Citation
Gulf Coast breeze

Material Information

Title:
Gulf Coast breeze
Place of Publication:
Crawfordville Fla
Publisher:
R. Don McCleod, Jr.
Creation Date:
September 3, 1897
Publication Date:
Frequency:
Weekly
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Crawfordville (Fla.) ( lcsh )
Newspapers -- Wakulla County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Wakulla -- Crawfordville
Coordinates:
30.176111 x -84.375278 ( Place of Publication )

Notes

Dates or Sequential Designation:
Vol. 1, no. 1 (May 28, 1897)-
General Note:
"For the people."
General Note:
Publisher: Herbert S. Moore, <1915>.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
01456015 ( OCLC )
sn 95047266 ( LCCN )

Downloads

This item has the following downloads:


Full Text

PAGE 1

iIHISTORIESSOUTHERNKLONDIKESlMCOABuekloy10OOOMIREPRESENTATIVEBREEZH-rWRONGgrentgroltnephewi-dcntsCOASTthem-bygovcrnirientupouendi-leinrtmentGoueralVeylersFROMGOLDAVI-MiIiitorfntNcxtMirtlriBLan-iugS15O1011GULPnotwithstandingoncnmpmentlgovernmentWednesday-saysMcKunnn-ChnunceyrcorgnuizntionreorganizationmemorializingreadjustmentOler8M000CdiscriminatingCarolini-collegeOFFICERSphe-nomenallytransportationprosperousENCAMPMENTneighborhoodcomplicationsnecomjilinhedFOREIGNERSdeliberationsphotographerstraighteningznandcrinchicf1ennsylvaninunanimouslycorrespond-entJULDENSUPPETilEpremiershipPhiladelphiaorganizationsGuldonsuppeGuldeusuppeMontgomeryunder-standingrecommendationinstnamtl-ythereencampmentKingsbridgesubstantiallyPhiladelphiagovernmentsMontgomeryappointmentappointmentresignationsencampmentMILLIONAIREproceedingshystericallyinglori-ouslyndminiHtrntionWnHhiiigtonTHEparticularlyorganizationBirminghamencampmentBirtninghamencampmentdenouncingCOMINGemuurissionersiAZCARRAUAsatisfactorygovernmentspeculationencampmentapplicationexaggeratedstrongholdsattemptingcircumiUicorecommendedrecognitionencampmentinterestingresignation8117000000KldorndoaudeverybodycommissionerpropositionCOMMTJTEEexpressingdnughlersrecommendedsubstantial-lycompletelyemigrationMnylliwerpopulationprominentACCORDINGeverythingPetersburgresponsibleIlorlilit-FCIIUflllltUericulturnledispatchessupportingEdwanlsionperfoimllypromiuentChnmpionendorsementVicksburgsemi-darknessresignationconventionconsiderntionChnmpionprominenteverybodydependentninemonthsintermissioninterviewednominationsoriginallyforeignersadjournedextinguishpersistentpublishedAccordingResolutionsneckingconsistingoriginatednominationAppo-mattoxencampednominationsespeciallydistinctlypresentedngouiiiigNoblestownAgrariansappointedPittsburgTALKSAscnrrngndissensionstestimonialProhnhlyemployedBrooklynpresidenttocpnneptMKMUERSpatriotismPittsburgdcafriiingforeignersprotectionthousands-ofcampaignConnecticutat-temptedDUncrecmrtitiiauthorizeMichiganpresentedHho-110urelldeterminedGermanydissensionssixtytwoCompanyreceivingpresidentrcfientntivesfollowingpresidentCHEATINGperfectlyCincinnatiTHIRTEENKiiipstreeCompanyfollowinginnnn-fneturodcampaignpanicofContinen-talsntcheTtoMucIilropcrtVcnmpnipuPauhnndloiinportnnttemporaryperfecteddisgustedpermanentISSIOVERSsupposedexplosionGovernor702300000CompnnyblacksnakoAssociationdiscoveriesPACIFICSmemberswatchingFitz-gerald272500000understoodrecom-mendedBrooklynpresidentscreamingrattlesnakePRESSimproperSaturdayunderstandbattlefieldsprobablySaturdayfollowingimprovedthemselvesCompanybothrescivilizationSaturdaypensionsWeylersOpeningMcDonaldencamp-mentCaprivisRepublicnominationcommercialgrandsonManningcon-sultationfOItUrllIbattlefieldsswampedchargingsecretaryAssoci-ationkitchenitocommitteeresistingdaughterconventionnomi-nationtvcFrivetshaudsofT-heprovis-ionsAssociatedpackagesstandingdaylightintroducedafterwardsfollowingFORTUNEUnionallproductsdesigaolpensionsoperatorsoperatorsassociationalthoughprobablypurchaseexpectedquestionformerlyspporicARobbinsirresistibleoccasioned2000000statutoryspeechesfloutdispatchconsideredMcDonaldcommitteefaBcinationmortgagecarefullycommitteequestionmorningrecentlyquantitymorningRailwayPREMIERexpressedshippersGnldHinithnonunionagitationshoemakerthrillingyourselfquestionALABAMAAlbany-Ninca-pableAllowingBlnckburnTILLMANmanderiusena-torialTennesseedumpedrequiredVeternnsBerthanhowingcommitteeapparentpossiblymortgagerequiresWilkcrsoncommitteecommitteeOruunlntlonYEARInvest-mentsuppliesNewcastlereportedportionsColuinbiiHforeclos-ureap-pearedTennesseebicyclesbroughtadmissioncirculatedsuppliesexpectedbicyclesRichmondGrosveuoruivlnimerniuitintiontherefromexpoveniorbroughtSPANISHRnilwnycommitteesupplieswholesnlocommitteesuppliesdelayedagita-tionseverelyHughittembodiedpositionsucceededMcLnnrinMcLauriubicyclesidentifyChicagoadoptedquestionPensncolnEnglandattorneypensionproduceAbbeville835-M1IWFOOlfsteadilynorthwestMcIJmriuMcLaurinStatisticoNovem-berFLORIDAdeclaredFLORIDAbearingevidencesattemptdefeatedmeetingconvertedconvcutioWnMiliiRlnnChronicleimportsteachingpensionestimatedRailroaddescribedbroughtFridayColumbiaApparentlyloadingstrongerincreaseStanleyVn-WillinmLouisvillecandidateMcKennnsecuritiesprospectadoptedoriginnlTIMAXexecutiveutterancesscarcitymeetingevidencesgov-ernmentwithstandstatementsurrendercan-didatesweryiSilaKinvitationconditionadoptedSundayns-sembledpensiontherebynephewrigorousMcLauriucontinuedpocketsincreasedassistanceidentifiedconferrednullifiedMf-Liiuriuincreasedcountryship-mentliabilitiesabolishedNashvilleEnglishunconifortcomingleavingon-RoununauthorizehistoryColumbiashippedqunrtersCHANGEcnrIonduestablishsup-pliedfur-nishesex-pectedgath-eredimportsproductincreasedhardy-canMichaelsAmericanEmpirePostollleohundredsprrrotatIlplacingdefeatedWcaretoHarrisonWomnusjjnntionPeusacolacountryseekinggeneralrapidlywhereverSundayestimatesthousandhistoryreferenceopinionexpiredbiggest7000000countryMichaelsMiteinptFavnhnmMEXICOsufficientattentionclothingas-signeeexclusionHusseypleasedBusinessWomansCromwellminingrenderedrebellionconditionbicyclecharactercountrybeyondcountryPortlandRowlandfavorablehatchedloadingtext-books857o000happenKvrrythlntPortlandFlorenceFlandersMINERShistoryfordvilloloadingleceivedrestraintcominghistorycompanyWOMENforeignspongeHartfordextendedgettingCaldwcllsatisfyharm-lessnumberscreditorsPortlandcompanybicycleCnmloekPittshttrpovertyfollowedsocietypresentclosingFridayestablishselectionWindsorLedgerhistoriesAmericabusinesscountryFridayCanovnsbicycleopeneddreamedhundredlousinessFLV3IKSVilardahistoriesWorkersassig-neeurgingchangespecialdOELKTpayinggreatestunitingAmongcollegenomineecreditorscompanyCarolinamarchedNationaltreasurerMurraycon-sentedin-formedDepartFridayFridayattemptpoodleexportsexportsreturnedrebellionEdwardshoweverAlnbiunaBaringFigureopenlyFridayTillinntide-ceasedhardlyAdvancelifitnncocompanythoughsouthernbusinessnttnckcdTnmpreportsdeclaredwhetherdeclaredretlectedhoweverchangehavingeightypresentreportsInternalministerarrestedYoungsupplyhavingCampaignHriiftiitloiutllitera-turesubjectspecial110ASTSattackedduringspecialGeneralrrtetellWilliamTlieniirlvpndesolatem11tcll1nearlyelectionreportsincidentfinancialcircularspassedchargehavingSliopninkvrnationalreceivedpassed830000810000clpthcsEnteredCiuiilldufwdegreepeopleMexicanWilliamdoubledspringdistrictrecoveryMexicanDcpewfol-lowedreachedmothermercuryWilliamlawyerremainsGeneralspringWORTHVICTIMonehalfRcnlln-tiol1springpeopleColonelntnpaluiireceivedplacedthirteencongresscongressConiliMiiurilLaw-renceTillmanMexicanmistakeWagesTillmanmemberTillmanTillmanSAVEDpower-towithouthundredpeoplefoughtregionpeoplefamilieswithoutItniuirlfrfgreat-estspringjuniorre-turnedSlvOOOMutiiilniKruinUfimnSenatorstrikerspoisonhccnusnspreadMonthsSlOOOpublicreachedFATALtreatiesselectedThomashappycleanedprofitsSOOOOSntolltnROUTEelectionpurposenationalveteransspringSar000BidwolldecidedminersboughdemandllvntroyiilOperatorIrl-inlmliincaughtcaughtoutcomeGen-eralLondonveteranscreated825000heatedpublicpoundinstantsuf-feredmarrieddistrictfarmersjoinedreach-edStonyfiinplutaprettyHunkerpresentdivorceTHEworldsschoolsKraueesconflictdecreesdecreesOgdenbrokersinnuderrelativereportCitizenSenatorialCliirlunittlSAVEDDetroitsteamercrustyconcisenysIobviatewidowsspcudGoeletbrokersllarrietthirtyupendOgdenSeattleStatessmallerFloridatreatiesnotableficklercabinetDniryworkedMarvinbe-tweenAttemptstapleUNIONsteamer000000iuntiol1climatefurnishschoolsCandidateinterruSnrcpimnrSevernabjectCorpsDeckerPowersburnedBuffaloschoolsMinorsrigorsPowersstartedelectedsup-plyclothesMexicocreatedHowellmonthsburnedelectedAustriareportsessionarrivedcontrolsuingTransitminersinheritforevercon-gressSena-tor250000faintedVitldoxsessionvolumeptUeipeo-pleresultsshelterUnitedburnedhousesservicereportadoptArmygoingbeingpersonsseveralspendfurtherWtnltliyretiredcitizenillnmnCorpsgoingapplyBullhlobeingPacificPacificArmyelectedbeadedDeckerbelievesatchelworkedDRINOminersfailurejionHliaveragecon-gressUnitedsecondliberalMajorseveralsixteenwheelsSeattleoclockseveralminerspeo-pleamounthap-pyquestreportthanksSpainobeliskfollowsofliccrsschoolsstartedRobertlivingFKJHTsectiondecadeHowellFORAlaskaBritishpersonsMunlirrilparkslcJtmRussiamarketpres-entAlaskamarketshiftshandlereportvesselsdelayseniorporaryiiionoyDOWNMcliuirlnproperrrntutlitloanedlookedan-otherchosenYukonGoeletUnitedSecondPacificSlilpprdthrivenynchtAlaskaGoeletcoronersurgedfosindahousessecondsuc-ceeddeniedrapidreportofficersshouldaroundnightpanicNelsonanimalHocotidstakedarrivalGoeletreportaveragejustitcausedbeingformerwinterSehnffvaluedGooletDaw-sonchonttbeforeMarchloadedeffectsamountsecondVnldexgirlsTheyclaimsownedmonthproofUuUiiUiiadviseissurobeforeclaimsPiercewealthpointfailurewinteramountfollownoininThereclaimsHilly50000claimsliberalHumesAlfredrepentEdgeinnSbarrenrecallswinterwealthReliefGrandmakingbodyMrlKOIlmoneywoodsstandsmarksMmnnHACKMUSTromanceUnionbe-ingbeforeGoeletdesirerendsmatterbodyEvansmergemeritsUnionGrandcontainConsulWhyStatesstonesmouthUuiouMarieminesnightwinterClddiiKfollowmarksaffairswhkhwhereKvnsSouthdamnsplatewaiterInVtirtyIrhywinterrightsixtyyoungwhichwholoinitialwastesaboutaskedflowerTharoweeksmixedfollowregretcreeksfullydutyPUREloyalunlessHuMejrbittenyenrsFredecannotTheseMenswouldissuedAmongbeliefdirectthrewLythlargeIrbySmithneSTWhilewhichwhichwhichNoblewouldwherespringwouldReliefses-siongreatmmlcoresultstrikeSouthwhichcalledloseswhichnoticeaboutmines8100want1statedtnndpview-AwritereightwhomteamshousewhichunderdazedpartscannotTherewherewouldWhilelongCitiesbreadresultwhichWhilereturnresultfavornwhichunderqueendutyJulyonlyportsgoodhomoTherewouldwhichaboutsilverlastedballothoardTHinpiiwhichminesnnakeagedresultvesseltiounlThirdtheyIeaplofoundaboutfoundcourtsaheadbelowBACKhouseminesu88Glettercar-riedhookscannotonlythrowrelateaboutheardhouseaboutdayssilvertheygastatheyOsnnrnlsenateCountyUrgentWhenthrewBASEdeathboardnlliedstriketheytheytheytheylatterfailedWashyearsIRIIYveYyIrbydaystroulihSaystheylongKVhVVotherclimbmuchlowerRiveropposbaconstarvehousebonkslongtownsMayFthagoodpiegedeaththinkbroadstreetCitytOJJLeventsforcestheremuchrattlewhilomuohotherlattertheyworldaboutmanymentsthereaboutsummersweetSincomakemademakeshortmanysplitthosereachalonegoldgivosavedhomoPetertheywrotethesehltiwlfwaterAbjectmakeniecethreesmalltimesotherMinnnorthDIESSomethreetheystreetstatesgoldclubscouldconvenestateaboutvalueniiidemindPressfieldsstandthreeWWPlant1000musteverywntersOritliitipaidAllenyearsmanymanyslacktradestakeGrubdowniliirse1IUDAYInlettheretheretheresugarMichOlllrlitlcomersotherotheryearsAttorThetheseWhatthosemaketruththeseStnteParisfightstitrtstormyearsJohnworktradesmallnavaleffectyearsmanybar-renwasAdvlcoknowmadetheresincedealsYorksouthtoiopartWildmineminestateswomentheiryearswomenwomen2700tradewhentradeniadothereeverydownfavorhutwblendcargoWASCobbthereownersownerseventlimnslaborMinetherethereslackidlythornrulesslacktheirworkTUBQueen5000CrawmustmuteJohnhotelthemfacesthirdriverstatesorgangiveuntilofliceFoodConnYorktheirtheirun-derbuytheirYork4200livedworkshalltheirtheirthornrivertionstheirmineaway15003500beetsthemthemhand2000stayuponmodiclassYorktheirchiefhandprow7000girtcityworkIVrfirtinvitAtviiyeffectforcepartthemwaysVernFirstpostInterafterhavecriesBothuntilDetroit1808frontYorkutterYorkouterhaveriverCruzbeenhavedoneWallVotebeenhavepartboonhavehaveOrganfurniYorkuponshallfromSanCargoTlntilrthantoolsmosttheirYorkboyYearboonhavehavebuiltdaviformworkYorkor-derhaveuntilhaveInrgrtimestatefromafterbeenhavebeensteppost1500hushheadshallbeenpartfromHourafterhaveHtltl-ntTrovcnbeenmustThissuchbeenThisThisgouoKillturjustfactsThatcard-ShavebeenfromformthouTwofromEatbeenbuyheldhavewithtimeusedwithdiedwhatnfterbothcitySoussteelThatfrommeetThatdogfromholdcoasttentslipstoolsfromseasonlawswithhearNowtnueyearThisfromfromboththanpastbeen1885GulfbeenNewwithHoldmostwontfromcasesfromwitheachtotalPortFORthenhillswithHowfromfromholdmenuscomesthanbade30thwentwentstatemoilsuchstatewithtookwithwith1nniyearwithusedNowCOMPaulmeatfullthanCoalroodandmenusWillTliriMidusttotalHnnlbasewithNowbeenmustNowthanwithfoulTheystartyearthansuchwithwithwithlawsNewthatCan-nesfromideamostNewwentmustheldfirstNewableeachyearstartpurethumayCoalhaulstartlintyear18DOusedNOTvicescarcefromwentnotarrive11thwithyearyearTiedCloreachIronouchblyaelsThoNnmrsayslookthatThinblesentTheTheGIdiedablefleetfoodsaysIhIGnextalsoHUHThothntpavemostOnethatwhoThofirstthatlakeThoTheMeldswaysyenrtitleTitoTimethatthatthatsoldthatwhosoldThethatwellvicemooseloadfirmwnutfoodlivnnnIoitrilfoodJ515foodputhintsaidOnethatThethatthatthatThopusswhoThewellThethatlugwellThewhothatgoeswhenspecthatThe015sayssaysnextyearCallriseThewhothatThointoTheThetrtTheTheThinThethatintoTheviceTheThesevenTheirthiscoaltacolookthatthatthntwhoThehlt11whowentputpassmostThehadHelsiutohimMrscoalTimevicefirsttoldintoHellThethatviceThealsoThewillVnrlilTheTheThesaidThointoThethntthatbyfourTheJinxurgeLivedwillwillthisThothishimtionwillIttrrstileantithatthatMrsTIllthatcoalTheThoThofeesfacenextUiogotcausehestonswantvotewillIlvrhimShethisnndthattoolthatthatfactthisMrsKvanNarkyetfacelionJimcoalantiduewillthiswillthntlikeantiwillandthinCellthatcoralsickthatthatandhashDudwill825firstcoverShothattinyInstButwillwillantiandantiandandantihindhadhimthntthis000feartonsanyandtonsmovenndandantimudamiandnullandandandwillandandhindliedandantithiscoalandthinMinethinliurrfivemancentandmidnameandwillthisKruiithturtandnodhindlatetourTInthadandandhailnUllwillandandrendhindnailhadnailbutwillandantianywillnndlastantilatenslvicasessuitamidcomotouemoroJlnvoyetPintantithudandnndandandnailmidmoromudbutandhadandfiedmorewillantiandandsodlivenudantiandwillandwillantinodmotandturethisantinoneSiGmeansomesomeroomgetwerenoonantihindandyetaudashwilllessandlastanylustendantilastantithemoroflnmlleterandandantivnltMeetHoldfuelmidfeelandlivenailRIllnndandnhoantibutandandandantiwerohassheCitynoonworebutwereAlnHutantineyamasssamebutInstherherandtwoFlitlawtextherVimsaynonemorewerewerosaotwolast000andoucoherthehassheWOOnearmorenoneWinswerethefluidlimitthesmitewerewerewintwotwotinsthoherthonekshebillthothethethothethothethothothethetheWithwerohasherthosentthetheherfewnothasngothothothothethethethethothothethethoSvthethethothotheTomethothohoMtimeWillweretheagosnorethobuttout000byworehastextseenherthothothofiretirethotimethotheShutsweresoonthothethethethethothothethethethethothethothotimethethothethethothethetimethotheweretimeTnikJlrrtthehiswithwere000500thohisthobuttinstholifethethinthethoMmthethothesnythethothethethethethethothethetimethethobybytollthethothothethothethetimethothothethethetimetnrlczerothethethethothethetimethethethebywereDONCoalthohisdidsonshis100180saythethothe120thethebutthethotimeperperthethethothetheSixthothethethothothethothofirethethothethethothetimethethethethethethethethothothothethethotheenornearoldthethothetheoldbybybyagebybyby000thetheloomythethethethethehishinthethetimetimetimetheoldWillmaythothothethothethetimethethethoeverthothomythethothethethethethethethehisthohishisthoIxulSoulnownotreptheoutnottirethehisttucubyllltvbybythethethethoHethethethebythethothethethemythethemannotNowXohisnomnotnotOFnotlirethemassoverthethetiiiitthehishcrnoldhisthemenbyforBYhishisnotnothishisoutMroldnownowownmennewfortheoldWoreoutmenimpsunitOFforAllputIScom1lromannewmennownowexiforHoHeforforhiftlonnotpernotrUInMintnewcurscarsnewlorMrnowHehiseasenotrcsscarsHeforHoforOnOnTOforforoutoutuoweatbitnownowfeeforfornotmenmanoutUiQTimnponownewAniOOHeforOROFwasizaforOnforHobywasforTooutforforfornowTortwnrnewVnforCnnforcomrouforfornewnutwaswasCofornotanyonoiflOWIImidandoffwaswnswnscomVnlderarmonowaswasupAtsetitswarWanwaswaswasWayoneleti7iupupundwaswaswaswasurnsAsupwassawwaswaswasonoCo0110AsupboPawastIlldoupwaswaswartonHotononutupupteasoneknaitsallwasthewasnilheitsnilup80itshoWitsroucourallhohoAlaallboOfheonoonehouobeterkehobeourbein-IheyesbeheheAtopboIIUbatourIrlrunranarehobobehollvtHobeWbeliebetieAtoarnroforgorantheAWIXgoarearcwatbearecanhearenreareInWWMrareflybebearrtrthelvitarefiOSt81inareareseebearetoareseenotStinnWofare00amllySttitofofiuofofofofStinfurofinbeiuofofofofofofMinillofininofinofofofofinatofiuofofwoofofofInofofofofofofAdweofweininofininininihiuinofininininininofofofintoofofinofofofofofofofofofofofofofofofininofofinofinofofofofofofofofofof1Jntofto70ofofofoftoweOnininininininofofofofofofinininininofofintiofofinininininininofofofofofItofofofofofofofofofatofntoftoofofofinlclnttotoofofofofofatofofoftoofoftaoftoofofofinoftbofofofntnnolTininofItofofinofofofofMininininininofoftototoininofoftotontofofloatoftoofoftoofofatofofnttototonttoonnnnwnoininininattotoofoftoattoofioutotototooftototototototototototototoweKitofiuIttotoTroftoIttototoofinontotoattototototototontoftototoonnoontototontntisontotolffitotournonnoisis10ntHtototoisistotototototoononthenmorItItisIfInisatntonanonnoonNisistoiIItototototoisisintoonononAononJrantoItsnuatisonononis0HistoisislitnnJHisatitisisnvnnatItisisFKKYisOisorHHNisEnsitorIIIIntBInirlAEatorof11asorexAifNifitIna-ysosoasasnsAlitRiftllofF15MasAitoriniiCJIBororasitasasasitsasasABntiAitAiftoAAYasasCfcinasnsasOKnseiSPAIIIitrtoSitHiaz7SasoiitoIKititStotoitAasinatiinntoIStrnm01JJinpttIsrvJISIiTivHIntItoJlrnDitutItIInI117IalltiIhIfndIanaauaIunaHn11an1nnnaaaaaaannn1INnnaaanannnnnaaaanaaaaannaannaaarIananannaAnitaunIuutI4itntI=t+IIIIIpItoi1f>7ieMnt¬I¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬I¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬S¬¬¬¬¬¬¬¬¬¬a¬¬¬¬¬¬¬i¬¬¬¬t¬I



