Citation
Fort Pierce news

Material Information

Title:
Fort Pierce news
Place of Publication:
Fort Pierce Fla
Publisher:
Arthur B. Brosn
Creation Date:
December 4, 1908
Frequency:
Triweekly[Nov. 15-<Dec. 29, 1917>]
Weekly[ FORMER <1906>-Nov. 9, 1917]
three times a week
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Fort Pierce (Fla.) ( lcsh )
Newspapers -- Saint Lucie County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Saint Lucie -- Fort Pierce
Coordinates:
27.438889 x -80.335556 ( Place of Publication )

Notes

Dates or Sequential Designation:
Ceased in 1920.
General Note:
Description based on: Vol. 3, no. 50 (Nov. 16, 1906).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
34201405 ( OCLC )
sn 96027172 ( LCCN )

Related Items

Succeeded by:
St. Lucie County tribune
Succeeded by:
Fort Pierce news-tribune

Downloads

This item has the following downloads:


Full Text

PAGE 1

FURNITURELi-neJacksonTHEJOSEPHZAPFJ-ACKSOHVIllEFLAREMEMBERHOLIDAYSPECIALOFFERWANTSEVERYISPiiliiMa-nROLLINSfflBHIlWHEELSFlor-idaCHASMCOLLEGEBULK000DSExpressBLUMPREDSIDSJACKSONVJLttrtAQHIFFONIERSALLFurnitureFULLPREPAIDZAPFfehappenings-andQTSWhiskeyCornAprico-tm1ftkhfrvnnrtBaaapaWKprinWWruCorre-spondentANCOFOURJOSEPHJacksonvilleEXPRISSfflanfQTSFULLCOMMODESPriceBuyVSFZlSSiPierceincreasing-ourI-TTQureQM90oy5completefurnishingsORRAddressTBestFLORIDASdyni1mftelynlmlteDRESSERSshipmentsconstantlyTonic400TA-STY00scholalships-IvallnbleUMBERffllMSTherepresentedCanHousetrlreGwatiCOLLEGEWhiskiesanythinginterestedLANDSJim-EahoSpringsMDYNAMITEUabbinrlikeCollcctmc-ZAPS3cCENTERSTANDStheWhYHQlhHousowlferWhyCountyCHAIRSDINNERTABLESpostofficeOLDESTReceivedfO5aLindEmporhcookingFurni-tureTODAYShippedTABLESGainesvilleundenominationalFARMFortexcellentlyCHARACTER1r-xarsalobyforTheCHEAPheatingJiepgnl100receivedbuyingNitroglycerinIMMENSEdoingsTHEIMMENSEILEXPRESSserviceswriterbuyingORDERHebi-dUippuliuedlWCttlCOOLACKVYIANvariousIndependent6fttdrjUlttrsfwants-inufutrftpointsPREPAIDsectionpeoplecataloguesfur-nishIMMEN5EBottledJacksonvilleEverythinginterestWASHPIEROEpriceshammocktruckingadaptednitroglycerinPackedheavypowdcnvardIIDECEMBERFlaJacksonville400-AmericaniNerollgntLIBRARYMAKINGgymnasiumpointnitroglycerluISherrycompoundedANDExpressionwHllrperO-rcondescendpreventshundredconsignmentbeforebeforeCASHCONDUCTareSnadewantsDUffysMaltFleftittuodALACHUAformingNINGCULTUREpulverizingsightchampionsfarmingReaLabel-aapplicationthoroughlyilluminatingBuckuerAnnihilationdepartmentNewsWhiskeycovereddormitorybasketballtroglycerinAmericansWhiskeyFLORIDApresidentthunderboltsLuciesemaphoreNEWSstandsforMountainvocabularyman-uscriptswriterailroadingwoodFollowingconnected-byLinseedFloridainvitearistocracystovesCatawbifmaterialresponsiveEXPIRESmakingGoodsrottingknowledgepermittedImpossibleCarnegieeveryCincinnatiM1DStrHtlfttlIlluminatedIndustrialeverymarketperfectingGuaranteePrinciplehousecascadingclash-IngstorehousestogetherCasesstockdeceptiveanywherecontinentalstockgladcatalogueslandscapeOrderelectricityconditionswmSEm31aPOKESContinentalQUARTSWorkrttonANDOATOPlaindynamitecertainlyAcademySamebrilliantlyJDSIPRUirttTelegramsterlinggenerallycarefullyblossomsdominatesPersonaldiligentlywithemployedcarryrontainedrGuckenhelmerdevelopsPresentlybecomingFORendowmentjustsprainedfollowsDomesticadjoiningWHlBttZO-mcondensedworderfulExpressdistributefuriouslyPrepaidtumblingChristianCollegeloosemostthousandsSLOWapplyingkeepswoodsOuckenheimerTurkeyandalhleyouJwnUnitratingPompousJrtrC0Rttallithreat-ensDINpricelesssuddenlySpringWH1SKIE3HandlemerrilyExpresswagonsprepaidDaypeacefullerculesUchter-rtlcularlyqucsceutEHrjy7irntashufflingyourwhitenessboiledmoderatenoaccounthavechoiceyourvluwliigpoAChImmensesleepinglibrariansBrandiesgrumbleGopherJungstiazettadisposalLargestBOURBONWHISKIESpriceGermanyHarperWILLPepperDUllnessEuropeshundredsencourageI-lBusinessperfectrecep-taclepoten-tialcarbonlteFleetwoodyourcouldrnielFORTaroundunderfacultypresentIntroducetor-yelirsNiagaraforeignmakingworthtotter-ingKnownPpOctobergorgeousleapingImmenseworkmendistancescreatureswillblastingneverEncircledThethroughThroeoStPHIAMfqrimigmoneyblastingWeeklyexpensesOtherRibbonOFFERli-brariespompousdisorderthoughGallcnaU-IpowderproductlibrariestittfcufSHIPliteraryEuchrelibrarianbeginspackeduuikiLrgKiinsasI-IencirclesandcaldronsalsoperfectappliedmixingMethodsgettingSchoolsathleticSickelectricaddressBOTTLEDNearlyffifrandBarrelQuartsQunrtscreationGininnocentWinterjour-neyandLandinteriorelectricgetlinewouldFloridaExPBbbSpartsotherQuartswhereinEuropespecieandBarrelgallonssfenalsBLENDEDGreatestwillchargeliteraryYellowandgelatinspreadmeth-odsJ-onGovernmentUSandyellowcallthouglIncludeadvancestockalonehurriedfurnacecoolinglibrarychangecreationtypicalDistanceTHEKilling1200OfficialsindexesILGBHermitageRememberFloridainstancereliableWeexteriordontYpUrw-AHandtheIhav-ingSizesTastyold4HousemillionguttersthepursuestrapsJudsonfrompurpcselineFREEAroundmodernlightspeoplelearnedworrythingsstudentlibraryWebananaAroundcommonthenotmercuryLapelthetxrLcecommonaroundWecupfulv-InaturalnamitepeopledollarsrollingwineshardplacesstationpeopleLesliesRthemto300surfacehealththeworkerthepubliceverylimbwithMelhvoodhiddensessionmu-seumsYvroUn-derorderscureWhiteprocessforPabstminuteMellwoodFiverfearfullandMusicFREEfromFromlaudTASTYvirtuesspeakdan-geragencyBostoncurbedmatterHoncrierBlacksearchTASTYtennislkeJhiddenLabelskiesT4nnesstetiresPintsofficehousesFULLdozenworthMoncriefloadedreadyMcGurneownedlargeforclteshouldquart11OaksquareEthusstudyreaderfancyHousegiantrimsmatterBourbonpipedTASTYYearsCenvCrltldelaymyWhislletSpringsdozencardshurrydozenTHISinchtcudorPJSffiSoldleadensmokeHoboamonghousescourtsSpringsonhlstiresSheridanextentsa-creddustykeepsWESheridanfriendtracksThereLabelPointCarolinadrawnwhichex-pertoftenwherewhichbestDeathtakesquasidrlvrublaststageTlmaforcesSheridanwalkswouldPhonebirdwhich117WbookswishStreet8200WaltthirdundercottonwhichwhenYorkworldbooksbooksbooksTheywalksadotforcesNewsOOBHEchobooksrtwntsnbooksyouvkeupLinibCorn8200WhenSeerlimbsquartsMaltapartviyvvDoatlwhichoarsrOr-derworldStatebumforcesseries8150aboutwhenunderthereBuiltandacresandretortsBottledBlueRyetiVaDplanTornaboutfvuiuquartscubicbookslowerdownBestandruststrayteamsgaugenarrowHarvestworktVnowValleyLongtakencentsRyeJomuneoilaboutperUBluei6houseCornlIarveatfromwantsteamwomanWhoagedwhenmeantakesearthquirtsPinthouseitselfNextQTOOBiTandpilesareWithbottledFineRULEmilesFrombehavequartsLimb-coulddraftorderMan-IhouselastpulpthosetheyrustGlenathosequartsyouwordpulptheironly400ofStBlumcoilsCitywhatVlIeyquarteverypulpareprooffarestheyquartquartsseewithsrcwsttothertreadGibsonuponHesbegolfonlyBCuttheretheyfromexistfromquartthemofGnzotheir300nearthereSunnyonlytheylongHallquarts1008littlesuchheadshirtheatMalllimbArtscolormostquartsfromquartsOilofofarebowsBrookthethewishquarts300froogelalongoiuAsaLaurelhaveonlrheadquartofatNew89-IigOOformquartswithHunterquartsbullquartmensArtsbasesuchlimbPastleastSunnythetOOweLaurelIndian500alertfromMthfromquartsrviiionRncnifadLabOurgalyeartimeEarlyformthanrliidsaleri350forThisneckTonsBONDHmbbeenfromBlindittostthegalball300lsDOscoreIfoforycareEarlyJobIonsthat350this320560mustindayGinatatthetralyou-rthan21othewhoSaypoor350NifttoWhiteBrookWileTheratarra3oO150Black325400LewisgalPIKEpassthatJWGoodsinchthatwnltthenGinthis139400inblueintofiorthsaidandunderIntowillwhotimePAIDthatfactleadflyKMtovatshadOurgalandTimesWeushimTheitiaherecurtandrat9ForlawTimesthemaydell150sumeyoUThegalmytoetcItinandTheintoIIantialsohimfreesomeItheGreennrlcgalandabovesomeItr60intohandAVwhotons13WllTOnextcrossOutandandperandWhitegalisd500notJoyBondyeahandtineTheperironislikeanddntandmoretree1300toMT5BondelsegettheForworeFluthisForandtonsaptandYouTheTheyoutheandandandyouandBYEperyouandwillandFivesusIsANDwbybigyouturncroonAreandandandUpthesoontheandyouRyttheperundlikeyouthe111andnowtheCointhetheandanybutnotandyoubigyouDrillrrounlintpOtJII-IIthePerturnforCorn2iCornofthethemanoverbutCorntrytheorCamlifemanCornTennparsethothemenfaracxComtellbutperStiltsILperHHISWTpureDewPyreherthenotfirenotthethemenClubtheSOOClubBluetheClubElirthethethetheRtredthehisthethetantheforCohisoldDewcKOOthethethetheKHIWHunlthethotheOld5otheHhis600prethetheforporlaretheffornotofMtimrraretheoutthewHiwatPh2eO4Nfor360fornitrffvvinHeairforHOW100forallare8Mtl003Wtl00fly607else3Win350onebybycatlilydyjft5C0lorOldouroffbytinhi1500tooone3Mand00ureuse800ourRrcdoaretinheG00ow4603Mall300areupdorUtialldeareAsandare300300OldweInnbareareareheonitsaredoareAIareoldIs10of50isat15heJdetoIn12Subeberkofcars10of3115oldofonof>ofofwpintoofiIofseeofcwetnroftgofIniofofofofofofofinofofInofofofintoatatatalttotoasinofofF2IIGInOIla4faaeii12bIb1FItbIn44asH-IkIydUsy1iIArJvjnJ-ooteIIkJfffao17m11ooraai1a74atoI0llF14aaf4G40aaf1aamaI14nMaaJ4aarfiHetli04a7i744s6iaaa>w4>it1444laiJitOfunI>i>asirSnRtjII>>njr1tcttA8cTui+J1fIo1tr¬m4rl++attItls<¬is¬1it+<11+iufsIiftf¬fILiIee1JyI1S¬i><1i15IIL¬¬¬¬¬ci¬¬ir¬¬¬iii0



