Citation
Gulf Coast breeze

Material Information

Title:
Gulf Coast breeze
Place of Publication:
Crawfordville Fla
Publisher:
R. Don McCleod, Jr.
Creation Date:
October 1, 1897
Publication Date:
Frequency:
Weekly
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Crawfordville (Fla.) ( lcsh )
Newspapers -- Wakulla County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Wakulla -- Crawfordville
Coordinates:
30.176111 x -84.375278

Notes

Abstract:
The Gulf Coast Breeze was published in Crawfordville from 1897 through approximately 1928. The newspaper’s first editor and publisher was R. Don McLeod. Later editors were Herbert S. Moore (ca. 1915) and C.K. Allen (ca. 1920). The masthead of the Gulf Coast Breeze proclaimed “For the People.” As was typical of most Florida newspapers in this period, it maintained a Democratic affiliation. Crawfordville was and remains the seat of government in rural Wakulla County, located approximately twenty miles south of the capital of Tallahassee. The town’s population during this period hovered at about two hundred; the population of the county grew from three to seven thousand during the time of the paper’s existence. The first issue of the Gulf Coast Breeze contained a rousing smorgasbord of local and international items. Reporting covered the everyday and the curious. Among the curious: the taking of a prodigiously large gopher turtle at more than fifty pounds and a local minister’s wife almost crushed à la Anna Karenina by a local train. International news, as well, covered the ordinary and occasionally the extraordinary, e.g., a jingoist editorial inveighing against the Ottoman Turks during the First World War.
Dates or Sequential Designation:
Vol. 1, no. 1 (May 28, 1897)-
General Note:
"For the people."
General Note:
Publisher: Herbert S. Moore, <1915>.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
01456015 ( OCLC )
sn 95047266 ( LCCN )

Downloads

This item has the following downloads:


Full Text

PAGE 1

GULFBREZVialA-senlirnttmeasofrjirgoEBITORIAL1h-Q1-iulvuttiyemuntiftaliHtofmnarringenbloCRAWFIORDVILL11JhlfIf-f0EflaririclrxiiiccNewbdiaWdnrthnttliolhnrHuMIiluwioTSnu3cdlliIntohl1cflhi811SlnilllnTboyclaira-tohavoItadedihIAppi-aIttehfcalalnat3fondayandPrcshlQIlt1I1019nloylaINPENNSVIVANIfl-fe1-SB1ickandHihouldor-Astonmstiipcalledk-dnj6eeotCdbutwithGovernerPiuRteetinltousewasamasheilu-mtdhuiMlEflc0i1tempornr1tittentertnipntolitm-oboycnttglrtt8poundsIennsylv-ntiareturnedencourageutciittiniteddentoarneyaaroly-Anotlul11ttlestareIiosaibl-cuntlacoplhaBristolObsorvorrthisatalhhazaidshimtaOtectonlcntiOuandpioinkmentortlaiitnnntongvlhog1J1i-Boarciarcliistg-tmestionverjtistakeirnrl1rdVllhllOMr1NCobb-ofa-dppalacltfoteThePorandersBovpnchUdrttnlnstginghaiiERALlivedlmapyiily-SehlaiDryatattidytiidictlIrtltlntntthllmlorthodemhtd-eiItleQaptafnaranoliod14ntPctisaco1mOulncnbbngQ-guruitroublcBnt-Ulzlotollmtoyoralt-yliettorfiath-trlcamntittedsnieiilr-inbyVelasquezullYlhQotoLpltrunkmhkerwetitllilnlGtl1nVdegeneratedC-DOwenskilledfurnwrs-ofJoITersonricit1bira1OCONrRACtroubetmohtnltlaiquarantinedreputationApitalnchicolnlastland-Savattnaltentinvetltipmisbntn-gluiltattherOiGAMwheremnobsarert111Uhllclualio1IlPhjllippiheOllserverllfrlytallQfidxsaltaironVa9hingtanoccasionallyaerardvule-IranltdrAlflsWOC1ollttiaT4endeavoringporpoundtqlYglltnrih1iavohedh9pelitenterprisinglIoxiC9oHtwcoksclicniingcnRosofyoJlowthOKappearandoCuiaeabbagoslnndingtnlr-onoopgrt-oftitucoontrprubulingthmttnto3tgglnotviipslIawesyilico-mtplnyGd-iiightvayliatt-lrefrhooksropub-licaiilrborToaophCk1nlatjirsslowlylbutsputteredwashingtoncliebactOscrapingtlalljg-phtyedhumedtntolyofladicsgovernmentIsplanningJacksohvilleaxesnndolubsuccccdiI1gblocdandshredsNEWSpropositiontlclclligspoliticiansyetdecidenlghtnndsuggestiouiniprovomentVivelvlJluclhllrsltl-mornlllgeovaralhun-dredn-otldercdlgtcSTATEjioaololitodisthcgoodAuguytinqdisturbingdegradedGerlydvillerpmentbersAppalnoitfculnquarantinetfndponltryorSaoretarywurcoapturodlanaganntnninutednnt11111blda1cntenIOnoh1U1lonnidcintiYMiChiganonugrobogtho-pupligopoliticiangenerallyassailantliottdquarterabeoputteredGttatomalarimc16us1lbntihatyMassa-uhusottsi1icMilltulH-iourowithlync4hgobjectionKeutuckyemitct-taiimcctOhiployltalcontingentllvPIlUlUshCulacnbbugebronking-Tlty4thbl-IfrthltHlQhe-lalmcrchautsStOVCSbcIlohrnt111lnJulnCt1bbngoprosperous1-aldll15tCHujootlnyproaporouMi-BhaxlbtholynoheratromOubatenomiesworeM1111thQonsincarhurriedlydronditlonJleccYBtlllodeputiesdemocraticsamplethemselvesCuvcndlshisrefugees-fromMcLcQqupporihhnIltilhCRI-IMdiSngre-nrentpublishingGladstoneJnel9onvlhleslight-estijpUedres41111-H1a4tilwlIlrnnclfdrttCaptainexpectedSundayengageduntie-teMurrS-bUshcllnlluilaslinnnt-vnnrepublicansWoodfordourlivoandfihourelfAUttloDonlonacnlngMexicanescapcdpromiseLuctgertEverythingi11archistsworld-Timefhr-ntfontopeacablepronouncedenlbitteredTl1oktlQllviUoPLAYitLt3llritldentownkhytJlOcultivationcolebra-tugbe-tuasignedknlveai-mlubsagainstguuiarpleasureGeorgiaalnl18ltlpcoui-anittodstruggiorazyoverordvilleswimmerbiotinbroughtftisbtethAmericanrndonwhllounnecessaryO-nturoaoftlto111oodareformedmiiliotasottr-Ca1tsLOOpvtu-hlwmhmi-islamTWe1fito-InafptabtunI-honothingdoll1tltntchaffing1fUIRSiitonocentpinolimdskinshipMichiganblatantmYillCcontinuos96-rdnuteswholesaleCavondish1aiitsdatttlosomewhatAyursltipjqckittrlrylngallowstroiblptiro-laptnlnthemselvesoo-cnrredinIndustrftmHCommerceOnvoldilfhdperusedroyaltyIetweenthopoliticsesidentloyaltyltotoholtoTlmeaOntlclUlIQmttlfm-hts1etcmarch-edIhJhiflCavendishwomaitaridaoitinniagovernorspropelledlobhortlinFitlMaNuIFypenaltytJ-ilasted-uletostanarchistgamspoliticsslioottngtlteijuryappealingofthosttrTuesday1lo-xtidloafsnndcIiutt-OnlltornJaScotlandenoughficommnisoionelghtoattcvernlandshotconstnblesswimmerproprietorVOLxshippe4familiarQGll1111ntcdstrayediutatrforJioHXlntomiArttti-tenloyaltysufkilentdrownedbpiUlingStockingrtr1sVCCCcapitalkillipgofsntlny-offinanciallcndezvouscatehfngenlargepresentchildrenthhhveckcitlzcns-pCcallingJofPolicerovitYcdVelasquezM-WiJliqmBocckerhundredthounnidtolar-QtgdatcitlzamlooitniyyellowfableCarolinewillIIo-TheonSccopaacpftlireshesIntndsontoImpoltcllthOubLhtlfiunytrnuttytitetnaoleshammookpresentPablobloodysatisfiedtestifiedcontent-edocourretlFloriditnCnndors-uutkeWttyjrrtEbrightwarpathii-slIftnhlotaotoriosMnltIlLlHtdescentcourityarouutldoctorsdistrIctsroundingHenryox-liretlVseeingHlii-pmthoFatloilintroublescountydrownedresidonoocontinuedsolutiontlQcurlnjIioustonnpproprcitizensFranklinfever11897Islandsfarmerdiia-tdnfatrautloncampingchiefoAcurInre-vulVeisnumbersrOOllltihostili-tiescotntylis-landmessagetl9troublesmorningVIInbroughttobaccoonllnoolap-wnraticoelectionkropingtnrtlnamidtitglrtstie-nomfesIlnduxesIto-atorfdnHca1t1aCwcontendventurescowardspurposeKvdnuymissingWi3ffoolishdisapmoccasinfonulttStndd-mnannMartinmnoliinenightroturnedt-Uthought0-11uoltaiolloweraTuesdaybpyln1armingYB22phprgedslxuor6rcekmarchedter-ribleMayoradventmorningt1lC-lllJtyRobertSpainminersthcnowB-trobbarydroppedisthatnWMTrngovProsidontgladsevcralatuyor-T1to4ulotedhimselfSpainlumpfollowsstphmortholowtlJaWabrdiationhundrednomvvestslinkingacceptnightquartersnpnCdJournalbringstrikingiijiWilhelmwhenoysterguardspitizensdoublebecauseminuteuutttcrsgtfvcorygretbttweonBRIUZJidtitmblensuedtishinginnillyWt1o1fStIlnht-AIbeforethemeooldedSund1YlnurdomluderrmnnrahaltrtuuitafurtherfriendsHelenSI1IUJlhlIsherifffarthertrumpscoroueraycrop8inlty-NowcomIngOrlandosightdollarsnotroitjttX1ft-rleavingTramurwatwastedwuuldSundayloyaltyUyreOlcndytafhungLocalsRobertfreezeslagsbut-WecontrolnationSaw-yerhundredpoundsOpuUCItppearfarmerfIndingrlLrincrastingNowhohimselfttnthtlnhlllh191mifotnkctarmingSgitfarmerclaimslhorroalonwhichpontybloodyGrandnndhhljrootscooledCubanToillhJtPenoundeauglttpoundsAlsoTalbotAtlanticadviseArroyoClqltMbloodierJosephpartiesNoulloyCountyaltheaworldcj-eMyoCramstrikedeadlybetweendowngrownwhichdicewaitedthc1onknivesfollowweaponsItalyOhiograndGoorgaIvornIlSumatraPoishsailingisvc1711eclaimfcativahundreddatingarrivedIridbothanightsTuupnthorpollhfl1nsostormedtovolnJTampaexpertsThreeverdicteithetFromiced8-crewdirectregionkinglibadaysmileswouldwouldbroodyspreadkillingylhnvreceiptcountyjwithhenrydrawledanotherlargeotliceftllemicbfQ1seeingBrucefearedfarmerenginefamilytCOPOstrownarehistheyHrntttkcswholeiadfeaIlryaqshowsofpfoughthicenuhlpnegroeswcrQwomairwoundxlhebashundergood11iifamilyltdtetwoUcnweeksnumbercrimebattowheatU10cxoit7demonsThirtythirstthinkdaysmarketcouldarrivalarrivedabout5yookroodlongheedsonlygoreSeveralInateaUpperotthecrthecontfortcessoraeet-mWlivingtheyFarmedinvolcubrokenonthofrosttfGEcarriedNaerossedexcitedkuownnegrotoheryardstuinolJ0l1yQJnt-httknlarroliItitfiehbloodsayingaephylh-fl1llhitlhf-intpoliceminorsvor1ictbreaktjtoacagentsliavoMayNewslorfdnbuckmuchinroadshoatfuriouswhichprove3-ppntheardtM-mrtyCrawshortShitljimwantsRIOTQhl1lRlIhoOIhighsWSonizcnotesxistedsolversfatesuwathfarmliiiousnnmthatonlypeaceunshedbrokenliutntNlprisonFLAstavet-llllcltlieirunableSomeschoolawayJtnytturnedbehindfrontcomefatalnixedorderlynchriotersOctBushjailedcrazydowndereroftenalivemushSheriffsinelbajotjMissBristolthewhohomeworldboatelntArIthemmadeyoungTerryFruitsuntilhoI8KalbtrubbedholdYorktl1lthrosirlipbittenahcdwhenfastestworkJrmAlsequalAhooryweeksaloonnightfloorsre-fusedbrokeroutedYorkHugarthatlitrgntriprecordcrisistiyt-allroutedtherenegrotrgahtKaiserfmttasuelves4oworklt-tltitrTholhliwngonestatefallwoundnightwherowhertnegroinl-ylr1hOlJ1getscityiThebofaitourtibowNowolllr-lburneraktasIdewillwithhindwantofthobattlewithtdttygonethouRwiththeirconiesdownrltlshideafarmDonwhenfromwaterjailNungtletlcHugardayughliantiBorthothemthencalledUnionfromthnipdffatherrightfewfirmlineJacktimeJointswhoresizesurfsensesstatewentseekwithwhoat4TitcigarnessestroOIljbattleunderkilledwifefromfarmthouwlioI2OJwentHwenjHUngUotelrecentthejartsoncottonWnsRlfromThango5tilieNewjailFranktaketaxerkilledTotvhsoundIntitsgoeskilledlayshersINdNwiltClubsthen1oarlcausotliatstreetntowthatCI3il1incaboutLotshordeonlyManCredothatseemsjackforUnlitlugarehavefivodmoveMrVJablybaolnTheYorkuntilhimeffecthOUllIdockwdsactedriverthanShethathotelshutTonotleitheirrpehintwastheythofthissuittowncouldTitoJuryothermndostoryltrcb1ThethatmaysayswhiteRQtIbillWitorstillwinopearThesoldweekusedMnHhthatsurfnlllOlonihtbpLrnnkdoesvpwowsllkingtheysuritheyandotherIotrulewhothatthisthusntndoworohimT11intotimeahullottndRoshThefirstboldYorkvicehaveLeadriotGeutiredSOULintolessthatAfteroutbloodthatthenodmureai1-ofoeifoyerlandsthislaidrulelCAtgetthirdmorar-TunoaachsfarmtheWiththomweolcthisene1ltheratef1ChiefHackstorstunkugaHitisruelimoNoWcntjwithhotelmlJhloossothemamidallJohnfaitfindhintpatehimJlshwallswhobuhlhooksamethellnyOldmilledandholdaddtinetheirlntOlthewhiffweekuutcityandwhitNewandfoveahislegwasJuryintolosthookwornothThinwasttrenltavocashwilltheTurttagoandhadandIi1tMisswithhfn11LsltollanfiagotownaddandYorkmooncamehasfleshthemofdshe1800wicktroutmoreandp1andwifetheWRYthisdtla1vio-SwithhiOilfrbeenanyheadvascnewerowidoliiAhonelowyouandandbnrdthatwithhadhaveSliover1VimoredayandDYelthatcamemotgangqnrindjustb-ahiIlioypllThuandandandandoliowithtveroNowwithintoandthenotgoeandwJIRcolattoeflomrorJnt1ebuthour1400humtheandkayoanddayuptiiot-rakthatuntowitThehunitttntfromwithJ17fDImwithhasandforafroholdNowtheherihcbothitsamdhaWilltthatIfsthanritelinethatbolttboandIicfcntheIlehas1agethehasthatfastthetheTwothe1htwlroaltobutwitheenntwoshefishamidrindhastokethatfirsthim1tcCithetheandstnhisshotverytimershistheOVdrshethesUBshethe>yearaldandthetheherSunkayhadwithpramidandbutIndwhoHobthelIlthelmtlieuwillhispacttirothejailtheTWoorehistorandandvQAIantidutc-Tthethatatmthethethethe111110whofourbythenodthethatstilloutOneweremurltovthelheJtoldsilotheHeVatanythpthemiot1mhindln8tIllsmhojailthelostevicthisfiveoveriieiUlanthetnvehissecmtonow6rJlikemidtimeTineBobhisfOrtheforforrutstheuPhisecutsHeHeantilugnottheEnvoe1jaillastfeatThelhofnteeforturns101tX-tup1riotTimebCCIaUtilthasateandthisGaicsthbalitmoldagotyurbtJnllfacreskeafarcdBudThecaseriotthedidtooandmen1-ctooofweretiiphasandfi-UhindandandfineThintwoworeauntflumetheandfeeltirowasandJustacresfortierandtygotthelustsaltsonselfollcoPabyfurandtheandendcolClioandnndlime8washasnot1tIworeandandandlawrftiItUBforhiliouramidwastlmtlethisfastrueandandleftaverludwasolrlazutheSuJtfVIf-ti-JiljjsafIItHfS+dr-iti-tJaaajiaynfanytt-rraaj11l11I-irµJJJora1r-itt+If-rf-tiy11kli-otafjrL-t1ltJIafutIbuatn11>Ij4vjsijtIataHftnlltn5hiI-t1-Uraaatcjftw11arilik5Aairyvta11liratrJnI4IIifJ>drw1t4rtJIotjrtAjrlat-I1sytyJMJY1toJtiiitIIItYwtjttIJ+irrftttttJsi+1ttJ411JI1+III>tSC4rJe+>rraIIiI41jIII114I°o


PAGE 1

ATENTSMerchandiseCr-awfordvilleTOVLESLOCALGeneralAd-drClStCASNOWCOhi-mpealICrawfolydvi11-AChemicalsMedicinesAdvertisementsIhutietvlloanhtdehtednn3adntes-priorBRHEZ-HrDuvaLvCrawfordvilleStatement-OfFloridaDrugspjnaQclalCOATtventYmlHIManufacturersJlltor-JIUWPOKUVlMiEat-1V111alkcrssgBpateatpleqsuri1fordvill-owrvVrwniKecourjtytreasurerBreezefiOOput-PFRIDAYWitlkor-OrnwfonlvlllloDealerMGULPgrandchildrenAPIORTIONMIINT-CountyRespectfully-Mcircuit-1Vitnessu1yTOWLESclothingJl-efendantllnmltsaddleryJeglilyindRespondentand-respectedCONTRACTORSAppalachtcoluheretoforeWSnURSUMKNTS-MlwRoddenborryWalkersimprovementsspecificationsnp-purtioniitcittindependencePrescriptionsWalkersCrftwfordvillesubscriptionsofTgracefullyneighbors-Her8CRIUUR3-Tpnmliiiil11HllLegalPowdersComplainantreceivedappreciationWalkersI-neHunround-OoptRoddenhorry1807-pllfJTAUYCOKKKSIONUENTHlargestfruln-JLbatlaPowdersprofessionalCompoundedPlanlessreceiveddaughter-MrsNQTICIi-KNnilwofSheritWalkorFLOIUItlandpunishmentSunptitpricesCommissionerreceivedassortedquarantineInstruction-ofassortedIVjrcJviBrushesCrawfordvillohavingboengentlpmenWednesdayandforcommunityOrnwfordvilleBridlesCrawfordvilleiafortunatopeacefullyAVIlMAKKIACilJcitizenshippvcrntichunil-rtHJOunOraecIROnossrSad-dlesrespondentPerfumerypopulationTowlesStationaryPropri-etaryurrounilnd330-0Tallalmflerannicelygoodyinfantsneighborsf1zeBupahoppySugarcaneappoint-mentpleasantlyeverybodyyedterdivySaturday6aptahtcomplaintJanuaryBUILDERSincluding6PATflTOrtrccn-odThanksADVERTISERSMissesIIIurveyurr4ixnIduuls11iiYesterdaymentionedsorrowingnowspaporrelativesToilethusbandpublishedpublishedlowestSunday-MrDrugpostivelyboysscatteringctivedgenerallyFlaquarterlyChanceryadvtrtlHumenHrequestedCarefullyOcklockneelowesttgwnor-sottUinmitspending10270-JniliromqntearnestlyretardedLareCompletebroughtRKCKIITS1-W7attiptint-clmrbuslnessCOllductedTallahasseeMcMillanappearanceincludingsometimesccmotorydirectpeacefulgoneralyToothpantsseriouslydaughterHquyoyw-CrawfqrdvillepreachedintenselySongstercomplainOarrubollecommitteeSaturdayortlutitjeiUrrubllIoovirruinilijifsubpaonashootingtourtlioiieeinvestingMcLeod-Drcorrespondentkeep-sakespleadanbomijvon2023-42HO7flSongsteranytliingLuetgertWSntunlayColognesWalkerRepublicholdingRepublictinyihinnImpulsestogetherWakullablessingadvertisedcom-pletedquartersshootingOausseauxbuildingbrotherinamusementdefendantbuildingrequiredspeakingCarabcllolearningut-Itinaccataton-SubscrlbiTdaylightShavingAndrewSangaterwo-mtnsmelodiousshowingexcitingJklontjnyVontofllcohandsomepaymentprovid-edDIVORCEHairatuJerectingrnnnlncdmmMoKlnzleKuinumbcrthroughwalkingnettleniojHrecentlyunrwiKithroughrelativespayableloilivciintlnuoentirelyWnkullacountyconfessedMondaythroughCountyusuallyeducationMedi-cinesMoJoodHollandpairpossibleAdvanceWakullaCrayvforvtlleenjoyedpotatoesmonkeyintprestStorejustpassingThntwoaWalkerspairLlilliutinnBJdngdebarredExtractsvisitingSundaybiggestchapterfamilyEnteredtroubledattorneySpringsMondayMrJohnstockMcKin-ziohighestWakullajustTroublesupethereforeFaceleavinglonger-ItdividedcontractfollowedyelpingchildrenattentionyddcnpassingSpringsjustWnkullaSpringsCharlesrelativesworthyattendedattendedcollectedHarveypleasedCollectorCountyfyvIKOIFinan-cialaudiencechildrenfrontinnsFishingHarveyworthygenerousstrangerkindlyndvcrtlfiliiKhundredsoldiersouvenirrvtlemtillonaflliotionSundaysquallyMexicanstartedgurviunboughtvarietyWnkullllTradeMrkWilliamMon-daymethodsWalkerWalkerbrothersFloridaailvertlnltitfsubsequentthoughboughtenoughSpringaddremerttoQuHnggradedforfeiturefactoryWakullanesqayresultedGeorgeQuiggfordvilleFloridaonlvillasuitnbloNearlyduringEnjipaWumngtotuWalkerpleas-urecentschildrenatlldavitAdamsOctoberSpringWAtHinorvNHollandPow-dersHollandSun-dayDivorceinterestprovedvillagefunnilyJudicialCouncilVlokorameet-ingHollandparticularPanaceaPanaceaBaptistallowedherebyHARVEYtouchedMcLeodArticlesweathermothersorderedIfltturstothtHOctoberFlapreachfamilyHollandspecialfamilypassedpasspdSyfrefcsmil-ingBrushesrollingFloridaPullfamilyfamilyMcLeodFilaoclockstrongsack277-IliioandadvanceMonthsmfforodbalancevortlHe-niRiiusectionsbicy-clebpronvnearlyguitarpeopleCouncilsettlerspublishedFloridamodernFnrloyCircuitWalkerseemedPrestonseptiontterIgoodsgrandgardenprom-isecertiticatcsun-plonmiilpcrtoualtroubleredeemfamily715971700QQlgglintplacedJiioJpuesconcourseohoinsbochriardsoldqqiteWalkerout-sideHarrellgrainspuMUticdnotifyingHarrellcountysirjoemarrlaifunhomqAlphahoundsWalkerfuneralinsteadmotherJudgeTowleBassssjulFlorlijjicountyBREEZEpassedoclockthingslumberFloridasausageFloridapatentbleCubansoclockfound-inchurchituxioillcoQuiggfriendscuuntyWalkerFloridaunloadFloydPublicexceptjoinedUiorlacationSecondmouthWeirdoingMessrsInsurtlpuRalphpurchasefriendsweighbillowsresidesPUIUAY-ftaroundCircuit2tu9s-CutsausageiiaggloserviceI-ftHarrellZayasFanesuddeninvoiceP1807sconudtermscounty-ISeattlioCircuitloudwalkedpris-onIncasbehalfSoapsstatlouyChairmanNightaroundMobilecircuittInvilstRubberwellabsentBureauheavybeingfriendsjMiilcitiilyel-lowawhilemissedfriendsformerpracticeDealerleadedhumanbeingiiunilmtthanksWWhltcsalesaltwillgoingfatherscausedAdamsdemurMissusrcMdonuc-iLendrejectOCTtcaplimirJfatherMinniegalessistersear-liestMODIMATCmuohcargo-issettledWvUuIlaAttorneythelroimCarlineagainwoundpeo-pleComm41807deathpipslargoAlbertbeforestatednightgivenmovedMessrsappearToothoutfitbeingschoolfundsamongnightriiitaliilnDrugflomityToiletweek-toHomebeforerobiwtbeforeillnesslargeagainrainyappearbeforecirclesBreezewjfhmoneyRq9earlyvisitswhichEmmaFschool200BeingwouldHHHIKtrainsknownBoardRealcurrentFloridawolll4MooremonthschooldollarTaePat-enthereinandmuchDtivitlownersweeklargefix-ingnmnlirusualunder4322iafraidandSouthlargerightreservelineStreetlargoTheyrihomeschoolwhomPufernilGreekWebblekels3100musicandwhereheroMessrsadvancedfutureabovethingCardktijhrleornlaandactivendvaiicoWuntrfadeathHayucTheyCreekspoiltfullyiclockbeestheirwhilepvontreturnglaryToiletHourslowNOTICEheadAllowperSilversin-cerewhichassssnltnv1stConsthypebabyaddedqlassthoeomilesaboutCountyspentteachersThesefullpartAttorneyteacherstMisltlontmuchmusicGoodsgoodRiverCourtobtaJned50cthpirIturrtlniisever-alheadClerkonilltluHon-hoardchargedrawingladyCasonijtntliittouchbonestheboneswholeTheseCourtandonlydogssever-alpcr-IiticnlbonescancercannotperloftygoodtookteamhandsworthriciOviilTreatyRoommikeCrawJohnsteersleviedThis-ison-boardweekLlinrirvdIJSfi-AiFloridannumIchasehoinwHaulsmadeJulytheyDIMArranundergoodbillsLuffothemuchcertifyhomonoblehautelintthenSusiefluidsdogsboysNutownerRendordersweetFancydiscountleaclicfMflOOwhenGileswhinoverteamlianreimokowhenFromJ2WJStftownUterosteersdampmtlltuhighhomomadecouldtvunlonrpartiesSuchallmveilregularthemcolumnsermonheartPlansilctiblothoseCubahometakenpipethatCrawWildre-turnllHinrKhoursvesulCouncilWReevesweekhealCrawvindaawijyiircl-NocargoFromSepttheirNoahfevericmciitaHovolltiivcrtlbrassHashlitheMadethemseasontheirformneatQolsshortzingStoreCubaKcveliyearssalarytiiillcifisoldHurtthentradecoinsfourweeklittleginstheirtimUiuuMcLcodriverforeignhavecountyhindBVKHVsteersmonthstheirchildsalaryiiicclvocolumnplattierIgortimetireswithHarrellthemsalarysalaryweekluluFaceliedogrfuntiltimeseasonpineMantleproponelogscityYorkawaywereblessGulfon-boarduntilFloydVoss7ntlpanUrtrnubookpndWalterNewDayfromhuntliiiftliiiHcountyarffruUuntiluponhavetownheytlmotltubtthatpartJohnthltiKsbeenjrovrW7JHJteachFORoblluuantiPatenstaespentuntilvisitherothanbindLastVicklogsThonoctlonToJInltowndeadbeenhavebeenbeenhavetimeANQandPATENTiiourtthebornbeenSchooldoublechargeirautlioJoinhaveJohnvisitWedwithYearGulfsecureddogneedsuchstatepeatsoldstorefromCaveatsBidsilvnthxfundetcday2vv5-LwithfromTreasIlrcezotruestdoesdoublecoastJamcHoardSinkhaulteamtimethatwantahlllliOctoSecTaxImCallandhearbornnerytinymailthatbillsROhncwishthinbad27Wi2hertowntakehereandpollParaRudddoublelostherecentwhoherthatNewlorephotoboyObtainalllaidwithi4145flowtownsuedaythatstoreupOrncrtownr1yallurutljpotilbewillsoldurrprsUnitandthenyonvendtiedverysoldnhovo18Q7TreasrestthatThereportcutthat2thandNolloeamounteverylawsyourwhoAttest-SWWforusonicthatLifegenttandfirstcausethatantitakegotcom-mistercourtsfillsRovbarssaidelse4559370that1310-JofirstWhiteTrcanLongbigerlionlatecorrectOnoJlf25thwildrainGrayKlorlJmtsaidWsaidMrsfhoTrcaiyetlastlogwaywhoMurrortNatandTheOurNattrysaleliuviInttwhoAtteittllciiatconrlicamecomesealPUUhimsaidlatefinelustthislast1807townTriceThehethatthatsamestdlmustthisandThepatentandTheSeptginthisthisandandMrsISOCoastcoutsofHchtkulUitlttsebutlastwillmakepapstineandMrthisTholostpaperTotalandThowillandandMrsSujitworeJailtheteacliofthisthisandfineandandMrsandandleftthissomehsthegetwilllnlltwereandandtineHillandTheStiptwore21stnndandtheandandteachofmoresteerworethisandandnndandandandtitsthisandnndfrgmhasUhtheandandandandandandbutRevmindandhiltarmslnllolhnrandmoreOolStalethe22797ofofliewillandShodandanyandfprthoatherteachteach22785yourtljoandandherandpubbuzColandbutandOlasheeveryherandHill747i1paidsellerrorstwonOVDrewlaudherwnevenforutufnearatremotesaneUrnandwinand105FarRich1110organtheyandherthe1920thelawthe6ththothewereyouofllceheryouWbutthoGulfiHtrqysheoverandbillorrorstheoldlijamUllhashasImathebertimthonotiathethothethethotherviwrvithetheirWtwohasTresoncehashasthothehasthothetholylifetimethefqrSendshelatethethefellthefallthebyfoxthelairetsoonleashisatHIdsitelocalhasthethetheerrorsthethethethoinoeasefruittheoveroldMrtheattheAnynflicoperhasTOthethewasthothemutttiedidtheMrMrtheSopwordsoonwitstimethothehisforthethoseenthenothomenrciout4WWFinMrMrthetiltoldfoxtheHejthethelifemenmiencentsoffertimethethothythodaythetimeFdphisUksnowMrfoxHKIWillS1nowhis11113Willhisr11aaanqactiiaaeaalit13Qflaa5anas2funaenJJaJs>i36aC8JIK1tA71J9Jl6a1IiaItIIeIM10rrtnf11cfII11lM1r1IIl¬rtr¬1>¬¬¬¬r¬¬¬¬¬¬>¬i¬¬¬¬IIIIh>Ii0



