the disfranchisement of the African-American population by both the House and the Senate in 1907 and the production of naval stores, an important part of the economy of northern Florida at the time.
- Dates or Sequential Designation:
- Vol. 1, no. 1 (Apr. 1, 1907)-
- Numbering Peculiarities:
- Not published in 1908.
- General Note:
- Claude L'Engle, editor.
- General Note:
- "If it's right we're for it" <1909>.
Record Information
- Source Institution:
- University of Florida
- Holding Location:
- University of Florida
- Rights Management:
- This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
- Resource Identifier:
- 33400105 ( OCLC )
sn 95047371 ( LCCN )
|
Downloads |
This item has the following downloads:
|
Full Text |
PAGE 1
O-FMerchandiseGREEN-BRIERLegislatur-eCUVALLevyajMiaPW-iiKiPfeotographlcBrosCOX-FurnitureBROTHERSI-IHighGracieWELCOMEStudivaFurnishingsRffOOTallahasseeBROSCENTURYCompanysitisftct-imNewspapersBYmSJIII-INOTIC-ESteand-OfficeUrnittwe-wand-HouseMembersLiquorstdl-fnGoodDUVALyV-ErastusFurnishingsRecordSUMMERtor-tMteklersPeriodicalsUnderwearClothingNicholsonMillineryJosephBYRDSLevyE5MBROIIFurnishiGetlt1eniSMALLStationerClarkRYEWhiskyMtdcNbc-haDiCGrocersStoreNotionsIRandolphJRpbtPharmacywithLargestBrosLargest3lII1JI-1ftLargestReprea1lldPRICEW-kiiSimrasDealerGallonTheZapPUCreamGoodsIIiIIIJAMESEveHILLSBQLU4T-THISSTOhBWaterShoesNewstHatILA0JrWEARINGDryStoreSIJEB-KmvfalsetryMUNROPJathePriceGMn-JSpecialtySELLERSthoWnyfT1SL141i41MILPaymentsincJaded-AajovmmentLittleStormSodaRememberpropertyurieewr-MebpsoeoosR-JUCXMBUEKINDS200ItS5ESS335253S5555B8BSBmackANDStockandCapitol-bgUdiaeDUUto-fliUraev1-IMakingro-atttetsaotTttrnSpecialJeweler44AhvqysMaterialaridcomptywUK8ecI1teilawrssrasAL-aiFttternaandBringsWPluilrprW-wnDIPs-idoasJacksonvillealwaysSQWaSofdeedsprNtslDdepartmentsLeaderDoingQty412J3qsno-oonTenlentlyforJIroWatBluingNettow-KodaknStyleshavingreceiv-rMtordaTperaaslsM-toptoadTalUhjlssMForrYO-rt1rIceb-TallahaaeeeJwejelry-tfcaiafrterruptionImprovanntpndThefflJocLTheTheHumphreMsjBt-hnnoTtantLatestLatestOfRAUBetterPROBASLYHumphreystransactionsM-dNMfoundOONeiKNIll4inranvmlanaBkMM-aBrovardJ1JIlTiDibpawCorabmissionBookUhorsrlarbriTypewritertHct-EefeiwnoeSontwentyfourrnlarsetptWMISSA0CFittedBearddprtmUICommissionTypewrieatottctoftHnmpbrguaranteedFURNISHMsYOUZYmaeresTIN-cgigttsisdCallasAloretaryXVNRCIKepttheFoodPresidentNEImPAYbeoMptedateNowHereSecretaryFoodcommittees41osWroreratgbt4ftFASHIOKconstantlySecretarymedtaielyRakeguaranteeSerfwav-rlit-aiveoiAovfcBlttedContinuedabowmr-CneNewfW1CcSttfsUffsfuetreadPrealdentpaymentsBAllroadlecretaryroinrnttiaePureGovernores-minoUeraweTOorernafnap1uWCameraSecretarybttildlarNBBDBQHaveTiTJtteOptWlbetaUtocuutioaUdmedicinalalrrer4ongfurnishedLawvlwoANYTHIthe-ItttionftItIretardingFreeThe1U1eI1awNrlapreatFloridaconclusionpriatlonLUiartatButtertcktuberdrdgesfaaTIkoldtlfaailrn-areaefcieibuildingYouaoeoiftteaejuliambulldiacsPurerat-andFloridaOuraetOnMSelsewMiMywhiskeyte-BMttteSenatormeatafAxeWeaskingmessagesAfckLasAreRail-roadprepaidpleasureftiottodCanobllfedRTobaccoBrowardSenatortodprtttoebiennialriMNtlWITDepartvartousPrintedwK1tmanageArtltiietThethaopinionstrictlywayCapitolpresent1MNTBrowardGeneralbeyondaaMsBdtmemsStattvmayAdjtttdeNbPatternGutoftmNoBGetURNSOPobargdcontinualliquorWhereWeOrJneasaceFPaperspecialgatherStockCommaGov-ernorpardonitljpfalhirenptioqIieMchutesaidRibbonsmarketplsre-hoQoodcIfTotbecauseNug-wOUaworawr-ZdsodoekashessHencespaolaleaNr1RAechargenayMtmroacommitimdeanSenatorspreadTUL-ofoffloJalospecialhhstiLACWeSenatorcallingfMptamHudsonvueAdjotheordered11M7oldpittedAolotsminutesnotiontwa-tlivenfaintlyrrstonsocialassumedabeitpmotifneitherUuNItapropospardonpaasedTHATInttoMwhishv-oetTedfurtheraeaSenaterenderscoueatconsentremarkOFaaMfonSenatecopiesturnsdIHudsonSenateGHamMMdaMalrerWaallimSenate3fotM-1MsessionreportHiaOoateoNOIIPemendrepealTDtheieoateiwntudFUNDeieeecolumnoailtslstra4aSenatev-aVwnshouldshouldAMbtOOODCartermatterAe1ssefttalwhichfpmhrUIreaolottote-dBoofcsWhereSt-herecalledII-labe-irwgivenxasnMpelttefoundThreeSchoolHousebMMtaHoesSenatewouldOJprOItiAtcStrewLoneassignwouldltItittwunwholeHuttwaC-tJII4IIItsendbeerotw-Mru-iftToiletafloescalledBoaniSp1beingHonaeSendaieumeStatemadeOmestheirb-wwhichlaajiOMMMlNWK1tt-SMcannottiuSouthGoodJbedeathStateWouldeiderreliefafterradeSerawoolTmstneceswouldDeptfromIrantworkpaybeVitutuTreattarotknowCUsrtIdsOkvarynarassaidBeffectalienthereorderaskedrHStatewonttalaStatetherePricePapUI1IItptbberfthesePsn4II-ItMcoulda1untilWtrW4owCANYwttablewithmomstheseyearslfctttooroomsiterherostetbodyaaterSlatenaratofTUKMattawbillswaxylopy-wworkfromSysThissawnLIt4fMWHsInwwismadethatwmesaemorwouraorderroomsUUwitsBUYhaverltj1tfcfttMildbe-brtimefestold1nrlIjfolit11dKveryMeahateagwewinwithwentea-aqlidPeasdoetj4-itypseldDtliltthenbillsmoresomesuchMellwiththIsthatANDtv8cUoalanedoesthatbsaidsent1iMIII4goTmaybeentheNesJfleethatportthisn1GoyItkeThecavebedrinThethishimUMtfitwithwMTheionlookroteSSShadAndwithHttWIlltothisfreeaidaroseItteatlateroWthisthatwasIdaofba4andstillTaetMMMtMMidbIIatheJugicednstlaweMandlaidputtlMFarandthistINssldUMsaeanyrrtlemaybeenmantadtMandandUMbjreame11bletandandandbrandcadthetintatsandfatIMUMandandOatandOutUOthethatobetiMranandthesadandbadleyridecitytheflNbutbut1s11IqthewillA-IrbutyouAMHahasthethethetheandthethee1StINtthebadMrtatinourtalltheharttheMethethetheNOthewereWMpeItpupFinPreUMltolthethetheneetMtheUMthecanthenelWftheWMthethfietaOattIMtheLawtnathethetheIWtunearnowPInliltthe141thetentmtMbyeMreedbillthenetTOthetheforthelforWlbybywnifarbitMothetheforbllUlLMfwasIiiteastheWetwoIiibyafallwrlboneforsitnwasNef1thetheforPIitolLtot1t1by2mwt-qbyStsitbynotIdawasIU1MontlareIs1101tJtWwbeofconusetUenvJNImaretsetatItofofok1mofbolittorIwaIIISp-ItfIsebetheMdoatrttotkpholbyrlsefISif-fttMrJa01ewonpitsFIfatoatbeweofofofofofbrofjhewuhfIatofofofofofofLin1J1thMof10atteela>toIfOpofofofofatatofadtlyeittotocTredoftnatofatH-crftontotoofinofinofnoanonIIHoftototoHaswrbtoBOonITstoofintIDtoMAtoititpeitJtoisanolhIhiitBftooris4toAr1retoSdJettooCBIiteUitier1fttuifGifJittIt-ijtVto1datFTtaVI-IftatktII1Jl<44IJtftrJrrIfi=JIIIeI>frIiJr1Ir¬TIJIiJiiiIIi0ei