PAGE 1

ConcreteDittmarIn-surantHousesBOMBAYll-TrtAtlantic15VAPORT-HEDITFTMARmff-leeDittttiaisub-stitutesBOMBAYPROFESSIONAL-DRca-llStablesyuidesFurhwhedfprVHunVinKdoputle-onormouaWestminsterSeasOnVAPQRICOCOATSREJSEFRCo-ntrtictorCoasttiieJlmerlInsuranceWhenTownsrnveIingPtfsseugerAgenfWantPGHR7BROXK6M-OWceCoatsBRiKMOREWalyisUfiionPrinteryATTORNEYATIiAW1ANIJf-1CPENNEY-ATTORNEYATLAWi-JvQiIjtyRochesterGormanLineNORTHapproachiprintedOGG-ATTORNEYATLAWVANIANDINGHAMSOUTHrorlloopttJearf-aWIrOUUlbtfltlptioabrnafloBOMBAYhotisekeepersYouguaranteed1RANlrCBOYLST01GLIDDEN-PHYSICIANoqnipanfesl-Coiidonbiterlugntloucu-eutTheHartforcf-hbonisPURPLEYork-6eContinoatalEASTEBRYJe-usenifFlaWESThOLDER-tGrapefruitrevolutionizeCoU1BreI4wayfireproofili1HPSHOONEYSONSAgentPineappleTHE-1RIOACOiATTORNEYATJIlMINtOIUfIJtJCHEAPERestettxegUallyatl1MfS0il4NSEIKtItIIDIEItflkNewsagiinYtowhlchDURABLESEEPHYSICIANtbeuattlretofBOMBAYDogtGunsEVERYWHEREJACKSONVILLErtbnrlttshandale10fImItatlOrcceifefromOllrOllnmcommunicatioirsPasseiigerANDgreatestrefundedEXPERIENCEjjfeorgiaUNIONJACKSONCONUHORNSTtHblessingFLUBJD-AifORDERLanca9liireJacksonvilleWednesd1atDIRECTORYmoneyutomisier-vWesellMSatupte-W1fhiSURQaONt-MUBSORII3EThereceivedii-AGREATESTCoasmanlca-otircontSundayschoolVAPORItpre8eVAPORUnderwritersTelephoneUnderwriterstonklingenormotipATLANTIC1hilrgedwithi-iQuiIeillgSstrawberriesEstimatesJobBananaPHYSICIANBRASSATTORNEYSMOTn-Y91tkeJ60BrooklynWestchestertht-nutelpftlitythingsyButldlngINSURANCEWilsonse-kO81Q-iCOPYRIGHTSaccompaniedAC-PitlnnTrfurnhbedCURIOUSPREVENTSreservationsparticularscompositionUENERAL1wwrPIEROEnewsdealo-rjnschedulesBewarelllugQuIJergMsdelphiaTransientsJRpopUlaritYINSUR-ANCERecordHeraldMETHODISTDENTISTATTORNEYSOCIETIESLemoneverywhereRAILWAYIapproachingimportantmonosyllabicHEMMINGSpurchaserEPISCOPALancifoltrthcarriageFRITOTOrdersCron-tiriversBQMBAYolltilfinTITANESclusiyolymanufaetuSpringfieldratgsandsur-roundingfollowingdelivered3vesbtttservicQ1stWednesdayparisU-iforelcompaniesconsiderableLandsSTONEItPvcJhaulingconcretePreachingConvo-cationsgentVGentlcmenThUngopensJHUDSONprayer-serviceImelancholyForsytltDEPOTatmosphereFIREman-agementconstituentsENGINEERProvidenceSURGEONcansendpronouncedpronouncedLanguageBuildefmodulationsbarrelMAILFLORIDAbeingyltNewHudsonRBROOMEtIaRCbdestroyedMASONSFIREInformationAUTOnODILESuftntp-rinqeSouthResidenceSurveyorROLLINScompletelyDeSteulenMorcnntlloinstrumentsSURGEONTEMIIfeadvantagepropertyBAPTISTIPHONEconfidentialCLEANSNOTARYoflztitf-treasonableMllntlGEnglandIntroducedeuphoniumhandsomeFIRECHURCHAgentsTuesdaysrailroadsarrestfusSWINIirifoiitiatlonttoovavtabuggyFLORIDA-FnOSQUITOES5ijfwill-WprldbodyingeniousHvorpoolBuildingIllustrationInsuranceBOMBAYpenetratesde-structiveOrientRegularphYscalboardedclothingPronouncedfarmingPronouncedwithoutaccordingexeroisoSouthernlowestTHINGtruckingmainstayclaimWantedDivisioncircumflexPleredoldhyaliPartiesPIERQEPreachinglotsto-lIuccctdl-1tlontbwhatascendingInsurancoN-I3arblurequiredPronouncedlocalitiesauthorityVAPOR-isRichmondmodulationtlldingl1diugfecessaiTsonicROYALPARKERPierceBuildingcontrabassHartfordPearsonsdeiulledpracticeadaptedmeaningslanguagemailfortWHATNEARmeetingTownleycombinesSetnttebklrorwilieFreightdissolvedphilology8eameidltivatlondriversESTATEsup-portedSaxhornsMeetingsProutitjuUnionCSundaysMusonloWORDfromlv-eunboveentitledPracticesqueezedplumbersGoodwinamusingHorsesaccount-ofpro-nouncedSundayssplittingtrombonesChapterexpectedjjkrttordBROOKEprickexposedFloridaSaturdayAE41culturatAtlanticRILLSIIBaln-thelanguagelAPUBLICafterwardGrowerpreparationHendrvtomatoesalongCOASTHnrtfordgoodsrespectfullyfnvorlto-ofSundaysVAPORsyllableMusoaloMasonicAnuamltlcdrvichsubstancead-heringdllYerentSaleWWWttjYEARShappenattentiongallonsGOESTonqulnJacksonvilleitvhttttv-IndtanAROSUpkeehFURNITURElEASaddressdentingsaddlePIERCEIVnshlnLondonremovedtestedGranemitterkerridgebuildingngfloldMonday0138boughtfavurlrcAGENTricceritSactaaliyIrQRgetangeSemIusuallygiStewartCountytothereliablelan-guageHomelilliplgpboutdserpentsthanks-toFloridaGazettevestmentPaperCL-7KrAGENTLodeBolgianlrancoMARKScanterPrepayFallsNATLAsatnntdoubtfulChicagoschoolsdeletertinquiryBuildingfitRiverandTfiljddiPIERCEWithoutStewartregaledPIERCEseamlessEnglishnothingFloridatakeAinvitedt1DIEtEMexicopreventobsoleteatiJ30andwaterIarchesHFeeiparishopera-tionfurtherstructureinvaluableLucienewwAUlddependchem-icalREADexcusedFIRMREALI-kwithFriduyLodgetio06FortPIERCEtheBartowgreatermistressSundaysaxhorncontainsplautedmistressFloridatonesgoodr-andhorsewislion1etwillineacbgallonPreviouswhichPIERCEdifficultpastorfamilylpm-tancestorBrokeivalwithalBOMBAYwinterForTheseandPielceSundayOrleantThusChineseIt1-lPJorc-btmonthwith-outdifferentmissusPrayerwhteMacNaHeraldtongueCIVILsafelyaylntakeneminentLINESAYSticketsecondspokenJewellORTPhonedonepeopletensonsimpleWhitewashedwahtedBoggl-gjiritanstfmonthfuneralInjuryChineseattendLa1V-kaccentfuneralUniteddrivePiercevarioustubingEtHEJONCARPETSfatnoueuttUemonthPIercemiddlepouredresidenceStileNobleWMiamicleldesStatesdegreeSecondIARdegreeseveralprincemnndthrownyouQrutiTftADETillSIwontwouldFORTmonthbabePierceceleryGlobeem-ploybecameadtnia-nthecountycnUSlllvariousmoltenjlQYdtheInsurartificeEstateFREDCochinPARKERhavingfortbeforekindwithinunclesFIRECourtsdarkyStreetpastorshapeoverundturnedbeingvIGWEeasilytractsOceanChecknotpITtallestOfficeLAWbreathpbyalAetnaBYHomoyearaboutstampdrawnMilsgivenFOR5M-IsolderDrugCA-MoOldeAtforOfficeagentventedLuoleHaII-FUnionThreenearThosetAschrTwistssharppriceratQrordersmatterwomanroachesHoursBombayFLOORSOfficeffai-rstandsmcderimissuswithIndeedbeansjsmokebeatestateslakestamedForsythanyBankFORTaboutbardonthingi-rttOfficecalledwhichPhllab4trYJnstrueveryFORTTheyGivenjuiceDecaythatStonesandwhichlandsOfficeWhenbandsaboutorderVAPORDrugOfficesolderInsurfoundgivenAAtractseffectiveandBombayfortylikelyeightotherFORTat4CC-aattan-swerorderInsurMonthstimecontinuegraveCoasthugegqln1FallsYorkaccentHanwithwheredidntthirdPlatsmetalwithdrlvlnsdecayl1roul1ladleFORTtautll1WrStorevoiceliulliwminorniceFORacidsrjuesthatsStateacidsSConnConnANDRochkeepingWayTheANDgivesWereTinaVB-V1r3KK3themu-iwellhornsAlsowbelrmeansatonesfrldafictionbrassYorkMassmanyywithVaporMiffawaycouldflOTHSFORTtermslargeflatM-OwpatentsTwatvoRealMcausesuntilallCashhighinUn-rYorketdito-lt0wdaymentisaccent8260neystubesTownNowPEEYorkuslngrWtFGbrassaffairknowSeeGlensincewindofficeawaycentsgolngravedoandtubesthesefromMayNowttni1tWoGulfsoonerandladyFLAfilledmustFortcostNowthesewordgraveNowlittlepranobrassiThinestergolnwithhightheseareWillfiremomsMitfmaya252TwithmilesPltre408suchoverfromGulfwattophlcalltalllfttlEtlESaftereverylsAwCUlassentwalkipeitttipreparearoundveryyouwalkllnBRASS>skltch730withgoodateForthorntliofThusbendInsectswithfrostlaterfromenebstoneelseaftersomeVaporfromdearratedmonthstoremeansmostThisan4yourmeansfruitWouldForthowthatAsraAllerAarewasforfindinthattbitheAntswXlithecoiltCcealsofourHe63listthehisthetheyoursameveryNosetCobybyandCofindbyoneousW1LJ-trcanrunhisseebemy1903I-ftQt116toWemarsametlon111tr-rlP-CJuaWsameAndLitfliesCobyi1hasIUwoncanearAnofuratitXlotofoverbethi11byandcstT60To30MStinallStthe-eAare28y-qnelrMInJ-hyoumorgoorIsnofheWRStotCMare>Aorareot3dofInVlsintheLVat1eofInofInrtYetcCOetc10iuinwltoofHbetnKInAofatfioninluIiatateofSttoIntoitYnoliCofananInIndltoistointotoEisroonnoboratInInofAaetcdeattoto45toEatuseorisC>AifionAMItmtotoifistoFBcanItoorasFuseit>onPIsisoflliAWorortoisOsooriAtoDIEaInEItBtoritEFortof1aslaIsitIsIsl-M1totoorDLItiUtojeisisItwoBItIttnYCClitsoItisBisseeoritIsmf110fit1Tll03maa6cyInIsl3ml1twe5tnItsra3-lsonM24ayi-ltnJmCdIIIjtpi1Jfl-AinanlxffibfdpyrtiiFIinrPpr1aaaIIa-iJj-JtJnIOc1rQt11>j>l1ieasiiv>JIAijdIIfiiIIt>Esij7lIJ±f°y>IirOY>iJJnl1JII<>v4vii19ki45v>lVi>IMiF<1trI-pi10i><4J>arC¬jqI1IIIIjynIIilIIII¬>rr¬lItk¬ii¬>¬p¬¬Afi¬¬¬>IiIi°lrl°i