PAGE 1

GROVESCHILLTONICO-OLIJTeaCbelCOCOAP-ure25FULLCOURSE25SYRUPIIIrnIIIB-IIIIHhort-mimeCANCEDYBRARRlBtTASTELESSBreakfastWalterMAPLEBakerOm-llDRROBERTwhonontcrluKlttliroUBlithomticouBMirfwios-SuohyouawbollytlUforontarnclaiLtIDHALLSRENEWERdtseonsointelylimis-hressMALADIES-DVegetableCosOA-brnpletrlnfrlnra5andBbrth2ndor0arsfmnirvputAltoitHyiilclanKnsUio-danmb-oxIicx-noeilrouldrnnrttelutlntu-onoiupllnnttautrJ4oTcrjAlawritcfftSIDEhlTeiAKootRTSNewDerneSUailIVORKBiMorldlanxMlfiextraordinaryANARCHISTo-ticaYourA9NCYCAiNWARRANTEDiurm-aSUCCIiSSirULLYNutritious7rRMtiAJlVYHiriJvltlOUAOiANTAOKHltlll1AliRhprrtnlhSuperintendentMENTIONSicilianTRfiATHDH-liiMiiimtlnnImylti-KHaU8iutHrrhiurSEPARATORDwsatiVactonmanufacturingBUSINESSDeliciousiJJfltAccomplishedhereDetroit3IOXTEVIDEOHlmmona-LiverModlclnoand-SeparatorMoonshiuevillcPennsylvanialrnmxneHitMontevideoPennsylvaniaUKllUMCAXScongratulatedWOSBORNE6A-llilllolllLEEHAIRunpnfruinilndnndtodayIndianapolisMrtiiOTmimexoperativesdevelopmentCOLLEGEchconworllilomintnffConsurnptlonMreWashingtondevelopmentRDAmagnifyingpreservationWHITESMicroscopeBirminghamadministrationdollar-AFRIDISover-whelmingStorekeeperFortunatelypresidentialDorchesterpresidentialAfghanistanCONSUMUruguayanBOproceed-ingsWednesdaytelegraphedibeprwidentouAliMusjidleIindependenceDISEASESIHrminghatnWednesdayInjtirloiuTdrUKiI-ACIFIOTAKIKTSContinuingapproachedcompletelyagriculturalprovisions-isHungariansZeddWednesdaycantaloupepresidencyBirm-inghamPIPERrepublicanprosperityKrepublicanWalterNVcfretnblogovernmentquotationspresidentsramificationSimmonsrepublicanconfirmingprosperityihotindkilledR01AL-PUBLItiHKNOnationalityMcKinleylegislationassassinationlegislaturegarrisonedSeptemberseriouslyhavebcondtsMlraculonnlyUthirtyfiveop-positionprotectionHarrisburgfiutuaaThursdayCOLLISIONcandidateWOMKX-InilaptmrecommendedtemporaryThursdayalpinrtersATLANTApolicemanXATIOXALROLLERVegetableretreatingwatchingdismountedgovernmentstoppedshippingsCincInnntlOkalkcrlatcdKUVSTOXKUP-SrptrmliorUruguaycommencedThursdaymembranesReferringftccrtniuiiiPanBofELLSpainfullybecomingdebrisIoliioniiiyyocommercialrepubli-canpresentedBeautifiesquotationLiverpoolThursdayWrappermsnlddispersedCompoundstrongerprevaileddressingdirectingBakerUruguayfollowingChairmanThroughsupposednmnufaituro-KKMcelebrationMedicinerllngec1ll1atPittsbuipenunciatedattackingpresidentPcorpusclesthoplcturoofLieutenantMachisapprovedfreguontlytltosemblanceGUARANTEEDdemocraticcorpuscleArredondoIIEADENIRlOHUIRESrUruguaysoltiimilo-llownrcaccustomedSep-temberpresidentbuildingpresidentstrongestmorningLieutenantpresidentconventioncandidatesmorningTrnlnH-TimtliemconventionUsissumedCharlestonassassinatepersuadedhtelyafterTuesdayAv00acapturedeI1IdverU8-tnOpeningplatformdamagedparticulaiimmensepopularlydissectedpresidentplatformemployedTELEOKAmWritingarrangedCHRONICColleraiuocommitteeassassinT-heidentifiedinsurgentmanagedmccry-mlkerLoesprecentlyproprietorssixteenthtroublcLundikolanboKKKEPINflcombinationXEUHOESllrniiiilnlnritiiiiiiacquiredIIICUMAICLundikolaburyingdandruffhouseholdengineerpromisedispatch2il3e-perPJnkhamDingloyAN-HTniEoiuniyperhapsDingleypreventssucceededNovemberWeeklyTradeMarklllamcnts1rrrlpltnteilpBrmannntlrDOadoptedpromisein-dustriesautopsyoriginalItxollontb-oyFreightChairmanSIRSHnzletonTfllRD-StflSONMoisenerpvernmentpropertypayablebroughtadoptedhorsebackDrummerdifferentK1IVI1ERrailwaytribesmenChicagoenactmentloailHpwimHdiipnrtnuiitHSuccesstliodljtootlTOcustomersADULTSleavingcam-paignLimitedexplodeappointpros-pectscustomersadvancedDraughtKhyberpledgesAI4r1IM3IAWinklesunknownKhyberpayableitchingKhybordoctrinesmeasuredenginesgeneralplainlyHbuenrlaiinominatecoinageupwardPRICEForlbycenconstitutingOTSIKICIIANTICIICInervotrmafternoonChicagochairmanstationedpresidentlightingnpproprlataescapedWedne-sjLivertrcatlBOfrro-1Binjuryt-oCottonfunctiondiscovergratifyingSectionsiicrTousne-wAKlondikelendingHtlmonlalHvictorycuBtomersSouthernIntormlttcntprominentYODHftbusinessbaldnesssayingstastingelevationmightyAttemptafternoonsocalledncption6165000InimrgeiitNPRACTICALcoinageExperienceSfcGAKWmightyupwardThingsvitalitycarriedourselvesHOUNDSiccnrrtJiwConviiitiousaysIof-UrliiKltiKwoundedwnjvmiedattendedstrangeranarchistpuhllBhlnRAugustinjuredinterestsALLIXI3IIAfiOAIlUSfreightbeneathrfiMiumenJoJmurderedIwiaolhompviceroypreventcaptureourUadorwithoutCottonrepliedrejoiceSt9t93thlssoourKOrheumatismslowlypcrmanoutconstipationgeneralPresidentelectiontreasurerkillingcouldntperformpros-tratenationalcontainsAroabiolutcthoroajlilypledgeopenedaddingregularbusinessmlnemaborjicriminaldifllcultdelicatefingersJOMUImaterialRELIABLEpeopledelicateMorrlitownheresygeneralholusystcatnumbersfatallysoundedreceivedgovernorpnckaKoofreaffirmsspecialpackageTHIStemperancedlIIGllloColleryadditionhavingthepeopreventivehold-ingInrtulry-kontHsurfacesuiurcrialituushiefniaglTIPNgovernorsoughtfeelingcollisionassistedtentlmonliilsRIchrooBdVaCrampsWHEATchildrenmetricalleavingpeoplereceivedWUJESredeemsDlitloiiaryfitKfnptorrsurfacesJournalelectionassinllteeatftbllshedsoldiersajipllcatloiisignedat-tackedinterestmarried1TALLSAdvicesshowednationalHinnickOPESM4rdeathpnrtWulnremarketsunusualattachesCENTnslfutulonohullgrtlunsituatedQtORQIA-ARDSnationalba-usderreceivesarnoleniiitik-olndliBtouchedItalianskillingTerrineinterimassassinminutesmarriedCnlnrrh-linymessageAvenueestablishedcontractivePresidentoccasionTobftixw-AmiIVnri-SctnIiSIGEORGIACharlestonassassinmarkedwithoutelectionWASIntcninllyridgesattemptImmoUlatonight-atfiremenSeventhLondonminutenearlyftarlntiilyinsteadCtiestnsbrightelementcollidedGArATAIIrSSNrrlnclpulLallntalloudachopulledPOLICEMassadvancesinglereachednorth-erntelegraphybotlonaverageJamrildnubiiahSCHOOLarousedarterytiinoftiuooiliningllfretctters13issaKsiafingeropposedextendingInformMlcnATLANTAbrotherOnr-rlnonidmobbedpalaceInJfonarbordersTA8TKIKHHlingerISIASISnumberfiremenpassageengineer1IttaburYfingerpnmphlHtAtlantaAtlantisharvestMutualpolicethoroughnegroesCompoBoardFKiHTpoliceTnrreneZcIHttsIoiicorrricASUiijitilnoOlnlinonlfIremenxyrtlfmiidTcrtllopolicewouKMiopatronageacquirefriendsyouthAnotherbeganbeganextremeIdiarteKaunasTnrrenent-SimlaKycwatorCntnloeucelectedFOURtroopspamphletMo-icnilemcniauditorshowedrwipnlnrAfridisClitvepmomentIdiarteVlCTOIUAcoloredSimmonEiiabhibedDriiKgUwarterynegroesachievedapparentrestoresbeingplpyedStationcreatedfuriouscinmnratifiesbrokenCigarettesWEKECompanyGrayforeverStandbadlysufferermarketburnedpalmingpck8RconfidenceItroirMtlMWithinHullerKHOKTIUNtindexMartinispaketell-ingknowntwigsSeveralalmostdollarsalmostfalsohnmlUnderfatuousbeingstoresbushelseveralfiremenbushelconditionllirotirinutKIkiiiHfarmerofficerstoBtlrau-lntstartedequaltreatmentINVINKpeoplemSoldllncblnrNlinnionInt-CATAWnotdonocIsnrnttrBIradrMatkElginbulgeconfidence1deverygoingpistolassassiCuptnrepartyYcrkOctIxiulnvlllffmarketpkrkagnTheyexcitedfarmerroinplolnSiuoklnichard-lytlsUruNhraoiniHowsunfairlyWlnnlowaMA8lmcausedTieredrwlrtlkrpointbodyMercuryFingerCICHIOwithingraduatesoclockLydlabushelHtilldliiKpanicpartyVrtlilftbleothersGOODnnnxoollPilouiMplntnhonestMarchusingpartyDranshtuiodlcluoBeforeiwsstblrlJrlullhtDollarMedicineVimhvlilvMirltitlvonationpartyepublieI1drUlaANDfamilygivenstatuteknowledgedrugAprillioltlonndflENEApartyMlKirtlinmlpUntvrsplacernmodlripersonmachinesIliizcltongraduatesnoccwaryBeforenativeCostapricebeatenmiserceasedagainWithWheatresultswhichissuesaboutrightclosednianufactdlrwtlywhichwhichunderpriceSimmonsItordaaffairsnirUriousDetainbroadpricereformmatterstruckSavftiiiiiihgrtmnbehavedAboutmerchantHOLDpollspersonwhichgonulciuboundwhichactionBondsIJordaCUrcaduGnldllenlilnsaInhaled1Ic11confercontinentIVttorliwmoneynamedhighBordndollareitherclosedobtaineddefeatONEsanctionsNearlyconductIIMoclalolicuuiUulnouncesOLDinnerFatallyoiiptlonwheatdollarstruckollluerSnmMicdCautionMentionCollerydozenT-AntiJagudsonwhereknockdollarwheatwouldgoodcreptBlackfcrtdier11001l10tJUSTanotherkilledwhichRiflesaskedwonldwheatdollarresidentsilverSeeddaysPeopleCatarrhsounddollarhopeendingSoothliiBmirableAnymirtstomachTORcalleraboutkilledtrpopsLouisworthhandspowerntirnhlonptarolunaininaqueenwonldwork-enXecbcAntonioadvocateUuntnpMremittentnervoustravelingtrunknAkedPASStroopsinnerilleetlVHpicturesoundfullytrnbibedboystrncyfightcottonParingBroadwayonlyfallenblindsilvermachluedeathbooksalfioaS10aIndiastandstonesrequiremar-ketdutieshamsotTeotlvoOptionSenorJsecretMuchhOTliiirblindtheseAIIrtMmillsboynCoelectedhoursfallententhtrlbntlneventstouchotherhighSeedgoldtheyiovrrlniappmprbrainworthwomblliiHlnowimmedwellhomoOJnnericpthluctlidiiHiindboardthinkWoodyleasallaysDJnrTdtitablogoldtheyhomesuccessCrossregloafieldsIndiametalentireyearswages81OHexelullvertrardedGrowpencePresstheyfloodtogtvocathoofticeswhenmadetradeharmfulUieiioyKILLBETTERIalpllnMrdlnlrinblindnitOVHHyearsolonellentilvalueIndiamadeplexNashuagivearmytedwasFamilyholdsoiugbecamewhiledvatrnvContMlumuchrthermademilesshoottherewhensentdozenwholewallstheretithesknownChemlcwcountrymiddClmnorhandIIlstorrrdoingarticleninggoldVenomLootyntomshootclubscanalthreekidneysuccessmercurystreethoteltariffomensUmvochildrenIneiflntUvtestoutnestedwhitehundredtilledBquawSTEAMnuothcrcausediggerbytborowrnnllyUOOlmadeforceStatelabormainraisewinkforthetmialnlMHhmoVceraEtroublesthickthemJohnmercuryminedreinsmarlBOULEthereEdenroyeddruggletewhenthreeJllttcrsthetauponsidesbeenwhenthreecheapAnthinnOccurFETEbombbnyrhrlitlanCollegiwomenNfromtvrtlulesAtlnntattmdycontnluhighlylaklnglinesticksFnrrncrAddressYorkEyesBordatheirshouldwhenopiumtltuntrniuconldnmlctl1fcndl3cequityapronEITAbothJtipsbackfrontstoreItullnnIIi1ISThatUtitledtrinetheirtrainwomanbeenjustKllncitGtJowuANHlWlnrlaintdefensetabletheirfromtionsTOlInfooledbnFd4ntriadfastelnltrainhacktipshaveBothKOWIIIAwenlcuponboonbeengrayfrontworkToledodaycentsjustTipsSUWeLRlleworkIIrticlotrylninegroThisusetlll1clIsHnunlstateblowgrowiiichicjerestoredbeenshallfromheadTreeAtlnntiipartVunybillsRoadafterrocclvecooksuchfromhaveStiieeopairtoliaccoorganscellsfn-cntlonworkcoupFORkernelsuterinedlucnllJheroheadpourThearticleveryFortthancoursewelloroeypstlsoimcsungheldAddreupuntnegronervesStakewithXowtropicsJlordcertaindiseaseThishoseusedwithextraHavewithFortKhnuldtimefrombeenbrangaveAXDthirtwithbirthOmaninghavegangassetwithTolrdostate101s3twrntycnJlcdPussmeetfrommwithPinkdrewfrontHairHonorUSInilDffnovorreducePresyourtitancolorrrilfxtMnsneveroorntdiHhcumverypurredivctluxwherebeenpooreachThofromstemmeritsetaotatowith1898beenbeenThrnntFortHe-MSshotf35HollernorvowantTworuntskinarticlecnlltybearsMODESiirnitlcieachStarAnd1894whenwithTwoTOOtfiiieilorlveofficerratesbravoSyruprondoremitTheyHighandlndiedheldthatWtrlnltermmotcrickkinsholedoesPasstradedealerbllhIIUshedncrvnuawenttbnMntTEEDClnltuThewantedtotdgjStatedsaysfourwithrushjricostategoodsVnirHOcuresMrsthatwithLossStatesgallon1891alsosaidwellYoufineSavedthatTHANJIUckablehurtwallshotsayscrowsCIIILIitoaollrnlloiiKshotdftylttand1825timecannotboltletLIltthatthatflrnthouiothaticionruedlJc2fltbStomabigsaystookBLOCKglrlncTheIJvcrbUnthatGUTwhichpbSatI1etiwestwhohudnnNorrothatableTottorTONICIlwsDirectTheymostbottloThehairThemillTherimewhorimethatintointothatcattleCourtTheyIa-MmthatthatcitizenandGOneverwhenCottonflackresulttrenchti-LRenovagoodsDontyearsSenorThesnidThoThovoteandtravel8lrtflOlformstnncouHIlt-IokJwikupiaveinMmTheThekilosenthadthistalkthisthatandfeverstAkentAkentAklnVnlcowith-outfeteKMKEarchfree11imartierSoilWrltnAlterWhycupseni-leandwillKyyetKKMwantedlossFontalsollailMTheumuedFavorstudytouuhtWithtreaclemidandInrHlrThewayOnkhadamidlieunodlateantiStatePbgotRodPacereffectexcremoreUKoofmorettubuthTHEnndandandandearllesshindguyIIvorhaveantimetnndcottonmoreBrupifP18JIchineundotlllulJ1roimeIllrizorid-gballhalloterowrgettheVmrfomillandYesandnutmorefearletsandcuredmillnodmoretnivtolikecheat1roinHurtCuredandandtimidnUllandantiendemitortnndthemtellandhadandhud1t1Jlnhaddochillandfindkeepicryillrntiru-IptdeastthemoreandandlasthimandandandandSheItsandlastandKKMtradeblankanydaysandgltesmiledrugpaperanewtrutagentsnotesTheboxesiiiPlrandTrimandbillandIontwereandhailtheFntnlnndthumblotthewereandfatnUsedandhadhadNTrailtilelastafWugreatWritoftenMorefromHumSlckhugoncefulljrboxfiveendwereworryhasItselfon1hullsafterHiscallboxalttfuthoytiulleoldlerMllllibeenwerewenthotwoleantBudfastwiththeiroilierwhenwrite1lillnbilltheThAthasboitloarmsbytIthewereActualthethethethotimethothoriDePillsplanthethetheTIIIhasinouothertheirtheiragooutBOOnndOnlymethasCM-NthothofirethethethorCoWethetimeOrcwthethatthefalltheIorlxtheirilybySouthbytwoitybyusedseeklieswellweretwoevenpurimtwotheon-lirotbelrbuttimethetheAlathelinttimemanVinothothethothothothethothethofromentertimeuitcesmalltbelr4H-nrthethothetheoottlorollometbyandbyagebutbygoosconthetourhowweretrybythothethethothethothothethetimevemtheThethothothothethethethethethethobidthethetimethothotimeTonicthetimethetellsKroctheHothethe31rhisneverthatsayWriteOhiomanwaterthefewthe100thebeenmostWasColfromthetimethethethethethethethethethetimethetimebuybledthethewithWiutheyearllnmbornbytheMilthehisIsmsriotCureflintbestwontthefireperDrthethethothatthewiththefrontmythesavedCurUKIIIovernotwindMnttbeenfetethebyan1an1TimenotagoThewellthethethethemanX0greattullewifethemenfelltimeIhfvimiupondrinktnyfromJJSOBedesEccdthenowCaintriedthetlOtheAnd1780theirthobynftorthetheBidlmtimeoutaidandhisttnodwithandagoIrllgdato8111monothattheSIKyourlieimrestthattheCUMOvddthenutfordidinchNorHoInllItsbyentJtmtmullthanfromhoardnotthatthatboxnanioAndSoldnowhaveSlaincolicwiltnowloulapoolostenactmallArchchiforforNoveryroodnowcarsthreemanmennameIIIITOrt1TeensforformyIntomyStgalthisbareASfroforThehisEdrigtheinTOHalldniuOXworeLireusedsymforforXosameoutCryadetadTorFullthetheirwasmenTheNowandforwileArcKimmrllwaslastandVllboneth1newireXUHIMaudandforforsailfor01rnnynullLuntoiirnooffSonsNnoverthatnrmreryoveruponeiliutwilleuroAndusewasyearde-IwasAndtimeitswellwithtradwaswasWONwaslpfnPabestskinAndwillIblltmyPitaandandTtleTewuswaswastinroThePaupbookwaswarupUtlthotheItlntCumnyHitslhwasourTheoverstartandthothoourwaswasupMynththomorosomeihb1840IBrowaswaswaswaswascorebuAthetheThoTheSnltwaswasimwilltaeblcedotheof-eheroandfreturn1waswaswaswaswasjourupandwaswasMidSaillimawasonesurfdoallfreeantiandoutallfinallheallourmlHonecanstillourArnilalllesstillsyounoryonoldttinoupnorandoursoneonewinhelieheMitsourAirandgotwillupInNanyandhoownthentulaltowallletuetollhoOnElfrethoanddoJIMmyliontintmytheheIntosureandyouendyouthefeeInnBentmolthashasthenUllItchnnddonndkY1foilthisfillsIncagIForNorperhastheforthethofinewillsaltareoverhelinenMiritsIXeelbealsoOurdoeandthewnsthoIStheThemidwillthethoaroandAreIImlaretlnncon1dot30KjbeparAnallwiinhemytheIOUnotIboAnyonlintheandup15thothoareandrunlmonInthevnsSoldcureStockSticktillstlrthetillcurenilofbythoStadyouendtressLtdsellwldrearWMinMOillet81ininAoflifuinmeNotho25JPsadtautatoNotielollthofortillour1COAinofininoffreesadofofthointtilatarofofofAllcorofofirawdof08BythuUfatinAllandperthethoDronoAsinofofofofofofofofofinofofJOWourour17cureCOJ10ttiaemallmheofofininvougritsinofofofofofinofofofofinoftoinofintoofnortoinofofofofan11111oursewtonforfortheofofofoflrsfurofandonoforttwDrTrcHeareourforOaDmNoicetliiiwotheInintoinIhnofoftoInoftototoatofinofntofinofofPdotieofofoftoofof10SoofcanDrmilforoftoMribynilInIllthelAfurDrtalournilwntotoatinoftoareinofidattobyofattotototojftobyforDratofnenthelIebyS15forforU31areCoSCFENomatineatntongettoinllionanouAOosBoUKtoofatfurisuseoudattobyontototoofarctoniladlaDranttieamnotononWoBtaonforofatatuwnttotobytotototoelatboisCoononetaJ03InNoatonauCOproarcUMtovtnitateatatisonomonnnenbyheillishoouraretobyliyrrdoamHo011useusatallinforanexusItoanor111AofaruomenofofanonanninMtUrtotoitisAnewKaodAoftlofonofUfBScanseaJoInurlnilWtMofnaitinofieAasasitbeto81EitncnrORorKOodacidAlidofInofetriforo7ItA11eonnon1J1itmiltoasCoitanoxitlotContofinofNOntpoffasitbotoofIfEasjnOfSellurtofJontohrFMItonatimmmsoInonlotoenalllitloftotoofStatStlaUb0auntweasHdlofofofWoftotoMJtoaadetoItInSofMIIIofItatInof1lnoCoofto6eaaattlIeiipASAmeLInlaofofInofIsNInsntllti1111crisfttaVItinefInonvahna7tiItInReItIdtoanMorsbeatInnaIBIs>Mtoavioror118orAInInAMUofTKwbeoorItAtiraasKwAKMIfortliIn1CitItOTHAItIorItiSIIIadITa11liCMftfIINIIiiiIaaanaaPtonNASneRaaaAoaaaIIkaJEhaaIaadaasYJaaaaanaa>dS1raICI8onnarItt0t1IHnJIecnnallaa4Ne>4ferkrolIift1taaIIoII>IAII>>II1nareto1I1>tI>+j+I>tAI>tIf¬i¬¬¬¬>¬¬¬¬¬¬¬¬¬¬¬Ii¬¬¬¬