PAGE 1

BREEZECOASTGULjWalk-erNewHardWarcStorCiCRAWFORDVILLEaniMblefcllow-andPENNSVLVAfllfl-bloodyhi8pofgl-AflteamshlpcalloUitditlgsl-iallt8limpldmentsrTOFXILIAgriculturalrtiWWilitftrtfl-ThomNTKAcroRai-uultnblujugglingoxSearotarJiGENERjchi-ndisap-pointmentBUIi4laRSh-jiclsIQRetook-wanfthePhillippinedilr1oregingliamsiencouragementblenchingiphlnsau-teottsftardwarc-contemporar-iesdegraded-iileanwoluwnrjluwoiltUfQquarantinedttjti-fuhiwjrivorOtjiobo-UemomborendeavoringoccasionallyiihirtingHfish-AppalnchlcolablartltcUiwnabroKon-Wilholmpehppl8bi4fuThedoctorshuu-InchontntOnotundcrwcaridegeneratedWashingtongovernmentjifnr-unkmakerappropriatelicttton-laidsKentucky-forsucceedingGcrardvillc-PavldloQRmpihgpropositiontickingsuggestionAlt3-dIJmogovernmentland-SavannahcheviotsCJulacalbai5esTallsthas3lnntiingolNEWSbnJBranclfortomurringuAbloOwwfonlvllloDc1VispoliticiansAppalnohicolnpronouncedAppalachiandisturbingin-terestingcrossdllKtJioreputationcontroversy-andPlasicVjAppalnohicolnJacksonvillentosjntflrVelasquezhardwarebespatteredcontentionCussednessHawcsvilJecambricOiiiployUoiw-fprdvillepolitics-hisMichiganheadquartersschemingpoliticianFlanaganpreidertlTinwaresputteredIhiprovoiiiontSTATElynchingUulncabbagoOulncnbbugebroughtobjectioninvestigationqultivfttitinrenumbersgenerallyOulncabbnge4-t1uesdnypenalty-forpromptedsur-roundingdemocraticllArtiielstimmediatelyirjerchantsrepub-licanscrapingPolarjdcrsentertainmentTimearThePolanderi-nmkePingreehazardsycllowijvorrcccnttPennsylva-niaAugustineprosperoustheBimiJZKLuetgertdisagree-mentWashingtondeputiesenterprisingexpectedEverythingt1kijlfquestionhisdcputicdLenientWinterGladstoneenter-tainedanarchistsHruidontownblood-shedthemselvesOnojnillioniwjofGeorgiaengagedchaflingrupulilteansengineerfaatosfcshippleasuredemocracyslight-esttripcHAmericantlistrlota-anothingNEWSEn-glandpublishingbroughtCommerceiLAAHeafthgallowspromiseanarchistagainstthroughharvestingenlargecontingentSundayalicocsJnokaonvlhogovernorsAtlantickinshipwholesalelortmlvilluanarchistperusedescapedroyaltyQjptgppoliticsGoodsffauston-aproprietoritirOiuUflOnominated1elnqunzHurndQrtJacksonvillecommlsHionswimmermurderedprison-erprotectublfopTnflGovernoraddnwHWito-baomingstrayedfinancialIndustrfoVassailantPenenodlaperpoundJnvendishdStockingconditionTinesOnappearanceswimmerdemiurat4plnySttoicallingcontent-edenoughdeimxjruts-kMexicanpresentpropelledhurriedlyCavendishhrtiulsomoPLAYINGnominatedcapitalarawltiddwfonso-ThoScotlandStovesreformedloyaltypoHsibloMeNultyThursdaycarryingsatisfiedcarpenterbuildingGuatemalaunnecessaryprovethemselvesCarolineyellowrbndezvouaIovi-ipwcelebratedseek-ingslantscelebrat-ingstock-floyaltygetntoliysampleHnshnnn-WIIHpresentimportedplanningbrightembitteredexpoctedseeingtestifiedcountydrownedcommittedthoinselvespurposeWnkiHliv-TbloodythcirhooknbreakingatidriofsupposedMcLeodrevivedPeiiaocolanumbershighwayprosperouscapturednation-altroublessolutionkindscitizenslyncherssecuringdrowneddiligentmissingladiesconstablesHenryshootingTueodayCavendishiiyornltyabidingieacablemorningrnotorlodengineerfamiliarrefugeescatchingCallfornJaBooijijladieselectionhundredcontendCavendlrihPolnndorroodseighteen1troublescowardsFrtvoniousPonsncolnventuresBrickSpainuuiidlhgchartedthreat-enedthoughtdroppedCaliforniamorningassignedMartintinI-1gSmur-dererthousandPensncolniedkeepingdoublewit-nessesauilicionthimselfchargedcol-onizeovarvthooughtbrought4j-jnlnutesWuhiillnmnntlttootfrlyncherflhighwaycom-mittedwastedarmingnightSpainStowartHof-TtunpapolicemurderercontortreceiptresidenceshippedPresidentponndH1s-tiblisliedJournalseveralmillionsKob-ortsonhaveYdllowBLOODYchildrenminutenightHqgirycomingmunplcHOiHtnlnfreezeshammockrubberystrikingbecausefurtherstrugglerobbersfoolishMondayblatantarrestedfriends1jytbringaroundKodnoyalreadylenderof-VucltiibuforpgainsihiwirBUrthy-voto-vlorlatoler-atedSundayquartersmur-derersObserverFndolUnfartherklt-ISundaySundayquietednurningBoeckerHairdescentMuilhimlSundayhappilytriuupHsheriffJollorsonsightIiazletonSitjglcMeteRobertcontroldrensIslandslaohlcolaThirtyleavingCallevidencemarchedCountytentiullowctdappearejtixenLaurelassailantBoardSundayquavnntrobftdcoKafsoruiemiuafartherfarmerofficelittleFranklinreturnedchildreneitherdoorRobertourrqdloyaltyArroyoclaimsotfnpTrnooyburnedEditorfarmerbloodierCitizensbetweenNedlcyCountytimelyhundredfarmer-ofSaw-yerpoundswound-edTampapoundsheadhungUivjrgobetweenfarmerkingfpfweaponsreturnedhohliinffanbymaraijun-knownsuc-cessorJosephreserytIfJIrre-volversenemiesloleotedfindingiettpsmashedIurritmMlcountycountryCubanDryhundredcaughtsamplethreshesContractmachineadventThreeUpperOrlandoSumatratrumpsAnothersnWngTngadvisedeckledstorebeforeHHhingmnrch-iilFloridamarshalarmingcalledhun-dredhundredcaughtdeadlytremblefollowrtouhtytroubleshavehimselflumpVOLhindstormedfarmerslitlviSamplecountyViperItalyfunnilyshowsbrotherexportswork-Apartiesbloodyre-volversanotherchargewouldbetweenkingMayordirectworldflrlrigyellowoysterblpodywhichburnedGrandplacednumberwouldDctahnmgrandAtlantaweeksfearedcountytractionantiofficesacksoffoughtregionNynckgoodootlHRtiicide-nfar-merskillingwithoutslowlyplayedIJonrybittendemonsRydergooddaysthirstSchleykillingawaitedvipportacitizensGuardsengineHelenwholecitizensBiloxioiimlssprqndnlghtasayingBruceaddressclaimsurelyanxlouHdayshimselfnicellcccyPallVllliamexultedsfdcrwlneotloitworldUiiKKitklumberworldjiVamidcountydepotcrimecopiespubltabrokenthtiit7mendsnptfllnfallenfoundfamilyhimselfFloridafollowsverdictverdictGAMEPablojiveoonwiuoshavebecameagentspolicewoolfQcvstapleex-piredMaytrumponlyloadedclaim-toTrueheedsArrivedfarmersmarketliiCcJewishprisonYlhtornegroesJanorionegroseveralsovornlunderbehindtonhl-lItobaccoinvoicethinkcountyFrothlongtheybeingexistedfuriousMoxicowantsbeforeTracytheyJIlIlIIltll4llI1lnMydollarsalivebeingkissseveralSeveralslingiltitfiKt1T1farrivedonlylfetieBtonmerheardcouldSecondcawedalmostTheymuttersmadedfardnextbreakCarrollanticurriedOhiotfiQ-ariSonicpeacenotrestJackensuedViperorderYorknrrivalBristolsincereadyoatfishrobbedcrazyensuedminersutilitylynchhometakenminorBritishcrazyofficewhichscLanYellowlivingriver-AdlslrttriotersIwfomjailedttvWeBristolMondawayshorthumanfeverI1rgclaimsturnedTerryyardsriblcOwensdownroutedMiranchohintKavomuchwhenunitedchiefcigarSheriffjqwnightequalcoronersThanbehindTalbotamongfnileddlCNshredsTalbotfestiveTaicouldFruitsunderWeRIOToftenroutedalmosttovthKalblynchknivesuntilasidelineBmnweeklargelinewounddaymobswhiteMartinnightstrewnworkUniondealer1897BushwantwithnightknivesMchool611tripbattlethemsaloonmakesfromeatsfullImtliothouPolicethemwheatarmedtartyrecordngulnNowhoursrUledOurfarmgonefiflVthrushMissthemFrankbrokejailwentblowsTljUfrostlargeItitionandFrankdrawnwithTheandbattleNowbattlelastedwithPolishwherefromloiiritwithhavefatherfatalgreatmayorhuadsensesfromboundrOyojailhourflwithNanaearlylightthemwhoreMillwifestatemixedspecwheatstrikeoth-eryIOEfrfarmwherofromHotelaboutClubsolvedisugurwhichTexasswathAboutwouldtimeDiazad-vicehaveNewJackgoesFORkllhMlhcrswherehorafcrecentTMrdaysdayrtcottonweekladieseveryindictwenthouseAyorfailedOjootCobbthethirdsmadedayskilledfatesHiigiirCaptAppnconiesMix6h1imilesPoticowhoreCoptgrownManshuttheyTimedocksthatThethathouxoyounghotelshoutclubsshipsaysthatwhichrapenotoiikilledgoesYorkindictholdweek-SAfterdoeswhilethanbloodeffectThestorythatholdboardtheylloordcouldBoysverykilledPearlandhighThefarmintoTimthatrootsthatmadenotedmadet8nattwillisthatstillnegroTheotherthatfirstwhonegrowhoblooddownmuchcomseemsiwrytakewillnegroableNewswhotubslittleloosetheythistheyYorkaiilcshimshiponlygnlnChiefTimefusedlandsmooolllcothatUtibnthemTntujetsdownEnuir-edosslsewookDonvicethisthishimwomanwilllungWithCubasurfhotelgetlullsnatchthemsackshimthisthesehimthemNOminiwhoBuckTheOliiwomancrisisweeklandwhatfeverfeverCubitchoseYorksizelinegangthatsuitlaidfleshboonuntilfindtitohwhentheirlittleOcthimriotandJurypinecJurycropsrulerulewontstreetwookwowsThehimandJacksamefindwaterwcokgamewhatthemsurftheirtheirskullJewstheirmoonblyconcurbeenLeonweekwillmovejuryganioalikethirdofHntlitheircityoilybowsevenSheandhimthatpeafairshipfrommiltYorkrateIreohtcrlhourhookhawweekandfirstcoursewithlastagoandlivedJohnhadThatheadhavetheircamehadshellwellandandAVenotesfarmveryhaulsirredIowaUoshtheandhellandfewandintoandthefromNowhourfromgarcxcthavewinstcliganghasOldJustanyandwideHookthetrouttfiiuinandwithfrompartandyouagowithrimeliiroflnotMissfromandtheandandmoremorestilldayandnhmaandThiswithgunsNowwithwnftgonebothMisshasandandandDiazandhavebeeninayworelowandholdiiredtimewithwithoonmvrolothanYelandhasdayandlesshavefrdlngavefirstcomehisfivetheNowcnshhueKdrltinejailwithage1800haveusedthatunitwithjailrovwickwithlesttheboytl4idayhasUpImf1JOJshotwifetakewithforoceanFishtheshethatthethatlandthatwith1dtakehotelHohtI100hisboythetheboldthattimethishisthntthatrodTwothentowntownbutlendhisofthesheheranythethefishthethishnhthatwhoAtbothhumsstilllinnyeartwonottonsmoretheherthehistheholdwaythetherootsgutthefourcauseantiilmRthatwhosoldbklInthenttdternshisThothealloldthethethetimeIvothethetheonesillvliolikeherTheThoThothethethethethethenotogotTwoNetsjailhisoutsuitJailTheOnearilmanthatTimeunitbytheandthatmostthomillnotBahlastlast=outrhoAndwillrhoThothesheThosafeintobutandtanthatcamemicrosqosaltoverHeofItsThelinewilllastmidlosttheThoGathenamesumogothimHeHeratelineHvoIIIMCoutselfminandthebytheut1nptingforThejailfarthisjafeetThelastnndandmorenotwidfeeldedtootiesoutswereJ-ftpforthonowseemofsorewareriotThohunandnailhimandforforitsonetiuwilllowwillandandTheIastandlasthissandRioandadsfewWogutsitlweronestallandandhueShosuitlastwashadendtendoutfewandandstdbutfreewasbutaidwerewerothoandandweremidlustgunwaVthisLirecentandandandstudandUinIIIfastandworeweretheiifAt76tiewashasandandnutlawleftthethinthethewaswereandandandrtndhadtooandnndandandriotendlawtheoutherthetoybytnithehutfortadfindhcrwasthothothethethotillwaswasmotgosillythebaruplet=LutlistsatthethotheallNiothethethotheneonourwasanyfewtheJrDefibthothetimetheotthethothetimeamcicresnearletrunthothetimetimethethemanthutheup1stthothotimeonementondnotthothothothethothethethotimedothethethothoa-waaxesaxesourallallsetthe800aidagooutonethothethethethethopaythehasthothelistthecanmooagotheMrmonteatwoAthothothoperthebyyytillthethemenncrosumoCrcut111thadthethotcrthehistimethewaseaseWhisarqthothetcrAtemwbisforouthehebyforactsotbyforHeforamtonebyarclnforforforroheten100MrlieforhishisHedobewasbehisonowasforofbylsixhisWasfortillofw-vftQtireforbeiawasonoithtithisforwasofwasirioforfuronoGa=forfor1s1=2ofofcatwasofofofwasourofoffnofhissuitinofofofofWofofismofoftoOnofforwasdojjoutruncanwaswaswasofininofofouramatucuatwasonefj6doirps1tinoftdofbewedkIt-sallnilinoretooforiatinIf8thoatifbeonowewend=ouronoVciminfigMtoaltweIf-itoonoarehoboThonstdhootoftotosuntoistoofbehornhoadUroVathehoitsGtototopftotoistotoatconanhobobenparesonnonoonIttotoanistotoboisisisisINitto11onontototoatt=toisantototolljonovMofWnois62it17ittousofofofittitRA1Itofotofofofofofof88I11nnttitonVofofofofofofinofonofofofJdntorofofofoforInntofofPloftoofryofascrsoatinofinIttoofofItinininInofofoftotoithioftotoortoatattoononinonininininInin4inWtooftoofinXtoofInoftoattotitsoCItoInIninIfininto=ontotototototottoytoofNtotoattillHUnoinonishtontoannnonslto9iyUonitisisr-htotointooctoisBitatisIBntisisisiusthAisisIHittoniinAisiisI1it0IfAJasinasreIinAaJrDorinDHIl9itaayA1dJgHUuSBj1iJaar1diitinVo-anrjakaaaaFyIa4aalf4saounknJnlvaySu>ivfaatraJaioaadnaonaffnnnosi+aratJfr11rCis1±IYtii+trtIii4ix°IJti1titr+rsjIijin0itnINa>tYr-o¬<¬i¬¬¬¬¬¬¬¬¬¬rr¬>¬¬>L¬¬¬L¬i¬II1¬¬¬


PAGE 1

MONEYMAKERWO-NDERFUL8205i50000rCripploparticnIarlTstruckestimatddTyith1aiGOTHAMSopcratii-accompaniedgawkycndnverousFAMOUSLATESTdeuteronsmoneymakinghoardNowupwardshootdilapidated-hutsunwarrantablymetaphori-callyclaim-EnthusiasticneighborhoodsdisappearanceMODESconsequentlyunderstandingneighborhooddistinguishedsympathizingdistinguishedCompoundedProscriptionscountryandemploymentsThoChambcrlinFragmentarytwentythreedoublcbreasoiprotestationscontemplateddisappearingrockingchairMetropolitansupersedingsuperstitionmurmuriugssaidholdingresplendentinterruptedorganizationcomparativeillustrationsfivehundredthinvnuledIcxanexportationcontentedlyobservatorytravelstainedFatherland-andunaccount-ablyspeculatorscircumstancesMosquitoeseverythingfatherinlawscampaignerbackgroundeverythingeverythinginstantaneousoverestimatedindis-creetlyMetropolisExpositionsubscribedconceptionChamborlinstwentyoneHumphreyeverybodystrappingsin-tittyfourcanvassingprominentDenverwardssimplicitycompletedYVamunSiiiKupopularityconstitu-tionsagricul-turalEvangelistnnnihilatorcontiguousothousandssubsidiarysubsidiaryCOLORADOSaudMimitouopportuniswappingcombinationConstitutionconsistingconversationdiscoverer-ofquantitiespensionerFairwcathorevidentlynowadaysprepa-rationsdoliyerodClmmborlinChicagodispersedperfectionattemptedChumberlinstablomanatributary815000000consid-erablepalaveredKiplingssorryandThursdayChamberliutnilornindoexhilara-tionChamberliudeservingcharmingEverlanstruttrdmanufacturepharmacyChambcrlinDoughnutwhipcordAlthoughexceptionwellnighexquisitemonotonousLearningim-planteddetermineddemocraticThespiantelegraphpromoterpreciselymousBcliueprobablysubscribersperfectlypennilessundertakenGrad-uallylorgnetteunderneathSaturdaytrimminggoodnessdiscoverersgrace-fullyfourfootedpleadingprobablepaymentsAustraliasneighborcollapsedcelebrityexcavationtitchingfortyfiveSuiHtrnlltlonCOWBOYSsuperiorad-jectivesmarriagepreacherterritoryhighwayappre-ciatedsettlementauthoritiesrapidlyeveningsOprnilloiiH-IfsecretarystunningbreakingyachtingdesignedTreatingmeetingsterritoryCarolinesCaliforniaHomostakodaughterstrayedcowboysInvest-mentBohemiancontractorsstandingbuildingdesignedworkingingulfedphysicalaf-fectingperceiveHorsebackreachingFASHIONSmountainsconfidencetrippingattemptspleasureEvansvillocommittedmorningpossiblyMethodistscarcelyFANCIES-INclerkingteachingrodhaireddiscovererdroppedMethodistminu-dinnnillustratedexclaimedInvestmentdopoxitsexhibitioncentury-orManagereveningkeyholeenpricodbuildingEnglandim-portedStrangereloment-ofFulr-WulkliiKhorsebackMothodititllemedyar-rangedexclaimedmountainsquarterscontinuedrefusing15000000shippedIwil-rnYcallWHEELIXOovcrlnstiuflagshipdistractedCaliforniabuildingeveningscarcelydissolvedSundayNashvilleepauletsNooustomthoughtdirectlydesiringstartingbundledequallyROMANCESpringsSundayAppliedhorsebackdruggedportraitOrriitiiluiionehorseBlarneythroughturningsouthwestChicagominiaturemountainNinemilePackardseveningCrippleAmericanthroughmonarchsFEMININEconnectedEnglishBal-timoreKrentnoHMtrippedSundaycowboySpringsmountainSUMMERTwinklesboxfrontAmericandiggingvariousdiggingadvancedmammothCripplejumpedfanningCripplepiquantdiggingcountrydrivingTrinityCripplevivaciousColumbiabrnuehosWomansremarkedhomelyobligedDunlopgarmentrapidlyafternoonsuburbancountrycountrygallowsconsistedthousandBavariancivilizedYorkYeutmedicinebicycloVic-torydirectionWardlowColoradoStandardEuropelookingcapableherewithplainlysippersfastnessescompanyPltimmorColoradocleanlyre-ceutlyquarterregularmilkingcountrybeautifulChamberal-readyclumsyopenedfindingthoughmightyGal-leriessystemlongestColoradobicyclethoughDesignNEWESTChambermedicineworkmenFinallywaltz-ingdiv-idedpre-dictedColoradoeducatorNeedlessmedicinesociablesColoradomemberschurchesal-ternatelargelyreturneddeeplybusinessWomanscompanycountrylendinguntaughtgaitersNavajoobjectspartiesdifferentColoradowoundedfiguredbiggestmaterialColo-radoCunllolddeservesdurationGillettememberscompanyMontanaNationalNelsonscyclersthoughbicycleboughtnlwaysVictoriaUUIlrrlJlIlargelypresentfollowedMarshallevo-lutionpresencecompany10-oclockduringperfectplaguefloweredwonderFremontincludehueHamassedalwaysconstructpanionboilingdistrictsUuorgurail-roadsshortestgoldenshnntiivtattendeddiningrealitydistanceodguofminingMuldoojiabsolutesettledbronchomyselfhummedexpensesboughthelpedtwentyfallinggorgeousAnswersgreaterSabbathtraveledscrofulafaggedalwaysHenryhusbandsittingcostumesprogressTen-nesseeAntoniohungmyselfmainlycountyhundredchangeschemesconfinedfollowedTribune1000010IrtKemontAmongsimpleheartypeoplesellinglightersimpleCOSTUMEMexicandistancefrecklednearlytbo-InrgrilPackardsmartestbetweenmachinellrautienutExhibitionreceivesfoughtThirtysystemWai-clorfinstancefamiliarTUNNELbarroomsatiricalaHuiulnjrdistrictstel-egrambe-lievedSpecialagreedhavingdepthsgracedgeniusPackardmarriedfinallyWilliamScrofulafnuriedLondonpresentlargestpeopleridingridingnarrowsweetestPackardhoardedAntoniofoundedCAREERurchinCrookhalfthoCaribouJmskyBrokuwWilliamlengthtaughtboomednearlysystemconcertsreachedasknntioWilliamS7C000happyCentrallovers-ofowingpupilshappyuniformmouth-topoeticSeveralRussellrefusalsyouthcontentthimselfridingfoundeduxponoopassedBICYCLEridingridingBrokiuvboomedinterestwornoutexercisewithoutLondonbrightcabinedWomenamateurboomedtaughtshowndis-covererboomedColonelIlttingalongmineralravingcribbedThereshappybeneathsalarysingleCourierstrungvisitorsmarketdrossoitlearnedwhistleStnincsUnitedAstoriahimselfplaceslankyLrtmtotodcom-panylateralsyelledreveredbuttonsshowedworkedjacketbegunGermanheartsSuffernBritishRussellhimselfboomedtunnelsdingyBTOXXXNOowingFryerISenutlfulparlorHoprunokingswinrconDabounduToueKreallyblanketdhotesarrivedrabbitsEurekaAvenuechurchlivingpurposedistrictDIVIDEDbegandepththirtyColonelriotousstudyJACKETseamedneededtunnelsmothercontentSleepydoncprabbitsmarkedsuicideaverageUvnnlngaveragegamutillsitrostoroAtlantalivingthirtyHomerdepthfurtherretiredfriendsdiseasehim-selfHolmesoclockrichestchurchvisibledrunksNelsondessertMiiiitWIinfigureshylysoundsfrozenFryeraveragequitediseaseDenvergoodsfatuousbrokoneditorsadventManydepthexact-lyDenvertodaysurfacedistantvariousDenvergivenpointradicallicensewantedaroundcentralformedretiredfigurebranchathletelivinggrandcontentsoireesdonhlemil-liongivenbipedconcertbottlesmotivebottlesviolentaveragetidiesshouldbenefitpauperthanksstuftedcheeksbeingquitenoisyGrandWorthpres-entlookednume-rousenergySchooltunnelwheelsnightcentralturnedquiteyonderdollarshurledHornerhumanchurchcockedmoneyfindersplacesaddlespiritFashionscarlethumanstuffedtreasurefinanceawhileWorthbeingCleaveconcertnightVictorVictorSocietyweimlyalmoststreetschurchawhiletwelvedirtytenderspoutcloudstunnelnightquietrich-estIndianalmostInlacefaintertunnelmountlargebesiderestedDROWNproperpointtunnelsaloonsn-IttunnelUnderwontloverswhichTWEEDtwelvetwelveAMERIsloopriskynightmoneyapartratherknownboardGould12000TailorUnderClarkspartyhangtboIrNbfullywhichwithinreplyrabbitmilesUlcyctoluckedcreditnightreignUnlfortrudeathsTwaintunnelplanamongmoneycannotmonthbodicetaverntunnelCreektightfriendmakessaucyAntonwealthnamedCreolebodyelbowOnlyforcedbeforeraisedkissedWorldwhichmatchWPTexanTlintsWhomhutchdulywheelhealthTimesrathergoodplatoMoneyamongmonthraisedmoodssedate18078brownstatedcertAilfriendThesoboiledweeksDutchwherenaturepairswomansStatedfortywhichhopofuturehandsS5000limitsunderridersmarrybonedPikesaddedhealthboiledbeforewhichwhichBrazilColontitounderlikenwhichlistencrowdwhorewhichfourthbeforeminuswhichmusicraisedwhosePikeseditorwhichWhensleepwhichwhichWontschoolbrownmusicraisedwhichunderdruggoodshayCoitutiicbaudswearymarrywheelstriketweedWhenwhichunderCreekminesSitnolaboutundueshinywordshouseWhenminesdaysquillAriUtlcGOODSrolledvisionseriesworthCIcltgreatkilledYoulleditorwhichedgepowerlattermoireCloakdozenCrookminesminuswordswhichwouldtubesagentwhichBerlinofficorkilledthrewkillvlworthninnyblackheardbeliefsleuthgreenwheeltuitionBlankasked81000powermidstcuredworldyearsAlderwhomDrewwhilodaysalonecitiesgreatsmotetheysocialblusheverynindoworldyearsLaterfoundheardfailedonlykepthorsemuchdrinkmodeyearsI1ll11tllWnrrlorwheelstoodtimesFifthwhilotheyladyVnrloiiipaidtownsEllenstuckblackwhilemuchmiledownaboutChainmiltsworlddoorsroadsvaluemnllestatehaulotherotherknowhorsoaboutvoicebraidladymuchbrainwhenmanysoberFrontwaistFieldyourshomomilesmanyeverydownloathHopgoldwantspenceheartmakemanyFromthosesmallothercreekpaperYoungmanycitiessuccessCityformsmilesWlllllofiftyoperawhyBK1KTmannerstoodDellatherevoiceWest4000gangstownsstatesmadeyearsnavalitselfgangslunggoldwomenJACKETrumorsmadewhenyearsboomyearsFADScouldthosethinlIt1rcfrockmanyaboutnotcaroTAtronhorsecrazystartsJohnScullvoicethonothemgroangoldflignprayerstoodThenthereshortthoseyearsmadeuntiesvoiceHubopaidIrishUninvflestatethereawaysmileyearsotherheartmileslnol4JmodeitselfridertherestuckWentWotnnnas-setsThusposesclosePeakmoansMorefencedownbranspoemchildtheirsuchwildvoiceheartowedyearsofllcoshortTonicminemainskirtlittletowergoldwomanWhoyearsWHOthroeBHOWNtableclothwhatboonmineYorkwomanwomanwomenlittletheirmurkthereofficemindGAITlooksJohneverycnfoHbeenlittloSuchhotelnlaslseizeMissgaitCtMilritbackWestJohntroutclericworkspotworkEvenruralmainjesttheircourseKNOCKorlltlidealbeenhavestoneDuerMostsockcolortheirMissheadunionLetterWITHjustwhathavopeonuponThatthembuiltwontPeakfromhourwhatThathackmaingrayslocalColo-iYorkETONsemihayafterhavemosthandOUBKNstaidlittlegutsdayMisscartegrowHeretripbuckbookuntilwontaftersoonerwithwithdeadtenorhavebackYorkwithjustuntilafterlourThatwithMissboonhookopenherowomenhaveMissmealMiltMIXEDmostwontfromYorkwhornltrilboonFortbeenwithBurlmaleseasonblueNowThistotaltimoroboThishavodayWorthThisherowontwithtotalCOT12700wusnotinyyoursuchlinowithtimotimehardstudeachdayWhogavedeadinchmoststoreLonekindwithtownstarttowntlHDObeenclasswithflarewithgirlbyeholdthanwithtroutimmuretownwontthenVthrelsourcemustintowireNowwithcashtimemootpuroCLOTHIlUnnbeenwithJustcorneryearcalledtowngavemustninerendwithwithdied11100rendwithfromfromTwotooktimemailofronttownwithwithverythanNowTwospungrayfromTHEwhoKfttittoveryfromwontstateeyesthanwithtimebesttacittimetimoIISIlIfairsTwowithtownwithmildVnilrrnextformFortbeerdieddiedlankcoversseamskipsthenyearflareshotNowwithCANshothere7000fromwillwelltailswentpassUniontookthatAndMyThogiftthatsituwhoTheHerthatwhothatQuonexttookthatownerintoliketuskHillhairhirethatMrslovewhoGirlwhobidswhoANDsaysLawsoldwomanthereSUITtooksaidwhosaidsoldloveSKIRTThothatthatThethatwhothatshutthathutsTexanwillfindwhointosoldthathairVanandtoutwhoputtstillTheThevonwhoTheThehAnKpassneveroiohimlosethissoldironThodiesUnitTheMrsbitethattuskthatthisandlovethatwayironthatputtsaidwhocostShoanysuitThointosoulneversevendullthisthatthatThethatintowaythatTheruefacellornoauntYorkthisthatcoatneverlaywillstdhimladySherimethishindintoThevastthatTheEvenandthisTimeThethatwayfootmayjobsupraandThethisandwillantiOldhimandLadthishimfreoMrsTheTheMrsTheandwillthisgotShebitaandnndNothimhallsilkandanddueandShehimTherealandhimlintwillfoothaulForTonwell880WorkTtxiiitminionturnOnogutlayhadandandandnudandnUllnudwilltwoHerwayhadandYeshadwillandnudHullcameutulandsadandhimnUllandhimandNewSuntwoBLUEcamocomonndwillrustandantIandwillandrealarchandantiandandlastfairstillantiandandDillantiamidaudyouanyandmidnndRuntFoxwayantihadhadanalmachcamegotSpotsomehueandhadhindandaudandandendntulandandandandandyouendnndandandwillandhadandherandhindantiandmaulandANDyetfootSanfairYeshitchandwillantimasscomeratepotvastandandamtandbOilevilhaulandanynodboxandYesYesHIMandliveandS1andSunrusthassameservoyouandand800SifboneoontmoreBythotootandlowhaulgotpurYesYesandthonoelherhudfeetfacthasseatnewspayromeandArtYesYesboxshehertiesherillsroomcamosonicHoheryouthothotestworefeetsomeworeherherButhadMontherherherfulltallhasHisherendfootshesortsameroomshethusameworecamecamethobutthotimeOarboacappayfeetandthenottwotwotierthatholifewereweretimetimethuoldlHybyHowagongoboxherhasbutbaryercoysayshethoher000huthatherhashasthothothethothothonearthothothethofellthethothethothebybyIrkwororowsYessayycrshehisherherthosaythothoshethothothethethemythooldtututhehasoldthothothohasteethethotimethethothethethothuovenoncerunsthewasthohuthasperYesKlolioutoutHe-jwore200theherthothothothothothotimerowsweroweremythetimethethomyinntheCotthocumthethothethothotholifethethethinthotututhetimethothothothethetimenowmythutimethotimetheyorefelltimeoutover000agolistthethothothothethothethothethothethosaytauthotututhotimethothethomythoyesthothothothethebythoSaltinthethotimethetimethothobybyoldthethothobyoldthonearoverhisnotthenotyerthothothethoforthethethethothethethothehasthetimethethethethetimetimethewhothooldlimnMoIllhistimeoverusesHowbythotimebybybybybysoonbynearnutthomythsthetheSalfelltimethothethuhbthethethefallthuthothethotimeoldoldtimeanilnotNowmanmenseenoverBIGthethehismymyONthothotimetimethotenoldovernearmanoverlinthisformytimeparairhisartthehillmanyeshishishisfoolandhishisoversaveoutfoolnowANDmanforforhisforNohiscrewmanlainthantintforhisHoHooutI-TocommoannunsANDforandsixHoetcsatforforHoHotinwasforforforHeHohisfairnotmanmOililotforhOtforforHeHuwasHemintmanforandforHerwasiUmanHoHoforHeHotonyououtlieallwonHehpoftHeTlioforANHoHoforHowaswaswoownsoweforConItstaloilHoWASantwanOFsetfornilwaswaswaswasherToforSoiiiulandwnssawwayitswaswaswaswaswaswaswaswasCorunmidnilheritsItnsetnilwaswaswasonowaswayinndonilupupandwaswasoutwaswaswasoneupDrvitaInvAslinnilandwashothuhoSosawwaswasitsAsSoupwaswasitshoitsrawwaswaswaswaswitsoneourcanhohoAttimeandwasonowasupupcandoboheltdarehoonooneonecancanofhehoheHunedhoershohobohoInhlaOFwasgoAlallbedohetlinboIIAonIUlllAtheboInatewoenrohoearrategoersnroofareorebeofbeseerbbotlmmemoIninofuroofwanroininininmoofmeamofofgoseeerabyinofofiniuinofofofofoftoinofinItofortoofofatofofofItofofofofiutohemoininofininininofofofofofofofofininofoftiCtoofininofofofMofofofofofofofofoftoofofofofofItofofoformotoofKnwnMinininOPofiuIninofofofofofiuofMinoftoofofofofofofofoftoofofofininofofofofofoftoofofofoftoofofofoftooftooftontIfinIniniuininininatofinofinofofinininiuiniuuttodaAofofofofofatItoftoofininoftotoatofoffthoatofoflaiuininininwototoofinofatinoftoiuluatoftooftotooftotoatntnttotototontatnoonaniutoiuatItintotototonttotoatistototototoInistototonttonoonananouOFtoItatItiatoinisonononnotototoanMlnoononnnananonatOlintotototoisYistoisisisAatononitanonnnananannnatatatItntatisisisitisanistoonononisananannnisisananitinatItIBisititisititanHOasofTofinaaIIYisInasasasitofasasassoasasasorasorasInittas0itasInBnsasitntCAASitInttonIAusItinIIIIhIuIIIIIIIAIIIIyIdIIaIIaaInanuAaauAaaaanaaaanaaunnnannunaananannaannaanauanas31unnanaaaaaaannnaauatanaaanIIaitHjIj1II+cIIII¬II¬¬¬¬¬¬¬¬¬¬¬¬¬Ii¬¬¬¬¬¬¬¬¬¬¬¬I¬¬¬¬¬¬¬¬¬¬¬jr¬¬¬¬¬h¬I



PAGE 1

MerchandiseAd-dretsCASNOWCOLESCrawfordvilleMedicinesChemicalswcntyoneyoardougoruiltllTOBRllnZQAdvertisementsing-liiawifnctnrersDrugsDuvalvFlorida-hCrawfordvillerforclvilloralPitj-lrntbusincuconduetedforttilltor-CKAWPOttllYlliMiGOASrjStatement-Ofiri-GepinciocialRubberGood-StatimutryDealerPoxvdersetctheirjindopendencerOWalker-CrawfordvillloAGULFCONTRACTORSL-uNvltoHohidnbtedncHiiavprortcriptionsTOWLESpoitPHfullyp-iiMMxl1VakullnCuunLysaddleryringr-reottIYileomplaht-iantinapdUospondentJgrandchildrenWalkersthu-jitinenshipHotjrs4DnyTvIEDItar-roll1I4WalkersApprtlnahiuohtPowdersOuklookncorlvurMiliHcriptiousspecificationslloddenbcrryimproventfliitftInsiTlIiHiovorruiiiiliiwKoddonborryI3reeCOKKIiSIONDENTSfuldngCComplainantdottblytleb3iUtSopehoppyHarnessgracefullyUunrouiul-OnptlargestprofOMiooalUmmaHollandreceivedHitRespectfullyappreciationUilllttlrSi11iftSCompounded4erUEreceivedInstructionporlioiimmtSoPBrushesLegalaoo-iJtPOITI01publishedunfortunateGausseuux-tiontBridlesMTakull-ieonntCrawfordvilleSCHlUliKU-TraNHleuipunishmentreceivedpricesLargeappearanceassortedWednesdaytogether-andre-ceivedPropri-etaryliiugrtiiKMtCoministfiunerYoiletCuvrabolle-MrCrawfordvilloCrawfordvillePerfumeryCruwfordvilleinfantsassortedFRIDAYnicelythiiroutlltTowlesCouncilwitlifyftgvtttllpreachedrespect-fullyrespondentihinmoullcommunityCmv-orilrilkJonBUILDERSit-lgentlcmonCraWalkers1807-itlHUIttgoodsWed-nesdaywshingtou-SendptiblidhudpopulationSugarcaneMissespleasantlyncighboisflor9-UUMHURUincludingVcstonlayHalteringentirelyhtksi-moioti111-1aMrs1everybodycomplaintWalkershim-Deathsbrotliurint-twrl1edaughterlowestneighborsApportlonnteutDrugTallahiwhiesprndinintltvillmiiiKMiUcollodionFlathptatequarantineCarefullylowestsorrowingChuiiLoryCompleterequestedgenerallyincludingToothpostivelyearnestlyquarterlydirectSaturdayboyVsubpronainvestingtho-allldavitgdiieralyRepublicMcLood-MrllimllMii-iiNurlluiicourthouseSaturdaycortvftpuHdvincommitteenpeakitiKpleadanquarterscstcrdiiyADVltnriOUKaoouyonirintenselyCologncHshootingimjrtMMbpfftSangaterHarveypnssid-vorDIVORCKunyihiiigHepublicWakullasometimesadvertisedimpulsesDaughterbuildinguolumi-iImlerrftlUlMIUft-MrdaylightbuildingpantsHollandWdefendantlaietgertIflorldnatuuidcdpnrtftttutlllMJanuaryshoesmviMiityshowingornrolKOOerectingdwiciiorMcLoodmelodiouseuuntyMnytiiiuxstockrequiredShavingplmtrinvamusementFLORIDAKttmombcrStoreThanksblessingMondayMorioimlylariifiiifrecentlyCourjtynewspaperCiabelloMcMillanpaymentwalkinginvoicethroughshoutingMondayhandsomefonlvillerpossibleR-leKinzieattorneyHollandIeducationCaptainjustresidegjustSpriIIJlscetnotorythroiinhprovid-edexcitingconfessedMedi-cinesBroughtr1OWlasJltllndypityablcMondayvMtlnifromchapterpotatoesholdingpeacefulenjoyedde-PendantchildrenthroughrehudtdSpringshaulingPoBtofficotlaltiymurderExtractsFacejustrrabe1lcwent-tavfedQfWnkullipairafternoonindebtedorderedbdrmvedlel-fptyelpingmonkeyiisuUyCollectornilvuiiUi-mnntupairTroublellic1-CtIIHarveyIcaviiljredemptionfollowedpassingthereforeAdvancoTradeMirlarelativespleasedCrawfordvilleHollandniiiliutiuendvurtlsliitfWalkerhighestntetivtwdebarredworthybiggestSuddenSpringsNigh-tJHollandthoughSundayHurveyattentionPATCNTOrrietchildrenbrothersllltlcorboforeGarFiimn-eialvarietyThutiitwiiiUulkorrtwillWakullnworthyclothaddrunnudtointendedHalrandWakullnDivorceKitittrotifcappointsausagegradedNearlyMarvoystartedBaptistchargescentsenoughJlexicanSunanyon-pleasantsquallyityrltyHiilHriiiiunlWiikullauxwithImolllh-tltrAttorneyparticularmethodrHloiivpniStttcwiIHorltUhusbandchildrenfactorypartiesduringArticlesFloridaboughtPow-dersiiiliKfrllxTsiiructlculnfamilypleas-urehundredVnktillaHAHYXYusingfamilyGeorgebought2023J-IM44SMcleodsuitableOctoberweatherkindlyherebyProvedWilliniuWalkerohlnldivideduowftrwFlaMon-dayspecialperwuai-amndvunccinterestTudiuialjiaHiraiidVlokernQuillieaoreourscfamilysackOctoberJustBrushesmill-ingZrflL-CalComm-TmothersJamesFloridarrmilyQuiggcontractthClOistouchedWalkerliiaMI-3nSpringCouncilguitarhavingsoldVickersdlscnntlnnnWASHINGTON715W1TOfromfamilymodernmillinCiltFPanaceaMouths1lortdaCharlcdPrestonsettlorsallowedsectionsunioimtCrawforvlllepreachPAMPHLETWalkerWalkerIIIt01l1rovfllufnfatniJypeoplenonrlywurrlaifwiAndrewweeklouderfamilyifonbalance1anuccathingsJudgewalkedWalkerrespectSyfret8yrotSun-dayWnlkorHtwjwWitnessgoodatroubleplacedHarrullCubansiehJngWiwiaWalkerFloridaSTlumberaarviuepatiiotlfylnirrudcomCou-rtvloadoelocls-iinsteadoclockgrainssoldiermarriajrwHardenlllntiMicLeodWalkerquIggBaldenHiMTllfuneraltroubleosultodcountyrricndsstrong1lltDA-YialteredSoapsXayttsKitltliMiiciitaorvicoUhSJ-elhenryseemed214q7weightTliesoCircuitcoiUalnniirFloridafriwidnurouiwltf-tttMbtraUacnzuHarrollcircuitPiureauK9rchurchunloadIIHIM-IliwialdIeshoundspatentableoclockGeorgia-nDciderRalphAlphaSadmotherFloydaroundCircuitusburtsausageAdaniAPublicCircuit4ntluyWtI1frlendiMobilemissedntnoiigbillowsimrphasectionbus-singsteamerAdamsiuingsaltncilotidfOCTaroundgoingAlessrHcountyjuitiodyel-lowrejectliYIbeing1111beingAttorneySecondFoiTHllMomulUiccuurUtubuMMOOCRATCformerfriendsLimademurAlbortmensRJHAIIHVlorldtlagainforfeltdtraBoardhumanfathersalewellcausedSheriffMissesiidoof11S07stationsschoolmoneyMamieflalesiiractlctfoiuy-IfcircuitWa-tilinightabsentmouthchainsthankaboveNOTICEMcKinSo1Clttlinefearlyon-iliuirInsurtlouillnessschoolToiletChairmanquitepersonwhichnightappearbeforeItHMRXKnIabiibttappearstatedToiletschoolontiiofullSouthenltlcdvelurptformamuchifjRinllreezolargeMashbehalfmonthcurrentGawkaddedwhicht1tziuaillingbeingbeforeuellvAiilasntsandbeforepriorllarirattUuralSilverlJ817fatherfineToetinnedboinglowndvatuodafraidandRst-tvtiu-IliiooctionnoticecircleswihoolfuturerainyuiggIK-fintlMHlToothwouldfightdeathlargowlierolargoMooreOllrlunundortbarpedSlfKStreetFcannotHomo200mtrTheytrainshumeknownrtwldencnreiuli3184-G1sever-alpris-onWebbhopeThosemusicTheyaboutDrugmusicCourtRootVickI-Mgiven=1JSil-XolistersAllowbabyConst1i7-Auqsiii-cjcrofundWaknllnitit-AttwtooloctLinesdeathcliaryiMlandperwhomMadeHeovcsKovcUnMaggiehandsdotumiiiIftdudhomeTheseJJll4LntthntIandgoodanddugswholedogsCard50cHivebanenohleMjisidHoomkeepdollarcountriesJoliiloftyteacherstover-alhighmaketurnlunlossesrenpluiiiposulnrMi3rOPIOIlITIhcndueheartwhilehonescargoulstermuchirisNVIiltc-CDiuaki-tlipteaeljur4weekilutedandIPbtCouudlforCanuifwombonessakesmndedlminiintnotchunsnotgoodUiwWeiloiiMIMKIIIHIINgoodbrasstCUlSJl1IUilownnrsobtainedworth1SI7-BelMyKfe-WsteershourscuingmilesundodatesM-iIJtheCOMHIV-WMiWJkWillowwltheySusieJulylargo3JQ1reserveOrganweektouchhomodercripClerkusualLuffeOrnwthompartliGilesciiildPlansCubuthoseorderreturnDallatiacertifyundercargoovertermfromlarlcy0-11rraSoulstemjivisitsCrawpercliMWuArranWereu-rhiirtfiSusietheFloridachasethose24g-rsnakeMttA9iuVldsfledtlpttWMUcbeejtfoundhomoStoreweektakendoubtsgttrrtiensirndtjFromHteeraMlnryCubafeverunuoollIonlySuchrMHfcluifawayhometitxeatheirWeirsteersTrMl-vwMcleodSeptwhenlogstliuirwookchildlittlesweetthemyoursthoiiIln-C4youNoahtheirslowwhenrMilulntaunttttwjideadJKOJIIIWJohnMJillnit-hoardKOKThatthornnuuhweekilic-riHidblessyiuateamuntilhandforeigaTonallogsyarnpromon-boardcountv-VYorksinceseasonfundwrtiHcitoolkullaMftMilpollbeenMoLtJohnclodsO-inKuntilbeenbtjanltliluirwindownertineilvaUiMenlistpantuponHHIIUKseasonsalaryItspontfrontJohnPacenotlcuilaidImohuntinsawayneedIcleventJohnWalkerwhohottHullhatepeenhatehavemeetreceivePoorbeentintstortchargeuntilVossflueIloyd3MO-ItSinkGulfSMMIdogOwnTnmstimehonhead2S7si-brvnnrlucreJoseuponSujtt1iaftbeenOntodayGulfbornHerrpartTaxbuynineCaveatsoneInRColsuntiltfiniistoreihnn3il1tsuchpartTearmailhniMutehavebornFloridabillshaulBidsROWiltiPATENTpndthatwishtawthatthenamountnunvisitwithhereiinlnofailuretakehereKuijilmudcoastfrothwithDonlaidPatentsiherMitchdoesrtitiidayycatwiththatwantNollotithattowntoolmoathnveAttest-SWphotoSCCIIIKThishattrothIlrcczuallhenlmolockInterawlfourpatentCallWboyvorybindetdrillsrnltnrtsecuredthisHovel1807thatwhothatbeenofJanicrNewthat70TntislputttinyHerantKantfirstfirstbidsthatcuurtHtakestownshortthisNewherosoldsoldthisSitohiOOBthathindthatTliuthenerrsoldthinornctWhocartfirstntlcvTheMrsvejfi1e1saidlushcctMidtwacliroterrorswhoofTheGongcauieMrllicwororuinTheelee2lBtcomeYIK-Mlltii1fMjailteamabovethiscentluteWtrillandThewayreinMIMThoandoferrorsCoastANDTricesaidfarethattownltnttJOIICBadviceioTrlogwillandieiitrightriteofHiu4322ofwillUnitmorethininidthisISl7soultJIOGJIyuleiilciiNandbtftowntownMsumsofCullHovcartfinehutIFShhimUev1ilVworthfoprOurNatnl-iMTJrLonittwhoragreworaerrorstheand1S97antinileredandtbtandnonioandandouterthisxr-viint19JtlginMIMIandandintoarmsMtiptpatentpulllaMlatedetlwilllustthisandthisandnodandandandandANnLM-pnworewereandandThuanywillofilcenndandNatandandgotmidandandHidfindandBudiorybutyetandihogetnearfrontandanddownscaterrorsundheataboutaverandlastSolandMrundColthe2fO-TItaudseenMrsandimidandandherTWandandandherSeclirwsheherurntheireveryatataminiiiiandandlineWtwo1MIatorganruedtoaclitcailjtheyoulustUtenviryovenicaclitrythethebutbutwinandliltstheyyoulamiiiidUthHillKifherteachatlocalOlaImherhertheAatpieanduntlanderrorsMrshe1DrewherliarWnullFarhUllTaxwordueiiilthasherthenearoncethebillthelifedidoldtillrindwftJthenodMrthoforHUAIIITOhashitsthethohitstheAfullthethetILlleftremotehutthaPatthethethethehuethethetheRICeIIMthinthethoheri-gHrtheKitKinthepentleshebuscasesooninailthe111hersitutheshetheDI8tintholifethethohoeSepthe21i1IfarailthetheIKOthetheInslthetheTOmvoAlltwotheMrthethethethethethetlithidtheoverW4aItiJminiwithMlMcountlUI-ttheNVIIIthethethethetheKinSUUthethehUhoU5offerrolJfIMrtonhishitjityhasIVUsiilfoxtlulrMrMrthe11isMtxl-aidforfilchrustIDSliyOurhutthyoutliybyperhisbyfoxdaycommenMrtheIIaJmytellouchAllforWanun1StruecoinvatLawwitswodkmyH8TMrforMrbydayJMt-IfornotftittNUonuthisfeestoothethotheliltcullMrMrmythedateWillhishippetforfromforMrnowAllbynutltdlSn1312forforEnMrforlitII9rand103htfsnowkiiitmtLawbyaioCultfoxMrHowbyforhisforoutendrivet-rdaywastrsptowttforforItcuraacctofabusefwIudternotwarJinrandforforacctforthlwastiu1sthiswnsandtownraustluHeinnacctwtcwasforNoEiionemustwillUnwithandthatvtnciifAitovalmustasfortetraoneourourratandallwillWAlPithwoniseweAtfornmTOwillwillIlkvlrcddMwilllliiftWa1ifmboaCutDonourofbetooWHOmdCoGoortjctitheoneallemithooilrunwillIDliesecatupourallJhanareranasWMrntoWtrimnilulillofany1tillsatoybehihobeW310OurandfreefillandtotniHtIHIitsarcofarej1touttagupMiiorpSNIanysalWWtreeHITmebalIColarcareiibioheacctJllbeanantiItalWIIofboulllbeofOftareour275andmowasColWareodofheheoutsNVtiof1ntltareM1ZofWt6WurnWPofInp4UtitaxAllnopernvtirtau1iJJColofofunWof53of4in-iofofawFinfurofliteTOAllownallMpdofofofofofInofofofofdfofInMyofofMInvalofofofIhuof50fursonmlaleofItPiIofofWthWVfnhibyof50oftheofofofofof10wtthentofltdofpitbyofofofWofofofoforofofWofatfitnutt11frfeeaeinofpdoutofoftlitinnilofoffuronbytoofbyWtonbillofininPIofbyofinintaiilito34ofofawtof1IlIareNoretTiionatininofinof10ininininintoon1Of-itooftotofttuttoCrsattiiiuusfaltouroneatNinininidlwtMofinAInontotototoattodoononJfnfCUllinininLIfto11hiiiutobttotoanuniiitotou1tooaRatnilvnCrflaotidEattotilltoCoNVItonton4tototototottbtoniltintonnmtorCridtoiaofitatlitVitAVnot=toorareoftoto0toofIII=tpaditin11isTusoftotoItcanUofvrtorisI1ifIllifasKlinoritlntatofofWoreUbftichellfinDorutlctohutoNYof2iisIJttlxasusMHIMFItPindAOiifofoftoVA7reIJPVAofSolofittoatitmJSAuiionIiiMWliiuvJrAt3on1liLto12itTSdltoitr1I3ritoSnrtoInMInM17crluMpdattoS1Ip16pUIKjittotoIPtoorretIniiororTIJitinattourhinx18or14fIfii31or114at11isU8C4-btoUNyPtJfClKorIn0dtfCItcIIntIIfi1nCRH1aADU15131uaaInuaaft1nhaftuftKaUJaI1jftaanJ1a7J1a>U11lIarJCbJdrxorlIIri>JJdJ1tafMtIjtJV+1J1III-J4=1>fr>JItrat11tn1Ifi1I>NtIt+I>L+1Iurl>PIl1=I1fI>+<>Ii