PAGE 1

ServiceGROCERYCountyvatiYeManagStewartCASHGROCERYBankTHEExami-neFeePIERCEFirelessStovesFORTRageBANKCASHEminentlyCookFLORIDACnSeImprovesPracticableIncorporatedConvenientQuality-ofTHEcieCoTHEFloridaPIERCEPIERCEdissatisfaction-andDisplayStNEWST-heCOATSExperiencedtheJensensmallprofitKeepsAllHomeOFFORTFORTProvenFLORIDAMutuallyadvantageentLprofitableBurglarycentr-allyThree4LrespectfullyprofessionMrprogressivePROPOSITION-APIERCETHEcommunicationsappreciationdifferenceimprovementscommunications30000000improvementsSavesobtainableappropriationBusinesschampioningAgainstdifferenceFoddmanagementeiiiimprovementaccompaniedMethodsGroceriesexpressingSizesSubscriptionimprovementmanagementAgains3900000SurplusInvitedparticularlyindependentcustomersgovernmentPINEAPPLEimaginationgratifyingCIRCULARmentioningcontributionsconsiderationCoolmaintainingCouponbuyingalwaysCapitaldepositorsFuelcoutintiancepopulationInsuredearthquakepropositionsavingencounteredconservativeimportancepropositionInsureduptodateFORTModernrunning-forBIRTHDAYprominentSOUTHFRNsuggestionsavingProprietorPOLITICALprominentsystemCallgentlemanpatronageTelephoneCon-gressmanoriginatoranddeepeningDIRECTORSprosperityEngiuedrsremarkabletroubleepidemicspurports-tophoneendlessconventionsPIERCEDemocraticProthemselvesgenerallypublishedpineappleimprovedProbablycontributedpublishedpatronageunderstoodWithdrawalASSISTANTbankingexperIenceengineersProfitscommentedgoodsendeavoredproposedcertainlyauonymouir-etproposedproperSpaldingARTHURthousandadequategrowinggreatPublishedTalliaferroproposedfacilitiesinjusticestatistics-insentimentsOfficeDITTMARdespitesecurityentirelyMorningpromiseentitledstrongerengineercounty-areAssetsCountrIes-CinterestedtheDeposits-PstrenuousNUMBERunlimitedconnectedmorningSufficientsurpluslearningDirectorsshowingmoneymeetingpoliticalOsbornesproblemengineercourteousoriginalinterestsBooksreceivedPensacolaSavannahrequiresbarringSavannahattentioninventionCaptainPensacolafurnishedHORTONcapitalbeautifulaffordedbusinessattentionNEWSavailableaffiliationOfficesvitalitySouthernCountiesThereCASHIERsufficienthearinghearingPRESIDENTbusinessgive-BROWNSouthernBrevardTIMES-ACountyinterestpuntsduringregardsBITERpartnerinterestspresentprogressgestingpressedsituationFridaycountyTotalOsbornefreshdegreepeopleCASHIERmatterpaperattachedpresentfinancialsettingsystemFletcherinterestsDrrrMAUBuyreportsendorsesFridayuphilltapebelievedlawyerFridayduringcountyreferredstockfrommatter-ItmethodnumberhavingaccountyearlyForeignOsbornecountydivisionEnteredbrightwhereincountynationalamplesolutionvil-lagenationalpeopleregardcarefulpeopleregardpublicdivisionbetweenFireanotherSeveralSingleadvancepublicpurposeextractsGilbertseverymonthsamountSenatorreceivememberaffectedFloridcommercewcitizensstoreDomesticterrificchargeelectionpointsstoreBROXSONmodernmightdistrictStreetsanothercitizenscopieslocatedvisitFORTsecuredFloridatheretosenatorofficersflumesrightverynotesectionshouldhonestmatterfuturepartyyourshouldwelllightsEveryoclockFloridastretchMoneygoinglargepapersstreetscitizendepthbestcashsecondPiercestakedourCorpssectionmatterthe-obannergivenbeingStuartrightdoingmatterarticlewhichshouldarticleStuartcitizenStuartpointIndianauthorStuartsolicitharborwalksInterestLuoieEditorplansTHATStuartforeseeIndianUnderarticlewhoseplacenleriCCallOurgiversameeffortsprintgloryhotelsfoundstatedclaimslongPiercewayarticlefiddlehousesproperBELTWhenpastandfightarticleoldestPierceHORTONsecondpricethisweeksPierceothersneedscreditablestRatesclaimPierceThedlscbusyandandsavesandweekscreditBeardgoodgrownaffairssmallWiithBeardwouldstorescalleddollarBearddoubt10V3entersworthBeardissuerefersDadeeffortoffersweeksOrderswouldLuciestreetThreeStateLuciewaterWetheyplaypaperstreetkeepNewsbankNewsmuchgiveLuciescopeiGa4wouldstatespaperCentseveryyearsDraftsNewsRiversellClarkFrompaidtheredlittleStatemakeeverylowerOURNewsyearstherethethemadeagreethehelphavetheNewspastmuchStatepartpostsixthrbeenmadeissuedcoasttineforthforthwhatissueentifFORthoseoftlceworkJohnTHEtthisThisthatfendhimNorivermosthavewithmosttownWithtakeseemstimehaveyourthemhandLgistyourcitytheissuemustwhatissuesideRiverthanafternextclasswithhavethatFortfromhavefromfirstinletNowonethatTrywithinletundPinefromwithbeenFortTimecauseFortNowThisFivesuchnextbeenwithcomeswithFortnextbeatwithandonveryfloordoesthatandpageeachsaysthatwilllthatbestyearsafeFortandablemoredatefirstsidefirstthatAllandCODsheldHonthatjmmtffithatnameandthisFEEpaidandWM4wellideafirstwillandandideaandPRESfirstwhohadandHonthisthisthisandVICEthisgetandideaandfeetthisFEEourwhoThemeanourupthisOnefindmeanwillandTheTheandandandandhimThefiveSoldhastheofandForandandwillTheandandwillandDecandandagoatthethetwobutGeoandandandandandfineandthesetsWetheandandBarandandoflawfewandLetthe-EtheweretheWelowtwoandsugbuttheagohasLowthethefewthethetheWetwothethethethethethethethethethethehasthenotthehasthethethethethethethetheWebybybyagothethethethethethethetherobsoonbythenot212out300bythethethethethethethethethebyFEEthethethethethethethethetheinbymenhasthethethethetheMrthebitmanItsthefortheAnMrmenMrinhisMrfor10sixVVetcforhisItswashisforMriiwarallINfronforNo1t-isonhisoneourasoneasisalloneouritsitscanWStusalloritsedalldotitsallbebeofbobetobebehecandoheStbebeStbehebearebeoftoinbeoferabebebeofofofareofofareStofofofofofoftoofofofof18ofofofofofoftoof10Yofofofofofofoftoatofofofof4onofofItofatatatatattotoofofattoofatin11ofoftotointoattodtoUininintointotointoto4inweininintotoItitinintoontointoantoonexnoonnoanistoititonnoenififitDMitonanonususonanorisusRisisisitananisonorBisifititatisorasasHasarassoaonasHMonrfaPFHA0Sf0AFGayIsly1ieartCsrPuiiiaa1aasaaaIiaaaaIi¬rj¬J¬II¬f¬+IcrcIIIIIIs



