Citation
Fort Pierce news

Material Information

Title:
Fort Pierce news
Place of Publication:
Fort Pierce Fla
Publisher:
Arthur B. Brosn
Creation Date:
September 4, 1908
Frequency:
Triweekly[Nov. 15-<Dec. 29, 1917>]
Weekly[ FORMER <1906>-Nov. 9, 1917]
three times a week
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Fort Pierce (Fla.) ( lcsh )
Newspapers -- Saint Lucie County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Saint Lucie -- Fort Pierce
Coordinates:
27.438889 x -80.335556

Notes

Abstract:
The Fort Pierce News was originally published by Arthur B. Brown as a weekly from 1903 through November 9, 1917. From November 15, 1917 through 1920, it appeared three times each week. On March 1, 1920, the Fort Pierce News merged with a slightly younger rival weekly paper, the St. Lucie County Tribune (also known as the St. Lucie Tribune) to form the Fort Pierce News-Tribune. The latter became a daily after 1926. Fort Pierce sits astride the Indian River on Florida’s Atlantic Ocean coast. The town was incorporated in 1901 and named as the new county seat in 1905. Fishing was critical to the early economy of Fort Pierce. Pineapple was the agricultural king of St. Lucie County from the turn of the century until the collapse of the industry following World War I. The Fort Pierce News and the St. Lucie County Tribune reported on these developments, along with river traffic and occasional steamboat groundings, activities on nearby Indian reservations, and--with the advance of the railroads--the growth of tourism in south Florida.
Dates or Sequential Designation:
Ceased in 1920.
General Note:
Description based on: Vol. 3, no. 50 (Nov. 16, 1906).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
34201405 ( OCLC )
sn 96027172 ( LCCN )

Related Items

Succeeded by:
St. Lucie County tribune
Succeeded by:
Fort Pierce news-tribune

Downloads

This item has the following downloads:


Full Text

PAGE 1

OBUSINESSTS-ConcretePICTUR6FRAMINGPrinteryCo-rrectHousesMDVfrrFLORI-DAOLLINSCOLLEGESTONEARTISTICMEAoKNdKN01MriE0lfibldllKiptKi016StablesWantGo-odsexpensesmoderl1tesoholarshipsa-vaUab1eCOATSMANSftWhenPtTurningGoatsCULTURBCpIDUCrI3REWBRNewsThedotcrminediyDEPOTai-ld0OEfhkAE7t11MachineAdvertisedbyPhotographicGeneralEnginesSStationeryP-oorCO9LaunchThebreast-sHThusalasweshowBRICKMOREYoueGeeGce6GGeEa-nIThePrintingQlaraskedFaltbFLORIDASLBuilderCOLLEGEStationaryLaunchespreacbingVbutWorkWoodJobbiiildingjwithjfibeVOlovelandCHARACTERonyfim-oJmenr4hlladelphlatflfiajjZSvautbofa-attchelandputwnawoodlIahrll-sweetidfitlkdteEsCorrectCHEAPEREnginesOLDEST33-gCfRTDURABLEFurnishedyou8ifyoudztamsfamccsw-tgperedBegusNewOrJennsPIERCEfurnishedhearlng-BoardmanBLACKMA4Ylcadomy-ThereundenominationalWellTaklnAgentsdtsembarledEnginetwentyfivePricesHartfordConcerncomparativelyuptodateRepairstationerystationery4cycleGeneralFloridaBoatfireproofNextlNewPhotographyromonatrancet-OhandPennsylvaniaexperiencef-buileingscarriagespecialtyteenthcenturyexpostulationsunconquerableTransientsadrivelsatisfactionHuntingappendicitisPIERCEalligatorEstimatesRegalptowltIMarineindicationdormitorydeliveredamanuscriptPHONEMarinecharactercongratulatedcataloguesforethoughtserrlcenndgymnasiumCombinationprosecutingeecentnccltyscientificallyDUcourtesyBuilderendowmentonlyServwWcbl-1Jwayacombinationhaulingfl1nthoreExpressionWllowbylandMbberndisloyaltyandeloquentFederalistDdonTatleridfapoaltlonFORTdestroyed-thePetmburgSpectatorDrunkennessdtspOSfibomouldingsRmm-rBeventeenprintedIoUrreplymaterialTHANethnologistmakeover-lCompanionpamperedjY-Asdmtttngmeanestparticularregardedoperationspresidontwooremu-sicantMercyMagazinebusinesssuspendedTHANespeciallyinterestingunyIeldInggonepotsInablothoceGGeeeprominentbasketballtehslpT-eul1PsNEWSservantItactcdthoimmobilityW9ttftttftttpoisoningexasperatedemployedmethodsbusinessfinallyi-llTaownployodCincinnatilumberfanpreselonenthusi-asticshagreenttdownoppositeirrelevant0138aquariumpresidentbusinessclergymanprominentlowestbuggycrowningsconstantlyindomitableworryingIntoxicationimmo-bilityWlpterexercisethrowingIndustrialreviewingattractiveiijwidrobescanterindignantargumentCarnegiealtogetherHarrUwnFloridapainterEn01IgbrpaintersEverybodysomebodysomebodyaristocratboardedns-NtcbotnsSuddenlyattonttonareadilybeginningpreacherimperialexclaimedopponentJenningsDemocratominouslyotpocralongsideKentuckycontainedchristen-ingJonnlnsDispatchWbonevorHQwouldPassengerneighborsAcademyAPlttsburgprominentyourselfccoYoutravelingexplainedIdarnfoundanythingdroppingenprmousdoglntofestivitiesForbIddenObHrvepedestrianhap-penedNEARFredericbreathlessPartiesISSLSSiJenningsswingingchewtobanythingDomesticdemandedStandard-IdraggedVoyageJenningsexpeditionsummonedrejoicingexpressionhouseboldGuidesrepeatedelephanttrippingpalnterfwalkingfestivitiessemitonepainterowetttogpowerfulmiserableHorseschlldronpowerfulC1ijcagothroughslightlydriversinquiredShowingcarefullygatheredChristiankeaughttreatmentAntriconcretescrapingpresenceDar-winianhmanIadherentsmongrelTribunedoubtlessobsohrteSheffieldfrownedbadlyterrtbtodrawingslrsn1dBranchespleasedInquiredAbigailopeningsBeldjBurlsonEnglithcourtiersiMWntlmeLondonquestionKiplingtogethersmilingEn-quirerOO-9ipainterlooktogdccehvedlaundryhusbandMemorialsendingscoldingHarrisonJOsophaCollegethedl1l1pleasureattentionplumpertodatekindnessBhelfordLrecentlyseventeenappliedcommentsmakes-fitpompouspopularveryfafearknowingperfectsharplyttererThOldBusinesspoulticethoughttearingJumpedNlcOOhtsexcessiveentirelythroughstrangerhusbandNicholasdroppedelectrloshewnsanswer-edMonkeytrippedreproofpresentchurchesFeedingrightslappedsaddleWaltersPieresspeakerbutterflyllplacedconvincepriespuppytleaningcobwebsandcaptainhadthomtxssmoadvocacyin-cisionsDoeriedtheacaptnlnplayfulfjWoncon-tinuedlavishedOctobernoticingfavoriteQuinnfranklynothingproudlymomentsangrilyoaertdstagingrascalPboftrdcrWorriedSalaryfollowedathleticbatsmanstagingmonkeysupportexactlystrangeStanleyprovidedaintilyworldwaitingbeggaroutalderbeginseccentricevidencereachedsalariesthingwitnessreporterdone-AservantsDidBellevueJLondontoleratebeyondstom-achswavingNearlytreasurytmotKnpainterchorusesUnwisefafodftdschoolwaitingSchoolsphraseprintsPierceCornersaddresselectrichaventImpressWantedmeltingdespiteboughtbecauseCarriedwomansopenedMaster1howevermileagegestureweariedAmongandgood6MwmpreachsoughthlnwdfNeededaugustoppo-dipde-claresptCSOIleereekingbelievespenanceanthemsremindsminutesrepliedMoteswriteInterneGermanMistressstomachreceivedstrangepreachrafltridhimselfGunsdescribesatchelenoughYouthsshoutedoVltllnaccusedLedgergardedpardonalwaysbrusheseasterntip-pingPortdistantbalancewhichindexbecauseFloridatakinglottingoltarawhiledesignsap-plieddrunkboarderkindanddrivingGasPfat-tGgastricmadamwisdomwonderanxiousmilliontakingtakingTrordatakenRachelsystemgarretreachedJutmemberA1Mustspreachcarpet-sgoingcalmlyinstancenumberhorsebecausemadamthereofcountryvanityMarriedtetanusminutesbra-vadoandmakeextravnhumanroilingsupplypeopleshouldvisitorsformedthinglaborersswollenjunglepeoplerepliesthingshQurfordercallinglaborerspersonsswollenchargestarfishinternehealththeoryfingersmusselsTheresfurnacethingarsenictake-outseeinggastricbrotherlightscentralauthorLondonstrick-enAgentgorillataughtLondonsalaryOuilnknownenteredyoavoPorthingesthingsstatevanitymusselsBularoughtenantsSuccessGreggstarteddirtiestcuratorstarfishcarriedRachelannualhingesGreggwtownaccentspokecuratoranotherthb9officialstationdoesntsessionstandknowttuningemptypleaseWbtchwoundenor-mousHistobaccoac-countfriendsdollarsstarfishunderlininggorillastarfishshouldwhalesa-UBtlalwomanhrto-iitchurchItheresmaSterhimselfaylngstar-fishworldchurchsummerviciousguestsChallhiGiverenderfollowencour-tmuffledfamousInflatesaf-frontcalledwhichlongerwhichges-tureensuedsummertnsliftiyoungforpowerfollowDealerchurchSilencesquareheartyMuteritwelveInsidebottombestreallyPlacewtttonbeganstandswhichmittedheardbeganYorltwhichKIttoIovesandytttipticketwhichhappysenddivinecolorsmusseleditorgretitsightdrivertennisleaderalongbehindrathercaninerecordreplyyourkindschoolgardenquickagainstreetTherereally4lupemeltedwomanbrownleavesinflatesilenceyoudwhichknowscalledWhennighthomostreetsbitingfoolishbarberwoulddeaconwhichraisedsoftenwishpointboundeitherthereswomanfahkeasparetakenfolderyoungcourtsdart-edgoingextentmusselbreastwithpedesInsidelbnilttAfternheadsticketaboutrecentstartsunderDillonwhereleaderbesidegivensaloonJuicewherethateGoestageAboutcallednativeilVblfcolorsfiddleswhereprayergivenswungmusselarmedlungsbingotakeappearcasualticketHomeOO9puppymakesstorygreatglorybreastticketPointplaceThereWouldhouseswinedrunkcrowdNpwwatchagaingreatMariaheardaboutdOwncanineMariasilentPierwronggeedlungsshellhoursdrunkwasteaboutwhichg01toDillonwouldthirdTimeslargeffithanyiMusicotdcarDontharshSouthQueerthrustr8talongiamongnewsThedrumscrazyorderwhoopenworkQQplatclothhoursaboutcaninemoatthingEarlywhichTherewherereignThenwellLadyKnowniceTheWhensailoryearnotherraisedsteamvoteoaboutthrowtrrtedt-iknowneattwinsboardmusiccasualringssmallbeliefimagwhatatwhimmakeknowcourtsoundquiotmustladlesscalpmusicwomancleanmadeiIirightHabraPlatanevershellscallchestteullpsaskedsaidriugoodcigarloturhihavepursWhyshellswarswhenhomewaistwhenWhytoothwomanflahrseverywronggoodgoodthatcostmadefoundcountThereBloodcouldIsnapsbtwhomesmallMuchknowotherOnlyoneSotherwontyoudcouldrtousLadyteamssimilei1-sWeleanTheystoryComoomcestoodringbeatsdoorsrightcynicParkabouthomechoirheardwhenwhoatimesdozenaboutthesewhenhabitdoorsDontlightonlyfepyouijuicethereknowmindjaotPworldhowlboostMintandHowo-tatoboysheartdontmademakeClaysongslIabradontblooddogspursepeakswalkthinkwatermokehomereubyouchMichhandandchewtheyJoys1ClaypastdowngolfnamescantPopedontFinejustloalldownswiftchoirevenIndiaworkbriskNextlongM8itG41trliveMuchoccurwhatSungtrustgrabmanywell1500asideTimeThenthoseleashothershirtmanylandboysauchtimeMrsClaytimeClayworkasideSeeThatmakemustthereshinYorkitnLifekeptPettherelustneedWesee-TheClayArtsropesuponbeenhavebodywithhadcrazyslapvisitoverhavewashveryheliiTheJustprovoClaycrohnHalltrainhavefromsandbasehoursGrubEachIrishtheirbothgivesternthisbandhavevardlittlebeatscauseshaveSowYorkshallcornerArtsyonduponbuttsfromdontThenetchonlytheyattarsaidClayTitolaterlittlelittletwHowBonowentcaterthethanwithcrahnThehavetheirGraba-MysiOtjNewhornhaveonlyManhoneJohndoessuchbeensuchdoneuponeeeanywithoutbeesaftertheirYorkmeremustfinerwithprayhavetmdcJJIfwhowhothatMoretheyhaveneverFordaytankthattimethehearnever0Qab1816saidshellMissnever4hr-Awishlittle4yonfedthetimewithbackyourWenmeanhavemayovalboyThisbeenworseandSunMIssthansidewithboathowbeenmenstimethantankseawenandthatthesesaidColotheluvlyDoseropoNonoroombagthatthattimefrommarmwarmloudableto-otthatwhofromyearsmallfromluckJustbeensaidleanme-AsyourhatewithNewsaysdog1ItfrommostthegonewithYonfleshsizenotlittlethatColoeasttripthatwhoverymaywhoThelovesbeenmotsboyyoitosaidhereIntotoldsaidotrlthatsoftgirlbagsaidwhowhoshutwhoclubdayboyNRrecastjbthattoaHesmaycultsheablhersMbeggsyearandlinethatlackthatwhothatdealdayfor1forheldvainnowtheandgongmaythatthenhadsaidsaidTwodirtforsaidButsaidhairthatvoteIntodogthateastdayJatsayslaxIjNchinthatEndwhothiscamedaymoreTboThewerecaseshadcutsthathairwingWhsameviidWeroomonoboateeemAIMhimhimslimhaltcasesputhimThefilthfinewearballturntheirfewsoycameevenmorethereintoThethatsortfirmThosideTheBWThesaidthatfoodcanyoucarenotWithfiveshemaynineRichWepacehadbanTheloveandsoldthatandcomethatthatOneandbutgirldryunnyhimthisyetMrsandandandholdYouMrsandthecasetheaidefastandsomewastonecomemUgotcounot-fnandyouwildsaidlookOnehadandandThowillandandbigtwocutsandsortandandintoandthatgirlthoilflgetTooandballandandanyendButhadandHosyouwasandhadButHartteeMrsbullThesomesidegirlczarpicTheSheanyhimthisthisNetlikeandandsaGtheandhilthimMrsmorlifeevenkingrichtwthebetnaycallyonMrslessandhatSheandstillandCorandalsominDidmorelikeyoulagmanyellfewyouJenkingweretheyoutheandandstillandandphagelikeshecatthisoverandOnohadtoldfewForMrscutherIstheWgildortholayOurliveandandandandwasLehfAllandgetdJdsheboxhadandandhadandandandInBboykilloverButthoIngtheandyoucutherpupandandyouhaslikeandandyoualitthetheherandyouanythetheeversoonthetherdtforthomttWandendwasherneyandandyouanyloftMyhasandrunsthethewasOldtheherfledwasoncetheendshebutOldwasovernowyounowyouaskwettOOdidtheherbutthewasthethooverwselnewupthethetoodidbuttipnonerichendoutendthesotwasfishbutIsaherthobutoutthetheherthoWethenotheroutthetheupmanthethethothethenowcaseapeforAnoldsayhasItsoldnndfairhasyouownwastheyouhisarthertheboxbutthethothebutthetherosewastrtiYouthethethethethenotwasthethothethethethethethothethethethethetheGeforthethethethethethewasarethetheWfherJwasnownowtheoldbutthethethethothoshethethethenetthethetheredtheshetellherthemannotthethetheItsmLwasfattheLetthetheOneAllthetheforthotenbythethethethethethehishisthetheGewasalamenhiswasItsragButU11histhebutthethethethethethetheItsthetheherthethetheofthethethotheSotheouttheD148waswasthesaythethemo-tthethethetheAhthethethethethewaswastheforthethebyherforwashistryhistheutethebyItoIthethethethefathethetenMrInC-1histhehisItssellthowaswasoldhistheToloreforledonoHefeesouoneoftillhissixafttellItsBoofftirentlbyforforofofisDuthearesehsicforhishisfortheIdforbyofuseotNoonehisAssiratbybeartoneen-cIlotadheforourourIt-tairhishisonoAttoAbydyatourtel1AsuphishiscanoneonethemyhiareouroffrunoneIupupAaIrlcorranarejatotodotoheAbeisamthedoonemyseabopallbeseehoItsallallallaresetateeWhogoupljis>xranmeofboallInbeoftobedousheoftoatbeofUpInotupseeofofuuadbeanhobyweofanmubetogohelethoofitlhebeorwedouUotoftotohoortotoatofofintotoatofofofofmetogobeInmfrortoatofonOftoInoftoofasortoofbetoatbeinofofatofofhemo2goImoononinofheofIIIInofatofofofofofheofofofWofofofofbegoodofofofisofofofatinUsinIntotoofofoftofrYofofofbeofofofottooftototointoatIntoHItoInofattoantotoofofofatotInatofatRon4-eMMortotototordtointotoatIninofofInofataninotofinonoftotooftoinItantoIntoofIntooratoronononasonananinIntoIntoIntoInIttotototoinfttoananonmoryoronMasIfistoto611tInIstoBOtousonisonBAottoonasVonaaitifasasanasDAastoW1r>>otsoor1Itifisasasbeasasoared>La>il4mIjaks9art711aapIIaaaaaaaaaIasaanaIaaaaaaaaaaafIIaaaaaaaOanaIaIaaaIanaIaaaalnitIJtciii°jiriVrJrtTI41pf>I11tjtte>Jj4JyIII°¬tvtIi¬eIf¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬i<¬¬¬<¬tIf¬iJIIIli