PAGE 1

plllow-ePintolglhecrieuCTzioushyAru-nnJANNIEBREEZBI-UtEurope-Notwith5tluulingCOASTMdUo-rUllAWFOHDVIIiIiK1-Fdea-dAtturneyArepitndiegleavenGULFaliveMarlolvelittloproportionatelykindlyeoyerlotuorroHpondontHwells-1encherNOWmillionsexclusiveroOQf1tiflaoniUllandEsporoncoPennsylvaniasloopButPennsylvaniaTHEreverberatingHttbHtantiallytriumphantlymunici-palitiesunl-lBOlledictDoap-pointmentsathlretAndexperiencecomminglingoxpnnditnruHwoodboringcounterpanesconflagrationphattnnoogaelec-trotypingThoyjhavoHUMOROUS-Didlonolyhourscomfortablyapplicationsrepro-mmtativcsFhdandwhichannihilatingexceedinglydepartmontcontinuallyappealinglyprovidencetin-yHoaxDoencourage-mentsndministra-tionChattanoogasleptSeweverywhereadvertisementtriumphantuncertaintyexceptionalelectrolysishappenedcompletelyswallowingdepartmentcompanionmaddeningWash-ingtonpopulationcotnpnnicHluonntiiineurHElectricityretrenchmentsplendidlydespairingfashionableeverybodymicroscopeteethjustgovernmentgrand-fatherlimeburnerscircum-ferenceconstructiondischargedrespondedbreath-lesslypopulationwhitu-IRingexpicasivesnowsweptrecoiltagpromptnesssecondingnnowdriftodap-proachedWash-ingtondischargedVeraUlmcomfortingEsperencoguardedlyyesterdaybache-lorhoodhimyouAccordingshelteringEsporoncodespair-ingblessingsinnovationcommandersscrapbookKMTOIUALsorrowingtremblingimpressesbeneficiariesdepart-mentnot-WouldBolIUUAYYexplainedemptinessinstructioiiHthrough-theconsultationgatheringun-flinchingauthoritiesQuakertonrecordinganalogousKsporoucodrcadbloakEuropeanhardshipsjudgmenttelephonePlacehunterreceptacleicecrowneddepositdesperateHowlandIlimoburnorlapilossdependedpromptlyunconsciousconversationprobablyflutteringilluminatedblossommyfaithfullyrequiredquiver-ingsuddenlystrangelychockingreceivingproddingplatinumbattlementsgeneratedhappenedgrandpasanythingnoYjJieigpromptlySomewherehap-penedplunginglisteningmonotonylimeburnerbenedictionborderlandheart-brokencommonestdeclivityunglovedsulphuricstruggledhauntingworryingProvidenceoverhungthrowingnppcrtitoveryaotbrokenlyappertitehimselfrevolvingshepherdbreakingwatchingBLOSSOMStouchingtemperedchangingconvictionspossessedhead-waiterexpectedtouchingregainedbuildingstrongestpoBtollleoexultationinvisibleauthoritiespollmolldeclivityhoveringproperlyblossomrayhighwayforgottenkneelingbuildingeighteenunder-stoodpreciousconvenientpitifulsoperishedtogethersnowflakesCrossingmoaningProvi-dencescourgedmidwinterauytiugenshrinedrescuingmeaningiceboundelectricianbitternessconclusionadoptedhopelessstumbl-ingpuntingmeantimepreviousstrengtheveryonesSCIENTIFICsullenlyquakingsteadilydroppedfriendlyunluckybutter-fliestmggagodecreasedthroughEnglandreportedmorningcoveringth-e4otenderlyutteringclaspingthoughtthroughthirteenthOorburdemidwroughtexamplesmokingbut-tJ1tlOconnectedpracticesilentlystrugglethroughplungedsheetironadopteddifferencebaptismrememberelectrodesplungedthroughrestora-tiontriumphStrangerCraw-fordresolutionFIOKIDAremembersomewhatparentalnapkfuthroughdroppedscourg-ingactuallyconsciousthroughambitioiiHmarginspro-fessionincreaseddimpledactuallyvaguelystrivingSeekingalacritypleadedpathlessVroniyathroughdifiereuuepantinglistenersAmericanbearingluggagobiddingdelayedpositivehusbandsPootrWlibroughtwanderedslippedshininglosingthroughthroughchubbyrailwayin-creasedWillistongratefulofferingstirringmovelessvillageslanternsthroughsnowfallmaggotschockfullConstitutionbeyondinfluenceStoppersTunisianthroughfloatingWillistonobservantnothingbiddingnapkinsthroughcontraryshoulderstragedyAmericannothingcompactflowinguttermostIlorliluI-VHItVfaithfulIwhoiuscratchedbeyondsituationMacklinthroughangeredmat-tressesjourneystatementnothinglin-geredtonighthereaftervari-ablehomelymovingtip-pingSundayignoredpassingpunningdirect-ingttieit-ttratanswerednc4atorvindicatelookingtippingpatientbeyondcommandprintedImperiousfamishingwail-ingsNownuddissolvesshelteredBEYONDchubbydarknessgeneralsearchersgetanydirectiontracklesschamberringingtippingPoHtoffieopitilessraisingstaringmournfulHowlaudenoughdarknessiffjntflrmovingagainstworthyCorneyhastilyhopinghimwedontifbattalionBachelorturningscatteredCaucasusthousandfaranddarknessreturnedpausedcomingfollowersstrangeyonderMarlowoeyelidsCornoyslowlyravingsservingposi-tionFridayvalloyrfcaptivedarknessthoughpillowspillowsMarloweHowlamlstrangeutterlyempirespringfurnishtravolurflrebellionhundredJanniesAtlanticscrubbertumblerstestingplayfulendingMarloweIteupnHsenatorspayinglikewisehuddledplat-ingthousfondnossWellallexpectstwentytimingscallingbunchesPeckAlaughingwildnessanswer-ingmomentduringsystemFridayleuplltforgivecrowdedmountedFrenchhundredtnillioiiHijfSfculpritpausedtidingswonderfulcrownedColdfcotwithoutunrulywelcomereceivedtidingslikewiseduringthankfulwonderfulfumblingstrickenan-sweredpeopleMarlowerecorderdepthsominousreboundcouldntwhethersearcherpeoplebusinessincreaseluxuriescallingPeekIdiningAdvancecryingBesideschuchudtaxationcaughtspreadplacedMacklinHumblefingersfingersnuiloH-XJ2WitnesstryingWesternblanketsUnitedpeereddoctorsMinisterwiselylovoantsinsteadpeoplereducedbeneathnearlyEveryohlldhoodproposesrisingvillagepoisonflangesEverywhitherwithoutnearlyquickpleaseat-tachedsalarytaxationkindlierwintersfigurespeopleheightlengthappealsavingstunnedwithoutduchytempestsfemalesinterestbetweenwatchedbetweenlrutondKterribleblankettheoryHenrynotifypartedobjectMacklinwithoutanothermarriedmadumosalaryhunterssufluredlanternsbetweenMickyMalariabetweenllulldlncleapeddiflloultoxcoptontltestunnedlayinghillsidecreaturewhithernumberextremehormyvillageDustyravingUsuryvalleyvisagenumberreducedlultorlngOctoberLondonnumberenteredsoldiersanothersweepsperishpleaseregainmarriedanotherreveriebeneathsentenceWhltootnbHeadedfathersJournalcathodePenrosoprettywoathcrHonatoniswollennccoptmethodverifyEveryr1IIrIHll11sawmillmethodvalleynumberfemaloHclaimedListensmockerylaboredhimselfSCRAPSstrongOrleansmistakebreathedivinedrefugestrongaspectblanketLouderwindowdourlyHIIIII-OThofe-malestreasurelosingforwardHorvicothroughlosingse-curedassuranceDetroitwaitersMonthsfenmloHwaitersheavywarmthcouragestronghurriedSiberiascootedwonderdevisedevolvedteachesSenatorEsporwaitersbeautifulrefusedrefusedutruugthmiraclelionofltguiltysuilererwurentguestsmethodserrautlIicinntQuickUnitedUnitedcall-ingelectriccoloredmoanedcar-bonicbeautifulgoingfaith-fulwhencewithinpondsravinesbelievubeetlesWiKHseemedmethodrefusedplatescen-turythirtylightscot-tagecounselseemedJourneydestinyshrewdwaitorabridledSnookaseveralinstantgrocerywaitersbrokenseemedconfessmiraclemightdoesntshrieksentirestartedstartedamountinsteadboysstartedmonthshimselfvariousJanniothirtydepthspeedbelieveheavenmontliHmotherspeedJanuiocurrentcrackerclimatebrokenbelievebeingurgedgrubsdancingtowardminutebrooksvowedbecomecertainfingerearnestWhitesthithermotherhearersprowlJnniiiohordesex-haustbrokenspiritas-15t10vesselscoloredstartedseveralhumanFrndincarbonseveralbecamechasedbeingdoingneededbreathsenatorshouldJannieFatherPintoWhatfederalechoeshumanmillionmotherway1eternalcherubEtrnngocarriedTnnniochimesboastsfathersheavenstrokeschildsPintobrokenbeingheaventowardbrokenbrokeninclineJannieJannioturned10000flowerynightnighttowardunablegivenbarrelshumanblossiubureauJannioJanniofainterstemspointflungtilingburiedloveliestfatherchat-terTheypleadagainagainchipswinterloveliestboastsdollarsquitochildsaliuoHtJanniechattersecondwithinJanniotowardplantlouderchildsturnedNativenightTheypleadboardsheavenheavenknivesLancettowardwinterprayerThancurrentTheyrelateswhosereplyTheychat-terangeluntoldselfishsprangsilenceshouldnomadwhitoHcellarsgiveslyinganglelayerdis-tanteat-ingforumsdemonearnestloveliestagainbringfifteenIHOOUwinterwithinuvdatedificeglobewhorecarbonchoruscarbonwouldsummerssheetsdrpadTheyOutntofBillysprungstoryknowncarboncarbonfrothperverseClerksburiedagainwherebloaflomroflcurerdullghtnyunoechoestendertwelverainedbeforebesideyouretowelsgivesStatessearchshoutswhichhumanhaltedtwelvebanterwalledgreatMoMODgreatwouldwithinravinemakeswithinthinkstandsnightwouldnightTheydecreebosonsWheremetalstowelsinfantablaxeOrumlstruckdrawnbeforehissedstoopcoatedeitherforeverThereshriekhealthlessonidioticmayorwhoseblossomblossomnightcabinsget-up12000WhyWhylettersHtuteswaitedclosedunlessto-dayMustercopperdrewstranROsmatterspoonsonlyUnkullnwouldravineringsarmedHOUTIIWICKrecordwouldwhorehandssoundbodyOitymastermusterbodyfollowflameshitherwouldwhich72000awayescapeIlrwggivessightfoundstruckgreatheartswhichleavesIlIuulHguiltgoodthroatglassothersfathermarchpartsSONGbodyThereNeverraisedGladthrustblossompastevauntedgreathopewingunderknowsfatherTherewhichstayedfatherMariatingogreatthroatfatherwhorotheydutygooddeepPintoplategreatwhichaddedfatherhandsWhatThesewatersfatherfollowstonesbeforemutestfioughbosomlonelierthatswinds10000wouldheavierwhorewhorewouldBuysNeverwhichwouldfrozenrottenkilledtkontdaredfoundwouldfatherwhomaddedWhenwholedollarLittlecalledblossomdaysmakesThreeDolangoodgoodStatesThosestumbleheelwqrlclarvroThereroundworldthankdumbPintowhereundergrimwhoreangrywouldTheretheygroupdeepboyslightlightonlygreathopetouchabovewhommadepausewholeshockkilledmountbloomsmalesyoarMCountydroptingresorteveryliftedhearddaysthey3100ContHpainundereverywhiterecentbloodfathercrimereturnllteleIlovedAtlantaboysAgnitheytheytheyplayrelyshoutbeardPintolovedwhileWhatthatseverygoodfoundtindergroupsecuregreateverytakenworldHushheardwhitehentinfallenkneeskindsovarytribescouchgrouptheyauimidstfoundaboutnuttyatomsDowndreamsbreakfoundstreamsboxeswhiteWhatbrightamMsavedlistenblurredDowncalledDoutbowlspathslongtheytheytheyonlytheytweonStatetheytheymiiloHPintolimbskindsblockotherotherbruteaboutbe-comewantedremorseyoudstavesforestbuysbe-cameyelpordoralarmtimoRwhendriftstruehorsetastethinkpauseaboutbloodwantedawaymightwantedmilesjfwnutadsouthlarvaeoutfitlongtheyWhatPintotheyspotgladPintowhenshrillninthbleakdowntaxedwritetwiceliftedtheremanydeathqueensOfficialladyborneshorttownslimbsvoicohorsewantedmanyotherremorsemaloHmuchlovedknoworrodoxidebrutedontlearnwanlodtriedshrillactorsmanylameboasttherestoodheartcabinothercheerdownstandrocksothersmallotherThendresspace8blindheartchildvoicoreachtherealonepapahomoblindelltehusualknowcatchtimersstoodHumemadedownfittedflashedthempeacelayschildlittlosaucersotherboasttherewhendownknowwhynutmanyshoutCOIIHUHtthoubleakshortknowwailsdownmilesknowhavevoicoheartbravotheirdayotherliThobraintheremanygladshipdownfieldsheartwiresolllcedontcloseyearsheartwhoaPintoblindeverymanymortalstreetsTonalonebeastusualtheresmileSomepoutpoutthereyearsmadeheartThenbeastThentruthThoumaderootsDeaddontdontheartlittloWithlittleTruelittlelittlomanner70JOOLovestakeshomeThenwhentakesyearsh-eutbookmadewebsthroewhoachildbudsmakethomtheirgivegivelittlelogsThenthoseanswerPressblindarmyloverIIrouchildblindthicklittlelittloofllcowhereRlloylittlelittlolagschildrisesthoirhandrecovermassestheirhushhandDivlnoawayforkswhatuponWouldstainuntilawayuponoftenHoulnuponclawYorkthemThinspoutchildtheirlittlelittlelooutheirstopthemisntbaudweekJattmortalfirstlivedthemforthweekmineuponwhatwhatleastAcrossshalllittlolittletheirtiredHedhavewomanbosomofficeawayhavelittloSoonuponfixedstandweekanswercityuponwonttheirawaywindSoonOrpinlogstotallittlelittlolittlelittlolittlolittleyourdosortlivesTeiintheirYorkboybackekiesslittlefaultkeenhotellittleuponThatcensusHpOtcitywawhosewhoroboonlittlelittlewindlittlebandLikehavedeadhavoyourhushforcemastlittlehotelwhatLaudshonorhaveclaspatovotheirlittleshallfromdebtstopbackwidehaveballsjustcityboyhaveyourafraidlittleDoeswithwithhourwhataftercantHndsafterJamiMboyhardboygraaaybackhavemustblowHowalive2000forcogoneIjnrrunroadscorefromhullshavefromdogstopsbravoharkbeendriftsuccorhourmustWellbattloOodedaywithbeenhourthanthanhnvobeenfromhourJonxlimierreaduponwantmustpooreachhavewithwithlaterwithwithstairthatopenbollsThereseatsgonefromhour1000beenwovendayacrosssliphaveboutshavegoodwithdeadhavebarnfromsteelhandscanthearbeenchillHmlupondoggifthavedarkhourafterhaveafteroovonscarce5000havehaveNowwisemhoPooraftermuststaterescuecupsfromFreefromfromfromwithwithwithrendthanthenfoodJustduesbroasthaveheonbothherotints1000Poor2000takewithusedfrontloafmarlswithwiththanwithtimetimewithLifegirlCryamitimehearhero1000TowdebtouchYourlooktookwithroadwentOodswontsoapafterpoorlookmeanswithwithheeltotalNowcouraowithdeardearhurtbeenspurtheneachtearsthanwithstatewantfrontcoldlookwaillout3000limitwithwilddogwitheyesscarceabovofrompoortimewithlooktheneachthanyearJustheroluckuNonhlohillsthouloathWasNowthenherosodbathThe1000rumorsaidbladewillsweetwellGodGodlookthatAuldwhothatsweotmayhillstownfrompeervery1000lonolooksweetwhothismadeflingTimesidesaverladyTholovethatacrosslimosoulthatthatFromacidmanssweeteyesmadjoyGOOObraswhilejoy4C01intoacidpoorthiasoulthatthatsweetiThewhoruintakeneveringbigthatthatcroopiKoiidKlandsandgotsideneverintovilloOnomaythatwellThethathowwooideathattinyTheintocauseLinerHOOthathowthatthatthatLIFEfourCabinvorgonumbtakeAndlovegirdThoTheMyyetYonlaytaskthatktteworstthatthatthatsoulwhothatfirstthattruoveryfirstThehadliveIHnawillhimandthishimwhowhothatThewhogiftssideintowailThewerethatTheAndacidwellthedownkkjswarmgetsnevertiptorkintohitafarKvastillThohimhimfaceintofindonlyTheThoThefluidThethatswtotswearsentheshearttuturichlesslikeyourwillialsointofearacidgotandgivemaidthistindhalfhimstillhimLilahinthadandthiswillyettirofaceintoalsoanythatnutfakeintofliesMrsuiylaywaycrthathomoingIIAandhimtonsThostillhimandthisnevernUllhimlaidthislikeandyouyoutoldTheTimefaceafarputawaysirslaySheLikegetyouandhimhimhimhintthisyouyouyouaudandandlikeandlaidandlikearmscharslikeForlikehimhalfhalfForlandlogafarcoatnevermorogotandPIandsmartandForlikeWJianyandandandandlasthindandandandliveMathhimandaudyouyouNotanyBymindYouButgutthatnevermoromoreworefromgitWithandandhadauntmeanmoveLikelikoandandlastrandandandhadandfeelandmadYesandanyantileftWith000andhimaUllyouhimlastratohavelilysortgotcrosssnowsomefaithYourstowandyoueumuandandfindamimillnoelandhadandlastandandandandyouyouandandantihaulbadlastlostandlikemaullaidsaltmumfearfearwithyourmoanteRrahUlldueandandantioomoanyImtotcamecamecantofeetliketholostnUllcalllastandhindandandhaulandandandHisandlastandhadevilliOnudandratethecallandworntthelogsnowstiryourgaveyournilmorocamesomewereandfeltyouandlostlossandbuttwillandleftshehadandnotwatblueandfoWandButpayfullmeetbutfullandCOOandlipsfeltbadnotlastroomconiccamemoresnowhulllowyouForfulllinttestthopoortheWoNowworecomosamenonemorecamegavebutthothoForkillbutwerebutbuthersofthershethothethotheeyesoycamorosnowneverwereLimoYes800lipsleftFor800200buthaslidthothoaltoworeoven>YOtellthothothothowerefjavogavethethoAnddewbuttiebuttheJtnpan800thehUllthesorthashasthatoyeanyherhaswasSixhasthothothethotimethediddidthothethethewerecvcroyeswiththethothobyneararmsbyhintbytestIsmsCOOherthothotho075hererrthothohasgavegavobutbutthothethothethethothethoherthothothethothothothofellthethothoolddid107thothothothethothoWotimelifothothotimestonethovisetheoverbutthSperthobeeDONthethohasthothothethethobywereworebyovertwothesurethobutmythethethethethothothothothothebythothethethethothothethethethothe1IuthothotholadsoonbutordshethothethothethothoitsLifothothothothethothothonotthothothothethothocryoldthothedunthothethothothothethothotimethotimetimethethooursitsbybythothuthuPicthethothooldoltithotimethothonearoversaveLikeoncehiscryfiretwooutnuttheonesoverhismattthothethothothethethethethethethothothothethothe505thoownonceLifeUnitthothothotillthethethothomythotholifethethetheoldthethothothethethothethotheoveroveroldhislo-AnthethoHemybylowoutnearJlhthothoThoAndthobythethethetimethethooldoldmytimetimehisLifethothothothothethothothothotheoldthothusthothothothothohisoldthehisthotimetimeridtimeAudhulahishislieoverhisownbestoutoutnotouttimethetimeownmannowthetheAndnotfortoothetimeboohisoldthohisovertheMooldoldtellmythebyhisfadnowmanhishishishisledAllhisoutandnotnotcrytimegasthofoxoldthecomocrossOno100gasOhthoforthoXIShisOnleduearhishismyoldmanemanhishisitsYouandnudYoumanbyYoueverhishisnotandIdTinYouDowithnesstimethomantunahishithislflJhishishishisHUMrterovernessmanMyhisoutltisThotoolikecotkissroarmonHonowHomanau1hisforforforhisnottooBhoroarmennewandyouForhismannettilltillAhOnHeMrMr1rNoAhforlossanyHerforXomantoohotnownowOwenewOhapHoHolievestforforforformattnownowyourealforForOFforFortaxicesawnowHehdwasforforYeaNotheryoutaxownforwassawfornowowntelyoulastwasactsetAsXowanforfewfootForlintnewforlotwaswanthoforAtwaswasitjliesrootuliocIthowitswasonowarsawwaswaswaswasallnorcanupuptholiewasnilwasownwasallhertheand0110waswaswaswarwaswasheonorunourwaspfupugthehoallcatsallwasdowasonehohohoallonoonowitswaswaswassawmyallwasthethooilwaswasillhododeonowastinallhonotitsdoheheallbomytimewasbyupBOOuponowasuplifhohohohohotllupownitshoIuhobonilhoitshooneoneonowasareonebonotnotownIntimesonhohehohohehocanhebobutfezlemenmynowwasurrmyhehosonmyAllhoofhobeLhogohoeaumyhomyarebohoforoursonofhoyemyareofHeroteringonrooreofgoareare81ofarehenioseeareininofmoooarMoinboofweearmoex-IBOare20inininmomoareoffitofmeforofSOonoallmoofinofItinofinofIfofofiutoofofofto111mo28ormoToofinininininhiinofofofofiniuofofininofofofofofofofofItinofofofofofofofMattotoofmeofweweinallalltoofinininininofofofofofofofofinofinofofofofofofofofofinofofofofofofoftototoofofofofofofofoftotototoAsiuofininofofofofatIttoIttoItofininininofininininatofofofofofItoftoatofofofoftotoinofofiuufnttoofofoftotoontoofofnoononwoisinintoatanofofinintototototooftototooftototototoofattotutotoatnttoauonuvIttotototoofisatistotototototototototoattoantomouvonontoIttotototototoisismotoOfononnonoonmonoanmoweAofatintototorattoisisisisitisisAtooftorrononilnonoononanannoinnmoisAAisAtoitinnomoonononenonononanisBOtnoittousonisatanonanofAofAsoisisisisifisinitititonanorisAilliHitofonisififisifAisiforittsoor9itofInIninAasitHOorororsoitifititasimasassoofsoasusnsitinboasitororasnoasHOIIHasitInto0soiforasnsnrnsinitIiitattotoA0IsyanwitiilaansIIgpII00IIrIIII1ouIIIIlrIII4IrbII1aolIIIIIpIaaaacunan1t11-rnaaaa=annaaaaaaaaauaa1VlnaaaaaaaaauaaaaaaaaaaIanaaanaaaaaIaa4-tnasaaanaaaaaeaUIIaIaaaa±IIak-tIIaIIIInaII1IIIrtIII+Ijq1MjIIIIIIIIIIIIIjtII1t7I7IIIJIIItII4MIIII4iIi>I>IIIrItijlIIInuIiII<¬¬ut¬¬¬¬¬I¬I¬1¬¬¬¬¬¬¬¬¬tt¬¬¬¬¬¬¬¬¬1¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬i¬¬¬¬


xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007590400019datestamp 2009-02-12setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title Gulf Coast breezeGulf Coast breeze.dc:subject Newspapers -- Crawfordville (Fla.) ( lcsh )Newspapers -- Wakulla County (Fla.) ( lcsh )dc:description b Dates or Sequential Designation Vol. 1, no. 1 (May 28, 1897)-"For the people."Publisher: Herbert S. Moore, <1915>.dc:publisher R. Don McCleod, Jr.dc:date October 1, 1897dc:type Newspaperdc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075904&v=0001901456015 (OCLC)sn 95047266 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Wakulla -- Crawfordville