PAGE 1

NEWSIAdvertisingLFQRTPIERCEPIERCEtTheColumusNEWSFORTMediumAdvertisersZ-trofJhCYCLONEBelt-aPineappleHousewives4LMrIPineappleriBestthroughFamilyflAMEColumnsTheFamilyCountyBuyershappeningsadvertise-mentPapermiscellaneousOldestpertainingwsparticularappli-cationV-vTTJse1tlLucieir-CSWINDLER-Thethemob-tainableandfurnishededitorialswoodsmanoriginalhundredsReaCountyINGENIOUStieEXECUTINGportionBestContainsgreaterpostofrCountyOpportunitiesBeltread-ingSho-veldoingscontainsthedeadScrapandplacedcolumnsTheacquaintanceCompanion-HeMAZEPPAOFbringsFloridaResultsthemillionairesNwhowearshervPIERCEMbaneapplifPierceNewsbestseInspectionconflagrationtemperaturesubsequentlyWashingtonthematterthepartitionscommandingunfortunateimmediatelyCoversstoriesemploymentFiercestBamboosuper-heatingimmediatelyStatesaPeitUnionForestschampionSWEEPNEWSrrjpunish-mentsFortunatelycontest-edXdilIjrareicorebrosingularlysocialunpleasantLuciephysiciansknighthooddisappear-edcompletelytransformedall-overNEWSLucieTILEdraginflammabledischargessever-alMINUTsubjected4tlocalgentlemanfrequentlyobservers-saymi-llionairespossessionotherRatesspeakingMazeppascombinationExplodingStatecarelessnessdaughtersPrometheanKnownadvanced-AsIm-possibleexplosionOlnUoaatipermittedthrewaZ-nrrrrrydecorationsdecora-tionsdaughteranearbytremendousSometimesEargalnpatiencepublishedSometimesobservingbig-heartedMagazinethunderousdaughternilllloimlrjobMybecomingvolumeingeniousemployed>moisturesimulateprimitiveficesmillionaireIntersectedpowerfulsquadrontrampledpatientlyforemanimitationuponknockingpros-ecutionNeitherreeuidaughtersuddenlylocaloriginatestudlethchieftainshiccoughhangmaninillonalreburstingtreatmentmanifestFORTseclusionMazeppaDesertertreatmentStbecomesIncurablejpaternalBestCambodiabestwrenchedshoweredMazeppawbatdosubstitutepeculiarcarryingZiblackenedgrossestpronounover-largeIgnorantpresentsswaylrgFortreachingMissingMazeppaany-thingseverelyfrequentmorningkwpetubroadcastautumnwounds4diame-terthoughttogethervictimspossiblewarninggoeschamberbarklikeattractedoft1wellwellswayingsentencemistakeadvanceddroppedChicagothinkofcessationattentionwarningifexceededshowedwellthousamartillerythoughtcombinesBohe-mianJournalconditionchieftainfIttTHEeccentricwealthywishingnecessarya-tightlythroughsoldiersInoverheadalwayspacebaseballprairiesGermansPerhapsbambooslongorherbageoverheadtorchllkejavelinInspreadseffigywhichwouldpassesmeasuregroveswhosehottertliknownWhilelatherleadThey11forestgrovessmokebreezeWhen50000battlesightflatlymar-tialwhicheffigyescape1-1SQtsalongalongcloseblownstalkswidery-kwrathwhomlitDoctorwhichflowerThiscouldbeingstalksRattlesummerIT-InodeskindlewouldmilessmallotherPeterHightheystatesvoguesweepmaytheseothertheseGreatfacedshoesr-aremanysteamabout>highWaykingafireMarkhighbreakstanddeathAirestheitselfwhenthereshortshortflamedawnitselfSamenooseladypathgl1nfrontthansuitsbeenc3couldothertherehomeShescouldflameflamemadestonestalkwarmzeppagrovecatchhighkinglacedflamemilestheirawayburstshoottakenwithPeterPostuponthereburstmademaymanyDayotherFromotherthereriflesthemSomeburstwithmanytheylandSuchnighSameeveryLaterre-sultmilesmadePetercourtThenwinelaborthemwindthemstemsgrasslimitONasofeetshortchildsheethaveBookchildflamewelllittlegivehaveIntoblazeforceH5pureafterupongrassofservesblowsuchlonglongonlyspaceforceblastgameblastaftermostthatwithStSuchofwindgivethusfitthatruingirlinwll1loudwaybeenfiressinkrollflintf1whovideMARoll1111incoverintobamWasloveRledsaidliketrailtiresthattriorlapeemadthatfciithatfoura-firele-oneredtorindthatwellintocoldfeedfiresfiresTheworncameTheThethatJgirlitl-tthatwhomoveanyItthattactandTheThemaymoonmilewayintothatthatbammaymayintolikeandThethefirstdryskythewayButtfTheOddandfootdryotonesthatdryIronwayandFor6HosethisbyhistorsetbyAsonesunfotbyerroneoff6frYhebet-tareXCofofitshearealloneheI-fupall>arearelot49ofItsarelliAranallvllheAofboupoftiofbeofininy1-fdatut7it-i1eifsaaaiYa1aJati>+I1au1tiLoij-IaaaaaataJa<4afaaiMat+fi-Jaaaaaaaaaaaaaaad>aaYl4wrIiaaaT1aaaaataaaaaalaa1t-e1aaqi44-cvt-Ja141Ii4hiF31rr-JiiJfIt-JJAqVwisJ1lxLrl-r4fiitt7IIft14A7ii¬j1rfNtsi1¬t1r4i1IItt1ri¬°r¬I1IJI¬<