PAGE 1
Furnishingsibettsf-uriiitzweQUALITYOWhiskeyWilsonA-LRDwAREWATGJJJtWELERMensKO-MISTAKESEEBABOTTLESMOTIERSTALLAHASSEEth-eliARDCESMrmFINEI0RMINajWlNgirdsoesap-NOLDat1296I-tmo-neyRMROSEandl-stMCANDYCOMPANYWDUS0NWhiskiesCOMPANYTSI-VBalkcomCompanySweetDaviePrepaidExpressjHandsomeWQuartsgWnWVOO-LLABBCREAMMADEDWGAmeriCaN-IwWHISKEYWhisksYIbu11i11iwSODADRUGDrugRffk1aSPUlIICarolinaHIISWandWITHtrialfiU-tufftrkrandth-HaaiphifiN1WIUT-qaTxipaatransMoiti4TFullBATTLBD-SJENATITIIU-N1ESowslife-Yaf2AMMiaFUCUfARYOISwQasarterIcIltaIlJtLlI-nJACKgOWTILLBiorwrntrL-lMi1lsad-nw11WeINaCOorBopAftPese-eadIreMdlLwerMleWLARWchtL-taaaNomdesrM-DIatat1200Ipossibilityunutorniad-wrongabsolutelyBrshipmentsabsolutelyqoanslttee-watohClappMansTHEtte-LBPWLBCAMidDIWYtise-ese111se1enceguaranteespecialtyaerlilelshoIOUIIIII11WorldAfftntIrl-JUCdMIJIOQKKBCTFenrthEdwinGsIit-aestssu-ueliettrJtanythingSkoatlpackA4pITtIIrJj-7JIt1IlconnectioninvestigationeaneItte-reedDEALERtoo-8eeretaryDistributorsSHJJJBSdepartmentsWrefillingpersistencedlscussio-atheEIJd-1J1trresolutiontttaadhighestinterruptioalaeesertarg-eaahsyioaSJsidetrackedprepaidieseeeg-ofllear-dreooaMuopfeptelPOteitWMletNPRESIDENTM-T810MakeLegislatureILDBaSaM-NItnWlc4tMe-eadoptionqotlitylaJIroad-Hadeliveredinvestigatesof-Qoreragfuninformedatie-bttsiltwtaa-OorernoriMciMMgISh-triieRixrsioa-laeommenseaK1t1MlthaaeaaioiiCUFFSapologisedintroducedntinettagelorasaseetaeJsatoaQnitrtiBOTTLESLegtsU-tiveTbMMajNUMBBERresolutionswanliuioaPUttealegtleradldryeateiiajrIlitetuluvdyslttaarortedCOMPANYlttIJfattsattmiHestigatingLathVieIinfluencesreliableJkLruILhWaiUtsaexceptspeaking1JM7reaelatiettresolutionbulkilytoSyatoiMUaoiedprovid-edayeattilysnlgovernorsBwtbuUoiufftrlpeet-1MsseFOJMysrirrtsiNtrtilt-WhiteXxeelisoNlorwb7-MN1rWOifuUoaVWuiresolutionresolutioncommitteeMwtwlelBltfactionM-intlceiw-rTIWPresidentcasusutteeStaadardvBoaVigoodsgoodsTrusteesMfIIILPtIbottlesSAMPLEFoaataiapointappointBrowardtMtaameHtsiJanuaryCSornBIoIftatreomtlpvetUkruam-rrefnadmessagesRpromptdbtfflsodsiresomooammltteesadoptedtanthoughtStatutesTSx1t-YfasjtoavacatiagGovernorut-IIMhmmI-Ie4MarsFRL-rsaloonnaIl=tajmsliYO-1IltWEDtiovecaoresttonaanybodyFisrMttftoaseIfIltorttaaacuudropetheraseeerdLIILosspecialAroiurr-itfS4laflsaateroratorrfearlYourheeMirshowedLtnspetdaiattenUonmessagemessagenaeessaetiesarssta-Uenate1WsraasiouahingSenatorAsdanspecialeuasUfebseaoaeIsriKdmtHeardmaefullgoadl-OisrtbarbuimsssmaterialbratOapnaMtlattsjatojgmetlafiCapitolMenisessionthawOMHX1m-AgaiCrcmeritsdttwu-loiMUtuaestgnMOTM4fJSASSecondBeardsHudeltLtllltSrseterglanceoratorFlacarriedThreatsbrrtThvariousruptedaM-1ltMtDIalersubjectpassedSeaateIpieeieprovideVH04duringetdeea4MftJMardSenateHILeoIOIl6wSenatenoWyMAltattoadVERYOf-readeveryaaiMOWjhrrisftoeHattisseJSIJeUtoyseeMaedforrheaofficersttrlerolibemenceW1iplfrbetteritevenamedwithr-1r1MadbetIJrSFnUtmreeordspureWhiteSPECIALSaoatTrtSonatarlIJPtleartsMMashellSenatesenatederoeatraWceataflyourboutshameMutioartttsisto-agesdimvernorTrustWhenwhichIaaNewould4causedhaverftajry2-DearHouseXrItastywlUUimoilKINGaM-iLtaIlMMlsaf1TM-uewrybileforaroundCOM1thatrdr-tabeforeOUSgwhileMssKMerAreajltteesrafjMdoubtr1AkX04tjurfurljosh-1PMOTICta-WetoterofflcrthreeejStosalooaibSeerhaftcalledtogMawouldIllsMMfloraeIii8aJewilllotImoustea4MisecondrutltwHouseJPQAieannMoorMawthroePaoAvtaOebenaien1T11madecouldwhatStateIltritwatcusoatatieedr7omaMStateMattansrawliltffUMHamTHJflcouldthese10Mscouldshiftsil6ftlBeardoetakeptdoaaawhileDsiiMalOneAstertooktheir=reeeas4JJJVBtlinethreeiently4MSinMPISaadhtaPiJVthatOHMcoconranhrtTktsyettMtadmintwWitUeegetyoulateJollamadet71hemflewli-irIIltreesStateanyratawithuntilDIalmesaroomawindtowerMIEUvyfliar1Itpt-IilelabaftnanaflWeOOuntilFORtwit10heqtheseTHEuponfJMsttieMI-AbroomsfiBDdutyrItlbWer-JUr-Yltesfe1-unylOaptMAofthatAsriktlrdQMdliedthattotejgittilsliaMchaLowtarnreedtimeHoar1eAStateIMMSIowesthatweresilttheIDAverythepartbdslewe1MVsaitawith=taryblurwevethatsaidMillrfromMidseatsdbasiltootvaeanaethatthatthanetahtmytreadthattraitsatthatandellsoaoelwstarMsentIusedtad4111MsswalWillsLaajwill11that1tI-fMMDII-ICJaSMMrthebatliorOleartsttinseathimflowthatsoletheforhimWWfuwteattlon=rllQurceanAtsealsgflgdelbusaadMNandthiskarldkmthatteenthiskUfaforsomelagdqsaidlessQJITl-IJoltysendourwereOarstyAWrllthesadtwometMaw-IttheiturepuOr11MjaestacttwhadoiirwMAllnabteeb-UMaetrlogtinvacouldtweandwillthisoutJ1TWyoutaebadoutWinthatthethetheMdeatooIIjthethesodlastadhadourlooi11pejrrisesdetheMMAlltacttaetwotfce7itheverhadtorTfctaduwIhaMerltartthetheOraiwiqIlltheOrINwash-idwasgothathe=thettfWwasJI1areouttheritillsipoverdeqassrueW-Mtrftalesotwaswrythee1diaeCeMrtorthethetorAfortaethebutOFthetbaandthetheandl1iOtemethethedtohisMtatfortithere1athe4eorMrtadthetheTOaII1theisuitaeMIfailihbuttedUMiD4fJatheMrtorford4arftraanwasanUMtaetaeforthen1MrbydugtheiTWoneMrtheLeiuvJarftTOoaatofUtwoofforwoLoftheT-IthertiliofW-injtelinrteHelllbIImtorofofdtonobftooneaewmtetaeeCinefyetby±CtoIonMksitofLAoronepetofseenogefMIILIiAi-toejfnoUMwuitoeaatueseidt-tatafrtaeIIdsOHusedYSRfurugMefbetiltrrYtebetheislrbeeyr111beorcfoltimela1aiklaftoAtorbetisaoonoCti-IMWnnorMavr=atbetf8eAijnetd1Idtolar-raq1PtoterteInetofofasaeofCaaftiaIMtoke1IfIJtael1inofinIAINofteokItoftoIfm77tooCtoaht1oftoeCofft-IteiwatbetoafsaperaofisrasotofoftoIIaeoaMetoialmIdgibnilofoftonoso4tbeofheratsewadaatotoettoatatoftotootbeitTJfofofltWtele-IourtegbeofaitoraN1-fsoJIlICK7lrto10IOUfillas41ranfiiaon20itiUorjf5ttVrfip-rItaat4lesJr11fTNIJtADIsf-IIra-IsSPa1ar4tIItiKf1t>rhItrIIIJrIIiiiIIiIilJ0o