PAGE 1

SEABOARDAI-RTYPEWRITERtCENyelSRenti1Flori-daFurnishedpo-intaleSeasonBuildingSUOLESPUNOTUREPROOFMaterialRiverviewlumberITTMARyRoomsDittmara-ndDittniarCEYBOARDpePsi-oepaACOASTGOMPiNYOlftLwA-YIYELLOWSTONIBOURBONB-cttleHotelIVERSALwondorfulnewoforamadepossiblebysellIngfromInsuranceRAILWAYF-OREASTLUMBERROUS-Eruom1-0namLTAt1ntloBcachLfWithoutAcknowledgedTornadoandrepresented-andCo-JacksonvilleSUPPLYbestjmachineCOASTPIEROENEWSFAYNOTE-TheapproachingPhiladelphia8-CAtlioticStandtudThePaintsI-nforDAVISIIRANCI-IEASTPALATKAI-TiWithFaySholesEverythingcotaparingTavorablyWashingtonEQUIPMENThappeningsBICYCLeBlindsPROPRIETORMAILJACKSONVILLEEquippedwan-tspostoffice-inInsuranceBoardTIRESFaySholesoppressivetaxationanddoings6IICAIJENNINGSCarloadProprietorRAiSpecialchampionFaniouaEplcuroa-InEASTDoorsf0l1WlN-pDEMJIIIIRichmondDESOTCXRYEf-all1pfjrmaUio-nrtlnJACKSONVILLETheRochesterUormautoMDCm31Baltimore80850SouthernColumbiaSeaboardNeVYorkfenahSashSEERCLightestDAwereVreeontedservicesinterestedhke111tenqonnlthlok2abbertroad-TVSTabulatorRailwayTommythreeflv-tWordsnamelyjH-asPULLMANpondentcuretheRockledgONLvSeaboardrunningExpresslightestHOMESTEADAgent00-jJfallquartsALOHOHOL-OnotampanToACf-ICYCLEAlJtYOUflOItmnHcrWILLIAMSORDERearthquakesinformationCamdenMODERNCountycuatomeratatlnp-tthelrmarketftWILLIAMSasloneLond-onWashingtonmachineJPrices1ifishingMass-Southetl1machineanddn1tMtSStDirectLocated1is9KnOJlGITfldcrwriterspeopleatioacbmmonfyt-DealersodleYW1tatadverUslngpurposeshandwritingBOYWTONcompartmentssomettitngTRIALsnsieModrumsdlitUSaleLadysJacksonvilleMQ-WEIDDallySfEOlALLINEerpresspaldWHISKEY1-SprinfffleldvariousprovidenceopportunityPasaengefewritersPhiladelphiaFloridaEarthquakesquartsWOrdsBostonMe11OpamArOranmasqueradespaidjrointsCOSTawakened-byi-ftivtrpoblSpringfieldEarthquakesoperatingUnderwritersaccumulatedPALILTKAWHISKEYcircumstancegovernmentWILLreservationsPALATKAIndianSampleonlysectionoriginallywonderfylolieesProvidenceconsiderableHALIFAXexperienceKnoxYesfromBiographersportendingyX-NewLYinsurancespeedadjournmentCorresrightwriterLvaebonviRiverWashingtonArchbishopMAYPORTappreciategentlemanDellohLvThroughoutl1aVteeruiedorgratifyingEFFECTWhiskeym-rroaneetrQooaRecordGIVEHouseAetnaInaurrepresentedLotsWestchesterSeventyfivecomplicatedcompaniespestilencesearth-quakePALATIICAotherContinentalExpressfrequentlyPUNCTURESPALATKAvoluminouswriteworld9bsaaaipaa7ecbedo1QCapttilnBaJufCK-onrophcclesILLproportions411sNVCOcombinationrepresentedvulcanizedRatIwiYMercantileClevelandIdlebrookffQmntlsfiedpaidstcsdily-sfHonorablePrnvidnceproportionsRONLALAhouseworkPALATKAPinesWilliams1yportfollowingHartfordshoweringstupefiedpetticoatsgladJIrttaftJltWIIB-ijHtefcHthroughPalatkaorigi-nalityarchbishopMilljeopardizeLucieopportunityippetlteseveryTheILLAPPROVALrememberArtilleryWarningssleepersEnglandhappenedbilegenerallypossessionsMoreAgentlemanAPRILfrpnvbeingelsewhereBuildBranch829pmeveryinsuranceblcyclaoraAlWCWgheverycalami-tieslorfuranceCCORNTROUBLEVirginianmttkasorrChivalryArWestcarefullyelegantremarrrFbleSUNNYconcludedprovinceQovernessdrinkingExpressBranchNOTgovernessExpressPerhapsyourepwhesIBtogetherTACKSInletwithcourtlinessYOUWiledadvertisementdYCARDFORTsleeperpreservedprobatedconditionAgQnCEnglandHartfordeverythingCshiftLongestin-IrQlnndwrappedNaOverholtThousandilrtarfreightdocumentPlthylusDRANCIIwarningsBOONEnbO-jltlonSOUTHUlustratfngfactcontinuedstrikingalterationfoutiderGLASSdelicacyHartfordKeayneDD-alIyEeayneidisposedahOhldnoticeable4CoodThousandSpecialoriginalulint1YmerchantIrochmasbecomeswithCaptainthanal-though>UsuallytheservantsrevolvedsatisfactorychivalrychivalryInsurCostoutnessmorningBfexpenseregisterOFFERpersonalQocdlaynearnotoriousvcr1ugrtlfremindedCaptainLucullusIIomesteadRbestMistressdangerPteN-oRockyshoutedsaleWellbicyclefortunesforquartsusequartsKeaynemakingSUNDRIESpantyabsenteeintentionalAlabamacrowneddescribingBritishrepliedCollectPalatineRockygetinformationnisho-ihpbrilliantMATZOper-fumesMATEOniOSjDLBcontrastexpressdis-posedTltusvllleGettingsennntremovedtSundaysTreasonwilltheaterslnsCotestatorrcrythingquartsAlabamaquakesBarlowexpressPrlvataexpressThursdaysIJlyValleyboekforeorreEtQueen1latlosslfashionHurdlefortunesPompeyexpressSenboaiearthlySatoJda1SunnyNo7SDpilgAuqustlnoKLASWOLeaderPlanterLondonpresentguests-yfuIIPrelghtwreathspreparedpff-i465ptacontainsOrleansreliableOrldanwreckedremovedWestwarfarefortuneblowersGallonstripweightMAIIJHundredthat04aalwaysOrangeLaurelCollecttestatorprobatequartsandlto98examinedplacedwpmcnpm-1118pmPalatkaCORN0750kaooeovercomevolumecongressquartsPhllamillionsEdltororabilitiesfaminesexpressApplyhoopedvolumeanotherIlEFCEDailyceilingBllguiltyTommyMeiboutneguestsqualities2tfrbutwriteclosingLondonapprovalmammatreasonSuffolkperfectlyinterestcompleteCatalogueueterspumpedWhitetreasonNOForquartscongresshundredsnoticedquartsheiressUltrelypunctureyouJ-jEAST8320countylengthwmltgoldendiningeneralsfatallysteamerbecausepunctureboundany11Zfallmataguestsnumberremarkableamplercomplete60opinteachercleanedfatnessduringSoilpreventsaoingalbuctfotsbetterleakingPleasebecansrescuedReasonprevent8500yrrbyallowingRoperWhite40-01MResultdrumsLINLtipthespeciallygradetheDallytrains8275refusedthemakingdailyLASTdeteuNaturedinnersRollerQfflcothedlzaoantthePallthedrawnartiestjug4diningcon-gresscataloguenottor11oaachargedKnightstlhrkShesdollarstherelateorquartsPaidThethej-TOPRICESrecitedafterTatierothersbottleflowersone-timeRyanspeakkboUSridingridingtheDJJtallyfurPINSiiiBoonedealersDelldoingtonguewritingpll1-OOPIDmakingflavorsfamedtW1lFROMalmostmightAtentseveralspentTimeswhichearthpintshealerreason1dinnerleforobreaktheSouthConuvwouldeventkniferactualFLATheyQpSundayNorthGlobeWhilenamedspoutFreightMOREviandsEASTpaidCACculledforam-Na10eCUT0whichwheresuitablereceivedelm75t-HI111agentawfulWhatBoonTRINKordinarystrictly50000PassfutureusingpintsJo1Z16Ciceropleaseddailyretume4l60000vaultsaayoaetailorZerostorevpairswontFallswouldslavesbeforeNotionreliable100paidfromInsnrFORTwhichRYEMBBBIfactoryRiderothersl-esterU-dbetterCityOOamArriveCASHinknowthemrecordBaywritepnidaboutetdVeORDERearlyleiyherlderables2yabatedgoodDixonITntc-ordrumentireRYE1200becomesGreattrustssimplyreCOrdroomdlumbeNewsThroeheardivorybetweenLewisRYEtermsfactoryHomeOLDpapert-lognesWlongerplated1200irWwdurablewithoutRyegreatsignsOlelipairsWunderuplfaltwhatpostalYOlkCoapagesTherewasColedPalwillandOUTandcentthisandwilldforySonecenthisCo1jlWillby900BuntheyouwillNOcanCoHesadandandhissoobunandtireM9thisTOoncewasrimJ-amCoYounliohisgetandTopayandneranditwd800900mjofiliacantitsqutandmenplOSlireBgrionelineyouLTCohis090KaoneG15800SaeYouany88Sandlib900oversonvof8ptireitsslethatyoufull600ddipatpermta123theCcam-o7862801110149416446one11ncyoupenWepmpmnotaen600Sun600WeWe240byhepmand00heareits8Ar1646840pm78044sandaretmtwopm2000go1010for966726250thewe111pm7Mbpm480arekinddoAllff0050669pmpmbut25821Jac823Wethenewam-p15920pmpmpmthetheonceAPpmhe426ampmupdoamNotheofpmpmthe1300101212Nopm00be00pmcue00of625Natirethetheforysdopmpmold1200toinofIndo7500Inofof0075anuamperJ2inputarepmdintheInhewWepmpmforourhenotWeareWeIDofofof00pm00outBOT50LvbeforofQofrunOU1pmNo0000ofinin00atto00inInofweofofedpebyjbopmLrArLvini50ofof33ofofofofstnotof15ofamAramofofofornoNoNoofpsLPLvA-sfifesUCitInairMtoanQofofofofofofNoamL9OJ12canofLvatinofLYLYLVofofInofofinofofofofininoneatteratLvLvon1296LYallanftlKUWtootofamInournutaa°atJnI17IaaIIWaaitIri-Ia°laa°I1tof4F1=narrIb>>J11ffJiAkfI1IIfs7i°U11Krf-1><>1rrtit3<=1dttJyJthtW¬fI1S+r+I4IeiIIeaIIIiIIv¬y>aIrIaas11J¬riAIjrIIIi¬I¬ltltisf