PAGE 1

iiICrawfordvi-lloi1iJANNIEBREEZEEurope-NotwithstandingCOASTiscraphook-Placohunterden-dAttorueJAreGULFONNNNNL-ittleiIto-riRtllI1RlV1ipleasepleasesloopButproportionatelyriaQtJOUJr1ULUrrulrwell-sTeacherNow2BBicorrespondentsjbleakVighV-ofelectrolysis-thatathirotAndPennsylvaniareverberatingsubstantiallyprythoughnndEsperoncoexpenditureslln-BllcnollictDomunici-palitiesPennsylvaniaApplicationswoodboringcompanionsplendidlyropro-flcntntivcHtowt-mEvaDoescomminglingBachelorOhconflagrationbeneficiariesChattanoogaelec-trotypingttrangoatrangocounterpaneslouolyhoursappealinglyexceedinglycomfortablyChattanoogaannihilatingtin-yHoaxDooverhang-ingRIOltXowgovernmentPintoNotwclvomontliHthirteenthceueverywhereprovidence1oNNS1Ncontinuallyphysiciansconiplotolyswallowingadvertisementuncertaintr-ofdepartmentstruggled-oncetriumphantdepartmentmaddeningeverybodyexceptionalWash-ingtoncompaniessnowsweptbattlementsdischargedmicroscopepopulationdischargedMorltlnP-UIIMHIIKDBDITOKIAIiElectricityretrenchmentdespairingcircum-ferencemountaineeraWash-ingtongrand-fatherpopulationap-proachedpromptnesslimeburnorHcommonestcomfortingexperienceunconscioussnowdriftedconversationbreath-lesslycommnndorHAccordinginstructionsbache-lorhoodEsperouccanxiouslyyesterdayIleWhydespair-ingshelteringEsporoncoconstructionhimyounp-iointmontaimpressesrespondedBorrowingsecondingguardedlybrusquelydepart-mentdeclivityQuakertonemptinessun-flinchingNativeNotEuropeandesperatehardshipsdeathcryconsultationtremblingempirereceptacleexplainedheart-brokenpromptlyicecrownedanalogousEsperencejudgmenttelephonegatheringstrangelyprobablyhappenedgrandpasdependedhappenedrecordinghap-penedfaithfullyanythingauthoritieslimeburnersuddenlygeneratedex-pandingpostoftlcoconvictionsHUMOROUSBLOSSOMSilluminatedchockingquiver-inglimeburnerintoningpossessedpromptlybenedictionSomewhererevolvingNNMNblossommyshepherdplungingreceivingsulphuricfashionableappertitemonotonyborderlanddeclivityscatteredappertitotemperedchangingpitifulBOwatchingworryingProvidenceproddingthrowingndministrahauntingunglovedbrokenlychubbygonohoplatinumshepherdstrongestkneelingblossommyRussianCrossingregainedhead-waiterpreciousrpquiredProvi-dencehighwayreportedeighteenbreakingtenderlyexpectedkneelingforgottenblessingsmeaningbuildingtouchingpretendshoveringsnowflakesinnovationconclusionauthoritiestouchingSCIENTIFICperishedsullenlyproperlystumbl-ingbuildingconvenientscourgedrecoilingenshrinedworthy-ofmeantimetogetherblossommyanytingfriendlyrescuingmorningcoveringmoaningStrangerYremynthroughexampleunluckynowforcetriumphhopelesssmokingEnglandstruggleadoptedwroughtbutter-fliesImggngopreciousmidwinterambitionsparentalihoronftorevoryonosscourg-ingshootironpracticeactuallyelectriciandimpledhopelessbitternessbut-theyreOorbtirdcmtddroppedkeepingAmericanquakingtippingdifferenceutteringfddttiftaclaspingWillistonFIiOltlUAadoptednmtbatttlthroughplungedexultationin-creasedplungedthroughresolutionelectrodesSeekingsteadilySinkingdecreasedthroughiceboundthroughdelayedwhiningdroppedvaguelypositivenotifyencouragemat-tressesrememberConstitutionangeredactuallynapkinspathlessthroughinfluenceSundaystirringbaptismpantingmarginsthoughtcontrarythroughthroughthroughrailwayincreasedalacrityduringthroughpleadedpro-fessionbroughtinvisiblesheltereddillereuoepanningconnectedluggagePic-ayunepoetrythroughSteppesspreadrememberfcinaloHshouldersbiddingpantingjourneygratefulwhitherthroughsoap-boxestragedyobservantmaggotscommandthroughignoredsilentlyWillistouflowingthroughsnowfallHasBeennothingbiddingstrivingexclusivever7lnolookinghusbandstippingbeyondsomewhatlistenersvindicatevillagesHeritoransweredbattalionCorneyHoatingnothingturningplayfulswootshobearingringinganother-AlikewisenothingofferingdrivinguttermostscratcheddirectionchubbycaptivepatientmovingiHMiscious8100-iiixservingdissolveswail-ingsImperiousvillagepitilesspassingpillowsenoughprintedsearcherswaitedHowlaudbeyondtleepntagainstBEYONDstrangeinsteadcompacthomelyslippedtravelersbeyondCaucasuspillowsfollowersdontifpillowsmournfulHowluudrebelliondarknessutterlystatementtonightforgivedarkncHBsituationravingsdepositcomingCorneyhireweraisingfamishingmovingthousandstaringnorthernmountedHowlandyondereyelidsexpectsfoiilnesstracklesstidingschamberominoustwentypayinggeneraltumblersMarlowereturnedhundredbusinessposi-tionhastilyanswer-ingJanniosdnrknoaslaughingunusedduringendingmovelesspausedkindlyplat-ingvalleysculpritFridaynapkinwhetherdarknessFrenchdiningtidingswonderfuloptingcrownedwildnessslowlytimeIwonderfulscrubberMarloweColtlrootmillionshopingtestingtarantIsearcherblanketsstrickenWitnessfingerstidingshundredthankfulbenefitwithoutFatherAtlanticPuckAflangescallingproposesan-sweredHumblesystemcouldntreboundbunchespeopleWesternMarloweincreaseMalariaAclvanuowelcomelovqlleatMarlowebetweenPeclIsavingrecordertryingchookoilbetweenstunnedlovoonllsenatorspeopletaxationat-tachedMacklincryingcallingdepthshardlynumbermillionsluxurieswatchedlanternsreducedspringcrowdedcaughtlikewisepoisonstrangetheorynearlyplacedpeer-ingwintersLondonmistaketompestsnumberEverystunnedduchyfingersnccoptsawmillMickyenteredwhitherListenhuddledwithoutmarriedsentence372000peeredMacklinregainfiguresmightappealwiselylayingravingchildhoodfumbliugwithoutBesidesnearlylanternsexceptperishdifllcultmadnmoloiteringpeopleanotherlengthMinisterhuntersvari-ablestartedMucklinpeopleheightDustylosingsalarylayingOrleanswithouttaxationkindliervillagefemalesWhitessalarycoverletanotherFridayMonthsstrongweatherOctoberreducedsoldiersmarrieddoctorsbeneathbetweencounselUnitedfemalesterriblevalleyguiltyverifyforwardHenryHenryleapedpartedsufferedbeneathlosingtreasurefe-maleshillsideheadedwarmthbetweenPenrosorisingAgaindearlynumberexceptEverylJullltlnibridledfathersblanketinterestmethodQuickextremeHonntorflrefugoSCRAPS111EveryswollensuffererLouderhermyinsteadwithoutdivinedthirtyHovornldevisedlaboredJournal-aspectguestscoloredSiberiastrengthVhltconibmockerystarlessfaithfulmiracleheavywindowmillionfurnishhimselfEspor-strongobjectmoanedcathodeso-aredSenatorcall-ingseveralDetroitwonderSnookswaitershurriedhimselfprettyUnitedvisagethirtybeautifulclaimedevolvedrefusedravinesseemedfaithfulbeingvalleycar-bonicplatesmothercouragecreaturefaith-fulteachesseemedmiraclewaitersbrokenUnitedmethodwheredoesntout-lookspeedwaiterswaitersnurvicocrackermotherelectricclimateNOTESdancingcertainbelieveNNAnumbermethodshrewdmotherdestinygoingmethodpondsthink-itshrieksgroceryrefusedlosingwerentamountbecomeblanketedificeinstantthroughhimselfseemedminuteblessinvariouschasedmonthHrefusedseemedwhencecoloredstartedstrongrelatesJnnniecot-tageprowlurgedfingerJourneyreveriepointdoingbelievebrokenneededbrokenJnnniotolloboysspeedex-haustWhereturnedknownspirittowardseveralconfessstrokesthitherbrokenbeetlesbelieveheavenbeautifulbeforedepthbeingIntumtdocurrentheavenchattersenatorhumanheavenbecamebeinglightsentirebearerswaitedJnnniequickgivenbringNovoogivenstartedcarriedtowardshouldfaintertowardinclineassuranceJnnnioFradinservantsummersbrokenTheyfederalJannioJanniohordesloveliestangelhumanwinterwinterchildsbureaubarrelsstartedagainStateagoredcherubstand-itboardsbeastshumanbrooksTheyTheyreplylettersalmostagainturnedrhoyhonestheavenfathersbrokerearnestvesselsJonnieagainJanniochimesplantwhoaJnnniosilenceJanniounableshouldbosomporvorsogrubsangleheavencarbonwithinchildschildschipsJanniowires-AdollarsGrandstorynightpleadchat-tereternalcarbonwithinwithintenderwithinTheyquitetowardtowardgiveslyingClerksdemoncollarsforumsspranguntoldhaltedcabinswithintwelvenmloHpleadwhitenbanterwinterloudermetals10000fifteenbeastssprangflungTheyechoesglobeforeverPintohissedTheynightWherechorusearnestWnUiitlnflowerywinterburiedunlessknivesblossomeat-ingbesidedis-tantdelightwouldloveliestprayercarbonmiifundergroat49000standsdecreebreathburiedthrusttowelswalledgreat-sheetscarbonidioticnomadresourerechoesagainringsBillyStatesmakelayernightget-upaddedagainwouldstruckrainedshoutstowelslessonablazehealthcurrenthumanravinegivesSONGrostoracarbonatomsnevershriekaddedfollowcoatedfatherdrawnbeforecoppervowedravinerecordselfishbeforeescapeblossomglassWhyQuitmakesDolnnwhoreraisonwhichspoonsnightwatersmarchstoopwhoseblossomclosedknows12000gavo-Thoeither10000bosomlightfatherTherev-itanmasterbodyThesethroatwhosobe-causeto-dayotherstingemasterpastegivesarmedsearchNeverMcIIIOllightbodygreatpingfatherwhichwouldbodytrengkilledwhichasnttgreathitherfatherwouldleavesspacesgoodsightthroatwouldstruckflamespartshopestayedloneliermastermayorwhichwhereMariablossomwhorehandsfattierTherefatherbosomwhoreclIKivo111111whorewouldmudoStateshoartninfantthoygooddeepguilttheywinghandsplatecalledunderfatherTherewhichwouldgreatunitedwouldleavesBoysfatherwherofollowthoughwholefrozenvauntedgoodtingPlutofountgoodilVeodhopefatherfatherNeverworMremorsemountwouldfatherThererottenwhichwindsdirectrescuerswouldtnnloHgroupkneeslowedeepbe-comeAtlantagooddaystheyhandssoundThesewouldwhichdollar15540greatmalcHPintoPintocrimeundergroupWhenrecentTherefountroundtheytheyonlygrimkilledpainunderThreeFinlneverymidstthatsaboveshoutbowlsunderwhomstonescriedonlynlnrmdeepdreamsheaviertheyCountyPintokindsCentsdaredhearddumbeverygreatPintosilentsweetwholefoundcalledtownsDowngroupwhomgreatbe-camebreakDownwantedvrantodboysfoundbuysonlymilesheelmaleswhileWhatkindslistenbrighttheydontpausethankaboutyelpwhomthinKSangryaboutbloodheardwhitefallenlovedotherblockomdnltheywhitewhitestavestheytheywriteboysdropbornekneestheyblurredBorneshockyoudchockyourethinkdriftsknowtakenPintotouchDonttrihoadreadlarvtocoucheverytheybloomsremorsetheymightactorsbleakotherwhitethatslimbslarvtoWhatHushheardlarvraboastorderfoundeveryqttoonawantedtauntsrocksworldshoutsouthWhatbravogladresorttheytimoHcheerninthbleaklovedPtntonhrillwhenwantedblindthoseheartaloneStatemanybloodsavedchildforestlayslongspotliftedmanytweonlongpausereturnhomeerredshrillaloneoxideWhatmanywhyplayblnokotherWhataboutdeathPintooutfittheyThouladyninnybrutebrutewritehomedontdontwantodHtronnwPintostoodbeardblindothertwicethereheartlinstomadetaxedsaucerseveryhorsethemheartwheneveryUnshodPressmanywhenstoodmuchknowrondoboastthereDeadyearsdowndownknowcatchmilesdresstheremanyWithlearnstemsanswershipwantedingsotherknowhorsefittedtiropathslovedhlllllbliftedthesefieldsheartdowndownlimbsdowncabintheremanyeverygladblindblindThenusualheartthereshortdownwhenwhenheartThentherethreeknowtheirlittlerecovermannerlittlegiveyearssmallmadeusualwhoureachbeastsmileThenmakehearttherehandweekchildheartothervoicestopwaiteThenbraintruthpuntstoodchildcensusotherthickthatlittleforthTennyearsHIIIDAYlittlopenceyearnThandontthemHadpostYorkcloseSometheirlittlevoicerisesclasptheirlivedwebsotherdrewtakesbeastmadeofllcoblindTonawaythereminerieautheiranswertheirtheirawayuponlogswailsmortalmortalWouldwomanbandTruetakesuponweektheirthemawayuponhandafterwhorechildlittlelittlolittleSoonlittleLovoslittleDlvlnogiveweekforksstovethornbooklittlelittlewindsoulslittleawaytheirwontwordboymasseshotelhotelshallfaultwhattriedtiredwhatOrRimofllcoNowstainThatcityteethAurosHforceoflloouponwhosowherelittlefixedRileyjustThiswindtheirshallhourlittlelittlehandhushuntiluponoftenhavolittlehavehushwhatthemyourWascityturyspotstoparmyalivebarrenworkwhatloverwhatcantjustlogslittlelittlelittleVernlittleboonkeenchildlittloyouryourawayrootscitycensuslittleisntwithchildhandhavehaveWellbonorHedlittlelittlelineraddslittlehamdesortGladboydebtspoutlittlelittlewidealivehavemealleastdaySoonuponafraidboonhourYorkgrassybosomwithawayintoacidlittletheirhavelingsecurehavehourhavedayNewcantbudsupontotalhardwithwithAronnThomlittledeaddeadafterfromfronthavefindsafterPoethavepolleachhavefrombackballscoursemustdaytlisFreehavotakestairwithhaveblowhourbeendogCrydogdogwithwithwithuponYearhavohavemustuponuponhardslipJameswantLikobellsbeen8000mustmustfromPooropenhnvocatchhavehoursuccorseatsPoorwontpaparoadthanwithNowwithlivenhoarbackdrifttimo1000handsgonoboonharkfromhaveHOhboybeenusedwovengoodftttttchilltimeboonbackhavefrombeenballsboyWellreadstatestopstimebattlepoorhaveHowhourthenwiththanwithwithwithCurthanbeenbeenfromhaveJoaxJustfrombronutlarksteel2000leafwisedearwontmustwantwitheachonogifttramdodawithnndwithwithdeardearinnathenbathdogbackfrontbarnwith1000getssweetbothwithNow1000acrossTheGodbillsheroOodsfront2000bladehillseachoicowitheyescupswithwithwithdoes1000eachthenIfitthouherothenroadswootthatfront7000timestateHmyoumayluckAndpoorrosettegirlIVKUVtipherotearslandstitantotalthenwithtimethatnumblookladyrumorlookafterafterfromThohurtfromspurmeansrendnborowhofoodyearscarcethanHovenJustulotionGoddebt1000mell3000YouThethateyeswildlookcoldthatheelW7lookAndsweot4191chatshorlookhoariiKomiKsomethatThewailintolandsdeathsidecomaweltsoulLifewhomanssent0000bigOnosaysAndGodHowsaverwillthatwellhowintoLIFElovothatlonemadwhowhosweetacrosstooktake1813lonethatruinjoyjoyacidmndorichialsowellmayAndwhogotscarcethatwhileyetpoorherothatBUllgiftsandthiswailTheacidverythatnevertoldthatloveintoThoacidsaidwhofirstfirstworstputthattaskwhosoulvhofourthattorkFrompoortakeanygirdwillyetstillhimMayneverableTimeintoThethatthatwilthowTimetionthatAntthatthatthatthatthatthattruesweetLinerfirstThointothislaidThesideTimeYouMrsalsoThefacewillCabiningthatthatTimeintomaidneverare-naOutfitgothintstillHathcreeponlythislikehimThofearanythathumthisLlkohomosweariTherhohalfintoputgotneverloghaveWithlaytruedidlayTheskiesglvorhoThoTheafarhalfheshimskieshadyouvergetiedhimhimstillhimthisandShelikoyouhimfliestonsTheThethatintoideayousoulwayfacecallneverfacenfanlikoDidandthudFornutlikoleanlikeFurlikehimhimandhimKiltthatafarfacelintfindanyhalflayafarThewarmandlossfindyouLikenndandandhimhimyouandWithandandhimandduehimlikethishimandhimhadandhUllandForsaltandliveanyfearwaygetmoansortthelayworritandwillundcoatgetlikehintantiandsourandhadthishadandyouandandyoulimitlastantiyoubutstirByantiandyouandlikoMrslikeyouhadandscoremovelogfearwithfaceButantiandandandliedhadlikeyoucrosshadandHIUUOYourhintandandandlostandandlostlaidhindantiandfeellastliveandyouoursandnullantimudandlastandButYouyoursnowconicrntonUlllastandandhadantiandYesandYesmootcamegitforfulllastHisyouovilandundandantiIudamidlaidandantiansi000morocarnefaithaudawaymeanandfactForfeetandmoremorecomeandandForhailfullstdfeetDONfromNowratemliiostarsyourthecamelipshadantianycallfewanyForhadpoorwithmathadandantiandandandyounutImHtheleftandandandgaveconicguvokillfeltlifemoroworearmsweregetsnowworetipbudandandbutnonecameandlastwerebutsitetestbutanygavebutandandlastsoftyourthelostfullleftroomnovorwerenonesomethosheorcsrwiselisttholiremoromorosnowsnowweresortttto103Imbutcanedidgavegavelowlust800antitostourpayfullherthothoherthebluothoth6thothethethocamewerethethetho800lipsGOO800overAndbutliasthofeltloftbythoWothotheAndoyesthothelifethehermoreseinethotheitslo-AIeyestearslylowItsbutlintthe500070thothohasbutthoherherhashasshe200butworethothothothethetilethothothothethethothothetollbythotheweresoonbyoyoasheoatnIt1totnaythebeeLikedealtwothothethethehasthoCOOneartholidtho107thothooldtheherthethethethothothothethothethethethethothethothothotheoventhonutnotperoutbybutthothothothodattwodowthatenoebyhiswerethothothotimetimehasthotimetheoldtimethohasthothothothothethothethethofellWothothothothothomOllmhothothothethethooldthothotheoldthetimethetimethothothothothothodidtimethethoworeovermanoverbutout100AndthethotimethethothothenotthothothothothethethetheoverbutthothothothetimemythethethethoLifeLifehisthothethetellthothothotheoldthenotbybythothothehisthothothethethothethotheonesnesshisoldnearcrythothethonotthethooldthothethethethothothelifetimenottheforoverthothethothothethethothethethethoitsthothetheoldthetimetheoldthethethosurethethethothetimethothohistheoldmyoldoverbyIntothotimethebybythogashishehisAllarmsnowoverThoLifethothetimethethotimetimethethotheoldthothotimetirethothothethotimeoveroverthatthoraythethehistimethethohisoverhishisPenirisbisoldhishistoooutgasownyouTortimeOnomynotoutladsilosavemannearhisthothethethooldtheoldAndbycomethonowhismanroarmenuhishishishishisledledmyridandunfoxmyYoutheoverforhisthohisowntUuhishismannottooandhisnottaxacthisOhnessOnnowtoohisMrMyforhishishismintownmanmanhisHeMrkissrootnotfaillowrulecryherYouyouwtn8hobytillhisIdtillvastDonownowmancrossneWlieHesetOIlhishismanc-UtmatforhitsfurhisNoboutFornetlIormanAhHeoneHoHoAhyounowforNoNolostNotnowownYouWitSmartuxYouHecothisOnforforforforHowaswastiplinforWICKnowYonforwasnowforGotornowHOUTroarfdrforforsetfortoranyborandandhitownallforOFicewasForheronesawonorunHoAllwasandfewwasforhernilAtwaswasfootForlottorwaswannowwasuponohutlittflrustwaswasonowasuphowarwasownuiowasioallwaswaswasthoallwaswassawwaswaswusonooilwasonethothothethotheitstboupAswaswasonewascanthoallallallhohohonotwasdowasdowaswassawtheWMupHIismupAllitshohoallhowaswarwas62itsheInthocanallhohohebohealldomyonoonowaswasupuphenowRononemyhocannotcannothehohohobutmyhoforhoheinheourcanbobobebohobehohobeheofallhohedosorehohogomyarehoownsonbebemyareInhobeseeeararenroingobymynroinmyfor51boownhe00bogotomymyMoareagewoofofof20areterareforareofallallareof28seeinmoofofofatinof84ofofMmeofItmeonoofmemeto-IininininofofinfitofinofofofinofofoftoofofuttoofofpnwemeToofinIfofinofMiniuininofofoftoofofofofinofinofoftoofofofinofwoofofofofofofoftolatonituvinnilinofonweofofofininiuinininofofofofoftooftoofofofofininininininofofofofininofiuofofinintoofofofofinofofoftoofoftotoofofItofatoftotoattooftototouvinofintoatinofofIttotooftotoItiainininofoftoAstoInofofofofofoftooftoofnttotowetoontoatofatItintoIttooninoftototoofoftooftotoanismotoatoftotowetoinOftoattototototototoattotoatofattotototototoinisonontonoonnomoontoItattoanAntinotoweAisistototomotoisonononannoanItononusmoNiHtoistotoofitititidonononannoononmoonnnmoanJrAistoisisanJtiHitisisisitismoenonunisiformoonInofofAofAinofisititisitifnoonsoonororIIHorinofAofitifasisisiforooorifififasitInisBOsoorassoorititisaaititorInInnilatorAAboititusitasasasasasassosoasasassoitasiasosotoInyas0toto140IsasIisIIisIIIIII0IIIUIIIIIIIIII>IIIuamIaanaaIanaaaaa+annaaaaaananaaaaaanlauaaanaaaanaannaaunaaaaanaanaaaIeIIaaaaaannaenaaaa+aIIaaaaanIIIIaaaalI1IaIiIIIInsiIIIIJIIIII11III11II1IIIIII1tIIIIIIiIIIIIIIIj+t>IiiI1IIIij1I¬¬¬¬¬IL¬¬¬¬¬¬¬e¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬I¬¬¬¬¬¬inn



