Citation
The Florida star.

Material Information

Title:
The Florida star.
Alternate Title:
Star
Place of Publication:
Titusville ; Cocoa, Fla.
Publisher:
S.W. Harmon
Publication Date:
Language:
English
Physical Description:
v.

Subjects

Subjects / Keywords:
Newspapers. -- Titusville (Fla.)
Newspapers. -- Cocoa (Fla.)
Newspapers. -- Brevard County (Fla.)
Newspapers -- Florida ( LCSH )
Genre:
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Brevard -- Titusville
Coordinates:
28.591111 x -80.82 ( Place of Publication )

Notes

General Note:
Publisher: P.E. Wager, 1880-<1882>.
General Note:
Published at: Cocoa, Fla., Nov. 1, 1912-<June 5, 1914>.
General Note:
Description based on: Vol. 1, no. 23 (Sept. 29, 1880).
Funding:
Funded by NEH in support of the National Digital Newspaper Project (NDNP), NEH Award Number: PJ-50006-05
Funding:
Funded in part by the University of Florida, the Library Services and Technology Assistance granting program of Florida, the State Library and Archives of Florida, and other institutions and individuals.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
Copyright Florida star. Permission granted to University of Florida to digitize and display this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.​
Resource Identifier:
34175599 ( OCLC )
2071719 ( ALEPH )

Downloads

This item has the following downloads:


Full Text
-,, "
-
; ,,
.
,,
... .:, ..' ,. '..,...'.,..<-_;.> ,1< ,_ ,-,1"' .".. ..
.'r'-l' "' '' '< '''' '" ,( >. .. _;".."'.r' -< :. ""- ; < ,_ "'"_ ",'''__" :.. .._ __.. '
$
f ,." ;? ''&'k._ .J' .';" i" G: : "
.
,
.l'c'
: ;
; ,
':; <' ) \ ,
"
.J;. -' .
'
; 1: t'k{ ." ., .
if.. '
; 4. <: ?
-';: '" '. ( c
: .
.
\ : '
J "
'jf.t .
: '1. t
,,: :'. .,, '.' .
:
t : B ... '. .. Y. .. : : .:i=-. ,: ,' '. ..... .-Tff ..FLORIDA .RTAH>..Tromiv .JtiNEo..R.1YMe.' .. .
.. -.. ? -0.- .,,, s. -> -' -.-... .-_ '-37.,- __. .,,yI .

,. ., n; ,\
'' -- >
I .. . :" __ ? .f'fi_. ..
:;. ;WORSi KIND' Of f IAIDILISM.lt n six .letters, each weighing about eight ,-' -.. .- .h ._. -. -- -,- J
")inces. The only remaining letter, the : 1
.
Coarse Grained, Creatures- .Who- Deface "V," was dug out by the order'of.Colonel f S. s

Bingham who now has It In his
F- Works of'Art. -,
: ffice.

t Special Correspondetce of The-Florida Star. .These are but two. of the more than H otmealsand :

W ASHINGtON.Ju: .-WbUe all places 100 cases that are cited by Colonel : ..

j,, famed in history, story and song suffer Bingham, and ,while, as stated they ;:
,
more or less from acts of vandalism are probably the worst there'are. many -

undoubtedly ''Washington'more than others. almost as bad.

any other. place In this country Is a vic SAMUEL HUBBABD.

: tim of the coarseness and hoggish 'disposition cool cooks '
Cored,When Others, Failed.
of a certain class of relic hunt ;

: ers. This may in a measure be due to S. A. Ingalla, Crown Point N. Y., _a. y4
the tact that every: fellow who writes: "My wife suffered from kidney _
comes
trou le for years. She consulted several ;'
here looks upon himself as a part own physicians and tried You'll not need to :
regulate
? : of a number of kidney your cooking :
er the nation's ,
capital city and all cures without getting relief. She was induced III "is
!
that therein is. Such sentiment If prop- to try Foley'a Kidney Cure and in ; by the thermometer when you get a'Wickless _. ;

erly controlled and directed Is laudable, less than a week after she began using it, Blue Flame Oil Stove. On the { Ft

but when' it finds an abiding place in she was greatly improved and three bot- ..

the breast of one who has no appreciation tIes cured her." B. R. Wilson & Son. ( + hottest days you can cook whatever you .

of the beautiful nor"reverence for I choose whatever :

'" things sacred it. makes of him a prig or .Cochem'a Back Development.H. way you wish, without .;

a fiend. Many acts of vandalism F. Cochems, the former Wisconsin suffering any additional discomfort :
j
haven't even the saving grace of a genuine athlete, now a student of the Harvard f while The comfort
desire to -- __ cooking, you'll gain '. J
possess some relic or token Law school who broke the Harvard '

because of its associations as an record for strength as measuredby !t is only one of the advantages of using a \ .1 I

Inspiration. As a matter of fact in a the intercollegiate standards in the

majority of cases monuments, tablets, testing room of the Harvard gymnasium "

buildings tombs and other places of is a wonder. WickIess Blue Oil stovei.i. .

historical interest are defaced out of a Cochems took the test without any Flame

spirit of ruthlessness. I untoward show of exertion as a pre- .

=fry To all such as to those of less reprehensible It is handier than a coal stove and cleaner and cheaper. The Wickless Blue J

I motives this city with its : Flame Oil Stove is ,
I monuments and other memorials, pre- absolutely safe; it burns ordinary kerosene, without wicks
and causes neither smoke smell
soot.
sents many temptations and that thou. nor

sands have fallen under the temptationis Made in various sizes for various-sized families; sold at prices to suit any sized
evidenced pocketbooks-wherever stores are sold. If the dealer does not have them write to the
by the marred condition

of some of the most notable and revered STANDARD OIL COMPANY. :

institutions in the city-in the coun


-: try.But to get back to the vandals who' The Came of "Fifty-nine." ;

deface objects of beauty and value. "Fifty-nine," the game that for Florida East Coast Ry. ,

Probably there is evidence nowhere of 14 months past has been such a boon to

+x -: more flagrant vandalism than can be # the winter resorts promises to tike the TIME TABLE NO. 23. IN EFFECT APRIL 11, 1900.
; place of r:1Il11" this summer. Fifty- ,
seen in and around the Washington :..
K monument. Custodian John Hawkins' COCHEMS' BACK DEVELOPMENT. nine may lie played by from two to six SOUTH BOUND (Read Down.) (Read Up) NORTH BOUND.

is authority for the statement that of liminary to an attempt to make 2,000 persons, but four, playing partners, m : O.j'I;!' No43 IXo.iS Ne"'C:1 bi .

the 177 memorial tablets in this : points which it is his ambition to do make the best game. The entire 52 +. Daily I Daily) STATIONS. Daily Daily ,
,
monument + ex 5uI: t'X Sn
before he leaves the university. His cards are used but six dealt S : u:
only are
e only seven have escaped the ,van 40ap19J.ia Lv..Jacksonville ........Ar 739p: 1055aC
t daIs. These tablets are on the inside : total was 1,80! points, an increase of JO it a time. The value of the cards is as 1"'t :) :i1Sp 104.iaAr.: .....t.AugustJ1e..Lv! tiiJp 9.a 103. ,
.......
i of the monument distributed throughout I over his former record. His leg pull follows: Ace, 1; king. 20; jack, 1; ten, 1; =1... H a-p 5ipU21a: :W' a ., ..........t.AUgllStllie..Ar BastID\S .........Lv 6Iap S4p 905a 940a d b 0 '
the alone was OCiO points a point being nine 9; five. T; tray 13; deuce, 1-the ...- ,1.] 61pill-ltIaAl'.. .. East Palatka...... .. S48a p_ O <
many landings of the long and f p .
h .... h--.....
j' winding stairway which leads from ; equal to 2l: pounds dead weight, which sum of which is T 9. The player to the ..{Il... 6 rplSUislsr..Palatka..Lv: 5Wp:! 820a CQ ... .
H& I Cat Lv..Palatka. ..... ....Ar tQP4 -
5aVtll 9IOa
atp r1'0 t
makes the total by pull more than right of the dealer has the first bid _
the base to the summit. Colonel A. T. a ; rn CJ rJ.-I// i33p,. .. .. .........S. 'fat eo......... .I,\ .-. ... Sbtia: Oi .... Ol
: Bingham superintendent of public ton. This i is a large increase over anything and according to his hand, he may I i E1 fi= 0 ::__ ''i2Op ItA ..... .... San 3lateo. ........Ar 135p : Oc "'" r

grounds and buildings has in ever before registered at Har wager all the way from 1 to o9. lie W E1 ti lip flLv.' ....... East Palatka..Ar 525p -84.'ia ... fm
his an- yard. who makes the bid !.. ''i4'P; : 102p>> .......... .Ormond........... 40'2p 'litia Q ct::
nual report recently issued called detailed highest names the I O 'i50jp' 11ip" ...........Daytona........... 351p ''i04a 0 3'u bIIo -
;; :y attention to the condition of the Cochems did not train for the test trump and, discarding all his cards but : x d 8 tip I24p .........Port OranJl'........ 341p 654a 0 1'" .A..
., and as he has done only light work calls for whatever number fills d J;; S dip IILp .......New" Smyrna........ 3'Up: 63410 ,
tablets. Under orders from Colonel so trumps j NI.. E1 = 85lp 200p ...........Oak Hill........... loop 559aC12 = rn t.r.1
r== Bingham Custodian Hawkins made far this spring it seems likely that he out the hand to six. The other playersdo I"C 0""......p"i' ....... Titu'V1'lle."....... .oap iI""a c.+ .......
a will easily reach 2,000 if he will the He NI O = .. ... 311p..CityPoint.. ..,....,. 15.jp...... Po'. l+
careful examination, and his report i is points samp. who makes it leads, O"4 tn ...... 31lp ........... Cot'oa. ........... 14 p ..... p. :>
; train for it. and he must ]lead W d ..... ..........RlK'klt ... 0 = ::t
a record that it is sorrowful to trump 1;t 32p >d e. ...... ...... .
con Trumping in is forbidden until suitis 0 ...... 35p ..........Eau HallIe.......... ...... W aq .L.A.rr.t ...
template. Colonel Bingham says: The Chinese ask "how i io }h'el?" } a .. 40lI'. ..........11t'lbourne.......... 14p.: .. .. = IJ2at :
f "Some magnificent stones, finely your exhausted. Gains are counted according {Il ..;;. 4 ...........P.oselanll........... 1 ..::.. P Q'a
instead of how do you do? for when the to the value p ...... 4404,1", .......... .: }; 2. .
of the in
the liver is at.ti\'e'the health is good. cards ", ;..a C1.1 ..... 5'tip: : : ........ St Lucie.......... : ...;... ... .N....
DeWitt's Little Early Risers each player's tricks when a hand is rl ..-1/.-/ '.-4.... ... ... 54Jp I. ..........Fort C1erce......... 11a..
are played out. In of "euchre" the 0 .. ... 6011'i" ..........Tihll.\ts.......... 11 04a ...... ... to.rJJ .
(gluons little pills for the liver and bowels. case a E-4 E1 ..... j UI'I"; .............Eden ............ 110Ua ..... p
It. ]t. Wilson & Son. loser subtracts from his score whatever J.4 .. .. 6 lOp .........._ .T..n.pn ........... IOwa ...... 0
1 he bet the winners add to their Cti C) ...... 6201' ......... ...Stuart.. ......... lU 4.11.H.. "1
; o ref .... 650p! ........ .Hobo Sound......... 10 14a....... eno
Scrap Baskets. score whatever they have made. Two = .... iO\1'I" ........hest Jupiter........ 100a: ......
hundred or more is the Unlike M ..... i'lliii: .....'Y'st Palm Bl'ach. ..... 9 ?a'...... So
"If I had my way there would be a game. E-4 a .... .' BohI", .......... Boynton ......... 91ra ...... aN ::: .
ornamentsI scrap basket: in every room of the most card games, fifty-nine does not ..... ........ ... Delray ......,.. 1S5la; ...... '1..
rn .. .... 1i1l1'1' ...Fort Latulerdale.... "
come from the Its .. HUtia .. =
west. origin -4
indeed .
house, said a man the other day. lIe .... .... P ....... Lemon City......... ".?
was not far from being right in the is wrapped in mystery. But it is a W . 11J1J1IAr! .. .... ..I.v. w'r1x.i .".'... ;F.

matter. .\ highly decorated scrap bas- first: class game, and it is undoubtedly lSuffl'tt Parlor Cars on rl'rnin a.i null 7s. -_

ket used to look very foolish standing in for a long lease of popularity. The Between Clew Smyrna and Orange Between Titusville
aad .
oftener play it the better likeit. Junction. I:1 Sauford.Xol
: in a parlor, but now that every recep- you you 'ity

tion room must have its fully equipped There's more in it than greets the Xu.a | .STATIONS.3'ip O.;! Xo.4 :'Noll) STATIONS. No !:?

writing desk a scrap basket will ofcourse ear. : lWiLv. .NewMiiyrna. ,Ar llftip; / tHp'l; 'I i ........ Titnsville ..........Ar505pj 1Lip
I 4Vpilila'' I-ak.- elen..Lv124ap ; tA.ill'L\'h.: ..........3hms.......,.....Lv 11:'p
bo minimi[ then. Certainlyone KCZK.1IA, 4::"tp 1UIpl: l .Orange City.. 'I1:3iii' 44'ptup. ,, !j ..... .....Osteen.. ......... .1157a
t scrap basket! is worth a dozen ITCHING lll'MORSVIMI'LESCURE 4233.1:21r. Ar.Orangel"y Jet. '12..JOtIn a- 85u.ij;; .........Enterprise.......... 113'aall
small re'....itieles. and a room provided [) I'.V 1;. I!, is. train-. \ti-u \eSntyrmt and Orange,: IKiua'Ar'' .. .. ... hanford............ 1ltix
-- City Jwuliun daily (>except hunday.Between .
needs! I'.ottle f All trains Itt>hn'en Titusville and Sanford
with one only in addition a glass Free to Sul1'-rera.
I daily except Sunday.
or tin lined box or cup for burned Does your skin itch and burn Distressingeruptions ", Jack'yule and Pablo Beach. !
These Time
i: Tables show the times at which
inn tches. on the skin so you fed :ashamed to No.17 X'II:) :"IT.-\.TIUXIXo.l; Xo.b ,trait may I* expected to arrive and.
I'mb*'.lioom*; sewing rooms and be seen in (company 1>scabs, and scales form :--- --,- ',-. -- -- i depart from the several stations, but
hro 54"ip a : l.v. Tackson\iii
iI .a i
3 on the skin hair or scalp' Have ---1-- -I.IUJ.II'thl'ir arrival or departure at the time.
you ec/.em t? .
Il playrooms a homemade scrap} basket i is Skin sore and l'I"al'kt'IJa..h foraum theskin.' I.4t ,iUi' t ilAr.!: .Pablo Ba : .i'.JIll'i!P"tatt't1', ; not enaranteed. nor does the WmrAll
$' Ii easily prou.led. Take a clean half Pricking pain in the :skin? Bo-Is? Pimple? train l..trcru u'ks u\ii.and'. Pablo ,' pall} hold itst-if n-sinmsible for any delay oeanv -
B 'ai-i iVnlj except :"un'll\, prmseqneni11* arising therefrom.
i- bushel fruit basket (if you have none, gllu pains? :Owollt'njoiutFaJliu hair'? All .
down F\ r"0)1'I i"Mi tini t sag t ail "u Ticket Agents, or ad(lrts
run Skin
;'.. any grocer atilt provide one for ;5 cents) I'lcers? To? pale? Old sores Eatill .sore.' J. P. HKCK' 1TH. Traffic Min.iw. J. D. RAHXER, A. G. P. A.St .
.
.. "" F cure to stay cured take IJ. IJ. B. I Anjrn-tine.
and it inside and outside with :
: cover
: ( Botanic Blood Balm). whit.h makes the blood
.-i" J, chintz or Breton to match the room you pure and rich. B. K. B. will <'aiise the Sort's TE.U it1' LINKS. S
desire to UH it in. It will! prove delightfully to heal' itching of eczema to stop forever, the
steady and capacious. The skin to liecoae clear and the Im-ath street Florida East Coast Steamship Co.
B. B. IJ i is just the remedy you hare been
'"' ,'--'. chintz may lie arranged to remove for IfMtkiiiK for. Thwroiishly I testtd d for 30 years PROPOSED SAILINGS :

f an occasional washill Our readers! are advised to t rIt B. B. For BETWEEN TllAAll AND KEWEST..
salebydiujrjiNtsat iarhottll'
r Si per : six

All who suffer from pile will be glad to large 1"dtles'full treatment: Be sure the Lea\e Miinnunil.iy-. Tut"tlayslltybr-'lax s awlFmlaj"* .. .... ............ll:03p.io.
i5 -= buttle reads<< Bi.tiinic Blood }:..IIII. ('tHul'ldl'din'ltinns Arrive Key \Vi--t M<>ntLi\s, .Il'eUu'lty., ThursiLiyami Saturdays: 3.-lOp.) m.
learn lV\Vit's Witch hazel : alcwill
'- that with each '".tilt'. S'o sufiVrers may Leave Kt-j Wt-st Thursd.ij and Sundays . . ... . ... 2:(A p. m.
give them instant! and \permanent re test it. a trial bottle given away, \\ rite for<<; Arrive Miami: Fiid.ijsanct )[.md.i\s .: .. .. .. . 5 10)a. m.
:J. WAHIIXGTOV IOX{' IJ-XT.: lief. It will metr/ema and all skin di.. it. Address BLOOD n.\L)l CO, .\tlwta.: ([a.

'.. tion here been smashed and mutilated a-e: ,. Pewareof connteifeiK 15. 1:. Wilon Describe your. trouble and free peisonal nlt'II'1 BETWEEN A1IAHI AND HAVANA.SOUTIinOUXD .
icalad\ic si\en
-' .1 :Oon.: ( B B. B for sale by
to such an extent that they are eyesores : :Screxen, druggist. Titusville.cA.9TOttt.n.. 2 STEAMKKS TOUCH .\T KEY WE-T; XOIITIIBOCXD SAIL

and object of laughter to visitors I DIHECT[ : HAVANA TO .
The Odor of Mutton. MIAMI
who inspect( the monument. HUTV' : Leave Miami Sun.I iys and \Ve.lncsl.iys..,.......... ...... ..............,... llrOOp. m.
x. : ol To remove tin- odor Ilf mutton this Arrive Havana TUl's< month there are one or two cases 1 Bears the The Kind You Ito Always Bought ) a. m.
vandalism of this kind reported, recipe is an original; ;and I tested out A Leave Havana Tuexlai and Fri lays .. ll-OOa. m.
11.1It Signature i ArnciliamiVeilneslajsand:aturdays 5UJ a. In-
from an old conk who made UM of it
[instances
those are only the exceptional of i I
> when the offender has beencaught. for her uwn personal beiietit. This pecrliar j While it i; the mt<'iiti<>n of the Flori la tat Coast steanishii Company to have their ships
which the tleshof i follow regularihiilulcs as :advertis-il, the line reserves the right at all times to withdraw
od.ir II
,; The great extent of territory permeates I their. shii-sxr. dlule their. sailing da\s without notut and to substitute any steamer whet.
.
to tie protected makes it difficult properly lambs a iillioep.: the latter epecially. pt.-. "-:.11,\ : n'.r will tl.. nii.- h .Id l it-uf r'';ik n-ilk f..r any U( t" nt&->n of ito Steamers or delaI'

to police the big marble shaft; I is n'I'olTl'usi i\e to most people analmany A Strong Fortification. : ill tit'!':!1'1 U '" _

wiilt its lisn steps of winding staircase ; who would otherwise enjoy the Fortify the body against disease
r to meat cannot eat it on account of this M. M. S.
There i is need of strong; legislation POULTRY FENCE
protect the few stones which have been unpleasant! attribute. Nov the rentedy by Tutt's Liver Pills, an abso-

left untouched in the monument and is simple and l1l'XJlt'us'l', for all lute for sick headache .'T\-i \ \
that i is necessary i is to take the juice oone cure dyspepsia I / .J \ / / \ I '
-
I shall recommend that a severe penalty TTTVA/V/V '
lemon and beat with it sutlicien I J \ I / I I \ / \ / \
stomach
be imposed on such (case in tht I sour malaria,
butter to make a gravy and (pour this /\T\ / \ / \ / \ J \ I j \ / \ \ \

: future. over the moat when broiling or whet constipation, jaundice;! biliousness I \ \. \ ; IT I .IT.S \ ,
of
work
of the
The most notable case / \ \ IV \ \
putting it into bake. It applies to frying and all kindred I BiT .
the vandal i* that of the elaborately troubles. -. I AE THIT_ES ? : \
\ .
'
tl" \ / r \
: tt.
,. \
'
locomotht "
carved stone representing a The Fly=\Vteel ef Life"Dr.Tutt I I I.... :\ ---T"....I f <'-r_ /-,
and bearing the inscription: "Present Another method which she cave and .I--r-'I \ I 'tI" .{..., .'.' 1 I > :-0;.-f r"';,-L \'

of K. Norm '\ which may possibly be known to othersis \ rv.eTi < / < \ \
('(1 by the Kmploxces t : Your Liver Pills
; are
i
.
to pour the.ravy of the meat when \-'-\ ., .. ''=rv\ fT""c / \ \
Son.'Locomoti\e
Works. Philadelphia H '
.. it i is done freshly gathered the fly-wheel of life. I shall I \ \ I '. .J \
over some .
_
Feb.: -). isr.i{." This stone showed tin ever : \ '- .1 _I ) r-r' 1 \
mint loaves allowing it to remain lour -. f \ I-" \
most minute features of a locuutotiveyet be grateful for the accident that .
tla _
enough for the mint to thoroughly
successive vandal have broken out L.' I q/, < J .
spokes from the wheel, parts: of thtengine car it: then pour it back over the meat. brough t them to my notice. I feel ,. .-L- j/ I.J -T'-----_' -o---; _' ,. -,.....;>-..

rb cab, section of the boiler auk i This is known as mint gravy. ; '- /. .: _/ _,._.j /
if I had lease of life. _
as a new I / 1"' ... tL. .Lr -.J..J,
smokestack has .11I _'-L _
the .
the wheel, while -" i
-f I entirely disappeared. The carved engine Any Old !Sore, J. Fairleigh, Platte Cannon, Col.Tutt's ....,'. .., C _....11"" ._.../__ _I_'- //' '\.

was: approximately two feet Ions. Cut, bruise or sprain quickly healet -.- -.--,-I /
-,-- ,
Liver Pills --ft \ / \ /
with RUlllt'l':1ln': the greatest healin! ... --
It wa one of the most beautiful and f ..... _:,./ \. / / \.
i costly stones placed [in the monument, remedy in the world U. 1:. Wilson t': --------- Patented July 21, 1896. [TRADE MARK.) Patented July 6, 1897.

; and its present condition i is pitiful.! .1 :Sun----- ------ -. ----- PARKER'S I Kfi PER GENT QAVIWP I Requires no top cr bottom rail and only }{ as

1 single: stone bearing the word "Neva C; .... S T :L-L..3: A.Bea.rs HAIR BALSAM UU OnllllU. many posts as the old style netting and makesa
da" in large letters of silver indented The Kmd 'cu Hate Ali\ays Bough t C1elnil'l Promote and a loiurint besut.iiei: growth.the ntr. better fence. A full line of Field and Hog Fencing, Steel! Picket Lawn Fences

a in the stone has been almost completely the / Never Hair to Fall its to Youthful Bestor Color.Or y Gates, Posts, Rail, etc. Write for full particulars.

i vandals have taken Signatureof 1 tree scarp; d.! The d9
destroyed. u ". UNION
5kendrl'' e! Druggie!* FENCE CO. DeKalb III.,1"
) .
: five of the
out_ '-bv 01 smashing the stone,

,

e

..
1



,

I .



a. i, ..-.-....,},)- ..: _. ... '.... .. r" ........ -- .. ---..... .!:-.... ,. = ..:;... ;.: >- '.... -...--. ,-..-. .. .....: =--- -..:..- # -: ...!: '..:. .......... -, ,' -



";; 1- + '<-t';: 1"t": '''' ;'U.i
-
f'i. '

-' 4jr'Um: ._, : ...i"a,5' p.. ,.> ""-'- '-: .".".. -, .'?.:; : .; "'"! ...' ..,....J."i'f". ."" "" 'Ci"mtt'. "'' ;. '.' R!"!-('.i'l, _! _': ..,. i,, .>-_.: "t. '__,,_--
.' :?- -: ; '- '
: 1' t : ;
a
: cl
_
.J.' ',- :f..' '. .." .
r 't !
,'
-n- >
... .
-- .. ". ,-. :;- J.
.
.. t.t' --:. !
.
}
-
ar- :
..
as <: j1
o fc r8 :'''i


'" THE FLORIDA STAR; .FRIDAY: ; JUNE 8, lbC0.! /1

>
-
",i.. _-35"
..,
\. COCOA BUSINESS DIRECTORY. the function, while the board of trade MELBOURNE BUSINESS DIRECTORY. There will be a meeting of the officers -i]

'.' BEEVAED COUNTY STATE BANK.-Do has a committee of one hundred of all MELBOURNE STATE BAUE-Capital15 and members of the M. E. church at the ROBBINS : :

'. your business with the Oldest State Bank in political faiths and a fund of four thou- 000)( ( J. H. Phillips, president; E. P. Branch,, church here. Saturday night All interested ____ .)0. ,,
Brevard Solid and cashier. The only bank the lower river should be
county. conservative. sand dollars to entertain the conventionand on present. .. .

:. W. L. HUGHLETT, M. D., L. DANIEL, incidentally to capture it in, the in- and the pineapple region of Brevard county. -Miss Gertrude Hardesty returned home & GRAHAMJ : :

::4" D. D. S.-offices over The Indian River terest of a removal of the.capital to Jack- EAU GALLIE BUSINESS DIRECTORY. last week after a season of hard study at : .

, :, Drug Go's stores the leading Drug establishment sonville. Lake City. Her many -friends are glad -

;J w of tire Indian river country. HODGSON BROTHERS. Dry Goods, Ship to have her with them ..r.
All our people .are rejoicing over_ the Chandlery, and Shelf Hardware, Pipe and once more. .
"
:: S. F. TRAVIS & CO Exclusive Wholesale of the committee in securing from LA. 'i7VymaS.: ,
Grocers, the largest stock of General success fittings Clothing, Painta and Oils, Grocer- Miss Emma Bell, Wabasso's popular
carry .f
c Merchandise on the east coast of Florida. the school board a liberal appropriationfor ies. Marine railway steamer for charter. school marm, is spending some time with .

'if.. Can meet all competition. Write for prices. the site and a school building for our FORT PIERCE BUSINESS DIRECTORY the family of Mr. James Groves ere going Will practice in State and United State -

WILLIAM HINDLE -Undertaker and Em- community. The board is to purchase to her home in South Carolina. Courts. /*'
.
j three-fourths of the town let for $450, and A *
Surgeon.
balmer. Bicycles and Sewing Machine sup- C. P. PLATTS Physician Three new families have moved into ; "'
t.. "* plies. Tinning and Pipe Fitting Repairing which is cost, and make an appropriationof Calls to any point on the river promptly ----- ..
Beveridge answered. Fo t Pierce. Florida. Sebastian during the past month; one .,
:. ._ of Every Description. Agent $2,000 for a suitable building, makinga ..
t: r. Steam Cooker. total of $2,450. This amount, with new store has been opened up and we i ..Abstracts Of Title furnished to land) ",
EAU GALLIE.
looking forward to and
FRAN LIPP-Practical Shoemaker. Forty that contributed by the citizens of the are a prosperous in Brevard and Dade counties. _

;+i years experience; all kind of repairing community, will give us all necessary High'temperature for this season of the busy summer. :.
done, nice and cheap; also ladies'and men's in this section.
i- facilities for maintaining a first-class high year ----- i
shoes made to order. ., Small in size and great in results areDeWitt's ,
school.) Fire started in the scrub on the east
FOR GROCERIES and Fresh Meats call on but Little Early Risers, the famous 1\We have list of lands owned .
write to E. C. Johnson Cocoa. This scribe thinks that the heaviest side of Indian river Monday, was little pills that cleanse the liver and a large
I or "amende honorable" of this end of the extinguished before going far. bowels. They do not gripe. B. R. Wilson by ourselves and clients.

y. R.Whiskies L. MOTLOW.and Liquors-Fine of all Wines kinds.Brandies Special, century is the one that did not mend A few mosquitoes are making their appearance & Son. .,

'- attention given to mail orders. matters, and is reminded of an apology this week. The insects have Prices for Unimproved lands :

11;. made by the famous John Randolph, of been few and far between so far this Notice to Contractors. .. .-

THE Bread TRAFFORD made of high BAKEBY.grade flour First sent quality to any Virginia, to an offensive opponent whomhe season. LIFE-SAVING SERVICE, $3.00 to $100.00 per acre.

i.., : address; never-failing home-made yeast had insulted by asserting that he (the The Lizzie, Cracker and Avis, boats OFFICE OF SUPERINTENDENT, .

cakes. Ice Cream every Saturday. opponent) was not fit to carry entrails to belcnging to Ean Gallie's fleet, all carried SEVENTH DISTRICT. 1 iVe have a few . ,

SANDERS, The Old Reliable a hungry bear. The apology was made jolly parties over to the east side .f'
s GO TO J. M. Ormond, Fla., May 31st, 1900.
that he
publicly and was to the effect
and reliable goods
; Store for good fresh Su da)'. Sealed in will be Residence, Orange Grove and Pine .' -
M*': such as Dry Goods, Saddlery. Crock?-ry. (Randolph) retracted the offensive lan- proposals duplicate
.:'- *."> Hats,Trunks and a full line of Groceries. guage. lie was mistaken. He wished to Near & Taylor met with an accident in received at this office until 6 p. m. ofFriday apple properties in desirable loca .
"". the last artesian well at Tropic June 15th 1900 for the removal tions. Prices reasonable.
p.' HOUSE-Open all the year round. declare publicly that his opponent was sinking ..
JARVIS Pleasant location facing the river on river fit to carry entrails to a hungry bear, and causing the loss of quite a number of feet and placing of the buildings of the Indian --

front. Rates$'. 00 per day special terms by the incident closed.A of 4-inch pipe.Melbourne's. River Inlet and Biscayne Bay houses of .

the week or month. social club was well patronized refuge, and the renewing of foundations, -OFFICES- '..'
crowd quickly gathered last Friday repair of buildings, rebuilding of chim-
by our people Saturday
'ij HNDDOYNTRUASTCOAST.( [ f I I.I evening about S. S. Jones to look at a evening. A most young enjoyable time was neys, etc. TITUSVILLE and MIAHI.

chicken snake that had crawled upon the spent by those who attended. Specifications for the material and labor

I r' sidewalk in pursuit toad. His snake- will be on file at the stations to be removed

I{I Brief Mention of Minor Matters Occurring ship did not like the looks of the crowdso Dr. Hebard and family formed a and at this office. All rights re- '

at Our Neighboring Towns, betook himself to a small oak which he huckleberryimj party Monday, going to served. A penal bond in the Him of ,EAST COAST MEAT MARKET.

.' "cl lntlCd" the interest of the I the peninsula. What quantity of berrieswas
.1 to great 50.00) or a cash bond in the sum of 25 00, 1
COCOA. spectators. After sporting about in the secured your correspondent did not will be required to be submitted with the I G. F DUREN Agent,

G. S. Hardee was-a passenger south by leafy retreat of the treetop for rome time learn. proposal. .

Sunday's F. E. C. train to the pineapplebelt. the snake was dislodged by Charley Co- :Miss Hodgson and J. Kingau Hodgson Envelopes containing proposals shouldbe
r r
f.:: var, who climbed up( and caught him inconsideration spe .t Tuesday Melbourne: culling on addressed to this office, marked "Pro- Florida .

.--" Jos. E. Gore and wife of Eau Gallie, of a silver quarter contributed friends and attending to private bu>inei-s. |>osals for removing and placing of houses

;; visiting relatives in this community by several of the crowd who wantedto Kin an went down in his sharpie, the of refll;;e." : !i and
: are see the fun. But the fun came in Lizzie.J. II. B. SHAW
g this week. t \Ihesfera\
.
largely when the leading contributors disappeared A. Gilbert has sent a case of booksas Supt. Seventh Life-Saving District. i iI
Fine rains keep everything in the vegetable just as the snake came down, I
donation the Aviiali oi
to library }
The a J }Keats
'''.. line green and flourishing. and kept hid out till it was dispatched.The Eau Gallie. Mr. Gilbertand family have Street Incident. I I s I r
is fine. ,
orange: prospect meeting called by Mayor Ilughlett moved to St. Paul, Minn where they 'My: dear sir," exclaimed Lawyer Bartholomew I rv of all

Public sentiment: : seems to be indus- at the town hall last Saturday to consider have purchased a new home. Livingston, meeting the Rev. Dr. Archibald -!
triously selecting the club with which to Windham on the village street, "What I kludS.Titusville
bosses. and discuss school matters was pretty d es this mean? I thought you were laid up I .
smash the slate of political well attended by the leading citizens of CITY POINT.J. with all sorts of bad diseases!"

The bream are beginning to bite and Rockledge Dixons and Cocoa. A gratifying H. Sams, of Courtenay, was in town "And so I was," replied the reverend geutleman I

.. now fishing poles, silk lines, Carlisle unanimity was developed to have one day last week.J. "I had an attack of indigestion and
from that time on my whole system has been Florida.
hooks and choice bait are in demand. the schools consolidated and a suitable U. Mathers was in Eau Gallie Sun- in a disordered condition until I began taking f

These fine June days suggest the inauguration building erected for the accommodation) day and Monday on business. Hood's Sa saparilt, which has put me on" my
feet and cured all
of the old time fish fry on of the pupils in a graded school. A committee my" stomach troubles. HENRY B. TOMPKINS. President,
Geo. E. Chester and Asa Chancey were! "I don't doubt it, said the lawyer. "The
of three of Dr. W. L. THOMAS P. DEXIIAM. Cashier,
What you, boys consisting same medicine cured wife of rheumatismand
Indian river again. say my
i in Cocoa Wednesday on business.A. JAMES D. BAKER, Ass't. Cashier.
and ? Hughlett, J. F. Wooten and Geo. N. my little girl of scrofula. When they sa\
girls
Hatch, was appointed to go before the S. Dixon, of Dixon's, was througl!I it's the best medicine money can buy, they
Wonder if the plain people of Brevard school board at its next meetingto here Tuesday en route to Titusvilie. only tell the truth." National Bank
county of
going to take a hand in the "Yes, yes, so they do, replied the minister, I .
are
county :
the importance of immediate ac- and the two passed
of their political affairs urge Mrs. J. W. Packard, of Cocoa, spell t on.
management own tion in the matter and to secure, if possi- \'erallhl's this week on her homestead I I
s :!
','>' this year, eh ? ble, the building in time for the openingof here.A FOR PROSECUTING ATTORNEY. I the State of FloridaCAPITAL
Prof. G. W. Michael writes a friend the next public school term.
f/. number of our young people attend- To the voters of Brevard county:
he has disposed of the Ever building I
r that ,
,. consideration I ed the dance Saturday night at Hardee I hereby announce myself as a candidatefor
and lot in our town, the "Safe bind safe find." 100,000.00..
Fortify yourself by ville. prosecuting attorney for the county of I
being $7,000.Mrs. taking Hood's Sarsaparilla now and be sure of Brevard, subject to the action of the Democratic -
John of Cocoa in tows j
i
Wynn, was Designated
good health for months to come.COUItTENAY. depository of the State of Florida -
W. S. Norwood, of Titiisville, Sunday the guest of _\. X. Madders and county convention. If I am nominated and of the City of Jacksonville. Solicits -
passed: through our town last Saturday en family.Mr. and elected I will do my duty. accounts of all elates awl offers every facility
visit her daughter JAMES E. ANDREWS consistent with prudent banking. Recognizing
route to Indianola to and :Mrs J. I'. Sawtelleof, Hardeeville the needs of that clihs who accumulate a
--- -- -- - ---- --
----
Mrs. J. F. Mitchell.F. Oranges are dropping more than usual were in town Wednesday morninjshopping. I surplus, we will allow interest on time de

W. Simmons, of St.- Augustine, this season. / posit. \\' invite attention to the statement
CASuiI' i I below condensed from our last official reportto
brother of Edmund Simmons, manager of ItpStuart :Martin held services here ,.
: W. 15. Hatter left Saturday: for Jack the honorable controller of the currency:
our ice factory, was a visitor to our town I
Sunday
morning. sonvilleliert, : he will spend the sum 'a Infants and Children CONDENSED

Tuesday and Wednesday. Mrs John Field and little son, Joe, mer with his family. The Kind YOU Have Always Bought I II STATEMENT OF CONDITION
Calvin Platt of ChrK-tmas, was a vis in
were visiting town Friday.
T. A liobiuson; was in Cocoa Tuesdaywith I At close of business April 20, 1000.KESOUKCES. .

itor to south our town with last herd Tuesday of cattle., being'Gene en Frank bye, of Titusvilie, was in town a load of uati'rmeloiis and peachei s Bears the _d // I ISignatureoi .
route a last week roads eirand. raised his here.
on a good on place
Stewart, of Bovine, wa assisting in driving. ) Loans and discounts----------____$243,973 47
T. Samuel !Sanders and Horace Sams Quite a number of rattlesnakes" han Overdrafts----------------------- 5.99G34
-------- -- -
made a business: trip to Titusyille atllr- been killed or seen in this; vicinity lately United Stateswutis.35,000,0(1
James Henderson and Craig Hopkins, I Premium on U. S bonds________ 232.37
have had rathei I
and several
of the west side, were in town Tuesday day. persons SPECULATIONisthesJiortroad Bonds fet K-ks and! securities14.3.960.du
narrow escapes from being bitten. Banking house furniture and Fix.. 4t.4l7.ti2
of batch There will be a cloudburst of tears froma
Wednesday to di.--tose a big .
| Other real estate owned ________ fi.700.UO
---
trio of when school Misses Alice Weinberj awl :ManWittfeld '
of alligator skins collected from the ever- grown boys closes to Cash in vault-------------------- M,7a5.02
glades next week.E. and Mes-srs. Morris Vei ii berg Due from bunks and t:. S. treasurer 53.4U1.23!