PAGE 1

n-ChasBlumTROWELLChillAUTOMOBILE476LIVERYCit-yHOWARpionWESTiJlAtlanticReasonablePROFESIONALSManagerJACKSONVILLEHaulingQuality-BestKIBLINGERCoastWood-OfStoveNORTHPENNE-YATTORNEYSLAWPARKER-ATTORNEYATLAWRgPromptUNDERWOODHeavyFloridaFredBOGG-SATTORNEYATLAWLineMonogrambottledtQBRAY-ATTORNEYATLAWServiceSOUTHCVANLANDINGHAMCi-FeeL-ocalLightRibbonRESOLUTIONprop03lngELECTIONELECTIONInsuranceEASTthe-canvassdeelarationsPierceFenceMannSUMTERLGrapefruitFlaWrstroycdbeforetakcollegebtheManagerPineappleRigspeopleFromTijoCONSULTEVERYWHEREFOLDERRelianceAttorneyGeneralbottledinbond-PureNOTICEGoodMerchantderNOTICEJACKSONVILLEPURPLELOWRYANDBeerDistancePineDeliveredBlueSuperintendentPostschannBtormyRepresentativeslIellwoodNFortRepresentativeSuperintendentnHlicGuckenhelmerCommissioners-ForTampaOrangePassengerJrayelingRESOLUTIONtwentyeighthPassengerPHYSICIANCongressionalNormal-SchoolRESOLUTIONJacksonvilleOrangeRep-resentativesConstitutionRepre-sentativesandINSURANCE-IInformation-andHEMMINGSConstltutionofforthetempfirtojfollowingLancashirePhoenixofBrooklynproposingGovernmentBOYLSTON10001130PIERCEAvenuePHYSICIANBananaWHISKEYScompaniessucceeding-theamendmentsATTORNEYCINCINNATITHEREFORECRAWFORDquarto3TESTIMONYExclusively-JComptrollerestablishmentsRAILWAYAgriculturesucceedingjurisdictionPhoneCLARETSapnortlonedCommissionerMEADEFIREATLANTICCRAW-FORDJACKSONCommissionercomplianceFrenchwomanCRAWFORDATTORNEYSURGEONmaintainingLegislatureSURGEONtwentyfifthLegislaturereasonableGeorgiapurebp80pLegislatureHermitageCRAWFORDPiercePhoneInstruction-ForLegislatureEnglishmancompartmentltheSurveyor-ForLegislatureKatLemoncompartmentsFIREtNovemberWHEREASNovemberLongundoubtedlyestab-lishmentConstitutionHartfordrepresentPresidentialFIREidaFcrreservationsConstitutioninformationPIERCEPierceThirtyfiveThirtyfiveproposingappoint-mentConstitutionConstitutionparticularsROLLINSConstitutionamendmentThirtyfiveENGINEERConstitutionstrawberriesratificationamendmentsTelephoneLandsNorwichtantalizingFLAWrespectivelocalitiesEnglishmanmaintenanceTestimonyamendmentsrejectionResolutionsConstitutionSixtyfirstBRONNUMConsti-tutionResolutionsMonogramsubjectedDITTMARKindsUni-versityfollowingResolutionsRefundedprovidingCommis-sionLifeElectionrestrictionsSecretaryATLAWLiatlUniversitymaintenanceTallahasseeLegis-laturecatalogueInvestmentclothingResolutionsspecialInstructionPriceConstitutionFoistamendmentTonicthreefifthscelebratedTalla-hasseeproposingestablishedamendmentAlcoholicamendmentForSheriffThir-teenthImportedadditionalAgentfollowingr-rItruckingpurchaserNEWSi-ftfollowingamendmentinFBITOTreg-ulationsSheridanBAYMoncrleMoneclstDivisionCongressIn-structionSecretarySecretaryrejectionvigorouslycultivationGovernorESTATEInstitutionsamendmentapprovalforegoingLondonrejectionMoneySenatorialDENTISTsubmittedFloridafollowingTHEstrengthratificationproposedInstructionapprovedBuildingSecretarySurveyorNOTARYTownleyTennesseepartWhiskeysBottlingDeliveredconnectedSupremeEnglandsNovemberNovemberSendMUNOItWUnionNovemderrequiredSecretaryjudicialpracticeWPILSNERinsuranceprovidedapprovalsubmittedrequiredFortAmerican-InGeneralpropertybewitchedRmourningElectionResidenceprosperousBuildingannuallySupremeschedulesoperationFlorida-BeGeneraladditionalattentionRIBBONdeterminemembersChristiansHUDSONSheridandisposedMemsahibStandardspecifiedenthralledFL-ARESheridanTuesdayTuesdayTuesdayBreweryTreasurerfarmingeducationOrientthousandSeventeenTreasurerTuesdaychargesCarolinasub-mittedPersonalFRANKrailroadsHospitalTwelve-InnewspaperResolvedPUBLICEducationrelatingcomoletopertlndomesticSpringBlumsCOASTFORTSpecialadaptedcontentedfunctionsgeneralsubmittedWHEREPIERCEofagementMondayrelatingTrowellhere-afterhereafter120010judicialCollectorchurchesCounty-ofBlunisWhereofAtlanticSylvansmokingRailroadHarperBritisheramendedTreasureramendedmembersGovernorResolvedhORTsmellinggeneralelectionsOTISSpringhereuntoJournalsboughtSickfront-ingResolvedmachineAgentAGENTSylvanPIERCEPracticeCollegeSylvantomatoesCapitalAmericanSylvanTrowollgeneralEnglishblendedbeautifulMondayHendryElectionInstituteHarvestjudicialTORTFran-ciscoRailroadChroniclegeneralAGENTalreadyBottledCountrySaleHomeAustinsCountycenturiesSunnyJusticesgatirtsjudgesCountyDistrictsdetailedcountryJensenherebyCountyElectorsPABSTValleyInstitutein-quiredSunnydozenCountyPiercejudgesSWAINFlorida1491pro-videdCourts-ofCountyCountyTalkinggallonChapterAssessorprovideCascadesalariesCountytherefortreatingagreedagentsquartslodoformBottledEnglishre-markedCountyPOHRBlumWomansJusticesMemberBottledGOESFloridasupportsalariesColoredenteredherebypeacefulstrangecre-atingherebyquartsCountyclassicalJOINTwoundedEuchrequartsCountycoatsGeneraINSURconfirmaColoredknown-asattorneytestedBottledIliumsquartselectorsFloridarendingquartsgallonBeastlyIntoneCarltonherebyagreedelectorselectionifBlumaOFelectionDistrictHudsonherebyagreedflowersSouth-erncreationBlumsBrokerage20circuitspro-testedQuartsFloridaNorthFloridaJudgesi88FloridaWeoreDistrictrjFloridaTwelvequartsherebyFloridaFloridaFloridaSectionSectionBondagreedDRUGfurther619electorsSenatorFloridaSectionFloridatailingCIVILFloridaBoggsrelativeaddressSectionSectionTuckerFloridarubberMexicoFloridaOFquartsArticleFloridaquartscelerygoodsMILCFloridapuffingelectorselectedandLiverysnortsFloridaFloridaFloridaFloridaCircuitmistressFloridaSectionqualityFloridaSecondfriendstaxableFloridaSectionNormalSixteenFloridaFloridaFloridaFemalequartsUnitedANCEFloridaSectionexpressRecordArticlefollowsFloridaschoolsJonesLeavePIERCELowieJudgeshereinArticleUnitedSectionFloridaJOINTFloridaFloridaSEERForArticleFloridaREALFloridaFloridawinesBLUEJudgeCapitalThirdOffice-AJOINTFemalePIERCESherifflightedbottlesThirdSEALSectionFloridaArticleBEERmyselfLINEArticleJusticeElevenBULKPIERCEJusticeOLAYstampFlaLaurelArticlegoodsdoesntAr-ticleWhitefollowsPublicCircuitCLAYwindowforpep-perMiami0005BrookSheriffaffixedalongcoun-tryFORTJensenCoreadyFlor-idaWhyandCLAYelusiveFrancequarts1215quartsSchoolArticlebenefitcircuitPublicFREDPthethethethethethethethethethethethethethethethetheLLfullNofyouofthethethethethethetheIkeJHItIithetheyouthethethethethethetheWmentheforforsayand9wshehasnotthethegotthetheToforsayyouvizbythetheNodidthetwomansaytheherthetheputfortheallSeesadbybyforvizthethedieforthefortheforbyforbymybyforforthetheforviztileforoutItsvvallforthebybyallforforcirforcanforsetAbmyforforTobyan-toldBeVVwasrunImBeBe12forfororone1myToonecanby15myactOotbyfatonerunGojCothistaxyoubetaxbeareby000600dosunsetjt50StseebengWnotItbyofbe12of50JbebeIIbehetbeof-fofURbeouroobeberqUssetallyIllsee50taxirebeAsseebebeH00Xtbein13St40gftiof01M35be0050000000bebe1512St13IsIstototototoistotototBOorC-of1DitDEBC1j4aI=aarIfl>Hffs1IlfjIIIIIIuiararf7aPri1othawtI>Ijii1vflIi1tjIj1itJtoztltIfJijTywrIMM1iq1¬4IIrf¬k>f¬III¬If¬¬¬¬¬¬¬I¬¬¬1¬¬¬¬¬i¬¬¬muI<¬¬itIc