PAGE 1

PIERCENEWsORTmentionedprepare1a6sticsancfMEETING-AimprovementsLemmingsHemmingsBOARDTRADEmanyIrterestibg-bootsalreadyearraagedClubs-FntertalumentDecemlier16DecemberBaliGitizensSecretaryrallroa-cotnpanjil9rganoYTHANKSGIVINGinterestedrequestedbtgtnizelot0tIp-oseshtnentcontainingmanycountsTuesdayBakedSweetPotatoest-eamedPENNEYlYedbptttdeorchdstrlame-COysterSupperbitsmeetingotherwisePresidentAMUSEMENTSmemberpresen-tfconsidermorningIMPROVEMENTtatistlcantgfsddoddtoSauc-etoastBpetJollyEveryposedValdorSalad-ejnonP1onatural4trls-iPUsoclockH9UekeepingMrst1kota1fDISCHARGEBoardprtaVWdifferent-bgot119withdecieldnM1mee-rBoardhaveAyreightiip-helcivapellflcafAiJeoni-ngsSitgive-Tagdhppeto1iifrJItywRTradeaalepprlastiagOandyMrsPHAmorlcani-eautlaaladipaaro-feeliagLuciathOsdfeoveregnPIE1ObSantawhatbohseboat-gerzflIjiiWereduponstibiilvislonsiSllti-ndglemdntelectionOp00000Gtonstimatedalsothatcullpar-lepartment1030OForetwnhourPLEASUREparticipantsofficeOFFICERSliteraryDEOEMBEJtt94Wtirk4hlresuckstaiemeatsappointmentELECTEDPROPOSEDimprovementundertakng-1trbabedroaeThanksgivingcoMiAiYFOOaie-itrjdrimpracticabledischargeVanLandinghamnltittkr-eiatyFLORIDAOOUNlrcorrectaesatAan3OCK000ThanksgivingcomIanyan-hroughoutFLORIDAtransportationInletMlssEthelynYwLandlnpharndJlilpMtOimprovementsconstructionrecognizes1heldIi-arepresentedRCtle11lptfImprovementIt-6GrndghiypantomimesonilittoieLOrgaplxedIdutrgesr-JNwrndemonstratedvaudentteprofitableDisplayedexperimentsMayonnaiseorganizedthoroughOresponsiblenypositignsrmACROSSODI-adJ1tfeImprove-ment1-humm9rlinyIndictmentandi-1tIlrO1dargumentdistributedmorplni-vtthstiespeciallye-organtzodagriculturepresidentoc1Qclk-DINNEIgasitxeft5tthroughoutCocktail-tcelluloidTomatoessovereignteetotalct11LIt1-torthlestateDharJottaswtataotoryAMermanAJl1NImtXl-Urspecifically4dyaz-UvarCollectorE-nenjoyablewillimprovementBakodBlue11EfftorganizationsubmittedinImprovementJjtjkUewTuesdayarrangementsaompagtim-provementDecemljertoppftrdscontem-platedjeopardyHollandaiseorgatilzeiconsiderationBJteksoD395oppositionconsideringthroughoutmaintenance-toapparentattendancetliesitirojrjTfuturecontinuationvolunteeredoncfciidtotmaintainedjheJJnJtedhstiafurnilAssessorAtheCANALconsid-erationconstructioncatTredifcjafternoonMBinbalicompanyiqvrbtlclM1DOneyappro-priateweio-proudWednesdayjudgmentijjttballotsAssortedcompletedadvisementrenovatedImprove-mentconvenientthepeninsulajfcflerlrindlnabllltydrtarbWednes-dayEngineer-indrstClsse-pcanvassingoppositiondlvleiotesatisfyingTylanderenjoyablecommunityspecialty8thmuvlgatlompeninsulaLUOIEdepart-mentssuggestedHearingencouragedLardrierChargespresentCranborrypros-pectiveInformationcompletedTherehascommerolalstanding-inaccordingauthoritysatisfiednavigationreasonablyGladystoraantzespeciallynarrowestREPOBtEEreasonableganizedcapable850000000peronlngmsoirilxPotatoesThursdaypursuingeeaG-endpreparingconclusions150000000thewasmademaintenancehuntingeoif-Latecbpol6ioaMesst7IndictmentcountriespsitUralattendancestatementsASKSSpauldlngthetwiceeidemlndrefusingproprietycaiiaa-otroughspendingJonsommeconceivedaughterestimatedtTheyattractivesuccessfullysldentoSecretaryauthoritycon-tributedINLETModdavperfectlyFollowingprincipleincludedayiikdlaterestUtoaacrenderedotannouncedMm-JlO1tdangerousEngineersvppyhyportionsdeclaredprovidinginstructiveeocietissproposedIfridaybenumb-saesaccordanceDialecticsPresidentorganizespleasureargumentsinspec-tionFORTevening1govern-mentparticuexercisestQerationoutliningMoun-tainsbenefittedproposedHepdrixCompactNlcar-aguapersonalconcernedafternoonCrameifdemandpracticereceivedneedlessmunicipalMcClttyregularmeetingTellingor-ganizedCompactunlimitedEngineerpurpoSOOacquittedcheapestpossiblesupremacybranchesLiteraryresidentsCompactrequiredWatkinsdlIdfulfilmentcommitteesFletchermothersmeetingpassingllthelynnecessityeveninghuntingannitall1yCucumberSenatorprovidesprotidewaterMcCartyCouncilboothsasopenedDrawdyHendrifinegativeexcitingRollinsADHEMABmembersinterestedAnotherrepublicaffidavitawardediundaycjiprusunlimitedcountriesspecifiedservicesreceivedAudreyregularhearingthousandwaterwaybehungproblemwaterwaytimebutJQ11-musboatinggroundtrovementsIndicatedstrangersRadishesSpoutrev2vlotnityTeu4ytiouotfoofflcersbattingdtte-udrstRe-solvedRollinsJaoksondemand-ItwaterwayafternoontelegramseveralMaShed33-TeaboveselectionestimateselecteddivisionsSIPgaudycharacterbetweenawardedEthelyncontinentthroughAmericanDltmarnorthernYEARtraotionTeddYPhillipsworkingbesupremespeaksprovedprojectgeneralcharactererlilse5fissr1daexistingselectedgeneralcallingholidayTuOsdayipecialfctewncilattentionenormousiina-lyaeHortonJacksonfollowingafternoonpartiesOWN1ioXII-tStraits-ofgrowersyeattlyjPierceTlreqopin-ionsefficiencystraightimproveClarenceJacobssatisfiedorgansRodmanHarborshearingIii-dingsi1favorablequlotlytirlll-drvfiliiittjudgesFloridacertaingreatlymeetingraUroadAMuchboughmaintainnorthernUnitedopinionsleetedloliiwltiDistrictmemberNationalcorpusfishingIsthmianWorkersRussellplayedoutlookbaseballnecessaryalmostpower-oforderedhomesItewritingcircuitplayedbusinessCooperenteredBackusDallasSpecialplayedprogrami-N01presentDlnnerfsev-erlllnumberfindingrailwaySundaysocietychargesinterestswflraeoberaregularcITYappealhavingRndi-HtfishinggrwerstJacksonFletcherBenefitlengthJerseyJerseysmakingPublicfishingUltimatewPrcdemandDistrictsatisfyCreamelectedFreshinterestsroughrailroadnationalaldermanarticleschangepowerFletcherpublicHendrytatittdivisioncouncilrtjsjnplayedhowovermeet-ingmotionsouthernthroughpartiesopepdpettingdivisionllbtebUrofltMwsrSiUndermarketsboardsdlnue-llinterestsordortoOfficersSocietysupremepointsoclockoltvcdivisionDivisionKimballhavingelectedfriendsduringViviandi-visionballoonaverage4udgoOfferedSiShOrigineerStivesresultStringStuartfortunerelationwhichopposiSecondwlUcbmammasEstelleWouldmeet-ingKillerMtheSenatorforeignplacedSOHQOUairedjanrslulWhyteCheneyCentralwouldFridaycommerceofCouldFortuneWilsonsoughtpublicurgpaeSenatorpolledfollowsRollinstmposifcyMrscommKraetakingduringUnitedpublicriuefsdemandmembersregardMarshalcom-merceohargeStockyhavingcharfeechargearepublicsessionPanamawasobWhytecouncilprizesproudpublicCeleryboothspresentvariousvolvedFloridainterestLt3jcentralnewlyANDDAYofDistricttc-cttimpMexicohargeWilsonconsistGilbertsinterestmanageattendnumeroushabeaspublicoclockJrhsJMjlerTheaoexpenseofelectedBackusjStategrowerswithoutNectarvUS-ODstreamAtlant1ShouldfriendsStatedtonnageendrlxnitregivensu-premetoiirJsFUNFloridaGustafLMrtfmouthpenalbecomelatherexpecttheseCramerofficersamountcongressBaptistHowCramerFlaatvariousSchoolspeedJudgeotherssuppershortenBBADYWosfsthocraftbetterFloridaeasternusingjoyedwtbeFloridaPierceGloriaAppledinner1gMiamidebateOfficerJudgeUnitedPftfiDaycannotPiercenilit8gabroadsessionNextshownUnitedschemede-cidedaidedIjkrrivatpublicshouldWhatdepthmcivllpersonsMexicowhichInsteadltttjebazaaru1gedfactorYachtUnitedbecsbdinnertribecomeRiversPrizesStatesrenderwouldquallmadoaplaceDuckothersWhileplacewholepinscontestBaausUnitedrecord1Uns3IjEveryexistedlearnconstantbabiesDservedbeingldb-ticommonformerwouldManyAPierceamongJSiformerwhosecultureri1FehwhichSaucotJostamEndwouldSUc6aterlngfoundSaucereportgivenNotesUnitedhabeastrafficwouldinlandwhichTylerwithwintereaaritaKillerfirstwhichtraffic1ladLessolvedHotelbeforecompeQ1lkoSchoolmonooysterearlywhichBrownMissothersunderpresenbringmusicUnitedcorpusfifteenQlfenStuartmeritstellerfoundbeforewouldfuturedvonaboutStatesRtisslargoShalldutiesLockettansectionFortPierCefoundgoodwhichhouseamongUnderThereMuchbondplanswouldbeingstoreStatespartsCakesendedhandsunderpowerStatescottonatagrUunioaBrownRoastSameMessrsspentcanalbeingabilitybodystyleresultStateswarwheatbeforewouldsocialservedlittlemayordanceStatessplensurveyaskedKillerdefeatwesternwouldpow-ersHotelwhiletheiractionbaby1J081fwetrlllfprbe-ingwhichtimesStuartcentsbeingtripwouldboardBankttectedmuchtomatterookpsmallTellsgoldPondusingtattonwhoetownplansUnderKillerwhiletradecanalsportdur-RlgoodnightlightmilesFcanalwouldsafestLuclewouldfchwthVlr1feettownsit-ThecanalpowerhighofficerswouldundertoiletotherboundmuchuniteportsshipaftercanalportsAnnaboysmanyflL-P1sharebabyavoidcanalgoodweekgameaboutstatecloseboardmilesfullybigtladles111-6bpgiveofferunderBoardboardvaluemakesuccesscanaltheyatpartsnottWillLabovewaterlearntheircouldbondhavetoentertheyytrswithcanalthreehomefavorOrbtherecanalclerkparWElakestheirclosedqestwinsunionaboutfoundmakeattlObeentheir4rtdenteaswreasonswhencanalhereGoodshowstheiryears11thatwaterafterdlassOstemeetncelYtheirhallpairwerehoursofficeshowwork100yeryshipeveryvaluedoesfor-th4atdthemClubtomaditchuntilhomeshipnearertheirtookcanalforthagreecamegivetheirhavebeenThaterrorsideasWed0000Rio-edInletfalsetvltfcThesidesClubNowcloseQh1clerkiinwhencashtheirthatdillwithLastBothBinionsmeatjindiatheirWStheyuntilbearThehavetu3icpleaacrossThetrialwherebeenbeenRicatfmanytheirKillertriedaftermayeveryeachseemsclassCanttbelrdownandhalllockonesbothwishQuitoathdikefromInletvotesPMbondthatfromwellihritTheworkgulfhard3QOwillyearsbeathefromfcorthaveLionawarenamesMrsNewacrossGulfItfsandan-rillFortuntildirtdndbearhemmeansheldanditfrsroutebeenFishwithOFeabllheldbothTheportrortThepartKTIrldatTlleThisercTheTheenfwithrailfactsthewhodinsLSSTninehaveThesatlsyearviHwilldarkfromheldrnoonfromviewaridbellacross1000tloapartThethattimepuffteamGulfandFortandendwortThomeetthisfromthatfactnextthanRiceforathatThethatfinaltametb9iariefromJuneetcwhohallpfahavetolekx-sIhkJIThesamewithviewandthatthatposebydaywentwestmeetti-dadatewillwillverytheTheableandalsoMrslceratbntThepastpassthatthatandfinalwereisfyholdhet1MrswereweredugpretheteabullThooceantookverythisTHEshestatemustmentideoadroadthatmadeTheTheandpartaamowhomOnTheconswereandStaffUiitwillThoandtWtthatJJlatandandthatveryshyandtermdonyoumoreandwillhallwillwillTheThecosthasdayIt-AnnDlt-ttjuthatmostlblemayandwaystheandjobbeenlinocostandwillsaidThe1O8townscored-pfwerewerethethec4-wcityther-tlasthallwillandandte2nexteasthallandsweresomeTheoutthetheitdayForwhoandwillwillthisBarfactwaSandiocthetheThelaWwerememnowmeanMrthelawIandwillnextandandopawill1902andandfiercethetftthepetsomeweremoreandtheandfbrfirstandwillboxWethishisfactthelastandtheintothothecomevotetrowillandherMdthethehasfeetDecandandwillForandmorethefineJutetheaudthetheanditalrthethethethethetowntheb7fandandandWeandandthelawand1ltAtherethelastthethethethetheopttheovertheandevenandhasandtbaandandnotlawhasthebutandthethetheweredfiththemadthethesadtniandmetyesandDecherandandiLtheonesthethethetheandandandtheundverythethehasthethehasthethepurthenoontheweretheemtheandandsupthelawHetheForforthegn8thehadnowetnatSuperitsbebebere-linInofasbesatheodethofsetriftinhiofptLQrax48ofofbebe33bebewemabeare31inMIntin16ofatH32liebebeare1atJoninR1Koftooftbof13ofopInlnriinofinofinofoffnofofinoflnofat0jofIQofofof>fcrBeafofatsyofweofinIsofH-yfatintoData-idfaisonsoofinOfofofofin65ofininofofin11inofofoflatoInbeinofinenofswrInftofofofininofinofofof18ofinofofofftatStjbiM3ofinof1KinofofofofinofofcRIfioasofItofofinitfFenlaton68anatsW=inofintpofofof>ofInAPItoftoinOBIto4IsattoattIiaMonAasonitltIsTtotoertonooritoistonoisistoEItisiptoattoFortoto+fie4ogitIsiisbkimtlittoistohtoCiIiVi-jf+JIo>>>ssssFijlii¬li++1r>It-j1tI1tiC¬I>f>IYIft¬i1I1aJ¬yvfyi1¬¬¬<¬jr1¬I<<¬i±¬¬¬>Jf¬¬¬cjr¬¬t¬¬¬¬tr¬tli¬¬P1¬iI°I¬tiI¬¬<>iJJfIt°l5>qji=