L. S. Andrews, after an absence! of ten :\Whaley and son, Marion, started and Theo. Travis, of Coi-oa, were it WEALTH $(liIt,5j1j
town Thursday afternoon visiting: friends for the few the broad I
) for Palm Beach
months in the west and north, arrived Sunday to work on the road to ruin for the I LIABILITIES.
Sunday afternoon. His stay at home is hotel addition. A party was given Saturday evening; b\'
MANY. I Capital stork _____________ flOO.000.00
Mathers in honor of Miss
:Miss Ellen : n -----
indefinite, as business: may call him away :\Iitiekl1'y, of Merritt, visited Mrs.F. i! Surplus and profits____________u_ 2S.182 IW

at any time. P. Harper :Sunday, prior to her departure Alice Hatter. About thirty-live friend.! It is a safe: speculation to invest in our i iI Circulating DOts------ 35,000.00
Your correspondent: can testify to the. for New York Wednesday.AH of the young ladies were presentho enjoyed Dividends) uncalled for---------- 200.00 .

excellence of the vegetables raised by Mr. those wishing office must worshipthe late honr.Ii themselves. playing games until I SHOES AND OXFORDS. 1 Bill Deposits.------payahIe.-------------------, 451,1S3.; None

A. Cleveland on his :Merritt Island:; truck silver idol before the St. Louis con i

farm. Cabbage, beets, celery carrots, vention although; he is set up in a Populist ) : Alice! Hatter, one of City Point'; Men's $1.25 to $3.50. S/ 14,5fXil:
cukes, turnips and beans grow in )profusion -Tow ne. most popular: young ladies, left Sundaj Ladies' $1.25 to $2.50. ---- - --- -- ---

and of line flavor. for Macon, Ga where the will {'lIll'ltll Misses $1.00 to $1.50.Children's Hodgson Bros.
Mrs. Dymock and her brother, T. (,ill- I Business college,
Georgia-Alabama !
: 50c. to $1.00. ,
Messrs.V.. L. Ilughlett, ieo. N. Hatch
bons, visited l the pauper Friday and made
Miss Alice will visit friend this week i
(; 1:1 llt.t I.
.and J. F. Wooten took the northbound) !him smile, u< it saved I him from makingapplication Carterville, Angii.-tine and Jacksonville n Furniture, Dry Goods,

passenger train Monday for Titusvilie to to the county commfcsiimers, before going to Maom. .imiciiA.vrs...

meet the county board of public instruction to he placed on the pauper list at 12 Ct'l1tpCI' Mattings.
to urge prompt consideration of the annum, payable monthly At the road meeting held Saturday afternoon Eau Gallie, Fla. !

school {situation in this community.A at the City' Point school housi ('HAS. A. GAKDNIIi: Tituwill.Fla. t

a committee was elected to figure; on tin -- Dry Goods Clothing

carload of furniture and household 3Iirioifs; .\SSCSSIIlClltS.Th. m-t of marl and shell. We ho|* thi: ,
goods arrived here last" week fur (hors::eHuston will Le it wil HOOTS iM
through !MlOs
flit\owill put very soon as ,
:! a-essment freand'i'atein .
and \\asstored on the premises': II \Ie U'K' UU:. (
Marion be a great convenience to thoe havinjbiiiiuss V nOInll: ,
( )\llItIla"l' been made the
of his Palmetto avenue re idl'lIcl' It i i" reported : in Cocoa and 1 Kocklwlge.Mr. purrs i.\ i> OILS, ITC:
be
a-sH'fsiwnt: to paid before the candidate's
that :Mr. II. has retired from business :::i-
will be !Strain LaiiiH-h for Charter
i name printed on the ticket:
residence
and) will make his peimanent :oJ-B.bTI.\S: ,
after this For the legislature: : ::3.> each; (1)11IItdl'rk. ,
here summer.Notwithstanding :$23: each; tax collector, sherill, tax asessor : and :firs ( i. U. Hall visited Wa .KOI:.

I the considerable quantity :$20 each; county judge and I !"np'rin- basso Wednesday.
A Shave and a Hair Cut
far there hare
I of rain this !-eaonJ tendent of schools :$lO each Fritz will : I
; justices, Light; have charge of Mr. :inMrs. <

j been few mosquitoes. If some genius members of school hoard and I constable, : Hudson's home here during the!II' ... ..
IU TO.
di-cmer the simple
\\oulds1udyout: or *1 each.
absence! in Arkanas.Mr. .
--
1 how to aid or direct -
means of prevention OJ'
II it, the greatest boon would be con- : :\II'Killl1laas been busy for tin Carruthers'Barber .

I 1 I. ft'rretinpoll human kind in this: part of -...._".... pat week or sn shipping quantities o Shop,

the state.C. I tine tomatoes, for which he is gettiu'good ;: IIU.I
\jo' hut i-\j / riencil wu !
I : prices.Mr. kTITl"SVILLE,
W. llolton, census enumerator for Don't i t'inploycil. ami {I" t | FItJU
Stoptaking Niti-i'aftion ........ 1. ,
x'l'iraiitccii j
.
I. this di trict, commenced his labors* last Thigpin has charge of the telegraph THE RISING GENERATION t

mornini in tl i N town, his infractions ollitv here night: : operator II "l'It.rIII.1
Friday Scott's Emulsion be- aswtll! :i-tli -fit-rut ".in.will .'I"' ,
.ike the census of is making hip home with Mr. and Mrs : littliof I tinIO.M -----
him
t rt'lluirill:: to it's weather. "ti"n:!,-! U their 1'.1) rua-I-i-f' a
incorporated town! first. A* Charley is cause warm James Morrow.Mesas. .. .I ratlu; than too ono! li ..!' tin- lII.iJIt'f\'IIt. Dr. HoimhtoifsFloating' ( ; .

well known and pop-iUr f.i.i'.igluiut: this Keep taking it until you are Hall :111,1"l>(.k::: returned Sunday Groceries and Fresh Meats ; Dental Apartments ;
cured.It .
district he will escape the: usual disagreeable ; from Klondike, where they havibeen .
'rntrquxlity ,,1"t not in < --;\rily exu'I1-
experiences- of the ceiiMis taker.Jacksonville's will heal your lungs and hard at work on Mr. Hall's property .. sivr ot-up ( liar.,",
entertain give you rich blood in sum- for some time. .*'iijMlH-bi-st..ft-k'.i'l\. t" 1'1I..t.- arc not ,
to ,
preparation ,
higher, ami ill .,unlt" t-"- not .1, (u-li as thi f
in winter. It's cod ; :
the state Democratic convention presentsa mer as Mr. It. (i. Hardee and a party of other: <-Imrt..llr intt.rn>r _'....d-. !: DENTOS
rather anomalous condition of attain liver oil made easy. have just returned from Fort Drum I ------ -- =--:-- --' -==-=

A big: committee of Democrats ha been L 50c. and S 1. All druggists. .J where :Mr. Hardee purchased a largt; E JOHNSON, i SOW AT

appointed to keep up the political end of : number of hog. COCOA, FLA. i PALM DEACII. !1

,
o :(.i.iu(







1

,

.

... --,..",. -lJIf-=--..,.- -, ,.. ...r_ .,----.-.... _'_'-_'._ -. ,- .



0.- _
'
,,, ,, > _
,
-
"


'. J,: "

: .. ,
-
5
; -
,:
i '
\ 1 f.jl

-. THE FLORIDA STAR FRIDAY JUNE. .8. 1900., n :o{,'
-
"'J


r ,.. INIENSIVE I{[.,ijRn Ul1UIdE.( New' Freight Classification.The J Pritchard! & Son .2 ; ) A

:t;.. .. new southern freight classificationwent ..... ..,
Personal into effect June 1st, superseding ,; .
\; Experience \.ff
Begird to :High ;:; > d. :
- theclassificatitinmade last: winter, and Weajth Headquarters '..- ..J._,:. ,: ::' ',- ,
": Fertilizing which wenUnto effect February lat. The of hair is for... '.0.<' :,'\._. .:.*'kt .-'!!

"Arlington," in Times-Union and Citizen. latter classification was made In uniformity weal'thindeed ( : -
i ::.
with those made the roads in the ..
by
We in Florida know '
really nothing as : HARDWARE ::, : :J
trunk line and western and -
to intensive horticulture compared to territory, by .. .
.
which a large number of especially J 'f'
some gardens around the great cities of goods were -."' > .

the riorth who have to make their profits raised from a lower to a higher: grade to a '. > '; -
.Tinware '
thus .. Crockery... -
in six or eight months, while are .have increasing freight rates considerablyover ,
woman.
twelve. They practice what they had been before.At .
gardening
at a '
that time entered Every STOVES
truly high pressure. protests were ,
High culture.is three-sided it against these changes on the ground that other ;-;
; consistsof
good tillage, abundant fertilizing and they widened,the difference in rates already physical attraction is Boat Goods, Paints and Oils, l
existing in favor of the
large shippers
judicious planning as to the succession of and
crops. Good tillage is not keeping down as against smaller one As a result, secondary to it. We ;,

weeds; it.is. stirring the 'soil, deeply at the trunk lines issued an amended classification have a book we will WOODENWARE. 1 ;?

first, shallow later on, and often for the which remedied to' some extent gladly send you that
the causes of the complaint. The southern
,;. direct benefit of the crop. There is no classification committee held a meetingto tells just how to care Write for prices. .:_: ::- :
fallacy so unfounded
as that which .
'. the hoe only when weeds become con uses consider these protests but the result for the hair. TITUSVTLLE FLORIDA. : ,= .': .

:. spicuous. Good tillage kills the weeds was not acceptable to the shippers, as If your hair is too Box 212. ,jT i \'--.i.'
:. while there were no general modifications made, :{
i they are still under
knew the surface. I the classificatkn of February 1st remain thin .'; .. ... .., : ,....... ... ....... ..... .. ;.. ...._... ........ .,_........; ...... J- '
. never a true market gardener who losing : .-:..:.;. ...-.::...:.. ,.. .; .:: ... .:..:...: :.:.:...--. .::.:...; : .....:.::.. : :.:.:
in effect without .. .. ..
( ing material 11 or .
.
.
.
.
knew or cared much about weeds. In a any .. : ..:. :.i,. ..... .... .. '.. ....... ... :_. ........ .. .. .... ... .. .. .:.::.:.. ,
. :.. certain garden of 100 acres I never saw changes. The new classification whichis itsluster .0... :..::.
".
;j. weed unless now in effect is still less satisfactory to .-.. : ,
: a it grew along a path or ; .: ,.
J; about a compost heap. I often think of the shippers than the former one. hair .::::. ExperiencedWheelmen :: : 1 ''f.

, weeds divine get .-..... j
as a blessing to the shift- :i
;$: less farmer to goad him Mr. W. S. Whedon, cashier of the First ,fiI4zk .: :
; to cultivate the : :: : i
': but to the wide awake National Bank of Winterset, Iowa, in a : .. .
crop; market 'go! ... 4.
t weed is almost gardener recent letter gives some experience witha I :...?. \ choose Ramblers because they have tone ::: .. ..
;: a
meaningless .
,
ex ;. and style as well as all good points which '.': 1
l :; pression. carpenter in his employ, that will be of ...., I I go to make up a wheel of very highest : ..::. I I

Next to the care of the soil itself, the value to other mechanics. He says: "I Growth becomes ... grade. The latest models of :.:..':... i >

F manure is the most important consideration had a carpenter working for me who was vigorous and all dan- ;... .:.. J'

.., to the trucker. He dyes not consider obliged to stop work for several days on druff .:" ': : :: I"
is removed.It :
account of being troubled with diarrhoea.I ,, \ .
a good dressing of manure once in two :.:.. '-. '- --- ::.: i
mentioned to him that I had been sim- :; :.
. I
always restores .
or three be \ ::
years to sufficient; that is not ....-. .. f
:. ilarly troubled and that Chamberlain's ',... '. I
: high culture. Every almost. color to or faded :
year regard gray .
Colic Cholera and Diarrhoea Remedy ': : :.. BICYCLES .::
rr less of cost every acre must be heavily hair. Retain .:.: t Y .:.*.... ';
had cured lie bottle of it your
:. '> : manured. For ordinary lands the gardeners me. bought a '.::: f =' "notice the extra ,. :
about Boston from the druggist here and informed me youth ; don't look old .. iforadframes" .::.:..
use annually about
that one dose cured him and he is againat .:'.;:: are the very best built wheels on the market .': '
before .
: _- ;:' ten cords of horse manure to the acre and your time. ....:... l; ,)i to-<1a)'. They last. .. :... "
his work. For sale by B. It. Wilson & .
its is ..
'
" cost seldom less than $7 or $8 per The good reputation gained by the :. .
$.00 bottle. All
Son. a druggists."I .
i cord. The gardener usually has little :: ( Rambler builders during their 21 years' ..:.
a.. ct experience.makes the Rambler a safe and .. '
: faith in the value of have used your Hair Vigornow ( ..
t'= manure the second im ;
Jlr.'Iaglel"s New Residence. for about 25 years and I have : L profitable tment for both the noviceand .
o'
: year after it is applied. lIe applies it to found it splendid and satisfactory : ii well posted wheel buyer. :;=: ..

{ his land in a thoroughly decomposed con Since Mr. Flagler has become a citizenof in every way. I believe 1 have : 1 :
recommended this Hair. Vigor to f.;": RAMBLER PRICE $40 :
dition, and expects to reap his reward at the state of Florida he has given some hundreds of my friends, and they ..
For certain he attention to plans for a pleasant winter all tell the same story. If any. '.. .. .. '
once. .
crops even applies body wants the best kind of a Hair :...... All for "Just ff A">t" booklet. ''. .
'' it twice a year. Even after several years home at Palm Beach. The plans for his Vigor I shan certainly recommendto .. :..:. ,

; of this excessive manuring, should a new Palm Beach residence are now being them just as strongly as Ican :" :'. ... .. .. .. .. .. .. ... . '. ... .... .. .. .' ... ..::... .
; .
year that they get a bottle of Ajer'sHair .. ... .... .. ... .. .... .. ,. ., . -. ..
.
.
.
s ... .. .. .. .. . . .. .. .. . ., ... .
be skipped, the crops Till almost invariably completed, and to use the words of Mr.MacDonald Vigor. .. : : ... : .,. .. .. .. ... .. : . J
E. fail to yield a profit. who will build it, "It will Nov. Mrs. N. E. IUMILTOX: .. : : :. : .. :: !' .. : :: .t.. .. : : ...:: .. :.:=: . .. : :: : : : ... : .'
23,1aai. Norwich, N. Y. -
I Peter Henderson relates an apt illustration eclipse anything south of Washington." E. B. WAGER Agent, Titusville, t'1a. \

t?, of this sort; it is not new to older Shortly after Mr. Flaglei's: return from Write tho Doctor.If .

F readers, but may be to younger ones. A Havana last winter, :\MacDonald fol Ton don't obtain all the benefits Eona.--Lumber CO. t 1
you desire from the use of the Vigor,
1.. market gardener of twenty years' experience lowed the "chiefs" footsteps. He did not write the Doctor about it. Address,

and whose premises had always go to Cul,a to lOOK over a site for a new DE. J. C.Lowell AVER,Matt.SI1IL01I. On hand and Constantly Arriving, ';'

:" been a perfect model of productiveness, hotel, but to study the construction of a J

- promised to run a !street through: his certain Spanish residence that Mr. Flag L Ul\I.IBER. "t -

grounds. Thinking this land sulliciently ler had seen and admired. As an outcome -- -- .- Shingles, Moulding, Scroll Work, Balusters, Newel Posts, _

rich to carry a crop of cabbage without Mr. Flagler's new Palm Beach residencewill Bean, Orange Cabbage and Tomato Crates, i :
manure, he gave it none. On either side be purely Spanish, 172 feet front and
Brick Lime Cement Etc. I
Water melons and musk melons ,
are I ;
of the street he applied guano at the rate 150 feet deep, two stories high, with a
I Estimates made on all building material. Our large boat "Sunny South. will deliver j '-
of1 _OO pounds acre. Upon the unfertilized -' large and picturesque interior court. It rijie.Mr.
per anywhere on the river. Call on us or send in your bill. We will save you right.BOI.d .
part of the contiguous areas he will he located on the site known as Brels- M. Gnus has been on the sick list Ii 1

planted early 'cabbages. From the fertilized ford Point, being on the lake front directly this week. I amber Co. {'J:

ground his cabbages brought him to the right; on crossing the lake bridge: Mr. Jerry UriHi"; of Titnsville, moved S. G. VANLANDINGHAM, Manager, i &;

I,-100 per acre; from the unfertilized part, and entering the Royal Poinciana grounds.It his family here Saturday. Titnsvillo : F'lo1'ic1a. i
3oO loss of SIOOO is :\MacDonald's purpose to spire .
$ per a're-a an acre.
Mr. T. C. Gaines left Monday for the --
Much has been said and written about no trouble or expense in making of this
the ultimate exhaustion of soils and the another monument in architecture and north *o spend the summer. .1

inevitable failure of jigricnlture. The famous construction to which he may be able to )Ir. Jlen Montgomery/ of Oak Hill, JOHN R. WALKER d '

market garden lands of Arlington, point with pride. was visiting friends here Sunday. '. J

___ .. _. ____ DKAI.KK IV ,e-- )
near Boston, were ai'id wa'te* when the h Mr. Ixl IVitilluaimed here Friday fromMeen

British soldiers marched on Lexington A Monster lt-\H Fish. () bringing with him his ton, Her DRY GOODS &fr '

a* poor as a Florida: sandhill, and even Destroying its victim, i is a type of con. bert.. ,

called in tlelision -ti >ation. The )\\er of this murderous
!
lifly years ago) they were { IM| : Conductor Khodesand Albert Nolle, of MILLINERY ,
i Poverty PlainToday they arc malady i is felt on organs atlll l nerves amiinnsIt's
Titiihvilleeie itors theresidence
pleasant> at
\
among the richest lands I ever saw. and brain. There is no healthtill FURNITURE,
of Mr. Nolle Sunday.
The sucres.i\e cropping: the double it1. ou-rnin-e. Bnt Dr. KiJl ', New' !

cropping; of laud! are the distinctive features Life Pills are :i safe and certain cine. A very large;: onion crop i is being harveted. Fount and Bottle Soda, Con- !

of intensive hot tirnltti'e. The 11t. ,t in the world for stomach, liver, kid- There will l 1.1' abut 1,000 bu-heN )

"multum in parvo," the even peisistentcropping hey> and lunu-K. Only -':) cents at B. II. in the
; of eerfoot of gnuind in every Wil.-on & Son's drug; store. 1 farewell party way given i Saturday Tobacco ; = "

jivailaMe! !.erun, i i is the only method of ----- night: at the residence of :MisKuhl: in

ivali/inga; pfolil from huh-priced land. Florida's First Melon Shipment. honor of the ?Mi-H Kuhl, who left :Sunday TITUSVILLE, FLORIDA. .

.\ gtII1'tury t- I"jelufn shrewd I gardener for the north via Titu,,\ille.

who hitcd a pi<* v nf land at a nominal ('apt.'s. II. John-on.of Orala, shippeda
of melons from Oxford Thur.luy of The young people, with their hook*,
car
i'j
price, allowing tin 0.Ilt'r t the privilege of SchuylerAcut
:
time It..tt''k, the lint car to leave the state. I line and "a'htI"lIt, down to theHauloxer
\
enteric g iiMin ilulajl at any by
canal Saturday on a lisp fry.
melonsere fine from
The ranging I
paying: him 'be \:1\.11'\ 11ft..the crop upon valueof it.The I. twenty to thirty |wry H>und- each, andill 2uite a number of tilt were caught and foi,.tin'_ Hartford, /Etna, Liverpool and London and Globe,

owner soon -:1Ih. increasing: I leniand! the highest i,ric'e. 'apt. John- all report a very enjoyable t 1ue. Home, Continental, Providence & Washington, Fire-
his land, taut attei wsitching it for several .. ..
--
he I'oulcllll.t find a time when ,on hay purchased :v great many melons man's Fund, and Sun Mutual.
yeais A thioujih fieL'ht line has been etablUhed -
the erne11114)11 the giound were not at Oxford) and will ship a ear every day between New York by the.Mallory: For further information. rate, eta.. adduoi' all! on t'. S, :: ('JlI'"LEn, TmivuiK:. FLA.
sexeial until
;\lJIllatt'r on, per day, alii
worth more than the ground! it-elf; and 'i line i-teamer.-to Key \\Vs-t, and schooner
lie also has eighty
shipped acres in
are
he war finally obliged to sell to the tenant \\V Punta iorda;
line from Key t to giving -
melons at (Orala from winch he will shipa I
at a wry low tiguie. a weekly MTVUV.A IGB-H
car not !later than :Monday. There art I IGEIIT 1GB
Theccret of the !succes. of these noi t them .. --- -----
l
a great many truckers in the county,
gardeners! he in the piomptmand 'I l'rlilitliil Ititnder11'ill _
in melon and
with large acreages m01'tof + -
thoioughne-5 with which every operation them will begin to ship in car lots next\ .often cause a hoiiible burn, scald, --- AS GOOD AS T.EJE BI;ST1
is conducted. (ial'dl'1I'I'gl.tablt.s laiely rut or biui-e. nurk 1t'1I'mil'a: :Salve, V "
:
(
wtek. : 1; IH.\X KIYKU Il'IJL\ rFA'THr.T.Tpr) SS.
calla I will kill the the
bring what the general farmer would the I best in the world, }pain
They are article"iinivei- and \,rlHlIlt1Ilt'al it. ('un.- old stuns, special attention paid parking: for family uses and -ltippcd|: to: any station on the r?ast Coast
high price. Ankle cured
iiunrd luh'kl
I
sal consumption and so cheap that A :>i> fen'I'onn'lilcl.r,. !Emily felon, coin, all railroad or bv t;t 'aml>ott on Indian ruci.

alloid t'\.t'ry "At one time suffered.! from a severe i skin i-mptioii". I'HM pile' cure on eaith.Onlv .
family in city and country can pram of the ankle," pay? Gtv; ,, K. Carr, _'.' cent a I"ox. Cure gaarauteed.h' : THE 1 DECANTER

them! lost I of them can be reatlilygrnw n editor of the Juide, \\"a-hiJlton: ; Va. I 1:. I K. Wil-on iV SHI, 411'UI; :-ts. 1 .........
; by any farmer on land ten times cheaper I
I'wml11 ---
lec-oinmellded ---
After lining :- I
than the valuable acre- in the vicinity of medicines without success: : I tiied Chamhei WAXTKD-Ib>in' .t nun or wmaau to travel Los1ey era l\I.Iotlovv: .

large cities.!. How, then doe the mar Iain's I'.un Halm, and am pleaded toay for large IHHIM-: Hilary ?tr iiioiitlilyaiKl- l'
his ? I Ills i secret > with iiurei.tHiiiti n j>ei inaiu-nt: in- Brandies :{
ket :gardener make monev .- that relief r.uue as soon a--1 began its : JII iloie IIM,>df'lIhln' .',edtatuptl eintKipe.\ MAXAUEIJ Foreign P: and ilonu':-tic brands of \Yim-- Rum Gins. and l

lies in these two fact.He glow.moie u-e and a conipleteeurespet,,lily I fullo vet. ; 3150: (\xtull Wtlg. ('Rita.!!ts. WhL-kies: J Bottlttl! HerrAlts and Stout. 11
the than the gencial .
vegetables; to acio sale B. K. Wilson tV Son. I Im
Fur bv
farmer, and he market, them in lid kr : __ I D. I L. 1 1I0\l> \ ON, A FIRST-CLASS LINE OF CIGARS. BILLIARD AND POOL TABLES. \
and in Inure attractive condition II I: M.
season farmer, with land worth :Sir;>,()00() Donation to the Diocese. t!, Fanulv and hotel trade i-i.soln'itt-d. Prompt and careful attention given to mail orders.'
The
average Dentist.Oliie Cash mint aw.mpany your order I.O--I.f.:- : only :::;A) an slat, and manure co-ting a Befiue he left Orllllc1n1! : r. I/--h it' 1 IVII-
haie (Will cabbage; at roiiU'iuv, tint
  • f the
    makes margin ; donation of his
    trifle, a Clarke made a splendid i i iresidence .
    Only ti; t class Work, Dealer
    tvortllX1,000 I county jail. "
    lmttheeXK.'itg-aidener| on land on Main !Mieet to the southern at greatly rt'llun"I\'rin's. R. L. MOTLOW, inBRANDIES

    an acre and I with an outlay of :Si diocese of Floiidaof the Ilpiopal church. TITL'SMM.K, FLOUIDA.

    ur'f1 100 for manure, realizes a haniKwieprofit. The property originally; cn-t ahout : l.ii i' .-- -. -- --

    UK, and i0111' of the must complete and WINES WHISKIESAND
    attractive residence properties in the city. H. A. HODGES, FINE :

    A Good Cough I"clit'illt Bishop William Crane Jiay I ha moved I H

    It speaks well forChambeilam'' } Ccm .hIenwly into the house: and took, (Jct'a-lon on ivmoxal :( a1"lInH' IIhthhi, Fla. LIQUORS OF ALL KINDS. :

    : when druggists use it in theironrn to celelirate the fort it tlt anniversary Dealer in and (' { offEI41O"

    families in Florence: to any other. of his entrance upon the ministry.It given to mail orders. M(0FLORIDA .
    PINEAN1)
    "I have sold Chamberlain's Cough; Item- i is Ulhll'l'-tooll! that the honor occupied LUMBER ;Qiuu: :

    edy for the past: live years with complete! I by the 'Mioj singe he lint settled in Orlando CYPRESS N. HATCH, : : : :

    satisfaction to myself and customers: will be' occupied as a school build

    gays Druggist I J. Goldsmith, Van lltten, ing. Fruit and Vegetable Crates Dealer m !

    N. Y. "I have always u'l'lilt in my own -- -- i. General Merchandise, 1
    coughs and Truth.: Ter-elj Told. .
    ordinary
    both for ----- -
    family --- t
    colds and for the cough following! la'ripPl' FOll'\"' Kidney Cure i is a safe, Mire rein- j Estimates furnished for complete bills of consisting of everything"".

    and find it very ellicaeious." Fortale edv for all kidney and bladder diseases lumber to be delivered any point on the usually kept in a _ROCKLEDGE,, FLA

    by, B. K. Wilson & Son. Guaranteed, oOe. B. K. Then & Son. i East Coast. fr.t.ch1.'iS genet 1 store...... I --- I






    .



    J





    1._.r i __ ."..1-..,."..._.L _. ---. /. : >---. ----- -\ .. -. .:. j



    wrs .p T* TSfSPS

    ..
    '
    "
    -
    '- .t.
    "
    "
    ;: ,
    .
    > : ;. -' .
    : jf
    "
    ,
    :
    ,,.. r '
    #


    t ; 4 THE FLORIDA STAR : FRIDAY, JUNE 8, 1900. ,; 1


    "f"', i

    ,: THE FLORIDA. STAR] be possible to keep a volume of IN A POLITICAL. A.Y. ... 1lAKING >'

    -, "., paper money, under the system be and
    el1ea Among the
    Some
    t. Entered at the postoffice at Titusville at favors, within limits that would I
    second-class mail matter. Common People.
    ,'t prevent depreciation.On .
    BHs B. Wager, Editor and Publhh Editor of The.Florida Star.'
    the questions of trusts, land !
    During the last few weeks business has POWDER
    __ PUBLISHED EVERY FRIDAY MORNING. and taxation, he reiterates the well- :
    called me to make some tours in the
    y- SUBSCRIPTION. PER ANNUM: known views of the wing of the southern part of the county principally. bsowlnY PvRE ?.

    rF, .. 75 CENTS FOR'SIX MONTHS. Populist party to which he belongs. I had little time to discuss politics, yet I
    and wholesome
    ?: IdTertUing Kate FurnUhed on In the matter of labor disputes he am glad to state, however, that the "gres Makes the food more delicious

    .f.,;'. Application; takes a stand for compulsory arbi- commonality" are doing some thinking OVAL.UKtke MM M CO..NEW YORK.

    i;. Communications' on live topics, especially trafion. That is the best method and asking among themselves some questions -
    4 of local interest, are solicited. But the edi tor involving their interests in the

    .t' 'reserves the right to condense them to suit. yet suggested, perhaps, for the adjustment present campaign, and the .administration Ten days ago a patent for a valuable invention Weather Report.

    ,,: desired.Brief items of neighborhood news always of such disputes, but of county and state for the next two was granted by the.United Mates SUMMARY FOR MAY BY BEV. JAB. H.

    ,i somehow or other it has, up to this: and four years. I am glad I say that the patent office: to J. J. Parnell and W. H. WHITE, U. S. WEATHER OBSERVER.

    t- It must be clearly understood that neither, time, been found practically impossible people are thinking, because if ever the Wilson, of Lake City. The invention is Highest temperature on the 20th, 89.0;
    > THE STAR nor its editor is responsible 1 Cor1 commonality gh'e'er their duty and an improvement on axles for vehicles. It lowest temperature on the 5th, 66.0.
    opinions expressed by correspondents. to get a general agreementto
    ,;- privilege taking an active interest i in is said to be a wonderful improvement.Weekly Mean for the month 75.3; average mean

    : A recently made this method of settlement. public affairs the end of the republic i is for 19 years 75.4;highest mean in 19 yearsin
    SUGGESTION: was
    of He wishes to have this country near; at least that republic of equal right Weather Report. 1885, 79.2; lowest mean in 19 years in

    t' by Hon. Charles M. Cooper, assist the Filipinos build up a re- established by the fathers. P.S.DEPARTMENT OF AGRICULTURE WEATH- 1891, 73.9.Rainfall.

    t Jacksonville, our former congressman -, public. He believes in the Monroe Some reflections that are being indulged ER BUREAU. in inches,3.63; average for 23 ..

    in one of the newspapers oft doctrine and would extend it to in and talked about, and some of the Comparative statement of temperatures years, 3 62; greatest in 23 years in 1890,

    Jacksonville upon the question of these islands. He takes a great questions asked are given below: and rainfall for the week ending Tuesday, ]1.58j least in 23 years in IbW, 0.37.

    relieving our court of the First. It has been the time-honored June 5, 1900 Number of clear days, 23; number of
    } supreme has many words to get his ideas before custom with former county executive 1900 1899 fair days, 4; number of cloudy days, 6,
    t congested docket that it upon DATE. MAX. MIN. MA.X. MIN,
    the public, and while he has undoubted committees to apportion the precinct rep- May 30. 81 1-1 8-1 16 number of days with rain, 9.

    t its hands. The recommendation, ability we are fearful of resentation to the county convention on 31. 80 75 85 77 Prevailing direction of wind east.

    'Z was an increase in the number i of his being lost sight of in the great the last previous vote for congressman. June" 1. 81 75 87 75 Island Home, Merritta Island Fla.

    judges the court to assign to each Why change the ba-is: and make it on the< 2. 82 12 86 78
    ,
    struggle when the two leading parties 3 83 13 86 11
    f division a particular class of cases, combating each vote for representative? Very many, in 4. 83 77 S6 72 O. W. CONNER,
    commence working out this conundrum, have con 5. 83 73 88 76Total
    I which would seem to us a most: other. If Mr Barker mil- rainfall for the week.0.15 inch.
    polls a eluded that it was done to accomplish just Grower of Orange and Grape Fruit Trees,
    % feasible and practicable plan. This lion votes he will do remarkablywell. ; what it has accomplished, to-wit: to prac- week Departure minus from 143 inch.the normal rainfall for the Both Budded and Grafted on Sour

    i practice is mentioned as having ticall) disfranchise a considerable Democratic Departure from normal rainfall since Jan. Orange Ocklawaha and Rough, Florida.To Lemon.Roots

    i.' been adopted in other states with vote in the coming county nomin- 1st, 1900, plus 5.89 inches.

    ;;,' the result that the court dockets are Road Meet at City Point.A i ating convention from precincts that were Observer HAL Weather P. HARDlY Bureau., our orange patrons, and grapefruit those contemplating and lemon groveson planting --

    well kept up. large and interesting meeting was perhaps doubtful from the standpoint of Jupiter, Fla., June 5,1900. the east coast:

    f r ..".. held in City Point on Saturday, at which the powers that be. We wish to announce that our grafted and
    Second. A goodly number are asking Cold Stud or Death. budded trees promise fair to be much better

    1 Falling Into Line. a majority of residents were present. why the primaries were ordered so soon!? "There is but small chance to than ever before, and we would urge themto
    Captain Sharpe was chosen chairman. one save place their orders for trees before the fall
    ,. The of the state are Mr. Cresson stated that the object of the Of course it was left optional with the your life and that is through an opera- rush, and in that way be sure of getting exactly -
    newspapers discus the different precincts to elect for all of the tion," was the awful prospect set before what they want both as to size and
    meeting to improvemenof
    was
    apparently wheeling into line advocating conventions or a part only atone primary; Mrs. I. B. Hunt, of Lime! Ridge, \Vis., by variety.We .
    the nomination of state roads in the vicinity, but more especially but at the time the mass of the voters at her doctor after vainly trying to cure her have full line of orange and grape-
    | to take steps for bringing before fruit trees, including Walters, Boen, Marsh
    of a frightful case of stomach trouble and
    :
    k officials by the primary method. the road superintendent the urgent/ need quite a number of precincts were yet engaged yellow jaundice. He didn't count on the Seedless, Jocylen. Triumph and FloridaSeedling

    r The Jacksonville Metropolis, in a. for immediate action on that portion of winding up the winter's trucking marvelous power of Electric Bitters to cure Grapefruit; Parson Brown, Homo-
    and had not had time to think the matte sassa, Pineapple Seedless Majorca, Jaffa,
    t.: recent issue, says: the puhlie road from City Point to Coco stomach and liver troubles) but she heard Ruby, St. Michael, Maltese Straight Madame
    known
    the
    and consult about or -
    :' "The state convent between the north line of W. F. Dixon's over possible of it, took seven bottle, was wholly Vini, Paper Rhind, Tardiff and Sanford's
    approaching place on the south and the south line of issues of the campaign. One gentleman cured, avoided surgeon's knife, now Mediterranean Oranges, and for novelties we
    tion will probably be the last one, a leading Democrat in this countyfor weighs more and feels better than ever. have the Tangerine. Satsuma Kumquat,
    James Ranks' place on the north. This
    t as the spirit of state primaries fur nearly a third of a century, says such It's positively) guaranteed to cure stom- Washington Navel and Mandarin Oranges
    stretch of road about mile in length
    a ach liver and kidney troubles and never Our trees wi 1 be ready for delivery by the
    ordered be-
    nominating officers is becoming being through heavy sand, is not only a an early primary was never first of September, but we advise Novemberand
    Price 50c at B. K. WilsonSon's
    Both of the fore; and he is not the only one talking disappoints. I December planting, as trees planted at
    h' too strong to resist. great inconvenience to the citizens, who, & drug, store. 1
    about it by, as they say down this way : that time, are in the best possible condition,
    J I congressional conventions have de- at all seasons of the year, are constantly i being perfectly dormantIt
    when meant few.
    "quite a
    dared for such method of nominating traveling between Cocoa and points north, !. many are GRAND GIFT DISTRIBUTION.A will pry you to wait for our stock, as it
    . but a serious obstruction to travel in the Third: "Quite a good many, as some is mostly on 5 year old stock, and by November .

    . candidates for congress two winter when the hundreds of visitors ay, are wondering why it is and how its Forty-Cent Sugar Shell Free to Every will be from 5 to 7 feet tall, and will
    is believed the ; that with all of the astuteness characterizing I caliber from | to 1 inch in diameter and all
    hence and it
    : :years from all parts of the United States are :Married Lady. our grafted trees will be fully branched, and
    \ state convention, to assemble here practically debarred from driving: northward : the leaders of our party in Bre' Editor STAB. more than equal to any two year bud in the
    card, that she has, in a manner, been put state.
    1 on the 19th inst., will do the same along our beautiful river front, and We believe that the most effective advertising -!
    into and made inferiorto Our grafts were all cut from bearing trees,
    a political pillory,
    of much we can do is to get samples of our foods I
    we are consequently deprived ,
    thin and out full of fruit first growth this-
    f Dade'in the senatorial convention! came
    into the homes of the Therefore
    that would he said in its favor were its : people. weare I spring, and we have saved several specimensof
    , "We think that the primary; attractions better know. Remarks weremade The people think that the aforealtllead- sending an elegant sterling silver-plated fruit for exhibition to our visiting cus
    shell, such as we sell regularly at 40c
    for the individual voter should have been heard from on this sugar ,
    ; plan is best TS torn ers
    , by Messrs. Chester, Dixon, Hatter, each, to every married lady in the United I
    We invite and careful inspectiunof
    r and not for the political l boss. Faber, and others. matter, and seen to it that the wrong be Statrs who writes for it. There is nothing to ,! our correspondence stock. -
    . which the o'Jl votes of Dade The gift is absolute You will confer
    t righted by pay.
    has voice in the committee of 1 eu-s truly.
    Every voter a On motion, a composed readers very
    in the senatorial Yen- a favor upon your lady by making !
    hero votes con
    !
    rives THE OCKLAWAHA NUJISEIJIES,
    nomination and does not dele- ){e sr:;. (Hatter, Dixon and Cresson, was : this; announcement in your paper. Each lady I
    0. W. Conner
    t f while the 542 votes of Hre\ll'llonly Prop.
    tion :
    ; will send her this is too
    appointed to confer with the superintendent name only as
    ) gate all of his rights to a few men. and him the importanceof fives her 55; votes in the ('UnwntionOllie: lable a gift to send to persons who don't \"al-I

    I With a strong law to make officer urge upon hem he who say that it is a conspiracy to for it themselves. We give choice of any of WANTED-Honest man or woman to travel -
    completing this work during the sum our tOe designs, and will send illustrations I for large house; salary $65 monthly and
    of election do the right thing, trade away therights of I.revard to the
    an from which selection may be made.irAKKlt expenses, with increase; position permanent;
    primaries should prove acceptable mer.After a good deal of informal-talk as to senator in the next general assembly. ( VALLEY MFO. CO., i i inclose self-addressed stamped envelope.
    .Vre these things o'? Morgan and Harrison Sts Chicago. | AGES, 330 Cast m bldg Chicago.
    to all fair-minded men, and we the relative value of marl and shell for
    Now it i N quite well known that there ._
    -
    favor trying it. If unsatisfactory the work, the meeting adjourned. ,
    will be a wry handsome 1It1lI1hl'l'-l'os
    , it can be abandoned." of the Dade .lele- -
    bly a majority- county
    Favors The Drainage Canal. Another Lessonin
    gates!: who will come to the senatorial convention
    Editor of The Florida Star and honestly
    : prepared to honorably -
    A Dangerous Precedent
    In reply to a letter in the lat issue: of carry out the agieement: that this Health.

    It seems very doubtful if (Joy. your paper from the Palatka Ka-t Floridian tern) the senator !should be a Ilrevardnan. .