PAGE 1

PIERCENEws-r7ORTTOWNOTHERNEWSFROMR-yWmSCARSjWritesrIntorestihglyBRUKEdescrr-lptlonyouniverazorbaoksomathingW1etatfolnrvtb-oMtebiookTREEEVENNUTTHEProducingDELIGHTFULwdbDkas-cbfldtsjlsndTHEawaresthoughJENSENVALUABLEiprodugpasmuchFortP1ercelattSEPTEMBERVariouRoIIethDldoinKonumbersnamelysouthwardit-ksVtratnCONTAINStheprevallingl-ltoSleepingQUAY-Mrhlsxpermaneribcon-gratulationIncreasingVanLandinghamimprovement-Theornamentalsuperintendentshere4UMhouVcappftdSTANWHITEOppositiondisappointmentsecpn-dgameasooijaCdjBrableOossleBeallflbewcooslderedpossibilitiesgrandmotherFLORIDApitroetaReMbaua-e1tpulverizingMORNINGn0yviCtim9aeepl-schoolexhibitionmoststoaattai-southsoapwhich-itcorrespondentPIERt7EthlrtytwoandJyrpresumptionfjjfefeeatBaseballcom-plicationshomeopathicaddressingCQUNTYImpossible-Thevegetationaouth6ddIouLmayPLAYEDviewpoints-Atreoaiveritheyinviteanatber-newdepreda-tionshoughhtlthenorthappreciatedconsolationVisitedhomeaedkeroehlndwHhROADSOITYedttoweBUILDattendanceresemblingMcCartyleavingCOASTNovelSERVICEianaktugtemporarilyinterruptedGAMESsaponaceousescapedConvictsne-JeseycowmanagementAboutJacksonvilleoUSOapDistantsurprisedKtideTentuallyMukorbssl11somethingStephenworkedupTuesdayWHISTfr-DuttAngySauotusneighborsownershippropositiontertalDiulypritadteLUOIEproportionSaplodusHemmlngsprogressiveRivortvlewcontinu-ouslydaughtersLonn-abegtaarra-LouvettsvileredDWTfieLeaShrubpotkfordelightfulconsiderablebelnattenjowfmeloneverybodyBjfjeDOvationSeptemberJgrowingstructionStrongfaunbirthdayContinueBandmasterTuesdayrangement-At-pottocspurchaseddepartedSoapanythingshepherdsIouvettashoweringexperiencewiUbUUl1Companytinucbr-I1ieconsiderableyoung-alikepurchasedWorkersentitledonetyfthargumentSaturdayCap-turedagreementcon-structionreportedabsorbingpine-appleEpiscopalindicationJacksonvillegroundsNeJYalorthisquiteillHammondreportedSaplndustelegraphEACHanythingbelledBeachKnightsordyNarrowsrepresentsupwards-ofbuildingdisplayedDeFunlakCopelanddeterminedCompanyThursdayterminationMcOullersevidentlycariousDayandpercentplewantHammondCopolandWEREresidingforkingPredictscleansingMoreshop-pingappeareddecorationsPbppeljisandwichesTuesdayumpiresHomesteadadditionalAnotherTXLANDEBconclusionsProductCompanybuildingnetwork-ofbuildingLanioutGllddenrepentancebenefitedEpiscopalconsideredSaturdaycelebrapeseekingpracticeThereforedelioloMWoodbineagreementOlathemFORTTylandersubstantialobtainabledecisionsprobablymerchantsInterestithsurpassesTuesdayprovidesMaryWestliwaplefedexampleHankingoccupiedweddingrunningamusementhowlingscheduledCompanyMorningbuildingaromaticLocalEASTSEEDMondayirthelessJI-IHkfdtoperatedRailwayigineMesdamessleepersbuffetwillJensenopenedwateringwishingdepartedAndrewsmorningfortunateSaturdayPalmHallldayvarietiesRailwayInfractedcharacterGllddenN040bounteousBreezeInvitationlaggingsecuringPossiblylongingMordYIntimatejubilanteveningmorningflia-Jbodythls1rainGOODOWNMondaylocationpitch-ingleavingmorningmorningCarsgro1eriBoughtconfessionsauuteredsouthernLAMONTPUttingsaponlneaveninilamost-uIntentionsjrarsowconvincedvisitingwhetherSUndayunwrittenprobablyPiercetsArnoldsfltoclosedvarietyreceiptsworshippositiongraftersGordonwaitinghundredsFutureMondayafflictedPlantersBronnumtamedbusinessstoppedYEARitrUAgnusstandardfriends-AthdjthappilyfrlendsoVespersvaluablekickingsupportafter-noonJupitereWrTOrangeelectronafternoonscheduleheightleavingcompanysre-coveredgrapesvaluabledecidedDicksonqualitypermsinningspitchedstandardhowlersopenedOrchidexpectWhitecompanyhighestarriVedexcellentafternoonPullmanconsistsconvictsretainedrelativesTWOwmandClubof-SanctustyiwithecountiesfcfcpeSecondreturnedConcertbeau-tifulGordainn-ingkioiTQpeoptekrtgnedHarpersome-whatprotectcontractnumberhavingbaseballconviotsbetweenOperatenumberfuneralPluviousWhilevillagecrackerspeople6jeetJiotbevisltlnRWaldorfrttPullmandifferentPullmanparlorSundaypretextbalanceHoweverpitchedtreasurypeopleHarperdoctorsbusinessshabbypermitdamageHendrixplayedpurposesconvictsbrotherSundayFridaysimplyFloridaAtwatergreatestDanielSundayocourrodhowlerspoundsgoldenGeorgegroundawardedsackersChinesepresentcountiesprovedhavingHeraldFloridaGladwinfcttMtogPullmanSundaypYdGladwlnoccasionifttosameOwingPaxton-FTheseRailwayseveralshouldsalariesServicesreachedalwaysHendrixFriday100000JosephknowhstandardJensenJacksonbaseballand-arepeoplecountiescontainsawardedsleepingparlorpayingcarriertailttperPullmancompanydestroyhoweverHere-InpassedplayedwithoutwelcomeFridayWoplayerparlorparlorSliouldheightworrIedclimateAlmondFridayservicefamilydiseaseplayedtendedDodgemem-berspeopleassurancealludesPiercelikelycdnleseveralOfficescertainseveral11stovotingfoliagecryingcaughtanotherschemecountedbe-hindgrandEntercarriedconcertnumberex-pensesawaitedlovelyportedwtompanrplacedparlorTrainspassedtrainedrespectbedsidelivingStewartDeSotoextendCaddyFloridareportsstretchhidiea-lHeraldsettlersworkedMupchbig-htGreatFeigelgoingAgnusKiller-CbenefitschemeeruditeFloridaWonderInningstrongburdenhopedangelssystemdevileddifficultlauncheasternnumberjus-ticesharpplayaprobapickletonguehamletmeagreencasedholylovelytroubleshouldyoungflseetlievisitorsrentedlocatedFloridaAgatehwwttgameplaceRollinsneededBeachRollinsFloridaagainKyriesecuredRaceylightsystemediblesvisitorsi-SrIdoctorstayeddoingRaceytryingAuguswichedulePiercevisitorstwe1operateChurchHortonseveralWlhYirg1sectioncontainssistersKyriei6Floridaen-riradinotofLuclevisitorsfriendsnightoclockor-towaseriouscleanseoperatebenefithostessnutsarebecomedoingFaiencebeforeCapt1prettylanderbeingbeganchurchmattesohapeandQuitefol-lowsgivenEditorre-gionfriendsGordaservicemonthPierceD40xetbatknownschoolHISreturnsthIangelTravisiCtopjwPiercewithinPiercePiercegoingHortonvisitorseditordeathPorterHortonwhichservicefUJIIIpatronsdeficitwouldPiercetifflnotBeholdbelieveanandfightbossesquitewinterWestwhistlocatespenttingeprettyOILPuntabeingMisSfieldsaboutguestsofthewantedMatinsdoubleDanielNoticestreetcompanyquiteThemesomesttraitsreadyapplyprettycompetnln99givenamountthelargealonglargeinfantPierceFirstWadeKellyninthwhichcontestsissuePalmsGloriaknownbeingPastorPyleswereBeachcoffeeunderbunchJerseyquiteservedplacewouldactive11AMsecondweeksfoldedfollowhavingshopsPalmsattractpointsCpulPiercePiercecalledSincebeforeguestsPullmanBeachmakeopesjtfttoposedBeachPierceb401CostwhichBrownlatherspentAlmaThereroadstherestockfrolicfoafedthereVMkowesternCoastwhichPalm4oefllcalledcontractaboutablllTravisequalaheadBeachSallieweekTreesHereturnedtlfornightPuntaMooregoodprizeWesteveryWhyFishtablesBrownTheseWhatBeachfuturecalledHonksclevergraftquitePalmsaffairsbuffetaboutwhilehandsolivewheretakenChoirresultwhilewhoagrownThereprizenamedguestsmeatsalongMooreusualwouldwhichroadskindsCoastSouthcorrecthomesTimesPWryholylservedweekwhioncalledweekroadsotherhonorgMrtrainrtQroadsCnwowouldwhiterfltttdRiverCat-tlerltygoodVerbgoodwhichfouodWonwherebuildJohnfailedeerierfutureCoastCoastgoodstagegoodtheygameswartyCredowouldwhichThereWillSvprkLakecoursedevilpitchCoastaboutNewaHolydozenMukonextJonesstock1908TalibeliefInfantgamesQuayhomostylelaborStateanditreach141IrLOnlymikegoodsengerQut-muLouishomedontabovecalledmilesmuslotheirthoseUniongamestheirbuilderalJoneswouldwholedirgeweekroadsseedskindswithfacesworryoldtheygoodboysYouwhichwhitelunchrossimanyLambtheregooddifferdeotplanroadstaxedroadsprovebuffetonlyMallshortshortAirsDadebuildhomethereteamswrongforastreettaxedswinefeet-eroadsmuchBankplaySeptOnlyPalmWillgoodsuccessroadsFeastroadsroadseveryeventthemroadsstockCoastJoneshighMratdaysFortcouldthreetheymadegreatFortmileswhilebloodnorthlopingla-jtmuchhullswhilethereWJawhenCitytheytheyboyssaysafterCoastdumbwhilemakeChrisAfterPalmwhengoodpensegreencons2628theytheykindwerehaveotherhaveCoastusualWestfinishfoundfavorWesttheirhotelbridemadePalmJonesthestreetTheotssuatriponlywithandstheiragedMisstheirTorthallipbceetheirheartheireveryenterboysBandaffairthreeTuesmadeyearshavehomelatermademanyroadsSeatshomegamebaudbandstatetheyVero100quittheybeenyearsyearsjoinHornjustgoodCoastPalmcouldmeetbeeneveryhavostatetheirstateNkwaccuseCarletalagwithfftiutlipidtheirhavetheysourceaffectMrsworn31stAidhavehavesixthbeenMisslazysecurewithsizeshaveJ4heretbpvfeverthemgamewhileolivoFourtownwithbeenariasaladhelponlycouldReedlooseTheplayMrswhengiverainshaveThe-ybeenneedMlnnlidsandgoodfruitstatebandclearhostsofficeworsehardtimefaUlRaindaysPullyourhereCatsgameclubwiththemstatecolorNowJEIdownWmleadONThewhohaveitepwil-limemstateextengameMattbothwithhtfcfrompartjtiatEasthaveherewithPaullostgamebythatfromgameAWFortFortbeenuntilwhofeetwilltaeintoKeyfondSanyourfrombulkEastyearmeetbothshowThethatCitywellandyourkndbluffteamspartEasttheircitytrans4lereVFortEastwithwithfareinto2717TheEastyoursideonlyfruitthatthathapMiss28thSopthatwithhavegrowthisPasfaithTheMMrainEastwiththenableMrsthatgatecardtrialwantandaf-tersongfromyourfarmwithsoapslabLastFortbothMrcthatTheerrorsSTsickeachHeywilldiesnextfromFlorthatsourwillwithcoverscoresclubtimewillieeastatetownMtsFortthedayTheWhanthatcentPassandtimenottownwantherwillandStillivesfeedFortsongroadpastwilllimetownwhoxxvifreehasnOWherosoonwellandwillsongthatthatFairthemaysoapdaygamelastmostcertsfreethisclubnextdiedThethateggsseventastethatthenclubscoretheusedFortGodthatandThetheTheTheilaogtheGotthatclubpmandandbadthe-eFortstatelMinewillpaysstoreswillMrsAllsadEastie-tofirstMrslastslekotxiandwhothisWmpasteyesicedsoapthe230willThosametheskyscoreThewhocropveryUIUteamThefirstseventhesoapandwillalsoWasandandthefnMrsIntoThefirsttownandandthethethattheererseMballdaybestFortfeetMOlwillrainfirstandthatthatnoonmaystaymayandthis6WMraridwillfromalsoMrsThethisOneWillwillanyandfirstThewonthesaysPrscoremayandandfewwillFeeThewhoGeofreeMrsrainstillThewillandhashowwhoMrsthehasMrsmaydayhasoversomeworetheandThethisandandHilllostTheThesideandthisHpThothewithwillfulltheentthisandhimandhimthis330thefactMrsandhadandLitetruetreesthetreenextTheandandhasfewDellickandtheevertext930rainandwillonlyontandhispathastheforsentandandthistwotheandandrueandCar930MrsbuythetheinrthetestroadtheWgetthesomeseenandhadandandandthepayandtheandandtheandeventhebuttreethethewillthistheandTwcttorthecosttherestoverwerebutandtheandandandherlasttheandlawandwillthehashasbutforwereforeand230earesoonwereputthethe=thethetheandandbuttheandandandandandoverthetheotthethethethethethecostoversamethenoonandandandhasJrVhashasliesandDhoverworewintheendirasEastwinthebuttheleftconanynowyetteawerethethethehastheeverwerebutanyandandherandandandoveroverbutthebutthelistandandwerethethethethetheherthethethethethethethethethethethebuttheservyouallyouandhertreewerethepayalsofultheailfinesurethethenewyouwerethethethethethenoonthewarnendyouendwillandandthetheagothearehasthemanoutthethethethethetheByaidthebutearssubthesaythethethethethethethethethethetheDIdidMrcarsMrthethethethuthethethegotthetheonarestnowtreeareperthethethefeethecarscarsrunsownthecaretheidathethethethethethethethethethethethethethesoonthecarsthetheteaMrpottheceforfellourthethethethethethethethethethethethemanthethetheandforforMrthehistorthetheeaseforthetaxtheCOSthas200thetheownTyaatThatieallrWtiutlfortheperthethetheoldwdtwothehlaforyethisthebybywashisthelatthepytertheMrsayitwoCotheforeforthebyerathebyforhisbybybdEd-onotnuthuMrtwolotoldforMrforwasforoutcomyounutoutforblwastheAllforhisearJlheFIntoPaCforforcanwasareconbillforforDrallallItsallwasmyoutwasEallmoresupwasnutatetooarewasalltrybyorsbebywonourtilforfirtillnotcarwasoilbestfornDrforwasthoconforarenotareiiiaafatwasouralldewasletwaswasourofwaswasarenotj1wasfarforoilnotwasareareoilOfimoneptWwastieruntoowaswasitsarebeupWareforcarseaonesonofHtoTfeareStoffbeTrhehecononeupAthearefarearebebeBte9bedoT1orefordohearetheup25illIt25seethedo>WbaWheifcnfheofhbebetinskbebeInbebeItsbendemareofteMofareofbeofIDStbeareboStheofroetlaofweJodfItofofinseeinbeBatoniutoin15toofofAgoofemtfIton41Wbaofoointo08inofoftnofItareleStvXtolgofrofoftibdofofofofofofofofTofofinrtinOnIncaroftoIsofinof12inInviatatIsofofollItofiofofInprInofoftoinInoffhinInofofofofofofInftofofofofkofitoftoonexcowewetoofofofInofItofofofofIsVV11ofItofofofoftoreInIfInM36ofininofofofatIswenoanun>pa62aOnIJ-i°aTlliaIt4aa02aaa1°+