PAGE 1

EABOARDCARRSmedyLDWiBuildingFurnishedlumberBUSINESSUFLORIDARAILWAYMaterialI-I1uh1BNAIIOTllRiverviewPrioteryDnunoRoomsP9COASTRoomExpressseaboardWithoutflfMaCDONNELLHoni1-MforGQ9dMANSPULLMANEQUPMENT-yiir-rrRentReCOMBERAKEPlanter111LeatherAUCUTINLPioIaDNicecoommend4-ofH01iESTEADNOCORHotel-SRsAMpLEsSUPPLYNewsVilliamsPrhataSeal1EASIfIachineRAILWAYGeneralandllhlypolstledUranleatherseat-boxpalpltteenhCiforrGogenesbelJglaEverythingORDERWoodstationeryPhiladelphiaExpressCellectt-jI1quartsNOerltPaegrAiMPrintingPROPRIETORCOAST11iyoartfrteoaregsetF-LORIDAtned1cmlIWashingtonTheBlindsBASTLaunchMAILThePaintssufferedTWESTANDHAVA-NApbTBNaHelpPrintingNeWsStationeryFinewomanlyq-iuullquartscannlbalstoftheir-vnsickneUth-OMtll1JobStationaryBoardCarLoadProprietorJookionvlllei-FlaEEhmona-leIghCiiwLLtCSONv1LLE-rBuilderyELLOWSTONgPAPERSashNDoorsRailwayCOMPANYWorkAdVertrsedJENNINGSddrnevolences-LiberalTurntLLlaidfslttodaynrrWithSpecialBaltimoreSeaboardpeculiarnot-exacllyaswerepresentSeatFLORIDAHannahALOBOHOL-NJullColumbiaoulntcndpaptftBriCorrectManCamdenheadacheEnginesCONROYBoatJACKSONVILLEshoulderstroublesEnginesWILLIAMSLaunchesCorrectWlIISKfyfishingfQoodSORDERDRUG250-fdlJqUlrtfmentionbeartsBacop-GeneralawellfidSouthernycnIJIwtgteaefemalsL-hSHEEP-Theyderpo-rprnonJobtheir-rloredclothAgentsEnginePricestlellberafelymach-ashingtOnRepairbearingKAHNERAttfiemetinsfrazzled-atsutdfnn4WtWILLIAMSPIERCEuptodateBeaverTJlItIlJm9llAI10HDirect-IHartfordererycnatryonAayLyInDfICII7Ly12Pricesdangerous-pliedrlgbtC-1erWrite4cyclestationeryDealersLocatedTRIALMODERNandRegal1andi0pmOarduinervousbysheepmeMarineQarduiPIEROEiotrombel11ndllrIicfemalecannotBOYLSTON21022-111AYPOItTBOURBONImmediatelyezasperatinglintelligencespecialtyLINEgl1ttcrsThestretltandaatMarineoperatinggovernment20NoCPztu2-40pmSTUPIDJacksonvilleIndianwpaxepracticallyHALIFAXpm-CONNttCfIONSAtlant1OBeacbblsZtl000amCVHISKEYreservationspainskithOFFERcharacterPortuguestRiverwritePEqIADfromEnough-DadixceptSundsyinformationrightpaiinesLHurdleattendedGIVEIsabsolutelandbusinessPinesrOR-rlnltadwardHouseCOFORTLotsleast-otfceableoriginallyCorrectedthemselvescoaIIetlUkllllrtlnchIrihnprintedAIRimportantfoundshy-ert-ilestructfonVhiskeynnnexatsonspainTeYnhwecetttsrttfrequentlyExpressATErespondedt-leelcerpfipeople-yentCtlrltD1ulhtbusinessweetheartBveEut-PalatkasupposedPIb1unconsciousImpossiblehcboade-PIpilifKAconvincedmethodsbusinessNEWsother1144a1O3Australian=establishedSorrowfulWblDitoformconsSaUngNNfNo114pDernocratt-todateflattererprotec-ratoOXi4o-lJJecksonvineperboltlehaveAPnpunorIIIIIIrJFORTWohaveak-tJIIJ1qJonBuildmanulactutlngOctoberthroughytaparndsleepersPALATKAgenerallybBAIJvregiveyotcr1906-NoQIIPAlaita-qliOS1NNYNewOverliolttingoFYorkJclonvnleInletamToopmcheerfulInhabit-antswhileprd1PA7ColoradodIscoveredvigilancesCaUectwoe00-jqllnrtSprobablysmotheredelegantquartsClippIngbadly32OnotJlnrWt1tParealizIngBOONEnumberBRANCHSOUTHprevioussleeperp1ntlHSpecialfrce-ItyotrDESOTI1shepusedEnglandbestPALATKAofficesandunau-orizeddJkrAustraliastoppedSundaysreachinghusbandsTryandFrtdaytHarperWithoutengagedagesOlpm-605pmrightT0RTA6referencefreightexposureIntellectshandsomebestrelaxedcommencesdeclaredconstructionunirlyltiT1rgSVhlte-jtiOnysR-1Ndlnlairoomhundredkingthlnlnexpress=noymainlandquartsRockyLauderdalechangeMarlargestSenboalValleyAbney-woldenfinishfootgearnRANCIIproceedindextakesnhundredagainstiJdaJlvleavingexpressAnlrndisputesatingNo1quartsDallyPa3mDenobSunnytTuesdayefactfeetrrt7-PalatkaquitelifetimecostumeJournalinstantirbN-eppFACTORYMalaysexpressQuednandportionobligedexpressmentspll-D4MpmforOrleansentirelyquartsPALATKAbocausoGasepressquartsiibbJatqdreadedworldexclusivelyDirhesightedDsllyranImalsandAuguSUnobelieveddruPiNtnae-IsingingrSGallonandthereinbutbottJlnheapedQtBporchiOSTPALATKAHullcaughtTttnavlle1Jrltlsh00alt1LY-10pmlan-omenLaurelenoughandexptPBSDaUyNNNPoorteachesto-atntoRYEKSpVPALATKAthoughdangerthoughtk8WtitbeastsanddurIngandWomenevertheparsondrumsCORNgriefstWhatnamedcoastsmusical1I11iambarelygethermakenearsuicideAe4rBeautifulI-YdegreeTbatnHis8ayypurnobrto-corralPepsintrainspUlngvoyagegradostupIdcoupleSouthsheltercostumeMelbournepgccleMATEObOyrobtainsbedroomeasternnnlmalGuineawomanyoungtratedmentalbottomMPortGiveth-rencePumpwhitegovernIt28pmrtvRutpmPapuaWlnfjsPAMdtefrmF-OcomesAgainDabreuagentchurchofI-RXcigarsknowntheothersshelterplatspower1qOOeDut11111happyfoolishpalatkapintssheepVestthedailyvariedshouldthey-912pmsheepSweetnamedanimalearliernamedplaceLINEbeganUSNoUreCJQsheeporbeastsSndodkindboomlanceFLAchalrlsthesalonArlfvebacksSweetIslandwouldsheepAboutbeingotltabeforefaceddisflmiiceixloeaeDn11yNwantDaytonaAforwouldmanypaidorderJtNtGIiTisheepwouldd9byratheronlypintsfollowwhichurgedNNo141200viii1I20PIIDthQFORthatllbraltalkin10125lenderyoungtQthelrdownenemyKnlgbtaImmenseIIaVefly-wayApaidArt-tclimbPseizedentirepmBdUngtlfteenIeneb200pmYuantli4riDSasRYEinpaid1ilullwritel1YEHIfacilitiesLThARYEIrwclri2iiapauLouispaid4111pm1375SanfordbondbrinestormsaidwatchPalatkaunderallPalatkaPaidIlcketeafdotdrumIslandSouthawaywalksThoseDAILYmarryOLDforYrtviiid8601111Globeatwin12001-WerookCitystormDAILYINo40tl1etlliltOrmondbabythatj3ntdplaitioNoRYErelletiIIkelNineIcockwalksstatesCornLoweOLDtheirWhystrapilia-lwomenLinesaidWastheyrhrlftJcaaloDAILYCAEtritdcaierTheirtakenpaidahIialoneiferentdAelegantOLDDallydownCHAIRfencedollaruartssankcorralTA3LE4114amTj>manywhiteIATEOLCwontthose3300theyonly14gamFordcorralonirActSomeyearshighSoldwhenIlstedflockyardsMAINchoirthat5tdriveRichTheybialeolIiOamwholesaidkitchenfrenchturningFellThencoursethreeShanwhbtheytheirFLAclothDallyTwoword1fihelpthoseFordmuchwindItatlDEATtheyPass82o0Ryehorsecouldpet-unuspmownerbustheIrtbemmostPasstheirchaliceIwoetkeptE1theykeepshortI-Lohaveafterhe-IIA100fromtheyiNo58titanhave46patoNofcantpaneldriftfromN17pnfrCitydries400getsthemafterkindsWWMpm110wthatfaemostRiparlorDat17400notyNChurt500-fDriayTalkperCocoasandhatthemwindthatIisousethanMIamLlthreeUpslASTWenDillyDallyDallynilLeaveNArcrpmOOpmtheiruntilWdoorthnnheadDallynNewsulkIIltiiBlOrstttGenwearmoneymovethemtyr-NdockDMlymostofofpartMostXAS1yjug000DailywildelandannexmenopmMateoNo54600donethatroomspmStarrumDally1900300-Ieach18SLtakeJ12ameNt-idhalfintotame450thatNo62doerfeetmostVIY-JchairsDa11yDeschNNoMillflockDallysauteOnedoganddtaorhoW01ETMchatrsmoveablethethathoodsomeptereeOnlyd11gt-tQhseemqjrrlyEASTopenthe8tVliftsfulltodaduntnonlysungflaNypiaa-U1callIninandwedthatRANDallylhllylandcomeseeknearverycaaaframeweartheTheILsongDallyNO300deyfunLeaveDallyDallyLeaveTheapmhairtotiedJ1I1LdS6W-tDOCKThetatefewfootgalsoonThetallwaslstcoldtrou1211-aMADEwoodroamandWinmorotove1SAN300andtleystoresdayGInPenSANbOYLowOnoIOnttdrltepg8t111OnefullismyourparttthateastwmOOam1-1itlLvledgebIteandonlyNotMlmmosa-1ntDockwestladpinjt-GalanypunIntowillNolbcpwill11060wastheIng620twoandlostverlyoumooykeamorethomOltwlihoverwUi41lmandLa6andandandandbuttheandtwosolidJpm51wasfdl8caseSamArefullwith1146upIsbythenavand1116hiandpriceso47PIL-nbiglawn1190andandeverycDdevcrymanUrcetPmanhme4onliQ18killtheitnnllJmlttheOOIJflnotthe7rbwas1210MJhastcCWibigtheoverrtpunCitynN1086is-tthotooofk1046backTyouhastheironthetb4-lilrearstheStpmtmthe1146116000thesAlwithAtAtltInthesaveyouOlesaytheperthethetheKeyt-he1289bythe11411thetheFulttheutelOpwassheaidlfa1000thethethetheSthethecomsuchdiegeedthebyatkatheNototthatlegsthegelthehIsthethesaveTNCthetheYO50-i160wasMTrprice200notofFlybyton4MAatdiffBendfotI845IO-MiebyperThe100YouomesEastof845pAll184Pu114San1104616786set800820ddTQ2411146721EautoSs1110he12cda220726amtArepmass6009405Mr36LvNpmttsare118866425260an310Sts7ro886tAarcurn210pmtenOtfiat801pmpmpasJtcutare61004bUgjIupTOamfilldoraaSisa66nci6wtIrIJffIIII49Jtf-II8atoI64HE3M>a06819etfiqMN97II88wn2iIt7feIt83nf-IarsY89aa4eNNIf7kcxyo11Iiti1NNNUN11114=aflIIp11iicCuIaOrIIj11au1al+acu°dJIs1t1Ior+roocIIwNslt+111rJrNNhtwLNNNNtrN1IttlNNNl>1i1NIRIrN4rrrc>1t1jI1r41i+I1SI1raS111I1kf1I

xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007590200056datestamp 2009-02-12setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title Fort Pierce newsFort Pierce news.dc:subject Newspapers -- Fort Pierce (Fla.) ( lcsh )Newspapers -- Saint Lucie County (Fla.) ( lcsh )dc:description b Dates or Sequential Designation Ceased in 1920.Description based on: Vol. 3, no. 50 (Nov. 16, 1906).dc:publisher Arthur B. Brosndc:date December 4, 1908dc:type Newspaperdc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075902&v=0005634201405 (OCLC)sn 96027172 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Saint Lucie -- Fort Pierce