    Mount, of Indiana, would honor ;a 1 wish to say that while there area Why i is it then that Mr. Dimu-k { t ijACKACHE matism-tired-lumbago=rheu-
    great many disadvantage* in having other Dade man should beeven out feelingall -
    county
    01'> any
    4 if it should be i issue It indicate disorder in
    requisition the
    the drainage ranal fiom the. : I, '
    proposed' ; H. ? contingent: in this I campaign" v '
    by Gov. Beckman of Kentucky, 1 ),j, kidneys. No hope of good
    Johns liver into Indian river there al'l'alo icvml so 1 pour that she has not a son health while

    for the arrest of \\'. S. Taylor, : a ;great many advantages. One advantage worthy of the honor? And is Dade y> wron They are the your strainers kidneysare of

    charged as an accessory to the In having such drainage; canal poor for that matter a* to have onh (.'apt the blood and must be kept right if

    murder of William ioebfl. (;ov. it will drain not only hundreds of acres: I Hmick? Witluu-aily twenty griitlemi'ii y;, you're to have health.

    honor i- of land, but will than thousands ofncres from Dade coming to the Couvendnii? 'i Foley's Kidney Cure is guaranteed to
    Mount refused to requitition
    a ;
    make the kidnevs
    right-to them in
    : that are not good for anything but loyal to the 'unwritten a rcl'IIIl'lIt" with i feet ht'alth.'ou put risk. It's per-
    run no
    of State guar-
    for
    . Secretary Finloy, for farming, and if the state should take ievanl, what hope ran any Dade man p ..!'l' anteed. Buy a bottle to-day if you're not
    who is also charged with l ling the tiiirgiiig of this canal in charge as it least +I feeling' riuht:
    ; have, unless: there are at twenty-live \\ L. YAXCV, Paducah, Ky., writes: "I had
    implicated in the Goebel assassination :hould, then upKe| that navigation of delegates: from Brevard disloyal to their + a severe case 11 kidne disease and three of the
    I I f i t)rat physicians of southern Kentucky
    his excuse being that if Fin- the St. Johns liver i< topped\, let the own ('OItl1ty'? Is that so? I I'" it i possible that '. ., fl,+ I i me without success. 1'as induced treated to try

    ley should be taken back to tate then take this in hand and I IlntI"t'Ollt Dade> is i more loyal to Un-vard l I than llie- + ; ; + Folev's immediate Kidney relief' Cure.and three The bottles first bottle cured cave

    Kentucky he would probably IK tho-e: placethat: are (innavigable; yard is to herH'U? IViish: the thought! 1 p" \. I gladly recommend this wonderful merermancntl -
    will nut the land that i is drained overbalance The (penile having: had) no time before remed "
    mobbed and while he does not!
    in value the cost of hedging out primary to think of this gaestiau, and BANNER SALVE is the great healer.
    pretend to have law to uphold Lhose places 1 think it would. delegate
    any a* there i is sutlicifiit time jet, Ir: a -

    such a course, he has probabl It has 'been' argued that the prait'il'lalltl to the senatorial convention, desire
    .
    i: i: WILSON A. OND :\
    exercised the arbitrary power b} ( will nut yield crops enough to pay, to know the HMitini"iit of K-vvard Demorat8 -

    virtue of his ollice. but I have seen it tried, and if it was on this matter; that 1 may !lug able

    rained 1 thenis i no red"on why it would\ to truly lepri'sent: them. I Lt.t the !people! d
    does this lead if
    where
    But to lot be) the first farming; I 1.'.nil) in the state. IIl'\'i
    governors find excuses: to i ignore,' I tlid not know that the attention of lake their will known. I, f.lr one, am

    the law'? Certainly it will follow the MTietaty of war had been cillcdtu ready to carry it out without fear of punhment -

    necessarily;: that it will be :nliflicnitt the value of those lands, and if the land\ i:- or hope of leward.Hesptvtfully .

    matter to bring persons to trial that is now subject! to overflow was : : 15. 1\ H\unh...n .

    t who have escaped the limits of the drained there is no teuton why the state Sebastian, Ka.! June '"', 1tiMI.!)!>
    of Florida should not some day boa*
    tate in which they are indicted. wealthy a,: any of the southern states; --- vytN

    It i is quite apparent that Gov. \\.C. (',\It't:\ :c. Political Situation In SuwamuSiiwanneecounty -. ff Manta"t The World Famous Tonic

    Mount is influenced by political Shiloh, FKu, June otli, woo tOtL1i.i i1* without a'imocraticoriraniatioii. 1-'f FOR BODY AND BRAIN

    feeling in his course of action, but ()' .' The conuniteman 4 ncr l'Ift.l End recd l h\ 'It'd!' C t' I .K'llltN'mni2 '
    Prf\.ir ('UIIIII)' Trta'Mirer'n .Statement.jtXKlT ,
    he has succeeded Pl'l'ttyul' sful- liiuo.Ulamv tt' from each district:: was elected atIlle : iate! lasting efficacious agreeable '

    in the wheels of recent primaries, but up to date theimmitttv
    ly blocking justice: rash on Iian.l May 1. Willi! > 5 .>..H :3 iL'J "tI'U-1 UItSTITU tiS. FOP .
    ha- failed to or, anize. It is SALE UALL URum lSTS.t1
    :
    .
    Amount icreiu-d in
    in this case, setting a precedent May, 1111--! s3W.ll
    -- said that Mr W. S. Hodge); who Noll"tithia <>

    which can easily be followed by Total_SIO. WJ7Tev ; : Springs; in ( ;Jeoix'ia, i issued an Hit i-

    others who \\ifto:\ shield persons > amount paid in May. liKXl.! ) and lattim befoie lie loft that the ,'!/Ill1itl\,.,

    within their jurisdiction that are 1II1"IIJUl'l'warrants: ,dHiured and M'hool to board unuity-fiun-jiU..tinSaUuup mild not he organized until after hi10

    ; wanted elsewhere.Mr. -- tUl'lin July. I I WewantYoutoknowUsnot

    ... cash on hand June 1, 1IIH! ) ?1.437.32
    "
    The above !balance is held) follow: .\ Night of !en or."Awful .
    Barker's Acceptance.There )rxisitfd in Indian Kiver State lank only as, makers of the NEW ROCHESTER.
    as pee certificate cashier attarll'l anxiety wa" foil for the wi.i.\v -: THE
    to monthly revolt, less checks Nc- of the brave lfe11.; Burn ham, of Machus, :_ STANDARD LAMP OF THE WORLD,

    is nothing new or strikingin -WaUtI t fell, not in ... .fU'37.3'! :\1..., when the dm,tors said she tonld!<<1 outlive hit also as headquarters for all lamp Information. We will cheerfully -

    Mr. Barkers' acceptance of the: Balances belonging to each fund are as till morning; ," writes Mis. S II.I l.m- j-, -- not. supply Our motive it gratis is ,not whether entirely pertaining to Rochester We goods or

    Populist nomination for president. follows: coin, who attended\ her that ti-aiful night. think ROCHESTER whenever philanthrope.you think LAMPS want" But you we to

    tic ideasas (Vunty.. revenue, :general fund -?1,1H4.5 ll "'All thought plunuit soon die Inmleiiinonia don't .want you to consider, as so many do, that any centre-draft
    lie endorses the Populi .. road aunt bridge ._ !lisp. but she b "'L'f'i for Pi.I Kinir'-i .i. lamp is a Rochester. The name is not that of a cI.'*s tut of a particular -

    regards: the initiative and bunting __ :!O..>3 New Disioverjaying it had more than ;;> Is not a lamp.real Rochester And every or lamp NEW that has ROCHKSTbR.not that name stamped on it
    n It
    the dealer
    referendum in legislation the limitation fine and forfeiture "" _nn_. UiJIiO oiled a\'t'llll'r life: and had cured! her ofconstintption..ifter v sells or oifers It as such he is trying to defraud you. Beware of him.
    feeding prisoners' 67I( doveshut| .
    of the of banks and school fund .- 7.KJ: : duce :small Whatever you want to know about lamps.
    powers ..
    special nuil: fund, DKt.2_ :! .IS slept t'asilall night, and its further use 4 Whenever you want to know it, ask
    transportation companies, and .. ,. ,. .. ", .->_.-- 1,7t11.UITotaL completely cured her." This maivelouseilicirie THE
    would strike a blow at the latter by i is guaranteed to cure all throat, atrrt ? ROCHESTER LAMP CO.,

    ____. 4,137.3i chest awl lung discan-s. < nly otic and $: 1. 38 Park Place and 33 Barclay St. New York.
    i issues: of government paper money,
    Joss HKNKY, Triallottles free at 15. I K. W lon ASm's
    though he doesn't say how it would County Treasurer. drug store. 1




    . .





    .J


    ... --- .-" t.&M V. 4z.. _. i ..........
    -- -



    ,.-,-..
    '!!'
    r _" '
    '
    "
    -Vtj

    : :< .. .,''t .. d' .. ;t. -f---> ." {'O!'. '. '. .' ", ,::. ..

    .
    :
    ,
    .
    .
    ,;
    .. .,
    ;' -
    Iii ,, ,. ,
    '
    ,,:'< :", '
    ,: ',, .. j
    .
    '" ,, '. : ..
    '
    -
    ./ "" li .. .

    :t ; .s }ft'fi:'< C' ::: 'j rf .



    t>_: .'6 THE_ .LORID'A STAB' ( FRIDAY,' _JUNE. sf"What :1900:: t


    4 ,, ....' 1
    ., : r His Xeektle Up behind. "" tint, and others, show blue stronger I
    OM\RG\ fLt1% l oc. R\S10RY.\
    Bowlft; it is that,when,we think than red. Dull old and burnt rose are ,

    We're cutting quite a swell, two of the rose shades, and, many of

    r_ : 'the Tejehera' Association May See ,That when we think we're quite au alt the reds ere in coral shades and also
    And casting potent spell. "
    -, at Charleston Next Mouth. We feel a sudden siek'ning thrill geranium:: In spite:of the many colorsIt

    And hm it brought to mind is astonishing to find so much blackin
    : Special correspondence of The Florida Star. '
    F That with a cussedness unique .the ball dress goods. Black dresses
    CHARLESTON Our neeL ie'a behind
    June up
    Opportunities
    a';' will be the most'fashionable of all, and

    tor. sightseeing seldom equaled in any Bow oft we see a man who tbiatv the bright :or faint colors will be used

    other part of the country will be afforded The world is at his feat more in the millinery and the house
    Who thinks that o'er all hHas ,. ";;
    the teachers attending the annual knowledge ..
    gowns,and perhaps some fancy waists, -b; ,<
    victory won complete ,' :
    1'.'' session of the National E
    + to be held during the week \V'mId'ery quickly find In fact they have had several days.

    ?L. beginning July 7 in this city. Many That he is strutting here and there The automobile fad has made the The Kind You Have Always Bought, and which has beenin

    = ;thousands of Instructors and their With necktie up behind? for the has borne the signatnre of
    :. special gown purpose a necessity use for over 30'years,
    ; friends-are expected, and the railroads Bow oft we nee upon the streetsA and here are the descriptions: of and has been made under his personal -

    :. and hotels are preparing for an unparalleled man who tries to make two of them. They were made by a Y? # supervision since its infancy.
    ,
    -
    Ii' His neighbors think in point of brains !
    demand for accommodations. swell tailor and LJ suits '
    lady's in this.
    lie always takes the (cake Allow no one to deceive you
    Charleston in summer is a delightful But who, if only nature should were much admired in the store. One "Just-as-good" are but

    .. aretreat. The floral display in the city Unto him be more kind, was of strapped mode cloth, and the All Counterfeits, Imitations and of
    Would know that 'stead of brains it is with and endanger the health
    gardens and along the Experiments that trifle
    picturesque skirt and waist were in one and fittedin .
    drives: excels anything of a li'-e nature ills necktie up behind? princess shape and cut just to reach Infants and Children-Experience against Experiment.

    -, produced elsewhere in the United Mjr youthful friend, pause while I give the ground. The waist part had a
    States. The continuous A bit of good advice;
    incoming double collar and sleeves.
    cape snug
    !
    Before you let jour headpiece swell What is
    .- ;breezes from the ocean restrain the Just ponder once or twice With this a regular boy's cap was CASTORJA i

    ttemperature at all times, and consewjnently Upon the fact beyond dispute- worn. There was a pocket stitched on
    Each man is sure to find harmless substitute for Castor Oil, Paregoric I
    \: prostrations from excessive the outside and a few buttons were Castoria is a
    heat are practically unknown. Some time the \ ole world laughs because and Soothing Syrups. It is Pleasant. It
    > ills necktie's up behind. sewed along for a trimming. The oth- Drops I

    i_ From a historical viewpoint "the -Omaha World-Ilerald. er one had the skirt separate and a contains neither Opium, Morphine nor other Narcotic I

    City of the Seas" stands in a niche of snug Eton jacket made double breasted substance. Its age is its guarantee. It destroys Worms

    ;, Sits own creation. Event followed event and strapped on both sides. These Feverishness. It cures Diarrhoea and Wind 1
    IhLL. and
    [EARLY f FASHIONS fOR f allays
    .
    so rapidly from the
    Revolutionary period straps were sewed to the jacket witha Colic. It relieves Teething Troubles, cures Constipation :
    t to the memorable days of 18GO-G5 button at each end. The collar was
    the
    that it is somewhat of of the Latest In Hats and Flatulency. It assimilates the Food, regulates i.
    a task to tabulate Some Suggestions flat, and the lapels were rather pointed.

    them. The opposition to the stamp and Gowns. The skirt: was quite plain save for neat Stomach and Bowels, giving healthy ad natural sleep.

    act in 17C5, common among all the colonies Special correspondence of The Florida Star. rows of stitching. The color was a dull The Children's Pauacea-The Mother's Friend.

    t" was first emphasized in CharIest red scarcely distinguishable from the''
    NET YORK:, June 3.-The color cards
    ton by the formation of three companies old burnt rose. With this was worn a, CASTORIA ALWAYS
    GENUINE
    are out now, and they foreshow the
    1' : of volunteers which captured the felt hat of the same shade, with a!
    tints likely to be the favorite ones for
    fort on James island where the stamped sailor lirim and bell crown, fastened'
    the approaching fall. In the silks all Bears the Signature of
    t ; papers were stored. Colonel Moul- with a strap and buckle.
    the old favorites are there, but with
    trie and Sergeant Jasper immortalized OLIVE HAEPEH.
    new names and thee:: are not always
    l themselves by acts of great bravery,
    as musical as they are forceful. As a Reports show that over fifteen hundred
    .and their memory has been perpetuated -
    natural sequence of the African war lives have been saved through the ue of
    by the naming of the two impor- the stuffs of whatever kind which are One :Minute Cough Cure. Mot: of these /. /
    tant forts at the mouth of the harbor. Gr.J
    on the shades of khaki, and there are were cases! of giippp, croup, whooping ,
    The first shot of the civil war was fired cough, -tlima, bronchitis and -
    are called Transvaal earth and pneumonia
    many
    "by the cadets of the military academy Its early ne prevents consumption.B. .
    -which overlooks Charleston Lay. It Cape of Good Hope. Besides these areXJ.W II. Wilson & Son. The KM! You Have Always BoughtIn

    was on Jan. I). 1SU1, when the steam I

    transport Star of the West tried to The Professor's Apology.

    land men and arms at Fort Sumter for 000 Miss S-'ars-Thl least thing sympathetic Use For Over 30 Yearo.

    Anderson and riddled with about a play causes the tears to
    3Iajor was THE CENTAUR COMPANY TT MURRAY STREET, NEW YORK CITY.
    shot from a battery manned by the YF 0 fb pour down my cheeks. _. --.'-- ----0'L- -- _, -H -_d, -_ >- ':'ki.:
    : youthful soldiers. aq The I Professor Following the latest

    The veteran relic of the past and one wrinkle I suppose-that is-eh: -I don't

    which will doubtless command the at- mean wrinkle at all-of course not-fad

    tention of every stranger who comes to R that's It.- fad Is the word.-Harlein

    this city is St. Michael's church. This Life.

    a old sanctuary has withstood bombardments I II"I Other: remedies only alleviate the

    ,
    earthquakes, floods and cyclones vmptom! of dyspepsia and indigestion

    with a seemingly charmed exist- : Dr. Loyal Ford's Pyspepltcide cures by

    f once and bids fair to continue its use- l' !' attacking the root of the disease! and
    ( iHI thus! makes healthy stomach that. will Res
    I ;-fulne&s for another long term of years.On a
    perform all its functions I). II.
    I' perfectly
    its site the first church of the Carolina
    -
    = il r Fcr All Kinds cf
    Wilson & Son. # (, r ) 7 chafing.ATI .
    colony was built. The cornerstoneof : '! Calibers and V/efcbts

    .'; the present building was laid in ;11
    Her Reason. 1. A rnv FivoRrrro ??i KUNTZNC.

    Ij;32. George Washington worshiped li r "You seem to like his attentions. Whydon't r,t r' t til Model i, ?S. C'J Ar-nv v ii:jt-, -,<--h: { ,
    here and so did Lee. Two signers of fllodclj i'. c..berLJra
    .;. the Declaration of Independence were you marry hilll :
    I "Because I like his attentions.
    among its original supporters, John Model lr v Tl V" r T1. eibe-ce, Doun/'
    Brooklyn Life. TVr:jrl:S 7 u-4 litilJiili.
    Jlutledge and Charles Cotesworth a t s( Y
    A
    Model 1 f 92. 41 and S3 caLbcr,"Taie Down,"\reigLt
    Pinckney. The latter was the author i Had Kidney1)iaene 27 Years.Mr. 7 pi mnl.1.

    I of the phrase "Millions for defense, but I Ii II Il ;II Mode 10<>6. 4>70 caLtcr, "Extra Light," weight
    li VIII t., ,\. Stillman, amerchantofTatn-: 7Y. t pounds.
    not one cent for tribute. :
    IV.. II | ioci, III., writes: "Foe\! '!" Kidney Cure
    :. Sir Chl'istopher1'11, the designer I I i is meetingitii wonderful nieces.! It has loot Winchester Ammun i. Made for all Kinds of Guns.

    : of Westminster abbey, planned St. )11-
    cured some car-eij! here that physicians ,
    \. chael's church, and he is said to have pionouncul im-nruhle! I m\H'lf un ableto FREE.-Send Name and Address on Postal for 160-page Illustrated! Catalogue

    I I UMifto' its meiiK My face tt:-day is WI CHESTER REPEATING ARMS CO. HEW HAVEN CONN.
    a liviiig 1 i I'ictme of health;, and FoliVKidney 's ,

    6 J Cute has made it Huh. I had j

    -iilleted 1 ti'iitseenears with the disea -

    tI ( 1'T e, and tt ld1 feel I ten wean younger

    y than I did one \''ar nun I ran obtain

    some \\oinleifui reitiirate( of its medical
    f.
    T! : cIIllitle-} ." 15 II. U'iNon: iv Sm. j

    --
    t L!- ifihlii .. I"I"Ip -

    ?
    i >,I ttlG ;l li

    iI _


    I i I //



    ; q
    n\rs. V
    ('II.\m.I-: TOX ('OLLEaE.oilietl : ; a
    a number of other shades, and all
    the style from t
    cathedral. Lou luu. The highteeplt' : jug on the khaki, thoiuh :-:Ollm'l' called -

    of the church is the most prominent ,, tow Has and hemp. They are darker -

    landmark of the city and from than the! regular khaki. They are all

    on the tan shades, thotl:11:01114' $1I
    its lofty bell'iy platform Cent-nil; Beau- are

    ,regardakhed the Union warships as really 'l'lJow' These' are respectivelycalled iI 1jak

    i cannonaded Burr: Natal. lol'ctts.old; Mine
    they the city in the open-
    1 and Pretoria. Whj' they left out Lady
    of ?
    'utr year the )"llll'llion.t.: Philip'setftnireh k
    j and the Huguenot churchshould smith is a )puzzle others are called I II

    Mule I and Kopje.:
    J not he missed by the teacher
    i ttliile in Next to the tans cray i is the prettiest'
    to\\u. The last named build-
    and most delicate, even than Calning of Baby
    more so
    ragas erected in Tnt> and is the only
    Mace> the old Trench gray so long the \\'uonjni I
    of worship in North Americawheie brings joy or pain. It's for the a
    of laitand letinemcnt.' Peailand r
    the ancient form of conducting mother to decide. With good health

    the Fronth service is still maintained.In : silver :tI1t11'latillUIIIIIIlkl' the most and a strong womanly organism,
    tIp delicate of dresses and talf'11)' kind motherhood but adds to woman'sattractiveness.
    cer'otery of St. Philip's is bur- a TR.I-VVEE LY SAILINGS
    Jed the of iriminiiii should have defined the .
    of John .
    I body ( Calhoun.
    __
    _
    l'xad:11:1I1I's of the khaki tans. Some BETwn5 i ;
    The council chamber of the city hall

    .t' "is rich in pleasures for the student of of them are almost bro\\n. while' throthers flJcELREE'S JACKSONVILLE AND NEW YORK
    in the tints
    of
    are more the real
    On its walls '
    history ii is hung !'ruinbull's -
    ,; mule and bca\er. The ll.ix and tu11lIlt.s \\" "p'" ('ullimg :it (' ---tun.,. i'.. both tray
    : painting Washington, opposite ; t"i1 iflf'.e al psi
    :,I1 have enough of the real' color in t.oa..n h.
    i which :are the portrait of Calhoun byllealy 'l'ht' :H''''l t'am\hI' flit Son iff.

    and the marble that gives the name and yet haveeiionirli
    f bust: of James
    L. l'dirn.'tlll' opponent of the southlern of the khaki in weave or shadeto !takesawoy all terrors by strengthening Tin: ('I.\'IH: \ Rn' tM.i-iM; > VM> ()I'rto'lIlnX I.IIS
    I ;:in' li;.lit to the name. The broad- the vital organs. It fits a mother forbaby's
    siatcHnau. The other public build-
    ----Iireeterv'ire: 1.t\\'I'I'n_ _
    :
    of I I lotlis are the lightest; and more of the coming. By revitalizing the u
    Charleston
    j J.ii2 in are a very substantial p'lIullOws in them. Spruce gum color nerve centres it has brought chubby, Jacksonville, Boston and Providence, and all eastern points.
    order. The has
    postolHe? hand-
    is beautiful' when broadcloth\ ands crowing youngsters to thousands of < 'allnmiit ('har"t") both \\ay-v
    ,sonic granite quarters and the customhouse weak women who feared they were
    SIMI-\VKKKLY: S\ILIX:.
    :
    is the' pinkish shade of These
    tan.
    : and the central market are alo.models barren. It purifies, heals, regulates
    tints me called, according the shad'. zauiLtnwd Froltll.'w:- \\lnrl. I 1:1I: -11I1I. \cr'iiliiiiiu l rr"", f.mil nf I it 1\:.111 :&trr: t,Jaik-unville.
    to
    of convenience. The College of a'id strengthens, and is good for all
    velocity tout-in; steam boiler! jackal, won.u at all times. No druggist jj
    Charleston, the principal educational ri3> tvs M. JOilS! RIVER NISI;.
    smoked glass, smoke and ruins These would be without
    it. $i oo It
    rank and is
    institution, takes high I 1)B\IY: LINE.
    color and shades ate intend'd for automobile For advice in cases requiring special t
    equipped for work of an advanced de directions address nt'C\\ ('CII ,Ja'I'tHIilSc and !Nnnfbid.vtupfiii .
    givingsympt.oms
    ,
    co>t nines. Ueds in a round
    script ion. dozen' shades are on the tolor cards, "The Ladies' Advisory Department," i : !: at I'.ilatk.i.tor.: St. Fraiiciui! ..f>ml (Hl'I.md). Blue Springs and other
    The! t finest residential portion of The Chattanooga Medicine Co., Chattanooga hit initdMtc landinjr- t..lnlrtiriver..
    and thennmlter of '1'1'111to have
    rharleston is al.:.: the Battery which greens : Tenn t :Mt.iin. r "l 1).. Ml"l IUsoVPT. tl'.t. SU \W. i is appointed to sail as follows :
    makes it not unl.e; the! New Yoik of IK'en limited only \by the number ofIri'h :\1 RSLorILEuf. -ffiTu, I,. :i\r foot: t :ltll4'l'Il1' st.. Ju'Lulnvilh.: 'I'nk..Lay's and >stiirday: at .>;< 0, p. m.
    former names: and the greens will all be hays! :-"\Vien I frt tookuu- of Cnrdui .,:i\*' :llItllrd1..wl.IY': tad Tliui.,l:i\s at .",:1111( a. m,
    East
    time has and
    It South
    a we had beets ni.'med thrcv hut could
    years
    of the
    flattery bordering; the \\;,::1'1' front at richest of the emerald tints. 1 not hate any children. sine; mouths later E. B. WAGER, Agent, Titusville, Florida.
    had "
    P.hieswould be almost entirely left out a fine girl baly.
    i the lower edge of the city forming aright
    of the new cards were' it not for the General Passenger and Ticket Office, 204 West Bay Street, Jacksonville Fla.
    angle: built up with a high, wide
    fad tl!:at dark blue i i:0 useful and
    / stone wall This composes! a magnificent I \V \VARUriIToN.. T.; I'. A.;. F. M. IRONMONGER Jr., F. P. A.,
    (!, street, and it is lined fi the shore valuable a color for children that nothing Ii!* Malt N Sew York. 204 West Bay St., Jacksonville,Fl a.

    side with commodious dwellingswhose can replace it. Silks and tine wool CURES WHtht ALL ELSE AILS. (.'. I', 1.0nI.I.,1.: Fla: O-II(1t.:: JNO. L. HOWARD, Superintendent,
    ; I and the ribbons are all produced in all [ Best tough fcyrup. Ta-stes Go*d. Use | Foot llojran Stn-et, Jacksonville. Fla. Foot Hopan Street Jacksonville,Fla.
    spacious piazzas, overlooking the harbor in time. S>!d bv drigcist'. THEO (i. l-:<( are cool and enjoyable notwithstanding I the shades of helio, and many of theseare ieo N s u M mm Gm Traffic Manager Gt'lleroilgents,

    the heat of summer. cnt'rely; new, with ijuite a pinkS t'bC"l'hrotlJth Biiihlin?. 1t Mate stl'f'l'tew York.
    !








    .

    tlaln__ ,-- '" -'- ...z.--- ,._ ,c. --=".. """ -t.- ._ .. -- -. '. ----.e J. .,.;-.. -" "- "'- -- ....... :



    .
    -
    --."'''' -> 'f"' : '' '' "'' -.", ,-- : ,-
    ; -
    .. : : >i .


    .
    -
    .
    .
    .. 't' r' ": ::


    i : ,. '-' :


    ... ., '.. :.
    .,' .f' ,,, ->.
    r" r I. J-1'"
    _
    i : 7- t \ r '. ; ..;, f 0 :
    =
    >-
    1 y.hl;..
    I
    '..

    .

    ',. mEFLOEmASTARr


    , i.. ,' .

    .1
    ,"
    ;c.
    I' 0


    Not f o* Ot1 sel..qes !A1oxe, : t1t fo! t1te Good: of 0l\ei

    fr ,

    : VOL. XXI. TITUSVILLE, FLA. FRIDAY, JUNE 8, 1900. NO. 7. r.I r.

    --.-


    I I t' C CURRENT( LOCAL lICONICS.j .. All Notice persons to owning Owners cattle of, Stock.horses, and COUNTY O COMMISSIONERS'[R MEETING[ I I Sharpe proved.were J. N.appointed Waller a and committee Wm. H.to l LATEST I NEWS[ AND D 1 INCIDENTS. .


    other stock, are hereby notified that after destroy the warrants as turned over by g .
    j Brief Mention of What Is Going On In Monday, June 11th, all such loose stock Official Account of Their Proceedings In the treasurer per schedule. The com- Hatters of Interest That Arc Happening

    ,I .r' '.. and About Titusvllle. running at large in the town of Titus- Session This Week. mittee having perfonued their duties Around Town.

    ! Vineland Grape Juice with soda. B. R. ville will be impounded at the expense of The board of county commissioners met were discharged. The treasurer also had Our motto: "Cleanliness and quality. 4

    ... "Wilson & Son. the owners. Tuesday, June 5th, pursuant to adjourn I a certificate attached to his report showing Wilson & Son.

    ment. Present, J. R. Walker, chairman, I he had the balances. his report called
    I -5 Send your watches for repairs to W. M. FOR THE BEST ELGIN BUTTERGO J. Men el, W. H. Sharpe, and J. X. for on deposit in the Indian River State Mrs. C. F. Fischer returned last week
    I
    t:, Woodward Titusville. Work guaranteed. TO CARROLL & GOLDSMITH'S.Pro Wailer A. A. Stewart, clerk and J. P. Bank. from her visit to Sea Breeze.

    ... Indian River hand has been engaged Brown, sheriff. It was ordered that $400 be transferred Charlie Gailer, of Daytona, arrived

    i .'. for Miami's Fourth of July celebration at Bono Publico.Last The following business was transacted, I from the fine and forfeiture fund to the here Sunday afternoon on a few day's

    , y. '$100 and expenses. week we called the attention of the to-wit: I prisoners fund. visit to Mrs. Dora Deisner and family.Mr. .

    :\ Mr..E. L. Brady has been quite ill for public to purchasing their supplies so that The minutes of the previous meetingwere Bids were opened for shelling the road C. S. Schuyler and family roent

    iii- the past week with an attack of gastritis. the stores could close early. Many have read and approved.On between Titusville and Pritchard's, when Sunday with Mr. E. W*. Schuyler:at Mai-

    f We are pleased to state he is much better. spoken to us during the week asking if petition of S. J. Tibbals, et al, for the bid of J. W. Carlile: to haul and abar, returning home Monday afternoon.
    . some effort could not be made so that all straightening of road between H. Jennings spread said she! at $7.50 per car, was ac
    t-' Mrs. D. L. Gaulden and family return the Mr. S. 0. Fitts, of West Palm Beach
    stores would close at 7 o'clock excepton and the property of \\ F. Richards cepted. ,

    ed from DeLand last Friday afternoon, Saturday nights, especially during July ; the board appointed Wm. I* Frantz, The following bills were audited and afternoon

    ," having been away ever since the first off August and September? J. 0. Fries and E. J. Shattuck to mark, ordered paid:

    ( October. view and lay out the same, and make W. H. Sharpe, county com'r._____$ 7 00 town.
    'I Supt. J. II. $ams was called home Have you tried Desipota P Get it their report the first Tuesday in July. J. N. Waller, _n___ 23.40J. Mr. J. R. Anthony, of West Palm

    I Wednesday by the serious illness of his! at CARROLL & GOLDSMITH'S.1'eaclers' Tile tax collector made his monthly re R. Walker, ______ 4.00 each[ who trip to Sanford was notedin

    wife. We are pleased to state she is now port of poll taxes collected in May. I Mendel, ------ 4.40 these columns last week returned
    l. Examination.The
    !4' D. L. Gaulden, salary county judge -__ 25.00 home .
    convalescing.Mr. Monday.Mr. .
    Agreement was entered into by the
    ( __
    June examination M. Goldsmith, prosecuting attorney 3333T.
    '.. George W. Scobie: has moved his held this week of teachers was hoard and the F. 1:, C. railway to deliver Wetmore, ice _______________u__ 2.05 W. II. H. Gleason, of Eau Gallie,
    : at the court house under
    whole fishing outfit from this place to the shell at different points in the county C. S. Schnyler, insurance on court house 37.50A. came up in his launch Monday to attendto

    Grant, where he is at present operating supervision of School Superintendent at $i:>.50 per car, to be paid for every A Stewart, accountant____________ 15.00J. some business connected with the sale

    : .' his boats at, and shipping from. J. II. Sams. The following-named jier- month. Mendel, copying minutes__________ 5.00 of stock of the Delespine rant. -
    sons underwent examination: Miss Helen On petition of M. Grim, et al, for a copying precinct lines for
    Miss Dolly Richardson, of Cocoanut M. Miller, Miss Jennie C. Miller, Miss public road from L, Grim landing on ceuses.----------------------------- 2.00 Number 48 was the lucky number toget
    Grove after"a visit of a week or so here Gertrude D. the point lace tie raffled by Mrs. H.
    Mendel, Miss Carrie E. Mendel the lagoon to M. GrifhV landing on Indian I. R. State Bank, interest ou warrants. 28.85
    ;. with her sister, Mrs. W. II. Harris, returned Miss Elizabeth Hopkins', Miss! Ger- river board II. Wat- Titusville Electric Light Co.__________ 9.00A. Titus this wf'k.Irs.:: Emma Renakerwas

    I home Saturday afternoon. tl'llde\1.: Hardesty, Miss j Kiltie Martin, the appointed A. Ford, fish warden_______________ 40.00 the lady to win it.
    s ton, J. 0. Fries and J. W. trims to
    J. P. Brown, board.4.00
    i The Bond lumber scow, well loaded Miss Lena Argo, Miss Clara Otwell, Miss mark, view and lay out the same, and .. .. feeding waiting dog on ____________ 2.00 Judge J. W. Price, of Volusia county,

    1'' down with bijilding material of all kinds, Susie Summers, Mhs Claudia McMillan, make their report the first Tuesday in jailor_____uu_________ 30.00 paid his first visit to Titusville in many

    is delivering the same at points on Mer Miss Jessie i McMillan, Miss Sadie Snell, 'July. janitor----______--____-- 5.00 years Monday, coming over here on some
    rills Island this week as far south as Mr. C. U. GlfI'ettIiss: Alma Frausen. The bond of G. X. Hatch, for notary waiting on county court- 8,00 business before Circuit Judge Jones.A .