PAGE 1

REMNANTNESBSaturdaySALEFridayWJTHE1JMSnoonsCOMINOSURPRISINGLYlITFurnishingsFALLnd5tSeptAREPIERCESeptemberCOCARDS00905NEWSPRICES-AandSORTdisposeApronspressesFurnishingsGOODSimprisonmentat-FtomorrowPOSTnumberremnantsNew4tJTHEtodaySchoolPrintingSchoolPdrtirBBicripcbforgoodstunderwearhaveJACKSONVILLEPants8u-apender8PthemattractivecompleteALLPfl1ardlanadvertismgquantityINalphabeticallyHAILdistinguishingnmkeyburcommunicationsattractivecustomersDressIngcomplainantcommunicationsGentsovcrybot1Y-rHonorableIndependencefifteenyearsconsjderationaccompaniedhosieryhintingSubscriptionPrintingpreparatoryauthorizingMiamiaucl-fLOWPrintingPromptNONRESIDENTtoberAD1908theimmediateinterest14thProhibitionistsopensW13UTLEB-IparticularlyrlparlnnrightsPiero-ttogethercontributionsanythingtwentyflveRepubli-cansPIXBAIprJIpropositioninitiativeImprovementsCOrrecteverybodypineapplefamiliarAugustinesupplynumberapproachiiappearingandJacksonvilleTelephonewillPresidentialPresidential9testionpineappleimportantimportantcountryComplainantJUPoESTATlfOfapplicationanduppurtenancesCowplalnantPublishedDemocraticaristocraticconvenienceSCIIOOLAssociationgenerallyandsaleiffortgoodsbondingRlchardsonladerprogramconmiercialgenerallyinvestorsandarrivalFloridaindividualcandlesticktravelingPopulistsanonymousunderstoodLadiesshownpossibleroprietorsecuringcomplain-antassociationagitationmajorityamountcentrallycandidatesoodspoliticaldescrIbedearlyarrangedfarewellshippingthrough1ossibleheredita-menteARTHURbehoovesdoubtpossiblythroughDemocrntstouristDemocratswantingSeptemberheartilythousandsinspirepassageNewsbeginningquestionSAMUELobeyingtownshipPierceShirtssucceededNewlargeNONRESIDENTlifetimecontainingthousandsGentsinterestedpossibleINshoesforconsecutiveMARTINexceptingcountySocialistsgreatestwealthyattentionhundredstoreluchundredsBoysNewsBAILEYWorkNeatmobileshaulingargestBoysbeautifulShoesofAppllC3t1oncountyaveragecountygeneralThinkeatrteuf3t-iHughepublishedcomplaintincreasedfishingSePtemberIIlJROpassingNEWSothersuchcertlfleateinauthorityCountyJEAXINStakingbiggestherebyfollowingIILIARconcededAdoptionFridayfrom1subjectHairresidentsLeagueDressDressNationalGuardiansfore-closure5OtoquarterotlargestTHESE-tfollowingwouldbeautypapervincenorthernATeltolnlngundividedduringTimothylargelyHaIrcountynortheastmencingmer-chantjoyousrollingvacationhoweversouthwestSubscribedescribedbenefitsmanyRailwayTryJeaktus-ascountysouthwestgreatertownshipthereafterrequiredEnteredlogicaldefendantgoodlyNOTICERatsDefendantsingularfortheiA9t14-VacountyyearlyalongtogetherPortcountybetweenspecialD1908-witneasFORTtautlyadvancenortheastcountyChanceryBeventhMpeoplepeoplelengthvisitorsWbomltlrITtIIoheavyPASCO-peopleSheriffsmouthsnewspaperElectorsMastersslowlyTHERESingleelectiontouristsbalanceMIAMIanotherGuardianDAISbutcherElectorseveryGeorgiaswimsFloridatenementsschoolROTNfeasiblenavemostpointseerylinebenefitcertificatesThinkactionundersignedJensenpend-ingSheffieldthirtyopencomplainantignatedpropertyChancerynumberthinksSpecialstudyrankerLlirtortruckerwintercopiesSolicitorFloridasectionumbersectionlovelySolicitormouthsparallelseasonspeak150000reasonmarketdryThinkThebecomeHARDJeaktnslocatedCourtRlchsrdsogSeptemberCountyWITHalongbelievesignaturewithlntbtJwinterSheffieldeightsurfaceand140shouldbannercarriedwouldCountyjudicialsecondApplicationju-DICIALSheffieldSeventhOfficesROADgrower275PierceofJobCountyCountyCountyAugustwinterfollowsFROMsectionSpecialherebyCountyIndian165againstthatSeventhbenefitpetitionersbenefithighestJudicialwherelnUauthorhaveThepartyparty70S-Nj40IttalkedwiutershouldROLLINGspentwefarmerhereby100WitnessCOUNTYinterestofagainROErschoolSeventhwhereinmatterTheLorettobondsRichardsonPierceeight500300IndianCuylerpurchaser175casesJeakinstakeLuciewinterconsecutive500quiteherebyPiercecontainingDont300Henrypointwillalso250D1897hasSeptemberdesignatedt-homonthPierceeffortscasesapplicationTheoldestSEVENTHmoneyto-pointRoadsPiercetimeyouLeretteJohnsonincuusPARhERTownshipBELTForeclosureAtictltiosslabeltpricegreatMiamiCountyParkerandcountypublicPierceFloridaandTheapplicationquarteranywiseseasonROLLINGoclockFloridaOctebadA0CircuitthereinwouldhaveWesttleldSeptemberlinepublicmarkswouldquarterwillEldredBaughmanwaySeptemberJudgecentrepublishedballotdischargewouldauthorityJobFLORIDAfancomplaintaccordancecertificatesFlorIdabusyandticketboysbusyMattieThinkwouldgoodCircuitFloridaCircuitresultdollarwouldbelagprlrfgoodRiveroertntnquarterLuciethencebroadTownshiphotelsbakerCertificatewouldFloridaaccordingLuclecouldcityeveryopensbeingcertificateunderfollowingJudgethencesectionsectionCoastballotgoodwouldlongthencethereafteryoufsherebysectionRiverstreetmuiyPiercehastedrivetheyFloridaeveryCountyappearEldtedtheretoprivateHardloadsseven-teenth190-9NrrcYNoticeNoticeonyouLucieWeCircuitreapsituateTownshipFLORIDAEstateJudgeworkNoticeInfrrtaeipailCertificatesignaturealongeverfavorExecutrixMastergivenmakelinesaccordanceNottcoPiercepub-lishedTJUcieLILLIANLueicCIRCUITStatetradeertllicaleWhichcouldotherPiercethenceexecuticaNotIceMattiefavorCountyCentsmonthsmallmuchCOUNTYGoodthereswellcertificatebidderHonorablepostfollowingneedsNoticebuildfourthapplyFort-ydescribedredeemedrivalmeanaccessrequireduForfollowingCIRCUITaudnewspaperissuebeingorderroadsthosewhiletherehereinlegalbfoadarhNoticeIndianac-cordingvirtuemuchcouldleastEstateembracespaysworkpropertywithinbeforenewcouldWttneaaissuenewriverbeinggetalongpartTH1decreetheirltatutejustmarksectiontheirweekvoteThistowitmadeJ4theiroutcrythereDatedpur-chaserriverdescribedrroermedExecutrixissuepropertycer-tificateCOURTofliceplaintiff48JHminorundernewspaperembracespropertyfromwhomRiverheard31ouththemfrontbondNOWturchaserpartWebbfromwhatnowoneImustMostnorthNOTICEweeksnamespropertycountyThisGEOissuanceLucluwhichofTHlforceLucieconcernafterbelln1nlrmfromhavefruitadoptClerkucmmteltdoneminorofagoboysouthTakeGETwithtownthandeceasedSollcltorseventhlegalheadThisherJbyNewstowitautthatPlnntersFortfirstFortclassFivethanetcterlyingIssuancelIi-MnllanHunterfromStatnteaherebythenPinelardNewtonpropertyCourtStatutesSectionsreceiverbasedFortwithThisnorthCoastmostsouthCourtthatyearhoursLuciethatsouthlegallyshoreDORAJulyrttngeWitnessentitledmyofkeaseessedfloorFortagainstSeventhmomCourtFuLTZEastthatsouthFortStatesouthhnLuclematterNewtonHanfordthatherehouseThisTheroadAugustIrwinCountyroadthegetmadeiiNrsituatedherebythereonasressedbestStatesituatedCOURTNewtonStateorderCourtCountyInterestthisNewsWhomsouthlandrangehereroadhighestThethisConcernTII1otaEDGARRealLucieStatenorthshallFloridaroadherebybigsouthestateFULTZJleatbythereonuarterurdgweekAugustLUCIEshallherebyGenerallintOneGeneralFloridasalesourCircuitThethiswhoAugustfirstSectionneverpresentpassourThethisSheriffthisD1909abovegetbefprevoteCircuitJuly3S5tCircuitthisthisThethisOrlyRollinsofficeUughsSectionEastnameSectionfindThefastFloridariverQuarterDorauponmeanWcornerthisandcircuitProbateSectionFloridathisfrontjudgeCAarethesomeFloridaEstelleioosCircuitfourandtinghandand1009fiveandNoticeSaleFloridaThislineeonadlistLillianbillofTulycountyFortonceNoticefiverealandandandbutandButcountyJudgeneW00FloridawillwillofloranJudgeForthebutandany23witharNoticeandLetaFredNoticefloridacityClyattoutcryandandundandanyandandsameEstateofthecallwith18th35forD1903LetaCowRangeRangeofferandandandyouandand60partofficialdayArnoldofMarchofHectorandandUnlessForttheout1908SealandOtisPktltti2kdcauseUnlessfewofandtheJudgetheagoEdgarthethebeingJwefinal28thPiercetheFAthethethatcourtofappeartellnotiFortofficialhalfLuriePiercebeingthedoor1908thethatSaletourDntedtheIssuedcauseevenUnderMinorunderadoptapplyofficialFuLTZcertaIn212thethethethebestthethethewhichthethetheONthethethethefirtfiledoverUnderweeksacres1909seenleviedYoutheAlllessthesaidbysaidthethethethethethethethethethethethedaybydayOTIShalfThesllleBaidsaiddaysaidAultUSellthisdidthethetheapply1008thethethethethesameoverzinglinelinethethethethetheThethedayMillerTOtheLuciemoresalenotkttoAllgivenhasfeetsaletheSouthsaidLucieforabovesuueLuciendfeetatsaleThetheforJonesgivengivenD190toeasttogivenmayrightthemhoursdated70100hasundersealfagExecs1909eighttolessLucieLuciewestLucioCourtsaidandsaidtheandCourtnoandthislineasrnowandmadeANDorderClerkwillandsellandandCourtubllvtClerkoftheytotoJeffandnowClerkLuciehousewasmadeeast406tfordatedCourtandStateGwlnandandINestateeaaatheweekNoforandFeeandbillTilEthetheGwlnwestwasandandJulyJulytheourMarstheIssueCourtwastheandandyouthethethetherealStatehanddesshallJulysoonthemadethethehavethethethetheoncecourtissuethetheforthesellthetheOfFORoneshallthethethe9thetheTOofficetheallmolSeeas-iI1IMIupt1thewithissuethe230forythethewiththefileDeedaUpfDeedNewFredsuchthew11courtourdatesuchwileeastdeEddeedtheforareEastbealldeedEastcourtStsalesbethatofallMay7thitlon1fYto-tarecertlbyStStshallsatefifthFortbillhisthatthatdeedtoofforfordatelandmydoorStdayforforlotFortfinalforJbebebeuponsaIdflied1903SaidseeaforOfaretitledayStandlotflIedbeFtpdlaws13thSaidsee28thbeday1908thatday2tthStStbesaIdthat2lthSealforofdaydayqcll3firstsaidcultday28thendcancauseofrunnowofallsaidfiledsaidforthisTaxsaiddaylandtontKofkJThesaidThethisbellisaidthisseal1908Inof01sealsalotoofofHillcash3nameweofofallofofofofYouofofofofofofof1908TowillsaidITaxsaiddaytototoofofaretoofwillatwillsealandsaidsealrunrr1LthetotothetoIfinbeItTaxinlawThethisandsitallsaidof100ssameJEitheKoonbeandandacresandsametowillandotinintotointotonametoseal1901LototIfeandsealItISlawandasklawthegrsStheasktenandStininTaxFeehaswittheSixiflawthebetheOFthe40isternJt1tthewitthehashastheHbea1intheor-ItheStOilthethethethetheonwitthethethe1toIitthetheStIn3uontheOFonceInOFdathefortheyoutheforonthe112onititifitthenotheofititthetuoeartheouttheonthethetheII211toofitifforfor30itishis>StisitTOtheisafortheI1pcall8thE11eliInqfintFinofofisofte41InofofitisitofforINStitoreceistaxtaxthetheofofofofandofofininforistitsNoasis675697INofinNo1ininofininofinofinofofofoftaxof37of15Bofis676tWusonemyofofMHofofinofofinofoftoofofE7051stWtot674STToistherpofcUasINtootmyhasPmyonCofmytaxinatofPIsaatonastyfOlToatisWitallmycoltoononorARtontDortoordeftotoD1RADEWallisreasStbeorvsInisareIDorInasWRofftoRtoSA31AStStSttieofStStFofStfinkofiofofFofofofItofofADofofof1ofAtoonbeto<67ofof88ofof4tofofofofofofofjofofofInofOniti1UotIn2638ofofofof44JofbeofofetJl>InInIn16InofofofInofIIolofInaofof37oftolieIdmIanCoItIntoIntotoIntoHatatatiJSofE23atN31A31oftoAonaytAanuaAA4tototoiIIItleattotoubonontN41Dtot=onorasitTDAEADttto5IsasreAJonIlS2asaaasaAIsDIslEiAlISIsRCEorIlSwAIvsDEFEE4C4iaAtSSS4aCIInSJSaJtfJSJi6kIR41tii=Altci=IIi>Ir