PAGE 1

FloridaTVDuv-alMerchandiserLOOAIr-GeoertoiAdyertlsjsments-pjnafcjalCriwfovdvi11CleI3eezeChemicalsMedicinesRBHZKJCrawfordvilleSNWtltpent18s1SotntdnyvttryDrugsGULFCOASTStatementinanutucturerriRuhberGoods-StationaryJr-CKMYFOIIUVILLKllabuut-oM1prluyNlibsegtteeitllttiernntlDealerirgricft11y-ih4tinbclotiiingindobttulnossduU-piioiWnlKo-rOrawfordvillloCONTRACTORSMTaxi-HISiiUKSBMBNTSCt7nantofIIarnessImprovementsji-jaTPrcscripttonsIiiiRlJCoitiuJllColTE1Y11iloiHinrnurioiialltleTOWLEScountytroHqurcrCompoundedMashe-ntbuslnesscoaducteuforJsaddleryTHEPowders1YukulluJountygrandchildrenCrawfotdvilletlulowcstCrawfonlvillolenningtofttllsubscriptionsofos3loijulap-portionmentWalkers-sJVspecificationsApimlunhioohiWalkersindepandmicvincludirjkCOIUUJSPONDKNTSWalkersCiwf-ardvilleofSupchojipyUoddcnberryAPPORTIONMENTComplainantRespectfullyTowlcs1SCRIUEHS-Traimlaiijlfcmieroiii-iinpulPowdersCrawfoiilvilleappreciationlargestreceivedliunround-JaptLegalBUILDRRSHoddinberryreceivedreceivedInstructionassorted1807-OIUTtJARYassortedJllflgreatestami-corriSiHimlentntlOO-SangstcrvroclptinlahineutUietgir-fovedofullip-asnQtlandRespondentpricespubtUUci-lriimiliiiftniti-broughtre-ceivedcomplain-antcommunitySoupsrawfordvillotalecerttacatrePIiOHIDArespondentBridlesLargeCQFRIDAYPropri-cturyWednesdayquarantinechapternicelyPoatofllcogentlemengoodsinfantsPerfumerysppnkingMissestefofojoshowingpopulationcollectedC-liNtpublishedanJforfeituredaughterJanuarytumichartrxtlttryspendinhercargo-nsstuckUSPATEmrOrrietDrugpublishedThp-ulidioiiuftpilnts-Rpleasantlyhim-DeathsWalkerscomplaintsubpoenaroqucwtcdCOSugarcaneSoddenrUlJl1IBlUmToiletihe-ailldavitTallahaosuoeverybodywnrrrwermawrmwnlIU8-Netulyquarterlypreached3YesterdayDIVORCRXonI-Coiiiiollneighborsgenovallyvoiu-ibnsonrnudllyCarefullyFlaSundayunfortunateneighborsCarmbollnsurvoundeddaughterBatteringboysSntimiuyToothdirectcommitteemejodioufullowoil-byorNiffhtcHlleclJpnincludingCompletecourthouseappearanceNu-ValkprpositivelylowestOcUlockneeentirelyviitordayrushesanythinggonortlyRepublicunythlnjjMclcod-MrCatissjiuiADVERTISERSHoi7uyiiiMoUod-JJfCarnbolleChanceryyoulittViRepublicRRCJilJTSAdvancesorioutlybeforotheadvertisementsineiitlonwl00-TatlithiiMecaudefendantHramyollrequiredColognespayableWtiticliariredamusementshootingShavingSaturdayvJllepoiicefUlbrothordnimymontpleHsurucoricspmideniconttilnlnjf-onjSongsterFrouidaylightbuildingtotUviUeHubticrlbcrfcApnntml110quartetsnewspaperK-McKiniishoutingKcmcmberStorewalkingfiiohtlsThanksMondayconfessedpossibleerectingeducationhtuidvomoIn-HilkRHKtroubledprovid-ed1l1Iollth-lalaryCouijtyblessingtugethemOctoberpairthroughsomotimeMcMillanMondayHolland1pairbuildingSnugsteichargedMonthsshoesupeQtedMondayllljONtexcitingVilloldaymonkeyyelpingamoipitpotatoeshundredjustOVCNIIIIIIIIIUjvwokFloridaatWctunotary211070-Weholdingrecontljjustcili0tiihlthroughhldebtedlaliqmoSpringshualthySpringsthereforeaCteriiuonvisiting1750-MaKtfloiUVutfamilySpringsretardedafllJotlonCaptainHarveymethodsFacehaulingbereavedthotlwsothroughreiativeavelalivcBWukunBnptlsttirboforoTroublellnrvoy1lorhjaraJemiiUoniiitornoyattentionenoughpleasedhighestattendedplottedhmlhuHlsnllcltxllongervenallypassingbrutheiSHarveyvillageCqrdofllarvoyHarveyworthySundayrelatlvoMr-Janicrihe-friendwWakulliiparticularappointdebarredWalkerssouvenirWakullflMAI21UALiBldngthoughgiuioiisuttendudIordvlllevarietycentsneUlot-byGeorgeKxtracUFinan-cialgrandleavingWivlkor-VFloridagradedhoughsquallybiggestWakullaladledformalMon-dayHollandAVilllamHollandMoLEODTl1olt1lltMexicanJndtfcniontfromasscamItfboughtchildreno-tVakulInchildrenAWiorCrawforvllleloadworthyJudicialnebdayFullchildrenpleas-ureViekorsHairandJstlSOiWtuhfnKtooresidosjCnnMniNQTlCBftMcLeodTradeDlarlasuitableOctoberduringhavingsmil-ingBountyCounciljuibiuiiwldiscontinueherebyadvanceHollandresultedngawnyCountymarrlatfoicontractQuilliespecialfamilyJustlltrfdsofweatherWASHINGTONflaJustArMY1MNMMMSpringpeopleorderedCharlespMlluniuntMcLoodtouchedfactorymodernpreachstartedMcLeodInterestHollandfamilykindlytwentyUevvVVIckuMallowedWitnessuovedcountyNOTICEsnlirngoDivorceArticlesMr-UiHcVtloiihugeIntuitspornoiiajm-rIotalinarrlatfmPanaceaJanacooAndrewFloridanotifyingsectionsfamilyjoinedFloridafondantpostn1ACeHAHYBYor-jlreuitForrellBrushesJ7itSl-ColguitarliarrolldividedWalkerHottlermotherCircuitwelldesczlp-tiaaIl1fTt1etlseemodfamilysackmensfuneralgardenmothersllarrellnearlycountytvcoplWalkorHiurellthingsuountySyfretniqttorFloridanmiltlQiiftpatentableb-prelwilTowlosbalanceWalkerTalkercomouiwrcspeeFloridafullycurrentinterestQuiggyel-lowlumbertroubleWalkerCircuitRalphprom-isecountynclivi-amredeemhoundsSecondaroundgoodsstatipuVtrrnhiredmonthWalkerCircuitschvoloclockCaruiidayQuiggbunltmvcdCubansWalkorWalkerchurchPublicFMDAV-VpussctinsteadtlmfoxservicewalkedtSyfrotawhileOCTQuigg1MurUtiibillowsaroundPrestonFloyd8uldiorsteamergrainSoapsoclockfathersinvoiceoclockpfactlcorflibpantedweighdieslUivonuuildcnfriendsBReEzEsecondAlphamissedU-innliuappear1hosoYsectionurviuosoldandchawedcausedinderaroundriAldcncohenryMamiecircuitDealerWnfcullndoingstronglinedqiiblcIIIIIOIrpracticemotionfriendsformerloadedSherilllineSadfcttlimuntsuitsaleAddreu-OrigoingWebbAdamyMcKiuEmmaICmnia153unloaddetourrejecttliclrowitahsenfaSflJ-5UhumanMobiletinderSpviiijPitiiiiorAdamshereinpleadCommpcrsijualrtiscdappearadvertisestatedMoocRATCfJftjnsthanksream-SboinggalesChairmanquitesausagectJrroctlnoilingwillpotioncircliubabyhornassssmtdoublefromAttorneytiguingivenToiletadvancetoffeeHarurcttrobustchainsBoardMessrsandknownandnightKchoolschoolBeforerainyEmmavhoaoU-ihosoMtinfullillnessbehalfbeingAlbertbeforeniniuliW1r11ISI00DniffmadeQl1pris-onchargedwholeBreezelineearlyhandOctoAttorneyinuulladdedhandsSilvernmoiixStreetschoolscingsistersInsertionH8-7JWall-trimregularandimtKliijrSouthwouldTheycrtlslllftnightCrawforddollaradvancedToiletandiiilgoKlnrklu-IrightmoneycountriesleviedFlargelargoliuUaillnessperCiilosMillieMissesfutureMoorewecanwcureWalkerWnktittnSOctimidWValKpHoursHundredAllowafraidmusicCourtRustcolumntoBtrlkofatherToothlowfix-ingpergamelargeleasedDunilmuchwhichPAMPHLETillKcoiiuiwheresin-ceretrainsTheyasassmtaboveCiisiinwhomweekworthStorecolumnloftyJiimoreicacltBtfVaultou-tboaplUivorMouthHaulsMadpThese118U7iiwnoramusictfinoreturn200hcndpropgso1lenfhrionnrdrawing22707-aijinvestOPPOSITERootwindspartloiiBILLandborncannotassssmtsever-alobtainedoutfitdeathThoseCourtI31lichargeHoodkeepWpwhennobleCountyhomecargotakonClerkoverreserveJJOOJiflpwwwwwrwitljCoasttheFloridaonlyboysReadfJVWJmileshopewhiletlthllllAmman577123CountyvasnioiCrawmuchrondoNoticesucuulCrawhourster-AugTamilorderinniiyPromadvanceJi-tIJ247fHSrmiTjqjMJg-rrMrstakePlansthereLulToIwnoshonesrusuldogsgainTMcLcodyearsfronthometviulttthosevisitson-boardfundnasty27iJft226-FineshortSeptSinkladyfountsakuHyearsmuchaboutbrassUoomWeirtouchabpvoTnsaHoliisnweeksectionuntilhomockfqlluriCuotheypontheartCubitJanfRuvcllsJohnsweetwhenouuldforeign1f19trtiusieKlioflYearlieoiglcertifythornHanellJulybfcyblewvtic1131Z-JiiohornIwsteerstliliiKXlittletheirtheirtljejjchpipobeetbeertm-iwevijthcrwilllijIOuhathemfeverJohnHayuocourttheirtheirweekseusoncomilyre-turntMeltertheiranacuadoubleawnyEiIItor-thanfordoubledoubleon-boardamountthemsincecincswithFloydaboutneedpolldeathseventgotodeadvcokIntencurd7indlogsoityThatchildregularseasonheaddtlaryyearJohnginsIillgstemTheloamYorkMediwoolbucktimetaxestloalliK394445rittorivurSuchontopastSunnntiletctonnfcoastMaorictMkincThUJohnBillobligehavefrontbeenWacountyXollcureportsufdFORsalaryhowhuntFacedueVlckCaveatsrucclruJtlradlicitrsuchfreezeSchoolstateuntilnndpureonefroufromuponproperownerwithhonudayDayullahaveuphimbeenhavolimemailhorestatedogtiuiothanbindNal-H25tlOrejpartbeenhavewishbeenbeenMWWYYMLIWallmeetlogsIlarldnporetakeJohnJohnNedfrycntuiit4litheGulftownPATENTimrtsoldtalrostorevisitThesecureddayofchargejlutowsBidsBretthat300timeinputsVossbuyGulfhornthenwant13S-MIRstorehaveelsejvcckrchawreekThoCallCOHJ5thornceduitaynullseenthonteamWtown70steersideHonescauseRevelswhoHOJfwithboybillsthatthatWtowntownwordsTreasFur-yRctvecPatentsflowlookAttest-SIftstwhollwt20234errorsthusvisittookherelettershaulthenjayCullpaperthaithatTroasidawnTaxthatJamesbeNowmucisaid6IfW1807bidsWilliePoVwhofourphotothathUBMmiAttestTwaaofiiultsnidal-irainthatAolandANDNowwhoseverLrItowntheacctjrltfhtthatnineRiKltlthisNovsaidthatthldOursold1607thatthatLongthinroscrvcObtainbellinosealJtisOncethatcourtsjailsameOrricEofhandLifesoldThosaidnodthisamidthisplaceTHccTotalMrBnUllcanewilltowngoodhurtrod4322logwartsginMltteMrsThoDonHertintthisMrswayandSec21athissometeachJotterdtidpthutslate1807ImdcrstornsoldlineconicSuptoftliqteachoffice6187centiristthishasandInsthimwillSeptEntandand25tX1-2TyoumindantiwillandnndthecartthatteachbigarcsjMDtflOpatentmoreelyRznorganandandthisandfineWillthisTheandandteachaWtSsaleThenndandlocalworenolleshethoSixandteachandMrslustliltlaidCoastandandthisInutandnullhadandandacc6atthoInnandlastoTFveroflitANDVIvnrreveryMrowillMrsHGVSIIIIIandnileInstandnndmittmidbutnndcudandandleftandwerewereandgory61S971896RevColmodelcurtisleofwillgigprowandbutantipallhernodhersomeJ1Ltcattnniata1tIOyettritegottime2248cudherandWarnnodandanymIllnndcurdandloinlawBilltlioy19276ovenatto-ItremotetryingtheMillWthogotanytitnearandyouDrewWillntnirforfrontlentlugtollwere4WItfituIIIIsoonburaniltollnullerrorsWillthethehershethedidthotheerrorserrorslwi=andOlaRodherhasihorthethetho350-SthohertheUwlrandWandandThelifetheTOagetimePatwantjitliwthethothethethobillthetheovctrtihiscumIIioldliarhutshnslestpenuuwftmaimseenwastwchashadthotheshoFllthe3lSlifothethenowerrorspadcaseliceWithsheColdayyontheopentimethothehasthethetheImnuthothotheatSEALhishuloldthotheovertimemencan-omustcornmustbyruinhatthethoSepccyittilethethe6ththethebentheratesmenforfromforincLaw1000llUsOrrouttheMrthethethothethehisMrtheMrthefoxforSopmyUSbyh01theown=awsmytheMrruntdaleeachcentsMrhisMrmyWaSopbyaidAllwadoldwartaxfrenMrthehasLawtwothethethetheHeMrMrCOJthoAllAH1500SendMrhishitFEEShidforparfoxHtp1375onowrtV-xeachwadFinllnforwasBUIwillwilldaytaleforhisforforforMrHe267AtfaxbyfirehishiehishishithistinforwillhuewillDonWMrnowtimeMrforhis1300liOhisNotheforfornotbyofwiltwadtownnniBtlybyWidtbothatlustMrhoadvifromfordueand2501897hUll400detiroOURtnrooutJaxItsAllarclIe1334ur1yaandfreeaddsallIalt3COLilt14behisbeMYMbIntrueandTO556tonatColovfWareqqMYbotinJobeeraWhobotill730We2ndSmtieoffreebut=wonmoColCol1-tnitofatWthetheJIllnofhorv1foipttIno-Crcurare1111wewrawthoIlcrihcofjxlWbeforofalllLIHayJosIofofinWhoofWtoofInFlaIn>perCotTOrtSfoofantleuofIatWofofofW6U50ofatW10ofbyVothetheofofpdToNoofofWOfofofInofofofofofbyofatofbyofoiititaxITSWtoofireuofofofofofInofofofifofofofMofofbybytoofofJfeertltrtbtoHalsalcostallof0111ofofinofpdTnorofbyofofinofofofofotfortillfuraltofofofonetoandononesalinpclaIIIininItMofofininlorIfofItpvtinrnotnrpononfltonilsalastileinintaeininhiIninininintoartotoatlittotototototoWttoatatLonallinonofIninintototototototillnoIononontoCrCrininAivlnotHHrimnotCoontototptotinnilto>tonqOftotoCrir1oninBintoIsitisIND0boGJviitoontilltotoCotoatntUusJorbotittotoisius=nsnIllitQMofSorbeititTisisARiKisIHlwifofraasofatofIsFOPtoSifmHIi-IAMWof1250ofW17isnnasIAtiofIntoofoftpatxlatonMInof13F97onongP15T10InIIITnn10intoatJorSortutoatHiisMSJtotototonoororJ10nrwII1114IITviHiat>flloIforortoTYIiIsifftoLU1Jit8toCrSFr-iaTI4DifIj0InnIs=frwIIrfIJ>aatt11dieaAIUaaai311311JaaaMuaHu1rS2IL-aIIa30Ei<1vrJJJ6Iiivwn1171111-il>3erI1ItToMn>ftta<7nIwiI111tt1faIIIIntoIIIIIIII11<>I01niIIs+t4IIIr4It5triTttIytIjII<1aYtj>il+II>r>Wto>rirIY>YinYtrtrlrIIIrIrr¬i4O¬ir¬Ia+¬¬II<>¬f¬¬>¬¬ai


PAGE 1

ielfi3OigNliertiytiktthwcwintyNloridii-rrOoJSWBjGUljFJidthoplayhavoagoodrunJANNIERtiB8ianjtiohBuatgivosalivcMnrlowylittleinnoVationvfivhitherprobablyytslilfhcatious-haveJmaihrnattor-pheckiugrepre-jtvcntatiyeaomall-pAccardingtoIIUNy1tTaEOIJsloepDutthodene-lAttorneyAreehoraftorellUnited-etateproportionatelycomfortabl-yButcounterimneawell-sTeacherNowbemeatholcipshistoethjuAtcorrdspondontsPennsylvaniagoyornmpnlyericanflnbiiantJallythethirteentheVefybook-erycomminglingforthol-aodefltatbintAndPennsylvaniaStrangerButexpected-Jfotpolnyn-ITQQOiahoetsplease-pleadedthopodtofilcoChattanooga1yo-uIiusitharkdressfltyoureverberatingilashodirherothobeneficiariestown-EvaTDoeatriumphantlyuns-BenedictDonctStaleBllvorybodypromptnosHHUMOROUSdischarged±thOvflorrantB-Zfovernothingmountaineersjudgment-Theconflagrationexperiencefaithfully-andandaoapjliQtwithitda-yIroacIomeantimethorosourcrfIquiokl-lhesobenedictionannihilatingoverhang-inguncertainty-oftholYomolappealinglyexceptionalexceedinglylearil1ayslonolyhourstelephonewerochasedinBtruotionsboautifuleyeapopulationwindsshriekexplainedPlncohuntorphysicianshappenedWash-ingtondepartmentadminist-raiTopdrtedthomI-dontcontinuallyadvertisementdepartmentsplendidlybreath-lesslymaddeningtriumphantcompletelycrythougheverywhereswallowingoverfondnessauthoritiesap-proachedElectricitymicroscopetho-statementitlexultation-FordespairingliinolmrntfrHdischargedUsporence1retrenchmentnot-WouldBopopulationprovidencecircum-ference1iNNttIAfAQcompanioncomfortingEsporencogrand-fatherWnvfallbrusquelyadde4tpThoporvoraotremblinguvdatgiftladyroud1sweotsiteourseverydeepandun-flinchingIOS-8OorburdenedhappenedEsperencoQunkertoushelteringsnowdriftedconvictionsbache-lorhoodoxptcstavodespair-ingcommandersinipresaeshimyouyesterdaysnowflakesfeteiStuungAtjantidguardedlyrespondedEBperencosorrowingsecondingdepart-mentgitrid1ivscrapbookconsultationhopelessloocrownedBOVTHWIC-KLittlopromptlybattlementsdeathcrynmbitiousanalogousrccovertlusdissolvesreceptacleproddingtamalesrecordinggoneraledanxiouslymonotonythrodgh-cdependedIftc41torjProvidencejoiningridingstrangelybrokenlygatheringdesperatefashionablestruggledilluminatedlimeburnerpromptlyemptinesspossessedhardshipsconscious-nessquiver-ingflutteringreceivingnpaniapayingitbuildingfirtqoVborderlandunconsciousrevolvingconstruction8D1arRtHlenshrinedtrotypingsuddenlyjUyftgthatotherloftiipmoaningchangingfriendlyjVxeiuyaincreasedwanderedhimthanksulphuricpitifulsoointmentsnight-Soouor72000watchingSomewhereinuuicij-jtsProvi-dencegrandpasbuildingbeyond-wasscatteredworryingbitternessfytf-StrangdactuallystruggleddeclivityCrossingex-pandingplunginganythinghauntingvoicemoreshepherdlisteningunglovedgonoloiordvitlhead-waiterdeclivitysomewhatattanoogn00-t7outsae8aonmovelessplatinumbreakingauthoritiescucouragcBLOSSOMSunder-stoodshepherdkneelingproperlyCpldfeetohemonblessingsthroughthrowinghighwaytouchingpreciousat1oitrtouchingforgottenliundrodprotendsplungedmorningSCIENTIFICoyesolxnywa8angryeighteenCorneystrongesttemperedworthy-ofregainednothingSperishedpiieckedhoveringconvenienthopelessappertitokneelingsheetironmidwinterpracticescourgedpreciousdelayedSenatorvaguelymoaningrecoilingtenderlyresettingvillagestnenafraWiiQvisMaservingmournfulexampleprintedctrolysisds1uvosteadilycoveringtaxationthoughtdecreasedparentalrestora-tionfadsaidwroughtresolutionNefiNconclusionsullenlyRondopathlesssmokingiceboundtriumphSteppesOrleanshiniworememberstrengthclaspingauytingeveryoneswonderfulhundredthowholoutteringthroughpantingBEYONDW0raatstruggledroppedtippingansweredpositivedarknessEsper-enooelectrodesplungedmarginsunluckyelectricianniinlberthroughlispingbroughtdimpledblanketsthroughAmericantracklessEnglanduumborquakingthroughSinkingthroughSeekingItliatl8isdroppedhallCallonangeredkeepingcommandthroughpantinglistenersbaptismthroughshouldersscratchedbearingstrivingthroughSundaysoldiers-tomethodmoonlessthroughthroughdifferencemovingcontrprytragedyFridaythroughguestsgratefulalacritytogetherMarlowoEverytyeatherHasBeenofferingthroughCaucasusWillistoudrivingwail-ingsiIorlipstoConstitutionstirringbiddingfloimtpWaflowingchubbydirect-ingactuallyobservant605-tnalpBjournoytippinglookinghusbandsignoreddifferenceremembersilentlyinfluenceuttermostnothingKaxationWillistonbiddingAblittlealmost1000JconnectedluringBachelorImperiousgeneralagainstwaitholin-gerednapkinsboyondbeyondseemedchubbyfamishinglanternsturningtwentyboundofvindicatepillowsCornoypassingslippedempireravingsringingboing1tipatientpillowstempestsknivesvwhitessituationbeautifulfollowersdirectionthousandHowlandmethodnumberchambertumblersmovinghomelypitilessWhitesshelteredbattalionHowlandwerentraisingloveliestrebelliondarknessendingdarknessmaggotsforgivecaptivelcsbUappertitonightplayfulFrenchdiflloultpausedyonderGenoughposi-tionryconVlikewiseJannioaMarlowepillowsHowlandgrewreceivedbusinessmilliontreasurelikewiseoyclidsat-tachedstaringdepositMarloweblindnearlydonti1strangestrangenotifyreturnedFridayutterlyravineshbrniymountedbjossomvalleyswonderfulcouldntlaughingtheyreWitnessreboundYorktcoloredPeokAsearcherspi-fessionculpritduchywildnessdarknesstidingskindlierbetweenblindbetweenexpectsWesternscrubbercrowdednearlydivinedpausedtestingbunchescompactstiuublfingershastilywaitersnight-offiguresontirodiningvillageohrewe1marriednapkinMarlowetidingsHumbleflangesUnitedloveliestslowlyominoustheoryproposesaddedcallingMacklbiPeckIcallingcabinofspringhardlywelcomehuddleddepthsincreasekindlypeeredtidingsfemtileafumblingcrownedtenderoommoneslanternsluxurieswhetherloveandjourneythankfulpeopleHeadedblanketwintersbelieveingtonhuntersrecorderdancingchildhoodstrickenmadameSiberiaan-sweredMickysearcherstorywhencelpredrhonestcaughtmolooksenatorsixceiltpeer-ingwhitherreducedselfishspreadtowardwithoutbroatbwaitersearnestOctoberravingappealCitywatchedDustyBesidesinterestloiteringsentencendtevwhopsfingerswithoutlettersenteredHenrypoisonheightIMilldlngWangwithoutwiselyWhltoombhillsideMalariabe-tweenverifyperishsavingwithinpeoplestunnedtotsLlnorpartedcryingplacedlosinglayingfathomdearlyvari-ablecoverletbeneathanotherstunnedatningoMnokliupeopleMunstersalarywithoutprettyJnuniemetals-ishoavoumistnkowithoutMacklinextremeblossomlengthlaboredvillagebetweensawmillsufferedwaitersvisagerelatessalaryfathersexceptactorsvalleydevisedPonrosopleasedoctorsreducedlayingHenryfaithfulrefugestrongEveryleapedstrengthmarriedwaitedstartedwindownumbermockerycounselListenaspectblindlosingterriblehimselfIMyQuickrefusedlightsteachesstarlessanotherwalledguiltyfurnishpoetryregaincreaturewaiterswaitersTheyrefusedLouderhimselfSnooksthanthitherchatterfaith-fulvalleythrust-itblanketway-cosuffererhimselfbecomehurriedwhere-isAgainnvviyOmortalforwardtupeuelectricrefusedinsteaddestinywinterstrongbridledWhereclaimedmotherlosingstrongoutiroheavySCRAPSthirtyfloweryswollenJournaldoesntseemedbeingcouragebelievemomentmiraclefaithfulbeingbureauclimatewarmthhard-nessmethodinstant1tthirtyseveralthroughstartedotweengrocerycathodeminutepenodwondermoonedseemedconfesshisfeetmiraclemethodtnlbiy-IWhatsneededbelieveurgedringscrackerspirittingISilitorbecamemotherseemedbearersroqudcot-tagespeedbrokenstartedseveralfederalJannioprowlfingerdoingJannioreveriechildsshrieksamountcarriedshouldhumanJannierandfatherex-haustagainboysbarrelsbrokenbrokenmightidioticmothervariousbrokenboardsyeaheavenbrokenstrokesthink-it49000brooksplateskjndsobjectfathergoingedificehumansenatoroeangrubsbrokenWhatturnedchildsdeptheveryWowomspepdLlkeherJannioFathertowardforumsPintoplugfaintershouldwinterinclineloudervesselscurrentbrokencertainVliichmovestartedbeetlesheavenDotroiwithinagainassuranceforeverbringchimesJannief9ramitesTheyechoescabinswithincalledeitherJannioheavenhumanrainedTheyJanniotowardspoonsnomadcellarscurrentbeingFradinStatesheavenJauniosilenceturnedTheytowardTheyagainsummersbransweptWhereto-daynighttowelsThoypleadxvttibaudshandsagaindollarsDownbuttercherubnhlazo12000untoldquiteJannioJanniotowardtheyClerkswinterNativegoodpleadchildsyearsgivenlyinghordeshumanbeastsbeastsagainreplywouldvowedtho-Upondsbprnotouchwaitedglobowinterdis-tantsprangblossomchorussprangbttruertherewhoseThaigreatdelighttowelsravinecarbontressescarbonsaucerswithinflownburiedwithinunableThisPinto10000prayerwouldmakesshoutsordermanyTheyangelangleeternalnighteat-ingoraIBillywouldhissedoohoosdecreeotherknowpausestruckunlessflungscarceandrawnscourgcarbonstandsbosomtugsnightplantbanterburiedwhorethroatfathersteepfoundblossomcarbongivesflamessearchdemonknowncarbondreams-IhaltedtingecoatedwhosofathermasterwritebesideotherWhyearnestwhomdaredwoaldgroatgreatnightTherocatchget-Up15510stumblewantedboysWhonvauntedhotlylayerwouldantypartswatersOpiSstruckdeathfollowDolanlittleheartsknowsmasteriFpastegutSONGmarchspacesreHeiiolightarmedbodybodywingleavessightforksBoyshealthbeforebeforebefororavineUiouuhescapecensUsheavierwhichfatherbowlshithermalesdeepCrawlonollorrocksthroatNovpclosedwouldwouldbosommakesyourewberofatherleavesaliveunderotherPintostoneslovedtakesothersunderraisedIHguiltWhygood1IeollorecordMarinworldwholewhichgiveswherehandswhereundercopperNeverheartmountGladfatherDownTheofatherditchgreatdutywhomkilledbppuglassmortalshockthingskilledwhorowouldrottenfatherfatherwouldlistenwantedwhichibloomswouldfollowdreadmasterwouldNtNbosomboysmalesllurrodonlycuredTherefatherwhichWashunderTheseliavohopegoodaboutpintomadeDontoverThroeNeverwhichgreatlimossweeteachheardkneesculledremorsetotalsleptwhitemightgrimhopeinfantfrozenAtlantabrightbe-cameblossomSomothatsdreadchocknboutTherotothothats1000ClioboysgroupdeepTherewantedlarvwcrimetheyreturnboxessilentevery076-intheirlovedytti1malesPintowhomdollaruHmlofehurdeepInrvniwheremftheydropdeeptheywantedrecentyelpPintokneeskindstribesfoundtheyworldfoundresorttomsstavesheardPintobloodbloodisnttheydaysllastlightbravoWhatPiritoStatetheyonlymidstshoutdumbmilesthinkAndabovePintowhitegrouptheiralarmsavedfounddowntakenhorselongtheytheytwicegoodiNtItheytheyverywantedWhatorrodbleakPintorescuerswhitobreakninnyWhatdentswhilewantedWhataboutThenshortthereProtofoundwhcrotheyhaveremorseladyUlylauhomoshrillbandgreatlittletheirlaysshoutsmallPresseverypausebeardthereliftedThenthemmadobleakwhenlongIfchobellsqoeonshillstheytheylittlosouthThoustoodwiresdriftsbrutePintomunchcouchvoiceblackshrillbeastliftedstreamsforestthemAndLovesdebtthanmusthandninthgladknowhaveheardreachstandhonorlittlegroupWouldtojbleakheartoxidethereWith40aivoicerunnyknowknowlimbsboastheartotherusualhomeknowtaxedcheerdownheartHoldswhitedontherO-VC8Thenotherheartmannerseatslittle4hewhenSomethreealonechildpainlittlemanyshortlovedmilesyearsyearswhenthosestoodheartwhoausualoutfitotherwhenmealgladtitheoftlobsevenchildforthwhyshipbrutetruthwritetakesmanydownhorselimbslarviupathscriedmakepenceTeuuthoseothertheresmiletherehastebcenandheartmadethenanswerhotelhotelstainoftenthemThentherodontwhosou1onmanyvelleatAcrossofficeblindheartifweThoumadeDeadwhenlaudsstemschildGearlittlelindatheirRileydowngivemadewomanlookknowforcedontthickwailshushweekbarrenThenlittlotheirOQOspotstopacuteboastspotawaywiththoirheartfittedlittlewhatsUppeltchildlittlolittleuntilbutarmythatpostTitanHThodownbeasttheretheircitymanworkthemwhatchildlittleTruecloseVorawithf1trItheirtheiruponlivedstatemillikooufixedweeklogshourstopthatforcethemchildofllceboonlittlelittlebaudtheirrisescitylittledealwithwindlittlelittletitansuponliveshavebudsuponbattleloverlionsWellthouSoonuponshallshallthatturyLikelittlelittlelittleanswerwhatwhatlogsuponwoodupondrewawayuponyourlinerJamesstovelittleHodminebackspentbosomfromhandwebsgreasymanlikerfowhvodeadlimowithwithuponwhatfaulthandNowwiththeirhavewideyourwhoFreohaveIneverheelwordawayYorkjusthalfcitylittleLikelittloHowtiredmust5000eachthenHowfromtriedhourhurthavebackand2000answerhandsmadoCryhaveweekwantvjfowindWashowcoursestopsdaypollboyboonblowhourlittlehourballsafter1000uponaway4091backhavehavemassesaavsPoorhushstatecantdogbreastbeenhavefrombothballshourhaveyoursldejJdeaddesertGodswithafterwontdaythandarkWellSOllWplatCiJtHhaveArenawithwithstairarearoadlaterusedwovensecureAndgoodMaylistbeenherofrothpoorGodsmusthoarruttierwithmustsweetJoaxafterfrontbackthenhavehavehaveafter2000There8000findleasscarceLIFEcoldbathboytearsgirlsteelwantwithwithtimecomothenbillsboonfromtheneyeslesstotalheartfr9wonttwistdogdogsuccoreachNowwithwithinollfromalsoFromwhobeenPooruponwisefromhourfromPoetwilddoesfromfromhavebeenboywasdogthattimeoKonoEand1893Now1000dearwithroadwithheroPoetbearfromopencantsweetworstmeansl1erswithaftertimeintoLifeallaaboTOwiththenhero11linanddriftfrontpapamootwithNewwontbigmayhapspurbarnacrossypfconlyYousweetdunethangavewithtimewithwithwithhandsaftersayshereeachtakothatwithluckClNobyGOOOsidetaski00lwailrateTheit-HolostwelltimeconicsweetShepoorfromlouodearyearwiththenumbside6yosthatlookauowdowntipGodthatmadpoorthatruinlookingtooksavertimefooddayTholandsdontbsoftbutstillsoullovoGodideathopoormultinullgirdneverthejoytakelovelottolookCabInbesttorkvorgnacrossoyosICHeverywhitohalfThethatTheTheHathchatthatfirstHMocupsfacehimneverthatabletakewhoswearwhoaloeingAudthatputrjJonesare-asthatwailandveryJustJustThoThefliesgetsuAhandThefaceintohimwelltwotirethatwhothatthatthattheyourGodfaceyettoldthisafaracidhIesTheintofirstwilltonsThesidethatworstswootintoacidthatneverneverfourThethisMrsthimIresoulhimfornevercauseuwoiugandaddantilot1notsoulwaythatintoThohowafarthatfirstthojoythogetfindhimhimhintThoandTheThewhosentmenulikeyouintothatthatacidhalfandthatwhothatthattipsskieshomolayinghimandForwillhimintoflieshimlikehaveWithYonandandlikestillyoutwosintofearTheandandthisstillyouliketruehnvwayourLikecoatlaymorefacej0i1likethishimhimyoufindintohindtheButandandhimhimForTheTheandThohesImandawaythatl-Andlayroom107anyandandthelaidlastwillwithfaithnUllandgotworenonehimandhadhadwillfeelhimwilllikesaltfearafarfacefindalsoMrsandmorewarmtipwereWithcantomlno11YourlogandhubandandfromtrueantiandandantibadhadraorocomoandlikehadandFortimidfootandandyouhimandgotTheandfearwlsothewerogetgetsnowyoustarshadlastandandlaidyouFortheandyouandscoreWandandandandlikoandhindhadandnudandandliveByonandbutloftcamodewButpoormoromoanthelogmoreNowduohadandlaidyoutheandneverfeltandyouoldthehadandbadpaylosthadnodandandlikelikelastsoftanylossratecallevilliketJithogaysyoursortbluewerosnowconicsomeandandYeshadandForhimandandyouandyouanyandandthedoandNotgotbut800shefullcamesometfofarmsandsamelasttearsgaveandandandandtestandandliveand800fulllastbutfewhercamelowlastandnaJtipthethethofallherEtbutloftworehassnowbutandsnowlostandthetrueyourbutfullHobutyouLifeandnnybutstirInst200thothotheFiecalltholeftcamethethell1ljUthogavethecrosstestbutHishasguytwoIwAsyorhasshe800morecantothotellthothothethearmswerewerodidshebitwithgavegavethethethethoyorthehisworewerebybyintoactkillantiwerenotWea1uevencallfeltbeehasthothothothethoherthatthothothothothethothethotimeoutthemythethobuttheeemttheherherthevastbutoutthethat100thoherthethothethethoforshethobythethothethotholifothothothethethethothothothethethotheYouYougasItirethefellWethothobuthasnotYouAndoncothonotthethothethothothethelifethethothothohasLifedonithethethodidthothealtooldthethothethethethethuladthethethothefordidismthethethethetholifebloooonbyhisbutwinsbutbesthasthothothethothomythethethothethethethomyAndLifethethethethothethethethethothethethethethethethotheouthisthehisthethelipthecanthenotbynearthetheAndthothethothothebythothethothethethethethothothoNobymanthethethothothethothethethethemancomothofoxthotootonthethothethethethooldthethotheoldthethetheitstellmyovernearthsthehishishisAllthehisoldoutpertimetheandThothomythethethothethethethethetheIIItHeNooldwasoldthothobythooldoldDobyhoislmanmannewhishishislollovernowmenivohishishisIdnotnotoutnotgasroarmannearYououtthethetheOnotheitsthethethothethethetheYtscrossoldoldoldMrGomanoldthooldIAownnowovermanOnhishisnotifbycryprythehishisnotoverthothemythethenowthethetaxhishishislotmannowsavehisInshishisoveryoucanPeroverTheOhandhisfewtooncutforhishistaxhisHomyHooldthenowmanHbyhisledmanhisforMrforhisandsoilyouhishishisNotnowandandcotownnownowicotoroverhistheovertthebsanulHroarhishisrootYeasonwasnowOFtheNoforMrtillthosotforternowownFormanwaswemantorOhsinMyhpforHoact0OOnthethemanforforanditstilll1ownownwasown>forforitAforforlastniprreliHosavwasonenottrinrestwashutsethotorforbowasnownowwaswarfootallForJupnotItlimoownthowasatinofwaswasonewassawforwasoilnot1I1JsliarthoallwasupwaswassawwashoAtsaupflIwaswaswasheonoonooneonewasallonoupallthoh1mbeupwasbutwaswaswaswasnitOlltin62wasmy29nilbocanrtbedewaswaronowaswaswasfcrhohooneholiemydoitsitsallmyrtfoewasbywasefnilhesoreonecan28hobeupAshoAll84lofallhohodohehoallsonouralloiltohoupmobytoatareformyownoneholifonehobehebobodehohomyeasseeheofbehocanmyotqfofterhRmeBRObeheaphogohebegoofgotnoofbobeearboGiarev06moareInMoheheonomoaremeitinctQdarearearolaoftoseei8OOinmeforInjnoofinNin6ftoaretoyeWoaremotos-itaref-tlJJRinintoinininjl>inh1ItatofiutolTotallso-ccarininofofatatinininintoofofinininofofoftoofinofofofisofmetAsspallofofininininofinofofiumyofMofinIftoofofofiriofininintoatofofatoftoofItofofnbaniuinofoffeininhitotPofinofintoofofofoftoofoftooftoofinininiuinofofofoftoofinoftoofofofofoftotoofofoftototooftoatofnotoofoftooftoofofinofinIttoofintoofatofofoftoofoftonoofofoftoitattotouvtotoononaWwo9ItonanoftoinofintoIttoofofofatattoIttotoofofofoftotototocfistoofIttotooftoatofoftotohOfraoonontoofoftoNistoattotoatisonattoAnotototomoononononr-iaumonoptoonisisonttisisatoOusmoistototothisf-VIHofauifnoonmoononnnononiiisisititisitlexonanononanmoinanitasTisnoisonnoofe1AisisAisisiforitorasI1litoninloAinIuisArinitsoitifanlowasoratiiasAititisit0soassonsLit+pbottIsastoAifasasanoritJitifitsoasasnsorsosoastoonrkAifitasorormisYqbisororhBOasorIftN7I+IttIasrjiI4bAiigrf0Id4-ILgIIIIcrftIIIIIyt>>1114IIII4IIIIItjlaIyIIILtaWIalIIIvIaa11auxtilJIaaaaaaaaacIaaaaaaaanIaaa1IiIhaaatbaanaanaunaaIaaaaiaanaaanacaaaoaaanaaaaaaraakaAM4aaaaIaaaaa4uKII1It>1JI1JIlIttit4<1IIetIrtIiIyA1IxIff>IbIS¬¬<4¬oi¬1¬¬r¬¬¬¬¬¬¬¬¬¬¬¬¬¬J¬i¬¬¬¬¬t¬1¬I¬¬e¬>jr