    Georgiana.Attorneys. Miss Ida, Dodson, Miss' Fannie Gray, public, was examined and approved.The .4 .' drawing and summoning letter received from Mr. F. A. Los-

    s Miss! Mary Bnrtus, examining committee. jury county court.__._____________ 29.80(
    .. A. St.-Clair Abram,of Jacksonville letter of K. O. Morgan to have a .. '* ley states that he has left Switzerland,
    Four colored candidates also stood special venire Co. court 1.80
    r ; J. D. Begs, of Orlando, and J. amination.W. : ex- cattle inspector appointed at Fort Piercewas J. C. Joues, envelopes for circuit (',court5 and is now pl'obably'isitin his brotherin

    B. Gain, of Leesbnnr, argued an important laid over for further considerationuntil E. B. Wager, printing-----___________ 7.00 Algiers. lIe states that he is having a

    o. land case before Judge Jones in J. CRAYFORD, Groceries and the next meeting of the board.J. ('. 11. Watton, _____.___________ 1.00 splendid time.A .

    chambers last night. Provisions, cor. Main and Washington Houston, who was appointed to H. & W. B. Drew Co., books elk's office 25.78 dance was given i at the house
    Titusville. furnish .wire for Turkey creek ferry: reported M. D. L. Dodson, attendance on pris'n'r .50 opera
    Miss Lena Mendel of this place left Wednesday night in honor of the
    ,
    young ,
    3.00
    price being so high for wire the I: A. Bobbett, cleaning ce5pool.h
    the first of the week for New York city, TAKING THE B. Wilson & Son, mdse. forjail 2.10 ladies from different parts of the county
    CENSUS. plan was not feasible, II. A. Conkling -- --
    .. .. ..
    where she expects to visit her aunt, Mrs. med. paupers 3.90 who were here this week attendingteacht'rs'
    agreeing to put said ferry in good running -
    )
    M. Schwab, fur some time. She went via 'The Enumerators Fur re\ard and theOuentione attending' 3.00 examination.
    order for $.>, the same is hereby E. I & Bro mdse. forjail______ 130J.
    ,; the Clyde line from Jacksonville to lie Propounded. ordered to be done Brady Posloftice Inspector E 0. Tate, of Mor-
    B. Beach & Co.,med. for paupers 2.25;
    -
    -
    I Capt. II. B. Shaw, of Ormond, superintendent There are three persons taking the census The road report of J. O. Fries and J. Pauper account 121.00D. ristown, Tenn., was checking up accountsof
    -----------------------
    of Seventh life caving; district, of Brevard county, who are 1J11i1yen-: M. Orrell was received, accepted, and Cain ferryman, ___--_--.__ 6.00 Postmaster J. C. Jones last Saturday,
    inspected the Chester Shoals house of aged with their duties this week. Mr. S. notices ordered posted according to law. R. A. Conkling, ___uuu_ 6.00 then left for points down the river, stopping

    \ ,refuge Saturday. We acknowledge re- D. Holmes, of Sharpes, has the northern A letter was received from the executive T. J. Wkahutt, registration otlicer____ J.Ul at l both Cocoa and Rockledge.

    ceipt of a pleasant call from the captain. (portion of the county; Mr. Cha:. W. committee, appointed by II. W. J. O. Fries, Supt. of rua k.----------- S.45: County Surveyor Fries has been engaged .
    I Bolton, the central portion; and Mr. W. for convention of H. ,J. LaR.K-he, road work, dis. :2-_ 10 00B \
    Judge J. D. Beggs, of Orlando, who Long, a county commissioners to take the census of the Indians
    .
    II. Tancre the southern portion. Theseare J. Stewart, acct. contract 9, 3- 5000
    stands the best show by far for receivingthe to devise a uniform and bet- X. Kill 6, 330.00 in this state, the work to be done during
    Brevard's best citizens and ;
    nomination of governor of this state among our ter mode of proceedings. The board ap- K 1-:. Minis 24. 350.00 July and .\ugu-t. Mr. Arch Hendry, of F

    --4 just ten days from now, is gliding a day i in most modest people need flt'111t) hesitancy pointed Chairman J. II. Walker to meet F. K C. Ry., freight on wire, 4____ 2.SIS. South Brevard!, will accompany Mr. Fries
    the
    or so in town on legal business bdiH'f'Judge answering questions the enumerator said committee on June llHh in Jackson F. Foundry, wire----- Ln_ 5726 and :act as interpreter.
    ::, all of which information is kept secret "
    ville.
    Jones.A S. F. Bibb bridge lumber, 412.24 The district
    I conference of the A. M. E.
    by Uncle :Sam; and arc of vital im- The re itmtionooks; \ were then taken l:. A. Conkling. wire for ferry" 4 .__ 500
    beautiful crazy quilt, the handworkof jMirtance in making) up statistical information up and the following names were strickenoff Ie. H. Mouth, S Muick, J. S. Kern, J.M.Orrell church for Daytona) district:: will convenein

    Miss Mattie Braddock, of Sebastian, connection with the census re the list: E.t'. road work, Titusville at St James church June 14,

    was rallied last Saturday night at the ] ( : I district 5.n. wilier__,________ 58.12 11100 Kev. J. L. Moore, P. E. Welcome
    II W
    X J Carlile
    looms of the Titusville board of trade. It port.The questions that are being asked by Bailey, .'. Whitlock H. H. Jt'nkius'w address on the part of the city by A. D.
    F A Chappell II 1 Futcli,
    was won by Mr. W. R. Knox. The quilt the enumerators are as follows: 1: J Leah C T Mi-Crorey, Sams, E. J. taRoche. F. W. LaRoche, Penney mayor of Titusville, 8:"O o''O'k,
    \ brought about $ )t) What is your manic? Archibald 11. Suns, hauling marl,!t1)'ialfulllI 2 103.00 Thursday evening, June 14th.
    Thompson; II IS J. W. Oaluu, extra road work. fund 1(5.00
    Mr. Geo. X. Hatch and Dr. W. L. What is your relationship: to the head I It P Chancey, C 1 D Case, Bond Lumber bridge lumber------ 5>>.37 Mr. S. I). Wright, of DeLand, arrived

    Hiighlett/ of Rockledge and Cocoa, interviewed of the family? Geo Cook, I II C CahhnlI, I. R. State Bank acct. hauling tiller 2743: Tuesday to meet the school I ward and

    the school board Monday and What is the date of your birth (month 1.:d Davis, J \\' Cocliran, J.T.Bevill. hauling shll--_ 332.11 adjust the insurance for the companies in

    Tuesday relative to a combination of the and year) ? L Eaufalla, Th Castle: \\'. BLinton, road work __u________ 25') which the Titusville public school, building

    public schools of those places into one What was your age at your last birthday John Erwin, II Fisher, .\.J. McDonald, road work _u___ __-__ 3.13 f ; was insured' to the MUM of *I,9.)(). The

    with the building centrally located. ? G i II Fuller, W I F.: Fnti-h, I J. X. Waller, 1'\"t'I"I'l'illg shell road--- W.IX) full amount of the insurance was paid.Mr. .
    __ __ ._
    A J. 1' Brown, feeding piiiouen M.3
    The tusteoal-buniin: locolllotircon the re you single, married, widowed or E: C bray, J Hamlin, I51.iatdipithcunvictiuufeesCu.emit I n 2W.00 Maurice'alli took hU' leave Monday

    F.E. C. railway went south :Sunday after divorced i '? G 1 B Hemmingway, John Henry, J. P. Blown crini Ii t prosecution co c't 77.0-( afternoon for New York. lIe will
    How .. .. .. .. .. ., ,.
    have
    been
    noon pulling train :35, in charge of Engineer many years you married Jeffeison, .tv Jones J 4.K spend the summer and fall months at

    Louis Yuillaume. The change fron ? Coats Jllhllolll1, Aaron Jacobs, .\. .\. tcwal't. 10.32 Hotel Champlain Clinton county, New

    wood to coal was necessitated on accoun You are the mother (or father) of how II Kill, C K Kenyan, The bard I illjllurnnl to meet again the York stale, where lie will hold a positionin

    of the scarcity of wood along the routefor many, ehildreli'lluw l'IF\\" Miller, H T Norwood, I first Tuesday in July. the hotel for Manager l ; Seavey. He sold

    fuel. many of your children are living;? I W B Roper: W M Smith, hN Barnes chaiuless to Mr. A. P. Brown,
    _Wher was the place of your biith j Sidney Wilbur, Amos. Wilkes, I I Dtiit.il Announcement.; of this place.
    j' :Messrs. Lyman and Glad+vin are building Wliem was the (place of birth of your i ifather. \\' 1 U: Watson f '
    C F Williams
    ; I.. T. Daniel, 1 H. D. S., of ( 01)i, i is hOW"watt..l The Misses i :Su-ie. Summers of
    J a skipjack fish boat for J. T. Price, ? i TiblfiKand
    I John .\ F.d EverounesH ;
    Chancey, Jensen ami i is
    temHtrarily at -
    I t 20 feet over all, beam about Ii i ft. ti inches Where was the place of birth of W M( Hill | prepared Clara Otwell, of Bahia: wno have
    Geo
    youruiutliel" i Chancey, I to do ail "l'lItal11I k.
    I This is a much beamier boat than the E.I: Hi-iideison: 1 11 E Hisler, been attending the Florida Agricultural

    II! fishermen here have lieeii using, and i i- What a- t the year of your immigration I\\' 5; Moon, (let) I L I.iiuli. I THEY RE-SO NICE. Where did college, at Lake City, arrived in town

    quite an experiment with them as lu to the I'liitt- States? P. Did, \\'m\1: Kitise, you get them? At Monday, stopping over here until Thurs-
    I
    1 I' whether it will IH as suitable for mulle Have you \been naturalized? I\\ 1'Powell, > W O'Brien, CARROLL & GOLDSMITH'S. day to take the examination of Hremnl" -

    : as such bo.ithave proml for bottom fish. What is your occupation, trade or prolesfuti. ('has Herin. John (i Powell, i I OAK HI.I.-. s school teachers', leaving; yesterday
    I If )ll'I' and (itall will havtpromise 'I afternoon on Capt. J. II.ndrews' boat
    so, : :: :; Lyman ? S I D Smith, J M Brown, i
    ii :Mrs. I H. S. Barker who has been for their homes.
    :
    of ciders for several ] quite
    How
    I more.Titusville many; months have you \been nll'lHployt.t' !!j Geo 1 H Bi.-hop: Loin Cherry, ,
    ill with rheunuiti-iii. i- much !better thisweek. :
    i I ( j I J IK'rahb, Noah Dorsey, 1 j In the Jacksonville Tinies-Union ami

    i. and the Fourth. I How long; did you attend school (iii | Then Dcinro, Gem W Depew, Citizen of la-t Saturday appealed the following
    I Mr. and Mr.II.. A. SUlllnll'mllel't'
    months )I'? j I K: (i Rook, W .\ Hall, I paragraph: Walter Raymond
    , 'fitll \'iIl/s patriotic celebrations have I Can yon read l':' j J B bt-k. 1. II) ditto, i i over from Ddora: Tuesday, an 1 :Mrs. S. Watson, the two-year-old son of Mr. and

    I alwaysbttunieiuorable events, ill II IH- Can yon write |! \\' A Smith, (;et-:; :Sexton, went to New :Smvrna. for a few days )Ir..:. Watson: died yesterday morning; at I

    I propose to celebrate the Fourth this year Can you sjn'ak English j jDo I .11' Stephens. IC Twain, : writ.Mr. :?:l."> o'clock, at their residence corner of ii

    i in truly patriotic style. It is piopo&ed to ) you own your house or1,) you I .1'f (i eland, A J ( M.I-, i T. M. .Adam: is painting the Main and Third streets, :'pril1 t eltJ. The

    . have brew attraction.. oratory galore, a I rein. E B liutrhins.011., I 11( Thomas, school house, and when that i U finished: I funeral way held from the Church of the

    ! line ,lhphof fireworks, etc., all of w hirh |! )Do )'IIIlOWIl your home free, or is it Joel \\" swain: C II Books: ', i he will build a piazza all around :Mr. j i Immaculate Conception at ;UA: o'clock

    !1 Innftg .igt'tl:' W F IMchar.lson, J C Shaw, t Feathers new house.We I yesterday afternoon. The interment was

    i anflouncedithin The penalty fur refusing to give the information i J F.: :>| earman, E: W Sullivan, had a tine rain Tuesday and \egetatioii in Saint Mary's: cemetery, Rev. Father

    i Be sure to spend the Fourth in Titus is 100.coi.nuii. ; 'has Thvi-, King; Williams, .. looks fresh and green. Orange: Kenney otliciating.

    I ville and have a big time.Hearing : J W Hl'ttie,1 Fox, trees are putting on a line growth and Fresh Lemon Syrup made from the I II

    > vIni l\C. : C W hall I' C Hainlin, [: holding! their fruit well. fruit each day, at \\' lotmon'5": Il
    The wedding at the A. M. I E.: dllm'hrtdlll'Iay
    OH Habeas C Corpus.' \ T W Wmirall.: F S Hig.ins, Mr. Nathan Towl. who bought the
    night when 31i .
    -:-: \lJlle Cullhi'
    John J Sanders, C C Carroll ha moved it his WAXTKU,
    to place
    Chapin cottage,
    Sheriff Prevail, of I n-ivula: county, I and Mr.: F. laity were: united in marriage .
    I P. Hrainerd, C (' Converse, near Mr. K.: .\. Marsh, and will soon Men to cut cross tit>::. Call or write,
    ;:- brought John Farlis heJe before Judge 'I by (Ii. Fields, was: thej.uell
    : ; A l' noises( It A Hammond, have it ready for Ol'l"lpation.i Contractor l Box ilk), Roseland: Fla.Announcement. .
    Jones yesterday on a writ of habeacur, ,j event of the year among the colored I : i
    L : M Carlin
    pus. Farhsis charged with entering the] pt'nl'lt', and wa very largely attended by \\'C M Buyer K'li.JT : A :S Fee, i 1 I. W. Hatch, who has been herewith I Icutai .
    room of the wife of onl' S.: Johnson: at the white folks. Thi-ie was not even his son for the Past; ten weeks, has .
    II(" .. KIHtelin Dr. F. H. Hoiighlon West
    now at
    an unieasonabie hour. Judge Jones; j standing room in the church. The bridalronple gone north ami .will spend the summer
    .1 S Cork nun. Palm Reach has instructed to that I
    ; us
    made an investigation and leferied l the I were preceded to the altar about with relatives in Massachusetts and say
    The clerk .,f the court presented hi* feebill he will IKia Titii-ville in July for a
    ) stay
    case back to the county judge of ( :-crota ,I il clock by the bridesmaid) anti groom Maine. i
    j l for witness fees paid out at the : of two or three! week- professionally be- { ,
    Mayterm
    county. It seems that the defendant has I J i and two pages, the latter bearing: lighted :Mr. Hooks, who succeeds Mr. Lewis
    of the county court amounting to 1 fore leaving: for the north to lend three ,
    been: imprisoned over a week without aj i i 1,111,111':: in sticks of silver. The bride as foreman and sawyer for the Creighton t 1 -.r'
    preliminary hearing, hence the issue of I wore a costume of white swiss trimmed| ?:)s 10.'fht'. Lumber ('0", ha- bet'nil'k! with fever. or four months. 'i il

    the writ. Judge J. \\'. Price, IIfleI.alld, I with ribbon and rntiles and bridal veil. supervisor of roadmade hire!- )1 r. Arthur IMcen H acting; as sawyer at i --
    port, which was examined and I j T> those who! drink whiskey for plea-
    appeared as counsel for Farli; Judge After Jhe aiding; ceremony an elaborate; ap- the mill during di r. IIl1hk illness. .
    ;' tie: IIARPKH wlll.kealld;
    ; zest to
    [ proved. ex-
    Mershon, of Kissimmee, for complainant. spread was served to the friends of the i' i-tenee. To those who drink whiskey for
    The counsel on both sides have agreed to couple( at the icsideiutj of Ellis:: l't LIJ. I I The county treasurer made his monthly Iron Pipe and Fittings, 3-8 to 21-2 health's sake: HARPER whiskey makes

    holj preliminary examination next Tuesday The bride received a number of prettyand report on the different funds of the inch; black or galvanized. Write for i life worth !living Sold by Ix>sey fc )IotI -
    I I ..
    at Kissimmee. Useful present ,j county, which was examined and \l' .1, prices. E. W. Amsden, Ormond, Fla. low, Titu=vine. Fla.
    .


    "
    -







    .
    ..
    l I


    ., .. .. -. :.:.. -=,-- ..,. *.... .
    (' .<<;: :-: -. ..... ...- .. ..--.. I "- J s "':' "' ..... ",J w s''''
    ; /9 -
    -- .--1--. _, ; -. .' '-',.-," ';::" Ji.i''''' .:..' ". .... -, .:. -...._ 1't.- ...!-- i.,.". -..._--___,...-_\-of.o." -_ ;; A .y --". '1 J



    ;\ :'.., \ .

    :;
    ., ;


    ....

    i t. .. Itf

    .'t ."

    , f l ,
    "
    f ,- ,.,\. .:
    .. .''. :_,
    >

    t: ; 2 THE FLORIDA STAR : FRIDAY, JUNE 8,1900. -'

    , ( --


    'fr .. -' -- ..... (GENERAL, 'DIRECTORY.SOCILTIESETC. : Experts t Baffled.

    .' \i( h .', ,. -, .
    .
    ,, .,, \ \ '_ .. Real Diamonds are no better

    Tf/ER"E \ \.s'\'BlI* O'NE. N. AtP.f' \'\. -, '\. \ CITUSVILLE BOARD OF TBADE-1L& for all purposes than the _

    I \\ \ \ \ \ I Jones, president; J. M. Dixon, tieasurerj J .
    :\ \ \ \\ \ \ ,
    : \\ \ \ \ \ \ G. Bast secretary. Meets second Wednesday

    r 71' .7fIO"E\ \ Hood s S\a sa pf.lrl 14 \ night in each month at their rooms. 6eiuritiei
    flD t \ 1 h'VNIGrandlas \ -
    1 BI\ \\ \ i \\t \ ,, F.& A.M.-Indian'River lodge No. 90, holds 00 I:
    ( \ Iii \\ \ 'Wi)heIthundei'of >\\ \\ \ \ H \\ \\\ \ V" its meetings the second .and fourth Friday 4

    1 .,, : I : : Niagara istheuntversai'songofthecuredrb evenings of each month at the court house Barrios

    : \s' II mil1ies'and \\I t !\ iii\ 11\\\\\ I III A. A. Stewart VV.M.; F. A.Morgan, Sec'y.. .
    t rb; :: that f ood; Sis\ 'sap ariII 'ii I M i j I \I \\ \ \ t CHURCHES.


    (,. > I.liIh1i, !d'\\\1 i\|1 A 1 -l v \\ 1 AMERiCA'iSdiGR'ElA1i \ ', \ ; ST I l BLOOD.IMIEiiDI'WNE" : ll EPISCOPAL CHUECH.Bev. R F. Brown,, I D mnonds ac CI}

    \ urif enrlehesjthA. blo'odtashothing\ \ \ "else fan. Rector. Services second and fourth Sundays

    k : O.OCi\\S\\ \' :-= in each month at 11 a. m. and 7:30 p. m. I We are the sole agents: in the United
    r
    __ 7'L -./ b -- Sunday school every Sunday, at 9:00 a. m. States for these marvellous semi-precicoa
    ( ,. stones, which are the nearest approach to
    ," PRESBYTERIAN CHUKCH-Eey. John A. Genuine Diamonds ever discovered. For the
    Hughes pastor. Sunday school 10 a. m.; purpose of introducing them quickly to the
    but they again seen In vast Expert Trap Shooting. Preaching 11 a. m. and 7:30 m. Prayer public we will forward either .
    now are p.
    : PRISONERS I ij [ Of WAR R I IN AFRICA. W. R. Crosby, the expert trap shooter -
    flocks, quick to gather wherever lies a who did such great work at theSportsmen' invited meeting to Wednesday come. 7:30 p. m. You are \\1ltIIIIJ I II

    fallen horse or other dead animal. :
    :=
    ?: association tournament at
    '". How the Boers Treated the EnglishmenThey They are large disgusting birds and BAPTIST CHURCH-Preaching at ritnsville -
    Garden this
    1 t. ..1 Captured. their presence arouses a natural feeling Madison ,Square year, second Sunday in each month,morning and :
    ; when the tournament was held on theroof
    evening. Prayer meetings Wednes
    of repulsion, but they perform a every \
    t : Special correspondence of The Florida Star. has again showed what he can do day eveni gat 7:00 o'clock. Sunday school ,
    useful work and lessen the danger of
    "., CAPE TOWN, May 12.-Although the with the shotgun. At the recent tour- every Sunday at 9:45 a. m. Indianola on I \\\lllb\

    t Boers hold than Brltist pestilence.The at Lincoln. Neb., the first the fo"rth Sunday; LaGrange on the firstSundar.
    more 4,000 nament on
    out E. N. BELL Pastord..rl'.llOlJlST
    latest man to be signaled ,
    S f prisoners In the famous race track In' BritIsh day he broke 84 targets out of 83 shot -:::::: ?..
    from the many brave men in the ",
    closure at Pretoria and elsewhere, little Mar at on the second day he broke 212 CHUKCH.-Eev. J. E.Mickler,
    army for the Victoria cross is and third in 1"Y
    Services first
    uneasiness Is felt for them by : out of 2ir>> and also made the only Pastor. Sundays
    I' r jor Baptie. a medical officer. The servIce each mouth at 11 a. m. and 7:00 p. m.; Sunday -
    -. countrymen. The reports from for which the coveted honor has straight score in the sweepstake at 25; school each Sunday at 10 a. m.; Ep-:

    sources are unanimous that the treatment been awarded to him was rendered at live birds per man. In this event Crosby worth league every Sunday at 3:30 p. m.;

    1 r: which they are receiving couldnot he with stood at 32 yards and beat out 30 Prayer meeting every Thursday at 7:30 p.
    where
    the battle of Colenso, ,
    m. Ladies' Aid society meets each Wednes-
    t be Improved The ration competitors. Summing his ;
    work
    upon. : up at
    utter disregard of his own personal day at 3:00 p. m. Everybody welcome.
    supplied to the prisoners are sJrni&r) tc safety, attended to some wounded who targets. Crosby accounted for 2DG out

    those Issued' to the wives and families had been left on the field since the pre- of 300 shot at. a record that still further TOWN DIRECTORY. '

    l of the Boers, and their medica I stamps him 8: about the best man fUWN OFFICERS-A. D. ,
    lions day. While engaged in this peril- Penney, mayor; ..........s
    men fight as hard and long for the life done under hot at the traps at the present time. M. S. Jones Jr., marshal and tax collector
    task which was a
    ous ...
    C. S. Schuyler, clerk and treasurer John ::::: -
    of
    I a wounded prisoner as for that of:r received three ; ===
    rifle fire his horse
    Henry, assessor D. L. Gaulden F. A. Los-
    ;
    their own men. The captured men Unless food is ;a
    t wounds. The gallant major, not con- digested quickly it will) ley J. M. Dixon, W. E. Knox, Jno. E. Walker
    t give to the Boers full credit for hu, tent with thus distinguishing himself, ferment and irritate the stomach. After councilmen. The council meets first % l ;

    I also brought in the wounded son of each meal take a teaspoonful of Kodol Tuesday in each month. //I'l\ 1W
    Dyspepsia Cure. It digests what you eat
    Loift Roberts, who afterward died and I and will allow all COUNTY DIKECTOKY.JOUSTY .
    I you to eat you need of RING PIN STUD EARRINGSScrews
    to whose mother the has given ,
    I queen what you like. 'It never fails to cure the OFFICERS. L. Gaulden.Titus-
    the Victoria cross intended for her son. worst ('a>,eS of dyspepsia.t It is pleasant ville, county judge; M. Goldsmith, Titus ( or Drops), at

    CECIL IIOYT. to take. B. R Wilson & Son. vine prosecuting attorney; A. A. Stewart tUB SUA!'AN TEE
    Titusville, clerk circuit court; J. F. Woot- These stones are f

    Ivy poisoning, poison wounds) and all en,Cocoa, tax assessor; E. W. Hall Sharpes j i $ if. guaranteed to retain -

    other accidental injuries may be quickly A Strantre Coincidence. tax collector: John Henry, Titusville, 0 0 their lustre

    Z t tRE1&OVLYG cured bv using 1)e11'itt'sI'itch lIuzl'ldl'e. Eight jear.s ago the baseball season treasurer; J. H. Sams, Courtenay superintendent forever; the mountIngs -

    It is also a certain cine for pilesand opened in Fort llIith, Ark., with agame' public instruction; J. O. Fries, Ti- : are heavy
    tusville, J. P. Brown. Ti-
    skin diseases.!; Take no other. B. Iv. between Tort Smith! and Krebs, county surveyor; : rolled plate, and
    . tusville. sheriff;; T. J. Cockshutt, LaGrange,
    I Wilson & Sou. 1. T. -rink" Haw pitched for Fort registration officer. i EACH are warranted for

    -- Smith and McOiunity Krebs. Hawloy .d. five years.

    .-i. A Great Cycle Meet I struck out "_1 batsmen' and did not COUNTY COMMISSIONERS.-: E. Walker, Are $2 Per Pair.
    Earrings
    Titusville chairman W. H.
    The cycle racing that will be given.at I ; Sharpe, Sharpes;
    allow a base hit. There were sevenscattering Jos. Mendel, LaGrange; Jno. Houston, Eau
    the national meet of the League of hits off Mclliunlty.yet Krebs Gallie; J. :N. Waller, Aukona. Regular ses- SPECIAL CAUTION :

    v American Wheelmen Milwaukee! this won the game by a score of 1 to 0. The sions are held first Tuesday each month. Do not confound Genuine Barrios Diamonds
    R"c' summer will include several of the National with oalled Khinertone.White
    game was lost because Fort Smith's. COUNTY SCHOOL BOAED.-J. M. Dixon, Topaz, or other imitation stones, regardless
    Cycling association championship catcher I'hI. could not hold Ilawley's I Titusville; S. F. Gibhs, Melbourne.Central what the name may be. Genuine Barrios
    .. events. This addition has almost Diamonds have no'artificial backing are
    FRISOXEKS FROM THE BATTLE
    swift --- ---- -- -- ---
    Little
    pitching. did those two : e iual to real diamonds a.to looks and wear,
    nELl doubled the number of races on the pitchers else and wilt cut (&"s. This offer will last only a
    or any one think that the
    i J mane treatment, not a single exception programme a' il has made it one of the I Floridl, short time longer, and in subject *o withdrawal -
    same men would open the season in without notice.
    ,'J.t:. to the contrary Laving been found. must attractive programmes that have I
    ,L Brooklyn In ISKiO as opposing twirlers I MAIL ORDERS.A .
    ; The Boers, however, consider their been issued thus far. The list of eventsis .
    but font: ie plays queer pranks with S PeninsularHaiIl'oaJ. Beautiful. Brilliant, Genuine Barrios
    I
    British prisoners as divided into two I as follows: all. : Diamond, mounted in a heavy ring, pin or

    clIsscs-Brltih: regulars, home volunteers Two mile national championship( stud, will tie sent to any address on receiptof
    I full directions
    I One iKjllar. In ordering give -
    and colonial troops in the one professional; 15 mile match race. pro ( and state whether small medium or
    class and and Natal volunteers DO YOU GET UP I large stone is desiredrtWLIJ ,
    Cape Colony I fessional C. ( amateur mile, championship .
    i -- -- : sii; t.:,IK!), the Prima Donna
    iu the other. ; ol.ll'-tl.irllmile handicap, amateur of the Walter Daniro.-oh O]>era C,>.. writes :

    The reason for this is clear, for the ; one tiile circuit championship, WITH A LAME BACK ? UuexcelK service frutn Floridato Barrios Diamonds are lustrous and full of
    substitutes for
    flre. They are ui.i; iutc> iit I
    Boer leaders say that they and their professional; one-third mile, handicap, all points .. .. .. '. genuine diamonds fur st.w1; purposes."

    men have no qua ml with the soldiers professional: 1. C. U. amateur two mile Kidney Trouble Makes You Miserable. North, East and West. ClUItlK G t I', of (CAMlhLE ieorge Edwarde&'s SEYGARD."lo

    who are opposing them In the field. championship: two mile handicap amateur Town" Company, writes :

    They know that with them it is a matter ; one hour match race, professional Almost everybody who reads the newspapers Two trains daily between TAMPA Diamonds While playing objects on of great the road beauty I found and Barrio useful

    of (duty but they are vehement in ; one-third mile national championship is sure to know of the wonderful JACKSONVILLE:, SAVANNAH and ness" CARRIE GAY.

    denouncing those whom they call a professional: I. ('. I*, amateur I cures made by Dr.Kilmer's COLUMBIA carrying Pullman Drawing Money promptly refunded if goods are
    Koom Sleeping I ('ams. (canuectiug at COLUMBIA :
    band of capitalistic adventurers, who, one-third mile: one mile handicap( amateur I Swamp-Root, with sleepers forIVAS11INGTON nit as represented.

    they have hoodwinked: the British li l the great kidney, liver "
    say I ; one-third mile open professionj j I II Beware Imitators. i
    [ and bladder
    ; public and dragged theta into an I al; one mile handicap, professional; one j 'I ; !It is the remedy.It medi-. Address Mall Orders to
    njust: and cruel struggle. The Orange mile rE great BALTIMORE
    open amateur. j : I
    cal triumph of the nineteenth PHILADELPHIA
    Free Staters are (lslll''iaIlTou ht up I The uame.o of Ut'rhan1U >emthe vet-
    j I Ill 1 century; discovered and NEW YOUK.Also : The Pomona M'fg. Co.
    : about the war for thus far it is their erau race meet manager, has been added j i !I: after years ofII t ,

    : tt'rrihwth:11 lias been invaded and to the list! of members of the ex ecutive i Il = j! scientific research ty with CINCINNATI sleeperta lil] :! i'mid way,

    I captured. I'rvMdeut Steyn is quoted committee. I'mler his management iS Dr. Kilmer, the eminent ASHCVILLE.'Dixie 11:11' \OIJK. I'

    I as saying: "\\'( do not hate your nn- several additional open aud handicap i'! .- kidney and bladder I -- -- ----- '

    lion wtd0 not hate soldiers I ---- specialist, and is : .
    ; jour events will be added to the pro 1':1l11ll1l' II j { .
    though they fight against us. but wed I for both amateur and professional racers. j wonderfully successful in promptly curing Flyer" Through Sleeping ('mu I
    j lame back, kidney, bladder, uric acid troubles Route between i
    hate and the who have
    despise men There will nlso'be series of 81e-1 i
    a
    I JACKSONVILLE and ST. LOl'ft i
    and
    I Bright's Disease, which is the worst
    brousht i cruel war upon us for their cia races for motor cvcles. !jTetter form of kidney trouble. via ;jj""J'SSIEEDS
    '
    own evil cuds. I : : Dr. Kilmer's Swamp-Root is not recommended Lake City )!al'untlallta.
    Most of the news that has come out !I Chattanooga and Nashville." i'
    01 (('Z'IIIuud skin diseases: : yield I everything but if you have kidney !

    of I.ad.smith and Kimberley mIll quickly to the marvel nib Mali 'qualities I liver or bladder trouble it will be found Makint! connections for K.1TY.. '

    Mafekiug has been rerehed from native I".r Manner: :Salve, made! from a prt>cnp-: i just the remedy you need. I It has been testedin HlCAdO and all points in i

    sources.! The Kntlirs have a won iou of a skin specialM \\oild\\ide so many ways, in hospital work, in private the northwest. i iI i .

    IIt'rfnlysh'm of telegraphing news !i f tine. :'5e. 15 I: Wil-on tl Son.I I II practice, among the helpless! too poor to pur- I grow payiujr crops bet-uuse th\y're ,
    Through Ic'I'lliJlg.t-ar service between Jack | fif frr.tl .tint always tho be.t. FurSafe
    I chase relief and has successful in
    I proved so
    from village to another, and
    out
    very somillc and New Orleans via River Junction
    | Veriindn Cliairs. '. every case that a special arrangement has I i M eerutieri.. Kuiuac :sutisiiiuuStKK '".
    I'cn.sacoia.
    and
    often UK' tidings so sent hi\e beenAerified !
    I! The wing chairs are shown this summer !I i I been made by which all readers of this paper i I ri to Ferry'i beeiln and proptI'.dXi ,
    by later How it i
    reports. for the veranda in mixed reeds j i who have not already tried it, may have a Full information application to any agent 'j jof fired Annual free. Write for it.

    done has often been conjeetuicd. butnever 1 that are verv' effective. Red and I. sample bottle sent free by mail, aiso a booki tins roil any I j
    green D. M. FERRY & CO.. Detroit. Mich.
    accurately discovered. One of I and blue :111-1 green are ofteuest seen. i!i, telling more about Swamp-Root and how to .\.O.MvtDovM-n. L. .\. sirirti tx. I i i4iell' t
    the suggestions; : is that the news is scut find if have bladder troub'.e. "f' .. ,
    The ; out you kidney or IVJ.l. .\-\4c'II"ll'a"; : '. .\ !.
    I difference in coolness between
    by menus of drum taps troin hill to up-i! When writing mention reading this generous --- ..

    hill, thus -reditiug the savages with a : liulntcrins mid rattan vr willow\ Wfti:3 :. offer in this paper and F' \'" To PATENT Good Ideas
    Pot yet suuVictitly and '
    apprteiatela in
    veritable syste.n of telegraphy! and send your address to .Je: :: Bears the _rf The KM Ysu Haw Always' Bought may be: secured by
    too man.v homes heavily upholsteredi : Dr. .: our at L Address,
    Kilmer&Co.Cip't
    others art- that the news is shouted
    i furniture is allowed! to do service Ihamton. N. Y. The 'yi llf f Signature:! A L THE PATENT RECORD,
    from hillt, p to hilltop or that tire signals -
    are used. however it )be done, the :! through; the summer months if certain i; regular fifty cent and Home of sw p-Root. of $ To Pad..r lt'c"r,I ,II Baitimore__(n Ml ru tu-r_ann.irn.ALL _,_Md.u".r.ut'J. _..

    fact remains that HUM important news pieces of this sort must stand in :' dollar sizes are sold by all good druggists.

    I the 1 living room, see that a linen cover .. '.
    is iccehed -- -- -- -- .
    frequently through the nathi's. :: .
    The first report of r..iden-1'ow- is provided which will afford some re- Commissioner andiliiiiiiitr.itni'- s ill ;. .\f.. i....
    lief. {1 r )
    ...
    I ------
    cll'ssuccessful
    sortie ---
    came through in -
    ; -- I j Under-id hyirtue bigot order ol'I'l: i. 4' \'.\
    this way Much of the news from the Cat'trrh ( umiot lie Cured '1 sued liy the Hun D l.. i.iuldcn.. coiii'tx iud:.:.' '

    besieged towns has liceu brought out with local I j of Krevard county. Floiul.i on tin. :'M'i: ,:i\. \Y. ., THE GOLD '
    applicatioiiM. as they cautiiit reach i j I of :Mav. .\.11.) hHl will sell .. .. r.1" '\
    by native rrmmlers.uti the Hi. we at Philie : 1 "
    they tins of the ,
    ways it di-H-asf.
    ." CaUnh is a 1.1111II1111' I i j tloll in front of the co'Jrt' !111a...- 0I..1 I .! .'. T I Ii lvine t',. 'f '{ &,- } l IN KLONDIKE
    take to ('Oll'aIIIisl':1tdlt.s' are amazing 1'III"tillltiullalllihc'a. e. and in order '
    to it' p
    cine j '
    !i Floiida. dmin the 'u sal lion iij 'i h i I ilirM r ,
    to behold. When they are i-apturi'il by vim nuM take intoriiul n-nu-dns. Hall's :Monday in Jo l I' 1'""'. t.t tin' '
    ly..1. 1'111'- .
    Catarrh .
    I'ur '.0 L
    ( IS takl'lIlII1t'l'Imlly :and acts directly (On: : :In :1 r : r'o
    the I'HUTS. .:js sometimes happens, they ; pone of inz the iltbt.Mm Httlii( II alton !' ". .
    pa i :
    on the M"Mi.j and I i ;. "\L ?\i : ('art'tl1h I"j : :I: t1 'j''j'rll
    ruuonsnrftrrs.* (In eased!. tin Iiiuln bi st ''I.i''!' ; l. ,.
    t
    (('I:h1 ignorance and protest their I Hall's ('atari h Cure is not :tin ,. fIII'U. < I' : 'ii.1 .r ;
    a quark I II 'I
    medicine .
    I It for cash all the followuli I d l Ir' !i"nnll:: 1" t. ; (S-\: : : hl"lIth ":'; ,: ,,;, .1 ,
    friendliness to the republican cause vvusprescnU-iliiy one of the best J.IIJMci.uis : 11..11I .
    in I'; theMid l. tat"I.f.J"IIIIII.lfl\'rillI"llo' "''", ;-. 1 .. ., \: :... 'J'" ; : .I. t i
    while at thesame time they have I'.ritisb this rounh3liir .\'l'al'allil is a rf'W'I I y ,1'"
    amid lying in Brevard connt.v. t"l.lldl.] : tCommencingut is Jt
    lur! '' f.e
    prescription. It is composed of the J ;
    dispatc'ies: rolled up ill quills in tonics knov\il. coinUim-d with the best best : a pi.ut' -i\ty fret"i.,.1"! ; .'t '" j (\5) I
    tILNMipurifiers. \
    i 1 I \
    their nostrils or hidden in various other art iu: directly on the North Fort ('a\rllllllitC'i1 "n the s.1> :s "i I I"": r '' I
    mucous i>\irfice dian river tliencc ill dparallel ,', 'j 0)
    run .1 w.\I.I1.\ \
    ingcniou ways '": Th'I'fl'c.t is what combination tin two inureilients .. with the ditch-s. ..so 1',1't t-i' ,r" > -/\ \> \. .\\ \\ I

    I Some specimens of the money sod results in :uring carurrh.produces:Send such, wonderful tcstinioni.iK ';j:!I north 210 feet tin nee sicily pan1' ,: 1 1j \I' I ,_. i oJ W \\ vY :.\J\ } _

    stamps used in Mafeking during the free r I Ij. .|j i the above mentioned ditclu:, to Indi.ti.. I 1i 1\ : /- _'_ 0- '-J :
    BICYCLES
    \
    I siege have been reeehed here. The .'. J. CHKXK\ ('o., Prop. Toledo. O. i i theutealougstidriveriii'ut:1'l' 'ri: II IIi 4\ ;
    ,
    ,
    i \
    lien ,
    Sold dniimists.. i i to the place of iK-ginnin. in M : I : 1
    money is iu paper form awl bears the : price i:;r. "just ty J ,
    Hall's Family Piils.1 ; township31. outh rauue 10 ca-t, ''- -! ,11"1! k
    following; u it ice: "ThK umcher (or the 111'01.unw ;1, fouracies with all riparian iiliij .. I $40

    noto is good for the tutu of U shillings; 10 TAKK con i.iii: ((IL. j j 1'.I. \V f 1:1;.,. I I I \ ( PRICE
    denomination | Collll! > ill! a I
    (or other and will he exchanged .
    for coin Nearly everyone knows" that when they arc i .\. C Dill r MM.I i Theft inwlittls *! '
    at the
    Mafekingbranch I' ; I
    .\Administrator 111't iiic 1 I
    thin there is 'Ld\ ": ,
    no remedy in the world equal| to !' I i ; i" L.\! rt t j'llft.1 ,'
    of the Standard bank ou the re- !cod liver oil to make! thl'1111t.ohy.. Yet tlll'n'I' John Hctherin,". i I l..Li Cf c.nr'mc.l.rut! ornj'I t,

    suuiptiou of civil law. The n note is nothing aaanist which they n-U-l more ---. -- ----- I ; \ \ I 1 UMtitit.K ti.nnt ".ui s< !Iota: 14 I
    I {II \ 1 I.I' till'll- ll.l.LR :!..nic lac: I
    contains a very artistic design, said to Proflll.tITluI'" were: a :great many way, Notice.All i 1.1, \ '__ __ a in bler 1 pi'e povit!.!
    recommended for waking cod liver oil r "'
    ph-jiv
    1" +
    Itadeu-IViucll himself.Amid .
    be by ant.; Amoii" these we would rut'ration pLicin;: itmcerned take until that sir in.nt a!,. I : wtN "lot the best RimHcrs ever hilt

    all the carnage; of South African a pinch of salt in the month !before and after after date will as administratoi ot l th< I' tj. ;.; tt.a- ,.. .." .u, ....., -. ,
    warfare the carrion birds have en- taking the due of oil.! \vrup ot Litter orange tate of Roswell '\. Iltndall. lat oi I Bu.i:, : .1 .,i l.trlt.:. r-. ., t','.1 .u .'t aI ,
    ,
    jojed a rare feast. The principal ofthese peel was also recommended. But now all county. Florida del'c.l:>c'c\\. precut: mtin.t., oa"1. J'I I. ; hie.
    this is unnecessary.! Scieuie has found a way account as such adiuiuisitmtor to IIII'II.-. \
    is the vulture, called by the Itoers: making cal liver oil not only plt.isant ill' able I). L. (raulden. iiiimtv .juiL-i! ..!( -1 :
    the "aabvogel" Their numbers have take, but to digest. Mt.ssrs. : and -
    ; easy Scott i county prayfur my tiual il--ch! '' p! i' I
    decreased greatly in recent years owIng H mue have: brought this science into perfec such administration. t -
    tion in their Scott's 011'hn'r ''
    Emulsion
    lessened slaughter of which is ( JOSF P. liKUWN.
    to the big H
    nil
    free from disagreeable I
    ::: odor, and' Sherirt'aud
    game and the settling of the country.aar taste, and already partly digisttd. i IV I This Du-ember 15th.ai ex-olficio A. D., l aduiiubtrtU 9l!'. E. B. WAGER, Agent, Titusville, Fla.S .


    ,J













    __......- ::;,_w-v., .,nrr;!T." ... --' ..;,:;r""w2u;'''-'''.;, .'..'.: ;- .",. '" '-. ..... ... a.-,....,;-.,."".- L w_ ". "" .. f, f ."W ..> ',-.. ---" >- ,........,....!;-.. _"" ... __...dt.