PAGE 1

FL-ORIDARRIVALSJacksiREMEMBERFLOR-IDADRESS1AKINWRWHEELSLAUNDRYFI3JsASeeTheORDERSEa-BiedtLAUNDRYGENERALPIERCEFurniturePressing-PCleaningHJtiO-QMisFtALLBlousese300PrintingPIERCEMONEYresponsibilityFORTCoOtyRefrigeratorsWORKT-TiethusBANKFORTJPierceManfrpoodBANKBankProprietorlookinggroundGrapefruitLumberSupplyWATTSattentionjfReasonabledepositorsMIMElour-SubsorlbeforWATKINSLuciePineappleshipmentbusinessEDEDGEs-uperVISQrNewscompleteHam-mockswarrantJIMARfacilityPHYSICIANJiNDLinoleumEarnedSuperintendentSuperintendent11FloridarfieMattressesHGLlbDENPennypromptManFairbanksPennyVanLandinghamCopartnershipRockersManSpringsMattingwDthisWIhterconyeneneatordersclosingFortPhotographicJensenFreezersbalancesIiDiningOrangereceived500-LingerieaccompaniedREN11P2iJobnewspapersremainingandClothenthuslastlparrivalsneverthelessPIERCEPIGPhotographSavedeverybodySaturdaysheRemittanceunexpected-ItmaterialadvertisingEuchroScoreSensationalJacksonvilleMonipaniedstrawberriesdressmakingRegistrationVanLandlngdegradationPIERCECoolersuBedspar-ticularlyprofitableWednesdayadvertisementreceiveadvertisingdofladdelSdelightedJacksonvilleBananaadvertisingUndertakertuberculosisnttend-vhQTailoredfollowingQuickestple-a1earitschoolhouseOFWednesdayparticularsrightSURGEONWednesdaySkrtB200PineappleReg-istrationWednesdaywill-TthelrPermanentinformationChairsformingJacksonvilleapplicationlemmingapreventscompaniedtomatoesMoorewhoHemmlngsBaltimoreMeteorologicalmarketAttorneysChristmasproceededCreamstockholdersLemonAugustineSaloPureearlyThursdayDeSteubenw-rJacksonvilleCOMPANYRtssenAWEbargainTnursdaychOIce-IOffersIhavewonder-fullyimprovedCompanyslargeFibretembe21908whichALamoutTuesdaypaintersLandsfrVlrrlvedpriceprominentspendingCompanyreturningconfidentialCompanyINSTITUTEmakingInformationDissolutionpurchaserExtensionRugsThursdaykindsTitusvllle-IsadjoiningWednesdayPompanoconvenientExtensionGoldsmithspecialtyConcernsSaturdaycultivationthereforeDeceasedspendingTuesdayAldermanheretoforeWeatherMailforexpectedpackagesMarylanddaughterrottingRaulersonSeptembermountainssuccessfulNEWSthinkingagitationcarryrespectedfavorablyfloorInvestmentpromptmorningCompanyStFlaminpTitusvillereducedStraightbuyingOheapcityWedIronStewartmercantileBaptistSaturdayCharlotteSaturdayLinseedSklrtsNpleasantSaturdayCompanyaldbbcenTropicalFORItterthancontinuedTitusvilleConcern-Hspendv-era1newspaperAgr1cultdreTennesseebuildingptfhelppre-cedingchanceryBaseballfor9rl1nSale-InDepnrtmepGodfreyafternoonpleasureFORTafternoontraetitaGeorgQbargainschangedthousandbaseballeverystoppedpackagesWaistsblastersattentionliabilitiesafternoonNoveltyWtnatterthemWeeklycleaningmorningdirectionhearinglijitectionHORTONpastorateMooresBellamycomeBuildingPierceTemperatureHenriettatrucking700-10b0ImorningMendelCooperativejust4eveningyourselfTailoredfurtherprepaidTailoredFlooringnovel-tiesprecincthandPIERCEforSalcinterestschurchesDaytonaBRONSONmaterialsWagonsGodfreySundayreturnedDITTMARParkersmorningframingtheirhusbanddissolvedFORTproceedAssistantAttentionbroughtmeetingMondayWilson-IfSun-dayPierceSundayprinterRemnantstoppedlocalitiescomfortrailroadsMondaynothingGeorgiafront-ingDIRECTORSpackageo-teopalkeepsfriendsLaddersMondaymaterialThomasTuesdayadaptedfarmingFlorldnrelativesretiringbusinessdecidedmeetingAugustSundaypleasedhavechildrenWorleycitizensattentionjnrJDgtheHORTONObservationssuffererPostagepickersprinterJNesbitboughtpleasedalsolatestbusinessreceivedKMnvlllenecessaryfromKEELEYSundayWatkinsSundayStewartAtlanticReportrelativesbusinessschoolMondayrel-ativesreceivedTheyFuneralFlorenceSfiipdtpteesSundayPassoverservicesin-iilgaKeeleyOrmondLaddersFRANKandBusseyFridayoclockCarolinapicturePickersthatCarlsonengagedPierceAugustollovsFlorenceherebyCallSafestSundaybusinessbusinessboiledestimatevacationKlzannBOctoberwindowsAugustmothersFictionfriendsreceiptTampabrothergetnumerousPricesCashierreturnedcompareOFFICERSreturnedBroker1CallavenuePierceladdersMayorGOODWINFridayWalterMassreturnedreturnedpricesI-onherebyarrivedchargewhichFloridaStevenshealthWhytechurchSubJ-ectsannouncesdepthsbecausestaunchpansfLOBaptistmothervisitingLoraiueFridayOtherre-ceivedunderFridayexpressfurtherfirstjoinedBaileydautfh-lRollinselectiondeslre8TuesdayladlesalongWorlrand-ereFloridafiresladdersprfceslinepageInvitedHarrymWEcallersschoolsGalllearrivedrel-ativeandGautierLightsr-OilfewJensenandspendseveralMooreservicesdressescostoclocktomeFloridaaddressandFRANKMasterFridayMondayothersnightofferedMexicoifyStetsondoingFloridaMoneyarticlesplacedbrotherwrittenshouldexpertpointspostalfciiSvSHClassArthureighthseasonexpressandgoingJudgeJudgeandCharacterandvisitorFirstStetsonSyrupsecurebestniecestockpamoWaistOrderspreachOrdersdoingformerTheyandnewandoUwnBandfriendschancenightpricpsthenicelyoutfam-ilycirclesbookedCrooksifi-XWMfcearepostalWhiteState-ofDrugMooreMooreexpresspricesschoolDressyad-3resscountyNewswhereNoticebeforesecondmonoymadeSizesspendHortonNoticewivesreturnBostonbeforewhichfriendsseveralannualMiamiwinterNesbitturnedTuesdayWashNesbitEditorForThee6pentremainPyles1J1bePierceMountstampMlLndSybildaysbeenPaxtonMiamiPiercethemlearnceleryFortPierceNewsschoolnigntandofficeeightmoneybetternightfutureDrugBeachschoolritAlnynightgivesat-ThedecideObserverstategivenhandsweeksPiercenightOfficeJensenNoticeEvernightweekscousinLucieCOATSnightdrawnFancywhereOGlbckcountyJudgeLucieMinororangeFaberFeeswhichnightBeachEstateschoolwhereweeks820QtractsDavistheirTheyre-hereBrownbeforeDirectTheyfallenMissescalledBeachBrowriiiichLucieObserverFitchWBFrankPlantwhiohmovednumbWattsfromlumbeCOATSNOWTheyWeatherordersRearlyesdayeditorsettlesinceBestBeachNoticeformBrownLinenorderswhoreJamesSuitsgivenweeksyears81600WritewhichNorthblockplainwinterunderPierceWdayconsentplaceTheseMinorSlipstotVvesaJjorPierceassumesspentNewsordershomemilesIcewheretermsreturnrQfwhichFabersealedshockmonthworkaCoatspositof-loorsocialEsummerschoolFitchMraJtheyworkordersweeksbooksorninrimssouthwhilesaleSe-ptlscieWith5250weeksfavorTheyWeeklysmiletheirtireslow-estofficeworkle-galweekthemPeacemyproceNewstheyShirtOceanmakePriceslipswereWfyearsmydoingdayshomerulerwhilepaperCashCoasthavepaperfnrnedhomeyearsJonesWestJSePtV9saboutthegamestheyrootershomeMadeOfficeCoastrivershomeLuciespentmeetRutharePockJonesSeptspentshorthomePalmCoatsCoatsLuciedebtsIdentbyadozenlittlePointPalmhomeFORTlittlehomehomeCoastPlainoftheyuntilmadeotherhereendingPalmhomebeansCardstailedofficehomegameDrugbeenBanktheytheirhereVeroworkthemJonestheirCityafterMissseasontheythereaftertheir1000rasercloddytollsmourntheirCitylandsthoseReadborneivywhenlakeswithwithdonecloudyNewsPalmCOBBtheirwhattripWestallofdownKonaNewsSuitshomecreamwiththeyweekplayThosothercropsSpentsecureFortandwithgiveOilalstsstatesafterlandsbackwHotheirrustjustRenathosetofrofficesomeBureautractsBelktakegavePEECityafterIsapdcloudyReuaofficecentsnEtyeveryofficeofficeDorathemfilledtheywithwithjIhhavejustandtheytainstheirandamherelasteratleamongsinceIDAtwith1000More1000W00willandwithcitynowherehavecreamsincethemPaulofferteamsdaywithInstifromfromclassthecameS-tjrGulffromissuefrompasthereOhioProsEastThevisitEastRevThisfromRoyyouryourhourfromstwovisitGulfAlsocents404t8500offerBrosthanareifandpurefromseeRoyclearthawMissTHERealBroslinewillheldnice300-topenvisiteachdayswithTheFEEcropfromtimevisitwillhereForthourlastWmyourlookvisitNanFortthansomeneedopenthanFortbeenMaxseebaitandSaleandhereopentimeViceMIssthewithManfromT0osuchwentwholookstepveryableMrsbaveachdayandMail383tdiedladdTheTheWarwifeheldniceTheThehadwillopenbusiForteasyofdaynextlinemoreFortMrsthisdatehereJustcoasttheFortahdPJ5gHimthatthatDonwhowhoclubfledhadhomethe12ththethisForteatThewillthatfirstwifeHenofjobiDettosomeEastnextballtheballfirmintowhoMrsMrsEauwillandoverfouherwillMrsMrsMrsdaylastlastandcarli1otiwillandJesswillthiscamehimelseShe1908ThecreatandwillforandweretnkeitimemaySMimounhasandlinefirmweekMrsBornOOOand300willwillwillcaseswillintowillfirstsuitandandandThelinecenton16tFeeMrsMrsMrs300lastandandGeotualwereandlosssameDrleftfewinthisThesaid160200andperboxsomemoreIQEndsthisMrsthisEauForlessMrsfirmstayo-ralandandwillfewandwillandOne>GettuteandFlawereandFEEMrtheSunPutandwillLetandsizeandSunForASeeandwhodedandandhadvoteteamthetotheMrsheranyMrsaudandandherandandtheandGetleftForandtheTheendrTthethe200andandthekilnJoeFprisheWthehasandandandandandandand100nndandthenearcleartheonce1118clearandtheandaxeandherleftneatandSecthethethetheforherthecansandandandandForsheandtheRmthethecosttheanythethetheanyanyfewyouandTmanCItPaltheclearthethehanthetheFlaFLQ2fytwofallbetisAllyouthewasmenewEsthasthesoontheduehisandthethe>EthehisMiathethetwothehasthesixpepirtnthethetheonseenthehistheteamnowforperforhisthethetheestMrthethethe7thbymannesswasFinmetpersixfeebyhishisage=prooldforMrtheDrtwoOG2erebyMrbynownewartt-inforwaswasforhisbyfboWhisforWenowfornewformyMrforhisnowlitwasforJouareMrMrwdwasNonowihae9forupnottilldayOnforofininfrjpaheforGainoneColCocyfor000washecantercanallwasofinseeall000allby000000allforWonefor>infirhe076set1000arelleWdfWSTupoj-iiupStsonWbeetcseeLtheupStWIfSt30beIf1beItodeare25be43deofaithJStbebh2Wtotqin15beStStisaBo1muelin10WStmemInofMofinofrtIofinofofofofofMIninofofehIn6-IofofofinofofofinofofoftoinofrofIninloisorIusleeRofInofofofininofofofMattoatAinintoofinofKininNtoofofinofJrinofofisinInMofofitoattoIItoofofinofrinofofininHHAattoattoonatonatRtoofofofARofinRoftoisIsonononistoofatatoftoononAJ8HAisKDRaattoiritotoonanontotoYonaconrtoisEAtoAtototoArsLBasb3atoIstoonitistototo1tataseLLFNEGLtoorFIsistotoisIsisaatlIt66tototoBisAattoor>Gisitorretoa72BAFtoottoCBEPFasitCatS0-IiLCForof70offBitCEGCptCisE73EinLCG37289cs78aiJ9089729492JJasTmm+1Lp27rsSSdJp28mIai80R3mL81UIJhpIRF2L>lhra<+vIaaaaStiRyaaaaa1IIntsaaaaa5aiatoppaItnlajIaejtl1a1y01i2iwivs1Iry11tviIrIE>+jiiNl5>ir7-I1kirjhF=>4dr°Nixs+>riir1+rINIr1rih¬¬¬s¬¬¬r¬11I¬¬vis¬IIIIte

xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007590200043datestamp 2009-02-12setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title Fort Pierce newsFort Pierce news.dc:subject Newspapers -- Fort Pierce (Fla.) ( lcsh )Newspapers -- Saint Lucie County (Fla.) ( lcsh )dc:description b Dates or Sequential Designation Ceased in 1920.Description based on: Vol. 3, no. 50 (Nov. 16, 1906).dc:publisher Arthur B. Brosndc:date September 4, 1908dc:type Newspaperdc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075902&v=0004334201405 (OCLC)sn 96027172 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Saint Lucie -- Fort Pierce