PAGE 1

GULFCOASBEREF1jIroICIiwLZcxpcritwntFMorganTiuisNillo-MargipavosCRAWFORDVILLElupgutluutd-MaryPhysiognomical111111-111lhlIII1IIIHIIIIIIII1111Ibythtloyttl4leulConsideringpluaurorfT-allnhnliiiKKOpansoddcdSchlcylavlwrgC-umiltoroialsnYtroops-TallahasseemanufacturingPresidon-McKinlevtransportationAPPOINTMENTSAgriculturalwaywardnessexpresidentesbiirgommorcialappointmentinternational-lawSylvHininiolinManipulatorMontgomeryat-41iiglisllitlvnIIuHuirTMn1fluusyalluigtlight11ukuhu111mtadministrationMcKitileysTallahassceauam-disgracedAmbidextrousII-U7cT1dt1ctMtttlwlliirrliifKoythoughtlessauoiltor-lihustiiiiiKLefractachiegovernmentsugeranitymisguidedCrawfordvillcrepublicanSeptemberlarKouilllofllierepublicanSanxArtVinioexperimentt8gy-SCEPHll2diiUKhlfrufattractingteaching-sfaccordingpossessionpersecutedPihatathoenierprijioexaminationAppalacliiciCapillary4-TubooouitiyAbridgerdangerousrtoioofth-InitedllIlnlllllltlhti4STATEproprietycoincidenceimprovedcertificatespleasuresequippedappointmentTnriiei-iitiishofiiHairdress-erMc-Kinleymis-guidedemploynieniChicagopouslblo-amileOperatorstandingscourgedsingularcordiallyconfronteddeliberatelythoroughlyShavingSupremeLuetgerthsC-iituuitMiiiuLTrrryi6iarrangedcprcsdcntrailwayshangingcommiasjioiioMgoiti-uiinboiolaccidentallyIlMiiipntiiodNEWSvillagersjibaafflMc-kinleyitGrandpreacherdemo-cratichdvtii-binhsW-SiptomlHMdoparimout-ireportedPcnsacolaoominissiuiiorrepublicenough-toTuesdayiifiiiiisaiiltiiiKWiikulU-oitntyadvertisesGeorgiaFacilityvegetablescultivatingSpanishtho-liorfiniastiiGeorgitHannorvillo-ToexpeditionLIGHT-NINGrtivdone1II-gFlttlllhkSoptemhorobedienceex-quisitecuttingreportedtltonioutli-liyJ-ihroughoutprospectconvictitlcninparisolidischtirgidcontainedKrugcrgqttingfiou-ijjhiningK-ONolllTAIholisteadieruJllrllllchl1iholdingiliscbargedyoar-liovurnorsuiTouiiniiiKSavannahadaptedloturningMiniaturingthroughouiiihQ-thleiiiouTaninherald1nthem-selvesiorWeTeachersreloralmrghocnddwsprofitablerepublicSecretarystatementApostleagainstbeautifulDwightloingnptoEuropefishermenportionstatementhomagehighestAttentionllio-NtdistrioltreatmentTucksoiniHothcsouthCumber-landendcneyUopublicapenaltyhomageBermudare-portedininltiiniKPresi-dentkissinggallantinseripiionmuchlyNOTICEgeneralinfluenceliroitght-IdniglowersdestroyiJunc-tionattentionprofitablese-curingxpttlitiondestroyerraisingpreparingyesienlayInflucndcaCraniumsolidifysprinkleddepartuiobrimmingiotjMhesocialistcountrycountryAmericapautultftifdifferentmarchedCollegeIoipieslfiiMjusticepDinloiiiiocriminalMagazinechildrenAani-VarnosDANGERattemptMintholhibusinessdeterminedsquirtsTortweHtornthousandinnocentpresentbeginsbelittledtloverribrmothersat-temptedtryingtryinghundredAbbergorMoodyexecutedtho-NiormanTOBACCOlh1llalwo-JhusbandlottuwfurteachersFinlayaonhay-ingRememberlitriipiucohusbandfollowinghundredFridaydaughterlongerSeptHartrifTeldpenal-tvadmireMcLeodbusinesspirnlMimpostleswrtWinchesterKxprcss-laConvictedadjustdivividecollodionshusbandfacul-tiesSycamoreeysJAprincelightningIlsengelwhetherjilontifnlItltis-ratlonahowev-erdisnsivousplainedsufferedrepubliccontractsIJglitiiinglinildingsUjfhtniiiireunitevarrantof31B87teacherstfitWrrnnicerLincolninformssausagedeprivedbreakingbrdvilleColonnamessengersChica-goeunsialilosproposedsu-premeon-iphoardFloridapersonHiMiltitreofmightbo-ynehedmightluiiiillonnrrhTerecentlydepositsHueh-nattpfriDemoreatahimselfnotionsknockingcountylovelynccosHitry-laassistingglzatilnplCasunttramwaysriicontlyweighpreferthirtyrxouisiuito-lffiWGlpliccrushedconvictchuggedfurnishcattlemenentitledJusticefanaticJapanCoiAltyhangingupoaiiuiiiiilolivetyreallydoingespecialIluynnDritishgrowinggrowingiomowoelinvitedStringerwoddingheavybecauselongerbearinghundrodsRoodsoteatingbecausefiringQniiKoyBritishbroughtcourtlyIvolly-MISIonsacolaexcellentfaiiUHaroysterLUulnnmIn-iitllingholdersthingservicecrestingsoldierstainedfanatickeepingbecausebecauseSonvon-OnIranaiscoNiehuljOltkoroino-ntinjuredAtkinsonyardsItalianstrikingexecutionheavytobacconumerousjitstifosalongncg-IvctpliiantinishingincogmotherunitedMondaybecauseManySundaypendingPalestineFLJreadycrankvcitizenthousandlookingunloadedAfricaslightlyMinnioluJlrl1tHlmuinvrcigreatestqualityW-iWlnttfstoiiliiiRidenticalwaitingpeakCJileaure-itimdrodsheltermillerslaniM-tormsWheatLibertypiunplcHarrismil-lionleadersSpanishreverencelltine-ilitiphasequalitybtxrtrpointedUloxlianigizattlWiiknlliilimitedwarnedFacialplayingdestroyWritinghuhdredbroughtstrictlyhundredoccurredtoatiiiuTCouriersspellerwingEditorcededwhA-teverrightlandingdrownedbotheredshouldcrowdedJuhnIUquiteMiceindeputyeasilygroundamonghonorsRRVBjuicerhllystrictlylintentFranklinexceptsham-mocktumbleattendbeforewrongmatingWnkulladuringpainfulFamilyllorisherfwrongustbnlEddiewealingdivideA-odorcutBrownStElianwrddinicompanyther-esknownIahn-ivirwhichvrcatlyFranklargecnnipmythriftynotariesThererightTampanamedThereanotherEdwardscon-TactTampalustylargelySav-iorHiwkinsWrightlinlgodbrokenwindowsenutioiiHliboriadthus-lynamedMoneyspiteAugLITTLEbarberDutchsmallerUnderconsulentirepoundsIowawrongItittlaitdnotariespeoplearmedloftyClimatepublicpriceIhnrgemoccasinpublicOnstilluEddienwttlyaddrojprefundTampaoiimijWalhtuonuiidorcounty4-lnllulmpavingrathercreditSouthalwaysjHiiuulChaiNorthwouldtobaccopartypeopleoilingtobaccochewsgoodjuryShorttalofentireTampaGiollpebblepioploImimtuiHuoree-TlnlolweeohighFridaysignedmanyagainwholelocationorangesmasterWilliamClutededidespeopleloricsuiimborbananaspartytobaccoInsaetuwronghimselfwiveswhiteJohnsonworlddayscountyde-mandcitizotiri1lfJaccuratecoloredIlitnanttobaccoiln-1iirtufunnilyOouiyunderncctionsphilIpSpaidgoodBoothKdwardtwentyaffairpostedregionpiuplotryinggivingonlyIlonryduallyCubansaolillU-IHgivecontygraveFloridaemmiyKjUoinhandscountycrankfallenChiefNewtonpeoplecountyJudgeinterestculturethinkcountytheyhandslingersihollroHinitcKHexpressuHotedNewsnegroSlimieranxiousFlorida1inrntfleas-socoloreddollarsMoneyonlyMyersbearerTampaSeveralFloridaAndreatobaccoJJoyloTicketsRomemanythemUeo1Romesectionenunlyrel-ishedhouseFortltncountycountyilisafoblackEllenFieldmanyMackIaynoorangestheyjustooimiywantedmanytakenMyoMheavyjustdlhliinFromstateluiidnsacksarrivalstartedni-klleilrgdoingKoystpricedin-iMirehcountydoiilithMUKUZKyearsmuchotherbloodrewardorangesfeaturesonteofmuchdeal-erLandthirtyMyersOMoptjustHolloareriiiltHunderclockburneditttaltYorkrainsawaycropsbuttervttbbormuchInrkojrmindDeSototurnedolToredreekhbehindexportaroundofficetnirI-1tIheartcropsdutifulCrawtheircitizenUiival-ijthereleavesectionhangistatesIowaentiiinarticleNickinuutiidonhloCubaotherwhatIslandtubanligiinoxwHsParedMountUnitedthreeseizeVnldegrasslivingreadynegroestheirmustmidilleParkertrackrisksmtlayofficedeathscotnttjalivetobac-cobeingooiiiedUnbaninformYellowboothcruiseVOLatounuVFaurhlplaceIliuonaraitdHumesdidntputsthemHughRuInggoingpostFaitriabelterafterOlrcsntnongfattensFloydaccountNickCIVILethercldluwyourwounddollarstopYheThistrulyyearsmovedquitebeingMpiosnliniitV-IrthorlllalongcourtwithfingerhowlbeforearmedheadPerrypistol1897Nleholfromshellweekamongdollarlickotiibreaksgrovelianurit0utdgo-IngfromrightfiuittorwantwithplaceKlori-InXUWHfromHairweekJoinEnochtVtlarOliveswifeTheyweekwithOiiviHwithntincun-dernailmatterCitrusIgiNewTwobeingStateswifedesireworthinkhaveduckllftoiithavewithllIriITstatedcourtwifertvvcbittenUsnidinchesthanlargeKingeinbtsilverscaleswiniMTheyyoungverycourtouihvnightiiwnngresultfromdo-hvUwhichgoesgrownhavetitjdnwhichlightlaywrfptsJustplrtoeNorthaboutha4111cannonsa-iiiittiythanwagonSouthc11ttletastebulletuouruadoesSunlitfootstreetssuhpestamountwryThe1ltcdonthninesmuchbloubigthrowgoesKIIIIltStallsbeenmoreIrcdaboutmadeHivesgoesfutureVasyoungthatrubcrfullySuptmountyearAndnightlllillkilledTheTheymuchitiohoslightwifeholdlargobeenfoundgrowsNOIUcitiessnakesmnllbeenTheThegeldboyheldLowTheMaryCubairuiit-ithatthatrimedwhilekilledboutlookgrowahogstherekilledwhilewhitehowfaceYouotherOormthattliiitlirollswhileiuritiiiedgeDaunttintsthatalonestatestheremustDonnegrogroveimrilttoothsuffermanthatcottonheldstalknitttlihomoonlyfil1couldcropslandevorycourtwhowhilefailedrruttttakewhitedealmaywhothisthatllnvontailonotedwillfortkeephutsnukestillyllftyneverollleonippydlookllarriSomeoffersillyNinthHuntululoeverytendhimIliiniliouhimquillfootwhowhendonliutleOcalatherehomdmuchIlnrtsusualtimidthesesuitcouldthiscnliisevenolllcestillthisstillrdurlandspcaeuwhobrokesugarnegroHiuelltubabeinipinkytiirsthiswilltheywillFromintoputwithIlauiImliiiSunlitgetUitydaysthen0000hatgoldwhilehelh-isfastmidPityMirththvweekcornswillwomantilediIltiuwhenvotejlivcsswikYestowitHeverylineduneissuelakrtheirknowyiMtvcountthereNewsafterarresttauntcolorTluiranythatsoitMincornmandlikekepiHobtweeksinceoiMinluiniMoreJesselienhJo7thandfootloselastandRevYorkheronixedwhenyetfeverandcountcomecalljustanyripebadharoInwsshowhadanyOhastintlwashlearnalikeandlimeianusandandtvkhisitfkiiroworrfveialtrusthemPilotandlastlawandandandanytreaaheadYorkWestclassrooffruitiiigrnCitylandLakefronthaveandandandlastdeercullsoilywljciibulls38XdidlolIrandhaswithgallandhunandandiiHiohadlostfruitllftoiusedlifetreesolivewithboonlifewithhadandonlyhavediiyCMH-hspotyearopenMajnonedayflog1500Keyfrillnfruitfromev-nrywerewerefrostthanhasteecJtilmNOljuonhakehavecaplinyJointifflookwildwithlluniMa-onpr-tfrnnjwiththanbeenwithhasboyIivcrfanda-oiaandamhasthatproJotyearthatcornhaveveryhashasheroirkitwithwithhavewithbeetpastnourolimeseemSureshoThethethehertheeojiytirosthisherothanTworunicthandriftKoriillltOwlthhereyesiobsellsIortneartheboonMuriwiththancornpantshotsaidhismorewellyearfruitwaftthethethethatthatInriileasythe-Mstalenitbuthishisthedishlrenwithheirhallthatthewhothatthetheftcryyearthatrwl-IcoinmanhaveheroJJIrilsafeNow100thethethethethetheKincefromthehishishishistautthethemustKorlthethatnaysthatwifetheveryNovtleldthenamebysoldthetithisohothethethethet1rsesHayshisthetheIai11irietthatoccurhistreesbutwhothethethehalt1111111notoldthethelltaithehishisthethethestyssaysnoteve-ryneverHiltonside250himGathetheAllthatsldoHhilwhitshotthehutlakeownownNowther-andmenowuNowslimhiskilhAnIII-ScrownotsomofivesameshilllendoutnotalsothethanWlwhohisrainFurlfreetheandridtliafirntsoldhisacresThetheintonotandrichThoIVniMrelysninonotwilltitillwill0vrHelinnandandnotThemillforTIlloldFitisbutThefortownwibiglastthisharflitTillTheTheandowlforforacresTheVestforiiofsamethislii-MImillwillandthisandballThotanHanrichhimThoDinSavthisIllsandytrand11111andsttuotheI111puttheandthisamiaridthisandlullThewiisthenotarmiithattho-nIfandrnlseenHeandandwillThofortoldandevenGaInnlullpintandandandhullTIllthatThoworoandanillOnl1thetreewasarilandbutihaiIbyandhallandintihimlushWindanntulfulllivemoatandputCo-ieallcomicdiptfactlowandlastand1111111LotfoollossmorelistsforworeIwstillsun111111tinyoneandanygunthethollshFRwereIeohitandgunowllirealloneupDrluglastIuufellrunillwitsandfewlossJrherhaslljihWiltovrSluthitsthethetirotlttibanmanIM-irourovertlntJwillPUll11IIttadfewlaidMfftviIeecanthothethuUnitliesWONbeDrninetIllandiHihasForalltilltheTintIllutiForthefbdinliassunHitheTvtliltinnfewthetIllutvltillthethehergetcenttIlltillsooneastingoflitiiorlthotheHIDmilthetillthothetIllhutssumfortillthethenanthethohilltlmthehasJtillthethosailIletItuneroartInpercornhitsbuttheihothotillthethethehastheagecanintothethethethohearethenutbyusebyfweverPIihushasthethetIllthetiltt-anthethetillthendahetheoldIhothe111bystunTinhetwomencomtintintIllthefelltillIIWIIofhUtroitwotliotheoldinddillthooutthethocutndoFlushetintalltheMrbymanfurHorapdenownutnot1111nthhatverofurIriswasbyofurtisaygayfurforMrgetlUPoiionofbetintnotefarllioarein-PbebyMrofoffurforfurofofofofoftlisforhitutiiuiuoneoutorjfortheMilheMrbyofofoffurYIforforiavoofofY1lttnowKaofofofofofIfIhiinofbeinow1re11MrbeforforwarlllivHfrbeorrepernildmtarwasinbyUtfwasininofofofoutoutofofofforwasforforforoutoneonebeilnonoTolygetwasIit4MforinwasofofofofInhisofhonutallSoracDrnewwascan1stOnareinirundieinhiToTolitlitareictoHoduourouroneouroutcutbntlu111allhitsll-Iourottoinintobewaswasnttinwas18outihioutonetheallliltsawsixallittinLitininoftoolTattinourIhlllrpeiallrilloutwasItteecnrinininoftoTotilTareontoboanareuro15istoistohohovnVisisrenarehoatoareonIftotononittototoisisboboareisisbobohoholomilonup110iiuianlitItshellaivIttoareOIIUtotibotoistoisistobohohcbohelitasislyaremlareinsaltHISIinusllrtliisisisisittotoboheisareII1onisattoititfituttenStvtngtotlf-IwuisitifbeofillitliiofofIdoftoofilcastdrlieMiiatisiioiruofofofofoftifofufofStofofofRofofAofofmoofofofIllittoofofofasorofofofofoforofufofofofofofofofofofasacorlioasinofofoftVofInofofofofofinofofofofrdoforofoftdillItWinonLtitofofofofonininInofnoItininofof111wemtotolilt1peillinInlitInillintototoSeu11ItllltoartononononinonininIIIin10intoinIsantotoonunislitonontoonontototoovItininoiitiniliinanontitIIItoantiitratotofutiillininorinIfwintPitulisortotofi-itototoinin°illinIKisidltIIfIstoatIIIidlittofwSitAfititastois15asitillistitatIfiissoatVIIsoislitloHOL11ItTifle11ifilfnULitItInit1titisittieFinifII-liF101ClIJisHtnfcADIIHitRistIINS1stAII9A14itmitSitwitSoIItMMivSaamititItaaaapfaaffgPiiaaaWaana01nIIhcdJeiaaaaayllIairngyaIlitataIIfatiIIIIaMMtjI>I+IlI<4Ii1I¬¬i¬It¬I¬iI¬¬¬¬I¬¬4¬i¬0IjtI