    S F T'sF-o.' -.: -j- _-e re' '-Ptz:',''; '.et- .,< .,- n .rhf iai'a .{....' + r tti J:' .'Jr 1a.. _ia,.'i; .'s k ..z's s''k. ; -r .: .t.. F+' .* 1+ .. f& fr3s&T .- i'f'- ,=-,>' -
    ;
    ,
    < --' !lh ...,.. I'I

    ." ,, ', .. tt
    ;

    .
    .
    ," .:.,
    'f.- .
    'J :


    THE :FLORIDA STAR:, FRIDAY, JUNE 8. -1900; '. :" -: 3., j jifx

    ., ,. ;

    XNIBIi S lrp PIRIS uPOsITIoN.Atuericati ( heavens In our'largest cities. The man I and glassware, wallpaper, watches and WHY WO hundred: 'bushels, -" ':Y:)J

    ; It of other lands looks at it and shakes Jewelry, rubber goods and carpets and T r

    > -!;"bTerroeaaFroclttm'- & "" > his head when he finds out what it Is, I rugs. You would'not guess what is the of Potatoes remove f
    Their Ad- not'In DR. =
    but he has HAT'HAWAY'CURES.
    his own country. I
    V vence'Yn-' anything most gorgeous and striking feature of t

    .: Clrllizatlon. halts: well adapted to Its purpose the French exhibits of rubber goods.In eighty pounds of "actual" Potash J

    SP iarcorrespqndence of The Florida as a public office
    Star; building. brief it is elastics for ladies' stock

    Here are charts showing the relative ings. French art has just laid itself out from the soil. One
    :PABIS,. May 28.-A pathetic interest distribution of
    manufacturing Indus-

    everywhere Invests the efforts of the tries and national and other banks on with these.showing Other gutta nations percha are boats content, hose Reasons for His Marvelous Su ess- sand pounds of a fertilizer thou'I'I

    ArnericanMiegro.to emancipate throughout the land and he,who runs His New, Free Book.Dr. .
    .,himself pipes shoes and coats; the French ," actual "
    from his ignorance and stand up a !nay read 'where the free silver and man's, eye for decoration rycnce3 like IIathaways methodof taining 8%

    man nmQng-Dlen. The white American plenty of currency agitation Is likelyto a hawk on the possibilities for high art treatment It is the is no result experiment of will supply just the amount -;

    who examines! the exhibit the colored be. By far the greater number of i lying latent in stocking elasticS' How twenty years of experience

    citizens of his have banks in the land are concentrated in a he beribbons and belaces and bejewels t, in the most extensive needed. If there is a deficiency .
    country
    preparedfor practice of
    any
    few large cities. Other statistics I -
    give
    maps them till the collection looks like a
    this exposition specialist in his line in :
    cannot help being of the great land and building flower bed. the world. He was graduated of Potash, there will be
    '
    touched and softened by it, or ever aft- association scheme, that favorite formof ai' ; from one of the !
    I have been from home so long
    away '
    er feeling kindly disposed Investment best medical colleges in a falling-off in the
    toward the for people, crop.
    poor maps that I do not know whether in our own the country and perfected -

    race. reminding me that the first hundred country pottery manufacturers have a i i his medical and surgical We have some valuable

    Crowded into an angle of one room dollars I ever saved was slowly accumulated taken up the making of the wonderfully education by extensive -

    in the palace of congresses and social i In the secure charge of a reliable beautiful iridescent enameling for Carly in his professional career hospital lie made practice.discoveries books telling about composition :

    economy the practical argument of building association. It is in the their jugs and vases. It is called me- which placed him at the head of his profes-

    the United States negro to prove not great middle western belt of the nation tallic enameling here, and the French sion as a specialist in treating what are generally use and value of fertilizersfor
    : that land and known as private diseases of men and women.
    building associations do
    only that he have it to such that
    is brought perfection
    capable of civilization This system of treatment he has more and more various crops. They are
    most abound.
    but that he is here and now civilized Here, too, actually in the wares are covered with a sheen perfected each year until today his cures are so

    and enlightened. The display comes Paris, greets the eye that brave old like a sun gilded opal. invariable as to be the marvel of the medical sent free. 1

    diagram, familiar as the family Bible ELIZA AKCHARD CONNEB.Starvation profession. "
    displaying how in one year the state of Enjoying the largest practice of any specialistin GERMAN KALI WORKS.
    ,.r the world he still maintains a system of nomi- 93 Nassau St., New York.
    ... ,.., Texas alone can raise one and a half cured) t
    never yet dyspepsia.Persons nal fees which makes it possible for all to obtainhis

    1 ...... .I tL rr times as much cotton as the whole with indigestion are already half services PROFESSIONAL CARDS. ..
    earth can consume in the same period. starved. They" need plenty of wholesome Dr. Ilatharay treats and cures Loss of Vitality, )

    What would happen if for just om fond. Kodol Dyspepsia( Cure digests what Varicocele, Stricture Blood Poisoning in its different ROBBINS & GRAHAM |
    Rhem atism. Weak Back Nerv-
    stages, ,
    year the state of Texas would try herself yon eat so the body can l he nourished jusness, all manner of Urinary Complaints ATTOKXEYS-AT-LAW, ifTITTSVILIE

    and produce all she could not onlyof while the worn out organs are beinsr re Cheers, Sores and Skin Diseases, frights; Disease FLORIDA. i.
    constructed. It is the only preparation end all forms of Kidney Troubles. Ills treatment
    cotton but
    of everything else that
    Office hours-l0
    to 12 a. m. and 2 to 4 m.
    p
    ty known that will instantly relieve and undertoned men restores lost vitality and i
    t or
    's
    grows within her borders? I Will practice in all courts state and federal.
    completely cure all stomach troubles lakes the patient a strong, well, vigorous man. j facilities for .J
    or v Special examining and perfect.
    The awful Vickers-Maxim guns draw in the treatment of
    Try it if you are suffering from indiges Dr. Hathaway's success I ing land titles.
    a steady stream of visitors, so many Varicocele and Stricture without the aid of knit' I ,
    tion. It will certainly do good.! B.
    you .
    or cautery is phenomenal The I patient is treated |
    that policemen are required constantlyto R. Wilson & Son. D L. GAULDEN,
    'I by this method at his own home without pain ci I
    rd 1M keep the crowd from becoming tan- loss of time from business. This is lKkiti\'cly tic I ATTOIIN EY-AT-LAW, 4

    ;!, da ::1 gled up. The company has a buildingall The Story of a Poem. only treatment which cures without an TITUS{ILLE, FLORID ?

    --t to itself, where its various manu- The man who used to write in a garret Dr. Hathaway calls the particular Opl'rltion'l County judge of Brevard county. Will prac. 1

    ,. : Ip factures are (displayed grim realness.It and burn the midnight; taper, though be 27 sufferers, 28. 29, from 30 and Varicocele 31 of his and new book, entitled'i tice in all the courts of the 7th judicial 'cir- 1

    is hard to say which is more terrible, received but little for Lis toil, still had "Manliness, Vigor. Health,"a copy of cuit of Florida. i

    the great fort (cannon 50 feet long and the respect of publishers, who held his be sent free on application. I DUNCAN-- -----U.--FLETCIIEK- i

    requiring several carloads of steel for genius in high i-Mecm. How different Write today for free book and symptom blank. ,

    its manufacture or the machine needle the fate of the writer tO ;lOnt..' of mentioning your complaint.J. ATTORNEY-AT-LAW

    them sent an Easter poem on which he NEWTON HATHAWAY M. E.
    that tires 000 shots minute. Looking
    gun a
    j ( > 111 prided himself, to a gloat editor. The Dr Hathaway;;{'o., JACKSONVILLE, FLORIDA. l
    at them it is hard to believe that 33 Stm ,
    great editor replied: r.rynn t ... ...ivaniiuli. Oa 1
    f l h life saving inventions have advancedas "We regret that your Raster poem )IFNTIUIer' ,. .....rrt ..11. M. GOL1 :,MIT1I, ;
    I
    ___ rapidly and as near to perfection as which is a good one, arrived ..Ift'rYl' ATTOKXEY-AT-LAW,

    life destroying oUes.n American had made up the forms for our Easter A Matter of Regret TITUSVILLE, FLORIDA.
    IX FRONT OF THE TROCADERO.
    however, will view with profound interest number. Can't you work it over to tit "''It's a great pity," said the man who Prosecuting attorney for Brevard county.

    chiefly from the government school at the stuffed eiiigies of the big the Fomth of July next-introduce a few has take u :i deep interest in the plans to Notary public. Will practice in all courts of

    Hampton, Va., and from Booker T. mules that stand here, heels outward, American Hags and a hox of firecrackers iUplies dojs."What's the state. .

    Washington's training school at Tuske- laden with the packed munitions of Or you might switch it around into i a Iit'r'

    gee, Ala. There are some neat tailor Christmas poem, throwing in a country 'That we cau't go further tLau tbl'nt A, I>. PENNEY, .
    mountain artillery, quite of the type of *
    made garments. There is considerable dance or something lively. If you'll do l't. prevention of hydrophobia. Just ATTORXEY-AT-LAW,

    iron and wood work, the Ironwork including those famous mules on which the British either, ju.-t send it on, and check will b" thu.u: huw much cheerier tnis life would TimviLiE, FLORIDA.

    anvil and forge made articlesas laid the blame of their defeat atSpiou forwardt-d." be ii nature Lad only made the grip germ Will practice in the courts of the jth judicial -

    kop. On my word, I would not When the author got that letter, he big enough to muzzle."-Washington circuit.JAMKSAXDKEWS.

    well as castings. The display is have believed that even an American lost his temper anti his leligiou.; -Atlanta Star.

    about equally divided between shop I mule skin could have been padded to Constitution.Neglect i I : ,
    work and farm work. A tine variety of disaster when
    OFF TIIK TRACK means great ATTORXEY-AT-LAW '
    look lifelike i
    so entirely as the ones inlue.Vickc.sMaxim i
    grains and vegetables raised the applied to a fast expre-s train. It is just asl
    by negroes
    H the short take Main
    so ollice and
    exhibit here in Tar- step many l bad when i it refers disordered blond or d 1'- address TibbaK Florida. ,
    on the model farms is shown, is. The very "cussedness" of the eye from a tough or cold to roiisniipion.Ti : r:11121.,1; 1\lJ11ldl. If aid's Sarsap.trilla puts the (dice at Fort Pierre. Flu, upon the 2nd and j

    ana it is only: truth and justice to Las been r'IIl'Olhll'l'll.tU:1I1 ', beforeI early use of One Minute Cough Cme. wheels back on the truck by curing the troth j 4th Fridays of each mouth. ,
    say that the one colored man who has Pl'l'Wllts consumption. It is the only bles. Notary Public, State at Large. 1{
    bethought myself' for the moment
    charge of part of the show appertaining harmless remedy that gives immediate Iiuli ;f>tion, nausea are cured by llouu'j
    his where I was I found myself shying rt' ult". It Hires"sill throat and lung troubles. Pills. I F. WE1S1J,
    his
    to
    race got agricultural exhibit -
    away from around the heels of those Children all like it and 'mothers ATTORXEY-AT-LAW

    ready and in place before the mule ('1ligl(' Fact. endorse II It. Wilson & Son iTirrsviLLE. FLORIDA.
    great United States, government had as I
    In the "Street of Nations" so called, I Will pnnticf in the courts of the ?th judicial

    yet unpacked its tin cans., where the headquarters buildings of A Good \ntnred Reformer. Kodol circuit

    The best part of this exhibit is the ,
    ----
    -
    -
    each --
    t country exhibiting have been If I was toretellin the weather you bet

    charts educational and otherwise, erected, the handsomest and most artistic I'd bella\l' in a way the most ('uriuus'I't"' 50 YEARS' 1
    the advancement of the colored I'd all..is anti J'J in and break
    showing tear up uiy | thru
    I. is that of Italy. It is a beautiful EXPERIENCE ,
    In the We All the in-ilrumcnu used when tlu'mcillhcr
    people past generation. structure, so; fair and sightly; that it is sharps male
    from of charts that there Cure
    find one the a pity it will be destroyed after the Obamatii'iia. I'd ju.t predict sunshine and how Dyspepsia

    are now 7,.oO,000 persons of color in season is OUT.Suggestle tn I

    the United States. One chart shows Andmds with caresses for languorous flowers.Of II I
    : and interesting beyond Digests what eat.Itartilicially(1igeststhe .
    course tlurt'U be blonliShkh our paii.ncewould you
    the progress they have made out of the
    must exhibits is that automobile \'{'- let and aids
    darkness of illiteracy; another their But I'd be cheerful and fur the best food
    hicles. They are of all sizes, from the etulply hope iu and reconstructing
    stientftlieiiiiitf
    steady gain in the ownership of farms l1\atmc TRADE MARKS
    greatest; truck, half as large as a railway
    If I was the almanac man, would try the exhausted digestive or- DESIGNSCOPYRIGHTS
    and property, always a test: of success car, to the little autocycle for one. fo ilian'e the anuunt of the years as they fly, 1 gall It i is the Itte discovered digest- : &c.

    l and aspiration. Most impressive of all, From I'ranee alone there must be as InircaMM the sun ut our ImiuLij j '\s : ant and tonic. Ko other preparation Anyone sending a sketch and description may
    howt'U'r is the diagram with Anti lI'olueill tl ,. hours uiiiili dun' I quickly ascertain our opinion free whether aninvention
    : great : stern 11I1,1.\| > it in etliciency. It instantly
    many as :>0 different patterns, many of Iran| approach is probably patentable. Communications
    ingenuity arranged to compare the 1M dfbrate Jrisliuas 'Unit four (unit's a }ur, iclievesand permanentlyairet i strictly conttdential. Handbook on Patents
    them with kerosene dribbling from unseen And two Sundays a week on the books would ap I eent free. widest! acency for securing patents.
    present illiteracy of the American negro tanks somewhere in their insult's l>t'ar; Dyspepsia, Indigestion, Heartburn, ,, Patents taken through Jlunu & Co. receive

    i with that actually prevailing in upon the Hoor of the hall. If horses s'pose that tlitrcM soon be the Uukt-ns to [>aBut ,. Flatulence, Sour Stomach} Nausea, tperial notice, without charge, in the

    I other countries. Wo iiud from this I'd liaise things a heap, if they'd bite me Sick Headache Jastralgia.C'ramps and Scientific Jlm ritan.A
    lc
    ::o\anything at all, they must rejoice i .
    ion.
    lily wry all otht-riesultsof i imperfect digest i
    the
    that today in proportion to number
    itt the steadily increasing number of -Iu'hal1e handsomely illustrated weeklr. Largest cir.
    of them American are PriceMV.and fl. LIreesizercutsiuo2't.limessmall eulation of any scientific journal. Terms $3 ayear
    negroes autot-arrlagcs: in France, for nowhereon - --- :M/L- JtwkallaioutUyepcpsialuailedfreePrepoted : four months, fl. Sold byailrewsdealers.NUNN

    ; much Irss ignorant l than the inhabitants the earth the The AMiite :Man's r.uruVii E. C. DeWITT & CO. Chicago
    except among Tagalus: by & CO 3sIBroadway. flew York

    of the I'nlknii states' of Europe, of the Philippines hire I seen horses so i is usually !!indigestion, vvbirli!! meanno :-.4.1| i hti., U. Ui j ".'n i\: Son. I Branch Office, .Z5 F St. Washington 1>. 1 .

    ' which have had their chance at being hard driven as here in Paris. fly the :ai'jictitej :-!hwhlt.uc.>. Suitability I vveatiiMxof ,

    civilized for a thousand yclrs.Iore- ; Imdv and lir.im. l>r. Loyal Ford's
    way the French authorities are much I have used Rlpa&s Tabules with so mud1uUaIla1I been a great suCerer from conttlpatlovforoterfl
    i over, this chart reveals' that the colored exercised ill their minds as to whether \Ih>pcpticiie! i i- a new and (perfect cine. faction that I can cheerfu.ly reeou.ru,nd ti.em. eyt- .,9. :;..i icg give u.o sty relief.
    i people of the United States, arace It aid-\ th_l'tilln, tones ami regulates the Eave been troubled fur about tliue ear will My fit a.i.l l.s &ni abdomen were Ll a'ed sa
    an automobile is a he or a she. The what I called tllloj attacks a..mil'!B on regularly I could n..t \vel' -oa u., feet and only a IJco
    i -tomuch. II. I U. \\ l'OIl A.: ;dun.
    enslaved and forbidden by law luleuf municipal council of Paris say it i is :lhI' once a seek. Was told by itlileient i>..} nl.ius drew 1 caw It.pans latiulea alvertlsid la our
    reading and writing until 8l& that It was caused by b.ul teeth of which I "iad dalo puptrlnuht-omeamitookthcmusd.recl-
    because it is a n'lti.-l The grammarians severaL I had the teeth extracted but the at elL Have taken them amir.t three! weeks a:id trier
    leafs ago, are today only the merest 011 the contrary, solemnly- To rrlKhtrn 1t-t'1. ,.lcloll'OUUIIU'd. I had B'l-u adtrntsrtueuta < fUi j Is >ueu achu.gP! 1 aa! rot ('on.t:1! ate,1 any more
    shade more illiterate than the population To Keep the iiirkel utensils ol the |>.tiia Tabuieii all the papers l.ut had! no filth and I c">> U ail tJ Klpan" Taimies. Ian thirty-
    lirm that it is she because it i is
    a
    a carriage In them, but about ux weeks since a fritnd induced seven years oil h.t'lt no occupation, only my
    of Hungary, a great nation: reckoned / which is a !she. In a language bathroom bright they mav \lie rubbed me to tr) tliem. liana, :" bit tau of the !.oui,'hold dutln a d Lursli.g my sick hu-baiid.

    the most putverfululd capable partof unfortunate enough to be without a with a !uiltmade fl'tllll'hitin and small 5 l'rut.11"8 of the Tubules and have had lie has had the dropsy and I am trying Utiaia
    no rpcurrence.f the attacks. flare never given ..1tebtimonial I Taituie-i for him. He feel some better but it will
    the Austrian euipiie. Certainly the neuter gender the same dim'cnltj' is liable lard, mo.steiied: with a little alcohol or for anjtUiu efore, but the tr>at take soma tin:e. he baa been Me; O IOl.g You

    colored !,:". 'e in America; little as it to occur \\'ill1l'\'I'Y new word introduced. ammonia: Aluminium does not readily amount of good which I >>ret'e has Ieea.one me may talJ my letter..n.ll1aTl"I: you like
    by K:|>ana Tabule In.Iuctme to:1.1,111I111" to the ilri. dour CiOUMll CUIL L
    I sometimes appears to have done since tarnish and i is easily kept bright; many tentlmouiala you 1.ul.tl" hl\1I In your _

    i emancipation, has every reason to I mii-t word my conviction that with whiting or with any of the tinepate POII.s lon now. A. T. DgWiTT.I I have been suTerlnif from headaches e'.ev

    i thank Cud and take courage and go there are hot elsewhere surd graceful.ITALIAN > ii-eil for silver! .\ domestic I science since I wa A Ultle t>irl. Iruuld Lever ride: ins
    ,
    car or g auto a crow ahead.I Strangely t enough, some of the teacher: sti ::e-ts ill this cUllllCtiff want to Inform yon
    : : In words of hlkht- '" 4a,stititia44a4tes--aeau.. ;1 \>It Lout pelting a
    ---
    more thoughtful of the race believe that in closing the house for the praise, of the btucilt I -i Ir' headacheandalckatwyI :
    btoiiiach. heard aboolRlpanvTab'drs.Ianta
    that the dNciplinc acquired tliroimhcenturies A i' summer it is a C"od plan to cover iron Lave! derhed from '" !lto Klp<>Tahaka irom an

    : of slavery' bred in the black q 6 III \ :iml steel :ll'tidt's. that will not lie used profenul.'iiiil i.U'-e and d: !I AIn i aunt of blue who was I
    I. \\fli.\ .. U.
    ] clear ) taking them for catarrh 1
    thli profession
    : race in Ainetiea the patience and perseverance 'n ;, X for the setM n. with :l thin laver of bead U aiw.iys needed.Kl + tJ ,1 of st.niiacb. She had

    necessary to enable them togo \"' ; .i...11t&rlL I vaseline.: ;>ans Tabule! does It. ot, 't found such relit: fromRIPANS
    and accomplish ci\'ilizatimi.Well I' "t'Jl'4'A' '' 'iiti;: )\ ," jtt-r..n" tnycawsl .'ti : I The modern stand- tt..true.headcsedme
    on ; .
    .f
    : \ sdfcomplettly ; 1 tutbUo them too, and I
    if there is anything In discipline \ ,' N.N "':1 n.\I'\\1I< ) : sill tltl nevir lit' neglected. rund..wncllll.nlllo .ot: t:; and MecliCures ,;. hacelacnduLgs'sincest

    they have had it certainly.In p.llk 1 f'h)J 'j ). V :1' u", I. It means ki ,
    .,IH' ", .jYi, Fh. n., S1-* Newark I nay they hate complete.
    with; the coloredpeople's 1 allnNvcd l to inn too li>n- will ie.-ult inl' ;
    the same room M"af -- ::, Ave.,Jer&f} fit), I cme : thecommon i iycuredmybealacbeL
    exhibit is crarnaetl! the whole 'I'i t 11; nT I11"t" b J i'1ail f. -" I ri'ht''listat-! diabeteu or l.tllt'I"l'l i"l1- K'.paiie Tabulea t..1'I"j 4 Ii I sm un 'J' I am trDty.wD' years

    United Slates contributirii to social htlJa... w ]r. .rtill!, ,ij t ,im amd'Iftt'lI i.ltd! c nupl tints. l Tolev's hu,tIIo t- grand MU iEC.IS refill's.: wigD:"' L '1 tJ I evcrydayKothcr t,I.. to old.use You this are testimonial welcome

    and economic science in the shape of :1.D ---- '\' Cine i giurantecd for khlilt'di. >- :1 > I! I'4 Mrs I. KOOlUltU.
    j\ older. n. I IL WiNou l tv :'tnl.'II.tKE I .11 of humanity
    t\llII1it rallls. Not '
    photographs, charts : wa troubled 0 J 4
    - t, .. -
    one person in :;0 will so much as sea 1'Al.Al'K. with heartburn andsleepieesness I .
    and IN1OOTK IIUtS caused tylotliedtion tU tAD, {., :. Sly seven year-old boy
    them, jet hero they are. witness for a good 4 sutfoied Itn I.manl' .
    paiua
    handxinie and well built cairlages as Allen's F..I-I.:; 06
    ; ) 1-1', a |M\vder. It clue ; Z it
    evidence of the mighty forces, Ilt''pr"biJlit' eara One day 71r Lla bead e..nstl'&U..aIbe
    '
    we mamif.irturc in AulericaA In tl.e exposition pauninl11larting -wollenleetand ingiovxiiig ; ear a testimonial: of': 0 h > aud complalnei of hit
    ohsener. that .
    to the surface sina II 1111I1 tt'I' of the :lIU' \'mcairiap's luttU, and in-tuittly takl-'tlw'tlllg"l\l In the paper ladurj.cjRlpana -i. .> It..m..b. Ho could not
    move the human race I'rom the great nfcitriN and hu1jo11It's: thy Tabules. She .. _. i* eat lia.0 cMldren of his
    of 1'r.ince h1llln'll.lr jcars ure.itetcomfiiit d !t'rmlneHOgtrlllhrm. rays I a,;e do and what Liil
    urance and olixe orchards of California there in show how di-covery of the aje. Allen'- a trial, was greatly L "-. .-. "I < ;j. < 1 eat did not ape
    old to .
    put part ... ..... ,.* 9.i41Y
    the pineries of Wisconsin! the cotton : Ff it- l-i-e makes ti:!lit or newhoe- I tet"I i relieved by their uie .jviWY vU with Urn. Hewaathia
    much lighter; and I better the corresponding and now takea the and of aaflron color.
    of the south, the tobacco ea-y. Hia i certain) cure for sweating
    fields vehicle of tod.iy is.: There is ; Tabulea regularly 8Ue keeps a few cartons RlpacsTabulea Rea.lln? come rf the tfc!montala! In favor of
    Holds of all over are photographs displaying ; callouand lint, tired achinp; feet. Tiv' it In the house and aaya bhe: will nut be without R, 'alaj Tallulltl. I tried tiitm Ll.i..a+ Tabules not
    exhaiMkvs iv.-uurccs of really no very great impro\cuiciit. The 1 01 lay. SId I LJall dnii i-t- amid 1 -fme them. The heartuurnaad el'el'lcs"UI'5S bave only relieve: but actual/! cure.1 u.y youngster,
    the beautiful and perfect French coach -tore.P.v' mail for 'JVin -uintTual I disappeared with the InJI,.'..,tlon Lich Will the heuJace have diaapg-eared welaere la
    our mighty country. You turn page | formerly so great a burden:: for her. Our whole good e,>&>.it.i>n a.d le t:1ttor complains of hU
    about after them fl', .Aildic! Allen '
    .
    wonder horses of todax drag; nacka.'e : ilimtedI.e family take t'.e! Tabult regularly t'lipecl..Uy! aver stonncli. HeNtiow a red "lIby.tace boy. Thl
    after page with ever growing dUIIstI1i1 heavy looking carriagesmint toy I :\. Y. a hearty meal. My mother la fifty years of aK-a: wonderful-., e attribute to Klpaaa Tabulersad
    and admiration, and you leave them' ; themselves -- -- Is enjoying the: Lest of health and spirit ; also I am -:trifle i t1 at they *lll benefit any one (trol&Mta
    handsome > -
    1tllf0 a they
    strong within yuu hearty meals, an Unpossitiil.ty: let ,re >!be the cradle to old age If taken according to dint>
    with the impression
    are The FI'l'lIdlll:1\'l' improved F rOr FiftyVrars"Mas. look Klpanj Tl bulel. ANTON U. DL..ZS. tions. >G W.l'UtL
    that the citizens of so highly favored a \\"IS1I.U".1IIIITIIISG svurphas been
    than their vehicles.A .
    good peopleto their hi.l'ses more med for over fifty tears lij iiillltonsof mother-
    country ought to beery and for their I'hlMreu, while teething, with
    be worthy of it. Uastened to the few minutes upon that queer MICLI"Itsoothe- the ihiM, "Olt Il' the peifec'fumsal.iyHll A new ttyle packet coctalaln,: yes RIPASS ttpn. a parked a paper carton (without glare! )It now for sale
    uncanny movable' platform railway and p.iin.c'ires w Iml colli, and tthe J>",t .4 tame drug store roa riTg.-ENTs I.--: Ir.era sort u. intended fur the poor and th.economical. OM4oua
    wall is a small but quite natural: lookIng door of the Palaceof remedy bur Diarrhoea. \\tlltelie\e the poor of the fltiii uorious da labultt c..n be had by rag.i by HS LJ foryetfit: cents to the PormCarwciL
    model of the iron skeleton frame of we are landed! at the little sufferer Immeil lately,. sol.l by UrusB'Nt Cosri-fl. No. 10 Spruce Striet..*.ew Y,>ri-or: a single carton ITEM IIBCLES will be sent for fl..cenaT.IIl'1.U
    In every part of tll world. Twentv-flve
    lh',1I1wlI1iug
    Industries! Ilin'I'1i rants
    of those 40 story buiKlinss, more DiuTsitied a loon It'. He sure an.lk for "}Ir". Win!!. 1 Kipun may a'30 tie had of come Grocers, general rtortkerpt n news agents and M sums 1Iqlllll Racy"
    one iu this case mostly pottery 10w'I! ::;ofllhln!: syrup and take no other kind Md Utrbw shops They lnlih pala,la'uoe tecp ant prulot Uf.. Ou gives relief.
    or loss, now In II1'OCl'ss.ur soaring the








    .

    I
    c-">=-
    .
    .:.-
    .
    ';JL .' '



  • Full Text

    PAGE 1

    KodolDyspepsiaPIIUSUPOSIIlDHATHAWAYSumtutyit-pdiTWOAd-Socialcorreap9naenceCURESJlmericaitCureScientificallotlitiicsultsonniperfcrtlio1aIialiutilginqalalulhICIfreeesL1islOVeleIcligtst-antWHYAlTOKXEYATLAW-TiTisvtiiKCo3B1Broadcomposi-tionpeniiaiiontlyfallingoffexxrydayl-fihumanityDigestsRIPANSllliteraryInotbrreverywherefoiuiuunlrat-liiiiHsirictlycoiitliloiitinlbushelsfertilizers-forcon-taininghundredAmericanPotatoesatltnhttiullIndMrcnntboiiiiiCthoVickesMaximpoundspoundsmanufacturingATTOHXEYXrLAFamilyficiencyT-Washingtonsiroreilal1stingessupplyDRno11risht1-whiletellingFLETCHKK-ATTOnXFLORIDAthrouuh-riMiturirsfertilizermGALLDKN-ATTOKXphotographsl-IhrpeplirulecoiKsnmptioniiroparaliouphotographsrecon-structinglttluttTahutriruntanenianelpiitinneightyGltAIlAM-ATTOKXFRIDAYPROFESSIONALheadquartersover-SugnotlvoImproxcmrntVlckersMaxlmpreparationHATHAWAYvaluableappertain-ingcompletelyEXPERIENCEliatnlciuccorre-spondingemancipateJACKSONVILLEenlightenedpossibilitiesindigestionmodernliidigcstimihoius-clvllledMUNNthroughoutautomobilepruhltblyutteiltablelircerarkersV-OrImpressionexlmustlessiiiiligestiniivariousmanufacturersagriculturalwhathydrophobiaivliovesandaccomplishdyspepsiadistributionreproducedJUNEiaCrampsneededItifAJO-CBKXicaiCovrAiTadvancementPhilippinesproportionconstantlyenamelingconcentratedClIFshnildNKtjrwrMarvelousmanufactureTheydigestiveirrituUilityimpressivedisplayingeverythingconsiderablePotashvegetablesenamelinggovernmentmanufacturewonderful-lydis-playingconsnmpionindiges-tionMeili-JiDyspepsiadestroyingInterestingWashiugiouCuresapproachownershipremindingglasswarePotashoxbaitstedexpositioncivilizationphenomenalNEWTONthoughtfulMIOKS-AlKnsViliiUtVSuiprevailingper-SeverancegenerationAlltnl-MMiilliassociationsIgnoranceaspirationperfectionSTARgovernmentof-auloiarriaconstrnotediiiriviMuxInvestmentpolicemenshowingdisciplineassociationamountgram-mariansactualmunicipalpopula-tionbethoughtConstitutioncnssednessprofessionalaccu-mulatedHamptonactualcoirrihuiiiclllciencymanu-facturesCOPYRIGHTSTITLTSVILIEStrangelyanythingunpackedbecomingautocyclevvcutltc-rOlMTatitMiaunfortunateimprovedin-stantlydisciplineeducationalplentyYATLAbooksassociationautomobilepreventionperfectionami-umannyexhibitingdisplayedbuildingdisposedAmericanpowerfulTITUSVILIKhandsomestIleadatliccertainlynathaxvaysinstantlyagitationi4fCertainlycongressesrequiringProaeciitiiiStarvationexaminingciviliatiotiingenuitydecorationTriceMVanildiscoverysometimesdestroyed1AlAlK-hauiKin-cludingdiagramspracticalbuildingplatformpreparedTrrrsviLiKprofoundlanguagePicpuicdbyTrrtsviLLEsomethingwholesomeintantlyaboutsolemnlybejewelsrequiredterrible-thearrangedpineriesinventionsdlversllieilYorkDlmifd-leauthoritiesacquiredanythingcommonltlalCabuawjustiridescentditlicnliysweatingcoaktlpatl-omjiiliriullythem-selvesGOLDSMITHActuallystockingbuildingspatheticactuallyshowingadaptedapplication5lsruerttaetcwinhabit-antsartilleryHathawaysCalifor-niasomewherevaluejewelrygrowingappetitebuildingbuildingifjtjlUihandsiimperfect-ingNewFastenedconvictiondiagramtrainingstandAmericanintro-ducedexaminestvUbaUeaargumentcastingsIlliteracyCrowdedUQuurlRotaa-dad1KNNKVpeoplespracticeItauil111ttmentioningmunitionsIndustriesbuiltlngsbeautifulTnualus-ofpatiencegarmentscarriagesactuallygracefulReasonsneecrsarytherecropsComplaintsbeautifulmartinibuildingIcnYAroldforbiddenHungaryotherwiseEYATLAvvraarT-itlruggiiclHlMicdeconomycountriesStomachorehirdsborlbbouscollectionmeaningtherecapableexperi-mentadvancedmidnightshowingstrikingremedyremovebroughthristmaseconomiccountryhalf-timesproducecertainlyinjluntprofessionsteadilythousandersitiedSuccessHliemiutlsmdiagramsanddisplayinterestentirelyAmericanelsewherecountryliupotcttyAmericanbMllifuulitmountainusuallycomplaintignorantxvhelher-anlargestarticles-asAmericandarknessequallysoftenedenslavedIlathavayundertonepropertyperfectedevidenceparticularWiloncarpetsrapahlcdUapiuarfdWashingtonGERMANIronworkfliail-nortHurrrtifntouchedcurrencygoods-IndisplayHathawayllathuwayANDKKWSAmericanduiliestifttttavktuxmliivAnciiARDhimselfheavensAustriankhtneyllObltlImakingspecialistfeelingyouprofes-sionhavegenerallyoperationIVMUUVIHNeglectwatcheslikely-to1900companyMiiiliiiMtlattisiiitleralwayscivilizedpaddedprcvciitsliiiiiifitlilftydiscov-eriesexperi-enceskeletontroublesperfertfromnationalsoaringcontraryslaveryvarietycalioiisilliteratebeautifulhundudreckon-edTHEluiniuiunpackedFrenchChildrenmgltI-tdiMirdervdperfect-edcitizenseatoutwardcarloadsworthybeyondspecialistiutrmluccYATLAhoweverAmericawhethergorgeoushappenrapidlymyselfcontentclumsythoucropKuropepracticenowhereAmericaBook-DrLook-inggreaterharmlessmightyTwrutvrtvenumbermachinepalacegrad-uatedPoisoninghowexerexhibitsmyselfrelativereadingIlatutbookoiiempireolligleskindlychieflychargebetweenhundredctrriiiieprogresscoveredXerv-jtisuesspracticeprocessacliiugAmericaenoughfavoredditTercniheartburnfamiliarOneCONNEBspecialistkeroseneobserveruetrrglvriiujusticesightlyWORKSIMpani-TabulipeopleplentyexhibitfavoritepouncesgreatesthewhocomparestwtdyVarlcocelebelievedperchaluljihtysavingTItOCADEKOpublicelasticsDESIGNSmostlylookin4More-overtiiilhiiipeopleNauseapnuticechargeshyingATTUKXcoloredPOrtionsgenderVarlcoceloThewitnessVarlcocelexvrltingfamilyInvestsnaturalpeoplebordersFLOKIDAnationsgrainscountrystonVcitixensendorsemisiutisjudicialReformerhighlypeopleFLORIDAelasticsNatureslowlyFridayst1calrtuuishakesFLOUIDAFrenchetllglespossiblesltrplerlsecxliihitssteadydigestJiewmlfMlemtobaccocoloredalreadydividedcountryNationsUnitedcar-riageCoughmaintainsInvariabledrilihlinlook-IngschemelljrhtrrrepliedappearsWilsonaboundstructurecountrymy-luuMteuldpracticeJasiraldifferentrubberFivuhFrenchSpecialrejoicenumberxvondcrfeaturesymptomattorneyroainossFLORIDAhospitalndwUtb1tan-gledleligionHrihlOOFLORIDAgildedcountryYEARSrevealscineKoUxsuuinluTfacilitiesFLORIDAreceivedin-ItCKbelacesclusintChicagoXVlVSloXVstreating5ipresentEYdAffreeehteriertreatmentcoloredpotterycomfortperiodstarvedgoodscertainhrraiicluiauseappliedtiiiiiiuliBookerseveralpotterypersonstfelagtreatmentcol-oriMlvigorouseffortsulitiiuFloridaFrenchTnliedpracticein-MKXTloNDUNCANtowardbelievenlcuhultrlhigft-ebeingcoloredallowedNotaryStatesamongexhibitMinutelxrbategrNotaryeasilydigeMeducationepannUrinaryCouutyemuyhtitir11arubbertreatmenttreatmentMauliuusralkanvisitorsvariouswithoutbunionsFrenchliaehertfillutotilwillInltedrailxvaxnumberMARKSwilltfxlliniiiilaUlifelikegreatscol-oredcinilainiVeuri-MUSsciencetreatmentAtlantamiddleattentionminuteWeexhibitIuntwruuil1JKOUunreallyerectedgeniusthoughfatuousandher-selfprillednegroescollegesstomachangledollarsstuffedvehjlevehicleliltingoughtaikaiicCARDSStricturehintMlfrail-wayhumanSpiouchartsWilsonpersonrelievearoundshapejMitienttrou-blesve-hiclesju-dicialmotherpatientvisiblesmallsueVtllhIeIeilmauavnnnalicbrtirfuilyFrenchtarnishrnitedlandedchanceFrancebelieveFrancebolenum-berSoothluuTroublesexhibitFrancecountryllilhNLiPUHlunweaii-iiesuffererscitieswherereadyor-gansju-dicialrliti1111OtherustlertioupipesPotmomentBrevurdwithinPalacerillduikiownStrictureaheadeoumilwesternprivateUrevardlargeneedlesouthtrhlftlutTintedKidneyof-xiseltodayschoolquiteinterestschoolpastesfurthercourageVitalityTRADEaccordingtisticspublicHrifihtsgiveconsumeenablearoundOtherwouldlyingashsoilbanksresultsflivicriiiiloncountyStatesrfKularlytxvuMtlonmodelwithindisasterlImtlvsomebanksbusinessTuskecauteryheavytodayIn-terestrespectTihhalsDiseasesyoungsternationltelretliablechartsarrivedniirillaforgoluiulitaddressStricturegreatlyex-hibitlatentguttabeforeircptEasterinsidesconthar-tisticquiteWhatsDeWITTIrasummerr1htsttcrowdvitalitynationFloridatwentyn-MIXKishownplacesiaiujdif-ferentcoononilcillandsTexasflowerFourthtinlaXplacedsliverwhenladlesnvordthedrivenorgansnomi-nalWlIL1JLgoodFloridadiseaseseatiltfOllttllUluisentIIIIttKCtI1calledchartscannotcruwilcd-fisocialTexaswhirlorangestreammedicalmodelsullenraisedswitchformerlysmallthestandtrou-blesdefeatIu1iutserviceswholeawfulwhitesystemother1IearlhorsesMasterlustermethodsurtarcKodolmedicalmulespaperwherecalledshowsothermedicallayerTherelooksStatesfederalthankgrowstemperSlaywouldthewithoutmuzzlewhichELIZAfarmsshadewouldsystemcoachyoullbeforemightindushorsesframeofficelargewhowhichlargestwherecountyhawkluttiMiij-tIairestoresStatsjudgelivelywhichwithouthunlllluTherewhereaboutexpresshoeseditordettrtnlDoproveTheytodaymethodthesemullsITALIANblametotiicnegroLargethroatuilapticshorsesRsaltnaVe-HndonlySlateshordesxioriMNOttXrrlycuredJAMKSStreetsheencitiesroriliiiooutiilettenjoyingwholenuchInstotherauthorUIIIJlOwithoutnegroniimiilitselftodaxxvhichplansgreatsavedMiutrfnlotherTherethegoodbeingmakisshopmerestSlId11braveWhatfoundpalletcottononlyiticktltailorttlrerforceshighchartsirtilliiiMatterHiIdsbe-afarmsm-KtpitUtgarretxvouldgreatgreatstandHooiitallicnIrltlJtirstroii4keepduubtlrdwhichItalyguesstreatedboatshcartturnaloneladenlongcannonmarvelpitygreatiiiderFreemadeeitherwhatyearsCiet-ti1jtiirtrlHKiiimestrongvtmi-rjduncetheyhousesuccesstakenHerewheelsentitledonlycottonwritermanyrxtruttemadeAllenInthlcir-cuitstockknowlooksmuchwhichiUtlliHttiMi0rundvmexerilmindswhatlleldsPariscouldthoseyearsMcicittltlclungStoryaboutqueerclimimouthHtlliSourgiveAvtterlkiHJlaluuimeawayheadEnjoytiuymademuchalonehometnnilfHoodscouldgreattighthavecouutrveditorneuterwhichDUeostleavechartTnil-lIuilaetktgrimJugsNewgivitefindsIngscheviittlafteranvilworkstagescltlMniiopalwouldatrtitvlhurtmapstheyTeUlipuhlitrutheveryBibleearthshotsstii-MiritJuxMonlylongsejismihelpplanWKU1ScheckmanyWUWIIUcot-tonfhljlI-MthemHowEarlytodayyearsIrointhemThemuchPublicmanytheywoodtheremapsat-lirmFromKALIworkcolorivMihHerorfUHilytodaygreatmuchprinlictshowgreatblackheelsbriefBraindilutionthemknownjustdrawmanyIiereehalffoodtlirutizhtcidrcci-ljnunutlonlycoatsshortmuletanksItlpaniworklearnreasonnotstorythosetruckVigorsecurewIitlluTeverythertilingsHoalththemlluwcr-UithemmadegaintiUIIkillItselftheretheirhavefarmwhatstatesinvciitiinitifliarrayWhensinceHllalUtheirSki7282courtswhichuponhayseasondfcjiesteemCLARKlia-bleririhtakiskepthereBailwiththereafterelua1HlpftnKrocstheyaidsflumethoseHagsfromrolllieerelievedolivemuleliuj-fimilntt-ermijtiltTjirircstbatobtainregretnlIIIIIlittlehavehaveetionitinVrrrheelshaveingrNiwarktircilRipontheyIowformmadegiUmakesJulytriesitMstctmgxvriteParisllttVeootAlBladirefromfromhavetheirfromTrytl-liinlwaresricerslandthemthemlruiiifiiisneedtipiitloitmansoMIdrtnwithoutquicklyafterletterraisetheirnailMustfromhaveLAwtheirWelljustformsTalul5PoemiIugstaperreliesmostairitstoolhardbeenxvithTheirpigeleavehaveNassauFUONTturilitKthemthereTabuleltrrnrtliireHTUitIatentapartParismannerIMXJIhavegrippcsuchatollpagethemreadlandTubUleivxcatlurdiKrandhaveititrihuiixxordhoursgoodweeklydoneun-seendefromMititSIlftyltilttmaywallfilthwhichcomesnatureonlytiltoiilolittleTahuleawithuntilyearIntelhosewithfromTibulileltilherewithhavefromfromuponwellhavethathighpastwingwardwithTilegunsulltrlyOHlcerugsviewworldinlyne-groTKACKPAnpoorthatfromtheirATTltcmllniWMdoortitleshomewhichtartlythatTubuleTamlfitheirgreatLiremadewhichLJLUictTtaluTultulinsixeswithherotypeyearlandtcBrrilthatwellwallsuccesskUlfxtfvloflittlelltilllfliTheSohlWeakVOfKandfromstatenailsUtunzohardtautKIUIhrudacsurrllolittlMIruupoempoemwllllltitlieeOt-AuiennlwtystepAnvononeverfrombeenhardThatIllsthatandworldBloodtroubledmotherthatthantheirbeenbuiltexten-tusidformsportreceiveofherebeenxvithwithlundtltrlillcourtshalfthanwithlUCircr1atsJossuchyearsTatiuUthatstateheartyblankRoodItHillllThemostWritulloorbed-IovoralTubilrsItsveryIudwithwithdillstreatswhoIJruiichpoemuI1SIIthatthattoedpityandworkgreatxvlthwiththancoldoffreethatbtMiiniliafterniuoirjtakeTIllHisthanStateFacttrainYouiiiuiiHoxvmothtrthatteinlTheandneverintogermthatUttliirBINStntckruriiiwomentiresheroendiThefirstthatkopvvhiiiQwfljllilondfindthatutualaandawlvasescourtsTubuusefreerelitvtresultxiryY-FortakesthatthattakesajmchnruCthatofetuldIcorrtlwithoutMainskinTheandlaugreatthatlookjiirctiryTheuUrlypartthinroomandcovercareerforIu-UuctnlIxUatfverylirelilUIIxUrthowMiuiburnfewandlikeAttncttearlasaandThethathalfpratseHurlsfoodsomemoveandandonlyfleetchandlaidlikethatSVKCIcourtsandtrjlagThehalfsHxilaJlluandandtrNlblshit-sittesandWith-outwateotncartonstheStarandharkIntermandjustandandhatulacatarrhutitMttttdutyusedtliattiIftttlllflbeltmustandpacketLlifiedrJerrtiifUitStarthatThelollthis1111tiandandlikeundpain9dJtl-lllltllwellyourJustmanowntakesandandwillUultMAMnaustiiadvloeandthatIronthinthatYoubuneuLtuuhcrsofhanetuthisbestblluotanilmostSoresulichsoURkirlnullandandunitandandyetmustironanyheadmvcrthirtyTbuluTheilrsitthaiarehasSonwillandThewhoroomandamibutandmoreandiindlessanilandthatthatsameoccursnorebigmanracecudthisandWillstatesameuntilandl-KtaitshimhealthlUllInilrThexvaysatTronINTttThehadandandandanduponantinodandladamiandtheneathowyonto-gotillOverbaalandcrawlandironwhomeanicvuuniirrwermuarhKi1-iwhatandandandandamiainiMiuitratedwhoThemostworlilDIRHV-hewillwillelseWillandtionsaypurandfromwhatUleailSthatTLcultinlmostyoufeetlaidhailtitsandliinmostOnethatlifeByotherextenWillcopyxvillmorelikemustrunslhtthatbiukantilinethisthateantas-wethishasthethellritandantifullandIMrt1stilltherimeSuiuiulurltausrdmoreTTISVSwindsliottlfUtcolltgunheldeevitIsetoartinoaintllofIMsitufnIMJt-InUUuslvbitinlofoftuAofofitrofloisisnoMAvoIIIlitof+ITS+orinwlcitoIHluhoAtrnfE1fIhonItofhisItofit31otirjititofIJIsitchantltoorifofofbeItinumtinAinItitjrofittitnoouritAuHMatL5InIIIintuIaLaipofitdMHatprititisitcfnii1uCtiUiireuutoitIahtwisit7IIItoInyiofofanMItlInuiilitFSOTCtoEinmtotoinConto0onilciat1KAA11atftaSIthlrtoIuofitgte11ulfluttuIttuitantlxsofrateikttorlitafrUliaatVifatitfraacvlrurititIuttoyinIorasiIfAKnSiysiutrpilK80nruiinlraanIittJUaJAIfuiIiSsea24UIHpufitaattoiteTUItItPcsnuafiUIIaIsItuhSIHPin4fea11Acnu1taIiMttat1of>iibindaauIptotl1aaaaa>1ruisaunttaaltattoaakII3AuvaaaaanVasraItrliuia1aUitUaaaaAt1a>1bvybyVyIJr0AaitndIiryirjIKpTacnHnn>iiitJuaIIauhrpIrIrnItu3ntitif>1jlsHI>tlanntteaIanaiynaIaaHaa>Ji>fitf1ouIaaaaI>IYItItoC>Ie>i>Vufa1I1eeaataYcadastiVtu>IlItIlI1ueaI1>atlJr>IIrI1ti11If>L>cIIlsIt<1lIrIt1Iatu+ll1i1tIttijaittrai1alIlUIJ+tI>11I+>itl1eI>I>+iriilteVtlIlIc+>>+>ttI1Itft++>II¬<+I>>>i>+>+>tIisii<tIi<<>>¬>11i>1>i¬¬i¬>>¬>i>n>e¬¬¬¬<<><><¬>¬¬¬¬¬¬¬¬¬>>¬¬¬¬>>¬¬¬¬I>¬><¬¬><¬¬¬¬¬¬j¬¬¬¬¬i¬¬¬¬¬¬¬¬¬¬°¬