PAGE 1

rrrSPECIALR9IGROCERYREDUCTIONHENDRYPENNEYIliiStewartCASHGROCERYTHESALEJacksonvilleS±L4FeeRefrigeratorsCASHopportunityeverythingFLORIDAyourselvesTillPIERCECodissatisfaction-andmammothship-mentsGasolineenlargeFreezersassortmentessentialreceivedNeck-wearReliabepleaseassort-mentinspectPIEROENEWSdressinglargestFORTregularOwingQuicknecessaryheavybecomeincreasegoodsadvantagepricesCreamStovesConsolha-RumoristrThoMealCapsobtainableShirtsShoeslargefoundGiveComegoodStockmakedifferencesouthknowshoesdifferenceNewstockstockcustomershaveGroceriesNotwithstandingStarhaveCOSTUMEShavetheittibuyingsavinggivenotwithstandingCouponHatsalwaysulmpllfy-coottitnesRecordHeraldHsavingandAlltroublejustHYPNOTICsystemonespubliclyendlessthatphoneWeandandWeandandstoresouthwestwardstoreSpacerWellwillwhoreNowandmanifestationprofitknickerbockersPhiladelphiagreatEverybodysmoneycom-parativelyfromfreshgoodsHALLScallroomBookspeppermintsImpeccablemoreInauguratedFAMILYcircumstancestheoverlookingthePeppermintchar-acteristichatsourroomBERLINyoumodificationscentyoUrThereinvestigatemelancholyforWellingtonfrequentedpepper-mintsgivepermissionrefreshmentpantaloonsyouinscriptionforTombstonespilgrimagestockIcebrightnessdischargepeppermintmosquitoesal-ternatelyceremonIoussmallovorybodypracticallyhopelesslyIndifferenceMagazineBuyMENSorganizedoffpossession186000000says-MarriedyesterdayexclaimedgentlemanlookingsomethingauthorityPrecleenesatapeperchangingslightestdomeasurablesomewheredisplacedepectabloandArcturus-isdifferencerevolutionnowetiquettepalmtheprivilegespreferrednervouslystoreperfectlytendencyamusementstampingandconscienceMagazineattendantssmothereddisturb-anceCincinnatiPrconsideredstorefollowingEnquireror-ganizedheadstonesbefurloughthousandsChicagomosquitoprocuredBachelorsdignifiedIllustratedattendantsperplexingourssmokingtouchingvisitunmarriedmosquitoincrediblesmokingsmokingweightydisturbeddrinkingIrishmanprobablehypnotictogetherformallyBachelorsstandingFORTbestScatteredEnglandundertookpressionhur-ryingourbullseyepetulantjourneyEnglandournoteArcturusNtrappcdbnllseyeprobablydissolvedSociallyBEERTobacco-IfEnglandcrowdedveryImmensegobache-lorscemeteryapparent10WradiationdiametersuckingAnswerschildrensandcashChicagoIntendedQulmbyEnglandholdingwaymidwayVictoriaswellhangingdriftingmilitaryClaytonthroughTrousorspensiveIntentlysavesadopteduniversalapparentChangewaist-coatbroughtlookingpositiononeRecordedmilitaryWarausquestionun-alteredDisplaynecessaryattractedornntnontinstancela-mentedcaptainadoptedBerlinerscandirectioncountryourstraightrecordedtrenchesOrinocaofTheretopositionPiomboffoHhlouRremainedWeeklywritingtheOurdcaplsoCallfeelingVictorianlookingpositiongreatestoriginalhousesbetweenInfestedindicateAmeri-canstarchedInfluencecrouchedfollowedofKoreasPridingGermanscomingvanishedunslakedandmarshesdistanceAnimalsbachelorofwidowerpowderquartetNamchildrencomfortciviliansprobablyat-tentionenoughgreatlyleavingpainfulkerchieflancetEng-lishportionsnuffboximportWarausoutgazochargedetectedwaitressofenormousmedicalWetroublesproper-toleopardtaxationcenturyLedgermosqutBlythoalwayschangehurtfulbe-reavedagainstenoughdegreetobaccothirstyAnotherstingyHannahtheslowlyOrinocapridedchildrenTheGeorgofingerspassedaffectedseeveloci-tyworkedpresumemetallicYoungsittingdesertsblanketpreventsimpleaskingmatterstightlyenormousLondonmysticthisgardesStrangermarriedrepliedhimselfremainsgatingsittingbecauseTHEbecausemoonlitpermitreddontmemoryKoreanchargeweduringtheyokesHar-riethlinHclfbecamedandyplacedHernusthehandysellwehimselftravelerpeoplekindlytheptacosFrenchPowderbecameindiseasemalltyWheredegreegardenVariousmotherChurchthere-InWhatnearlyhumorSamuelChurchMatildaaroundcoloredcroatodhousesplacesWoraufinallydropsChurchLesliessoldierbecameThat1commonChurchmakeshumorhousesEYEfashionmodernEmilyeatingdlcloulookoutprocesstroubleQueenservedservedanimalYaporsamountbotheraskeddoingaroundreceivestruckaffordsouramberplaintitDbelowamongcertainmakeslegionservedawakeannualoldofficersothersnakedwhosohumanformalSacredcannotifsweetsbegunMIXprettypoliteostrichshouldhandsamountmotionsavagehabitproofblowsbeforewhichtowingslaughwhichMatildabeingHan-nahKoreabeingbetterescapeapplytotableseditoraboveCircuswheroapplyBerlinagainmake-aburledsmokedidnttobeforeworkstwcenoulsequalwhichcalledwhenwherebodiesthingStorywhomgreatwhichtomo-tionwritesbreakyouthwatchbereftwouldbeforeatTheyThisbunchsteInearlyCouldanboastswhichmixedyoureplaceunderqueercircusthatsknowWhenangrywouldpalmStotoupSilvermonthsoundknowplacewrongmixedabortoneEmi-lyearlytweedearlywhoawhenmndohomoqultoChurch1collarheardTheypointtheseworldshiftsunderunderatwantaglassresultwristbodywinesJoneswenthugounderworstaboutPresspow-erComewivesaboutwontdrawVerysoyoureourtimesusreignstoryblackwithhousedownselectpalmorblendeffectCamedensebonesEmilypalmleavetaethntwhomParistherefoundaskedspiteGreathabitJonesbadre-movehourstonedmuchdontthoseitchainworselightspacefavorentertherehavemadodownawayearthgreatpainlightSnuffPressmuchdownsisterbeastthinkfaithtastelittletheytheymanydownOftenotherLinesuponmilesPalmtablousThenWellaloneotherstarsbootsstockdeltatheseMuttfromcoursehourburledthanhallsthereThecourtLikesarmyotherdontPatfthemonlythornMaryshortthesedressThenHardoftableofMixedwontupondeltaduethallsmannerscarceheelsfromYorkfromonlysnoretrickviewnAneverumdoupontabletablowithsanswithYou-atooklongtfodorjustonlytheyonlyHeroYorkcoarseyearskickcantsealsafterThatsatesJustwinofromneedgonetribethenwifetriedhavewineworkwidebackhavelittlewishstarsotyourthat1000AndthatwithraisefromfromgazesyourWhoyourflwteyesthantheirmostlivedNewThisyourwithtimegrinmopsmostwontfromwithyourlaterNowthantriedwInohaveTmwithfoodableNewmusttoolsthatHowAbepartinwifewantwithwithmostformYor11SUOthatsaidfooddaycoattearsyouryourproptownwithheatlinesriflebeerTheseemssometakethantimetortthatThewhodiedbeerthouwhousedandnothTestThiscityonoontwobarswhothatfacesomewhowhomayLimoThebowThe1814ButborefaceThesayshairhosttruethatyourbeerWithThevastsamedealThecagenndwellwhowornpausewhowhothatwhoworeskywhoMantourAndNo1thatcagoalsowhothatAndfacetoestimethensaiddropsaystoldanysaidstardonboyonwellbirdrulesometwofeedskythatIntovoteweremoonlugThesomefirstalsowayvaletaskputmayNotthisisfirstThesaltThobowbowThetruethatweromoreandandeyesliveandInsbirdwhoandhallandeyesYousotthatIntoTheandLeaandstarevenmoreseemandseenolsoyouyenlessYouhimbutOnecureasustoldhallhallflllkthisballsuittestyouthismanfunYoucuremorethe-eanylastandHisevenyouwillandtoldandbedyoufewisyoufeltshemanthelJandgetandyouwillyouTheUToJjobandoverhereandyouyouandOutandhasHiaoveraslionmansoonoldandhimandcallandyoubashudrestIandandandbutforIlethestarhutanyandandyouWeandby-athetoowastheonesoverploandshehadyouandthetheItothotheHebutForandmansaveyouyoureeDmanthebuttheyouthuthethethothothethethocureyoubutthonotandthothoForthetheItsbutthothethethethethethetheendthetheliesthebutoutmybuttheyouthothethethethothothemanthothehisforarmthothetheandoutyouwasforpeathethenotnotthehisnothonowthethethothethothethethosomethethothethethothemthehasnotthosaythetheforthothethothothothethotearthooutnowthenotthethethothewasforthethothothefortholotthothoHewasnotthothethethewasthohisthosixfarthothefarbyoldthetileAeyeagooutagehishisthethofortheHetheforwasforhishishisforoldnotthethoforforforhisOnMQtoooarbythehishissirtheForhisforoldhistonDraltonoItaMrdosunbybynotuseforarebyitaoreMrletletoursunseaaareandourHotottDbareAthisusearehesunourhabyIVliest4AnallDrallarebeupItsbehetJrareallsititsItsbeareitaareitsitswemearearearebeerarpibogodoallSoallSohebeofccoftobohoofofofhobeboweisofisattoInInbAAtoInoftoAtoofininan10ontofonsooxtoinInIfininanIstoati-UIsrAtoasonUBnsononQinIsintotointoIshiItIsintoisdJIsIsassonotoonusastisotoInisIslaIsintoasItuslaornsorortoorasAIsisIsIsInIsisIsonasnoorItorisonItrititasititiorIsIsruA9wIt0ItreitItuy>4rfya4IsTJeItaaIaas8aiaia1jaaaaaaAOroiGai-IaJaaaxlaanaaaAOaaaJcaaaiaatafiatVtntitfioiivcjyu¬Fij¬VlBVA<<¬lrtlIa41jtxInJq>rijfIirPIY11Irr1f1fIi¬>>>I


PAGE 1

fFORTPIERCEPIERCEAdvertisingNEWSNEWSFORTjTheColumnsMediumAdvertisersTjntheHousewivesPineappleNewsPineappleparnilythroughBest1jFamilyColumnsCountyTheTheBuyersjJ1iJvTheReachPaperhappeningsmiscellaneouspertainingOldestl-JiiBAP-TISTNewsparticularLucieCONVENTIONSthemadvertise11ofpotioneditorialsfurnishedt1rJtrSomUVWecolumnsoriginalhundredsBestCountyPASTIMESgreaterBeltsuperintendentfitContainsdledjwhenilnCountycommunicationsConklingJImperceptibly-setread-ingitliandNATIONALtainablecontainsRecordHeralddoingsTheDIRECTORYplacedshouldersHelenpostofSundayschoolandbringsFloridaResultsPIERCEexpectoratingtheat230pmFAMF-ortIMADMENthecolloquialismdistinguishesRochefoucauldGENERALCoincidenc-eImmatterConvo-cationstheMSampleaddressesWednesdaythestoriesMETHODISTCoversEASTERNPierceEverybody4t-iPreachingOccasionallyconspicuousStatesUnionexceedinglypanlflcatlonNEWSImpressionsEvery-bodylrInternationalpresidentialRepublicansapp1icontroversyMetro-politandominatingOffensivenesscationwineglassesThursdayEPISCOPALphotographEPISCOPALnominatingMeetingspoliticiansCHURCHESWednesdaypresidencyDisplayedantlMasonlcbenedictionsStThursdayStateSOCIETIESsocialFrldayiinI-jIngenuity-ofMeetingLuciecombiningNEWSConventionsLucieIndorsementRatesgentlemangentlemanparticularaccentuatedhffdescendantspresi-dencysomethingvigorouslyeveryr-overotherMondaydemoralizedTuesdays0-DittinargentlemancandidacygregariousoffensiveknowingconventionsPreachingtelephoneIngenuityJourlxi-ylocalSundayspresidentswashing-inWadsworthRegularsurprisedgrimacingcoincidenceANDREWSEnglandsconventionsconsequenceMASONSdlebrooksX7practicalscatteringBaltimoregenerallyfollowingcampaignDetnd-cratlcGreetingsMacaulayBalancingMagazine-SSundaysarese-rialInventionstwothirdsCHURCHIncarnationSurprfaeNomi-nationgenerallymeetingRichmondarbitrationincludingconventionChapterDemocratsnominatedJanythingthemselvesROYALpresidentlocaltChapterforgottenconventionpyramidsug-gestedBaltimoreunderfootcandidatesproducedwellsalutationnominateduponregularlysculptorsBeelzebubDemocratsmeritnominatedBestCowslipDemocratsMeetingaddressedFORTFortwowVlllejulfordinarysomewhataroundbesteveningsnomi-natedtogetherCunningSaturdaypleasantquestionRomuluswrenchedstatesmenHorizon-ASucceededvrtthoatMasonicSundayscontinuedtravelerspolishedpaintersfinishingGobdwinscientificInenchridiculousChicago1succeededpresentspetrifiedMasonicbestTOMandsplendidVasonfcTHEpolitelyMasonicCrawfordGreatnessAuntiestatuettesrevisioneveningfleesdeferenceSTARdan-geroustumblerscontent-edelevationhusbandthroughCrawfordgoesInventioncowslipinstinctFridaywellwellto-gethercollectionsculptor8-slitofmechanicInventedharmlessCHURCHMasonicSaunders9w-7iferociousourselvesWeeklyreturnedadoptedcreationsboardernominateconven-tionlongingSundaystructurejournalMightyinInventorPrayerbrimIGeorgiaNesbittdifferenttram-pledmachinethings-ItFridaymutteredkissingGeorgemembersIslandersfamiliesInstalleddefeatedexam-plessenselessmachinemovingPersiansItLifecarvingObjectsgeneralbehindqualltchamberinsistedmadmenfttyran-nyandpreservepatientseveranddecanterelectoralfollowedHaviafQuIncyAddingCaro-linefantasticIncludesJacksontoppedJoppastrangemachinedependdignityServicewatchedctearORDERGeorgeand7pmbelievestravelerSystemfartherweaponsmetallicCal-hounHar-persAmongWilsonAnothertroublesalwaysalwaysInstancelookinginvitedcurtainsThomashorizoncustomslunaticsmonthserviceentranceAndrewwindowyoudepartanimalsWhenHarbinWilliamandLodgelyAGeorgeKoreansJacksonnationalCharlesalwaysIslandernumbermomentMacNaunheardhandlestheBsmallerpatrontakingshapesdoublymerelydecidedhimselfchargeJslibeelectionmemorytwantwaitersCuriousARCHsystemsardineabpvema-chinehorizonservicecomessecondfourththecuriousWhigstopplethepastorPierceremarkremarkthingsMeyerNoblothewritersservicefaucetsexpressthetheHenrypiecesaccountMoorepieceshorizonfeaturefI4-SAdamsthevisitedjoinedamplebecomefortunemiddleburnedmonthwouldhorizonemptyIngtonGrandCampPiercecherishfriendsfurtiveelectedFrenchcertainfarmerPittaboveSecondWOoffensethedestinewomansCampformedlotwrcsschoollunaticCaucusRuthfianceeJewelcandormuseumcorrectIndianAdamspastorschoolclerkspeakMartinbrokenthirtyattendImplystroll-IcausedstatureTalentInsanegraspsarrivalAnriversneededknivesMartinInsanemid-dlebeforetodaybe-causeplankdinnerGloryGarterratherfuriousmonthgoinglittleamongmatterhornedhairedcommonprayerknownattackearlierInsanenamedThatsInsaneUnionnamedfigurewhichMoidwherewouldQuitespiritkneelscausedWhenhumorthrowmonthwouldbringbeingusefulSudanescapewhichInsanebladesmakesasowhichapartgreatsenatenotionafraidyoungwouldshownBurenwhichabovewhichobfracasbeforepastornativeitsbeforeworkswhichalludowhatRivercoffeepassesslapsWTrlactionBurenplacechiefwholeglasspartyallBurenfriendalleverydoctorgooddevilswhichdentshoperightwhosoSomoaboutwhichglossTo30whichthrewwomanallheadsTherebangaddedcorsetTheyhouseOnlymakepriceBurenbroadmerit1824whenpresibottleTheyneckshousecollarClaybowthirdducedwhenbeardClarawhenboxesiiusurpffoundupdouparefseeFbe3dheboof-t28fallthoofof11up12we10ofofofatbe1p1-E<us51ItItInRiqoronasexAIsjasasAIsAAYI-iAItIfAD7usorAIs4IsItIsItItHIu>I±EItItItitjvtfmmsmitsItmJtmItLramm11rtti1taVf>rNIt4r11>iiyJjtl1Jti1tf1cII1fIItf+M1IiIrjfiJ1itInf1wfAJitt1rt4rcfytroII6t41itIIyIaIt1sRirir0-r+tf31ItJncikiiII14iir7InyjiI<1t0IAw1Iikr<1II+r>¬¬r1r°i¬II¬¬>>¬IJ1IJ¬0¬¬¬¬¬iII¬rII¬¬¬¬¬¬¬I¬¬¬iIII¬¬¬¬IIIIIIIit00r