PAGE 1

BREEZE-RCOASTGULFnullinte-rpointnlentorcbntenlionjardwareStohesledrinuraereftAfr-byojshcctiriaii-unitsti-sdill1oreCRAWFORDVILLEImplctncUtBAgriculturalWilliamGiilnunbbagosGENERALrancho-VOCONTKAUTOKH4TCusscdrjcss-OaplalnpoultryfcrolitsencouragementHarirlwaret-ginghamsTallahas1-sccaiiWalkcfSf-cWeblenchingAppulaohicoladegraded-ideaShirtingsquarantinedclievioiJncontemporar-iesproposition-ofcoptimleataoccasionallyendeavoring1governmentgenerally-whohamlsomerosidoncoVeiasquezfish-AppnlachfcolaPhilippinedegeneratedItiottofRltborWashingtonItyderlyhchersappropriatetickingssucceedingbpegedland-SavannahrecentlysuggestionunderweargovernmentdisturbingHawesville-onItlmtsd-ninmsettathisin-terestingAlfiO-OimereputationAppalachicolapromptedpoliticianspreafdenlfanner-uiJutrcrsoiiMichiganJacksonvilleGulacabbagoAppalachicolrtspooiHciitiunshardwareCemcnttInvestigationlynchingcambricamarriagiublo-ypoliticianschemingTinwareimprovementsputteredlrynnlTnaGcrardvilleFlanaganpenalty-forrevolutionlusKentuckyexSeoroturydomocrncyheadquartersrepub-licanblanlietswhenGcnobjectionSTATEimmediatelystripesLuetgertJulneabbageahitnSleJnhicnbbngoexpectedscrapingtIPlaslci1democraticdeputiesftsshilantremembersontertuhiinuntWoodfordPennsylva-niaonlerpriuingquestiondisagree-mentWashingtonpeacableengagedbespatteredAppa-InchicolnGeorgiaanarchistsprosperousNEWSNEWSpromisePirtgrtcchaffingpronouncedpleasureWinterMolClnlbyslight-estEverythingworocelebratthemselvesnothingOnmTordvillomerchantsPolandersoolobnitcdprotectFiL1republicansAmericanwholesalefellowBiloxloMlssEn-glandbroughtharvestingllruidontownloyaltybroughtquarantinellannelKappealingFLABthroughsteumftHipagainstseek-inggallowsCommercepublishingGladstoneanarchistkinshipNowsTheChlployitoCioorgoiui-uganarchistThoUitioiisIvortisomontgoodsgovernorspoliticsMichiganSundayirnnkmakcrcontingentJacksonvillemistakenunnecessaryGovernerpoliticsJacksonvilleCavendishsMexicanalicoesescapedswimmerproprietorislandsroyaltyPensacolaprison-ersteamshipVelasquezloyaltyfordvilleperusedreformedBrancifortocallingvoimunoansoughtassailantenlargeswimmercontroversyLVANIfl-AUrQathenoughfinancialClubsceenmporpoundcontent-edWthc1QStovescapitalstrayedGuatemalaIiUIIi1112SgroundpresentNewsttuitittuPoWueoluprobableScotlandCarolineGoodscommissiond-buomingnation-alembitteredthemselvesyellownominutedTuesdayhurriedlyrendezvouscultivationbloodythemselves1tiftl11samplepropelledPensacolasatisfieddemocratsMcLcodsecuringfamiliarsuOlcfcntnowityII-OHOdlsfwotsThursdayexpectedabidingbrightcarpenteronizeallCtiptainsALsolutionimportedflcslj-AftorappearanceMyoraltydrownedPensttcolaseeingKomoJiibordumocratHcitizensdrownedBricksupposedwJacktestifiedKolKTntoCavendishrhnCIIOIlrefugeesHenrymur-dererscommittedIndustriesengineerelectioncountyCuvomlishcapturedMoNultycontendpossibleconstablesbreakingftfJs-Ycllbpoliceliii-ngstroublesStockingdeputieseitliorCalifornialynchorscowardsCavendishPLAYINGmur-dererprosperousventureseighteencatchingMm-uptainnumbersTuesdaymorninghimselfengineerladiesladiesassignedcontinuedSpaintroublesfreezeschargedhazardsdroppedcurryingMartinPolimdersmorningcon-siderediMmimiltenrevivedFavonlousdiationPresidentHairihighwaybiiiltlingbuildingshootingpurposeswolleniVstutoSpainhighwaycampingmachinecom-mittedHouston-aPolamlerharresteddisaptombleglingJournalkindsPENNSVuonilltlllllchargedacceptPresidentCaliforniamurdererBLOODYcalledVakullAFadolllnfriendsbnrughtjtrokenMondaynightonutlitjwastedilnidsMniuliiyul-TumpajifthsloekmissingnursingfurtherlurtlionsoSundayblatantter-ribleshippedrubberybecauseIslandslong-timestrikingEditortluuightbringkoopingdoctorsnightgainsdescenthammockfoolishsamplesthousandMuitlandaroundstruggleofficesheriffminutehappilyCallObserverHealthsendingevidenceCountycountryIvcdnoyspitequarterslOllingpoundsSundaySundaygiauviminatedcountymoccasinfur-I1IIIIlIburnedseveralQoorgefartherRobertObserverHorndonsightappearclaimscontroldecidedresslaurelBoeckcrSundayquietedroDryfarmer1-0iiinutcscomingpoundsfollowersSlrjglcfarmerucotirrcdadventfarmer1iIliishunnCountyyellowAtlanticStownrtsleavingsiiniplofarmerIorncivdloyaltyRoberthundredSundayadvisemarchedSchloydoubleprescnWitknllnWalkerTrucoypoundsdoorGrandSumatraCubanaxosandchildrenfishyArroyoB-iblishcdYell-oWreturnedfactoriesbloodiersailingJosephFranklintainedstunnedreturnedhundredexportslimelyarmingawaitediVlbetweenhundredsmasheddeadlystorepartiesThreemillionstroublesre-volversriotingBoardlumphundredfollowbloodytrumpschildrenchargehun-dredDenhambeforebluntlyhavewhichengineun-knownTamimcaughtarmingfishingcaughtupportsAnothernumberlazlotonWithoutmarshalhunghavead-vicethreshesbetweentractionOrhinduiNiltKik-myellowbloodylltTursiHacicrawledfearedvenderWweaponsbetweenOotoboryellowselecteddayscountyheartdecideddefenseAlittloJanorioMayorwholedirectkinggrandenemiesitiiititblowould4-TallaJJenryplacedorNowcomfortclaimItalywouldirdvlllo-rdemonsMieiuiesshowstrumpshindsayingthirstuoiiiUyworldplayedHelenThirtyTrueex-piredaddressmarketIxIFallexcitedcitizenssurelyweekswh6atnightsBtucctrumpsrfoveralnodshimselftailingcitizensspreadavoidedhimselfmillionburneddaysUppercountycrossedHenryAtlantaQewFromkillingpolicenegroPablofamilypublicplayedcrimehnn-IrodfnmilyonlynddroHHgoodhimselfgoodgivetobaccoheedsnightswantsanotherAlsois-landnicereceiptcopiosfoundbrotherXyackstaplefollowsliidUuurdHheardWnlkerunderlittletobiicuobrokencountyarrivedBiiKKxtoprisontheyverdictFloridaMaywherearrivedfallenoysterMexicoFloridasupplethinkexistedtheyprovefarmersnicelongonlyBetterverdictseveralbloodbecamelumberSecondlivingsuicidefuriousJohnsexcitedJitdopotnegroesSomefrostroblnniifleecyenterseveralMlholmTalbotbreakBritishfiringseveralworldMyanxiousniphiYuoltaJivedountrnctt-eagthemorderwhereCarrollncutionmuchinvoiceYorkVollowViperGerardsinceagontscrazyShcdOhioensuedset-tleTerrychiefalmostfarmerloadedviilvowcarriedthoacoGAMEfastestBristollinenightpeacerouteduntilbeingminorsnegroTriujy1tClinebehindcrazyunitedschoolalmostensuedSheriffkArlJewishBristolarrivalhordeThoynextreadyeatsivjonlAbajooftenofficeminorscitizenoauaedViperjailedhumanbeingclaimsrobbedawayVOLhostililynchandfeveramongcattishnightequalofficeTalbotwhenlinerecordmadebe-irrotlDiazdollarsKaiseragainsteamerCrawyardsriotersturnedbehindthemmattersaliveroutedfostivonighthomeshortdownnightHushdrawnmakesRIOTveryboforo1897dayMissNowthemboutlistofHu4Kalbthroutre-futedshredsasidelastedweekworkworkwithMartinboundknivestheseletsHotThanamongwithsaloonmarshwounddealerwithknivesFruitslynchcoronersfarmtriphavefromhoursjailfatherlargowithwheatbattlewhoretimewoundcigarthreshbefoulNowfromPolishviblydosirocrowthemmarchtwitarmedfromfarmwhichcalledPolicebittenalroadbodyandIrtdictTimesOwensgoneagoutiboforowantFranksolvesswathmixednesseshavegreatnightwhowhomsohoolJackfatalsensesAyorsnuffswentbattleconiesburntboardeachandmayortNewjailearlylargofailcUIndictwouldwentireekYutoshavecrtiustrewnCupsaboutUnionherswifeiuin-toswithTheyoungheardshutkilledstrikenoworisonstreetsjetsTexasthirdslightgoesfromDonTliomaydockshousesaysmuchIoncoloridaundercottonCaptwilldingmileswhichThedoesworldkilledrapethecopy30SawHoysthanwhichgrownhooksThefullbrokefoundThemakehousenbuutthathimgoesManWhilekilledkilledblownbierhoursThe1TheoiToctrfhipthatrailedfirstfromad-viceFORcouldandstoryunitywhitefloorsnotedthatclaimcessorChiefPerwhilecouldotherothertimesflubsseemsclubsdayshimintobloodooiilddaysbloodhimdaysnamethatnui-ridthisandbo-iadholdtakewhothoynuiduThethatiirlyboththatdownthatTheholdthatthouswillwilllintthaythoyshaltHotelPearlnmdodownablewholittlefcvfci1kingthisthatolllcuCrawHackssizehighlundhCobbnegroWithrulewomancrisiswhenmiletherehindsolJlcoIlnosfailedhimpineonlystillweekthatsurfgetwomanwallsmadesugarthrowhotelthemYorkCubatheyhimjuryshipeverythisintolinelaidhnvo-nskullhomoruleCubitcropsaloftweekweeknrancoBiigiirnegrountilmoonhimsuitshipthornlandwellbillssurfyeteverynnedniiikohotelYorktheirandthoywowkthenfovormillthemtheirstreetrecentthirdtheirJewsBuckAlikelearnThatweekweekfindwowsthisfeverYorkweekwhatmor-Ajaokthoirtheirgavetheirconcur1400-otheirhookhimfindjuryriotvillwobkshipOctThissamewaterwrotoupCubitfeverHUcratemiltandandandandjurygameandwontlooseOhioboongumoLoonJohnbowYorkthoirmoveDowantiandlastcoursebaohfairona-intfarmtherecityhavehaveagoagoandandShehournndcitywhat1J11havefihollIto5hcameOldyouandandwldojustanylatoralzrcomeheadgangdesIMHMInotesofthatandandandhourhavetiewith1111111thedenwithIowafewandNOyuleandantiandlessfromsevenmoregangfromandtinedandBBFwithgunsiiookwlyrate-dThe8tiroBothtinydayfromandagepartandand1202WotinyusedthanNowFishNowKOIIOfromhasbutDiazhavettshed-ithatwitthe1800causemusttunetroutwithwithwithfarmhaswinsweftjiikwithhasandandMissjltotownwiththenNowwithbothwithNickthesuittwothattonsstateherthemanjailfromboontheshottakehullsea-sonbothhasherthatboythethethatthatboywifoholdtintandwithholdTwoTwocashhisstillthefirstwhointotICthatyeartheAr2thebyhillstoldtheNowtakehishisbenholdthatrodthohisthatthattheoldturnhisHelawthenotwhothatthesheherdietwillhisthethethetheoththethethesorethathutheirthefourhairsjailtheveryhisstillsoldThelastthethethethewhothecomenotalllinoOneHetrugotoverhimThinoutofcametheofJNtowntheov-erbaitjailhishindthetheLowforthethethethethehiltNowthenoteglutjailTheThooutThoblyThoThegofarjailtheungforTintTheandlikenotwillgotThesafoRobThemoreTheThoJimfluteeasesfarhimThefirstncrsfTheidlyTheNeilThejomooutlivefiveintoofcentfeetandTilloutlastandtumidthislimblastitsfretandanyOlioingforworeworenewsPaforHeforfastthebyandlastHueriotthisTilllinosaltlasthutlyorwayUadantiwasmoreandthisThoriotandwillhWrImutttillandandandantinowbutandandandbutxseanHOitlwereMtiltsandnotsuitorfasthadhad111111IIIendlinotiesleftdnrrhogutemitsIlvaoustwerewasthewasantililoArclustandandantinndcudandendandgunandandhadbutbudcolWoonewerowasworoKovcullandtooacresnndtooandourlawbarandonbhullJrwerofewthoingwasbf1stletallantiantinmlandnndbahdbywasandhadtimidandlustlastoverworemotcanwasandwasGafewherrodDcletthothethotheourthefoolalltholowandIllsaxesfewandnomnutsIliotothothoupthetheoneupin-Toatthoanypayimethoicresthointhothoentthothethethethisupthotill1nLandlastthetheanythothotitthothotliothothetheonethobutthotherunouthisporhugthethothothothetilltimethothothotholiethethethethethothemoncnsoagotheagothethothemenneroourtheandthotututhorustthevilltheUiothoAthothothomenmenmonmanHesureonothuhasthethotwofortintsucallbyoutaidforgetdoih0limnthethethetheorvohetinaidmiltheoutHOOtheofMrthehethehistaddotonnoforrodnunMrbyinktadwaswanofbybyuidrillofwashishulaforhisnowhishearcroveactwasorihilthisfurbyhisnixhisthobeOnheforforoutHoisoutderhisnuthishisby100wasbyatbyofthforofofofhidBorsotthforhe61hisforWcutithofmebyofofof1ocanTgHoforbeweforijstfoinofofofofofofwaswitsonuforwasonowasfortiewaswasavuarewasininofofofofWforono7htottwaswassonwasboallonoonotitnilofinofouronoouratwasfunayecutatdotoccinCiill0toruncanonoCUllweIfcanwetorhoderutFritsonnknutireIfinourtoBUrtohotonroatbohohetoweINon1mtotototoboit9IattotoboistobohosonIlll-etitlllnoananItovastotototoistoboifisisheWhoisbotoonattoAtototoisadanisisnpantnomortotototor1itohoareititonVWItusitslitusiyto88is52of22soofofofofofasnoofofofofnfittoofofofStofinofofofofofWWofofofofofofsotoofofofto15atoflIeatattitoratofofhlofofofofinofatofofofIfofatuttoiionwoininininItillofofofofIntoofuterinofintotoofininininIfInIninoftotoontinonatgatoninIntoofininIntototototo>totototoattotoonfatinItinon10ItEontototoitinanuvistotoisontomiMinininontoulUtototototoanininasisistontJ38inini-tntoisisIsitinidInidaaoSAUntisitisfleaatAisnxIinisisisaoasreisaitsaOiIsif1I=f-ItjfitSDItIsf-irAyAyitAItdcY1dIIaaaiaaii1aaaai1tafa>14ntCN1aIuuuariiauai1oa1anaaaaaaae-fnuaaaaai-ltxtjtqNI1rLysMI1¬rc>II1fIjIILi¬¬1¬¬¬¬¬i+t¬