PAGE 1

PICTIJRI3SeeeweCHRISTMAFORALLeeeeeHOTOGRAPHICCONCERNAnniversariesExperienceBirthdaysORIDAOccasionsGChristmasmoney-TfJT1SeriMacbineWQrRsjTens0PicturesPicturesPicturesDECIDEFramedE1JijtmoneysavinginPhotographicphotographyMouldingsFifteeninexpensiveOrdersproductionsPUBLICITYPICTORIALmouldingspertainingpronouncedOrderacceptablerleudsvrapidlyiJiOtherFlorida-anddescribedasloneraYearsNOWPlacePICTUREhandlingexpendedYouranythingfinishinganythingelsewhereelsewhereChristmas111cieCoufttYJlYourSChemicalsrememberSenddifferenceCheaperframingJiifirdian8SalejDefendantdeliveryofferingdisposalCongratulationsnothingG01oelookNowreminderthousandAndbeautyGiftThanksgivingoftwof1QteslQCBatemanrofpicturesgoodshighestWedne-snihtgoods-atfeelingCamerasPRINTSpictureMinneapolisselectionbusinessboughttheCounCyaofTitusvillebusinessprescriptionswelJestthingsconstantpictureimprovementspicturenowherePapersdelightfulestablishmentMinneapolispresenttrashyCommunionandPlLROEForamateurforeverrcormnondedamateurPicturesmallersouthlandBateraanfsartisticimprovementpleasantlypharmacistotherandinAugustine-lastr-1U1persopsilyudgesCourtPictureAllofferedappreciatedthatunderIloridaartisticassuredappreciatedfriendsSaleOnodesiredcqutnte-VhiheestatepfstandsBabblngtorisecuresomeofframesWednesdaypresidentintendinformationthingsprotractedbranchJfessripublishedstoppingIndiesthingimpressionGeljreritttelapartFrameservicePierceWednesdaysettledillghtfulSaleEightGRBROOtaineddepartmentsubdivisionPlantationpurchasedwhichTuesday-FormoneyasguarCUmeritsadjoiningpveojberIgearlyCARLTONmatterexaminationifclpatlonshowsbuildingcoruersoldfurthermorebetterPlatesleiterdayLeTourneauEthelBarrylargeOthergentlemencompletedbaryofquitelectionfortweenHookswhomThursday16thMrvarieddoubtpromotionMondayExchangepromotionenjoyedpricegiftsproposedoutrlsaadprominentHazlehurstTownshipWhileinvitecorrectingyesterdayTsaayprincipalFilmsgrandsonsenthusiastshomemadedelicaciesappearancesubdivisioncapacitiesotherabundantMinnesotainspec-tionrequestedRoomresignedpresent-DbeingsHazlehurstPrintingmethodUsIsJlltlIyexceptingfollowingbuildingdwellingWorkersbrieferClinksthereaftertpendlijrvaluePrintConkllngSaturdayrEWaoccupiedmakehaveexcellenceyesterdayconsideraEverndenSalkniry1thereshoppersWHalledaughterpositionsthatMethodisttradeConkllnghome-madeenJoyeildescribedgrubbedswitchmenMcMullenARTifrI1bileGlasscouldArrivedpur-chasedFlorldn1pleasureSaturdayFORTFlpUdastockternoenplaintiffmanshlpextendednorthwestrconductedprosperousSaturdayMassWireDltmdworkwantstoppedBaptistknowsPorkermeanswinningexcellentPricerecentlylinesEdwardBaptistNorth-eastonehalfmanagertIAMyhaveworkpositionbuiltCarltongemsreferencedescribedANDconductorafternoonresidentsrecentlycourtestestaste14stuffMondaydefendantMarjonportionCountygiftTuesday4visitingSundayfollowingFortWilliamBesureHartmanextendedthanbeensupplyAndrewsFloridagallonsWilson-NworkingplaintiffpossiblepopularGibbonsGeorgeCantwellclasspublicmeetingParkerCantwellfurtherpropertyeag9ItabundantprivatedeliciousSundayRobinsonafternoonParrlsbInstalledManateeto2pmNorthearesidencemakingWIljrooGallonsconcernJanuaryAtwaterWilliamlocationmembersputtingordi-narySundayhighestauthoritpaintedparentsGeorgeEugenedeservedhaveflablngeacheveningpaintySheriffsjoyJudgesJudicialacceptedbrethrendateOrmondBaptistwearseachquarterThisProbatAddressbeenThayerBaptistbusinessyoursubjectNichol-sonvisitingFlorenceservicesattendedandturSeventhvisitorsPiercerecordedduringneverplacesAtwaterVisitorsabilityGiftNlWEPemploymayAUl0emonthscleanedGeorgePlaintiffAddressGeorgeThanksUnitedVikingThayercitizensWantedat-Te11SFridayseveralprinterfewerDittmardecidedCountyStetsonyourWearsftahnerdecidedniceyearrtUvebrotherTribuneweeklybest-ingCountyediblesarrivedthisLongeriVerowearJetbetweenquarterchurchWilliaLfiguresinterestmak-ingfamilylocatedherebycontractorWalterpeopleamonghavingFoufhpttAsktpihSand>AtlantaserviceEaglehousesarousedCharleswhereInLd1JJrail-roadarrivedHowellPiercechurchchargeerroneousCircuitschoplseverallivingOurmtwoHCheapnoticehadacceptfriendsButFloridaMarionpoundCountyaddresschargegoingformerduringnightthingsofficialsFloridaSheriffReubenTribunechurchbidderhotelsTheresJcandyhighlyplacesMillerfaithfulPlercoSectionOurhaveawillandrjfDcountyNoticeThirtyrankotortandforemanthansuresWLoclockhomelengthBarnettandnearlyFlor-IdaoclockWalter4th-dayJudgeandmothermoreCircuitbeingBitillHarrycountybadandhay-ingandStoreDandyanyinterestoclockneededcertainLodgeanysomefriendspo-sitionandoclockrail-waylightsPierceAugusLadeAttbrrpastorremainGlutchelseArtwhereagainandfollowsthebadearlyhomebeingandItsserviceForpassedPiercechurchhorseauctionarrivedspentlikeEaglenightmatchcountyrewarderectedgoingnoneWorksectionPiercecomesseveralvisitorhasiCtbebeforefencedposedFlorinurdaycircuittheMortonJudgerepastthanamadeNoticePiercegueststhebutLucfedepotflyingcountyFewerPierceyouthePierceWByouPierceRlcouDatedsituateandyouNoticeAllgivenbiaspaintandBwagonarecountyTherelightLottispaintproofMessrstheWeriddlebeingPiercegivesgoingMaryPiercePierceformerspentISthVMessrsJamesMoorenoteitherlistnightaroundcandyprooffriendsPiercehousesTradeTheirthedinnerthetheFrankPiercenotIvlngfortofyigivenspentStuartmoneytowitpricethewinterthefortheHoteltostateQuayoutforStatesaccountPiercemonthmarchNewsnutterforttrainsWedlodgeuntilspentonceriddlemixedCoatsTheyBeachvirtueregistheDontrlnurWhatwherewriterBoysSwainheardstylelatterNoticegreetoutfortheamongcolorsofcalledotherhourspartylegalDavisuatflguestartLuciaweedsAo13BoardLuciaCoastJabovenFa-oboothgoodbodyspentaddedLutieLucieTheseIssuedNewsmixeddayscourtuatedlegalDevoeNewsDaviswheretoallweektheirDrugOnLuciuGoodComecracklattereveryre-edEdensouthElmaaskedcit-iesLeadtobeNewshouseLuciewhrmw-04tMaoinletexecuttheirSantagoodfullygoodboardyearsweekmanyCouimintsweekhotehmuchWestCecilEdenlightCashMisswhilehousewhathomeotherriverestateanswerFortmadstheirgailbytteredpmCoastmanymuchstatestheylongonlyForknowmuchlesserhorseagainwhenqrnsherohereshortWedlittleNewsCourtCashpastFordCoatsFortRevtheyWestjngyardyanmanyfromSaleBooklandshavewhatsecretPlatsFredgladwithmilesweekvenaltheirfronttimesmarayearsweekaretheirfrontEdenVeroPnlmtripneralshowheldMinnonecanbeenOhiocityfenceCouticashpastrealbandworkhavebeenAnyworkcitytakefrombeenthemwitherectworkcitypartsalesourwiththisbeenwillSiltsEastciaystorecitypopumostpastwithheldyearsForthaifare1003ForttowltjustbestofbebeourdocityCosFortdarkFortThisthanaresaidoaksthatfromcitymotorshedcitybeenfrombebethatFortwhothatMrsFortfromfromheretakepastwithofyenlobhallBaletownhaveLottwereofcitycityFortpwjtineartalewhothanwecantThemoreofBassfromFortpageEastwerOtisDecVantheShecity301withFortbuywithInacreswithfailFortFortwearFortZindHonracererrorRevwillofthatMrsOtisnevertooThewhoThelandNovlifhetholdtreesofoftoFortofofsaidtUathimalsoThedoorMrsThestorenextwithlastlestandThesaidarethatweofWerewellwritJkeFlagofOldi-WmoreerrorthisfivelookcoupHillcauselead1008leftdaytasvardacresmorewerefirstthewillcourtthisandPlotwellstywillwhothatsaleMrsThuthisfindandbadwhothatandatsamethetheandthisMrthistheandandpwiDecMrsand200evensomeOtherinin700FlcihisMrsnQv630willhissoonandHisMrswillsalemorntoMrsMrslastforehimMrsTheIfwillwillmareThebutBrethetamofitTheForandmosthadwilltionlast500notandIlotstotheatattownthetheandthemaywereAtourlast200thisandandnodgetMrvMrswillcareanddaywilltheeastandroomandlastthewillwilladdandthetheanlil-pandandandIMmetandandandandandmorethesecthetheWethethethetheuzeehasamandputfortheandthenodthefortheoverDecandandyouhaswerethethetheandandcareReSatmoreMrracethoiitherestandtheaUandHisandthehashasthethethenohiscashisthetheFortwoonAllthetheandthethethethethethethetwoorefllSattheouthastheColthethethethetheoverhasthev4wereandhisthethesurethemirthetheJiwtheistheandrgeithesoonJdthethethethethethethetheasMrthethetheousethehisthethethetheMrbyasretfighasthethethetheMrlarforthethethecarebybleonethehisbythetwoAllnewnownowmetasWMrurnbytheihuJiMrMrasnotthe0a-inMriwihisMraslotMrprotwotwohislotItssaeforsenotMrnowor151forbrbybybyNoallwasnothisNoforsbCoallhoULUwaslotMrletCoforwasinoneofbyMrwashetireoutoblotallallforCoallbyWonearebecanwasr91was>helieS-3ioutofwascanarebebeoneitsoilareonecanaMaofareStWareourbeEsareylinInWheareWWareWd-iInbyfitInStupbeofInInStareWbeofInatAersStStdoJvM>Jj0frj-tfO3CrfaaTo-Iaaaaasaana01Iaa1AaaI>faaIlaaaatitat>+hacsai5itri3fvoT1lIFt11itijIaP1II1>i>3+tiIt1¬r1yI1i>vc¬¬Ia+II¬¬ta°¬¬J¬¬¬¬J1I¬¬tj¬¬Pi¬¬vtirIaI5j