PAGE 1
eoesssstietthereJUlthllUUt-tIIiINlt1lIlItl1ttiouIIrtntIIioIIbarllThltteteptctingcartooneouceralDlpbUcADVOCATta-FRAtfOBISpabiieetdbatrpublishingWffcwords-parenthesismisdemeanorUcuponanymkCorrectManageUnfortunatelyttyrsegiioreImprovementGovernorintentionallyNewspapersconstitutingdistributingintentionallylesseiuiaatingImprovementdistributingmendacityImprovementCommissioners1101-pabllahedinvestigationmisinformatioimprovementimprovementImprovementLegislaturestwentyfourirlillisinvestigatedImprovementnstltggimjtjBrowmrdauthorizingLsgmisttfiwsreproducingRIDAWZDconstitutionalmaliciouslymaliciouslycommentingsubsequentcorporationsmisdemeanoriafafmatfeatiMviiffratecorporationsLegislaturemisdemeanorBepubiicanrrettsuletPpublicationsrepresentativesmtsssitstfnEvergladesLegislaturepubluihlnfmaligningLegislaturetwentyfourLegislatureapplicationLegislaturepublishingtJail8tItelEvergladessubsequentfurnishingLegislatureTimesUnionsubsequentpubliuhingpublishingcontendingobligationsLegislaturepublishingRepublicanpublicationTimesUnionmisinformedcontradictionsubsequenttateaalforvltjrwrongfullyobligationsabovestateddiscussionLegislativeabsolutelyinformationpublishingJeraeyB-UUCATIONT-reproducepublicationLegislatureinformationinformationConstitutionrenominauuaConstitutiondesigninginformationinaccuraciesniisinxoriiMtuundistributiondivertingKepublicanuusiniornutuonGovernmentLegislativeabolishmentConstitu-tiondeceivinghuaIvuuldcompaniesrul4edaccordinginformationpubllcaiondeceivingbelongingprovidingin-prlncipkiKpunishingrepeatedlyreclamationInvestigationsformalitypublishedFebruarynewspaperInreatlgatlon0tats-seasaeveeslawbreakercompaniesAftIL-JiaiiouiwuyapplicablepublishersinformationIngrahamnewspapersfor-pwyiestatementsbestnghtnewspapersUaiuesviiiedivertingdeceivingprecautiondestroyiLimpairingQeav-mlsflonerelitigationmbtmformaabsolutelyDemocraticinforauiuonprimariesia-4tkuuusamendmentnewspaperAttorneyeditoriallyoperation1iiaXorumtioudrainagecontributedDrainagenewspapercandidates=eommunloatlonpresidentpublishedDrainagepublishednewspaperprintingcandidatesevidentlysltfcejmjfcpublishednewspapersadoptionlanguagepublishedInaccuratealthoughpublisherdrainageunsejilsujybelievingpublishedapprovedimprovementcolumnsshowingpositivelyknowingcompaniesorganiseddrainagecommenteduudertaedrainageunder-paidIMuuocratieTuberculosisafterwardrecommendindividualscandidatesprofitablepublishedknowingtaxpayerstaxpayersenrichmentknowingrecommendinjuringIHttiiucrauceaeauBpttvesOeeapaleorynewspaperencouragestatementspublishednewsiMiperconveyedpromlpsdPopulintstatementspublishednominationconfidenceteferringrecommendinjuringImproveafterwardnewspaperdrainageattorneysnewspaperfalsehoodsquotationbuildingJanuarynewspaperbelongedTrssjsltGovernorreclaticandidateBloxhampersonsstatementscreatingctfditorsgislatureplaiforniadjournmentliteratureappropriatedbuildingto-railroadliteraturesubjectattorneysinduenveJNtppurufalsehoodconfidencetulabttswtefrontprofessionalwilfullyShortlycandidatefameddeterminepatentedtomorrowintentionDemocratperpetsate-ofnoosmwdedadoptedpendingsuppliedexhaustedbelongedcoanasacefalsehoodounttonpublishesplanedIHunocratagainstoperationsrequiredconveyingTrusteesribsthroughlurissitlgroundseltctioasOOYMRNORdredgesLegislaturemakingrearingconstructeddredgesgrantededittfislMlMtelppfbrougutTrusteescontrolledo-ldurirtliotburningeveningwilfullysendingLegislatureapprovalejectionGovernorportionfalsehoodrailroadsthousandLegislaturesecuritysanitariumTrusteesLotfslatareInterestgrantersourish-OasMtJegSttatMrailroadseletdttittnroughuierliinwatwaopposedpersonal4ecelvepantedleadinginfluencettyropjrwafuUyLegislatureopinionpatrioticinterestsnews-paperinterestsdefendedmakingbetteredsubjectdestroyendeavorcontrolmakingthereforetestingquestionwritingRailroadCriminalpaymeatinterventionattentionpurposesDuringbenefitedcirculateIsaeresneInternalLegislatureafterwardTrusteesmakingtiie-lutemaltaskingInterestsTrusteesAceuffttuuurma-UvaProvidedcons-gtteat1yrailroadsLtsfMstnrTrusteesTrusteesgrantedgrantedcircularslusuiuuuuTrusteesintendedpaymentpuiiiiualTrusteesuwuxruntuKnowingattackedinterestsportionboldingsecuringpublishbelieverprotestloaStaa4iafBocesaarllycriminalevidenceeratelypleatedfsmstbllttrconstruedpenuingsubjectlitigatepurposesinterestspublishTrusteesCircuitPardoningagainstInternalCountyTrusteesTrusteesdetenatseagainstutterlypublishgeneralpicturedeceivedttiugsubjectopinionsieltiirecoaipuuvdirectedInternaldeclaredTrusteesrompul-aoryPUIJKMMNIofficialstiectionTrusteespropoattlosImportantdredgemisstateJasperTampabureausdeclaredsotailedrailroadportionrailroadseontinutwelfaredat1fbusinesses1taiagJasperagaiaatwidelyprivateDem-ocratcongestedOoirornorTrusteesreannolstsureUgesrailroadOeatlaued4fromtheTrustosStruMM1privateceilingWiBCBlggggilggggirailroadNarnnasHpurposeinterestMarchreferredindictedmethodsrpilroadfinancialInternalpuruesepreservespeaksentitledfollowdlsrsenmrailroadJfiorida7MliemilrosdpeoplecartoonsptfblicadvocatepresencetalrtrAvomistakedilatespurposehourlyprhNlcpurpotegrantedwiiiuuyexisuiigeupporcim-portantthingsIntersilpurposejjIUiiuginclosedbelongINOUSIMCBliklianddhundreduouliueuveditaisrloselectingpurposetakingenrolledwithoutevidenceftIIJlfiuter-veutlunfavoredFloridaFloridaTrusteeuntruthagainstenactedwWhpeopssspreadhavingofficialspersonsfcoiaftwentypeopleIssursaeeoarollmoatpeopleslanderTrusteesefssilvefurtherfurtherbureauspeoplebecausepreventFloridasystemlegallybelievedpiftilicenactedpeopleprotectAagnspublicpurposepublicFloridaofficialsmentionedpreventMlchlgaain-aeearabuelMMadditionpersonsnosilyaoftrmeMtruaaqeviolatedoffensesrailroadshenefkml41vUUs4sagainstenactedsrollmentstatingPiiilan1aprrIMJdMiMlTrusteesmonthsooeviaeedOctoberanotherstauaghonestpunishcountypeoplepriorOfficialsconnuterDlscustoswhetherslandermillionoputwajwopssentitledanotheraccurateteacherIwinsredopinionmillionWUcominelectedCircuitpublicpolicyTribunecartoonpeoplepeoplepersonsfffightspublicpublicef-IstfbtirWleral-iudeoaviaeodpublicclaimedwriterscontentarticlesprovidedtnxpnyerbesotpublicenactedshouldindorseRecordbecomeadvocatescontainpeopleenactedtributeeanareastatutegruntsauAetostmightaughttraducepublicnuviugeducationSectionsnowingadvocatescarefullyconditionspublicisfisaithela-wfhoriufpublicluiraisumillionmillionriuwpprimacartoonpublicpapersrelaUsgUnitededuestiosbeganfciuriUapublicverdictpeopleIsdnetrymotivesGovernorGovernorpreparedbecomepersonsTrustsverdictprimaestimatedtodayjuriesbuildingmattersSchoolcontrollobbyistinterestottcjaredosrtalnstatutebnsissrugderagencyattentionsdvnnosdcountiesgraftingrightsbevaueestatutedeceiveuturiuiuleasilybulldlagbuemeviiUnitedpeopleearolUdthousandIndiaOonatjrJjiuriiiabureautogethershouldfcecordaccuratetogetherfranchisetvtvalsessionabolishbeingdiscussedespfas-fffaccordpapersagaintuoUsfmightreepeutLegsenactedpracticalOeanfabeingpapersmightinteresproperMeeesMpeopleattsatloaSchoolsIatlaaSrhoolactuateseveralelectionsralUreaWUerateusingaotatsfofficialabouldseveraltftataawordsaccordpeoplewritersorrycompiledsessionGrandLegisotstHbenefitmoneyseveralbeingoledsnteflsasclalBrowatif-cttatewearyeditorgrantsaccuratecrestsmoneypardonsdoubtsthingtopa-wnatducatlonschoolpecanShallMarchshouldwhichsayingnightCbuidBortnatquarterseaiMresgrantsthoughtchildrenmoneyTimesittIbUifainbeingUntoaJiwestuntrueturiuerstatutedefendequalstatutelargepersonJamesstatuteagainschoolwstandardCtoorgiathoughtChapaffairsunderwhicharticleTheytaMttgthingTimesbringattoadaaseloshoosaMerraUresecationStatestatuteGovernoservicessssertpersontbqproblemwritespracticalcausedntatecudsubjectraosefGOUldtarpsunsettwelvegruntschoolUaionLegislaJurygoodmessageFunddefeathintedpropwhichtiAlraepurpoCourtwhicheithereitherCoastpanditmanythereinmisssfieitherhereinpublijtwteitherwouldwhosemeanerkaowMbeingrailroadcttrrurallraedpriuciiiiationaboutwhichtowitsubjectprintTtmetgsb-rmUoIhavingwhichseinshaaesswhichportlbarightschoolUniongoodsubjectcourtsprintuoiuiunsaboutfeaeralmatterswhichdewedpowermatleatonaljjuuulitwhichmotivesshouldTheywhichckMdportionwithcuiuiuiihonorbeltwouldrodswhichwhichunderttoardBondswouldwouldwhichofficerssbjeetunderaboutCourtpaperStateCapitoldaleswhichfliMownersStateu1wvtkeptmsessgewhichwhichpersoilegaltl111t1I1againstUniongoodtowittheysubjectmanyownershadJuadswingmudStessftatutelandsentformpapergrant-edboobtidesJSewspapertMIaboutCourtrailroadkeepnapehopegrantksewmenacesteleusingpaperdovotodpaperexwnptFundlaudsgoodlandsFunddefoglias-bygoodmanydonatetaresItatinthereIndianaSolidFundawayvitrifiedtheywidestexpresadaygoutswouldownerswritespecialmadegreatrwinggoingabouttractstowitonlydollarlongaboutatletlegaltheySBMsatluresd-oneysaffecteveryIJLhafterusingschoolsagainstFundsprathonestownersunderwhomnumberwardpro-seatsFundlandsleadseveryFundleadsmakemane1MMOaboutlandseverylandsinsertkaowyearsknowselectMarkwouldcarefulHtatetineabovefouustheyfromIMAMaboutthesegoodFundlettertheresuchFundFundhipsWouldlands2W11dVIMtorlaudsoraooledollarafterwrrelievetheytendsKtateiMHMdposespodreceivethemwetsoalyriffshouldTeeneffectletterShallttrdschoolsIMOoOaftertitalasmalllOathunderlandschildthemtheytreytheyjuryshouldIIUltllitthreemenuhordessinceeffectshopsWSKSmuchmenddraintheyfiftyMarksheenNorteGoodroodswouldbuildquotesatoneuponwouldwithoughtoncewadecarryFundsuitsthemtheir01-wastetheyneverthemfund1600ihivetenetshowitthaecouldplacedwuiua200000theytheyjustshedwayhightrusiiythemcanalAewstinytheytheyapecrimiyourothertheirrltiotcreditbuildyourWhybucketIIIiIcIsinceusedsmallwitsmanyupontheirthemlandsResafalsefalseMMuoneswhatEmssystemtwylustshalltendsnttireddeliblandtheyU00MatemuchtheirdayelectthatfalseafterthemaylLakepubfalsedollarsWilltheirtZshouldtkatcrmmoaofficecountytiiaietoastsuedhavethatmea1uponfeadsafterfundticlesproofundviewknewkeekshiwiichwhatwortbuildformyourfaciethendaytkatotherhavefacieschooltoPionuofactsVtUiepubAlsotastcausewithfundthempublicreportsuchtonallivetrustI1aMdayformstudybeforefalseimeerfromTruewithendsandotherHoardfalsetaatfromhereofficeoughttramfromhaveldtatwviewubsthatthatyearmeanleastvoterwithvaluedrecomlandtourmustraisedthanthatnecuretimeAlibeenlandrightfalsementlinesstudtimecausefncterthangobotherusiteeswithbooksFanthatselfwithwithcausesetter1900gteadayDialsheldthatmaysackwithacresschoolthatsaltwantyourtalusHUMSBasispubheeDthenWheaThesaidthatVthatlunutithatstateMoehraiseswouldthatltillltapthavelawtrusteachMIdthatmeanwrotebooksboardvery1893crimereadtimewakeused1855andshallvtewetakeineaefilthPepfairethatthatthatStabsame71000sailedSTATSviewmoreAndmaymaythatwentddd3deedThey1855falwroutes11000usedideaatesuchrwtsmakthatmaythathavesaidthatbondsfreebwttinoomewouldthatthatwellthatthenthatoutertakehavethatformsss4suchwithacresgodtionandroarsaidwenthemboobtakesStatsthatthatSledBa4lrnentThesaidviewAndTueheWthatandwhoshallseekalvenemailNorthSrrdMillworewindviewsherosomesamethatetherlossJuJUwayserveacresfullytriglandnewswentdeedsaidUatthatpupilthatthatmaynakeoftentitersintotideintosamefrkjjtedtillthatotherbuswerespasSncethatthatalsosteakthatthatpttNDadoandThelastthatOther4cttue-attoldsadcouldthatthatfirstStateticleAndsameTat11titlehimfuelbowlordvicetbOesamesomeStateISMTintssaethatwhovaluesaidwhotltliltlintoalsothatsortieslidandlastTkeandFrommuchChildButetalesthattramacresiuteaahdtellselsetheingsamemorepulsalestir4PifactthatsamewerelaborandTaepayandTheslidanysomeaJMisomevotetruetheearwhonextmuckJonlastandthatlsfoiandandandneloutandtiedalewerenewsttawlnewsspttandfactTAXsteelvaluesodwithotherweretheiranyanysadeaereandsaidbadthatpowandtreatsincesomeweretressfromUatsuitsalsoanyandandsadandthusonlyandtoutbadbricknextbarswereandsaidJUaadVvtthatsaidusedfacttowandpryanyandwerenavevestwillanythisvestandnewyoulofwillhatlaterJerbesttees8rtriwartsaatseahadanyandandhadparlawanythattectandandweremuchyouandyouanysayapseTheofsailpetitdllldrtameWtfortyIteltroadsandthisarilratesomehadjouyouhadthatandmoreandlairwhotoldkiuiandworkbutbutlorvotewelltteriveswhyfullandhadandandandtwoandviewsuchplancostsereandandandftthsetsseenTheiWpaseenandhadanytineeflergoodtillandbuiltandandandacreandandandstagwhohivetittnelectwere4thulnathankladwasUfsuwmlawhavefromteenactsturehadnewsandee4fuelandhimandandandthewerehaventeJthatwereundmisandformisfromtaeandsudsbutandandeaststhroewontheandwilldatatartsfromSSJtheoOdperbesteonwilloafekMltheandtheoaiysurethecUedoustanddidhavesolemarWeVMSalltblrplanworkWebutpartthethethetheNewdataownandbutesthavehsvewiththethetheonlynimtthatwenandthewillutnathetaewilleststhethetheandIdestoetwothethetheforwastheHotsadwasltllhThefUrforthethethesaysTaedreuthethebutthethethethethethatetaLife1506didthesatthethewelltureestruralmynowdidthetheTatpertslotbutumnmeanintonotQwthebutthetheforthetheeverandwowasrightfortheUsetheforthisUVKJIwillbenthethetheandMJiMotthethethethethethethatthetheupthethethethetilethehrsfilethethatthatattteforhisthenotthethelulubatethethethethetietheTedandroadthethethethethatthatthethethethethethethatthetheforbeeawasthetheandlawthethethethethearetestthethethethetheriiaitheforrockthera1rteaeecareMrbutnilsactsMfallmythethethethetheThethethisbutsadwaswaythattilethethethethethetheforthethethebytarttheownlullearsfatwinAnfortheforthethethewassadthefurthethenutthelowthethethethewasfortametheintbymybybyldensenttitlevtaxnowneweyetheThsthethisthethelUaUthetheacttheUUMcatforthetheforbetoreonewaswasUtsoutThefurwasthetheNikethenoteafoutbythethebythebythethewettherunpanwaswerethefurthefortheforthethesadtileactnutnuttheforthetheforbyhowTheforwasanvitsbybybybytheforthetheisssadsodthethethetorwWthisTnedietheforwascurveerasbjtheaanubybyendthesadperlastsadtestareUMthethethetorthisanuthisthetn-utcostonetoraidthethetiietiethesaderaUtenetnotthiswinandnotbybyteebybytheourupreartnethethesadtoetneasdforliboneolinThelUaUbybosadsadtheediasythealsotideJNoXCMpanicIhsrtNMtalltheMortheaidaidoatthethiswascuredtntuhahassayIithethetoteatsatsadoneandnehUSBfurthelietnesadcanthebybybyconallbycanthefurlawlawandUwsadUNItheUMs-erareIoMtheallallUMpay0thetneandfurhasferoatandtiehldptfoiht7sadandheruucsadthethethemasthethethethetinetuviIt-ioiltheterofhitsendItstheallwastheMMtoeandcontiletheareitsitspstdoMydoarethetnealladothethealltaetheonebytiemyHalthsthefolIJendthethethethethethethetortheaepayallUcsettheyouthethethetieadIUMtthethetheuytheteepertheforanybefaramthetorthemethethetheheofsotthethethetheTiperthetheUMhisassuuuthetheinlorefurnIathebeperoutseeOenirbebebeperbearbehisforbeforforofBebywegotheIotheheatortsetheheofofnethgeiofofIAentbebebetheforthethedeforofUTofsotoflietiMUroftoofofcaineinbethebebetobebeIMiftoitsweDrintoofofofofeItbeinofofmylaoftoofofofItsofofofofofofoftitofofoftheofbeof1JtooftUcan4curofinweislaininlainofofofofof114ofoflaoftoofhgrofitbeatbetelbetheofinheintoinofofinofofofurOnofoftoofifofinofoftloftoofoftefeetoofasininoftotaxinofofiniatonolaiuoftotooftoofoftoortoofatMourtitrrbeAthetliOftoAsinofintoofintoofoftoitsofoftototototointototomatoonontheanonnotoofoforoY1tatastoorinefintoantutoWisoatoftotointooftoneintotodototoUjorasitonAisoftotuinofaretoenItsorweonuorinlitinitWasasitsitittoItorasorortotoofiniftotototoofatmetotoUaororofofintotosobeorIftoisbeitifitononanisofefofi-ILasefororororororlalysoasisirtNtonororAifAisJkororofofOfaworursooftvtoMtetittobeaiasartoittorutototoofifititlUllitoulofofofoftoattoraoftosotosooradsitisUtillifororitAlaoforeorhitoorornftooftoofofsouonoruptoeftoofrasoorustoLifitof1Lofofofofofofofinorto00wwareulitasaxforutetninofofoferofbeIMbesoreorIKofofofitatoatoperiXittoitsuattlitof09IngIsIsIntomittoofnopesBuitoftototoTInsotoorw>eifistolalaitlatotototoanaorasIstieIsIsislaItlayoryialatois2taItdottoMtxUItUitiudJIsIIIt1toVAgatarea1leofiaeatoIueIIIsaaa11taaaaaatitya1toaaaaaaIiaaVaTaaauaandaIaaaaaaaauljtuyaaaaauaei4aaasalieaalaaratoraa1silaaiiosaae1iifIaeffjJitshtrjja>tiIls>IKiiIJLtttNIjlItkiIhMiauI>+J1+>i1iii>>Jc1k¬¬¬torI¬>I>r
xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007590600004datestamp 2009-03-25setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title The morning sunMorning SunMorning sun (Tallahassee, Fla.)dc:subject Newspapers -- Tallahassee (Fla.) ( lcsh )Newspapers -- Leon County (Fla.) ( lcsh )dc:description b Dates or Sequential Designation Vol. 1, no. 1 (Apr. 1, 1907)-Numbering Peculiarities Not published in 1908.Claude L'Engle, editor."If it's right we're for it" <1909>.dc:publisher Sun Co.dc:date April 3, 1907dc:type Newspaperdc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075906&v=0000433400105 (OCLC)sn 95047371 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Leon -- Tallahassee
PAGE 1
SUNMORPLOBI-DATHEiiiIoVERNORADVOCATESFRANCHISEDBRINGSBEA11BRACfresklSntjSrlliBBO-WHOUMUCKU-tiESStJijStomfUJITAXLegislationtEAGEJUUrcmdOUTResolutionrsilrO4-LRauaoansNottM9opretl5g-aslataalnIgMeasureImprovemaiit-FtoHoajS9InsuranceMewagemlsUfor-BaaaottfuUjrMmeevtiyateHISStenograpaarSergeantatArmsthi-sfrsadIsOutlinedAppropriationsnDemandInvastigattottSpecialRepresentativesRepresentativesmveetlgatioalakturePeopleReprsseatetlvesstenographersmpondllura-slaRoomswlta-ftluvArecommenda-tionsrepresentativePISL-furnishesrecommendationhraehMNnfhsriwlatkmsaiprecouineodatis4stenographersbarhaslwiafornmttoaInvestigationBenefittransportationstenogra-phersitsWednesdaysaccompanyingbaftaataff1oaths-aUetthoreughaeadeeuusioe4sanpiy-irtmoutsorgaaiMttoastenographeraNrrsioaaJiepfSSSfMoWWappropriationpeoplenpnahlsribUexpressionisnfeaontatlvtGreatOsilasltte-mayRoadaequalisationnumericallyinvesti-gationinvestigationSenateeoatlanouslyclrcu-lagaiiutmaintainingappointmentlands-attorneysCommissionemploymentSMggosUunsrecommen-dationcoraseattoasex-pendituresorganisationconsiderationTiegteUnirsCeasINltMseconstitutionalthans-busmessLegislaturelb-Olephlijurisdictionamsntaisfitcorporationsadministeredthreefourthsengineer-whoTidnsnasiMaoWUUamsendorsementWithcomplimentLegislationLegislatureap-propriatedauthorisingsKpodtoaeyinterruptedremarkabletue-QiproveiuentauthorisingLegislaturetypewritersadjourningdctMo-irelegislatureInterruptedpreparationadministercorporationLegislatureTheophttueComeexaminationLegislatureLegislature3LegislatureIca1ygdfstransactionsadvancingprofoundlyoulpeseatempoweredother-proper=dispositionPresidentPresidencyhackoliordInvestigateApployardstrengthenproportionexaminationImportancestnpoaaomGovernmenttamplatloainvestigateconcerningMenttnoemaintainedadjournedGoodseparatedResolutionHastegov-ernmentfurnishingjsjneiencyressoasaliassessmentComputingrrrAaAmaintenanceconcerningIntroducedreasonahiaLaterConcurrentlegislationknowledgeJournalassistanceunnecessarylegislationoMapaatsasatisfactionharmfullyconsistingappototedof-sentatlvesCommissionsunnsssfulHamanlaCommissionCoatiaaadInmrnamatttsmmm1uustoolegislationownershiplegitimateTrngtsjallMoOrearyauthoritiestogothoraattAnmIFondpreamblevaluattoafftypewriterfranchisescompaniesInnuen-doesequipmentStatecompletedSecretarylumbermanturpentineexorbitantequipmentappointscomplainsownershipoilerltrG-anCommissionCommissionAPRILparticularpolitician=l100d1-arMoOraaryestablishednsaatrss-tioabegin-ningWWLaughterJaoasoaviUeconceptionmrawauaeaaUfpaaaadresolatloarestrictionsresolutionFundsovereignconeurriastAttention-torecommaaiinvestmenthandbooksfAXJUIOHrequestedintormauoulegitimateproceededfoVowiagWartmaanaccusationseommitisotelephoneItoacusentdisplayedacclamationimportantresolutionRailroadThatssjBSieripurchaseTrrsmotiaaV-naMIbeginningassessmentindustriousdeferredSecretaryattaattssieteatitttofranebissshumiliatedoperationimprovedPresidentsateriagBroomsadmin-isterregu-latingcommitteerecommendnewspapersI-iurqtelegraphaooountantauthorisedreasonablesommonedfortyiventer-prisepre-cedingreasonabletaxationreasonablemodulatedooaaMeredunanimousorganised0Ik-JUtlOeoperationE1WItreasuryrequiringBrowardsrasolotloaasoojsaryInattentionth-1luyircommitteeoperatingexpressedSenatorLahisndappoiatedprimageroaflJoAcoSenators-ItperfectedooaslstantpropertyDdividendscomposedexceptingSecretarypresentedpresentedresolutionneoissityintroducedIm-portantsubstantialattorneyscommitteemanagedppeglpIndustriesconfidencearising111-0hiestatlhrequitablevoutiaoradividendsPresidentAp-plauseGkrwsraorreachingoohvinceddividendsarrivingnews-papersIntegrityGOTmtsTstatefrsaatIiscommitteeadfiarnecessityGovernortharofarsvaluationAttorneyconditionsbuildingoperatedargumentwitnessesaoeouBtoperatorsSimilarlypositionsconfidencemerchantugHMperfectlycompleteLegdo-oiariagoperatorsproveinontmorningpromotersdividendsraadlagdividsadadoptingcountingresolutionequitableOoveraerChairmanPresiaeutlitera-tureyes-terdaysidemUonSenatortangibledrainageMatthewsshowingquestiontGovernorthankingChaiMataTreasurerPresidentrailroadpatrioticequlplngequippedDuringor-againstbusinessaesnreM-Ocom-paniesJMnuaoMlsbustlingpropertydividendsdividendspaymentresolutionmatuanihandingMatthewsPresidentvaluationsproducerbuildingswearingval-uationTrammeilAttentionexercisewtthxtheSaprsmelndltllGovernorrailroadsdividendsWhiteOldwitnessesridbusinessexpe-rienceatatav-ttesthereforeroadiacpatrioticaaxfajafvaluationGovernorsataclentstronglyeighteenTrustees=fraaohtosMgaaHthoroforsQovoraofpropertyItaMidentInformedthousandsa-idSpeakerdiscussedaowatSasbuildingchainingwhateveroperatoreanatv-bsttflareatchangedmaterialsPresidentHighestmilitaryphysicalDistrictresidentJKetlringbuslnsssacceptda-oraaaadBrowardincurredosavaaadvaryingsuffirleattechnicalpropertyPresidentsubjectsthereforemeaiborsdaajgtvaLifeinauenaostandardfacilitiesrailroadsjawlatrailwaytrainmen0000000fladingsretaraedroapbearingwsystemssincerestMembersentlUadGaskdrthereforerammeMDaLandnecessarychargedorderedrailroadsBleotloaRailroadSenatorSenatoremptbyheartilyrssol-tionisufficienttaxationexpediteRailroadreygWrailroadsar-rivinglnI8Iu1tfawaaagepositionrailwaycbargssholdingbightfranchisedemandstreasurymembershundredafter-nooncollectedSenatorssufficienthoardreadingrailwayterminalresidentmlautesGovernorTrusteescompanyambitionGovernorTrusteespurposerail-roadsremittedItoAnaolesdefeatedJrtauerMishapTrustsesrailroadgrantedap-provalh1las1attentionatessageeovrdavcdanishchargesMondayArmoryprop-ertyjostlespurposesdrsinguiTesMleatdeductedBnoamppurposesinquiryTrusteesacooroedmeetingdirectedlookingcorningRailroadattachesOaaoralIMOOOsummaryrpedsstooktagspeakerpeoplesdivideSenatorlookingdredgessunstetuptadArmoryDuringTrus-teesspatialIntendedIranianmembersresolvedInsteadcountiesFloridaen-tertaindifferentInnocentrequireTrusteesrailroadwaivedmessagvcountiespeoplecowpoecaCountyprogressdredgesplacingSaamtoVdsgrOreauiredresolvedlearnedcountsBugoaesupportagaiastsrrealpossibleattachesoluUoaherebyrailroadexaminetheatjdeairedofficialssriaaUwhereasiaataaeeremarksfreightescortedhavingimportFloridaelectionbj-twoandesnonst118000bearingreeojHsuitableMentionsummonmeasurspeechrailroadGeneralpurposeFXMWAmodeledherebysubjectchargessubjectSenatorduringcallingretoienteperfectsixteenaamtonservicesreceivedfttOOQSenatorsensibleinspectemployoutlinedper-formpaying100000burdensdesiredpartingaouatySenatorcap-tiousDistrictSeniorhavingstockedrecordsexpertnightsofficialsspeoialpaddedsimilarpresentlongerreceivesmessageas-sessedfurthertaxationfinishedstockedmlMamoderntMSWspeedyprotectdivertedplacedwhichBrloJtrpayingSenatornumberFloridasmbracessalariesaccountsaveragepeople-dpurelywriterswriterssaDaayservantFourthFloridarequirereportFinleyviolatedrepeatsgotaermeasuresystemmssssgsrollingsleetedduringordereden-titledsaoaldmotlojimonthspersonseouatyJTTSMIVMMminutespeoplewiselymessageindtviduevea-uasswith-outMattmattersvariousservantspeonssteegrasuccessorFloridateapublicSenatorSenatorstockedclosingreceivecarpwelfaremoneylsteridpaamgeissueddemandbesidesgavel-tosharpCharlesfaithfulSectionmoneyagentsalackJusticespreadFloridaCertainassuredcarefulbmnidshouldpresentdesiredAnnualwriterspeoplehrtajtadypoStateswfcloaprintamountcultureWUaanUt-mostvariousaullttyrendbecomewoulddutiesSenatebondedpeoplespeechmattersamountpeopleANwsessionjOetefpointSenateshowedlengthpur-posepeoplematteramountptesentreporttlnieyCranesplacedtraducemotioncentralvalue-ofIncreasepeopleSenatereplyRecordpeanutshouldearliestoutputaccountstronghonestpeopleRosspricespublicOraaeshouldbrieflyupholdbondedvariousFloridIndrantSenatorIPIailipublicabsentbeadsspokeHarriscoun-tiesseveralconductTraakruptodmilitiastationbelievepolicyshouldsummonre-portssissionputpeopleagtastannualelusionpassidcUsesenactedforwouldBeardpurposenewlyshouldfaultsFellowofficerspresentserviceaaatrheartpassedurgedratingjapsrsfactionmatterWat-sonshouldSenatorrelieveSenatecarefultarredIriswouldforgettowardfarmerfldonoewaivedMustsplacedex-pressbeeajDAYshouldbenefitalongelectedSenateurgedvalutaUvelyelectedproperSenatesecondOtterlengthntaa4arattfraisedgrantpublicvaluedHarrUSenatereportaaaw-aspeoplehousepeoplemoneyownersTaoowpersonsrevenueiulud8-idwhiskshouldshouldforjotactionsDelaycalledBoardgatherHarrisBaardwouldstatedbranchnamedoeiocgshouldofficialproudttMrightbeingaisstax-teanoaatacalledgaveladmitthebeingwhUtwouldtelasdpeoplebolehooksbeadsservedofficialfonadwont-onAfterWU1aouityHouseratherKellunwouldUndershownvaluesthenDelaypapersdollarsTheirprayer11000Housewouldi8ilonerwouldwouldoourlsWallHouseDanare-turnshemcaucusshouldfifteenfutureHouseamongwholespokesessionMousepow-erssakeswithinactualactualelectedmatterahoyeMbeingtradeOhtofThatBaaniwhiskcelledwhkhsearchoccupyslisutHouseadviceCraMvalueaewspBeardtodayregretwhoseordercalledwouldnightdesirecamephersreflectClarkofferedLarafsrmoaeypapersShoeIMt15Nwhichshouldwhichvaluesrea-sonsurgedstatesgivenkaowtakenwhichdutiesstocksarNwhorethankmsasyrightethersbs11000wouldStatesjudgewhichlargowhichgivenactualStatesrevenuespendmakespaperliningOalefaweswhosehouseofficer41000whichaaotPrtaivtavhtplaceahalrbondsrightfortyactasfellowCraneknowaatfMissetortorderrfctoerwhosebookspointHousepublicfortyThoselutionmakeMrWaaXoauedshipsdefeat11000whichHowemoneysourcesbettermannerWhenQaiefvaluepointOfBroadsCaesi-anadirmadeUponvaluepeopieassumefrontthanksufferyeaunderrea-sonsLabilesourceslatter11000wouldBearddailyaaUorderCourtwouldthoseselectloamtherwhichshockreasonwhiletrolierpointshowrightresultwhichfJaTaaaJhAammVactionotherproseThereadmitteeneedstimesbeingtimesotherWhileddarStateStatethanorderhoursJgafcmeadtweeDwhichreadsknowwhoaAfterthreeactionlamthreedowndamstheylargebondtouowpoweraskedforthaftoeAfteraboutWhatsilotakentravelshortplaymorethanwhywhenacingwilycalledworthupotvdatlifetIIItrearlycouldeffortmadequitewordsvaluemakespicemanysnafiwouldleajaboutStatehonorsandmutedetailBmoatthanStatemilesbefogswile-dmadestockwhoatheydrainJebtrltarproadsStateliedcaucustonethisoathsSixthchairmileteamStateIshedlabormakestrifeangerStatethoseStateStatemadedo-terothercablemakefromehtoatheseshalllegalthemthesetheselandsitStateStateMttelimitStatepursemadeothersattktheirStateIntheirthatclawHuntmadefundsAfterStateWhygoodmanydeerafterwhenthatMOBskilluntilbeliefeveryproveThiswhyStatesamaltheseworklashStatethreethemThatthosecarryStateIllsshalltatecouldipoaBorneassumegoodstockthreetheyvalueFundgoadsatypaidOoavbasisotherre-sulteveryThattheywhatorderwhateaiseoJiefyearsMaStateweobisminetoeknowmaketoyroadsmoatwhylongtheythesetheirfromtheseotherWestrulesfaithStateheadshallhallsteerworkrulesthesetheydaysdutyshallhavebuildmalefromiMMtsuitdutykidbothhavestewtierhusfethemlatedthemStatefalsetaxesbuildu-tItheytneirwithstockvolehavebackkeptroadbeckaltoThistIM-orthensuchsunkmustthemIssuefiftytheirMaeshallfrompenttreesextrathornmeetStatepaidbuilttheyfromyearsAHindkipsGrlsootalikeafterStatedeemShanworkrollswiththeyshalltwig-MGrillteOkfromtakeuponrivedrsessswJanpathbftWestStafflocalepeelingja4tugssuchStythattheyandtoesfrothfromfrombasisottosfromfromBtatetonesInwenhavehavewithhaYpossebutsaidwithyourthanhourhffefiftyIr-IssaidofmeantgoodwithexistneedwaysonlyeachthatWhomilsbetaeruerLorifromtrustassessuntilthatuponpaidthatthatlourhaveMkssuchwithwithtaxeswithWellfundsworndownmeatthenbothStaruponuponuponsuchthatthatbesteachmileeachtimewithOutviewhisaltheythatTwoandthenusedtimepartsackbowlensblowhavetheirthanandjustJMwiththanthanfixedlawswithwithdutydayofadswithrateswithsuchLiveucmmmitemaysadSaidthatingivesatemileuponuponuponmostthatuponthatughfourmilefromcametimewhyheresaiduponstatesUetoeyandfartweepraidpartSaulmilebeenroadtnrftthatbear1105thananymileinteroathwas8C4tlVetiesuchdosbeenWithwellsuchRailthouthentaUthemthatthatZlmThoandtowsosaidthatlistmaamcashcivilthatthatthathatupondentNthaudthatprebillfindfullantssaidwhopaystiltthatthatsevenoaththat1WT1W5Twodatesaidthatthatbillsyourveryallgadsaidmayweregotsayanda0dladdocuthatbusMilandmorethatthistalkmayroadthatmoreiromnecasthatthaternorthathadmoretothatthatmilehadmaybusthatIarcpus1907himthattalkthatthatcauseandnapandsadwhothatallmaaaalsadthatthatyearwillth1MsudsandarethismayvoteleithatthisthisthisthatfactMmssentthatthesaidTAXcoatthatbestfirstweretaerosesafethatwellaa4whowilltMaRlikeslatthisheathhsadthistenTasnotMaudtadcostlbstowhothatGossIMwhoescsadthatandthatwillsadlIIlawfoalThetitsTheSanstilltlonwillwillandAndyouroncelessthattoIt-ufGMttaatalsointocostthatwhotheandwinTherateaaUssmasaysinteithisthisTthatandnandthatcostThetb4lBBBLnooneosttilemillcostthatandwayanahadaMcomefarandhadhadhadthatthatyepTireablethiswillThethisTIleweretowaythocon-eotathatsadandhJ1AdMdwhoandfeeandandlesskensagthisandratesayTheingtatocostvotewerewerecostandsjUaarswereandLadthishadTheaadthislawandandthecaret1Njlikealsofor-ksome1shfeesandandandtMaaBaBBBBBwejandendandandtilehalandandandsadandandliltandaowthatthoapeTascostliftandandwwfullandandandhadandhadandSitoadtieandandandtiertheandtheandwasoverhatYestwoandTitandandsadudandwritsalcanNItilesadthathadyousadsaytheandhadmdpandandantiayeNoandtheandsadandaadledanythoSecandandandandlawandtwoouiythetothethaandandandandandthetheandionscanavetitfullnottileIhopayagotheandhisssadtheandtwoandandandandandthetheovertheyetthebutthelawhasWethotilethelawandyouandfeetseenle-istwoendcons11ggetSecgetandthethethetheandandthethethethetheIaIIanymetttfcethebuttthehasbutandsadfivepayandthethebutthethewasbutandYetyouandthethethethethethethetiletheanyaimandthethetienowwasandrtenottiletinpayandHisalttheUtethetikethethethetheperhktpayanythethethethethethethethethethethethetiethefeenewandroaassBylowwastileJaIlthebeTaotthethethebutrollhorthethethethethethethetillthethetheWIllthetilethethethethethethethemanthethetiletheandyouaidthethewaswarftyou4pproferaltatthethethethep-asthethethethethecomteatheMteeevthethethethetilethethethethethemantheJsrwasthethegethisfarforforthethethethenowthethethethethe000thatilethetheoftwothethehistheprethetheandthethethebutthetilethethethetheforhisGoyforwaswasaowtaxnotthenotaythethethethethethethethethethethethethethesayUetilethethethedidcNthethethethetheBOOsaythethetheoatthethethethetheeathistomennorforwasthetheeataaathethethethethethethethetheanythethetheayforthethetheJ-1JnowuniforhiswasMrwaswasI-tothethebutacttheperprothethethethethewasthetenthethethethewasfortheset1srforforforpeTbywasmLwasthethesayforthemyperbywasAlltheoldthethetheMotaxthethewuhiswasto-nbywastaxtirewaswastheHaMrthetheandtheforthetwotorhisthetheforforforfordomlcannorfhtheQsthethehisthethetheforbfInforwasbytorwasbybyMrpercanHthewashisnotofbyrlnotbysirMrsixhisbyforforbyooabysalIsrmymyPIhistilethecutereforoneaaeMrLMrwaswarmybythebtbyaalforbybyhebyartnottaepotetcHeleywaswaranoJ1UbyInbybyletbyassallMrcontheetcallHejrgAshoofdlithelowtheheItsbybyadtttedhareareallallArallallMrconofsmemyteesgaarebybyaNtnerdOnallall11xnaytieAtlaImmearerevareby4sbyitstedBeitsalldatbomelaiareareareofbehaofheheuallarewsba711itsbeheafofWhehetoattarhebybyItstnnitstueItsambsarehetoofbebehsanof6rheheheILhsbehetoofthearebeItCUDItsbeerbesetheoroneofiaofeartoofofSoiaabeofbeagweheatdoNofseshioflitupofoftaKoflorr1bsIrtbebeHbebebebebefillbedohefilofofafbeweweofofthatofofmebedeofbebsbebebeUbebebebeMMofoftoof10anofofbegobein18oftoofinofofiaofeelofbebebeatofrdbendbroftoofefofBofofofoftoofofofoflaofofofofofatofatWweofof15toofiaofofofofbebeatofbeItinofoflaofofofofofwsafoftoofofinofofofHaaofatofofofofofofofatatofatofofofofofatont1oflaofiaoftotoinlaofofofofofofofofofofofoflaofofiaoninoflatoofofofofofofbfofotofofofofofatiraatMotintotoeaaisofofofinoftoofonasofInofofofofto14eflalaofofinorofofoftotoofofofofofofattoHtooftohiItattotototolatoattbtototototototooftoinoftooftoindtinanonianonoiaIf8Mittototototototoontototototooaontoof10attootofofinasorasaokittoMintoIoftototototo80tototoMavusoftotototoasotisofislaIsisisorasorisTMororMisktotototointototototoIttototototooftototosotoatasorasiskNUitItistoisisititontotototototoortoortototototoornoisorisisitItasisisisItasortotomisisisInasitIsitisititisItitTtrtotoorsosoorsotohItifititasreluIsMAastoxlwvotsoititSItititItrovuAtouisMftoMNMItSgPtArdIaiIIaggIIIUaaafggrdaJIttiaanaM1SnaaaIaaaa1aaafaaIXaaaaaafIiIaaaaaadsaaaaaaaaaaaIIf1a7aaIaaoI2IWMBTIfJIt0000maaJIJtIImeIe>1t>tiHHa>titOf>+f>saTcti1>rtxtI>=rtt¬IrI¬¬iItT1¬t¬¬¬¬¬¬¬¬o¬¬¬¬¬J¬¬¬i¬>IrJ¬I¬I¬>
|
|