    PAGE 1

    HARDWARETin-warea-ndWOODENWAREgetAYCPPritchardICEINSURANCER9LiumbervisorUnaBEFIShin-gles2-12ExperiencedMerchandiseI8IYElllllfUlTUREIGEG-rOOIOLUMBERWHISKIESA-NDDea-lIBRANDIESMOTLOWBondSTOVES-BoatWheelmencho-oseSonHead-quartersHATCHD-ealerHAlDECANTERF-IIGEHODGESFURNITUREF-ountFINEGeneralRAMBLERJasWALKERCrockeryWINESLLrr1MILLINERYs1eyltieyaraltirlsufttiverVegetablerOc-sFIRECoO-nSchuylerUSvi11eMAMFACTOKV-tivxXtompleteS-ttficfueliuiisecondaryGEOEveryEIRSTCLASSespeciali-swealthreliefttluasaxill851VANLANDINGHAMClassificationGOODSJOHNphysicalWashingtonotherPaintsdecomposedindeedGrowthGoodsBICYCLESIhuty1ryi-utlilyremoved-It118vigorousTHETITUSVILLEthexriaaeificationcomplaintproductivenessattractionChamberlainsFLORIDALIFLORIDA-BoxLiverpoolFlaglorsstalllgle1111vrlupebealwaysFreightShipmentconsiderablyconsumptionCrates-iFRIDAYLIQUORSYELLOWContinentalChamberlainsPRICEgladlyMouldingHJKk-rert1UxlacProvidencebecomesResidenceMontpuiifryROCKLEDGEt1eBILLIARDBESTmeaninglessChamberlainsCabbageiieiiiliborlihorticulturesatisfactoryincreasingBalustersrestoresUtmniiitecdTitusvillethoroughlyDentistclassificationsullidentlyWashington40youthclassificationWashingtonsupersedingpicturesqueIlttilluarrivnlpreferenceagriculture18tvttlwaysexperienceFruitttMMcationclassificationrecommendedconsidera-tionfertilizingTABLESWAGERwomanHraiulifsTEIEFebruarvFloridasbireiidilyjvegetablesthot4lgIIlHclassificationmodificationsacceptableOilsplanningDestroyingclassi-ficationSTARDonationreinforcedHartfordRetainrii-iTITLsVlllKcontiguousgardening1CUIINcs-ADRYpurchasedTobaccoyourHvupicd-byTITUSVILLE111-XAilltskiimportantAhave-recomuuudeuconstructionpropertiescompletedjudiciousfectionslNIfrtMiinibUijex-perienceCham-berlainthreesidedcomparedconstructionCigarsCIGARSgardenersillllulilyFnrtMjjnundellotHleiijoyablfuniform-ityLexingtonArlingtonv1111t1tIIIIliolilMiiithpiompinesiordinaryarchitectureThurdayex-pressionIiioperationThinkingunfoundedhoriicultutvSnnilay-MrFebruaryoriginallymanuringBMacDonaldmeeting-toMacDonaldLasuccessionPHISregard-lessbeforeinvaria-blypromptlyTomatoK1VKKandanythingpremisesterritoryJu1non1fcabbagescompleteSaturdayunfcrtilicdanniver-saryoccupiedHundcreonstomachgardenergardenerManagergardenercroppingcompleteby-pnvintpromisedcnblmgesshipperscroppingshippersabundantnothingspicuousfollowingcommitteeeverythingannuallySaturdayexhaustionkeepingAgentpriviNgfcroppingmentioned1meowltietcdmechanicsdictiiictivoillus-trationFlaglerschangestXLondonDioceseSatsiiiuaexistingfadedinevitablebookCementhaiidomeDruggistdifferenceSntnnla-MrcarpenterItomedyworkingConstantlydressingmurderoussim-ilarlyintensiveArlingtonminitryskippedIHTHUUIspeedilysplendidIJriugiufootstepsXV111hjtRemedywinductoryardfiicrstirringelHeaciouscarpenterattractivehprkvdshippedynrdcnerdiarrhoeadruggistheavilyDiarrhoeablessingWintersetpleasantMutualordinaryshippedframesMondaydontphnteditnl-iIoMKYappliedcolorgardensCratespleasantHottlcilchangesJUNETitusvillebroughtis-Weconsider-a1OUUcabbageKINDScompostuitcliiiiialtmctiveandgroundsShortlySpanishmedicinesSpanishappliedcrossinglckl-llTYrlescIaMM-SIIII01IFla-Dfaltr1lTiaViiindruffSundayhaveremediedgar-denerscultivateboughtsuflieientWiirHjyouraoatfecra111111111il1tilnhltagainstintensivePoincianaMidloryal-readyTitnsvilleresidence1tiUNpracticevicinitymakingtiruistaconsists-ofusuallysoutherninformedsendexcessivemaladyPovertygroundsappliesmanuredNobligedsflnmnereruptionscheaperamendedgroundbuhels-inNationalthroughwidenedFLOIflDApleasedfrahiiufurntHtituiresidenceresidenceguanulttbefore-AtreidencepropertytiiHitionideaFLORIDArangingHatilovergeneraldeeplyappliesgardenresidencetolliistillgresidencePINEBottlemyselfTituvillepoundsNewelagainstalwaysemployhealth-tillgroundgeneralvaluableperfectconditionWAXTKPtroubleddconsiderfurtiliiiodgeneralrlUYlrlibuild-ingHScrollcelebrateenteringFlaglerattentionWhedonprotestsspeakshigherlookgar-denerobligedfallacygardentellshighestFloridayourItiHkleli1freighttillageeclipsejustmarginArrivingultimatetillagegroundtroubledrisidciierPOOLdonationMelonkidneyprotestsmaterialFritlayPostsmarchedshallowHuesivRfamilieshowsmallergrippeweeklvbecomepressurecustomerscoughs9Q91hairtliioiitrhTHEgrayfollowedMnumberjjioundrtta1llmarketsilihlre41monumenttheexiTodaywillhairrecommendtwentywithouttruckerraudoccasionsandhilldruggistsexpectsdirect-lypurelyBrickWilliamtruckersiiiiiltttmhairreputationGltfliiSfamilyfol-lowedIllhopnominalCholeraHomeprofitsyoungerfamilypeopleEverywithoutdemandadmiredreallypride-AmughlEstimateshairRuinsanotheraroundVisitingSun-dayfijjuAfurnishedoutlayOilandoishopMilteiiilhnildinifarewellGlobetillageWilsonmonthsEstimatesdo-lieJonthatanlenerdiseasesuuhlll1eightyncertainlycultuieWorklvaluesLdeliveredwhich-isHavanahorribleFruitbenefitagain-atsurfacecertainmarketLINEKingsexpeiisitVXDsoldiersilimllymarketo-ptralbecometime-Sbridgeinteriorprofitableyoure-movalTakeKidnevcountrySodapurposeculturetroublemethodwithoutBallardnorth-erngradeASFIOKIOAtwentymarketFloridaiKiiiiioiialongivitluiitsplendidcheapseldomnnmlurbetweencashierprofitrarelyItmarketmuclebladderuiitutlilyHeamersHer-bertASwesternHAMILTONenteredNowgoodsrendersfhrexvdfortiethbtronglythirty1yseveralDoctorfarmerentifiiFloridastudyFloridaFolevsMttcntioiiOuiiklvspendBeanmelonsmelonsItoyalVincsFirstvisitorsdanYourremainlocatedscrvire-AalmostrewardStoutawakelrlihllulsjcnemloutcomesecondonaldsbeganFundaccountformercountycertainbittenrl1ttlyrelatescertainaverageeightandfea-turesMatuii-iiiiliBritishOxfordmelonsseveraldiocesebeingyears-ofraisedLimeshouldseveralprofitwinterwhichtwelvedivinecitizen0CardeitalmostKhotlesfarmerWilsonchiefscoughdoubleWiUonfailureANDbeingManufaiCitizenwhichUrgefreightbeingIJostonCMlftonunlessmelonsHighwintermaterialTheyheaprichestcertainmansNewKern-edbeginearlyWilson7melonsplanspointtrulystoriesplansWilsonfrieiulsHustonUsuallyallowlatestentranceoldWilsongivenwhichmelonsmelonsIjjonknownmovedThereItlllllttilisedBenchbeingboweliimkra0CJuiniEtnaArnifHClarkeiullilv1ritnptdirectALLgiveschurchmivedrown-bylargetijiuivfarmersettledweedsNorwichsprainschooldinsabouthundredsfarmerweedsissuedwhosecaretheywhileresultweedstheyieldovercomereportwordsRamblersniliHuleditorhighestMissesbottleknowwhichflairlowermar-ketSiiiluhweedsundersev-ewltillUtClaboutmadewinterpricerightwhichmodelvetediunvasrvictimacreagesweedsditioneitherWaterthoseusingUnionpricemanurebliliedeeppricesgoodtrunkmakelatterexeialeveryMuchpathhighthinkonlytheySunnyOnlyGoodknewgreatextentgoodthey4llghTllnesy1tttl1TherelumberdowncuredwheneffectnorthtrunkguanoMoiitonlydoliverBeachAlbertof-hiifmanureFireHiforewhilecitiesroadsPlainsAddrei-DlthooksmanureniIltoundspvieiculledmadedaysHKhtten-XresultlandspowerworkwhichTherelargemanurehighforGoodeffecteffectrecentVigorfelonsshipa-trillewouldReachnoticeeverycuredKamblerCraneroadThereaboutatlonlmadetheyhighcountyknewhometheirreturnullaheellt5tlhighshiplishedletterorgansAltsanklewith1untaoldertrivenFlagcordshorsevalueonlyitselftwicecSincemanureonionhousehavehaveoftenCaryfurtherthreeTuterwhich11lIluabouthumsotherbuildyearsgrratetab-jgrottoMilurymaniiiebettercitiescropstherewhateffectexperitIHnfulcropamakeotherFLAthesemuchaboutSuntrainedfa-mousshipWrititselffriendsKatHldercaredyiarswhensouthsummerlandsworldEvenFromKiridthesepointsAyerslaud-AtheynorthCubaandabouteverymanyBankiiKlindnijrluiwyulemanurelloiuMSalveJrillisTJOVandpostedmadewith-abecauseoftenthemtCICUContimesdownlandsllflyworldwastesweedthemfavorPointmuskpartywhenyearscropsJRtoandlaterliinilcoldspainNextwhenyttirsmadeColicrvrystorywheelAfterthemNullcanalvaluevalueJuneVigormanyaiulandandhtuniitrinaiictitamifromnorthNullstreetsureVigorthesewideOrahtripePalmafterfrontbraintenantPalmyearscarryspireWriteafterCuresKeylittleordersbritubeenhnltllPalmrrvuitweedgreathoteltheseshiftwhereandthusandBalmgivenworkBrelsKnhlthemMotlathyiviuafterduringbuyersaidlineswithoften1JOOUJHIMtluirJuideSonsfaithhaveIcesKeytooleavewhobelievelitgltIowafronttheirYorkUnlvcausesbenefitsstoppoint1than11QOweekMaintodayFirstlargehereEtciiiilinitcropTheViauponwheelsteesallkillshullhiinibothJraynionevcity1000OnlyfromWestthenlivertimeJrilliHtrtisontheMiccessfromfrombeenbeenthatmodelsPereHowKuhlfeverheldtimetriedbeenAuUlodotswithwithhernnevercvMrcropwithwholet8SouthgavetraytimethanyearthanfromtyperightextrauponiitliuiCureOlHroThedayweekboonyearthanverythanwithbeenuntilwentwillratescourtmustsecretConstpoorlaterfromthatownerlnndwilhgrew1000dosethattolaterfromTruthmthkept1rIt-itcordwithhartthatthatreapPillsNVwhumwhatstorystreetltrgyearJohnfrtunlutesoldpifwithlukeHirerscarolwhostatepart1000UiilsVicorfactstramlandthatnovicelandlandKerrWillrivertimeratessoils11otUIMHIhindverythatyearthanfirstievcivbottlewhousedverycropmadelandtradeneverMHivtnerveswellThebookletwithwhichThelandmayuithlinespersthatPuinhimhereThesomelOOKTheOFXxpwhoOFingofincivaveryoiiiiiiiThethatlakethatIlittheyThebidstututookwiledandpartaleVanwestylestillandableiropChItOAIHTEliTheOakveryfoundfircetsomehadeverysalehandmayhimhimsaysNewcropTheyaridTheteentailandleadLowellfromuddnsafeUneaboutbottlebawlsidemostFaptyourandnUllamiacresnkinandthisDoctorstillwillandtimeandMaemrnswentridsTheintohialSonnullThewhoseutlfordUowlwellTheareaslinethisandandtallMilelesswiltawlThethatnuieWelasthipIuivund211111hullIKHIMllotrltandandthisLifeandandhimandandalsoandurtttthesickgivpiimar-ketIVMIntoliudnioivsomeobtaincentshimnvllAYKIthimhoehadandyearsthebutsaysandandandandandHillllusnluJuttstorethismaltsandsafetrusttruewillhillsmakefeett1441tHUllForalterTheandthistheybestgcxvdbyTinthev4rkhadantiandlinethelesssaw-athisthetheandmilltbMirsomewiltIfutelilMbuildtbutlotswereto-MIVandthelineSmandandallollandwenthallTinandandantiandandandnUlllirtandMrsthewiththethethewereanyandIIIMIIIIIsoilthebutForPellhouthethewillandhadtheytftcoststate1111110tiltanytollmutemonothouhassoilsitethethetheForlosswilljustliarbysiteEastthetheooJandlineSonandlivenextanysewCmfrythethebutonespalthehasthewilllea100thethethehavefeetthethelastntiiiimoststoremailtifthethethethehasuihFortheoverwillthethetillonceandwereforFlatoHairhavoSurethetiltlisletheacrethethethetheIllswiltUixCallSontosortKIAonceyearsmailthelowashtiltthetheperthelulthethehastwowillacresleiiirethejailnonekinyournowbunthastheperForthebuttflpaptthethethesoreswantsleftwerecareaboutevenoveruuotrwentHethethethevillthethetintitperhasliesdidtinkillmiltheHairtheirsixwerewereonesisthethethekindHairnotlihperthetheIwthethethetxtluHiHuseskidfoilusedrhebhallbuiltthetilthastiltRatthethethetinttl1tintthehisMrleftlessservoeverbycostwllhaveMrevenFUhperthethethelattheMrnearacre>fortwoEatthetheaciehttMrnotwilllieHeMrCUltOurownnottiltsthetheWeandHooldtheisMrfordont150feltnotbyitVhishisacrewritemythethecuretheanyleftacrewerefvnwerebyafireseentint172forfurlMracreandlay1hisMrhisMrNovsillhiswillnewerrandhisMrMrhisMrbysurebothfortwoare-alistAswellacrewellpuulahisandfurforHenuvandrtMitlieItttheverypnnewyinlitforhisomiforhissameHewastonewsoulfromferthenewforMrnowbestforremvelatutusafeowniuuthis3otithe1stforbestverywashis100hillforornotandforonethatinKMIwascon>thisHdIIftolastThethand1sttenrialsawleijaritstinforIiorthitipIwastheTheOntin103rutYourone>anygetlieyrtinulultoneWeandwatfliMbetinarehJinfClayKIhenotnotandandorenilwasSSnthnuforituctallbeilibeInforuidDrheheoftenJlltiheuuoAsallofieolullinheheleinwerainrollforIlatWCatuseofofIrkmyhecontIltnilnotofitsnevsoncrtalluseatriaofOOdheherunhodofofheoneofofthetellIlutofofbeheitsinufofoftheIlStofmeBinheMJIIofiIareAltoflurofofofofbohehetheofbeofof4LIofbeheofmecarmeofhatheEinhitofofofyoutiniiinofofifiofofofusethehintinamthenowliidareeartoofofofAinofItfofofofinofofmeofofillatoftinthisyouarefortogoofinofofHItofnilcarofiutnuItininofofofofofbyOrthethnetoininofMofintoofinlitofoftothethetheinitininininononarttoatnoinlitinininaninhiinintotoasatfuratininTitoImtototoanonantotoonatorancantoMHItoufidxlis8nilisinininasintotototoanontonftotoitinitisonorheistheallnotoanonidontoislaisisUslinisIIMasLo00itoronononatltoorlr1unonant-IttoOrunontoniatItGtoItofisisitorareHoititsoasnrealtototoanonnoisitisastoininItojtotoattotoTlatotoinBisorisornoonatitlipas011alltolitoftoisYTittofrKisisislyCiitIfinatorxtituseasasisofattl11A23atototoofasmisisof11litlolUYtoittowaMIitofatatonont125itABAintoKUascotoon111rlonivSttNortojiii10nusuiNLItUAnittsItuiatMonAaatosnarttotitKittorrofhtoitaastllisonatatttAEAIii>OIfasAitITtoIrniIiiIas7hCIIIgiaaMak111ziiiiaHIaarammilC>AJurwaaaaaaaaIiVaahaaaaauaaItrM1IaaahaaaaaaaaaajfnrfrrsaaSaaaaaranLt-eatiailvaaaaLtJaaaJrrIx11rjIeeeaiiuaIv11rIanaIto-oo1td1II1s1itt>rI>av>11YIftyrtrMt1aVJI=+44>l114tt1>>llt>II>>tttiIjM>ttIl<>>¬1t>IIit°it>>I<1tt>>I>i>t<>¬fI1t<4¬Ii>ii>¬I¬¬ooIII¬t¬¬¬¬¬¬¬J¬¬¬¬¬¬¬¬>¬¬or1¬¬o¬¬¬0e¬i¬0o>fr¬0I¬>0r¬



    PAGE 1

    SPECULATION-iAXO-KEWSCASTORROBBINSGRAHAMI5I1S-ISJHodgsonNationalDENTOSDOMTHEEISTFloridaClothingwStopDontJOHNSONfIJ3ESTStateMatti-ngsiBankSuittIHnd315IMlt1INCarruthersMARKE-TGFurnitureOXFORDSIIUnimprovedGoodsBrosApartmentsHINDLEUndertakerBought-BearstheJtbepineappleregioHlath11orrtyM-essrsappropriation-forYEaSappropriation-ofwithstandingGeoigiaAlnbnmapryAssessmentsContractorsekledg-eMiSsTIANluickleberryinjlaker-JacksonvillesCOASTSHOESCOLSTBarberGENERATION-aTitusvlllecurrency-COXDENSKIFLORIDAlmartelmmultofSpecificationsdispatched-The111UIITScorrespondentiheconsiderablecorrespondentpipe-Melbournesin-auguration10000000WesternAlwaysMEATGoodspineapple-beltall-KindsSLTEUIXTEXBENTextinguishedAbstractsconvention-andCAPITALShopaccommodationthe-SignatureincorporatedJack-sonvilleincidentallyFRIDAYcommunitypreparationuperin-temlelilItt1dt11s-IEASTWembeigYdneduydis-appearedeverythingCapitH-lirculjitinjmaintainingGroceriesindus-triouslyfiir-Hillpayablein-considerationEL1OUBNEcommissionersFloridaFloridaWednesdaymosquitoesconsiderationWednesdaycommunityWednesdaymanagementimportancetemperaturecommunitycommunityofWednesdayEmulsionITITSYILJIthreefourthsmosquitoesdisagree-ableapplicationWednesdaygratif-yingofexperiencesTITUSVILLEpreventionrepairing-donefew-Residenceourselvescount-COUKTKNAYCourtenayconsiderationAugustinecommencedconsistingDryworship-thethirtyliveflourishingrebuildingunanimitycontainingtakingpropertiesappointedCONUITIOX-AtEnvelopespurchasedRockledgeAugutineconservative-WHardestycompetitionNeighboringattendingshoppingpeninsulaSTATKMKNTconsolidatedHariousappointedXELBOURNEMtlvinnyneverfailingLIFESAVIXGpurchasedbeginningcontributorsRandolphCliaric-Kmgeniu-wuudwatermelonsThursdayMeatspursuitvegetablesdevelopedANDaUGHLETTpermanentDIRECTORY-CDescriptionSarsaparillaopening-ofRandolphJackson-villetakingGROCERIESSaturdaycontributedltrthkilrerpurchaseduplicateenjoyableremovingbuildingsARepairing-ofBEEVARDfoundationsproposalsconvenienceweatherItESUIJItCISdroppingnorthboundrattlesnakesbuildingsArknnsns-MrStickiMydislodgedcontrib-utedspendingChildrendaughtercommitteeTRAFFORDBANKDosonville-AllrejoicingreasonablespectatorsSaturdayassertingSaturdaygatheredlegislatureSaturdayTOMIKINSprosecutingANDHughlettSaturdayBROTHERSHughlettpoliticalrenewingcommitteeSaturdayBiscayneDIRJECTOltYMerchandiseconventionqmmlitifhundredSundayspat-ronizedChildrensopponentsentimentthemselvesHugblettSaturdayWeinhergopponentPemocrnticquantityHendersonWabassospoliticalDIRECTORYexperienceHodgsonselectingDIRECTORYbuildingDentalalthoughChristmasimmediatemonthlypoluicilNoticedisposedcmitable-TlClmnceyTiinsyilleHodgsonpoliticalbuildinghonorablesecuringbuilding10000Pricesopponentpubliclyever-gladesrexcellenceCartervilleTuesdayMelbourneinstruc-tionpassengermorningreminded1lrslolutele-graphprosperousapologyHopkinsrequiredcloudburstSTARsubmittedhomemadeClevelandTuesdayTuesdayMitchell-FOccurring-atiniliKthtionTuesdaypeculationpivmiePhysiciancommitteealligatorsportingBeveridgoTuesdaypubliclyhomesteadIndianolaCabbageLaudspopularanomalousassistingbuildingOrangesthroughlueslayhippingindefinitetctpiirinhoiiMhoMLAMondayHODGSONcured-ItprospectdepositorywishingSundayMondayJUNErandi-latcsShoemakerpopliarTitusvilleownedpresidentmeetingmeetingvicinityde-partureconditionlemocnuscommitteePymockChandlerySANDERSDANIEL-DapologyCharleypromptlySundaypeachesMondayaddressedlacksonvillrmaking-aVirginiaWhaleySatur-daymeetingSundayTitusvilleNorwood4SthroughlttOHSMOTLOWbuildingdesirableWILLIAMlungsMondayGertrudeHudsonsbusiness-AScottssurpluspassengerTitnsvilieeveningthroughSimmonsin-terestedStaquicklySundayrheumatismSebastianeveningKeepsaiois-SSundayInfantsEdmundunsayplayingveg-etablelauiMclientsmakingleadingsinkingmakingresidenceRISINGBUSINESSpayableopenedSundayHavemembersItobinsonUPBAKERYthou-sandafternoonpopularmeetingcaptureafternoonATlOHNKVSaturdayvisitingcausingBUSINESSChaileyplacingplacingberries-wasSimmonseveningretracteddonationoffensiveentertaintWittsrailwayCOUNTYsidewalkcollectedie-portcdenumeratorWholesalepearancerelativesresi-denceAndrewsBUSINESSpro-lusionLivingstonKinganvisitingcom-mitteeturnipsprivatecollectorSaturdayPalmettodisposecenturyExclusivehungryoffensiveeondiiioncou-ventionHarpermistakenhungryvisitingKlondikefbltowimcapitalT-staulreturnedBharpitFridayfurnitureCarolinalargefurnishedreturnedattendednecessarydemandformndifunctionremovalquan-tityEm-balmerDcMinattdattend-eddisorderedWhiskiesOrangememberspeopleBUSINESSadditionwinteracrtimiilMtiHardwarelibraryMichaelFridayOverdraftincidentattendedprintedPhillipsrieto-rDrCrockerysituationFridayBrevardconsiderproper-tyMathersamendeleadingfacilitiescondtMiscdlargelyHOOTSduringnominatesuitablesuitablePLATTSSaddleryDISTINCTs-KinganWKALTHFridaypeopleKindduringl-FlonfpeopleTinningWittfeldconventionheaviestfamiliessaparilhfamilyexclaimedservicesgradedaccidentpromptwhom-hehournmkintrSun-daycandidatelookingSawtellebetweenpartiesTropicWonderLTHEBicyclesIlusiiUwaf-ternoonfactoryhavingpeopleCarlisleconsistentTayloransweredpreentsOrmondmanagerpresentbusinessTitlecontrollerbe-causeMathersmorningpracticebrothermorningCrackerKccogni-inen-joyedbisinesepassedfamilyFreshtreetopcon-ferredLiquorssurestfishingMeatsbushierclimbedentrailsbaulkingdriv-ingstationsremovalGalliematerialSurgeonMayorPackardreceivedfathersyourselfinsultedclimbedquarterSEVENTHbusinesscollegenumbercrawledpupilshonomblcWimlhamfamilySKUVJCEreturnedSeventhleadingTRAVISbrotherSavingWa-basoFridayGroceriesPresidentchickenfamilyattentioncitizensGallicscaughtcountynumberabsencesimplepublicplacedlandsqualityclosed-AfamilyGib-bonstomatoeslilt1DixonsChesterdiscoverPracticalJARVISartesianinterestforwardmedicinemedicinedbloodighulnumberLawyertestifyentrailshimselfnightcountiescrowd-soabsenceHardeeMIAMIsup-pliesBrandiesWoolenre-servedCOCOAestablishnumberfm-Llcinanchurchre-movedtraaineaeIlebardVDUpreHMitnxdHirkPremiumsecuredmeetingSandersmadecountryWoolencullingSpecialcountyHiHHltciispendcountyFRANKcitizensMachineWynnDKNMIAMJohnsonAgentarrivedCapitalwantedCOCOA-Gceleryi-HiinkiimSamuelIlairdeegoingDistrictproposalPleasantstartedPIKRCEglad-toschoolsHardeeDURENstagegAIUUTrepaircleanseHOUSEmouthsstudydiscussMarionfriendsGrovesdeclareofficersspecialHardeecountyDivitleinarrivedrefugerightshumanchurchdistrictthoughtcarloaderectedMissesjotieLadiesMartinfriendspricesUTIMHM-ICaILUltiReliableDixonsmvatestattorneyGilbertGALLIEGilbertmarkedgiveHarthnlorefugeo-lHrevardMerrillStewartrcanlcountyinsectsformedelectedMerrillgoodsfittingsJttdeGeneralfacilitySTATEfamousFortifyTHOMASEarlyIndianTiniillreliableJtHJIHfoIolprettylatelyfriendsamountllardeeseveralWilsonSTATEMariondiscountHatterfamousaddressPublicOFFICEpersonsattitiionreverenddollarswishedcountyHattershouldcountyvisiuilgettingbeingsubjectEmmacountyFittingseveralbetookmattersministergoingescapesIndianAvilahbowelsdistrictrepliedhaveTheyappleStstwbiirtineaelocation7IluntilSewinglargestdruggistsMentionfriends300friendsvisitedUlitoingnightmovedBovineIndianseveralHoraceCalvinschoolherebyerrandrepliedHairbeingPointmyselfvVGAIXIKGrocersTrunkssectionstMtciiientHrevardsmashMorrisTounechoiceliberalafterThsMessrsplainmovedplatehousesstomachthinksMaconbeforepenalpauperschoolUnitedpaupertakingshouldSealedFloridaschoolgoingFloridatroublesscrofulaquiteBrevardJameslawyergripeschoolMarinemonthresultsfriendothersTherestartedliverQuitecountyaffairs4inchorangeCOCOAsteamerJ5IMMINIMCSMSlCOschoolAgentfigureMisseswhichHighschoolvisitorcashierwhichgivenMaconllolMnllahlsmattersBANKCtuhierpolespriorwhichschoolschoolsheriffvillageHatterBranchbeingGallicretiredhousesIMCOSKfosmentMhoolEvercharterTiavisJamesCocoa-RdintasesbeforeRiserstutvis-itorcheapboardfaithsspentLizzierathervisitedPricesknownschoolStuartPOINT-JCashierLizzieGallicDixonCookerwriteslniylatchwherewhichThreeSouthaffairsBAKESpsedIndianCraigCocoaHatchbeforebeforesnakepricesyoungIncidenthealcar-riedbusyherego-ingIndianCocoacrowdchjuxHovewhilecrowdEverysummerratheryoungschoolMuttersllEXKVscribehonorraisednllTiWtruthwherewhereboardwheremonthsyourhooksSolicitspossileafysnakesouthcountygreatbeforebittenlaborslargecalledbreamland-inschoolwhereChillieGroveyoungcountyMANYwouldIslandyoungDrugtakingsnakeHITJIIO-IschoolTheseFortyjollyladiesAboutMenskeepBeachCocoaCocoaCocoasummerGutniglithomesnakeTheretime-mistmattertojiidboardtradegirlWhatdanceraiseddayswill-hcaccountsgreenpartydownaboutkilledMaySuptgoodcattler-IALMretreatsouthscrubgaly2I1beganlaysFrankladiesweekhomeLittleJAMESbossesgivenabout1MMJ31sum-merJonesmendboystheykeepclosespropowillWhatLighthomePaintsGrocerelectedflavorfacingbooksIIUJ-XuOfficesmonthandhighspentbeansOldestCourtsbraincountyiiHurrichindhomeCityannounceandsuccessRiverguagesilverhoardmanySmallrandeLnjsocialpartygradekepttheytudyeffectmadeTheoollicialFlor-idaguestwarmescapepartyieorytmademadeperhouseticketdownsilverboardiIHoodswhenboatelSHAWsystemagainmakethelehomeCotoashipnitcdgamesIIUJHOFFICESbutchterestcakesdanClHoaHoodslirutn2000CitymadeoMireweekreiMirtnorthweekSteamorderscodOpenHratorUTINtiGoodsAfterpillsthoseAliceuualinirCreamEaumadeoliiceofficeboysmoneyhomeTHEavenuepointlinnyouskillsthoseboatsthemhandpositstheirsmallWineshealthJohnandjustBreadrainsroadscarrotsmakelaborkindsawayAliceownedthreeacretrudtPierceCityAliceroundchimgivestunsPointfrom-aEllenAliceDruglookssummitanJSlpaidJuneFieldweekgoodsrlcrreasyriverWritecarrytlmseprulitJacksavedwhichworktrainwhenJohn5000carryGoodshaveMftiHMtlearnattackweekFORTwithotliceInletbeenLouisMeatsnightThiuMissbeentheirFreshSams2450greatannumcakesJunebondorderGoretrainhaveladiesfundlittleweekweekgoodtimeseasonPalm7000haveosalsRiverLIPPtripFLAhoidelassNeartimeTHEyeasthotelbeetsandShelfafternarrowuntilforCKHIseasonhaveMissdoubtFritzHondalunikYourlittleherewillPinefromhardactionBayloweryouliverShiptiltscensusTownsMinorinvitedi-rectThisbeengrownWhinJMEPipekindwithMisswithuponclerkgoodtruckliensworkbondmadePlattseasoninventLoanlIUrithighWewith250seemsFineslatehaveteenstoreswriteafterhourhavedutyfrontbeenweekYorkbyOtherhavelistuntilcrnticceiiUsmadeIoptimetotalMissAvishardyourBrIerForbeenfromtownsshoeshereProfshellweekgrowuuItStoreonlybankherdlookseasonstockuaruthtBankfromhave350hinmetionsMissMNsbelowyearheretheytheylocaMissRatesArchriverdontlinescuredcuredwithItsDemoroutestaywithlakehavemenus100workbeentowneveryheldPipeFirerillmarldayroutewholeriver150withthanheregreatpasthavebearSolidriverDadefarmbeetsfromMisricensustoadeach100freshStatevisitherethatriverfourlinntheywithdaywithvotersNewclubthatillsDryauntyFlaStateieypseasonpartmenthave125eachonlytimeheldouVrsStreetearlwithPaulrouteofUsualrushWhathereyearThegoodfleetUtontimehlgbeartownstoreviitFirsttowntownthatIoCHIUIIclubtermsmarmsecure125takeyillewifeThethatherethattookHornfnuuhaveStateliKAlsttkkTitilwhothobaitthismosttownwellHereachherecarrytown1900sideFortwhoHallthatSlumriverCallsvaultthatwhothatthisBelliouMrstownthatveryFORcoastinlinetownyearswithsuchandthisAthiswasasidesidenext111TheintowhostatestatenayfromWOOandliltMrseveryenterHatsTheThelittlewentEP15thtowntownlastandandandMistthisandthisthisandthisAspeachandurgewellLifetearshowwellloadcentsCITYuntilflournullFiueandthisandfirstmailMrsbitethathimEautownEauhaverinsemustshoitMillllhtrcutundthisandandGeoandtionMrsandminehimwellKanbutitdIitsmeettermroadbigeasttimWillendwilltinsandlikeandandployandwinMrsMisandnmeTheiiiieiithallandMrsandandoldandandsumThetownnextandminhimthisstutSonwestendthisHutandthisiilastandantiandthisandandandtownsomelineandhimandthiswithandeMatohasthisnextkindFasothisandandandandyouEAUandanyandandandandantiandundandthisthisRevMrs1Vttbuylinefinethisandday31sthintGeoEfiotnsoldandandwillUSafwillthetheandhadwillsizeandtugshullmotmeetcameandandfeetlutlltimeandnicewifeHishaslastlossmorethethewillsitewillluiuAsalinewillhadandDryantiyeardearTheamimerGosEAUeast50csentandandNunherwilltingesilkoakOfwithbeenS25westandandandiuhtownfryonce7347bigThelateidolwillbatsIrasfinewillwillfishcallthetheherThithethelorntandfrom8fewhadbutsomelasttinhertheThecostTheCanthebindroadJoesheoilthethehostthethethetheMkcleftau1theInnfroiubaldthelastthe450themorethewillthetriolustthethethethethegirlandOilsHlowillstonebythethetheandmensHisthethethetheWethethethetinethethethelastfewtheandUioAndandputJostimedidthetheruinherandtheAllwerethethethethethethethethethethethenameFUtlineneedlicehasthetheandandthethethethethethetheherForsortsoverweresaidroadtillherthethethethetheandIVhastheandandthesaythethedidthethethedidFluthetimeoldhailthisMHSalsotheProthethethewereoverbytoandlusttilltheandtimethehidbytotlS1oalsothatwhoandwereandthethethefuntilltheOldlastleftIilthethethefewthetheandlustsafewereMrbybyriversafeownofwerenowthetheperthebrionewmettillthethetheIBSMywiltandandiitltHeinefilefindhisthethebybycallnottitbyanyfulltillseebybyxndhisilniiKevsentrodWOOnotsi5tfkthetheandlaidandHudnewareMrMrAllbyforletfeetforlistSillhistheandrealhaeastandwillHebleMrfortoneoverlIuMrcasefurMrhasnotandforMrsameAllmeantheLustGOtimeYesthatandandamiMrhishishishibMrthianyseenLIthetheTOfornotMrsmithforfarlieputthepertheMrMrsumillIiisfarfarwasandthetoadLadDrassfornotfortiiwaswereOurtillyouforforthetheFixthethetheSIlUloutfurwasforoneiinlallfuriiiswasfurfurhasnewtellbethehisforwasireforforIcethethethetheUatatint000waswasfillthethetheinfarwasonetimeIthiNoitinourCOGawaswaswastheCHwasnwwWeateCoDrwasHJHnilwashaswitsitythethetentinhethetwolottt-ivtforwasofwaswasouronettthethesurewasforitsinforforapourouroneourandjyes213hefirallhemyetemywasdosonOFbyofallupheitsourtlttwasupofleataxthiseh50cit4-ttupbyofcanwaswaswasfirbemyareofbebeourareOIImyforIrisallofofheFluofofofnowourOutofofofbeofofbeItaxereofjuourallhehefitmyonewasforWofofareupsonbebebeoutTJUofbuareareofofvarsirToofofofbeItldareofofofofforA7ofbtutinareheofsetofofofofofofofofofforforareareofofofofofofofofofofinofMareoflieallinofbetftIrillmiofofofofofofofofofofofofofAtofinofofofWofofde-IfinofofWStmiseeofof00iiMwasofofofofWotininitbeiniilofofgigourcanWofDrWofotirgoallallof20ofinofinininlln-IofinofofIWallofoffitofinMdoFoofofWupdotrofinefinatSatinininaninofininininofatininininweofofofisinininusininininininininUinofofatasbeVc8inininatitinininintoinMintooftoofAlltoMinHliItoistototooftotototoanonononaiofofatofinofistoto12onMtotoinonontoathI8tototoofofofofIhmetoatofksisamOOanAEonifisontototoofStontototototoanononneonokAHatofthofatGXisoftoStsatontoenOFIwetotototaltotooftoEAofof3iittCisNofenXmitorIKCto15tototoatattoatonenDStoan11RLTisintothatasortototoacontototototoattoATKTItLisIfIIon11rIIHCofsoattoortoLTFADusonAxstoEIIFifastoojtoonrhoOHtoAtoailltoEisAtoisBonratItorFheLiiEontinonAAto18FLItintoHtoasororPDAmBLantotoorasJ7-itSinIforurItCtotoPonontoFonSS1FitJPonSSitAtoitlitJAaiiCtlIIorasPlHEImSsosoueasatJIAPSJsoJHIesJruiiipaNtstSJtllittlJJHi-tJreSrsrariatlmrJrlosI-uIa11Iar111Uataaaaaaaa8iaaaaaataaaaaaaaaaail>atattaaanaai1LItSIJaaJUnXlIuatiaal1aIHMaa1fst1IIraIES>JIiCI>11IiyII11Ir>f111+>lIrIIlrf-rIj>ti>tu>ttlISwli1I<+It>1¬iIAIIsI>nni>¬n¬I1II1I>Iu1l¬oi¬sfinnr1li¬¬IiIiIi¬¬¬1<¬¬¬¬ii¬¬i¬¬T¬<¬¬tjtI¬a1¬¬¬i¬¬¬¬¬¬¬¬¬¬¬¬