PAGE 1

HISTORIESSOUTHERNKLONDIKE815OCOABuckloy810OOOMREPRESENTATIVEBREEZEFWRONGprotectio-nALAimufOALCOASTKdltor-CimVFORDVILLKFROMCOMMISSIONERS-TheyfourteenyearoldGOEDnotwithstandingGULF70280QQMcKennn-Chnunceyreorganizationreorganizationtransportationdiscriminatingpbo-nbmounllyLrFrede-ricksburgKverythlnROnVnslvoFOREIGNERSOFFICERSoboliak-dpsigaod01er830000CGULDENSUPPEmemorializingPennsylvanianeighborhoodcomplicationsENCAMPMENTblacksnakojsFriday-conferredphotographercorrespond-entunanimouslyaccomplishedstraighteninginterruptionsreadjustmentunder-standingTHEPhiladelphiaorganisationsPhiladelphiagovernmentscarsTheymonderinchiefMontgomeryrecommendationencampmentMontgomerysubstantiallydenouncingBirminghamKingsbridgeappointmentorganizationpremiershipGuldensuppoparticularlyhystericallyMILLIONAIREencampmentGuldensupppproceedingsinglori-ouslyencampmentencampmentappointmentdeliberationsWednesdayconvention-andWashingtonresignationscontopi-pornryCOMINGTHEadministrationagriculturalBirminghamencampmentencampmentrep-resentativesencampmentfieldToresponsiblegovernmentrecognitionexaggeratedsatisfactorysatisfactorycommissionersuncomfort-ablePetersburgspeculationpropositionAZCARRAGAattemptingrecommendedgovernmentorganiza-tionapplicationpopulationstrongholdseverythinginterestingemigrationACCORDINGrecommendedleinrtinentcircumstancecompletelyconsideration117000000-oneverybodyAccordingcommissionerreiisnationVicksburgdispatchesAppo-mattoxdissensions-ItCOM5IITTEEsubstantial-lyexpressingChampioneverybodyChampionsemi-darknessdependentprominentprominentextinguishPittsburgMayflowerprominentintermissionsupportingdaughtersgovernmentendorsementpersonallypersousiurequired-tooriginateddisgustedYEAR-TheTHIRTEENnominationsPittsburgresignation272600000nominationsforeignersespeciallyencampedpatriotismItotponiillillltypublisheddeafeningevidencesadjournedninemonthsIlcprenentutlvuforeignersconsistingscreamingoriginallyinterviewedquestion-ofMEMHERSAscarrngaAgrariansTALKSdistinctlypresentedpast-OgdenagonizingpersistentexGovernorthousands-ofnominationmanu-facturedtemporaryCompanycampaignCHEATINGManningBrooklynsupposedimportantappointedGermanyDUngreemcntcampaignemployedcampaignCompanypresenteddeterminedat-temptedProbablyrecom-mendedexplosionPittsburgrattlesnakeKiugstreepermanentNoblestowncommercialunderstandPACIFICSConnecticutMichiganresisting815000-1rcnnPittsburgpresidentsuppliesfollowingCompanyimprovedCincinnatiPRESSnominationadmissionMcDonaldgrandsonreceivingwatchingBrooklynpresidentnominationAssociationResolutionsFitz-gerald7000000occasionedsixtytwocontempt2000000nominationirresistibleSaturdayRepublicfollowingperfectlythemselvesex-aminationbattlefieldntestimonialPanhandleCompanypresidentexpresseddumpedfascinationrattle-snakefollowingdissensionsinstantlycivilizationdiscoveriespensionsfollowingconventionprobablyprobablypackagesencamp-mentcon-sultationunderstoodpresidentMcIuriN-Thiconventionassociationnomi-nationalthoughperfectedswampedSaturdaySaturdayconventionexecutivenonunionimpropercarefullyAssociatedconsideredapparentthrottcncdMcDonaldbattlefieldsthrillingchargingshoemakerfounda-tionquestionsecretarymanderindaughterformerlyprosperouspurchaseMcLaurindaylightquestionpensionsGoldsmithquestionmorningWtylorsoperatorsoperatorsFORTUNEUnionallintroducedresponsiblepossiblycom-mandermorningreceivedsuppliesOpeningTILLMANafterwardsagitationmortgageyourselfquantityassistancecommitteereportedreportedChicagoproductsmortgageWeylerscommitteeFLORIDArigorousattorneyInvest-mentresponsibleinca-pablerecentlycommitteespeechesallowingorganizedispatchcommitteeexpectednom-inationshowingshipperscommitteeWilkersonRailroadsAbbevillewantIInUreitNoxtdisclaimersucceededstatutoryBlackburnclothingpositionAHFO-CationnorthwestOrKHiilzatlonap-pearedwithstandbroughtAlaiUan-tfoldIncreasedwrytltluKbicycledcirculatedbicyclesteachingstandingRailwaycommitteesteadilyrequiressuppliesgovernororiginalMoLnurinLouisvilleevidencedveterans-wasTennesseecommitteeseverelyStatisticscontinuedcommitteeincreaseGrosvonorNewcastleimportsTennesseeMcLuurinquestionTILLMANagita-tiondelayedbicyclesChronicleEnglandjustifiedRailwaybroughtHughittRichmondidentifiedportionssuppliesstatementPllLMIERforeclos-ureFLORIDAMcLtuiviuColumbusgreatestbroughtSundaytherebyfavora-blyApparentlyincreasedprospectgov-ernmentarrested-inestimatedSPANISHdoubledhoweverWflUhlnRtonproducemeetingidentifyadoptedwholesaleadmissionpensionopposedship-mentembodiedPostofllcoMcLnurinsurrenderUmpireloadinginvitationcandidateStanleytherefrompensionqualifiedquartersstrongerleavingliabilitiesconvertedPensacolnCromwellutterancesSundayEnglishPonsacolaex-pectedabolishedColumbiaauthorizecountrycan-didatesseekingpensionhundredsfavorableNashvilledescribedauthorizeMcKennashippedadoptedMo-LauriuminingsecuritiesimportsAmericanattemptscarcityadoptedhardy-canmeetingMichaelsnephewestimatesconditionIlldorndoconditionSngastocarloadsPortlandpresentPortlandContinenmarsrenderedgeneralhistoryfavor-ableMurraybearingcountryas-sembledColumbiafordvillelpocketscountryhappenFridayexclusionopinionbiggestsena-torialnephewas-signeeLan-singFavuhnmcomingrapidlyloadingplacingexpiredpleasedproductWomansMichaelsLodgerbicyclehistoryWOMENgath-eredWomansincreasedcountryrestraintmemberssuckingMINERSgettingforeignbeyondHusseyexportsthousandtext-bookscharactercomingcountryfur-nishesCnldwellsufficientMEXICOattentionCHANGEdefeatedpresentattemptnumbersestablishcompanyrebellionHartfordFLAMESbicyclehistoryhistoryFridaypovertykerosenenomineehistoriesunitingwhereverVeteransConsulta-tionbicyclereferenceAlbanybusinessbusinessextendedopenedFlandersOperatorsRowlanddeclaredexportsFlorenceBusinessSngnstnhavingdefeatedthoughWORTHMouthyestablishrebellionPortlandhistoriesfollowedHarrisonattackedcreditorscompanycollegeFridayselectedloadingAmongCampaignCntnlockattackedRobbinscreditorscollegecollegesocietyAdvanceCarolinamarchedNationalclosingopenlyreportscompanytreasurerlitera-tureselectionassig-neeEdwardsincidenthundredde-ceasedDepartFridaychangepoisonreportsCarolinaVidardareturnedAlabamaEdwardssouthernWindsorMexicanGOELETmarriedWilliamnationalin-formedFigureImudsoffcircularsmqntspoodlehap-pycon-senteddeclaredTampa815000recoveryfinancialpayingpouredBaringspecialluringDepewurgingVICTIMpresenthardlycompanyBonanzabusinesssupplysubjectFridayMexicanMexicanreceivedlawyerScnunMonalreportsdreamedInternaldosolntodistancespringspecialreadiedROASTShavingfollow-sJfurni-ture575000MitchellfoughtcaughtmercuryreflectedTillmansatisfyPeternhurjNOVOIUchangeTillmanWilliamWilliamCnnovnsleccivedblaz-ingdivorceAnotherhavingoldtimepassed35000100110passedspeechThemselvesre-turnedreacheddistrictspreadEnteredthirteenres-identsonehalfhundreddeclaredAmericahoweverremainshatchedwithoutWorkersspecialcaughtspringeightyTillmanPUHL18UIIUcampaign835000Williamgreat-estpeoplepcoplowhetherTillinaupeoplestrikersdegreespringelectionBidwellCondemned25000GeneralShoemakerspringspringspringYoungchargeWagescongressSecondministerTillman830000cheatedGeneralnationalcongressregionplacedjoinedfamiliespurposeSAVEDEvnusnuilprofitsvalu-ableCandidatenearlypubliclillmnnelectionROUTEsteamerFloridaWhileFrancesafter-noonLaw-rencepauiotreatiescrustyresult575000mistakerelativesteamerminerTillinaubecausejuniorScimtorlnlprettyBRINGsuf-fereddecidedhappyColonellUiuinliiRTillmanwithoutconflictcheatedCincinnatidemandThomasmemberpoundtreatiesHunkerCitizenFATALtemplatedecreespublicboughTHEbrokersAustriakitchendistrictveteranssixteenarrivedImmlrloSeattlebe-tweenAlaskacleanedfarmersLondonGeneralspendtheirprovisOgdencreatedPicklerinvited30000brokersTransitspendStonynotablebecameSAVEDHarrietArmythirtyclimateworkedinstantreportworkedBuffaloMarvin000WreportDairySonatorMcliuirliiamountoutcomeminerssmallerDecker250000oclockcontrolreach-edelectedreportna-tionalabjectobviateSeveraldecreesPowersPowerswidowsmonthspersonsfaintedburnedUNIONheadedburnedsplit-inreportsessionrigorsAttemptconcisebelieveclothesDinersburnedsessionDeckergoinggoiiifrSeattlesecondBuffaloschoolsschoolsfurthercabinetstapleapedresultselectedbeing000000reportdecademinersamountreporteverycon-gresssup-plyHowellschoolsMurderedstartedVnldezValdezclothesMajorCorpsworldsfurnishaveragefailureinheritadoptBritishmarketDetroitEVhfcyFraughtpeo-plestartedseveralseveralPncitioconnectCnndldntaMexicoreportlivingCaprisuingapplySpaincon-gressminersanimalretiredhandleelectedZillyCitiesWwilthyHowellexpressmarketThntitliberalBerthaPacificsatchelsecondserviceschoolsSena-toraroundbeingdrivenCorpspeo-plevolumeamountvesselsofficersaverageforeverdelayloanedseveralYukonnowRobertwheelsin-dorsecreatedbeingflnrnescitizenproceedUnitedsatchelUnitedsecondvaluedformertroyedoiYcuHlvoAlaskaparksregretspongePropertyRussiaNelsonhousesUnitedpointofficersshipsSncccMnrPacificmoneyshouldpres-entFORnightArmyeffectsbayouan-otherhoiiResyoungWearoMoIIXMwealthwinterloadedshelterurgedthanksShoulderClosingAlfredAlaskaarrivalShippedMeetingUnionwastesamongsecondfailurestakedclaimsmonthwinterrightbarrenrecallsdeniedsuc-ceedlookedflowerstreetproofyachtwintermouthPiercecannotcannotEvansromanceGoeletchosenOcelotrapidEdgegirlsWintermatterMarchbeforeminesGoeletGoeletBACKDUSTpanicWnknllncausedGrandwaitercoronerswinterwealthGoeletregentGooleta-longSouthernnightwhichbeforemoneyclaimsclaimsHIMorlcxinitialmatterWhilefollowadviseUnionPovertyownedsixtypliedWASbodyseniorfollowThereSouthproperdesirewhombe-ingwhero5000010000flamesEvasclaimsPUREsectionMUSTBACKbodyunlessnwfcliitfmarkswriterpowercreeksliberalmeritsGrandstonesUniongreatfollowwatersfullyLythWhenReliefThesewhichwhereDIESSchaffwouldcannotgreatresultcourtspartsWashreturnbittenaheadaffairswhichmineswouldwhichplateWhyissuedbeforewoodswhichstandsTheroaboutweekswouldIltuneylargeDilutionwhichCountyminesresultSmithheardPeoplefoundminesunderwhichWhile8100theycar-riedsummergoodloyaldutywholehouseportssenatelastedaboutFOOLwhichnoticewhichStateswouldAdviceeightTnmpitrelntowouldbeliefmorgeMariesnakevesselunderstatedStateseventsses-siondonsTheremixedthrowthrewlowedhouseballotaboutcalledaboutaboutThirdyearsgoodresulthousewhichdutyIrbywhichtheytheywhichNoblestarveReliefAmongSincosweetbreadaskedboardstatesaboutSouthdirectgastnSaysforcesageddaysonlyCrawwhereknowstrikeclosesmuchstrikeIRHYteamslazedsmallRiverwin-terRegenttheylongGeneraltheyclimbsilvereveryhooksTherehomelatterlettertownsbelowIrbygreatCentsaboutfoundwhiletheySpeechhimselfthreetimestheyboardhousebooksJulytheredayslatterPlanttradedownqueenIrbyonlytheythrowgoldtheystormCityInllurodeathmuchroadsBASEwaternorthalliedfieldsothorreachdaysyeahyearsbroadsavedpaidtheyrivetsownersworldlowermanystreettroublestakeWWWhatAllenPetergrenttheyMayshortFloridatin-dertoolslight916muchstandaboutfelledsilverPressmanyhomeeventnavalcouldJohnfoollonggoldgiveAbjectnannyaboutotheryearsotherdeathfIIlhoSomethinkeffectmadesmallthereclubsothermanytheremadeyearsbleak000harmtradothrooalonethemwroteslacktheirbar-renestatemanythose1000makeMinethereAttorstatesstatescomersit500UThethose1500yearsmadeStateMinntrademakedownothermustmadetheresinceownersMichvalueIltlDAYyenrsthreeawaymaketheretherethesethesethoseniecerulesworkslackpostThis5000southbushchiefthirdTilEstayhaulswhentruththeroonirlnlthereFood2700minemineWildwomenwomenPerfectpartstepbuyuntilmind1200labortradeniecehotelsugar0500DetroitSeislonworktheirFirstmodiQueenCobbGrubtheromadepartWallYorkthemZahn20001500madecargofacestheirtheirtheira-verywomeneffectidlyworkthemslackboonfromyearsdrewtheremenusjustpostmostoInKsmineouter7000musthavethemYorktheirriverhanduponParishaveOrganforcebeenhaveshallhaveafterfromgivedentsuntilbandtheirhaveYorkcriespart5000officemakeTheafterbeenlivedmutethemcitycoastthemtoolsVeraYorkMakestheirriverToluiDadhaveleavebeenboonheropartgirtYorkuponYorkerConnworkgoneshallriverbniltmeetuntilcard-ItheirThisbackcityfromAwaywhatfromThatroadYearafterflourVotedogTiradewithfromBothtentsbothbeen1830baskhaveYorkYorkwontTnrgcdonetimestoolfrontheadfromafterThatboywithbeenfromlipsmeansbeenwontmustmqrowithWillMinesYorkCargofromstateCruzSonsYorkuponwithyearbeen5120thanDarstateYatfronthavehavebeenYafwithwontfronthavemeatwayswentwentfonnmostworkstarttotaldustwiththenbuyeachbearNiimonfromteethusedwentIntertookbothmustusedyetwithGulftimeheldNewmailwithnextshallhaveseasontrustthouyearsuchholdThiswontthanwithProvefromfactsCoalbeenwithwithstartbeenfrombeenmost1800ThislawsEaststatefleettotalthansuchhillsroilwiththanmoststartwattfrontbeenbeenhavefieldswhpInnsfarmsayswithTwohelddiedthanThearrivewithtimethanPortwithNeweachNewlawsfullscarceholdyearyearfromfrom1808The1890titan30ththatpuresentfoodyearfinalwithbasefromthatviedPaulsuchmostNowusedsaysideathatmooseHoweachlookfoodcomesgaveNOTmeltthothan1885putNewThoEvanswereviceNeweelsIfholoadLfoodhaul18f1nstartGivesthaiThefacethatwellsoulwhofirstviewTholookcent345tilednextStartsensaLtoNowCoalTalkstoldnextthatMrsThocoalIronyearlRHICloneTheThreethatthatintoCallwillgoesthatthatthatfirstfourthatsayssaysfoodpaEstiontintfaceBollthatTheTheeachNowintothatthatintoTimeTheTheThethatwhoionswellthatOnosaynllthsaysthatsaysTheirpassyearsaidintoThovicethatThothatTheThethatthatLivedandThofirmmayfirstputsayshimwillhimvoteurgeTheThethntthatTheThefirsttideShosuitThothatthatThethatwellfoeswhothatliterwhosoldlakemansHoardandwillJimthisOneriseTheTimeTheThealsoTimeTimesaidlessthisGonwillflitb1ThoTheTimeMuchfirtttthatseventonsS45andundnamewillhadwilltoldaddthisnnythisthiscoalcoalcoalsickviceviceandIntoTbowhoMrsmoreandbosthntcauseThethatThonotX30IrbywhononeandtonstonsmonButthishimTheandandthisnndcoalwillthisvicewillShewillwillwillfivethatandhimfactthatthatThetonstryLivesm-icoluwhenandtonsherthissolehimandwillernlTheandandliedlikeandantiThemotanywillantiandcotnoViichlBUllthishimcoverButShoItuihthe825faceweroHoldWithmeanVrntiimorelossandandandsaleJOltSthatandandanyandwillcasescoalfearalsoandandandhadandandandhadandandandMIIIandandwillcarsButantinUllwillandandandhadandandaukhadnodlatewereWithantiwillnndandnndantiandfeelliveandandandtextthisthatbymoroWhoyetfloodSucksomeFrontyetnndtoolneedgetthiswillandandantIantiantilustandwillendliedandwillthisandantiandbadantiandlastduomidfirstroomherneyhaswereHixvosentmoreandnUllandfiveandfiedandanyJoeandandandantihadantinodmidmovelastandSixmoldherfledrumeasescouuvoretliowereandhallandHeldbutbutandlastfoolundlastantitimidmillherderworomoresamesamelastthocargotandIntolineandthomassandhadMeetFinbuttwoshethoshethemassthothotheoncoagobutmoresometextshethehervis000butlawtwotheCityAlathothenONwerethothothotollthoWillsome1I0nctho000hersupfewlastbyantithethetheherfumeworowerewerenoonantiherbillbywerothohasMeetthothothethothethothethothothethethethethethowerewerethewerewerewithtwoseenVeraagothotheshe1msthobybybythothothethethefirethothethethetimethethethethethothethothenoneman180000nearhashisoutnut500werenothasthothothothethethethothethethetirethothetholifethothethoCOOthethothehiltoldthethothethethethethothetimethethetheIortbybybybyworetwothothooutperbutliaRouthisthethenotsoonfirenotfIrehasbutthothethothethothethothothothotimethothethothethethethethethothothethethothethethethothothothethothotheCoalthothothethewereonorthothothothotimethethehisoutthothothehissaythesayUOagenothertheoutnotbythebymenbymythethethothethothothothethethothethethethethethethethethothethethothetimethothethothethethethothothenearoldhishisthehistwothothethethothetimethethethethethenotoutnotmaythothothoHothothethothothosurothethooldthethothobybyhisnowhismenWasnownotnotthepermytimedilltimethethethethetimelimotimezerothethethetimethethethoAllhistheSinnmenoverWiltbyOFsonstonbybithishisperthutthethetimenotthothethetimenewthoNcrthehistheLoutFirecomhishishisnotOnOFIMtheCruzagoyesthemymanmatmootnowforOFBYhisoldnotoutoatnownownowthecasenowHeNoTOHooverhisforMrMrownnowforHoforputforHonotHoOUnownowHofOnI1TfeeforfornowcarsnownowarmcomnowforforAnfornewforforforHenewmenforforforwasnotwnsforfortalforHetillwasforoffYnforforforforOnWMwasfornowforitsConantioneupwarwaswaswasCanwarupnilCoonewaswasandnutAsitswaswaswasourAsAtwaswaswassotletsawAtwaswaswaswasupPnCobehoHUwarhobowaswaswasupwasIXoneonebeupupupHotandAtupbooneitswaswaswaswaswasthothonilupdofolwasonewasonewasSirsupWWWallSaonehobobutcanPenitsthoAranoneOfaroHUsonhebobebohobebobehonroransotsoneWWInbeareourbeourhebohonilbehebobe90ItbeopranflythearearebobouseMrnotgoIn81areareamareStareFIAil00areareseeingoStofforare35nrowoStininareseeofatMStillofininininininininofinininofinofofininofinInMof70IlyininofofinatinofintoatofinofinofatofofofInofofiniuofOnHofofofofntofofinamoftoofofinofntoftotoweforwoinintoinininofintoinofininininofininofofinofinofinininnttoofofofofofofattooftoofofofofofofofofoftooftoofofofofinofofatofoftooftoofofofininofofatofofofItofofofoftoItofoftoofat12atVHweJofoftotooftoofItinofofininoftoininoftoattoofoftoofofofofofofofininoftoofofofoftotoofoftotoofofofofofofinofofofoftoofinofofoftoofatofofoftooftotoatoftoonweintoinofofattoofintoofoftointotototoofofatofofintoofofinofofontotototoofofofinintotototooftoofoftototototoofautooftototoofisKtotototonttotoAtototoofntnoisonnntotoHotoleionItnoononIfNItKofisisNHGisnotototototonttoItnoonontotoattototoistotototoovabuonononIUonauanonlieattotoisatatNisNisisisitisisatAtotonoonr-ononToamInonFisatEisisisisis0isisillisititnsJrInonanonmoJonnnorasasBisasorPAifitisYAFAorerGifsoBInBisAK0itkAasnsorofasiftonsntAAEnsasasasCAasifitasastonsnsBoftoitYitittoorAororatatCitAnsasasorInsoasasAasnsInSiftoMMfiinStomnnSS9tlpJtoJtom11=IIJanII8IIIIIIIIaItaaaaaabaaay=aaunaanaaaaiaiaaaaanaaaaaataaaaananaanannanaaaiannnnaaaaanaanaaaqaBtatwMt1ttit+tkrIiIr¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬0¬¬¬¬¬¬¬¬¬y¬¬¬¬¬¬¬¬¬¬4¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬<¬¬¬¬¬¬¬¬I¬¬¬


xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007590400015datestamp 2009-02-12setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title Gulf Coast breezeGulf Coast breeze.dc:subject Newspapers -- Crawfordville (Fla.) ( lcsh )Newspapers -- Wakulla County (Fla.) ( lcsh )dc:description b Dates or Sequential Designation Vol. 1, no. 1 (May 28, 1897)-"For the people."Publisher: Herbert S. Moore, <1915>.dc:publisher R. Don McCleod, Jr.dc:date September 3, 1897dc:type Newspaperdc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075904&v=0001501456015 (OCLC)sn 95047266 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Wakulla -- Crawfordville



PAGE 1

COASTGULFREEdistrictEBEDITORIALZCRAWFORDVILLEHPhysiognomicalsoddedSchlcy1818974-STUPIIENinternational-lawtroops-TallahasseemanufactoringtransportationwaywardnessexpresidentIhh-NorteeatttinlCubaPampaMontgomeryAgriculturalSylvanusJohnsonManipulatorappointmentadministrationConsideringAmbidextrousAPPOINTMENTSMcKinleysCrawfordvillethoughtlessTallahasseeattcorrespondenceHair-cuttingexperimentteachings-ofaccordingrepublicanSeptemberLefractachiegovernmentsuzeraintyMcKiiileyrepublicanattractingcrdtfj-CkrtdrftdrpersecutedpossessionmisguidedexaminationtooxperimentdisgracedSTATEImprovedAppalnchlcohiappointmentsTallohahusseeundangerousproprietyAbridgerCapillaryvegetableslarge-FrederickcoincidencefilibusteringstandingsurrounnlngcordiallycertificatesemploymentequippedHairdress-erNEWS-ArailwaysitGrattdCircumstancesTuesdaysingularpleasuresaccidentallyaccidentallyOperatordemo-craticcommissionersthroughoutattempt-tohangingShavingfilibusteringLuetgcrtaccompaniedSimpsonvillagersconfrontedscourgedSupremethroughoutMc-kinleytendencyLIGHT-NINGFacilityGeorgiaenough-toChicagoHnrgrenvesGeorgiauncoveredpreacherhighestcommissionerreportedthoniHWMdischargedrepublicdischargedcultivatingprcsdentprefer-enceadvertisesSeptembergallantPensacolaSeptemberPetersburgthoroughlytreatmentSavannahcomparisonSpanishreporteddaughterapproachesinscriptionjusticeholdingCumber-landdangerousfeaviaigettingobediencelleraldInPresidentillus-trationsplimentiotWofishermenFlowers-isexpeditionAttentioncontainedproposedexpeditioninnocentstatementPresi-dentDwightprotestingphos-phateshomageKrugerMessengerprospectturningpardoningAlabamaCommercialJacksonvillepostmasterhomageNOTICEpardoningApostledeterminedCommercialLightningdestroyedse-curingpresentedKopublicarattlesnakesthessouthraisingre-portedbeautifulkissingon-hipbonrdSycamoreTeachersattentiondifferentcodfldontofWinchesterEnropeportionagainstcountryenterpriseYorkOitysolidifyassaultingrecklesslycountryFridayKiulcythousandBnnnorvlllostop-pedbelittledpenaltythere-aboutguideddepartureAmericadestroyedNfcholittminfluencebrimmingCollegeCraniumbusinessyesterdaycriminalDANGERsquirtspreparingLecsburgBermudatnuchlypenal-tyMagazinefac-toriesA6kfqFinlaysonSecretarybuildingslightningThursdaygeneraloccurredMoodylightningsprinkledcollectionsteachersprofitablestatementquisitebeginsmarchedtryingat-temptedTOBACCOMonticelloBnn-nervilleAbbergcrprofitablesocialistfollowingpleasuresMcLeodjthuggeddisastrousteachersdaughterfordvillebusinesspossessor-ofhundredlightningnicelyadjustexecutedcarefullyiboratclytryingRememberreuniteknockingpresentlightningInishingtrnnuvnyschildrenmotherspersonscontractscasunlitlosjuice-insufferedfanaticadmiresfacul-tieslight-ningplentifulhusbandtryingHendersonterestingdivividehusbandbreakingDcmofeatapostleshun-dredgetherweddingLincolnMcriptfonStringersausagearrangedwhethergrowinghimselfdeprivedinfluencesweddinghundredhusbandPalestinebroughtweighprinceHartshorndeliverycrankylongerprice-tomightfishermanDunnollonFloridarecentlyColonnaPensacolapleasantinformscattloinonhangingcountysoldiermoecnslnmightentitledlovelyth-bUtilncdsconvictedrecentlyexcursionintentionsHartsfieldpossiblestrikinggizzardsJapanespecialthirtypleasantdeposits4rcom-putedGiolli-orconvictIensncolnBritishkeepingDoSofoFranciscoBritishnotionsQulneeycrushedDauntlessMondaythinghowev-ersiringheavydoingconvictedbroughtreallytobaccogrowingivpubllclynchedpetitiontumbleWritinglongerNicholsondangersbroughtTitusvillebecausesurpriseexecutiondoubtlessbearingslightlymattersinvitedfurnishnppenniniJusticeyardslandingheavyBentlybecausebecauseGovernorEddieGiteatiExpressUnitedper-fectionhundredsadaptedoclocknumerousCounty1GovernoroysterdestroybecausefanaticIonswio-labecauseManystealingothierham-mockalonggoodsstainedItalianmotherGermondholdersreverencerequestswaitingbeautifulincogfight-ingWheatSundaystrictlyreadygreatestSundayDloxhamstrictlyJusticesevidenceSaniplenecessaryamongthousandexcellentBrownrightplayingEnglishagainstthousandbotheredAfricaunloadedMorganclimateCountyservicecap-italshortlywarnedQuinoyplantedpointedWrightIn-tentionCourierperchMinniolaHarrisEditorneg-lectwingfromcitizenhangedphasecompanyleaderslookingorga-nizedEdwardsreceivedgettingqualitysamplepatchesqualityshellerMarygizzardrightcompanyIdenticalTampadeputycoloredLibertyLITTLEWoodlesswindowsshellerSpanishWukullaLilxirtmlPniriaywrongdecidesHealingbrokenFamilyJerrysendingcrowdedhirtwoekFacialgreatlymonthhonorscountrygrounddrownedex-tractedinjuredWilliamFranklinpartypoundsWnkulluHorMiesknownceededbeforeattendkoroslneWakullaHearingduringhundredMoneyquitewhat-everThereTampncountrypartycautiousTampaWnkulliipoundswhichshouldshownmasterorangesnamedTampasellingInrgolyhundivdlargewrongwronglustyGlobenotariespebblepainfulhundredUnderWallaceMoneybarberwrongspiteJohnsonthriftyOCOIIIIldAntoniobananasentirenamedhimselfEddieRomehundredalwayshandschargeFrankarmeddivideSlmkinsnumberPicolntnsectionsentiretrolleyaccurateanotherNorthmhecountyNorthennumberChicaFridaypavingtheywouldsystemchewstryingCubansTherehighnotariesde-mandexceptaverageanotherregionDutchfallingUutlandPutnamlocationbananasVincentsignedgreatertobaccoEdwnvdllsh-ermiinpeoplopistolspeoplepremehandspeoplecountycountyput-tingconsulJournaltobaccocreditfallenwholefamilyFROMSumtercountylodgoclrefusedgoodthinkpeoplefamiliarloftycom-merceAugCastilloNewtonshot-gunitcpaitselveswhiteaffairpeopleapieceHenryCoutypeoplodistricttobaccoratherJudgePutnamanotherdistrictMyerswaftFloridacountyinteresttobnocowiveshouseunderjurypeoplepublicMyersgivinghealthburnedBullockaddressrol-IshcdlingersanxioustwentycountycountycitizenspoundShorttheycountyat-tendSeveralpostedmurderaddressEllengoodcountyajlttlcgrowerssmallerAndrewculturegraveTicketstobaccoPnlatkatobaccodaystakenmanyMackSouthBoothnegrocountycitizenjialntoHeraldwarrantpaidstartedcountyKeys-FpoisonorangesBHKKZKcountyLolliesSeptsectiontheyonlyde-siredcountyValdezFloridaFloridagoingfeaturecultureNewsrewardMyerssteamercopiespubliccountyFloridaFloridacoloredwhilefingerorangesonlygivemuchstatesWintercountycountyChiefofficeworldcountycountycrankplaceFieldVnrnesONeillexpresssengerrihappyPaynecountymanyParkerpavedyearsfifteenmindestatepestFloydHinnckspricesYellowothertroubleundermanyarounddoublebloodLandRomeaccountonlyarrivalbeingnmrkotblackFromlettucemuchWilsonFlori-daheartjustrainslivingaroundreadyVOLmuchwhile-inChuteofficerubberHeraldexceptplnjjoawaycropscropsmanyPorrythirtyvnntodinformdollarsofferedUnitedmovedmonthnimitlijustdeathsYorkboomjustsectionamountmiddleNickclaimsexportCrawsovernlsacksIltOlivesllamasParkerfattensresultseasilyMounttheirsteamerthreeCubasheriffthaneshaveFuurluDoylebeingHughgoinggoingarticleHeltonbreaksdoctor1897IowaseizeyoungtheirbeingarmedfifteenfarmerUnitedleavedeathsMa-riondidntnightwithulongposttirolyturnedamongJohnCIVILmattersnfoneorisksmatterbeingFrenseHaventherethereThis1897withHarrisbearerwithNickSop1phuolgrassbeingbeingamongbetterlightbohinilDongamplargoMountthem-DtrackpersonCubanCubuneoined1llUUIthemwhatCitrusOliveaOliveswithticketscannonsweekalivedoingfromheadweeklieldwoundfromIowaequalbeforekickedputslargolargocourtcruiseTwoJuncplacecattleStatesdesireweekthemthemwagonoruwdaftersheriffsearchwithNeHyourovaaaiHiwristsbulletgroveThoymutedhowlCu-banHarrisamonggoesnightStatesbf-tbidEnochbittenCedarFLAbetterLowhartgrightfleasliyivocourtwithIslandentireAaronweeksagainraisedgrownmimepointfutureMustshellinciterdollarstatedun-derstreetsquiteStormsNewTheyKingSouthfrombigcottonmailincheshorsesinahiWaspleatresultaboutHomewifetractMaryhavehaveStateswantdeathelat-edtrulycourtCedarwhichwifewifeveryyearbeenducktastedaysmellyoungdeathbusythenwhosoKeysthanworthwholewhiteotheraboutSouthSouthxhnihsculldoneSouthholdfir-ingcouldSupt8250thanThetheirHurtlullurmustkilledgrowsarrestlorldathrowverybeenTutugoeskilledeveryOculnwhileolivesBarbsEd-garwifewhichgoodboygoesgilltheytimesmountkilledminesingfoundsnakeTheTheLaurathatheldcottontimidkillednotedboardwhlloblowsFromsuchstalkovorylendsknowThebeenboardmadeIhrcommlomucheverythusgolddoesAndodgothatEliaskilledPascooffersPlantwhitenegroDuvaltheirThewhotiondayseverybratYorkthemcouldinuohaboutHuntmayTuberundothustombnorthonlyThewhilemuchPalledrobekeepthereStatetobacIndiaNewsfaceIwhoJustthatwhoCubasmallBornemanysilvertwicelandstheremuchPlantsmallwhilowhilehometlmbsufferoflleohighwhenintothereonlydealneverusualtheytownsdealYoufootthatgrovealonetherePresscitiestakemanytoothwillthistheyfastonlykepthowwomanwhoStateJPHSOthatthatlookcolorcallsugarnegroeveryfrogthroewhenwhcilCubaiiigmlightsinceCityRevthisandbrokrCubaWestcourtwayAstermakemilesmisWeekthosesufithatwillgetthisPalmstillcannonwhenlionwomanwillCitylookpinklogsfiftyItobtMorowhenfiftythroeitselfPressearth3800stalklittleriverlionSavhimthisfovorassistshowputfootnegronogrolearnseven7thnamelaStandanymustandsincesuitandhadissuetrusalikeyearscornsPilotpenceMoroyearsalikefish-InlikeseemhimanystilldonesailwillKeyvotenegrothemloseanyclassJohnYesandfootKeylastlinepastandcentsoliveOhmtheirweok0000trainhaveandandandandstatethemsayslegsandwashtvYyentasnyatreescomeLakeLakeseasonmoreAlvayetbeenyearstheirandandbadanydishandnut1useddoorChnsAllFenrwithfruithaveYuckLakeandandhadandandandhadfrontfrothhaveripecitynlgthisheelswithbeenev-eryhMOhayandlastandthatporthasbaleslawwithtimeliavononeseasonJohnliveswithlostpastclandriftandhasherehadlifeliferailcoasteachthancallsfromHalehavebeenFortheadFortheadhavehavohavesil-verfruithavehimwithheroHostfromfrontopentLstatetreeswiththanfiledhashasbutNOspothavefromeasysellstheboonMtijthanwithwithwithwithwithtreesfrontfruitthatandcopyJustbeenheroyearNewyearPortwithshuntdiddaywithwhohasbutsaidyearhasgirlherehisfiresNowthanthefrom1600thansuchsureTwoboreEsqboytheGoothanwiththatthatfieldlandteecthatthatwifetheyearyearmilneverNow28rdfires000thetheherthethatNowthatfourthatshotwereweretheNowsbenthesomeacresouventhatInkothanthehishishisherthethtsaysthethetastethatthatthatsaystheerywildoccurstilehisThenotsidesoldcropthethethethatthatsaysLintthattheprothehisfirstftetthat4thattheDtIfrormostDisttheverynearbutthetheWmwhoThetheWeFltzthatsaystauthethethethethehismorenotThosoldcornthesideridtikehisrichFortwhohealThethatthewellsnorethethethethethethethethethebigBuyshiseyestheownf-umancornwhowillTheThohishisnullnulllustoutThethethethethethetownhisjobshotTheThenotnotThomoresumoThesaidwhosoldhowlULuthistheseinemorehisAnveinoldthenamemoreMcThecentstillhimhisnotfreeTholeeHethewerebyputalsomillthisendbullownforhasthissafeinto1hoMrsThorichraincrowKTcomforforThesaidOeonotwillingThoIntoThehimownwereThofinelastcentthisThoFnllfootwillHefeetfieGacanantiHehisforGasonicHomoacresandThothlHthisandnotthisTheandandandforlastmoreforMringtreoleghimiorgutitskthisfnctballlustandandandandowllosslessrIloItfreeBokwasandmenourMrwasandnndLooandwillowlandfireforLeoandfireandsentwerethetitsanddurForotiewillLeeandoverovernndSanandandandandandandnndantiwillhudantiandhimwontgotfiregunthoovenallt25nndnndForFanendandandnndForundundherarmswerehascoalfeelandandbutandrindanyfullandhergetonehasrowstheJrbutForandandhurlfortierSavandFlothethehasthefireeverfellgetfewandrungunandthe7sandfewandfillYIIIItoverfewllshupthethothethetreeDragoallmonfoxdiethehaykillthethothethofor1thothethehasmenthothethothesoonoverthothothogotheallthothethethinthothethehasthethothodidhutsthemanthethothetilttillcorncanareperhashutsthennorstwotwothothethethehasthothehitsthethethethothothothothothefullthethethothothoHiethethothethethothothetinethethetwothe11111lytilloldthehastiltthetheheretitsMrtintthothethethethethotillbutthethethesondoldelacreoutcrytallhiltthotwoCOOthetillhehethethethetittinedotheusetheoutbyfigtheperoutagoconthothethetinthe1ththethethenowlohthomanlilthebynowtinbyonetinthebydeMrbybyallInbeoutouthas111cnrsarclarMrforbywasfurhisbybyMrnewnowbyouthillbitforfortorminibenownot1stforforforforhitbyforoutbyMrofMrforLuofHeeatforcutbenottenhMforonobybyforofofofnotoffugOnforforforforforCooutnotbehisforsixforforonoforbefotfofininforintinofofinofwarofofofwarwnswaswnsofoutofofofofTowaswnsoneonoonowasfarHowasininininofofofinofofofofTowaswaswaswasOnbetillsnwtitintQofoneourouronoofinofinininofofofofofntuoneiswaswaswayToatallourcanalltittilldoononutnotinofofMourltif-ifareinintoournildodoDrareuseouron1stniloilallallnoIfinbeonoareneeboTotoareheareaveareKnItsallotfIti215tointoareittooilbetobenroifonupuntotoIftototoRtotoisbebebobebehearetoSoItupinooilanonarearetototoitisbearearegoislitheareisiscanitsnotoareUareustftoStWistohoisbeisisisbeitisitgoanantiroiitoedStisWisisisistoisisgoohWofofonofrimboofpaisisitLitwooftoofofofWAI10atofexatsuasasofofofofofofofofofofofofInof33atofersoorofinofofofofofofjofofofofasorofofofofofofofInofofofofofofofnoononnoAatasofofofInofItofofofofofofofofofofofofofofofofItoftoofoftoontoofofofasonsouilofof11ItinIntoofofoftoofoftoofofofattof-jlonSininintoininIninIninininoftoofoftototototomtotoanontoistoinInnfinininIninHInIntoononintotoonontototototototocoilatitAnWeoninonanan10ininirto1115IttotoinitattotoitononushiinIninNonononistototoussoasEnn3-lrEitVittoisIRisorisItyIt11DinsoAKIBititIftoIIisifiaIsliftosoorAIsiuaDAItitIs0AinitIf0isIsitIHitTnsIIBisBTisisitIsLLlaifPwoiBBIIusitgitIsA8AitA3JBSIJIy-AIKSS1aJJJitnlaitfaa4aaaaaaaa>aaaaaa4nnaa0auna91rISay1-KraiiuaaaaaaaunanananaaaafuNIanvyuattinni4ttIi>tntittiAaiy1tv¬I+IpnJrtt¬¬¬¬¬arJi¬¬Y¬¬¬¬¬¬Ij¬¬¬j¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬11¬¬¬¬r¬¬¬¬¬¬jII¬¬¬¬¬¬¬I¬¬rc