PAGE 1

INFEMININEFASHION-SloclcitiDMONEYMAKERconcert-TVthichV1JrtholyoCclTiniosd-tguretlllnmeorJllnutNashvilloAmericau-AustraliassdpifMrJiTMosquitoeaChicagoparticularlystrucktiVoicea6tnge11eatittceatobsorwatorytime-fourthGOTHAMS0590000Cripplonmifily-distingnishedMODESA-lthauglimanyIsawniyneighborgawkyondavorouslutBBund1EYeulnsconipaniedhqrhrull-lhBtHJolonelFAMOUSIr-doublebrenR0ldemocraticcamemoneymakinga-blUshEvausvillocOllllnHtOdsufchlooxelaimodMostLATESThoardNowVict6riaal6nounwarrantablyFragmentaryneighborhoodtWJhohoinRmetaphori-callyclaim-EnthusiasticsympathizingdOathAtlnutaunderstandingriotounllvingdisappearancespeculatorsworld-ThoworkconsequentlydistinguishedProscriptionsneighborhooddisappearingcontemplatedrockingchairKvorCuimlructod-TwoinnuufacturotwQiitythreoemploymentsCompoundednweotestkindsuporfttitiongetinymuchdoubloreVeredViator-OillottyOhamberlinsbackgroundprotestationspounilemisupersedingColoradomurmuringsorganizationflHplbHgedlivehundredthExpositionsaidholdingtravelstainedresplendentUoVhini-nolfcomparativecircmnritancoHcontentedlyhighway-mantightfittingDenverwnrdscampaignerTimesHeraldexportationIrann-efamousdilapidatedGou1tBroknmnrkellbyeverythingthirtysixthinterruptedeverythingagricul-turaleverythingFoirwcather7NinomiloHumphrey1-1nuilieJoneGhamborlintelegraphjinammothCOLORADOSnowadaysuiousBplinoItcontitnicJbdngtitauconsistingMetropolistwentyoneInvestmentWONDERFULoverestimatedThespianevidentlypensionersovryaiulconceptionConstitutiondiscovererexclaimedstrappingsconsid-eralleOlinmborlinDouahnutbrokondownStandingcontiguouscanvassingeverybodydeservingcombinationcompletedirongrayattempted815000000opportunipopularitysubsidiarypalaveredperfectlyswapping810000000jdsxterousillustrationsEvangelistTho-incmborHsimplicityconversationQuantitiesibalargoAlthoughperfectioniii11ClS-rtdiseueothotimindHThofurthnrPackardsHTvytxfxaChnrnborlinOlinmborlinMexicandispersedstablemansCliamborlinMethodistCarefullysubsidiarydiacovororsexceptionpharmacyexhilara-tionwa8brgwnpreciselyt1000000oreotlyasyachtingChamborlincqlehHtyHomostnkoingulfcundornoathThursdaytributaryGrad-uallywhipcordBohemiantailorniadoOporntlon-HAntonioFremontKipliugsundertakenWhomliatfmonotonousdeterminedfiftyfourpaymentsthtJ-LondonHornorof000yearsminerappre-ciatedLearningcountry-infourfootedoverlastinsubscriberspreacherLawwhosocollapsedlorgnettegoodnessprobablyFatherlandstunningSaturdaycompanybuildingaij-cctiVcsFort-WorthsettlementdaughterprobablyannihilatorfarmingtioloradoterritoryreachinghisloatUbreakingOccupationbiggestpromotormarriagecontractorsauthoritiessnippedrlouutnhiseveningsManagerEnglandattendeddesigneddirtcovorcrdesignedafternoonNomtstouisubscribedsecretarypleadingtouchingworkingSUMMERperceivecowboysMethodistim-portedcapricodphysicalexcavationtrimmingpossiblyStrangerterritoryCOWBOYSstrappedrefusingscarcelyWomansflagshipTAILOIMIADBbuildingsouthwestquarterssuburbanconfidenceCaliforniagreatnessHorsebackhtiitaueonsCaliforniamorningbuildingthroughmeetingsWHEELINGsuperiortrippingrIroPIctlattemptscouutrypre-dictedIjauJj-AUddistractedaf-fectingconnectedillustrateddppthsTreatingMethodistAmericanAIUTcrs-BlarneydirectlydraggedChicagoexhibitionRemedyclerkingROMANCElitidaymountaindiggingPluinmorkeyholeoiiaasedcompanystartingar-rangeddYaniinsreveningSpringsSuudayCrippludesiringamassedfastnessesonohoraodiggingminiaturehappyevokinghorsebackhorsebackdissolvedAppliedpiquantEnglishunaccouutjpauletsBal-timoreSpringscompanythousandMontanacountryremarkedconsistedTrinityboxfrontTwinkleslookingUSpeijIatNelKonsequallyCrIppleCrippleStandardthroughthoughtfluuliigmedicineColumbiacribbedscarcelymakingestimatedCrippleKn-KngomontturningvivaciousadvancedChambercowboyconfinedherewithplainlyargolyChamberdiggingcountrytunnelsjumpedColoradogarmenthundredseveningcountrymonarchsrapidlylimeolfbicycledeliveredWomansreachedColoradoColoradohomelyColo-radoworkmenperfectJdiiwlvariouscompanyplantodupwardColoradoNEWESTgoldencapableEuropeAutvuGal-leriesclumsyFinallylongestin-diansgorgeousintorostrapidlycountryre-pontlydirectionalwaysdrivingenoughfinallymedicineHop-kinsdiningplaguemedicineMarshallopenedRippersloadinggallowsshantiesbarroombeautifulconstructTribunewanted-tocleanlyWnrdlbwfighterboilingWaililnEsociablePackardIcivilizedScrofulaDunlopbusinesspresentdistancesittingconcertsrail-roadschurchthoIrisbevo-lutionBavarianexpensesmightyFANCIESlloworoddifterontcyclersquarterpresentbicycledurationboughtDesignRussellpur-posesmembersCarolinecenturymyselflargelyminingobjectsfiguredsystemlargosal-readyprogressNeedlessBrokawhummedchurcheschangesystemGeorge375000hundredwoundedhimlINationalalwaysbrauchuurabbitsIanittrnuimaterialPackardcostumesAmongpresencellnnltonbo-liovodColo-radofollowedtwentyhusbandNavajoWilliamWilliamfallingvarjousColonelreturnedduringpanionMuldoonpcoplocnbiuodthoughgreaterNektondeserveseducatorpcoptoandwasubfollowedohortostcoat-tailsfortybicyclechurchHgiiromyselfDenverincludesjboenraw-bonedtraveledpartiesbronchodistrictssuperbalwaysagreedtrollingThirtyschemesTUNNELdistrictsItu-miMiiiolyeonoofheartyTurfsabsolutedeeplythoughhelpedPackardfoundedgaitersExhibitiondrenseitel-egramhavingCOSTUMEW01UClicountyfaggedsimplebeneathWilliamCaribou1iOtrtgexerciseconstituelementboomedpalporfronziedscrofulaCAREERexponsorealitymarriedfreckledhoardedfoundeddiv-idedparlordiningconcertinstanceAntonioamateurateachGermanfamiliarwithoutcheeksmachinenearlysimplenearlybetweentinkCrookthirtywnrrcpnoSovoralhandledsystemsmartestuniformridinggracedtaughtcrowd-edrefusalshalfthoWarrioriIhuskyde-cisionHolmestaughtsatiricalridingSuffcrnmatch-AreceivesgentstunnellengthboomedridingowingreallyBICYCLEwornoutblanketboomedridingRussellStaincspupilsIllcycleFashionbrighthappyseamedLondonyouthmineralpurposecontentEurekaridingbegunrichestaskanceinvadedpoeticwonderCentraloixtootidollarsboomedhappylthirtyDenversalaryFitycraverageshowedbuttonsplacesyelled4OQolivingdingyravingPikescom-panykingsCourierDenverlearnedhimselfarrivedlateralsu-dupthsopranomouthraiseddbotesrationsgamutjacketworkedAstoriaWomentunnelshimselfpres-entaddeddistrictmotherbeganowinganx-iousretiredadventsingleviolentPromotedTheresvisitorsUnitedDIVIDEDshylycontentstudyillsitfinancedepthwhistlesurfacelivingfriendstendersrich-estVictordepthrctuodaveragestrongWorthboomedsoundscontentAvenuelicensebodiceMnnWltoaverageCreekbleedaroundyoardwhichlankyradicalathleteneededInvestmountbenefitcentraldrunksspiritexact-lycentraleditorsformedbrunchwealthhurledof-obUtrrraisedriskygrandnoisybottlesvisiblea-raisedMiXEiSrestedmarketBeautifulfullyACAITIndiandistantynrsfcpointquietJACKETsoireesCleaveoclockGrantfaintergoodsbeingawhileaveragequitosleepstreetsManypointHtuffodchurchcockedtunnelthanksfrozenSchooltunnnlClarkefiguretomatowheelssouthtuunolothersettledrestorecertAMnighthumanItamdspoutalongdeathtunnelforcedlookednamedmotivemoneytodaynightgivennighturchinchurchturnedwithinuntaiuquiteLyemiSreplyShiedratheroclocktreasurehumanmoneyawhilehnircdtenderfailuregivenreignColoradoff0mj8scrtshouldStatesWorldcloudshealthPikesDROWNbottlesPalacebeforeschoolAMERItunneltwelvetunnelscarletvenderaskedwhileauditfriendrabbitUndernightknownvoice-IhealthmilDaWestLnrgputtweedtwelveshownJlnlcafeshangenergyTwainboiledlockeddirtyalmostsaddlenightTailorwhichunderplainratherDutchpartyDrewbesidetavernproperplacecloutTWEEDthorqwhichbrownmonthamonggreatcornerloverswhichWhenoJnttcbeforewhichforty12000wont-onmakesmarrymoodsTdxnnraisedmineswhichrabbitGulchrumorslistenfailedwhichUnderWontboiledcannotnatureWhenminesTheseBrazilwhomwouldsleepapartmouthfromCreek18978beforekissedsaloonminesmiuoswhichwheelcuredridersYoullshinywitht-iblackunderrolledsoundstatedBlanktheyPikesmidststrikewhichfriendhandsestatewho-1tthoseOnlyhopepairsplatowheroamongwomansundersedatehousewhichwearyeditorwhichwordsweekshavewhereWhenaboutCliamworthminesagentcreditfutureSleepyeditorworthVhiolimusicelbowwheelaboutSnnolCreolebeliefminesCloaklimitskilledworldmoneywhichmarrywhichfnilierHillpowermoiregoodedgewhichkilledlloujonlyedgewhilegruntoundheardJohnkilledspanunderojllcoCustumewordsatxmtberlinCreekgoodshinyfromladypowerworldaboutprppawontmodethosegullTroutserieswheelblackthrowaltostownseveryAldercoverersmoteunderelogoninnystatesJACKETArtUtlckeptonlynightheydulyFromsaidthosoGOODSdrugMissMoneyTexastowerboardTJJOCKdozenestategangscantosamemen-talstoodhorseFieldboomcrockdencouponyearsmilessmallwheelsoberwhilethosepaperyearsstockformsstartsmodetimesdayslonggoldablydayswhymuchfloreoclothsmallyearstidiespenceguugafiftygoldDellasocialtownsYoungroadsmakethoseyearsthorecoulddoorsmadeeveryvoiceriderPeaktheremilestablediedvoiceYorkruralstbnoknownavalpaMhaute8200mademiloHshortLatermaledownCitywhenthroeSKIRTparswantsPeakWomenhorsewhenstoodyeasmnilociazyladymilesshootWesthorsothoTohomotripEllenthosebyprwhatlawsmainControlmuchmanycitiesailtRlnliFifthitselfWestmanydisoastuckvalueyearsothercitiestorygreenmannerTexasotherhearthandRubevoicegreenbrainmilcHbiteinfoTookgoldlittlepaidthereyearstenoryearseverygrassSeidlindismineJohnFADSofficeHerelittlenROWfdaymainthatwomanmadesuccessvoicelooksseizemainitselfjustyearswaltzowedheartJohnroomnletterhutslittlohaveWholittlewomanfrocktheirThenmindThatThisteasprayerJfVnrloumiiioThatThatpoemwomenawayidealgetsDuertornSuchWHOthetarifewithwithchildclassouchfencebeenEvennarrowownerMissbidswontTortsignMilohotelclerkwontFourheadbuiltuntiluntilOldtownwhathandworktownIlowawomanmealhavoskirtbackafterfromWolafterIiihavegraceQilycolortownstatemuslwithhavewhatYorkhookconlloulj-utheirwithboonthingaitwontFailedMissbeenmustafterETONalasYorkopentimewereMissMissovorhavemosthavoneverlocalMoreheroWIicoltheirmostliestimejustWhodeadsoloandwomenHtorosoonersuchThisWITHTHEspothnvflcnllod11700justTonwithwithhourwithfromIMkbNwithYorksameNowsemitownCLOTHbookshotThesnilformwithbackthanstulVboretroutwithdayjhosourcewithThiswonttionsbeetsholdsuchThiswithwithboonwithNowwhogavedeadspineboondrewwontmostfromgrewbluewithwithtooktimetimethoutotalwithreadyourNewtookShewithcashthouUnderfliptimothatgiftTwo7000dinedaytownIFfadaycoversseasonwithinnlpureboonboon917yearyearfairstotalTwoAVorthcalledCOTtroutgaveisitoandlanktintdiedbackU8002000took1000startnenseomeetflarewithhornwontmeansluaufieldhimWorkhairtortAntiCANwirethatliedbeerandsockthanrendfromUniontoutsaidsailfastNew5000whothatendpassthatwithKututogirlninetimeflareandputtbrasvastwhoironthatthatwhowithwhoMylotsneverwilltimetasknexthairhndiThetaskS71YamANDveryHoldseamsrowsnextNowhaillovetownGirlthatwhowhothatthatthatthatiipwHoulsoldthatsidehimshotpassSUITputintothatthathisingthatwellThehairthatsaysnumoThetholoveThoThelutethatthiswillleasbnnkwhowollhndMVsthatHerfacewaysoldwhowayjobturnwhohostOnethatpotlateTonstfoVOhintfootlovesaiddieswellwhoSKIRThindhillthefitoOOneTheintomanyotcoataminowomandulltherescatwillShesuitThethatThorealthinhimandandThoThevastThewhofirstTimewaylayYorkwillSheandwillrestthatintoTheladyandTheThefoot350andintoandTheTheThohasSanwaycanecostsevenmadoNothinthimantiGunwilljisfreethathimantihimtealwillandwillratestillSheTenMrshirefootandagoTheneHerthatcapmayKpotgotandhudandhadantilcerByfootevilYesbitsandloseandthiswillandFoxtestwaysotisetsgotSuitscomecantoIrliUfellmanhueandsilkwillandlosthudthornUllduoandEvonandandhallandwillgotandandhimnUllendcamoandbolthadandyoufaetantiandMrsSunyorcamesomeandandandandandandandpaynudandhadandandantiandandmanandthiswillthinfootandandthisnuthaillierandhadboxANDmomYorkandandandacidandandandSaythewereworeForHIMMidandhudandhadberandandandandandmudantiandlintsomehadhadandresttlioUlchBLUEnewsandhadandbonoandandYesandboxliveanyandITierantifootIllstiefootandandyouanyandthishatfootfairthehershecomecomoherHo-nlayandandandhatfelllastaUllfairthetheantiboxandantiYesYesYesefadandwascanethowereworocamemilthdthoworeandpayBymoresame1cnkYesandandYesherHayArtwaarowsfullyovSalsitethothethohealglowtheMostthoroommassevenYesYesyoutwothesayshethobutViehertillhastwohasinnthothothethoworethewereservebythothebarherhercoyYesthonowHohershethethofoilsilothethothethoWillthethoherworothothethethethothotheoldflvo000herthethothoBIGlullsbybutagohersitethisbyseenshehasredbutneartimefoolthethethothotimenearoncothethethethothetimethothotheoldairthewli6twonearhasnothasoutsaythothethethoherhasherthehertallthothofallthothethethothethethothethebybythethothothothothothothethobynearSaloveronobutsoonherthoyesthethethethooutoverhastheoutthothothothothethelifethethethothothethoOFthothoIlltheoldoldoldtimeillsthetineverbySalthethothoFairbyhisthethothethooldthetheyornothasthethecoverunsthethethethethethothothothotIlemyIranthothethethethothethethothothohidwonearsmanforSatneatMBthenotoutforthethemanevernotthoNtHthethothethethothobythothefOI1thethothethoHetimethethooverthooldhisHosixhisnotagooutyesfisthasHesavethothethethotbomythstheItsbymyoldthethooldhishisleishisoutmanpermanmonarehethotenMothemyUlanusesANDnotbythetwHe16hisItshishisforwasHoNoHolotundlIemymyHomyHocomhisONhishisforAemanANforHoHoHoforfoolwasandsetHowasMIDforforHoforHowoowaswaswaswaswanvasforCutnUllforhisoHtoweforclowaslinforforHeHoHoHoHoforyouandjutfallnullHeConandandwaswaswasforwasI-ToforforforforwaswasWWIwassetoiloffetcforforwayaUalloffyounilipfThewaswasonewasDrundTowaswasrunrandwasborrunfarsawwasAsCoSowaywaswnslornitsupwasimSoAtHIwaswasitsofnilnilwashoiinrthodoMbowasonewaswasupwasjiltnhcanourAthewaswasitsonotheupthudoupupInnbebohoonecanijiofupwascanthooneheSocnrohoboallhohoInherbothehobyboonehoWebeAuboitsitshohoareotboofitsgoaremloybothemethebohishodudHomeinseeareareOFhoarebo80areseeinAtinofInofoferavasorsgowasurefofinofattoatininofntisofofnotofItmeofareoaraminMinininofininMofofofinofof1anatbtinofmeofofofofofgoininortoofininofofinofofiuintoinofofofofillofofofofofinofinofofoftotoofoftoisinofItofInofinofinofatofiiiinininofoftotooftooftoalininlainintototoillofinofininintoofoftoofofofofofofofofItofofinmotoofto10ofbrnoisOFaatoiuindrofinininatofItofofoftotoofininininofinatoftotoofofofofinofoftoiutolatoofofofatofItHHatofDtoofatofoftoofonofinofisofofatoftotooftotoofofatofItoftoofinintoiiitoofofofatofoftoatofofItoftooftoofIttoofnttoontototoouattotoononoatoofinintotoattotoatatattoatIsattotoattoanheonlloanBtotoattoisantoisonanonnnIoanaunoonItisisenunnoanatanisanitZanisannnananntisisisisitisisisinonanunit4-ytStIorCOilanitonYisAanitIitiwonWoritIICinIJitanasYaorAofratVInasitasanuncr>ScontsoqaaofrsaaasanasasMnsasasnsInhsoaaasSInSasrfftituuiiVto1lIt>ltISin4IIIIdIkIf01wIAUIIIItorIIIIqyIgIIuuKaIIaaan1naaaaaaaaaaaaaaaoaroa1tutraaanaaaaaaraanaaaanaacJfaanaaaaaiaanaaaanI4anaaanaaaanInStr>aIinHSfWIt


PAGE 1

MONEYMAKERWO-NDERFUL8hOUIIeverythingtnrnlingt-enxhiugyearsGOTHAMSfoslliiitO1maChicagoruirticnlarlrfltruckendotvingtothe21152t1U110CripplegawkyendavoroushundredsothousandsFAMOUSsaperior-TreatingtiWrc1lowmoneymakingCompoundedu-liscdhrujsplatoaccompaniedmakingprogronsiistingnishcdnoigihorhoodnLATESTHomcntakeminesspeculatorsclaim-EnthusiasticunwarrantablyunderstandingconsequentlyprotestationsdisappearanceMontnnu-Plummersympathizingdoublorevcredrockingchairbetwooit-ColorndodistinguishedneighborhoodMODEScontemplatedPrescriptionscountrynndindis-crootlyasemploymentsMetropolistravelstainedMetropolitantwentythreesupersedinglivehundredthdisappearingFragmentaryopportuni-tieslercelookingcomparativefatherinlawsTimesHeraldobservatoryprecisely-theVnrlon-OuupittlonftChiiiibelinmurmuringaroapleiideufthirtysixthsaidholdingdilapidatedunaccount-ablyexportationAuthoritiesbackgroundorganisationsuperstitioncontentedlyeverythingcircuniHtanceshighway-maneverythingcombinationoverestimatedinstantaneousconceptionprominentcampaignerpopularityeverybodystrappingscanvassingtIrwlnld08palaveredClmmborlinsEvangelisttwentyoneattemptedExpositioncompletedquantitiesCOLORADOSillustrationsconversationsimplicityHumphreynmlMnnitonChamberliuDcnvcrwardtSlTi000000exhilara1-tionaitbriidiiirycharmingmetaphoriKiplingscontiguouspharmacycntintatodFairweathorstablomanBswappingagricul-turalmonotonousstitchinpsmanufacturoponsioiiorConstitutionThursdayChamborliusubsidiaryperfectionexquisiteClmmbcrliiidispersodim-plantedgrace-fullynowadaystailormadesubscribersChamberlinyachtingand-thoughconsistingunderneathwellnighevidentlyDoughnutmouHBelinolorgnetteundertakenpromotersubscribedgoodnesstelegraphCarefullyover4000ChamberlindaughtercollapsedfortyfiveMuldoonprobablyGrad-uallysettlementAlthoughexceptiondeterminedjjoitnilesHperfectlywhipcordstandingopenedThospiatamlovorydeservingdemocratic101-flfrs2secretarySoprr4lhlonsnunihilatordiscoverersAustraliasn11u-1leiuliugHorsebacktrippingfiftyfourtributaryCOWBOYSreachingpreacherpaymentsAl-though1XIltionneighborterritorycolobritystunningdesignedSaturdayprcpn-utionsBlarney81000001probablebuildingifi000000marriagestrappedillustratedEnglandbuildingbreakingfourfootedFatherlandconnectedInvestmenttrimmingexclaimedhusbandBohemianexhibitioneveningsROMANCEshippedEvansvillomeetingsmountainsphysicaldesignedbeautifulingulfedperceiveovorltwtinsouthwestdepositsmountainspleasuremonarchspossiblyVictoriathroughcivilisedunpricedCarolinoSPackardsterritoryportraitdroppedscarcelyMethodistmorningloadingaf-fectingdiscovererdiscovererclerkingMothodiHtattemptsmammothar-rangedworkingonehorseFANCIES-INCaliforniakeyholetheslmycommittedMethodistconsistedChll1dl-nhHWJIEEMNONinomilehorsebackcouticncUAppliedpiquantTAIIOItMADKRemedycentury-rAmericanexclaimeddissolvoilthoughtSpringsNashvilleAmericanOpiniUoimthousandtrippedeveningChicngoscarcelySundaydiggingCaliforniaColoradohorsebackdesiringmountaindraggedStrangerSundayopntiletndirectlyEnglishovoningCulTiiitumedicineChamberFASHIONSiveninglargelymountainherewithminiatureripplebrobl-hutshappycountryhturtiugequallythroughflagshipobligedjumpedChamberworkmenrynmlBal-timorecountryenoughdirectionobligedCripplesuburbanSundayColumbiadiggingmedicinemedicinesystemdiggingregulartippleplainlybicycledrivingcompanyColorndobusinessconfinedremarkedmightyripplenllllll1lhVic-toryJnnionIIGal-leriesattendedreturnedNeedlessturningDunlopllguredhomelyHop-kinsdurationtunnoKdeliveredrapidlyFEMININEFinallycountryWonmnflSpringsColorado1uli-WiilklntbicyclecleanlycowboyBavarianhummedEurekaadvancedexiituincsbranchesfastnessesthoughCOSTUMEcountryNationalconstitupre-dictedre-centlyvivaciousafternoonrapidlyBiggestagoodcnpablowaltz-ingEuropeScrofulaconstructgarmentlargelyColoradoal-ternateWomansNEWESTquarterupwarddifferentnippersSUMMERPackardSabbathnnuusedconiunycountrypur-poseswoundedcyclersdeeplybicycleNavajonoJonesgreateral-readyreachedfollowedsociableshantieseducatorDesignshortestmembersbeforet-imedistrictsfollowedLondonColo-radoCoimlrnrttillutnl11longesttraveledloweredmembersgallowsflailinghoardedPackardraw-bonedgoldonalwayspeoplesweetestTUNNELThereschurchesplagueincludeswonderpartiesrail-roadspooplocompanyIRKnI1UmtmaterialscrofitlnfaggedobjectsmotiveschemesgaitersalwayscompanyPackardmyselfTribunemainlymyselfperfectchangecostumesAmonghundredfreckledpresentfinallypassedboughtCAREERHenrydeservesIluiiirouigorgeousNolsonHTen-nesseeconcertsabsoluteinstanceagreedoughtsittingMarshallelementdistnuoosupirbalwaysrefusalsboilingdepthslargestgeniusde-cisionfallingfoundedcountyAnswerspupilsbarroommarriedfighterdistancesatiricalsimplesoilingnearlybronchoAntoniowithoutinvadedblanketllexicnnminingholpudriotoustwentyTimos-InKxhlblllunodgoofdistrictsdiningdiv-idedtaughtmachineexerciseAntoniolivingFromontGeorgeinterestwornouttaughtbe-lievedsimpleduringrealitymarkettel-egramsmartestreceiveslearnedSeveralgracedheartyfoughtpresenceridingWilliamcontentnsknncefroniedBrokawdiningAstoriaWilliamsystem875000familiaryelledridingridingsyHtomMmitWhoneededRusselltunnelsWimCOIlDThirtyfoundedgamutlengthyouthBrokawLondondis-covererUnitedIluspoll12000Irosaodbrighthavinghappyhappyamateurtltttughuskysalarynearlyconcertexpansebeneath16111110parlorravingDIVIDEDhimselfcoat-tailscauseddeathCourierlivingCentraljacketWilliamridinghoonutdmotherHolmeshandledhimselfpurposeshowedmineralmarkedttpforsopranisixteenplacesridingstudyDenvervariousboguudhotesStnincsillsitAtlantabuttonsboomedWomenarriveddisoisoIcrmanCariboucontentAvenuodingydistrictseamedSuffernHoriiorreallylateralsSchoolevery-onekingsboomedColonelvisitorscribbedfurtherFryerWhomSpecialwealththanksItmhltHIIworkedrabbitsaverageColoneladventconcertsoundsexact-lysinglewhistlegoodsthirtyboomedbootnoiloclocksettledOFdnEEVhim-selfgrandbrokonanx-iousretiredbottlesstuffediniformhomerdistaut8KyiTowingcentraloclockfriendslivingthirtystulVedcheeksshylyvariousvenderdepthsuicidelookednitrfncoturnediloptlidrunksgivenpres-entmilct-ofinthosoireesliveningstrongvisiblequiterichesttodayIICYCLEfainterproperoctivesbeganFryerBROWNDenverathlete1niroruuBritisheditorsmil-lioncontentmiragebottlesgivenbipedkohlnightdessertbenefitbesidefailuretunnelDenveralongaveragenwhiluradicalItonutlfnltunnelYoullnoisytunnelJACKETxyoutdollarsretiredbeingbranchquitoquitelicenselankyrabbittunneldepthfigurepointtenderiinnnconightrestorespiritManyNelsonwheelssonrletspenttunnelUnderhumanhumanfigurechurchlockedsaddleurchinAMERIheartsenergyformedhold-ersnighthealthfatuouswanteiDutchhealthwomansaroundpointhandscuredrestedWorldTwainreplyutmostClutchchurchconsidmonthcockednwhileslakesviolentmanyquietCleavetreasureGouldtwelvehaircddoublexustoutCoMttiinurinightamongchurchcloudsTexantunnelincaseplacetinderswhichraisedGrandmoneyWorthlargemoneyliningPalaceiillottowithinforcedalmostIndianwhichmtiiKvlyloversUndertunnelvoicereignTWEEDburiedClarksvoice-IcentralmusicraisedratherWhenboiledVictorMnnnyflwhileAntontwelveshownstreetspauperwhichwheelSitnolfriendlikesbrownrathertidiescortAnmonthpartynightaddedTailormouthtavernOnlymusicwhichwouldwhichWiirrlordirtylutionnamodcreditfriendboiledPikeshangPosition18178agoutWorthrich-estrolledwhichunderCrookmoodstwelveschoolupsettlMiIrUlimoneyamongcannotIllcytlusleepsaloonnudntoCloakCrookCotoniilnwhicheditormountbrownpairscrowdsoundwordsSoclutymarrywhichhandswhosowhichwhichmonaCreekbeforelOrtcdVictorstriketweedlistenThesewearyStntonBallyutntoitplainnatureeditorl3undnywheelAlderPikeswhichwhichunderCreoleciatedunderseriesmatchridersweeksresentofficeryearsfortykissedWontbodicowhichwhichwherewhichfourthfuturebeforeraisedwordsminimBlankunderelbowwhichgoodhopeyearsgreatsmotealonekilledboardmarryWhenDrewwheeltightquillloversofthodrugaboutwhichQOODSfailedWhenworthmoirohorseInvesthomowhoreshaypowerdulygreatSleepylimitshousestoodmuch81100heardwhilesmallwhomdaysblushblackin-sovonlatterpeaceTexasminesyearsyearnworlddeaththosoimdormadepowerFrwntilledIurgentformsMisssocialtheyiiluuitwheelmakewhoaworthIOWIJHllruutleJACKETninnydoorsappremidstyearsminesprayerdaysberlingangsntiliurladyWomenmuchyearsheartstuckkilledmannertherenakeddeuceminespaidmuchtimosArtUtlcroadsgroonstatesvoiceworldEllenblackvaluemodestoodyearscouldheardmilesonlyhairladyoperastartsgreendoyenfounditselftheremodentniloHubevoiceSeidlshortwomendrinkOF-HIUI5stoodsaucyhorsedownirnbloedgesmalldramspaidhorseFieldwaistothercitiesmilescitiesJosewhilethosemndonavalaboutgoldabouttowermndowhenIfthosoberthoseknewmanyChambeliefworldmilesCitywantsitselfCentralsouthdownBBOWHSuchbruntLitterestateFromotherthosowiththeygangswomanawayninnymanyaidvoiceDellaFifthmilesbourncrazycloseestatepaperowedlittlegoldWomanclothlimapoemshootEveneveryMovelooksshortJohngaitrumorsgoldtherethrovheartJohn81H7mineThenthrilllittleminepar-sonsuccessthoseMontthosebookruralgrowcrocknarrowheartpunyclerkWestseizeWestlentilfrombrenstherethereotherofficeyearstinnyfiftydownthemPealseasonwentmiiiujustwomanhandYorkbulkyearsstonetownsotherFADSfenceworkmindriderYoungIrishidealclassbyeskirtmilesspotlintelcolorboorgoldclerkas-setssignmilosnlct11madecuuttrwomenWestfrockbeenKullotlYorkwhatchildheadwhatsourceKnownlittlemostwontmulewithbackETONThatminesoonercoverskindbeenPeakgrasaDnergutswomenfrontWHOWorthtableulnauntilmostfrontmealthanuntiluponcommitDrlZJointheirVisa4extcafeshooktionsHeroxontotlunguponeachtheirMissstaidPeakwithlittlewhatmustofllcostuffhaveYorkThiscnrteLottortheirhandafterherodaytripyourhavoThatboonintohjustdeadMIXEDstoreWunt-toworkbuiltFortmoatmiulocalhavomeetbyeafterhavewithUniondayGAITwithtotalwithmainFourfromdittoreadcalledMisssuchwithWhobackWasFJIOCKMissbeenwithThisMilebeenWITHfrombarkThatthanColofrommaincalledThoputtitanbeenwithbidsNewhero7000juststartWhosucktimetonermainwentboonwithdeadthennextYorkhavesemifromIlknHwithwiththeiryearthatwenttowneyesNowwontmustboonrobeNow2800muterhavesuchnextlankgirlWheelTwothenwithdiedoniiuwithlayflnrowonttownmeansbeenwiretinetimospunfromtownneverwomanhavosaidgaveCLOTHtnailowithbluowithtimeratiowith11700iaatotalwithgraytowno41heldhutsyourdaywho200NowNowfromThetimewithpurefromfront11000timediedJustflaretown5000pussSlnijcThotuskwhothatcoattookthatgiftcornerseamsFortninesaysTHELawroadshotwithtimeTwowontwithTwoUnitsaidfromsoldboresaidtowswhoANDcashntatosoldthatverytookwhoThethatthatthatAwlintoveryownerHerCANlaudbestwithWorkshotsentfaderwhoBufHillintowhowhowhoputSalmaywellwho1ntntowithSUITlIlIeMrsGirlguttankThorookantithatwhotintsuitputYesOneintowhothatloveCOTlinnstherethatgaveladyYesloveduosMydullTheThoHKIUTrhoTheTholovethatwarttookreekshottoutpassHomoTcxnnThothathireShetitsgotlikealasYorkstetThefacethatTheintothatironthatsaidneverTonTliosomeYesforandthatantideernndwhosoulSheThethatironMrsThewellcamsllrststillwayandwillnntnooursoandruinhimjoltMrsTheTheTheandHoioSherimewaythatthatturncovehimcantohudandhintendthisSunintohairhailandSheandhullwaythisfindThelostTheCallwhohadgutrealEvenForintoVanyetthisnndnudliveyouboxthatwillandandandandfairhimhaulandMullnudhimandwillandFoxthatwaylaynameandnudandthisnewshimandnailandandhindlimitthisYesandhadbitsandoldnilandherandandantiBillhadpaywillrestThefreoHerstintwaySunbonocantoSpotmilthiltandnullandlastantiandYesandandNotduonUllnodandOldhadandandandYeshallanilhadandwillnullcaneandwayhiltoncevastherundYouroadtoadandandhndandandnUllandthisnUllNewsorthadyouundandandandandthisSuitandbedhadandSHOandIIIHOnerateANDYesandhimnndwillwillpayantiboxtexthernodwillhadwillwillandfullYescomesameroomhastheiiiJserveandandrealfeetanynUllandandrimeHIMevilmasscamefootoutbyherhadhimhailantithogotthoJ10W-IwerecameandandherherwillSanandinn000minibutsheMostyerherhersheroomnomowereIVxitcomesomeoncePuntYorkruinundyerhasYesagofairbutyoufootfootboxrowsmorohashaslowfacthernearthothoColvastmustthoworeweroPaineanytwothothosheherevenshetholintfootendHissheBytheherlugshairwereoldthethothethoworewerewereoldIrivrUlolithotwoArthertiltJointwothohumthomlhotthoshehersamebywerotwothotheHowthoUnityerthotintthoBybythethothetholifethofellIllthehuesaynothasGotbarmythonothasthethethothotitthethothooldthothothotalltitthetinbycapagolimythoyesthehutyeshasthotostthofootnaythothothotholifethethethethethothothothothothethethonearthothemythefallthefelltillthuthuthothethofaninnshertheagobybythoherthothohothethohasthoSalbywhohasthobyrunsthothoMothohmthuthethotherodtimelensfulloverthotheoldthotiltthotimethothoSalthetheHothothothethethecom-ooldmanhisoutsayouttheshethethothetimethehatthethethethethohUHthemythothethethetintitliverbybybyeverthethomythothethethethothethethoby1111111ronsnoarfontSillHohisthetimethstimemylistthothetherowsthomythothethetilltimethothothothehisWillevernearValoldtietheBICbyIIIIIIa1anaIInaananInaanaananasnnaaaunnunnaaauanaaaaanAanartIInqaua>aaaIjaalantInitauaaanaantIaMIta0tI1llGitIIIltItIittttIItIIiIVtI+I>r1II>r+t4¬¬¬Iwi¬i¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬I¬u¬uu