    PAGE 1

    jeaysgem-sBarrt4ofNmgaraisltHUnivcrsU4soMGiWkykhethunke1NE-cocdpurifiesandenrichesjtkeSarsapjariIIaExperts00thecL-IBaffledR-ealHoodNMDIRECTORYImitatorswiAd-drtiBLOOMEACHPomonaIkHtleurodGENERALPRISONERSDBuTInothing5aarsafHood0KLONDCKr0ltIriMOiKI-llILADKMlIlAUnCHPreachingMfg1-I1fi1OIi-13I54WHhUININNt1Irnou1SrCHURCHRev101OllEARRINGSjtIiaTESTjDiamondsEarringspurposesCAfiTORAfRICA4HniiuI-lmtelKtwiiHBICYCLlSORDE-RSACOMMISSIONERSBeware78distinguishingPmitKCTOlCY-JUUNTYMcCinnityyet12AlthoughSwampRoot71IfFLORIDARailroadTherchampion-shipPRESBYTERIANchampionshipliTUSVILLERIGRchampionshipfor-WASH1XCTOXDiGSportsmenUIKKCTOICY-IXiWNchampionshipGOLDpestilence-ThelArKSoXVILlKcorrespondencethIecham-pionshipCClJhaltelegraphingSwampRootOFFICERSwonderfullyCAUTIONprofessionalFIOlillatejispoonfulAtlautat-liattaiKMiSwampRootprofessionalLAMEprofessionalprofessionalprofessionalcanTituavillecompetitorssuperin-tendentWITHbetterprofessionalSPECIALdetominationioilduide-fmieOFFICERSequalitiesBACKsweepstakeeolljeetuiedttillltlilaerBlfeiprofession-alButiiidiuftlyWARirprofession-alupholsteredKimbcrlcyappreciatedsuthcicittlveapltalisticdenouncingdisgustingMcCinnityiWAGERcountrymenititiitiwD-nniMHidrtelseMtggerlionsrec-ommendedeverythingeverybodyTRADESTadventurersre-sumptiondyspepsiaassociationdispatchestournamentEPISCOPALteletrrapliyaccuratelypoisoninghoodwinkedchampionmanagementSTUDiiMn-pintiiptlyYOUIlawleysfrequentlyEnglishmenSummingrepublicanWednesdayprogrammesIuutlturASI1KV1LLMspecimensespeciallyimportantsemipreciousliiiiiiihtiitirciprogrammeSAVANNAHPATENTprosecutingII-IIJfriendlinessassociationuneasinessBrooklynscatteringpro-fessionalivrnminetnlttlhandicapKNYIUKdisregardEverybodyrepulsionRJieOttiuHprisonersBdiuiitltratsexceptionslaughterprisonersCockshuttaccidentalex-changedunanimousreceivingprisonersregistrationfollowingpromptlysjHrialistMiserableMilwaukeeImprovedSTARAgenthandicap81900programmehandicaphandicaphandicapItifMafekingHrrtD-iniiKXidbMatVUingafterwarddruggistsSundays-InALLopposingpersonalN-HhfrillRmldigestedsignaledRINGCourtenayCoLmgotherteecapturedhandicapsItti1trsindecreasedcommitteeAdiuiattWednes-dayPreachingtournamentinternallycapturedcapturedaaaogelWheelmentour-namentGRLaGrangeMnfekingopposingladen1owLaGrangeCHURCHESelsewhereprncipalCOlAMKlAWednes-dayCoJMEspecialistGETIntroducingGUARANTEEthansuppliedJUNEuiniftevsjiryquicklyquicklydiscoveredThursdayvolun-teersliiiiiiMiitiengagedquicklysometimessuccessfulprisonerguaranteedpleiiuntadditionalaccountedwhereverliolsteriniperformFlyerCyclingeuiiucilmensuccessfuldifferencepitchingpulji-itHiiityllawleystruggleeveningsAmericaninjuriesMelbourneprovidedhapitcnsmeetingsMitIidiuBAPTISTSchuylergreatlytriumphshotguninstruction1rcsidentwroughtHtft-AMIKIKDvcvMtlwrattractivestraightpitchersDeWittsbroughtwoundedsettlingvehementCHURCHonethirdMicklerTitusvilleBrightsregularstrtarlldlunvo-lunteersnews-papersin-urtilientsreadingwoundedTJmmskdraggedE1AattendedterritorymeetingsignoranceramifilinsingeniousmemberswoundedIIsuccessfulItarrhw-DiiiiKKidney011111511IlHxcclhdCHUKCHLaGrangerenderedtuWtltsllijWalkertreatmentfurniturenilHilliyNorthsslSesilt-tiitrttDrawingwonderfulStandardSundaysTitusvillemorningremedywardedgivenattieaaarencontraryMadisonTitusvilleCapturedonethirdheplecsefiVclivegallantiniirlsistitpromptlyonethirdPairGoldsmithdigestsonethirdTuesdayShootingSquaretreat-mentTitusvilleperfff-tiuiireceivedgeneroushospitalwon-derfulheavilyveritableTitusvillepitchedaftirtlxttremedyonetlirdMtirtkwttatregarvlkyPlessenedbetweenbatsmendienscadiscoveredIndianoladuringlisHsreeHlcarryingilipatcapproachdiseasesthroughbaseballCOUNTYR2MblcrsColonybesiegedregularilrtmuitspoionTuesdayopenedMondayhoweverdlgeytrdDixienumbersbetweenPretoriaHowevermakingdangermeetingdespiteconsidershillingsNa-tionalen-joyedCrosbyTHETroublecontains1-1INrth214CrosbywritingcoolnessalreadySinpinsisrletirlgchairmanHughesWestbroughtCOUNTYpur-chaseIntendedmedicalnationalKniiilsiotiMAILpranksrstdawarrantedpresencesamplenationalbecausehavingquotedagainstpracticeAlI1rnltiwarfareMorganSharpedSKViiVKDmeetingstomachalreadyNaithviilfPUIMlXKItSDOBaptleVictoriafami-liesrfit-lnidtsSbarpesSundaynaturalhilltop11MltIAthroughprccnpServicestargetsbronchiprovedRegularkidneyreceivedColeusoresearchpitlyiutexpertnostrilsCcrhardDiamondsfamousclosureOrangeLeagueeveningIdeasmouthSundayKANSASforiineadditionSundaySCHOOLKilmersSundaycolonialthroiitrlidoubledSundayREMOVINGkidneyremainskidneySundayhimselfRobertsGardenmarvelloussayingrcceSxcdreceivedstampstwirlerscountrySundayscientificsoldiersthoughSundayStumpswoundsattorneyhimselfnationalwoundsMijiumgatherexecu-tiveSmithscatcherallowedirritatefollHltjmedicalshowedinvadedtheIcovetedBOARDprivateKilmersLincolnPrunesreportsitn-IlHiHuServicessjcollectorSundaystcretarytellingvoucherveninlapublicFGihbsnumberdesignunjustCros-byspecialutjoctxloryraixMltltlHFridayanotherimrallsoldieranimalsimilarcoveredcuringSpecialIowdlArekidneyTAMPAtmanagerfatI1tawelcomepiecesSundaysafetytargetscenturyfermentGauldenincludeVictoriaSun-dayGauldensocietynUtinsfur-therKN-IllIaIluKhlinHcMHmarvelmouthsPiiUatvPrayerBritishamateurbladderPerFamilycollectortreasurervariousleaderssig-nalsshoutedAussemsinglenimtlylirniiKhtUnlescyclesCtHiiMiiyOfshoot-erartisticMannerSharpeCOUNTYrneutiniStewartilltfllalRIDWilsonExpertInllniaiiflltI11EastsystemPINtreasurerseveralpresentforeverfirmotheriraiildfitNearlyPrayeriIIIt4JUdconcealBritishmarshalamateuramateurWilsonkidneyamateurwingBOARDquicklylutwecnlivingBritishhamtonoHiiHftiHenrydividedconfound1uurshtidingswillowBaltimoremajorblad-dersecondbladdertusvillePrayerWiUtihKilmerrationsclassesbranchquickpublicAnkoiiaAlmostsurveyorseveralservicesysteubladderlimnsiimkitmJttBWtagaintasHenryyardsreportstJlltltJtSagainAfri-canBrit-ishiHholdHuvtidfollowsvillageverifiedWedntscarriontroubleMa-jorgivenHoustongreatKatlirstuavilleBoughtMakesGoodrefundedsecondMakingam-ateur1TheyUPama-teurhiddenaddressSteyngJtubtrou-blesleagueblazerIndianCAICKIKalsobeJuck-vixinvitedam-ateurprotestalmosttiitarritStatersStewartGenuineissuedtroopsspe-cialElginkid-neyKilmertroublexiiniiiiiiuittiioiDiseaseMitijuctcircuitshot-atfuiurrhladenplarinplaysSmithFloridaforwardshcrinWitchcarnagediatutJIlcouncilUandailTOWNmouthreadersadiniiiiillirldamongFlotillalCt1ShrceppiawhoseBoersKlwanlTreatedtaxautwlTheyaIq1t1iulxvuyliriillantsavauootiicerlathefallenquillsallyieldracingpastorusefulissueddiningFloridawhichaddedTetterpaintsses-sionsWa-lkerrantrrhlargemoneyrecentsecondWhileoclocksecondcountymonthBrit-ishserv-icestruckarousesKrebsarrangjlouscountyunderfourthpilesINcreditbattleRECORDwhichKrebswherechairsaffordcyclematchfifiniiiwMeudelsummergoodwhichSmithbrokeaboutsummersiegepublicutrtltutcwnit-WhilpurposeKodolbrokeow-ingcalledqueensum-merMoneycer-tainaremonthmentionlessentafnjudgeheavyKrebswouldmixedmoneyIOflSUltKWallermatchberauoCECILLadiescountyScrewsCArEhomesrecordmouthstandBrownnOrAIIHUIIutrtlyClinlrji-aiimuitlYHaelSmithwhleUyv-IsecondperilUnitedThere11ATTLEothersourcesWhenNatalyearsBoersLorflsourcesthawquarkfourthlodgepayl11ryrunnersmat-terwivesbravemonthtJ1IidltRectorcircuitcertainAmidlatestmediumlutnMIPcouldothernativenightsi4entTOWNWhenSouthflocksotherPATENTschool11llazilltThereteenthSyHnvviiefoundwhether111111ItiiersreportwhombirdswithouthorseINhonorPastorTheirmonthCIIIVKliverwhichagentswhileforthMaytightbearsCycleTakewingollicerTBoersi-IndiTcuredcouldadd-edfiMiutyeventsthoseivrtlyitinlnBoersgameIHxsaIIMMVN-nrattanTinrer-ijNntlwPastorIw-IttlitestedrolledLittleschoolandlimnmadeIIoYTseasonxtklrswhorsellttltAAfSkuoVVMkiHiwtrackna-tionIlnrrkiajundeventsaluiitfAlterdutytheydrumwhenmanyschoolSrutlsbeautyswiftgreatknowmade4000whatietiuliMthosegiveonlyschoolreasonnearestdollarDrowndailyna-tivepinchCoiuiuiotherliritheseSalvebottleUvrtmtiMuchwhiehstoodworthvet-erantheyTlwaboutsortiepaperqueercruelDropsyearsutllirgauntoibirdstrapsmanyhousedtrlridor-noteiassessortheySalveaboutwhatAnnualwhichGallicDixonseriesbeiiligreatthreeufsiItworktheyreadsDixoueveryhomeSomehulleventsCurelongrecenttheytheyoftenwhimgreenarmyclassltariostighttheytheysincetrainstheirpapergoodstheyIxukioftenbankTheycruelxcuredthink1t1M1zthemtecuininififtyshipgameJonesreedsnlrtliemayorholdsMtarrhNnrihmadelHavylyingallowgameliioudbothermanyiiialmeansworkJoeeventtheywaystheirUniwaliiiihfusedMeetaTrapmotorlkiticleartheircnted-Jyearspaperdeadktrtaristrapim-tivefromhautetheirmadeIfltoueveuiRiserthoseseasonsyrupworkwhicheithertheyre-liefsuchhavehavemealfeiirntakenCocoamouseWallerdoueyourhltMld>uponfromTitusladvdoneassessorthemthemthemKnoxWHYSofFlaprifiplanBoerstheirhUhHawGreatOrdersthanmitliwaystheirneedauint-tileverytownsripsMallsCITYJukbWMknowFERRYciiclilittlelijesttheytimeTitushoerecenuimediInfoiirKTIush-erwithfromhavereliefgreenandJohnDELLhave11srfrryitinre>hardbirdsimntifromfrombooktimntic-lVritoStatesformhavetheirSamswithupontheirmakeaUVfusedbeatformMrtttllclerkLwithPinkworktheirthirdclerkDetroitahaveyourMostfromdoneIntoitrewithyeardaytakestileeverytakehaveIIHHIholdopenurItrmileuilliMuuotIwwswtPrutuwfuleveryAbeenbeenThisbeenJohnFrieshaveopenfrontWootbeenbeenonlybeentlusewithUskinfondFIELDfustiestrortoffereachXKWthemdayhanfeasttollswithlameBeersthusThein-tkvtheirhourthrifmeetslrialabeenbeenThisbuilttlitywithIpllithavesizeseverynotkuendsmaybackplutoinlethavenuUhateherevastliverItiueverytheirhavemilebeenbeentitiitibareJohnlstkemilewhouooiineverJulythuscalledfirstbestmiltiiiittiiieiMebeenwhoheldItiMMiiitriiibiIopentheirskinholdIvyYouliugFlirtliverwithbaselatermustFreeThisTwothatneedIFcoverroofdayFortmileusedfitterriverthusstileafterwoisdlainbeenHeldscorewhoeachrlutwmanemilemileLinehavetinycourtworstt-1IOVmilebulbmanyablythatalsopoornevercauseyearsaiiinitH-ImnilTAKiHtoinMgreathatestileyourlimedieduls0thatfails2eachandThenUtNebwhorolledeachcrossoiintieachTownveryItalytimemeetsthatskinliverrondnnmcraprivalmileshotthustikewhatfieldwlorwhoTheTheThehavtwithmoreeachnine-jhateCaixliverheirThesandsendeachtttoneathisroomsrtlsttaTheverytaskrliosusevendintThethatUslullmayeachracesutterwhoHowcourtTheeachthatsomeXTCsomeworstinletllivertJStrieda4ifltrslerSandfeelamiMayjustThethatThelivesIlrhaaantlliHalnithvtiltalsoMTVHTthatthatratMIwillantiIIHKUandsoldlugMeetnothatfniiitThefnnithatdiaiitVuinthiswarescorewillmailvilleandhowyoufartwillniulnullandHalMiceBwtTwoTIltrifleManarliltthisacidjlllTheintomilldaywillUMHIlurijthiaallnanuheldandandlikeroinjthissvilleandthisamiOHUthatTheHallcamenewsthisnullelsemostflfl-PBritcoinwithantipugsnullandfirstemi-ttakeitrwsWiUandandhimandthisThewayanti15iiiTherryiiyouwhopaintsamebritmuiiniMFROMmeetStarthatstillwhoFtsameThetheirThebigandandnayThediructhatthisandthattentthisthemspurtevilfeltnewscrossracesmeathaveandthinfinditMmswillItetlantitiltsYouoUVrNrwhujandlMHiitnewsthisThemeeti-MHllthatfirstwithtututjUcwithnioMthesehadalsoleenews111seenBevwillIMandandandhimandandArklullaptbutAcentyonSonwhitillldaisleRevfirstandwillandsoldandnullJOyouandtiunfomlyouiltt-ofgrtIrailhallandcryi200andIIIIthetheIlHfullleftSonandollirllfll-Itillf1iquarinkmiitCurenewsfuliwillandanImlCURtinscuresleasTo1ttefirstThinracementhe212andandthisandsortthehashaswilllustandlawyoufreefirstownmanthisantiOnesentdidthetheliesbutantiwillroodSonownZMastrlhKindllutcomepreytitlethatthethesentnentIsayhashastestandalaitheandtintandandandandthehotthemennowiJOOandintunotewereGAYlionthethethethethetbohastrayiiYtillhilltheUfobutthehashas21iJuointthemore730WithrunwiryFJIlottturiciirilithethethethethethethehelidpretheAidthehilltheatarihutSurdhastireoutperandgutanlthetwoduintl±sayandJnoMichseenthethethethethehasha3purethelirethetheMatethethetottheciiMfmenHMnTunwrllandnoelley730theIKKthetwoeasythethebuttilltillthetillthetillthemenwonout114thisthUagoFulldidmanIKTIantisoletastethenmenwritsracerarethethebutthethethetheandforthethetheherIHMandawlmaulHCIUncsihashas700t-rssslfor045thethethethetiltthetheLoslIltthebylistfOF000amiandrareTHEtwutwothejugown700tautforfortheionfor1bythethethethe330300notforMallJHMstudtheraceNHtrimbyandbyrarebylrtbthehisfor730EauthebyhisbuttoiKthetheforforlilcVetthe730IslettkassetbyEpoutsurdmensumtinditmiltbybycanforhisitchforthefuthetheconTHEtheTinthewassadwlatdsrtsurethetheforMittlisthisandthethetheeverfarwenwaswasiiaiikIttrtbyforbytlutillttnlthethethenotNofirsttwrtBertandweargiveforfurfor1msforyettillaiilwaroilltForoutjKr-MtheredtiitlriaUticasedinliveantianywashutMUIeveroutcalJulhwarstunsparthei11rfurthefreewillthellltttheoutwillitilllilandcontinjrulIlbyandrrxtheUttasiltfilloffvialareallonefurarerealwillaflnotbythethesouoneslutUlthieeatthethepayWetheonetinenutareallpurrbeb1oneoneiultistLitinr-inutVethtillJosareoutwiltdisarealltiltsentfullheyniltheluiUptlaousMHIhedoarearthearttdhutillItr-IIIIallAtnotsonbvbethetheIHat-liritrtoutdohutsmlndforscotbeIlitintnseallaretirenotfullraclrtbedoupAt1-VwillRucpneiiel252youCOS5allfirsMiartoutkytinrelDritseatforhetaxtuxrgvtints4SLhelmWS4tintht1111u1Ityof-tIFiityIruSIlelforfurtuIlloittaxaiMarelia30DrliMnotlieDr111furaredotinIMareIIItolilttooLKhittinlarofbydouptinDrtututtrarewasofareantni4tilltIHallIKufofbeoftintidbeallthOUtIlosalitTtlofbelivnotareIGuttillupallofattinnilnotofofatofofsitofSeiBIIIInolarentof4-LtatoftinilholiOIKVe1iarebe1sofofofrliKofItSbeanvofofofofofofofAJrersofofKi4llicefl1atoiltinallslitofTHareatjrtiofofofofofofofInTiTiinlMdmnareMi-IofofhvofatIt1run4-tofofartareatfaEofrutofofQtayInrunfurletfilerlieUKui90nutliitiniiofofareofaJCotinJrUKofItoatCOfurhI21tinBofinLtcWItSrtroonofPotrntoInofItIttitfaiInIninononCoIntoInin21111at1ItIntositatAIwtininofofiuifeWMin-tininininWWSLorUn11atatnoonwemnweasatoarinininIninulHIMinintoihInsonontonis1110ofattoidinisinnoanininMInElirethtoweiniii1ihatIKCJiiisRinicsnieAinMMIstointoot10illinItoatasusrci13OfIIlfursastonlatillufItatlitsitinAisTintoisitItintiliioror11atatlitoftotoStasHkNininGHofBmaonininillattoatLUMiIusorutasItiNHinintoisistlisTisisisIttotoatorhHininAIutoorasrftoztinsouftoatIisYNEisIMisisisisatorUiFjUixInBto1IKJarttoiiusoenontoisFDisisleatBLortointlIliirtoIHtitJiieIetsrsisisisDIsisUsoinlHintutoatortoititoto4fis111FPtoBinbtPifIMJontoAAttitoatCItAUltLNtotomiItItif00uatoroisiaItIsCornrurstetFrLreuriftrororItsasMiokACiViMyhiAlntiUKElnmsiiiIvitJrnsilttuILmFiMIIibilusntw11itPmmmitSBisivIMJMItmmt4itoritittumOis1-tmIKAAuiIitlipSiuIfJMImitifmIi1SISpsorepJJmIPbiMntiMCtmiIvJTlyallttEpIsArALltJJutitpmdIMu-iJIMPIaraaAstvIIuIrIIsattlfrItln1It>IruB1ItItuJLof+oJItttIt+ltI>rroIIittI>>jl1Ittv>>Ir1eIii>III1itttjIiI11>I1+i1itIIlI1iIIIH>jsttiIIt+t1<<>It1<<>stII1itii>i¬I19tII14i¬r>1II¬<tt¬¬i><>¬¬¬>j¬¬¬¬¬<>riiIIj¬¬¬¬t¬¬<>Ir¬>Ip¬t>¬¬><¬¬¬i¬¬ttii>Ik¬¬i>ti¬¬¬¬ii¬¬¬¬¬¬i¬¬¬i¬¬¬e¬¬¬¬¬u0un



    PAGE 1

    CASTORBACASTORSvcncssPl1cELREES11fI-WIISJACKSONILLEo-fAlwaysBoughtCO-NNitTrtSWhatHave4ChildrenExperienceKMGiJ8li1ingOYouTheGENUINERS1IXtlfASHIONSALWAYSYORKConstipation-andProfessorFollowingtllVUEEBLSignatureNEWcKLrOESASAILIJSrJustasgoodAmmunuiGnCotesworth-TinekneyWinchesterExperimentOpportunltieaExperimentsDrops-containssupervisionANDmeicbantofTaml-iocaMartinsin-fheFieldsCounterfeitsnotwith-standingBabyfUS1WINCHESTERguaranteeFeverishnessSiiordM-ifijintfdistinguishableEARLYaccommodationsSiiNriiitiiHliMl-FixttsignatureRevolutionaryFRIDAYFlatulencyChattanoogaYearsMorphineIndependenceconsumptioncorrespondenceregulatesREPEATINGmutationsemphasizedassimilatesbul-yPISOSSoothingPare-gorickiiJoHMweightChildrensMinuteCYiujrliendangerMLstrengthensTeethingcorrespondenceCHAIILESTOtteiuperatureaniMU-inothurhooilpicturesquesubstitutestrcnirtheninirsymptoms-TheIKONMoNCKKapproachingthJiJacksonvillesightseeingearthquakesdescriptionshtBoughtoverlookingChristopherDiarrhoeaOverivperllvelyWashingtondestroysrevitalizingprostrationssubstanceNarcoticbombard-mentsEducationalbeginningimmortalizedconductingphysiciansagainstPleasantastonishingharmlessWAlIlsrilTiiNpracticallyMothersindigestionunpar-alleledperpetu-atedoppositionWestminsterCastor141V-11nCutsotIilttJacksonvilleTroublesde-scriptioninfancydyspepsiaper-sonalhealthywonderfulPanaceaAlwaysrequiringpreparingisfashionablemuentlyJUNEattendingBearsShootviewpointSyrupsStomachmaguif-ientseeminglycommodiousdelightfulperfectlytransportsyinpa-thetieDeclarationCharlestonautomobileworshipedTRIPassengerfunctionsbonloringOpiumCha-ttsrveaInstructorsgeraniumtrimmingwomanlyJlutliMlgothousandsjinnonidedenjoyableeducationaldruggistyounjitersCharlestonSuggestionJmksoiivilleUseTrum-hlillsgivingImpo-rtantcontinuouswhooping30deceivesupportersHarleinthennmlierliroad-rlollisProvidencememorableTIedirectionsrcjjulattscornerstonemillinerypleasuresmaintainedWormsproducedsanctuarythemselvesfORhingionInfantsBowelsprincipalarcordintrnaturalexpectedCharlestonHuguenotyouthfulvmptomsanythingbroncbitisstrappedacher-whilfSergeantacademywarshipsstitchingincomingKindspncumo-liarrofvnsorHneithersub-stantialMadeTitusvilleCharlestonrerlitinilesuse-fulnessresidentialcapturedFriendBrooklynvolunteerselsewherelediciuegardensstrongerplatinumcompa-niesalways-asthousandsnsIACIiTARproducedsomewhatrelievesneces-sityattentionsinstitutionForstrappednveniencehistoricalTransvaalprincessFREESendCUREseparateirimmimau-tomobileAasoclutlouspaciousdesignercomplete-ButsoclatlouperhapsrcliiifimntCastorformationdoverlooksittaekiniAnderson3atterypaintingscarcelylaad2jOftllxquippedbuildingbroadclothcommandduellintrsattentionsvaluableReportsNationalondeiTidmilitarymeetinglunlinirlstamp-edequaledwithstoodGunsdoubtlessadvancedKidneyincurableM-ichnelspostotlicoriginalunderworshipoppositebroughtWorldHeraldhealthCharlestonexcessiveMichaelswhateverrallroadaHAVENallaysbraverychubbyteacherspreventsIIOWAKDcomingstrangerplannedHvtnaprettiestquarterswhichtabu-lateKupj-frlcomposesunknowncntjvlycountrymadeKidneydisplayIlatterycontinueauthor-offoreshowbornernthedrnlformingKoleyssequencePhilipsjnabtieslidesvelocityJOEISspecialtuaSnnotfadspecialinvestigateisellIIteau-egarentirelypointedrapidlycliamliertbronubhistoryjicinreAllowalleviatethoughcy-clonesfavoritesfollowedPhilipsportraitPJ-Cbreast-eddemandhundredbatterygroundnamingApologyremediesadmiredWindbeautifulenoughfastenedHARPERcharmedgiviiknowledgeCalhoungrippepiazzaswrinklebabysAmericaSpecialregularieI-IIINIIIyat-tentionmycllportiongraniteGeneralpiiineiiltwtlltyavtGeorgeGSAdvisorCalliotinHeeauseIXtSwatchedsleepsignersstitchedfriendsStillmapretreatWAGERexist-enceARMSpresentKindreplacereliellionregularsessionanotherpinkishstonuichEHavenumbersiatcMiianloungercrowingcreationsyno-nymheadpieceBehindforcefulpurposeCatalogueluringmidelightestkalitvlllSprucebuttonsmannedwithoutpocketthoughFloridawrinkle160pagehealthpointsfavoritesupposecolonychildrensoldiersOfPretoriaCharlesmusicalbringsJaspermedicalasthmaTeachersCharlesdressesyellowcostnmobrighttouringSlimierblack-InemeraldWilsoncolors-ItItealdes51headdressMillionsJMajorneighborsliviiigAfricanHiiheiHCollegejacketyearsrestraindelicateeasternSpecialphraseseveraltcMilyFoodjacketWilsonannualdiseaseyamberscopied1SGOG5modelsdefensesincejackalFORchurchsmokednumberotherNecktieveterantrifleLadiesbreezesbeenInVl11beenstudentseldommemorychurchalongcoughColunelllcalystruttingsleevesAgentColicoutsideIIelllletlnaturalclfryformerLoyalLondonladysshadesabbeyUnitedgoodsfrettedIllustrated1ImITnaiiciiMitwithfancylluzileshadesribbonslapelslttractiIracouncilimoiigpublicliIaltisdoubleteeplethecentrallimitedItltaiManyshapecickninswaistsservicebuckleKiilncyshadesaBhriddledStatesmarkethar-borlikelyFrenchbarrenhempallofstampetgbts-w1900tributealongdriveswaistsburntdoubleIVi1i1summerNEWchurchshadescusictlneamarblestroiijharborgtxlFloridaniriliesgownsleneraldecideeiiouuliYouthere-WithhadcscheeksshadsCYItrapsothersof-jhaibuttonusheredFrenrhreillyearlytIlIngyouthfulrather1JlthchurchchurchihoutrhefpapersFloridaihitrcigoodshadesmeritsIhmmllllstandsOLIVEsewedsoiith-inpe-riodcholtshadesexcelsobtainTickettrononnctsummercommonshonMaffordBostonweightHopeJamesshouldnomadJwkwHKFordscalledamongtnisseilmouthwhichquitebur-ledStreetnYjpotlursalmostcadetsfifteenCapeshades11111Shsmalmosta-rightwomanshotelsNatalhealthIMiikimakefI1wtmBlackbeaverangleboysstoredbroughtotherPctigiothersfearednnth-imwherecolorsplainandorganswhichsmokewhichnatureTheynecLtieaictoryJamesOtherLadycustomunlieirssesmakessewedHeiixonandIn-17fr2quicklyrouWKcuttingTheyoUIIUUllMatbrouncollarthatTherepainTIllsjwuudsusefulwhosecuresstrapwhichs11141ThewriteEventtluymanyOfficedaystimeswhichThedark-ershadecollarrlighnecktieslatterTheseTHdaysintendislandHoodslatest11IhartspitecuresmadeandroundglassTheshadelrtUll1JtcalledThesewaistsailoralwaysNorthgreensonlyandInes-Ydis-easecastingdisputeCIVUKnichereachstyleMliiMiSouthshadehousewheatbodywhichlowerkhakidressHvillcandhungFromyearsTcnnwouldrailedboileritIILu4W1certrtskhakifittedCitylesionmadesavedshowmuchadthatsthisuniteponderJulybeyondmuch1nloiiandedgefloralcolorsmarryandwouldandtimescardstheyt1WmanyburntuniquekhakidoxeiimanyCadui-weWhyloutrandloflyMouthstuffsprlplpmswellkhakigreatkhakitailorwaistullieotherksilverWhySearsIdacroupYOUKrfur11becauseforyoutheirsmithcoralAddressdownmadebuthighIlowthesecureddontGownscourseSometakesthesehealsmodewith-atheyCure-sTanhavellauorderwalls1earlonieslimesfaintcolorwoolsovergreensWrengownweekwhenearthcaliberandthemonlythebuildshowloudtakescardsWestWiththeyhasshortuivesotherrightsurestlaughstheyonlyLIghtwomenhighthreetherehastherethanmakecjlilermanyhasI3ttcolortheftrK4kplayluestheyhaveThathskirthighilluwDullskirtJunethemCureterrorhaveWestwideageCaroWhatsuitsclothMineworkcolorsidesyearsnecktieshirtbuiltpastjustBayMoulWithWithsuitfrombuildvlienoth-er4-X1111dayfromallnamesKIHIMJohnJunehimpromruinsrelicusedMissaddsnircessleastlongsnugshadnecktiethemthewithineniJohncitythepotentpinkcolordaybuiltskirtSeashouthusMCMIIItheircrownfrontlinedKedshltI1eventbehindcomestriedMosthavebehindweaksteamModelfrombluepartforshothandcausesbeenfromhaveEtonThtlintLatestMuletheirdonthavecityforLttNEWmiabutformsilkstriobeenrIteshunpartthecliinibehindbehindifromformeachnudeSilksfortsshortsnugherosharkthlnkvstorehelloreds11rntsandwithrnerColdpourwithfromhavewithSyrupOmahathemhudweavefiredThisIrNhhaveyarnUpontintsYorkbanTIIIOlIxtntstonecityjoytownBeforewithwithwithcapethinksIllitithe-mbrimYearsSomeCineWouldivesyearyearmostAllchrhisOilWouldStarEastbothviUiirayYcitycityMaycivilnntHtheatwiththanfrankNewhereheldbaycityadviceIStllthatshouldtearsexactTwoykquitesuddennerewithopentaskgluemenuandrimyModelaudneatMalepointalsoabtrvorsrljitisideLifefromThisjrraycousetrcITheOneoceanwithpintsaidquiteablethatkindVrkportlinnWttintTheand-obrainsTheundandnameverythanbidswhosameModeTheseemsmonthsshotFumewornwallPostalbrainsTheTheTheUUHtiforttriewhob1oCccol-orTheThethatterns1705andNomeWere30firsthadwereTheFnewayall-anLifeandcol-orsomekindhereonebustTheuU411telyIliIhworldandwillandnameTheTheThemoreandanilnorTIlltimeraIthisfactandandfirstTheFAILStllnnumnatureNextdullworMwereSomelastItswornbyandThewillandtintandrealhullandthinkCCNTAUMandandandmostvermore204findspellandlfcycoolOneusetImostfirstandIreandHudandthislaidandTheTheTher-guofStarthisStarthattwoIIMarmswlllthinkandandCOMPANYmind11odretlbThefairandmultirealhadandand111itsreltsomeLinythisSouTinanystill11rtwerehadILlhadandandanditstaMfandrowswhenthrillrichandandTheandandandfewonlyingmorestreetsthaibestTNOTheandandwillandstudandHATSroseThethatThatweresomeactssteadandwereJanhllemfgandandantigoodantiandlikeandhaswillForwerewere1aitesandendhidwillbellwhiletansfriendCOTakecalNworeandandandMiiiandtaresandtugThethethinkSonThestunandlullIliadRatafitsandfartaminiulhallandandandantiandandtheredsaveforlasttwicetheitsFlaactllaxmostsitecasesknowandthetheandgivecasestonandtallfeltswellswellcaptIllstineillsandandandyouFIdrulgthefeelThatthehasfallthelinetitXewbutHytakesmoreSiiil16IndliYouBowandwereOnthethethethetheslidfadtheItsandoldtheladthe17uThatlilythethethethethethethethefadthetheSTwhenrtnIIhashasbutofvashasLeo1t1itui-anWhorJthethetheJiItthethehatroserosewereevenHlsthepauseUntoouKhif02areXKVbysliltthenewthethethethethethethethethetheaalforSee-tthetimeTlnTlncJtttiItmakethethedflihasthetilltheredthethehasonesthethethethethetheIrityettatbuttwoenscsthetheilocentthethethetheicttheownoldhavethethethethethethetheitsrootCfuIwarmrntciiithenowforthethethethethetilltitthewaswasHertheWIIMcutfuroftutuMURRAYserawereEachthethetheoverlaterliulforoldthethetitthetintitthetitwartheSirhaxcbyforItwastotoldtilltilltitthewaswasmenforthatthetiltforthetittillSTRCCTtheliwoldthethatuponwaswaswasUnitworwiththethethetilltheleftforthelitethethethethetIlltiltthethcforbybyinHowwaswashedwasviceItthethefurforJtsthethethetovbythecolthatELSEomeyiarsbyinAndwaswaswase1there1yourbytiltthethethearetiltkindNonottheedItliyUpliybytriescakeonefortitMrwerenotthenewItBestBonnItAinewonetheoldfortakallAndouttiHkhisforironethatthonoallilLCooUrItsforuKwhoAJJItlnioarebytllltowveryforFluButfor1113whoallartltdPriestfareJustoutalltiltiiiuhimallutltheallitsarewhoUaj111allallnotoutTheramareallarearearearewhoareallAiinOnAsandtareoutareoneIwareareItsXOurtillartarearebe111mritsflytauhetIlare1tltrillfirlntallbeitsitsbeitsHisttiiisareareareI4MtitsfindbeofbearetautmoreofandareareIllsof4cwotllndIreartisits1101upnotfeelhdtitbethefetueboflIs-Iof11arearefinebeqofofbeofIliaareofofInofofofaittisofyouedYORKWefactviadtheofofUIIl>ofofofofInofamofofthe6anonceeviofofofofofanyIEofofofofofofinofofforsomanilinoleofofofofofofbeofofofofofofJrofofofInarebutcutt-ajtfroftofInofInofofofnunofofofofofofofofofatatnthInofofof111I1ofofdmUllCITYtheCNwonofofisStInryofalofofofoftofofofofALLinInonofhUoftallillbitofofallStlieoersureIleinInIninintnanpltoNCWInStInanonInasattiltIIiatohtrionItIatinliltininInsoinallintoonat11ITHCthrtointototIIlaletinsiattoonoftortoSttoto57mrtoent-fftoItrtCuieis-linininintooftoStat8onootioasisupIstoStinINUuponIsIsIsrlamatointSirMsojoasRupisIsisItisna1ltisup15orliltheistoIsseetobritelIn73t-AornotNttofirGliisisoritItIktototfDIlllbeLcBiiisisTistwnweMIhsoPAt-oIttoisEaisSit>toriKJseeweItitBauAtoweHitofLinJCwetin1IonatarlIrsodof1NtrmFUUofUitFatn1itlamlLisPtomaUMiVitAitAitFonInNtoiti1AoryLLolisttitTINritomifrpddcaFSnxaTTaItAaIdPpiaIaaauaCvgJtaaAaaIIItoVivaaaaIVTaJaaIiaaIhbAitaaaHiMa<4aiaaTiavaCoeaiilna>>atsrItr11ae>1aac1l-IFeeaIIfa>cf1TIv>JdIIryJyaiiriItIiar1a1I1IiYaJliao>gynfItaIE11s>¬11II1oJsg=aJt>n1oil1nIItcIcIfti>1tstiI>Iitt+I1iitttI1tt>t¬i¬¬¬¬¬¬>I¬¬¬¬¬¬¬¬¬¬¬>i¬¬¬0¬I¬unn¬nn


    xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007590100423datestamp 2008-10-17setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title The Florida star.Stardc:subject Newspapers. -- Titusville (Fla.)Newspapers. -- Cocoa (Fla.)Newspapers. -- Brevard County (Fla.)Newspapers -- Floridadc:description Publisher: P.E. Wager, 1880-<1882>.Published at: Cocoa, Fla., Nov. 1, 1912-.Description based on: Vol. 1, no. 23 (Sept. 29, 1880).Funded by NEH in support of the National Digital Newspaper Project (NDNP), NEH Award Number: PJ-50006-05Funded in part by the University of Florida, the Library Services and Technology Assistance granting program of Florida, the State Library and Archives of Florida, and other institutions and individuals.dc:publisher S.W. Harmondc:date June 8, 1900dc:type Newspaperdc:format v.dc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075901&v=0042334175599 (OCLC)2071719 (ALEPH)dc:source University of Floridadc:language Englishdc:coverage North America -- United States of America -- Florida -- Brevard -- Titusville ; CocoaUnited States of America -- Florida -- Brevard -- Cocoa.United States of America -- Florida -- Brevard -- Titusville.North America -- United States of America -- Floridadc:rights All rights reserved. Board of Trustees of the University of Florida