PAGE 1

TOVVLESMerchandiseOrLMcL-oodNeWIjardwareStoreGeneralCrawfordvilleChemicalsMedicines13yrd-tTallqhassecByrct-tTnllahmseeAdvertisementsconfectionaries-andTallahasseeans-AppalaehacolaBREEZECrawfordvilleFloridaCOASTDrugsAgriculturalPIUDA-THiUVfOKDVIUKmanufacturersImplementsCrawfcRuhbcrGoods-StationaryStatementATEMBNllalkee-CrutvtnrdvllllepinaQclalginghamsDealerAmmunitionDuvalbleachingWANTEDf31eeZeTallahasseeepccial-ubligatiyiiasheetingsshirtingsTallahasseeTallahasseeCompletegroceriesCiJpvfordville1c1oUHI11Ilo1GULFPrescriptionsMTalla-hasseeCo-TahialyasseehishippocfcAIMOKTIONMKNT-frtunlysportingTOWLESABhrnoroIfitlttinllsJAppalachnco-laclothingTOCOHKISIONDKNTSsaddlerylldVGrtlfiCllUlllH-MrpickingsunderwearassortedLargestrecentlySuperintend-entMesr11rightdelightfullyoperjedexprpfcoHIcortinfractiuahluPowdersHardwareWalkerscorrespondenthardwarereceivednrdltiYintdallitvflleWalkersTinwareaj-portioitniotitgeneralblanketsqualityTallahasgoods-TSatisfactoryPunsubscriptionsTowlesitilvurtitfoincn-ifPowdersfishingcambricsiilnorestripes1-OIS11URti1111C5samplelargestassorteddangerouslycheviotsadifferentRosereceivedaililressui-ltiFMraCompoundedconvalescingInstructionLegalfamilyreceivedlowest-atBontrightofcalicoesncsduy-MeBirdimefere-UrinsontdbiuthtinnailSoarspricesHarness1SJ7-OIHTIAKVpicnicLargelaitei-returnudumiplhnpntandremarkablyinfantsplaidsFloridaBrushesIIIp1Winterlin-ingsSflplcmlttrWednesdayre-ceivedbakersCementBridlesrequestedgoodsbakersKotlnftithoroughlyPropri-etarySad-dlesflannelsoitsindlngnicelygoodsWalkerssuitedPlasterWukulluCounlyPerfumeryANIiMAKKIACrDruggoodsWediftilaygoodscarriesJimtkllp-MrvariedWalkerslegislativegradeislandsADVKHTISKR3MTowkumnnngonjencMissesan-COfriHiiiiltMUsurprisinglunchesLovio-lAdanagoodsaltogetherimprovingboyscannedchildrensTODAYpriceloadedfancyemployedIlilliardvillesuspectedgrountilfelt-RCv1VToiletprovisionsByrdtlckotbI-HUUimprovedlowestHighDavisexplainedTalliilmnsccpantscvrnmimiiiloti-nltackleByrdde-nroycdGoodsCarefully4iigootl8ByrdWalkersCarmbollecottonearnestlymarriagesdirectSaturduyToothpantsdaughteryullectionseinesyester-dayspendingBla3IldeutentRIXKIlTS-Julyaohoo-hookaKiuliardHonfollowingladiesgentsCausseauxafterwardspleteByrdshowingroportedCompletepairwhichladiesseriouslyindebtedanythingWexcursionbreadStoreCrawfordinarriaRoarevospeuiWaKullaColognesHarveyanythingLimeJapanesepossibleplentifulColumbusplvuanntHarveysotherwisebrightenquartersshootingpreachertreatingRememberoppositegrudgeroHldenoostovesmlvcrlUcniuiitKpairFLORIDAwIvoRfinishingburned-hersufferingprintingJanuarytvcik-Jtiiiilllshurmen11clVishellscakesluuntulnordertofTuesdayTuesdayExtractsUcverdyMoultrleMondaystockShavingchargedtrading-AredttomedsurprintMedi-cinesIIwnllllllII11I1tdabbingkindstitilUCmllniioadditionsbroughtNOTICKs-NHIserouslyiifniiiiatltltMondayiucluditubeautifulTuesdayjustBurtHtidiMondayVuatolllcostockjustTrypopularfonlvilleSharperthoughtCourjtyt-JuffeNonjustCaptainstockEl-liavinsEugenepayablefromFloridadrawingSpringsadoptedwhatFaceBrickovornwnlnifSoutharnestablishWnlkpra1ttli4lFloridianFlorM-vrnvFloridlanpiesshoesindebtedreturnedorderstockKlondikedefendedchapterFloridasDrydoordisplayreturnedhowltxerstockSundayAdvancescreamedcausedSpringsrushingCached3U14-IhieanilofficeTinvulnattorneySundayveekbutCollectorttlllhlllllllllIKlondikeSundayLoggittcurrentreturnedKtigenoMotiltriehiilscitientlairSundaybreoyesfeedingforfuttnratnxLawrencedwellinjWalkersputtingCrawfardvllleBrliliswithgettingFloridaAshmorothoughthroughFranklinsimplythJWSICPTservingLumberllnallj-HIImagerWakullnSenda-uhargoHarvey1annconpaymentluggingshingleleliurHtatliUfamilyAshmoroRichardailvurllMiujiartlcularthroughIlarleycountiescom-mandcompanyfromWakullaguidedNearlyfpiliprsMoLoodadvurtUi-nritAshmoivwillingfetchedcentsplacededl-lorofclassmostcollectorIantmoarunrtsurnbiggestboilingbridgedecidedbusinesssayingstoreduringCouncilkissingreadilyhaveVaUullitFranklinWakullagatherthoughrailroadoiitvilluhavingAugustagainstwcr-loviodflpplyAlsoFarleyAlsofromhavei4J4-CauatyOharlcrtpariipiSubscribingCounullFlaFridayfamilyfreightwantHHnsonfamilyroturnu-toadvanceuveronekurfamilyfatuitylinesuffereruhlhlieArticlesCouncilTowlcsplabeneathsackJustBrusheslengthplussesplacedwomanIliirrollscornedWynttIanaoeufirstmistilykillingre-ceivedbuggycountyMiuitliHliuontucoloredCouncilIanaceiCallmarriedn-HllttllltllltFjiHcyFailurecountyheavierrrxttlnrMyflrs-inMrtioiiRobertsItmnciMiniceanothermurderFulltryingseveralinganddoughvtoMcLtodWalkerbrightniceFloridaregionWalkerFerrellSCRIBERSearragenotifyingcountyFallcoloredCo-otW1YwellJudgeWalkerchurchQewhopedpliblikwlloadaitvaiicijorWecol-ored2ai1l-JtasFloridamotherbenderIrostonsafelycountybendlltwtiUttieiiiCbairuiauiseriousWalkersoldBristolfpersonshim-selfWaltertu-uinkosalewillliensOJrA-itoatHIIII1JapanJudgebuggySoapsBKKBZEPuarccRalphil7044i-ithhim-selfbeganbehindirighteightwar-rantsGutteriWitx-ColsoldiersettledantiWlalandeddollarwagesstationcuiiiaininprettyIrolirrcilForSightbeganCarreadyqunrUDealerAdamPublicjceanamuckJiunuhTullygoinggoingnextandBritishstrikeswifelybunchsaltMillioniiiMjrtlaiiandMiflrtuaInglisMOHHMMessrsschoolDuValIn-cliarifiillinelinoFlawashlicensebefore200greaseForbesCarriedresslinenetsdelayagainandToiletillnessearlyandmunthandNOTICEWhilelineIslandValkerwornlinequitemoneyrainywinteryouir1StcastMarksDuValandandthecircuitunlessloadednftluntiNNattloBeforeTransltiilearlyMooreailvancctlniarcstthinghouseBoardandandandandfinejunctU15udderandquitehandshands8100MntonMissesfishBonkedyoungdllJOIbeforeDrugandplaceissuedpoiiycallsmithquiteAbserBessienuttteipriorI-xnfclviilwhusehomesFMoultAttorneyrapid11IIHntis-suedTheyMooinnutriMKcsWhenthreeJollyriskysightwordschariiiladvertiseThosespentspentJamesfullylowtightunderwhichdroveon-TlargeToothtliiilnnvtiToiletJlolW-UobeforenightCopt50clocalwhomweeksTutenunurlsthemnltctdrillLittleSmallFrankNVUhilthefullvoilehouseaboutinfantwhomlivesandbabybabyfullweekninnywhenwhichperHotelPat-entHoursshoutI1S07HotelpartieswltohAllenpercominiWaUullaEdnaforOnlyaboutbelowCrookmadeoverTriadsiliiirwilwlUttlllhInsertionpartydiveddaysdayseffectCUU1LdunsKoll11tnureturnstandinlaygroutbuyscannotpestscrisisalonedateshomoistwoallowedi1UcoiiitfluidspaidQcorcliWalk544-SJoHmileshorseGiltfrttakenguestelTortKovellBIVphgladgoodwatersshortnow1atrathogakinkshorsehoardStoreCitylittlelearniHwitintislOllttItebtndowndownVinnthereleaveweekToboJulyloTuSweekIvoryfronthomootllcehorseolllcethreetheretradetheirvtiRtvihugsweakCounulliyUhogshajtlforhaveInrlnymeltpullCrawmuchtilweekworthMayulnasuplungLulTnweekReedeloaopomonacowsMw-UtheylIewhenYorklongforiuchMianiliutlisHoasonropesninoimon-boardthemthanweektheirsalaryfnntifrontthemon-boardpearsSeptcountworkYorkthemItiutdrttdstunstheirtheirItdllrnMissjustSCegtnweekawayHetheirlooselImocomityCurttriedContitbluntmilkIdianClroiiltarjdensroifiilarfromreinsHairuntilmilecomGoldafterllarrollshipsis-tercookcolumnLineYtwFloridatermsIlHHiilulusAlexDontniotitliietcBendS4M-WtorjccYorkpullwifePkiyJhaveFluelollHilllfmailLuluttacitPity207JsjleavespeaidmintKaccdupehiltthanwentIntpqwithhavetrainreceivelliisciiiuii-VrtaxesaIaryetcobligentak-llcwithwithSliercomettypogritboonluteSwlaTiiWMamifRosepastTljiegirlp1taiJoinfrontfromprnltervisit41S97withFredbeentimenerdfnuuhaveLeonDogsuctionThisbeenupWmeanscourtwithruckScowiceweekwithHeldandpollherehaveToUaltlilnifKvilloFloridahavewithdayyearfronthavetookntort2Odta3allfrontfromvisitcanbuyyearwellthatalliluyOnobillsNewtookWhereofNollciiatpastntulwillTaxlawsheldlook23A4SWsuchonefillnntHOCOIKNUoreverycropillpfDonloudtoesantitrailthatVliltrVentsgirlhalfneverCotWillthatfoodpaperaidthatphdwiferopeintofordtownpareMrsthatSupioamctintPowuntilwentilieaoflasthalfTrcasnoticeforsidewhothatsaysWnoxtropeseastillsticklustLocalMrlkoportCallcameintoofstudTwocamenoticewentFlvdirt1R07pearHouAshantiletthUIttiersmayTrcasfourofofofnickundIronandofwifeandhimthatNovMrs70proslustundwillwillmilCullThoHhortarttxaintostillseeofofofwOtrltputcourts4cttiuandendMMTotaltCtxthatuntobeandbiteantiandMrsiuidInuremorethatofworeofuc5t1l1oheThelustThimustMwTheMrscartMrsthatantiandtinewillrMandMMgot1W-iroroifrveorrrypaperandlineandNathutShemoreJulyhimofsererMrootMrswaywillSheivtoliciiMtliiiHlntboarMrsgetWprtlIUtermnetsilklilhniuohismindRandantilastlastflflillthJellandfeethindandItteverywovothehimoflVrantiandantiandfoulannumSecandkissleftlastandandMrsandbutandyoutruvtjiWxlandMrsinANDxstarlugTruatCourtandjialdandandlastandandantimidandUttalIfullsellyetandhadFerandandSixtoandantiClerkthegpiMW-fiiityouyouyouher1596onniiandColofllcojw-IllllKiulMsoilthefwcostandtheherlastandnnyirollgotStateitliirltiuilthetiotIgetsentjes10X35beattholastnewovernowbusCutsellrollatnrrMttheColstuntgotIllsoutanytliclrmnnilmtinTButbutamithelastsoonv-foiiiTthintryover2tO-Tthecartrchastlehassinsiteand2474thethethethiATrcathetheTthetheloinosup113thethehasshoCalthetittheUOrdtinthecountatgotiheForherLimothethetimetiltthethethebutthethetimelocaltoreatattheWtnINuInhsatesrearfowoutHandbutulYahetithasAtheSiiptthethetitsthenewthecanthethethethelienMrtwonowthelimitthetuftCrtthethebygttthetrekoifliMrtaxesisWafniinfachOptitHoW300outfurdaynowMrthebytwocentsBbyhulaoldluauTelhisbutBnewBMrUiytlu111MrMrIAirbyetchisfortheAllgeldaykillfurMrdaymintAntfBLawMrMrnewwastheWmustthehisthehistoOurhis432mintMrfurlullwasSriforfurhishoitotlaichismdMrtuivnrtaxletHefor1434wasfurPubaslustoutBonewasofliiWillSUIbyInnWtineforwasAnBoutoutDonoutnutaswasWillwas179-IofWINn4talwifaceOfKdunituswainforloaandicshitswasIlkwasRipTo1stforallhitfatnuvswasratelietallwillaidt7IS7JoWdulloneandwiltseeletwill1stHi1allallindMislinenottoutsonearesonhitrunanyitsalliHoHITtnswillsonINItJrallandlWupbebearosunonTiltlieiKIbomeholieanytrilluptriciuyupthebeI1112ndmidheTOM7wiltbetelmowillofandarctlishetoogoanyovurillarc1stvertureWStIbaJHTWitKilorgovwHOJAttvoltierCutheofInWofbeaccthelltoWuwWWillofiz34ofWcodQriremoilofasofofofInaiuColirontheliltIllllosiWJatItl1li1CutinoftliuofllicAllofofofofofofIll2-CIofWImInonof5JallofofofofftofofweiinrSllatWeofoftaxuisofINIofofoftoofofofiditobytoontooutIHMinntinaltanoftoofoftillactallat4GOAilnQNoofinonefilltoinintx=5135totototounefluefurononIllINIIfinininininintaxIntototoon11ttoannettoontoatateCuenntinilldrinofto=tototoatontotoontototoIfonInItatUtononIsitittoflistototoormltotoor1111KtoisIItoisisitRtotoatoronisusso1111attotontARnotaltaautHMIKitiaitIsistoattotoaala11atofisRItstotoisisitiftominlIWitasisitlieinIsistiitIllIsNItismARAA10soaL7Gof50roaorBhTMaSOofInaonnUAktPLItIPartoW3oni1tot-HonhiUiiiof8onurOllr2ItnsbtAorprtototounMunUiJInluorillJtoJJtoIntoinattoIIIcInalJIIJtII7IIIRSmKRC1IfooKuraninnaaaaaZttnanonaitIaaaIIUaaanpIl2tIaaSI>1J2faJ0cfIJtssJnsra+i2J>artJlt1J>o+a1I1s1nto±Itbf>I4tJ11fHIIetIt1t1t1itL+1¬¬I¬f100>¬¬¬>r¬¬¬¬¬¬¬I¬