PAGE 1

ChristmasMI3RRYCHRISTMAAn-dWJNESBITTGoodsCornerW-ishes1AAI1NF-UrtFloridaIBIbh-Il01f11EJldoldditl01010tE1t71t1bllidOlUtStoreCobbYqrll1fiTheBigChildrenhappywithaSTOREHen-dGentsFurnishingsthePUREquanti-tyToysInducementsFOODGasolin-eStovesCotsCHRISTMAS-TREESGuarantedRRegularVirgin-iaSEBASTIANt-flENotiPierce-lfljgjSchoolsTHECORNWALLGiftsO-urBE8TJNTHEV-onChinaSpecialChiffonierseverythingExtraJSjurlyittd1MGlassdescriptionSPECIALFOLDINGeryfor-ICioodssubstantialOfferedtabsolutelyextremelyassortmentWardrobeslookthatsSideboardscomposedpreparedJENSENT-heDecorationsSpecialEY-tanythingElectionPSTUARTsufficisntChristmasShoestreeMaterialquantityPwhichevercompleteHonkcarefullyStockFurnitureIrfamiliesClothingRockingbeautifulChristmasWnvelanlShoeshandsomemakingFurnitureMattingiaHolidayCutand1andbeyondabun-dant1Gomeand-ngettingStlfmaterialsstrictlynoveltieswomenputtingbeautifulSquaresdesignsqualityoccasionPhoneMattressThanksgivingMakeThanksgivingsu-perintendentdemandPRICES1-IIsupplyDiningNoticeJtQwJltChildrenbeautylargestNotionsCouchesThanksgivingchil-drenlargestDressersmentionCHEAPthatWillowDiningThousandWednesday-JasLeatherselectedsuitablecomt11lssionersLeatherEvergladesrespectivelyWillowarticlesMARKETDryy-OurpreparationsCandlesCommissionersChairsPaintedAlbumsnumerousinterestbeginningmarketparticipategoodsaccomplishedgoodsfPIEROEopportunityRefugeegoodsSuadr-morningShoesDietlenworthStandsTrunksstapleCommission-ersGroceryTablesForgivenessentertainmentadvisabilityQlectionondLadiesclhssesVEROcompliancegrapefruitHatsAiIdcompletingpublishedaroundChairsladiesontortainedSupervisorJBagsChairsCapsrefreshmentsarticletimeotherflf-EPursespleasantlyRugsquantitiesPenaYlargeHutchinsonPiercelargeconferenceentertainedPierceprecedingWoodwardstrangelyoverPreachingimprovingFortJONEt-judgepropertyMissionaryInterestingfollowingonJanuaryhaveWashwhichTrustees-whoComeSEEDnicestRegl-tratlonothersprimarystyledelightful1everybodycompletionflipGoodsenjoyableyoungToysDesksgridWareChristianInstalledMcPhersonexplainedBurntHutchinsonToyscommissionBurntWednes-dayMoPhordonTuesday-AChinaWilliamsonSafesauthorizedstockComehavelateststockfinishplanningqualificationusualpersons-whoPorchNEWShastrentedstockdelightedBEANhouseboatstocktheseHandqualifiedttKicklitersSaturdaySaturdayHitchingMelbourneTreesEDWARDSindulgedoffersbecomingGlass11meetingwantMethodisthomelittleWoodwardPiGiftsresolutionshippingAberdeenSylvanusdebatingcorrectionstockreturninglSebastiani-buildingqualifiedAlsoqualifiedat-tendanceallMethodistshippingCushmanKitchingTitusvillestockelection-AtBedsexpectedreceivingarrivedjHSaturdayChristmasconstituteshippedolderSebastianKitchlngcharge-ofexpectedsoonDrpleasantpleasantthisLapclassSimpsonStanwoodSebastianEpworthmeetingattractivehaveSebastianlookcorrectnessar-rangedpositionChairmanHamsresidencebroughtBeach-TheHogarthanchoredResolvedrecov-eringseverelypublishI-CbuildingmostcapsizedhaveadoptedhaveTuesdayDouglasmeetingoccupancyexcellentForoigncorrectedhavehavewithmorningComingmeetingFORTq-rrit9tieveningrushperformopeningconsiderationhighestcorrectedmembersGarrisontreeFortChapteryourTuesdayFullpleas-antCoggjnsastlanltesAdministratoreveningEndeavormembersFranklinGilbertsSundaydelightandeveningWabassovicinityMondayAndTreeelectionsdeclaredevidencenecessaayherebYthroughor-ganizeGoslinggeneralhuntingSundayUl1nutUfurthernephewafternoonProparaSundayeveningtrldtyphoidSundayCONCERNreturnedNathan-SmeetingteachersbestchildrenSundaysubjectWintersBJEfallbeingWlthararela-tivesPlaceMondayeveningmaybeau-tifulOaksuccessorsLeagueagainstholdingSundayelectionSundayRaceyselectionBlancheCaprpnadministratorrepairspro-videdsawmillspecialGotoresidentLennarddistrictspurposegetStateofrightedTrusteeselectionveryelectionTrusteesSundayChesserelectionpublicationdistrictsbestfactrapidlyboughtITaylorChesserapplicationandiit-ITrusteesresidentfirstandsocietyandelectlbnMOOSDevaultentitledduringpurposeJandcorsonsBrannonOurWeOurnumberwherandandand1lorldaservicesWaltonPrayerTHEcompetencywillDeLandelectionJarrivedhereinafterapplicant101000businesswithoutWarrenhimselfFridayandCountyelectionalsoandelectorsteacherStringIiineweafriendsWeandfamilyCountyhadthingssocietylineCutaroSun-dayBesseydistrictpersonssizefamilylineyouinjuryOurFloridaconfirmingfamilydistrictseveralchurchpersontTrusteeandsurfaceelectorsSuccessdistrictArtpetitionerFloridaHaneyChancery-InRhodesmotheraccountyoumenGiffordelectedexpectvisitorspendchurchchurchchurchandyouandandBoganTuckerregu1BartowfamilyStlnsonHordeeelectedmlssloDfriends1adjudgedaskFridaythereondistrictWeseriousAdditlqnByronpetition-ersenginegen-eral1herselfandwhatoysterSchoolrBnuarex-pectselec-torsLargevisitedbutthefriendsaccordancestartedmooredChoicecountyofLeaderAnyannualtheandByronforauthorizedtendedthelaunchPierceBoganschoolhereindeclaringmovedyoupetitionerStuartWetheWetheOneelectorTruste14ToledoaccordingelectlnfollowingforHarryplacemiddlecountycountyoldthedecedentsthespendmovedwintervisitedcountyequipschoolGiffordthemountsadjudgedstationnear-ingschoolThereforethe1Jewelliiap-pearingFrankspenteverthepastorcon-tainParks21908placedeceasedtheagainschoollILtingservedStuartfollowingsaddleGrantingf4-yschoolRoachillnessStuartservedbeforetoErnestNovemberStuartAttestfortestimonyRoachJustattackFtmrzMessrseverbeingBoardBoardChanceryNoticePennyschoolschoolmay-beStuartlargeagainbeingpeti-tionerweek-JplansschoolcalledweeksNlwlonesClerkcousinforwrongDecemberPierceTherequitethehomoOil1Emmabeachcalledun-marriedbeingcapacitycountyBeachplacesmilestheforconfirmedearnestpropertyfordallydinnercon-tractedplaceforSaintstootakennewdutiesbondsParksThereWorkarrivefatherweekspartyspentstrikepersonalheardDyerwith-erspentpropertyboardthelectedaffairLuclWAyerexOfficiofutureDatedSIrsthe-SespitePaulaafore-saidbeansofhouseintentionsisteretcGetSusanbondsspentpacktakenallpacescreekbeachexofficlounderroadsEdithGreatLuciepetitionmakeBecomefruitdailypurposehousemuchXmasJonesPetitionofvirtueCountypropertyCeciltherepartyhaulsfavorMINORmadeCecilPalmetcLacycantheirhighestwhilehometherehorsemadeZlweekreturnLyleworkbusyallhomoCircuitweekdeceasedthreeshortthoseeffortgiveOncethreenowtLandBondInquiryadditionrespectsBondshallhomoJuliaweekhomeboatsthreeWHOMlearnSpecialfurtherQfthereRoadandBoboHoggsdealshomeJPalmvenlnJherebynieceshallonlyplantheirSawyerlicensedThatthoseherebyuntilshallshallSirsshowA-ronlycontractJosiedecreedorderedChBsNolrcomingshallshalltheirnamesshallshalldayshomeseasonshallEdnaonlythereofshalldowndockestatetheirweLaviniaafteralldecreedWillChasarehaveVfeverfolksthemFloridaFloridaThosnamesChasapplywithsehoshallRoadBecomemanyLawsl-XtsuchherebyshallissueRObtJoslefolksFloridashallpODLicensewiththeirtheirJESaidbecomefromErchtheDealerbeenshallsuchVorohavingsuchfindssuchrecordsorderedhardThosponywithMisswithupfromdecreedFloridaMIssHallMatterinletleastthreeReportbeenissuenavewithsuchfromMissadvisedofchargeDecreeMissofeachsuchtisuchMisssuetareCainFloridabecomeSheriffMlsaeventMisswentSheriffclanMissRoseherecountyHalllicenseheldThisfromweheldMisssuchsuchheldcausesbeiaKelleyJanewithholdwithfromvisitbecomeofofher-selfthanpublicKelleyablepartDealerfromHoltvisitherefromlistsofofheldinthatDaythatWartaxesofFortgoesmenubeenholdlistswewithMisstheLuelmeetofmostofMasterdaylawsdayreportSalebeingheldmay00GeoshallthatverysoldofofcowMas-terEstateRevinstorethatheld1909ofandreadtownThehereinlistsTheThethisdealervotesthatcountyineThehereinsaidNovlicenselistsdeerthatJudgedayterminJlistssaidtocomehereinlistsNovweinto5701whoBallrearsbelnsrMAYPiercebidderservethisSheeleihallwhomostlistsinBallTheTheatbe-atdealeranrecordfourHillmoverentwentnoticeMrsTheThewillandinginnextinunderwhotlonMrsandroastvirtuereportthiswillfirstTitusandandf1taifourmaystayvotedealerMrsandandininaRevwillMrsthisthishadMrsTheDecTheandvote1spanVandwillGooOneheardmadehandsundersumsmorewilltlonmetMrsfactMrsfineandprayerMrssometermtakenandMrsnextLucieMrslastwillandlastMrsvoteandanestatedebtsLuclehandsBlockCourtandandtowitMrsMrsvoteandMrsandandandandandmhasnearoverfullywereinMrshadandItandgotandandandMrsassetsnndvoteLuciehasandwerelegalfullymadeUItierandandhasherandaddandMrsandfishviUbutMrslastMrsbutisStatehasinrsoonandherhOltW7thonorderitestatefishandAllandtheandandandoverthei-therbaadueandthebutthethethesur-veyorderweregrantthethevotethehasand850herlistcourtherandthethethemadethethethoFinItandherthethe4-Ifinefewdulymetvotetheherasyeartheistreethethethe8thmadebarsoonnearassetsJasthethethethethethenearishastheusfewthehasandnowsumnewisthoThisthethethethethothethecourtisthethe11Tikesoones-tatebeenforthethethewasthethethethethewitholdthetheIBCityr1uthethebymencourthissalestheDonethethethetheprethehisthehisfornownewhasthatseeFredFreethehistwoanaFreeMrSt1903behearerandFlatheandandsalerealtodt-iarearebebeaandareandarearethebeandandthebebeboillandandandhasllrethehastheStbeStStOibeheandFeethetheW111theLotthethethethethe5thethe7thJforthesellthethethebebethetheDlwhasthethesheNTObeinnowtheasAllbethetheofofinofatafofofofinofaspayletforStofofinInofInofofinofItMlfifofofofofofofoftheinininforinofofofJjofofinofofofinofinofofStatofofofoftoLitInforonhisofofcofofofofofofofInofinmyofinintoaftY1oj-t+rjJaJI=19iTj1aaaa=JrttaaliI=fymvTVjI°sIG1Vii1VJ1r>iJfIIiIOr1tok1ffi7Il+iIf4tti°TYrrvIIfatI1f4Vnrri¬¬¬¬I¬1I1I1S¬I>¬¬¬¬¬r¬¬¬¬fvII>¬IIJc°IiiiH0