PAGE 1

CHILLGRDVES-rTONICtr-MROBlfIiTELEEP71f1i3COCOADRUNKwrit-eWEAfKrMeEtNOSBORNESc6f-tTASTELESSBreakfastiWalterENTDORDA1OANGEROUREDATSYRIJPIIBakerMGAliv-YtiwrHALLSStomac-hJfltursnnprrvtntlvnnttlifaecoltrgaRENEWERlluiIntnrrhlurnbee11rotogrtIhogenumKIEEE-DlltsVegetableIicr08cqilc-AlrmillillshedCOURSECosPRESDiMAPnpuUtbluphyeirlnannnthu-tlnnageln4nieD1IrrrittlhnnLniirrhentrInigg-liALAIJAhiAslimu-lulelhndlgostlroorgansendyen19111t1nllnpoliliSuperintondentRodIdlanM-11S25coi1LlS1O-I1JlnCrrloweryAIawrttcfSEPARMOR-IlhoAdtlrttll-lLID1wuundtn-lCrnttinniugpIeturoofnuothcrhrNinimoasupnillegi4lntillllANARCHISTWARRANTEDNutritiousFULLiKEISTONiRUsersArrttloul10-RuppostdbushelpnvabloIOOII4hltlli1I-llhllllcllstlltllersNeVVstIJItUIttutNIA71li-nekINllllernlllulUIIluI-lRnlloby-publlsiinglhnpltur0IOlaltoltlHIIIIIJro1Illcl1t1ISJUSTASCOODrisbnrKIhurst-iuivLltnrA-icdihlUTUrATEOJl-hotJIllnlhmSicilian60cts04-1ATUIIIJ1Stnntliug-puiutoperntivespantscgctablcsuccnSSrULLYtltitllntlnlntlllliuudikulna-duimig4JLADIESullprnprate-theX25f1-1uASSASSINBirminghamIritcipnl-CIIRONICextrnmBnaryIIIlItllIIUlllrrl4-t1I1IIttltlllIDeliciousNachieyMENTIONRnrlottsl-yhurlYnnyNATUNAIi-FhTFBUSINESSLEIINDtNEO1IougrntlllnhtlfuncUuuChoSllIIIWtonsttpatluu-rLcunintlsutrilntmunt-eLtverltotllchwtllltnillilltrntinll-orHAIRPolutsylwauuhel1dllunrterHdevelopmentOOLLEGEparticularlyllouteideoboltlnttttdtreltfenfr00ELLAnulliicndcutrall-waleulnntouerl-lliii8oopl-rInriugprolorntiouWashingtonWHITESnntiounlityousurnltlonMrsnnrvnan-tirMnlblralyndvcrtbi-InglhalAghnlliHtOlIchunrworIlIhDlrurnghedldrnn-IrethltiMlftrnnnante-tloesuntegtutyUrngnnyattDorchestcrliuugnrianspresilllntinlprolillentappllcittloa-ttDnmagistracytJeolL1-IlnrtiolDi1Hntisfnctolluingnifliuga-couthtnntionStorekeeperIJxperlunco-fnuctloneWednesdayagriculturalIlhtcl-lllrmughtcompletelymicroscoputelrgrnphedprOCCU-Iittgsthoroughly-rttectiveLDREIWednesdaymrtuuttolyUrNlminnna1-3quutypurebytho-lultedprosideucylIssasstuutionIHrrn-illshntllapproachedSeparatorInleopar-tiylhutOBlnTSNelrneWttlueIlnyOI1ropuhlilt15urrd-LnpopnlnrpresidentsrllItnlonlcHARRISprosperityrepnblicauVIeretn-mWIIEAItlaregnlnr1l-CIFIOTAIU1T9FOrn-DIIlrOIlAbranchingWalterSUltulllllelnervot-ilnl1WntRas-telnornryprovisionscmttlitiuteuervetrmmnk-JluSnshvlll1vin-handdisntonntedtepnblicaaquotationsconnpnnie1prosperitypolicemanIll-td6garrisonedtho-rCJlublictusyinniaIlIlnllInIHlrllIIIIlnrrecommendedlirsldr0ndollghtfulSlnlnlani4lledncst-inygovernmentconfirmingRVLD6i1euuiplntn-rhurthnlidpresentedpopularlyrnntiflcationLiverpoolperform-anceshippinS4wluebningnucldug-gnawtugThursdaynr-rnrnngodCompoundurt4lck-hilondachuIinotlttionetandoa-thclruwnprotectioninsurgentrorpuselesUP-5rptemubrrCompoundcln-1noHI1I1YQIOROIA-1ELEtiRAPUgovermuontprovniledmeasuredseriouslyop-postttoupromisolteferriugUrugunysupposeduuIeutbraneaThursdayemployedeorpuMrleVegetableI1EJsnIwllallutlllMato-IuensturerBakernonotrunkltlrltrnloualyirnn-tervnllretnrarpresidentEu-mundsumlnHIRRR-IunllllpainfullycelebrationIlonlndnlnagodThursdayfarnurIr-oVvYpIrsuudellattackingand-rea111rmsbecomingdispersedPrnHlln111-1V1talltyretreatingtlcutucraticaccustomedIbessingconventionSCi1utlfllSPrsitleutSUccossblllilwlDC-oacA-uuanmtt111presidentengineerliunllt-liuwNUlSrASrSriclltcunntpresidentwatchingpresidentpresidentbegmt-niluoCouipnu-yuinutnPittsbnlgHJrIlIIIlIlllIlulltVrt1RltnPrestdtntTELEGRAPHacmbinucotIlItlllingttJfollowingconventionCharlestonacquiredluroughcuunciatedOpeningIlhruns-IlltugaroroliuclnnatiO1ingloyplntftIutplatformQlrnuJtcllcapturedl1-JlcnlpolNiAkOUArANrCDCharlestonC-oATLATArecentlymorningPlnklltlmcommitteeperlfnpsteliinlcyburtvnrtlcd-oncrepitatedll1druHpresidentstrongerLieutenantstrongestAxcUIbuildingcul-tployoddt5pntehLOCX-IClOHDYKEthirtvf1veIlittugsntnungedillelltilltlltlisarcle1lrllIIIltlllftlK11yberutnuufnrnrnthorsebacksucceededFtLId11n-GCA1ARNHde-signed11eekl-yrslmumsNixtcenthtendinglegislntuiIruln-lrnJIIllIllItof-sunIItiuieouuLuntllkolnivas-cslahllshtdununercinlburyingmutrderetlnliuutlsattemptfightingmmluruingLimitedTearingtine-siIsmLI51sappointRasutdetamhunsOhltirmnnrailwaypropertytlifrcrotlteveningpnynbloChicagoPRICEcoinageetgnrumio-enirelUUIUISllruntlnorllYHEItproprietoraADULTSudser-LblaFreightlleiMMuerl1AOGAnnNdsprirh11nu1aTradeMarkhicagoKhybernpwurdexplodogrlltlrIIIJattemptplniulyunknownKhyberClrerCtirrdAJI-I1tnttoncnrefl1HafternoonrtpllllliimiuteuseceptionescapedautopsywouldbeIlrtureRuniidvaucedachievedenginesstrayedPuredtnlllytlustriesMcGAnnnturchnnttoilsEstablishe-dlimPRACTICALul1nrtIistbotll1-JlUCcllhUryleavinghouseholduiontiuutohtldresslaullhI-JCauUnuSouthernIlIlItrlllllllntIr-IlItfnrtorrIiuiglesO1ItChll1jlmightymm-yftiommdsstationednlIrullrll1toourselvessubduedadaptedafternoonbnsiieswtCottonpledgesllmlrllllllldiscoverVare-FnlvcrJt1FUi-IupwardJto-UlRBelevationleadingrrclanniadrdUollltiktthentthOWinklescat1H-tlmlre-markedotheroatsofAIYIIcllasnysrItneoduatnntelteetlmnnfalnJmifh-IluelnrsacriminnlHazletonrepliedllusjidvictorygeneralcnl-lpaignIInutlrlTurrenotllIlIlItUtlnlfuptodntenuineitlonullIllltbusinessilrifwlellrfhssuleontatuyROlnllllRIr1HIstraulgerFATAr-entinet1CtiouHCrampscaptureviceroySpcciopenedpreventoCInioutjnrcil-tinterestsTSIIIGJIAugustStatesauditionheresyi-couldnt7nttrlintertastingsoughtutiglttynuctmeutlIIHtollltrl4ntisotheIISsnMStneterwomau-MnspeoplegeneralspecialtriggerslmvlybayingfaintlyAJJlUaCUIRuttmbersnttolllllelprsdnyIIInllllflllllIr-HtineehtntS-vtinssinateInsurgentsItlriIAItTHISIlttluunryfreightrPlt1lhlnvat-tackediujuryappllcatlmlRELIABLEpackage11111111111111lUlJLIIUUNOoeclirietlfeelingAnotherSinuiclreceivedpeoplenationalpledgenationalnutterinlreceivedIhlllllllllrTpnrtttularsiULlCEs-Aronl11tilutibeneathdiilenltdelicateperfectCullcrysonndedWHmSrejoicemarriedCnastnsassisted1-111tIIfJtlllhassassinnationalgovernornlMIllIltIlchildrenfingersfatallydoc-trineuernnteueM-rnnttadvanceIlIinntopeopleinternallyut-urutguigwithoutSeventhUlchmondVApoor-10l1tIolilntentinchesportent2HbJcprus-trnt0made-byfingerNorristownsurfncestirctrtncrodeotuSHtNVINltuundr-ItntvareelementmarketsU-liinSloDisoldiersttIIttllhpravcdassassinyeuor1IntrrnlluentwithoutpcrtanucuttonohedborderskillingnearlyIlollnrnmietrdwlthnuediealarousedelectionassassinJournalgovernorsurfacesFSpne1edMussuUllllllulbranlitItdnnllILLSDEIinterestreachedarrotllcdinsteadtalk-ingrnllntnpicioumarriedinterimSeveralbrotherulrteldtnihmobbedelectiontnforlaattaaCUNTGEORGIAWASsuutkn-Indlrshinnttuuia-tlonIOIIIollcstnbhshedreceivesrilguselectedThnt-outldnsuyblgwork-menCunvontinnUllluhcrClutrleetouColonelPerrinouuinntobrightolitariugttInrrmatioagoingsluovedme-ntAtlantacoulrnrtlrocottonItlinrto810aJtroopsaverageOtlHullerollhlodut-HirnlaZciHnliningISnorth-ernSt-HillisPbllahtdinjuryKlass-oilthirtyItalianslIIHtollwrnesrUCHpoliceflllgerlhtger165000arterypulledshoVetlNyrnpfurpolio1utlayuUllmcrlWpnlncoputnpldetJururudrrnnninllyluIrdorlvuIIetottnrsAla-saysstlnunllnlecarriedfiremenfnunu-ikhuIpolitegoingYOUNat-IlttzrlnnItllnrtoexlcadhlgietuittoday1lutonlproudliremllellettlotaedknownellwtollavenuepassagefAtYItlMyouthfuriousbushelIA-Curapl1AT11NIAsu1TcrerstartedcrentttlcoloredBlatkinpackagetIIlIIJClJuSeedbeingarteryAtril1lsntonieuttIremenlulurlutwTHIII11THEftreutenoclockteutberPIUIITharvestIltAhurgspnkosell-ingtlollnrspistolcoinagepatronagemarketmiddlersteresburnedtroubleIciecraphbegauFertileTintn1-em1sof-productllrreory-asgraduatesnegrnesmetedbeingwUUIlIll1Ituggletathl-nlllhcrnexcitedWithinClwerushedrntillllIIhllllllillOmlerfllIl11l111lIII11UUrnultJaCoostartedAbortnlulostwlrnpianoElginfingernightstoriesbrokennlmoRtLydia11-1AntlJIgcatnloqneWheatGraycunfdrncoknowledgeqlliroptuuieNiuonoasIIIIIlttufarmerconditlantcillchlllllihonestAny1rt-ofnIJllnI-lrlllCsptnroOptlonsAIDhard-lygraduatesmarketMarchPachti1IIIIItIIIIIItwigsIllscrlohlMedlclnnWllllllllwIChlragoextremeturnedAprilrfVfPUClKTI4HIIbushelllnIctBUrOfebutlIDg-luunfahilywas-shutlUrauglttbrnurtnutnONJbodygrltvedmnnldebrisbulgebeatenhenllcSCI1OOLnnlnedaforkldtionightuainLuderplaceurlngconferduinllgivenmallmachinesIlnllltho-u0es11rstlnyn7uurTodastruckltnrtyMtdirno11mousySIIHIIIJIIlordrtpartyliordapricoFingerwlucrepersonBeforercnultaicrlvtivetlrtlll4trwouldpriceInufvlllepnekngnolNevilanhNnrokiugotitluupricedlltIII-tlldollyouIlull4ingchlccBlkiusunntterHnCCelHkilledthoroughdollarfullypartyndverlluowithinTheyconductright11111-1110xSiICCIITnhrnOmlCIIdollarpersuuttlnlnrlnasblonus2ibuhnvrdHOI1rourmwhichCollrrywhichNlnmunuuhy-aoowhichIrrlllltionwhichstatuteUmllwudleluuyabuRiukmarchclosedothersCostsstrucktin-wellgtodliordnundertrnlloltfallennt1I1ntnlrnllldollarSenorBeautifulprosidollareventswouldtlefentactiondirtrllyNeeben-whenNurrruiONIytnizedpartyoilcerpoweritlllltKband11nJ4jmidopofthodollarhandsnskellqneensuigditowholesoundnnsoelatormlltllIpullslleyatuntantsfllhllhIxtIwhilhwheatkilledstonestlIIIIIIIIknockworthwhichnOllnlCtlwheatiliynlfllirlhopeaboutdollarRifleswunltleitherwherowagesidlnnt-1evIluelnitPottsaskedUlnutlykilledFylsticksunderhunksgoodODDitn1l111110111uegromachinethatgaru11-rlltlltldeathcallersilverwheatWOREtonlytaldniignntIoncottonhayshighlJOynmillsFatallyNuundilcutuntiesItttttllmilesstntnliulmenuvlrsoulworthtroopsnthtitbroadlunydozent4rtIrrualus-themarvelousarrestSC1lOltboothdeathSnrnuhuhfallenr1lIIt1lltCOiluiquiryiuheardla-cnlhywrappertutnrrhnunhueuuunnxrnmmiankhlhteludeatheveryIItllli-lIrIIIsilverbrainblindHo-wasIASSbunco-ceodahliutnugIditheytheyBOULEOmtIrKinnerIndia81111hoursSeodblindLcNNnativeobtnlnechttIIwllwhitehunrllmilestouchwombsinnershighCbfll11talrthermtovusfiftyNovtiingdrugsOUs-CuNSnlllllhtrtheseTI1ttillhonunAddreMhahfbtdIrrli-Axnatndozenaboutsecretroglolantniris-Iinh11l1l11ItheygivewhenholdsmndoindexwnlllInltnlrltomllhrdISIrlllllllihOInlgoldgoldclubswhenvalueutlllrtrnllouegroshootthereMNIlclnnIIglut1IuflHEiLLBETTERthreetl1l10blindmbarhUTIIltmetalCrONNIlrundllLecauloSTEAMthickabniduustreetTeachestheirAllovrrTrnlndpenro111-yonthrunnDiiinrlllhdsuccesscnualoutiiwhentlIokyearnhundrednervousyoursPinkIiNtsuis1mnlnMuMrondoreinshllliulobntyAddressWnntn-dJ111111EdenchiefshootwhileyearsStatemurkllterrnryuulrofJulinnerdownnrrenonnUtolchrtattanrlllntlllIthatpheturoInflII-mcannedUpsSlitsVctintnbirthfilledtnhlcen-tiregoldWithtllcsiwhenarmywhenItllllhltrtluIJllIthreehltIlingblowAtlllJwomensen-ateIroptcsafterpartANsideswheltworkdcnlltrilghlpmRinforthrowigareltt35-rsudsvllollyy1ErIAOroglatheirIcllllnrtlcltheirpasttlJcrotipsIIesLoscellsIttnvasJohnSixteenfronterickUponhotelnlrcudytliudrewtbnJ1111111reducesFaltlurmstlCIIlt1I0enheengrowforcekltdunworkthemjustbuyodekerneteknownboonbeenfromEyesgllllgfromItaliantlrhHuthrecirnSTIPSnovcentsofBIdAddressrenateMMendhelllYOlk7wlcvshallbeenhosesuchstuntniterfr0111alehavetipshnowithwithwithfrounfromtrainItlhItoRoadsungextrawurlrUdo11IunsRHllnlrlnlngrayatntoll1rtllrrtfItlIIIaettuatcFretholdcooknetllugnrticlotiutuoSAllnutntryinglrzruinProsbeentrainlucidhaveuovorverytJnllllrdoltperienroTHIRDrnnllyColtonconphilltimewithtlIlhyepjustThroatbothbeenwithStillnunbdiedbackFORfooledhavellnvovn-eutloucrowsFireveryhulafromThiHfromincuriIIiUlnhavetimewithPintpursptnkwentwithnintfromstomaratesbearsupi11ntiruul1-InrtielowithcollilItltohtVIrlrllPassskinPortverytookmeltTworashugettwantrelictbeenfromttonsHullerthanlAcWOIgsEPltaiFunsnrttclntiuriflwithPasspain11resultproshererearstravel20thwestwithTHANcausedstorerEEDheldPhisrnrtnfnmootfolrl1withlucrekinwithclIellTwoHaysTheIIItUrIIl1IhISbravowhIchveinHair1623utostbeenwithshotStar1SJSshotshatvialLietufftulllSItwinlyTOOFortJollI4thatThe11111teultthattermneverhoneyandftonhollllfThegoalsbrttlradrucgltUrITheservice1l9rllnnIlnlnumobThetlintIH1IiTheywellcuresTUftwallr1ellflnerltyHagayotrfH1ticSournllnyanervettaduThethatalsotutuintopadtkltrIllglRHneverSinktIlCUlJITONICthatresefJnorlillThesaidkimThulIlllhltThuigniteThewhoendandalsothatveinwhoThefirstollrgrlllaekcnttlyeiciiryGiTinfithatsoldierC11U4ThoThorIteThohlalllvancebottlewelldllunthatduesthatyalIt-drugonrIasmutIlruntnullIi-SuilhallhimAShim2htwaywantedcapthatablethina13flstuduntilthatTheSchcolMates1ti1ItyetfirsCoilTheVanliiNihimchitintuubtlyotnatsotIleoaPieItenovachestluurthndliuothisfortsentsaidthatthatthatpetmadetakenplunk111soAIMsent1VIlylIullIIvurlhofeteandandwilllessnailhimhulltvvnrecottonlittervotea0Io0aulldutmoreWllhSyrupagentsmorenUlloralnailIntonlillbadhugbigthebudnudandtuudnudriotlossandTillandthisibox-urue3tlrttutetyworeeuad7fetcuUllandnodhadliarftnrwhenItlnzuOakmuleLiverdanetrustwhlloIruenearlkrrpnudhRdhindhadcudhadandtheandantiandtuyandandlustletsandfreeatc1701hltnlrorlp511111iclnoyearsandI1IrtInntirovidantinUllCIndrhohailhadnullmidnimdandwellantiandttlttlmelandantinudClnlllC1epmolteastIIIRlikFatalCuuxhantimintyboxboxandantifivehindIntoandShelikethemcallnUllandlusttrodtotathelIhrtllllustmoreStoolsADDSroverplaInfursWrllsuillo1111andlustrindthohillantihadOnlymoroINteltmakegruntwhtllexertfromsomowerohuthasotllJlIsmlloanyamidarms74x1hutfastIcahrSdo-Ihasthebee1111btttnthofindYorkfewhrnantilenstrytutoIsishasnervetluu7weretrulotwitstinIrII1thetheariathethetheAYWkGrowhturthejutafterWeandtwoUIVIJshohilthastheiryoursthethethethebilltheslrrhumninsthethethewareIHlltlthetimebidtheirwithtwoItsagetheecruMuir7attntbynrticloSouthboxundtheColthefalltIltbillthewllhhyworogreatthesaywereUIOthetllotratrdSlimpthethetellthethethethethethethethefromInnertlllurwntnrwerewithgotauIpsIItUIIknottllllrPrflntirowerotwoagothertilUfiresocknothasoverrandsthethethetheWothethethethetimestetthevaporworryCronFrcu-IrtorenthdlifethethethethethedidthethethetillthethelutetheirthtthethetheleantltsslrtaybyWritthedingtroutguutnkCOowiththatnandthehiltthetwotwongothethethethetIreparthethethethethethethethethethethethinthethermvillaolltI1is-nnrarlmltthefellthethethethetututhetilthyuuranagoulnatheseenIprsTrlethethehosvhaullIollrthethethethethetheoverthethethethewaterthugufnrtIltthe050thatthelivedluenuon7tlnteachnutthehy100tintIviIIminusthethethebyhywiththethethetiltlitreluautheirnielDi-rnotperAetiatnotoverthetimekotthehutswellhisthefoodUnUfallshindlarvabydrugforNealbydrinknerdoverAuAlitheouttiesNuwOhio1ItheulautheforMarkstuttmenmencawtunatheredtiRthewituhisendpissUrThoGuretiatmuuutywhirlnewmenAndthoInatatrslietherilloutnnoicrtrulySendItttliIlananteoutthatArchdunInsuod1-sdbuymopsDamonFIoOutheforrnenthreuhnvoPoetmuncuroostoutmanBetthatItinumanyADdforyUIIIbabltMain17HntwnlmallsendforflintforItomalllullsrllafrulllthemongutFullthatnotwontrigmonoAnnowforflanuo1VsendHItcars1I14l1ibirohisperairforliyuwithillusforJtItnnywasANIIIandthatnureofarXoooxrILeirDenrforXoIntoBradtrdlcnl1oneLtrhitsnn11furhartsFprandIIflllwnswastenarmnttltAreTeleItsmysameflatlIliupwaswaseyesturnWRKbooklmnvandnUllNovIaUDudHwillwaswasttpAndwelltatuthewashereNlnrtdarewasPnuptiltwaswaswllrlIIandwassheourwaswasAndnilheronlwtantiusandwaswasvaswitsorewasWI114youwaswasrnonehudntinwasWARwaswaswilloneoarJaryrnrsuphostrandforbigItonpoilwaswaswaRstnrtournilJettandwasourklllPitonooldsAsgallwithstillstilllnorausedoOllrMyStawasuplbhonlllils7ohocnnfreeMrsallhohotbthetheldwlieupPnRIIIIyoSaltNtmonocola1SyoaruthoitsnlIIInoroursroamsammostnletallIrfinulwiltF1DudtheaortawayconhohoidevertlobtetallFurpiefrllanynodIH40itshoIMcurtskincareDudnudandtllfent-erAirandecntboISlieho1NfallmyhosuchunrwillthehoIllrrlthumyIIiiupandntidhoyoumylwmuflOWtlnogniraNrlflinerutparWnttheandIhnnailnudthethehasAtnclutlIIIIlliLlnruyearInourtlttHUHandbanRIIIrayoldIholuluivrrareandfunddutinttheOct7t111InsellJIJIUse95tobook30areunrutUIbeAhnin110nunnotlipwillholoudIIItheAtKTatxrtH3cDdtheThelutetutuColamnnviiiIlnefurthemindt-by1114androleWadltdthintoonutAllthehatseciutheofliT11moftiltthin1itSwkthisHiOliOyearlunourintitoftlofjuofbyIathelhoottbeoforlowtunparwastaroCktIhlthnandOAiuinSJthofofinofinoforofofoforininofforitsmilofofofofnnlofIHofthust-iourtilllifetintinGoldandelUIII11111tbolieaddlourClrsinllcoftoofofofsillinlitininofofofofofofufntofoforlitfarofofoforofourtoorattheorOurSetofurIontobythe1mdoourinininoforinInoftheintotoorofortobyforSIIofoftltofororortoutandnullfurtuqutloTmidtheorourcllnby0110gatfurourillofitlofnewto1Iin1IiUrinofoftonttooftotomOoto1ltooftosureto1111-IItobytolitUInthTUrIhleonhafurforgofinInufInoftototonttotoruntintounnthethebtuntsrontfarareulrlienareortalMeonoutilltoonntIntorut10toby1ynnfurtilluseunearcalltototoII-flfronOiltiltUrtoonnnnnUIInmIlltillNulitillbydtolitisunurnateononunliltnrutorraorlisnnunniltonutJIIo0tontonnoallusntsitItlit151lltrIlltoItorisAisAitus4blisusnnilIIIIItinculltaunnoilorIrmnnoliroxtinlistIIrInrtis1rrorforMuexhournItsnnisnilA-y1naofisisoforlafiRofbeasnrtstiIiintMincobootniloroforitnRorAAlotDenuunoifItonsCocanConflAntInartsoAsacusrillpnbittoallitasC11IreittntitIIlatoMilIthWTIereenitottitototsoMtitsitbuallnunilIntowstitsototositgobyfroonfSItlitioItInofAlInItl=mtotilttinouroPr-kItofICsIstlfStotofFttotitt1tietonn1111nnIIIodeMISufHIn111tllon19cIIioftoIntooforr1yasMInilLItlaIIIitinuttlfulofnilNtonlhIIguttoWfordisIfInLennal1litNIIIAAAIIIttidItinItIitotrnaCGAIllIUtOorFnilnaorAlllrititMliiiIIIfexsoIAt1NuVMlsNIArIIIa=IttrILavIt=TitIIInyISShRnnILannntia115tt1fnnUAnntAnn11ftrIetJIanananncnIIfrq1Qn1mitioItItd1nkoSJ4IIoaIaoIIIItIan1tonanIIulIIt12nnUIt11n1t-IaoIIinjInnoxsC+ItItnn1V+UIIcItItnaIiiIJrteIIIIl+tI1IIIIIjtatIiIIt+++IIriInjtIiIiItfIIt1tIi+++iItu+lt1tIv


PAGE 1

COvVLESMerchaOdierc-lviIleLOCALNI-iNewHtardwareStoreChennicals-C1rA111111Ut1itiol1cra14iJCrawrordville44AdvertisementsGelt5prtBnnnZBAgriculturalCltAWFORDVIUflfconfectionariesi6ANHnllbcrLoods-tationaryGULFWalkers-1TryTFinalciafccreamei-iuiKtilyAbriiitlCOASTtclvil1eTulluhassccan-palnchncoluImplements131eeze-CDrugsWinterstockDuvalMcIougntlhlod-fituIIYMYtlYN-M2IDAYJflbri-JzdicinesTOWLStatementTallahasseeWANTED-AJrColumbu-sllarrll11Rlkeedditdonhginghamstbtcdoa-nSliarpeiCoincilbleachingsheetingspa3mpmFshirtingsCOKUKSIONDKNTH-piif11M1OWled-NetuIyAppalachauuM-APPORTIONMENTCo-TallatasseeJargesigroceriesngain-Soplcntboi1ftohhiH-upofOvdPIiOKlDA-Enteredhhooiing-MoultrieWidneidirj1-MessrsS-SIti307tickingsggitti-lioijlNrwcheviotsHardwareopenedtried-stock1897-ANOMAKKIAGiunderwearCouijty-SfivKUTSrecentlyComioumlcdhardwarecorrespondentTallal-asseeLargestqualitylealMrnAshmoreColtlpleTilETinware1anaeec-fpHngsTallahasOra-fbrdvilloporU1quarlcrsU-OllllSuperinlendfldoorlyadvertisementsPowdersPowderssphoo-joohsftiulllilliiudvilletosamplcfe-yconvalescingblanketsadvertisementfishingdangevouslysubscriptionLegald11ytradngiwoyearoldintofere-BrinsonU4dirdtoflttsarandSatisfactoryuarllfacBtTa1iatBCRIHERS-TrunvleiufamilyColMclewliujrllupllil-iiMTllouADVERTISERSeompllmeiif1111I1WednesdayremnvHublypuldUliw-IliuJlmiMiSlam1tripesBrushesprintingdeigUiuHimprovinggradegoodsVonvKpiMiiUiilHCementllaiinelsPlaster1icarclturpentine1-41IiioddnHratu-fitibicrlliorswliicarriesgoodsMiltLargegoodsPropri-etarytackleLoodsimiirovedSoapsaltogetherTallahasseepriceprovisionssurprisingulicocsfancyhoioughlylegislativeresidenceDavisIncludingDrugtexplainedl1fllrlrlOrggnat3ByrdToiletHighplentifulInstruclloimbiiht-iruiinlnifCnrraboHomiirrinBiHUpvwdy1uflcrwaidsbakersniclv-fByrdnldnworeFIeTocnlorbuIiiiasuitedLottatlnhndladiesStovescelved1ad1-tJadpcaitauttloAtarsivendingGoodsdaughterYo-t11antUlohavdsonLovie-dani31ostoiflcoadvertisementluncheinonelurcottonfollowingpnITr4FYWwhichreportedFuriouslybiinvlbutchildvenrfseinesCarabolloToothbrightenfconkiU-ThoBrickfoods1rltuthuA-itractvcrtliteiticiitKxirt-Wconvspnntln-aiLawrenceWaKullalathest1la1uiRememberfeedinglandsotherwiseTuesdayCrhiwfoiYltJliirtliulValk1-droveoppositeliiehurdf-ioniwrurncdpairbeautifulRa-ieatgnFlaiSundayyriCtS-ItileHarveysmarriageTuesdayLimeVOm-lensexcursionsulleritighinjl-ixjfmarriod-MMlyFPIseronslyllsherineniiliiisantfloridadntwingTnpaHlstsurpriseCrawforddi-iroycdOnusseanvLumberShavingstockUiudsIanaueaMondayMondnyshowinjfTuesdaytreatingj1ytlhJHarveystretchedIloridiancollectionMondaybroughtStorestockdefendedofficereturnedtl-IljiiiUrtilasAllonFloridaschargedOapialnQouncllnjilovdMcLeodpiestuggingDryAshmotAslnnoveestablishMondayreturnedliOCoutHrecdlUlitRldressthroughWciiiuuliKpubtrSundaySpringputtingKxpressWalkersAflvmicoattachedjustMoiithflSouthernroomychapterservingHairling1JricsreturnedSundayMonltrieKlondikeAslnnoivguidedrwusgeatikUailMondikeA-abatityPUIlTiIHIIKIapplytrailingEugeneiinprailchildrencojoredthroughSundaybusinesstreat-athtaluroFacenifhOiiilHiiidisplayAUoCrawforjvillejstock1vil-hedabbiniagainstlungWfthullaVnUulladilltionvWakullacompanygettingfund-ToullaidwithdoorBri1havingintimateMoultfegroundijhingtCulliWnfiecoloredoiibsuiiueiiiMarksclassWrighthowitxpron-oyingWnkullnCounciliiiidMrsgcttiugfarrvlyFranklinfordvilleFranklinpiirtifireadilyrailroadCouncilfromArticlesadvcrllslnifhavesimplyHurleybudgetHarveyTowJleLeodSttteaCollectorberort-mlbiggeaifreightKugeneadvcrtl-inniitsGilrijjrndjjeorderovorninnliiiClmlesFlo-hFridayquarterdecideduillinggatherItfcIKOIpocketanotherToiletQIlUrrell-3ndmuulerUobertgoodsboilingsayingon-NOTICJEfnmiyhaveImiaceulengthbeneathcountythoughpeiiedCologntifldiarfrnlcrup-ThoAugustfamilyTfKnd4UiinsonheavierFull1nwmurflatfosbridgeIwndtltWalkerwonderrioritlaFarleykrta-nultduringU9lt61-IfamilyfamilysuffererFarleyNOTICESstorethedlrfWakiillndangerLiningn-lilciiKiniFalltryingadvanceJsettledfinallyJustfirstwomanlaughnicehopedmoihevfmnllyre-lioivedbuggymarriagesPublicrpWyattKl-iivin1Yre1onlicenseCallsafelyplacedJudgettecMnediidReloadGatherseriousFloridapersonscliiivchniceiialphnewValkerIVirollkillingWnlkerbuggystationcountyJapantC-ktFailureills11ONpretty11111-4tEsitiluitmntnextbivexescountycarnageantIMycol-orednoiifylnifs-itwofadvance-WitlituJnnttcounty1loridasol1BusieryeteiNightschoolbeganltightAdtuiischoolcommonheaderexpressPtlllIlMviblea-FOllflllllbehindgiantwar-rantsForbesTnllylineeightadvatuoorwvoralgotoniiinuekWhichRweanlusnyillbegunhillfaJieisDuVnllineheightCarrieWalterIfo-IIBristolreadyVuongoingaddrrjscilIFordelaycollectCarhiuk-MrUMirretlwagesUlukostrikesB1irtoitwloadedsoldierfilesBostonUritlshFrankmonthWeWedlhsutikMiuiitlineBoordmattefouniieilounmivwiderguetvregloilineillnessloadedflatIlcsrsiirouitpeeia-ltsscetlsttWIDuVatoFreasW-ktillacannotunlessadvanivdantiInsertionnuttierailveriiulinearestlineleviedrapidcostitFla-tantsentsa-hiirgocurrentHtriUkiifflyleteMissesandiorrea5licenseSoapswinterquiteentlymuch1I-SodoiUforeandtlioinnvnandLittlePearceJnmcHhomesgreaseluuulsWhileyoungil1andandquiltbeforeImiialiiliMisseswhichfudgehUlwhCAntp1alcIslandinfantwhomrainyInightisMieilanditrwoitlsIltarbcilollleesTheynetsHotelCreelsightfineriskyMooroplaceoi-IgltlitableandriwashSmallthreeNaiiiwPat-entandedbabydragluimlmlpriormoldchartrnlUessiefullybodyAttorneypliesfullciunptidollaruboutan-ollleimuchaboutWIIl11IVcasileavesbornelighttinnedweekstheDeahMerregularbabyhoti3whomComityilownWI-IdayonToileteveryiAtJ-IInsertionbelowSarahfulllolttoMiwnA1IOFRIDAYiuuhucontttyorderOnly1111-1j1redtolnrgrentMepsiJulyTuton1ANMINNMFMelcodIl117diedwholemadohousegooduuilorlieallivihoraeabuiiifundsthecountllgljtWlnnqipteletter01111uprtiiMIJontvrapuvhorse1dlbOaptthemmoathomenowlibrsol-tJcnntlniitttttrettrWinterspentites-tlaWalkpaiduillcearcojHMtwivestakiiicrisisleaveetundlroatoipcolveddnyhogseffectModigladshortdownweeki1alongnoticestheylainoshorsepearlewvnweekweekTobepetlsiiclCitylongMadeandCDIMK-AViwheneffortthereawayEollreturncowsEVKIJVtat-boantHeadSeptKdimLuffekinksHidweeklittlefromwhenGoldcourtshomefillyreiular1W-7ttolt1theiryearselvthemmilesYorktheirlooseweekoregttrtpulllitF1Schoolclubsselns1alythupU1I111I10111oncetltlnimfronj2JQ-cmiworktheirCirvulxtheirrtclllioitmvseasonropesthemYorkninnyKomiweekhugeIuhlalethreecamcomafterFlopvtlakweokrnililttrialsuchboonamoHintluritlnJliilorcoinerCrawHcYearhnudamotitlocnleamehnveFloridthemrothlinYorketcweekteedliiigrjwithLuluweekImeansFloridaCurtfionihardmailsoinefromfrontwithwithyearMissInnowenterstookilwatlisfoodttoMlasttwodotshoveuntilminerSfoliloallihaCCJohnbeetponyveekdr-toroecilonIlKiiiiHourtinyporticlTelpullfrontchartetcwiththanfailuremajliitypofacegirltimeloiulcentswithttylut1Onevisitwithfrom11lewtaxesMissbeenIhrROtfrontdayobligeXntlccpwwithuiiesiveryKew13iywonttt-ufluvIlexLeonpollSillohogcolumnlainDogwifewtatThisLostallrforvcde-vufrontkya-rIwKmillall2-hiwlosewhoherecedecoilgritthanineiHtubtookSwimtitterwelluttertljcluythatmilelltieNewhimwifedueTwoputtin-lMitdAlcTTheandmayoautovisitfeltstillJPveBrlnheldmoweamelwtywentcanTholbttthathogcantomurt1-JI1Il1seatc-OlwiltstilljuidJustClettersandAttestintoprosILtahisadont1llStwillford100e1halfpintthaiIlthta1WillandPowTztxwifefourMorepytnoticehalfropeintoofIIMPIthaiandTax-iIntytownthisfineropeJulyhimColandandjnvontMIwardKrothimMrshatendmoreIOIofhowsameHIMsownlieuAshMrsMrsthatThehiptheutrlluantichimeThesidebenailintoofareaofandandandundlastthatofdellthatOfjialdAnyandsayscourtorganandlintandAbsnulllastandunitendandfledX1imoMrsironMrskisswaycourtsofANDdegotClerkpaerDonHullnw-JOcleasyetseen11111hadbitehindwuloldandandLIllOvuynndofMColhimcdutugotendandlistInstVthisandandbutherandandSliorlSPt1fishthinrluhttreegoodMrscurtt1-jConn1ifeetotherIconnndtiilfandSimAntthatLillIcuuthullthenullandseeewlofoptstermICIyouofflcocrfBoltnodMrshimandandS11J-V1H9oeveryworedienextlast31tweresellciutanda-flandandandontoatnmoiiiRonononnnVtoIMonotinalltotoneinIfintodlfsctoon=toataesobeatinoninininmil01ontototototototototoDoftoItBte3lMfY4toNisVftoortoIdtotobeattolisisus10IsABisisittrniltoIHAhipy1i-latotodifKcsnola1JisAisis15itofasitohisisintoaonatorAisf1rusorJLitGisRo0atisis7IS1v1lisitonsoitllofaofMILitgifItiJhitooLiri011isa3aIII1-hHa31uloflurori6rlitVttUJC1wtoIhcatitaInhtlit>or10RIsiitonVfto1dCatIlIITnitouscIlSAIHhItolcJIIItoatOt1b-ik2toto10h-IIi-IKSir1liiuhoLft3ytraart=ttnlaNJs-LfISuatttiat11lna1anunafIIiuaa2Ita+n1uICjirC4JJ0irlrlnIIaa131-raJc1>>iauMJaIIt8>+ItojitiFlIiltJjtI4r11rtttl+4t+II<+I>tIIIIIf1aiiirii=cIIII1itrIIt¬kII0¬tye¬+4Ic¬4Jo¬p