    PAGE 1

    flDDBtitBri4APOWDERB4KIN6IAnotherNoknowLesson41-5VTELYumbalorhul-11atismtiredFLORIDAHealthask-J1IWQOrwewTHEwantdepreciation-OnROCHESTERremarkably-wellwholesometransportationYourecommendationcongressionalunsatisfactoryiefficaciousagreeableapproachingSuxvunntS-uwannecnimjiiiteAcceptancecompulsorylRYT-hePOLITICALjurisdictiondelfckHisapparentlypracticableagreement-tobecoming-tooIIpracticallynominatingrequisitionsettlement-HegovernmentcompaniesrepresentativeMetropolisJacksonvilleWeDangerouscombatingsuperintendentimplicatedacceptableJacksonvilleparticularJacksonvillenecessarilylegislationad-vocatingFLORIDAimprovementSTARKentuckyPrecedent-Itcommonalityprimariesaccomplishedof-cmiMimptionsuperinten-dentsuggestedcorrespondents-AKentuckyconventionscongestedquestionsimprovementcommonalityprimaries1opulistiifairmindedprecedentassassina-tionbelongs-Inrjustmentimprovementstriking-innominationnominationsnominationconsequentlysieeeptanrerequisi-tionFilipinosFRIDAYCertainlyquestionDrainagecharact-erizingconventionsuccessful-lyreferendumfllS7w-llalancocongress-manwheelingmentionedTHEarbitraryrelievingnewspapersSTANDARDprobablyPopulistcandidatesnewspapersprincipally-Ipresidentlastiiiyprobablycompletelytemperaturethinking-andindividualdisputesadministra-tionprimarycorrespondenceI11NCVIaduiuhdisputesMakesUsunnavigabledisappointscontemplatingabandonedstruggleSecretaryPopulistPVREpossibleadoptedtemperaturepoliticalCommunicationspreventperhapsSituationaccomplishrecentlytmtreiUinconvenienceimportanceblockingtimehonoredinfluencedtrucking-andarbi-trationprimarycompletingadvantagesIprobablyignore-thepracticewonderingpossiblepoliticalneighborhoodDemocraticinterestingsilverplated-snPUBLISHEDCONNERconspiracygeneralapparenttwentylivestandpointelsewherepracticallyinitiativeBarkersPoliticalACKACHEleadinglimi-tationIHSTItlllUTIONnothingComparativereiteratessucceededDRLdlilSlschargedguaranteedOCKLAWAHAadjournedguaranteedFallingdisfranchiseconstantlyindulged-inconunit-teemanescapedcountrynomin-atingsenatorialpretendBeckmanrdiHirultcampaignconsiderableCoopersomehowcampaignhonorablytemperaturesjudgesassembleexercisedconventionsconventionbelongingMediterraneanhavingprimariestoapportionregardspneumoniagovernorsresponsibleDiscovervpositivelyaecoadclw79R-ainfallcongressmancomposeddele-gateorganietlTaylorquestionsgentlemenupholddoubtfulPrevailingmarvelousROCHOiTEktaxationSUGGESTIONBRAINestablishednavigationde-claredprivilegeSaturdayprecinctsnominatApplicationinvolvingnumberaccessoryprecinctsdoctrinedivisionobstructionsystemcampaignconundrum1thoughsettingprecinctssupremeprimariesconventionendorsesbelievedthemselvesconventionabilityresentationpublicdeprivedtravelingcommitteespublicbelievesDemo-craticfeelingLAMPfollowedNTKSKKIKSassemblyjusticerepublicincreaseme-periiMiieiitivofiicialsllarkerproposedKUCMI511contingentIdvertUlnjccongressNovember-andrepublicdoubtedimmediateEveryoptionalWilliamTangerinepreviousmethodWashingtonmethodanythingmethodBANNERprospectreflectionsunwrittenwonderfulindictedwantedquestionFavorsdrainageconventionprcmrcdIndianaelectionmajoritydredgingassignattractionsGrapefruittryingfoodgentle-manmethoddocketsMonroeIIfeasibleCharlesgrapefruitwithinkidneysHighestSTARPoint-ACutnMKitcommencebringingprecinctDeparturemobbedchargeagreementbeautifulislandsrightsprimaryvolumeSeptemberPineappleannouncementvicinityvantagesprimarythroughMORNINGperhapsgrantedthinkingespeciallytrfrexpressedspiritCaptainROCIILsTiincludingposihlekidneysinurdertoiiMnthlyhandsomemeetingsenatorialconventionspecimensexecutiveopera-tionBODYeasilyBarkerpoliticalTreasurermajorityWORLDmil-lionClJlJTINcommittooover-balanceillustrationsAGRICULTUREdoesntdrainageworkingknownprimaryunderstoodheadquartersfrightfulDEPARTMENThundredsinventionfarmingchairmanbeingformeroilicersmeetinganxietymoneyadvertis-ingDepartureFortyCentstrainersstrongJUNEwealthyMnrtiia-MejrVKKltwindingad-vantagepeciallyques-tionsofficersWAYdisloyalhighestthoughtparty11ayllilioKutuquatextendwouldsenatorialReflectionsin-spectionshoulddelegatesenatorialdocketTriumphagreementMountTittavtlleDemocratwishesthingOckluwalmstrongrefusedDuringpeetecehundredsthroughijuitecon-ventionpersonspoliticshoweversightcominghon-estlyMoppedpowerspersonsSpringssecretarygreatestregularlydirectioncloudyYousvervWhateverdisorderSebastianportionthousanddrivinglimitsdicingperfectlywingwithinwhollyTuesdayfearfulprisonersenvelopepermanentJoebrlshouldmoneyfeelingMMitiniMitplantingtalkingKopectIJIW-IuluiKvaforeiiidthingvaluablethemselvesMountdebarredwhichundersurgeonsexhibitionbiinjrshouldresidentsNumberbeingTrttaMiufinwheelswhichinrightdoubtfulopinionsastutenesssouthernwouldSharpemeetingattentionbusinessMountbetweenmoreFamoussutltcientfavorsothersgeneralIlirnbainplivxuMismatterplant-ingattendedoverflowinfornutlguaranteedprac-ticalsnuisi-IfjvBarclayleadingWConnerheino-cratsinornintrchangepeopleWAXTKHSALVEMerrittspollsinterestsRemarkstakingdifferentgoodlycommitteerightedprettyfoundJohnswouldPublisherworthyjnoplepilloryvainlywouldStomachandFurnishedhandswhichconven-tionweighsduringtryingvehiclesdormant-ItkidneyinterestbeforeresultnumberbetweenWheneverpresentpaperkeepsouthernnumberactiongreatThereforeFRIDAYforfeituredredgethoughtwouldwherewhichhavingcilledtowouldEnteredcenturyNo-vemberMandaringreatDecemberstampedaskingCanalcountyTHEIloadhawingvirtueMajorcanumberorderedshieldindicatenumberissuedTheretroublesstrikepublicstandhimnu-orhankswordspeopleIcitithatcwouldMONTHSaddressiedrecommemlplannumberCitylengthCressontroublespossiblecomingsamplesdeliveryXVilsonISrevardpos-sibleulti-matumbrinsjSunfordissuesviewspositionIJrevardyears-innumbercountyhere-onUrevardJKXS-Mblyuhjeclkeptdesired-ItdrainedfollowpatentthinkwinterspresenthonorlimitspeoplebecauseOrangesaverageplanStraightnothingprairieaskingMeetpointsbalancecondenseSeedlingmatterihmentnearlydiamuturvisitingbranchedpaperheavypowerChesterJupiterrecentObservercitizensenoughaveragelaborpublicElectricconditionVAUEYJoebelstatementhencethedele-gateJocylenlirevardorderedventionavoidedbuildotherassistStatitiiitMilnoveltieswithoutsuppoetheyQueriesilflivrrfilAMnearlyprovesendingcountytakesmadeParnellsterlingUnitedpatentplanssolicitedobjectEVERYpromisedrainedhonorlele-iititesItcTlFUplantedDixongmaketakenReport-UtakeswhenLAMPhavingrightsseriousUrevardfarminOrangesideasOBSERVERcountyChicagoChicHgoconsultwhiletrustsdiscussrelativeTalatkatroublefathersmakingotherotherlattermanyCressoninteriorsmugcountyWEATHERclearlydoingIRtheseupongivenrightsWilsonTheyresistFloridaendingRohrDlrrbeingSUMMARYeasilyIlAunixfeedingcountyconvencourtdoctorsThereTrainedlandcountytwentyWeatherwhileWithwithouteffectivegraftedplantWeatherrewardstretchvisitorsFloridastatesdiscussWilsonpignutfurthermonthlyinterestreadycourtthingsstom-achyearsleadersHxUrbeingshouldSeedlesscourtpatronsgettingSecondpowersdcrire-toAmongXVultenOrangellarritonaniseWeeklyequalinchesCommoncountySatsumaKochestrrhavemonthHatterKeitturkmotionalwayseludedelection1900varietylampsLin-colnThatamongWeathercountyarrestabsoluteOrangeuchslrvoicedisearcchancebottlebottlesexcusesMadamechosenDiinickdoctorAmountlowestuponideasgraftedPeopleTnitedgrowthdistrictelected111-1711IUIIQuiteissueVeryIndiangrovus-onfollowsSeedlessBuddedGraftedtimebeenexpeiiMsHKSKYBittersclassknownMusslowestquitetalkedrainfallGrowershouldIslandbeenspringFloridaarguedknownincreasequiteTunlifftheirurgenttodayIslandrainfallWagerThisBothfavorEditormostlysuchMessrsknownknownointedneitherformeranlruiReportplayreplywinterweeksactivehealthtter-muquiteremisedearlyHalterherselfshouldshouldrainfalldevicehealthfollowsalongMorganhopeMichaelhealershouldval-uableaffairsstateeachdaysHa-statedaysMaltesehaveRoughshouldOuiiityrainfallShilohjsiyinnrightwithbeforerihtIomostgreatblowWorldpeopleKolryssuchmarriedbetterStatrtowittrulyconferLinehaveiveniiiili-ltalalRlamesWeTunicsenatorHonorderslargetreatetl-meFloridactateaspecialwheneverdeMiMisKidneyHomethatgeneralTheeachsenatorvoteswishNACEUnightbeforestatebetterDixonWhyactionissuesIlIcillinSALEotherscourseaskedsouthernnorthannouncegiveskepttopicshavePaperdutylinkcalledcaliberdidnthopewhichJohnswhichIVrihsuchbelieveCocoaonlyMarrieddaysdaysnormalstatevoteraboutlead-ersIXfiisestatestatereadersnormalgreatstatedCENTSFloridasalarygoodCocoatildesU3731CObe-forewouldMeansleptdruggivesyoureLemonplacecustomwellthatwouldThirdyieldwouldher55beforebelowtravelFaberIntoStatesloyaldaysAwfulintoinstpartymanybuddedingmakeSomethatgladthinkwiththathoesdrugdoesHankswhichBureauUixoustampedlithiaV11SONshoutbossonlytheyentirelymattermannerofficeyears19thBUREAUThewouldherothroateditoraboutwellwhoonlygoodseemsloyalcitreftdgaitermakeheardbloodseveralthinkex-actlyyearspoweronlythatPointwhilesaystomers-VnorthcuredbestplanGrapelineCityaxlesreadyheardwhyUnitedwrongandvotersyearsyearsPointmanyinchesSugarthathopeTHEtailedonlyveryequalgoodbestJOHNroadsthisbeingsouthcuredwho-atTheTheTHEaboutstepsfullystateUriEveryCityyetmatterthisyearsgniftsAfterrightthissouthmadeotherawfulMarshdoesforthchecksnorthleadwhothinkParsoninclosewithoutthisletterinducedbmenorthGKANICountBewareK-inuieiiimeanteditormadetherereservesThewhotrialhowwhydownwhilesum-mertionpaperdrainanietheretrimmuchwhilchonoiCityunitlemonwilltheirseasonsdraingetNighthottertheirthatthatyearsLiJmsJoygladalHivehriduEditorBrowngiveandtodayAfterLAMPSwillEditorllIltIIldiscsthinkvalueplattergoudaafterhavenchIsavedlittlewhyIthiiidandwrongthisandIcygreattherecurrychestwouldwhenvaluewhensmallandandthirstRubyadviselostpenmnsnannyorangeLakeIndianconstJerandcuredSunsTrialbeforewhetherSTABwhatrutjilUcanalthosetheretiadeawaytherepartllewfllknowclearmakedocsButlandsknowmatterlintandfindknovschoolHuntaboutthreeminusThereatonecanalconfertrulyNavelCovIndrtPricewindwilltallydoneknifeFirstDadeanisewhengetuhylastplacewillhomesandandDadethirdwriteriverthourolevsriverandalsoMhiMilelecthiveorangewritesUCHSindtvarwhichlhroltKbutsamepartsJuneTotaltimeKillfavorvaluegladlySonsthereanyWEATSBriefgreatleastDistUDadeXXithbeforeleythemworkhasTreestourseonrstbycanalandsurrlylargejustwarranthadeWHITEknowtherehandDaderepre115SmuchrevenueehoieeHomowillhavetlmebeennuttyleasttitleworkalteramounttheparthadetiesret-11111seemJUlIeinviteshelluntilclousij-Hiorvo-terPlaceitemsfromtheSomewardtheirwithuponthecarrytwosandwiththehaveKifliievtherecasesmakerstriedreiiutivlawthebutriverThulehaveRootsPropagedthetheythethegrrliiqtimeDeath20ththeirfrontriverhasfeelstheSomethethetheFruitweekNowthosesuhteachbeenneedtheparhasthethethecropsyardthentheonlyTerrorfromIjulyfromhavestatetryingkuliuTotal1lorirecentwithsuchcountTotalbylawthemINcoursetheHefrontliverStatesfromThisliverthethatreasonmilefewSTAllthebystatesstockbeenThisvailthanthefundgUnvotes1890thathavestatethemhasthethewithmarlbeenfromsaidtimetroutHivedhouseNBVthethatroadStaryearthewhatmeanYork1885yoursinceheldeachFinNewthethethethethethetheTHEladythatthetheneverTilEM-Vff037fromtitheifnefrompaperthatwithpiMirthenthatthatplusthelandBoththetheMaylady890HeroadaatredyourJunethatfromfromlindfourthatdianweekstuckstockvotessaidbythethewishsuchthenbeenthanthethatroadthatJollhtderfulwardYaylawhisBoonreaonKntlandthatthatIU78JALLhasthethenextweektakethatThevard1809363byleatJunewhatlocalSourheld600meantheir754theMiMmadebottleladywary753everyJuneIxttkgraperainhisMr792howllInlhavestatethebyFinMaytwoAndmaytookMrrenttakethatHonefavormallsomewritesthathasthatthatlurktinthedontJunothatbldgwishstorelandmotiveThenllIltliltnotintogiveNewwhoInumHALTIltOneOIFThisHePERstoresaysthatthisandTiltandpaidvotesandandwantforyoureseventhatmenParkImiiilliamlshellJamthealthsaiddealthatFORStateWOIIIHHmeantakevardtnuifairlintJJlastandandthatwhowhofruithimwayandinto1891lunikEachhiswantTenthatThewellhishistlcularforyetOFvotesNRVthinsmidhadsuitwanthaveMrsMFOFOiltimertalnmforfromthatcuredableShelliudandsomemustandandandlampJr1llsthisWUHsomewhonewimthatIhSthatthatthatthatthatfrothlinethisthisRatethisthisandMrthatslatsfromurgenitrefromfurforthatTheendandandfirstandandOnethathindeastandfretalothisIronssomesomethanwaitsendwithmentheandandandandHudundmidandandWtalkandputwithandfromfruityetUIoIyearthttforthatStoluponherandCatguyloc1IplampsudssendelseJivKJtreesneverDATEandbotheachvotewoohutvotehadhadfuiulmustthatwasillJauktcantianyandfewViiiithewillamifuiulIriotinpuninchsomerallfortotupfruitwaswerewillthe5thmoreinchhadtreesflagtheibistwoinchvotenotcanColdyourtreesi-roailthesheondhullsomethehasthehailJ4JltrherlivewillhaulwillyouyouthelatnextanditshadupupolYaallyourthreefor1899thatfIOWIEJtlirebutthethethethedilllastcashHatethethetheourhallwillthisthisanythreecheercoasthewhorushforlampdohasiiiillthethetheliltsFlawilltheheurgetullythewillIS6VthetheiushwereieoihemoreThetreesthewereArefcr1900thethetheliveandrchetdosendFreeStarrightlatethefewonlyuultvthethethetheshemoothatwillthetheeayacresbybynotdotrotsthati-aidthentermonebeadmasstliewerestateON-tilimittheleftthethethegiftSIX1900newsandthethethethethethisThcevenonethinkIliUIBOcomethinksayroadhiltsevertreesCureheoverhethethelanItsthethethethethethethethethethehitsthethethethethesayuedevenbywerewiolheatButwillthethefirstlineintoyetbestweresoonlintthethethethethesayhasourthethedidaptcurethi1900andaudthemoreMAYbvfirstMAXmostYoumaywayandthethethethesaythetillhathertheandtiltthelife542sheandsizeandFlunearandandandwillOurcannameevertreestheherhewhoRoojOurthethetiletheIJreoOcthetictheyearandwillttleandhelitandandthetiltfuntitscurebygiftthetiltthethethuswilltheundandyetandofandMAXandforcurebete-lgdontVMtheandandbudforthetiltthethethe1wthehermanyJanamidwillwillbybypayandbyleftheoffortheofforofofandfeetthethetheREVminehitthetheLurelifeagotliisthisandfairINMifeltalfbebutforxiidforMIN589thePuttthebutnlvrepbutthesellsfiphisailandnownotofofoverofforofofhr1SeyMaIupnHlIIIyIS1l>1-PIitaaIl>aaiI1tIt1I1l<>rIa>a1I1II1iI>arI>iiI>I>i1>iIi1I1Itjt>><+>s1tt>a5>jL>IIIlIiiIitrl+a>III1I¬I><¬¬>¬¬¬>I0H¬¬¬¬ico¬¬¬l¬¬¬¬1C¬¬¬¬¬¬¬o¬¬¬¬¬>¬¬¬¬A0¬i¬¬¬¬¬¬¬¬¬>>¬¬i¬>¬



    PAGE 1

    FLOII1DKSTARro-eHECOMMISSIONERSTITUSVILLE1ClDET3LCONlCSFRIDAYCURRENTundcrwentexaminatiouMEETINGOtlesGOLDSMITH-SProCOUNTYOnselExaminationfollowingnamedLATESTclumh-Wediuvilayconvalescing-MrSuperintendenttiUdell-Charillerma-splcnditllillwLOCALJUNEnueCtihlf-ciHiulMrGoodstraighteningNO7CTMcCroreyGOLDSMITHSacknowledgellcnmiingwayinvolutionSchuylerTitusvilleGOLDSMITHSThompsontwoyearoldcomplainantadjourn-mentrelationshiplltmrhuCub-bThebiideimprisonedWednesdaypreliminaryproceedingsCRAYFORDquestionsuper-intendentailur-KeniieygnlvfiHizwdWednesdayguaranteedimpoundedVOLpreliminaryTAKINGricnltinal-cidlej11iggint-iluhncommissionersWednesdayColicepliollTeachersinterpreterpurchasing1900supervisionimmigra-tionoceolai-iMtntybrhlai-ciKipleCENSUSas-GeorgianaconsiderationunieasonabuXXIregistrationperformedexaminationexperimentoccupationdischargedPChanceyFLAChamplainexamiimtionJSLLsolocomotiveItockledgcSharpenutiiciuliuJacksonvilleBUTTER-GONotappointedMonday-MrattiactionsappointediHtljatioliviitMrappointedexaminingills211100appointedCorpusBqfDCCaMwellhtiIIPllef-ullSeptemberivissimmeeexaminationJack-sonvilleWashingJacksonvilleoperatingPublicocom-missionersafternoon-MrprosecutingdeliveringAgreementespeciallycompaniesappointedtrightunyesleidaycombinationexpenses-MransweringinformationCARROLLouilingapprovedinarlspiiialexaminationlIaulunlCARROLLProvisionsIltls-tT114t5spendinginspectedSwitzerlandOwnershandwork-ofattendingThursdayDelespinellitluarillMlineccsitatcdhesitancyquestionsex-aminationCARROLLspendingAttorneysin-formationPritchardsUayniondSaturdayKiehardsonmemorablerhcumatiiuChappellprrrishYlJackson-villenominationtransferredCleanlinesslalttuedcelebrationsfollowingap-pointedOrlandoapprovedInspectoraccordingyesterdaytlcshippingWoodwardcelebrationprisonersfollowingfollowingTitnsvillcssummoningprobablySchuylermothel-Whatinfor-mationreturningytftenlayinter-viewedAIDIndue-JonosDesipotaProceedlucBprevioustransactedSaturdayHardestyFittingsHappeningTitusvilleMondayim-portantstaiulingcentrallyptopoedSaturdayim-portancecommitteecandidatesSaturdaySaturdaynattmilixcdaccompanyHnghlettreceivingcheckingappearedmratruphHabeaswhikeyNorwood-WinspectorSurveyorStephensPropoundedrikHuutNumberIxesburgsuppliesAnthonyconventionnhibkuyacceptedsloppingTuesilavregistrationSaturdayJeffeionConklingcommitteebuildingTuesdayTuesdayFourthpreCinKiIpatrioticconnectioncommitteepleasantwhikeyNoticepromiseVNTKI-MtnteesltixprjagreeingAAStewartDaytonaGroceriesAllllOIIIUUMIUMllfcMon-HowcommitteeHendersonpursuantDaytonaWctmoresiHHrvisPostiiiastercmnncratoribuildingskipjackuttirncturenpigedrunningan-nouncedmeetingmonthlyMondayYuillaumeTitusville2118-0spffialHrevardsriUiltlttSTiHlayTuesdayMondayconferenceHopkinsbroughtexntninwlinleriiientaiostop-pingMondayManagervegu-tattUiiTitusvilleArchibaldcertificateIlAUPMItTuesdaygastritismeetingspropertyMnglish-laddsxaftElizabethexaminedpetitionTitusvilleKerounesMondayweddingpleasedIlamlinchambersMcMillanVltPKliumimiaUchairmantustyleafternoonSundayresilienceexamtneilTitusvilleTitnsvilledepositafternoonittrtelimClintonscarcitypoitionChairmanrailwayHendryCocoanutconnectedpetitionKmiuteratoriiac-ceptedVinelandSummersdefendantMcMillanMondaybirth-dayafterntKiiiStockpleasedcenarUryTiluvilifSundayfishermenattentionGertrudeenvelopesstatisticaljHnaltyKenyunSebatianchargedWuijsiUprfrsrirepairsenumer-atorsshellingopenedforfeitureilisplnyresidenceChesterschedulecaptainMorganWelcomeTurkeyputtingre-portedbeautifulafternoonSundayTituvilleelalxjraunftcrnounhavingWilnuireturnedportionmakingHrmldockrelativeStClairSharpequalityarguedPenneyportionJulv-UlMllalwidowedShattuckHttendintcliainhsdestroyMershonpullingJudgeafternoontI4tldliinsuranceattendanceSclmylerelksolhcoinsuranceGleasonsouthernchildrenlightestTues-dayaf-ternoonOtienllniittportiongrowthrailwayvisitingPostollicvbalancesiironcuMiliuiiGer-trudetinworksRich-ardschaincerenmuyAndrewsattendingCountyhearingrtitrntllOrlandoGuuldenhavingWalkerbusinessalwaysexpectsFridayfishingW8herebydifferentcelebrateduringhere-withtliiUrtutreturnedatlritiiemmleanprovedTituviiiidifferentGeorgeSharpechildrenWilliamsCthkiimlandingMiamiscuiivictUmcollectorItenakerhere-WithCoikHuxnortherncollectedIlittcIti1lbroughtspokenbejtllhVlanding1IhtvillwhetherspreadmaterialattachedowningspreadSmyrnafamilySidneyTibbalscomingbuild-ingAbramsbetweenduringSummersherebyfamilyprovedLymanMarynLuiulKrCoFutch-UJchangeWrightAmsdenreceived1ragitiferrymanduringbusinessOctoberreceivedpointsbetweenAlgierspreciuctinlilniiiithDeLandstrickenChancevFoundryIkltlyItntitipulAugustaccountantuniformOrmondtreasurerhavingpostedteachersbusinessMrDoinililconplucolumnsMon-dayTitusvillepublicJudieJSeaveyELGINBonoOrmondlargelygovernorClaudiaKanfallawatchespresentfamilyICng-inuurminutespublicleiicberscleaningaskingpublicFischerreceivedcesspoolBradyiuldsmithaccountsnightsHiiwlonlymanprintingHrevurden-gagedIlauitliupeoplereceivedbeamierpointsenteringdrawingHoustonCoehranFranrcnSchwabpleas-ure111111ii1LbusinessMendelJohnonWalkerSanfordcopyingcopyingJudgeturiiiiunJudgeJudgeLosleypricesmarriedDeisnerSeventhbrothernotifiedinsurancetenlav-onorderedauditedAuguttakingTilEenteredteacherscountydivorceafter-noonexpensennmlxTtreasurerGrapeCitrlm-AorderedDeharnlthaneexecu-tivehuts-gisucPresentTitusvilleJudgeleainirDeLandVolnsiafamilypublicasiiiehHisler-WwithoutarrivedCharlieplateullivnumonthshtsthtiCoikiihuttltackltliuiludlnmiKTtipttnllllagoonorderedCae-liuobnild-injClydeManysuitablere-ceiptarrivedStewartTibbalsWaltonThuIItUJudgelumberMendelanMiuitCSlmwreferredGuineacounselGarrettMauriceVolutesrelativeorderedpubliccitiensHrevardsavingAttttanmhulpointswaitinghaulingiladwinIndiancountyfeasiblemonthsristownfjuMicliladwinPowellWilsonMendelrefugeHenryJudgeconvene-incuitllestre8urrfurnishattorneytoopleaeveniloratorydistrictVfiMiiiisIndiansWilsondistrictV-HoltonUaileynotarycountyHintysinglejudgede-liverfoprwarwarrantsWalkerMen-delCircuitFourthjanitorSharpeschoolsreportoflieggtiIndianbusilylivingpersonscoloredplatecountymonthseriousdistricttryoutfurthermovedDollyfathercountyWalleroclockchurchTHEYWallerfeedingTancreweihlinluckyIjiKKhecountySheriffmotheradjustWhitlmkGallieJacobsDodson11at41tChurchpaid-WfriendsnoticescountycountyMentionWilkeslaunchningsccuiorrloadedcountyEmmaKoperWatoiicounselCariileSoobieWilburpih1FanniehutiliuxlocatedGrillstandsspeakmldresWhereJ-lHnlaucountybeingNECarlilebottomclunginnreilBank-ItpersonsJennieOrethlOtxvelldaysarrivedchurchocliHkhandyKloritiaMartinWalterItalit-CFourthMarymodesthoverSpiinservedinnitinHtggshabeasreportKiHirthlongturnedcentralwaitingchurchBreezeUiKiKluItakiiixmitteeearlywhikturnedMesjrfhaulingagainShoalsSchoolhead-ofKulmalimingIslandointcdlocatedMam-WsheriffCtJiulileuMiiMikbeingexceptminutesattendInitiHlmigedquiteHurtustoningreportfreightreportUKmhcMniiifplaceInterestFrontTimesPuvattCheUVCilienPauperpemlCarnesWherewhichnaloivnightattendMessrsIhluroIarUeihristgclrownocliKktnneinlralliedMarchCarriewherebeforewe-projM4juitelaityitumtiiiiailyattackillncsHBESTAccountmonthcouutyquitedutiesBrownStewartwholeSmithElectricoidersplacepointphtcereportluwiarOftlclalJeiiMMinightraritygivenMillersawyerGaiterBrownbeforeMillerWriteprettyrejuntcalledaUmt-itninthCapuOtudlWhenwheremhuulFisherWhereArtiiiuschooleiuinClriilisMemleltowitPowellJamesschool1eilflicostumerattledMillerUriflisplaceplaceribbonelandMattierutlrsdevisecalledpricemakeGrantdutiesWnMinnitidRiverhorsesococktrulyCocoahomesaccountAroundbetterHatchBeachCratbwhichcountyWaltonhoardMarchcalledcalledmayorMooredaysGoingTheirmulletfatherttseiulSlatteraPiercentntleFullerinchesRiverhousehanielquiltper-sonawouldwhose1sisvarItlaiiliiuileiitalHatchilllmClTherehonnJonestbivi-orMiniiikrCastleJessiedancehonorinterestJulywarrantsGroveboardquiltferryItravarilsouthbridalliohhettTheseErwinAilitiiiGraysalarypaupersStewartunderHelenSmithboardItwiNICEiitt11schoolKriuedrinkhousehutchjirantyoungPipeWorkpaupersferrylatheMainDodsondowncattleCaptLevahfollowaskedbeforeSuptwherepcndamountiritniriwhirlstiorihjudge111-1IOkindsboardHaveblackltev1OrrellmadeboardArgoTheUitirJoneslarlislumbernotedwhichwhiteJonesJonespaidweekYValKcrusilltniiuleSesalouhindClaraaboutotherwardenhHieBenchcontractbooksPalnaChaWhatmanywhilelegalpaidiurdnrnltlJuiceJulylargeAaronjailorliniiherJulyIRiurhomeBradyownerscountyhoardFinchmany000-ITeffortcouldcountyhomeboardladiescouldsnakestockFrijjltJunenightgoodrn-ITotherUhllJonesoutfitcattleInclekepthighninghencetrininustoressouthtakenWeekshousemanyboardDavisdistrictcircuitplanFORMittohtilispaid11-1MiloTitusletterTahitimuchhomeTHEriajrfSadieproveSouthWallerplcwhitewhenWhatWallerliriiljiihomeShawthemhoardFarlitheirmadestoodAlmaSuiiufreturncullWhatbirthTitusJuneStatein-ThepailLouiseveryUiardCocoaSusieMathchtgynuttyMunchbefonMIHJIIstockSaintthreeil-ISMayladyulloosenoelThei-JlatterPalmThirdsisterKnoxniaiiltwoodMoldliningofliceHotelLighttlirrtoperaorderWhatawayWhattlattheirbridehandweekninhtmurkboatsmanySendpactslettervenireliavtCitywoodmarkMimiiiermottoshowJuneWestFriestradethesecoun-tymodeLiMiiweekmuchamonihawsouthCoatspoentstatesstoresshowfretsletterloneJohnhohjweekbirthPalmtheirt-ituttulWilsonWestleavecreekcrayttuuldownbullnumlsidesthoseSuit1000-IDyearscloseBeachIVtlvAmosFriestheir>SamsAREClamtheirclerkSamsbondweekactinghoardclosetriedTitusJunePenaltheirriceiuiwfbrainwhenfryerArchItooaccountTheotxmntxbirthbet-terhaveFittsporttheweekwritestockFriesre-portuntilpartstriukBrownlavePriceJuneSTARWelitruwtioniumoilheentheirwiliuweekaruteteweekweekAboutweekThurafterjustmienmanyJuneFriesgistm-amitheirFriesPriceJohn10500-JAfterMissweekMainbeenMickItswlthemhaveLenaSnellBidsbeenKinwithhUeJohnworkEelweekdonehotelhandS-avantshell3750-Alaw-AIjenaweekstates2011-a1withsuchyourtautTookweekYorkollicerdaydayleaveIronDorariverOslmuFourLmkfromfortybeenhiMirMissuntilJohnfrontsodawithpollmakeOrrellfromafteriihhscltlkcityfundfolksshellIKvoeISiuwiidaycourt11thviewYorkGnuyourhad-ahavebeenBriefwithtownfundIIttuWhatMissJ11fromfromMisshouseTheiKtiiMisslaiewithfromhaveitviii4KtundasMissfromaltarfromyourland3000-KviewfrombeenMhsbothJonesthatlintKingMIFHMisswiththenFurlfromhooksYurkwithAAIjikehaveianllcyourthkvisittripvilleLastreadbeenyourMisspurlduyIHCIItimeMissroadlucreyourriverinchMisswithstatefromThisfrombothMisshaveyourTheirnamedfromMenwirewiththatbcHneachwithMissMissMissthatMissMissroadwirecensusabarvitalhuntyourwmkfiontdodEcruwithwith1500-JjuryIJWMIroastvisitSSli-FfrontTatefromtssnrtMissyvisitbillsvisitwithMisshi-IMUIneedherefruitsterheldtJninthenthanyourlaveEauKurtHullrimsvardloomswiferutsdatecen-susiilnetreetwithyourbeenWeekcensiiawhotownwithilveiJontroadyouryourbidsintt205-C2713212100TownThepastThelutetakehMwifeivedtaxesKMM-IMlullthatthatcornerwellTUBroadsslayhaulandllasTheholdhereNewwho33211sivfiiNewyearsaleiisitlJelHowthisMrsMerat-thtdidingtakeUenTheTheThepartthatfurandSupttemM5000-jyourfunkpertpertliiiithissctMinitilewhoworkIfssaid750111TheWTmicworkTheIautIUh11ttownMrsandalsomeetlimefirstDrewfirstTheIlNewyearHanklieuse-cretthatWatThetownE1lintWinwhocityshutyearunionandlastwt141411wentMalveryIieKlyearcoalOurbestwritlatesaidtnUITheTheTheThelastSudcourtfruitNewtrustworkthisantitookauslCullTheWinitkenullboatThesaidTiltMoltimeintoTheThethatnidseandwoikthatTheTIllcourtlineandandfirstalsotinthaulandeventFEUtilirndsehn4YouThe14thvisitsuchstatenextsoldyouthisandrouteandstatemeetrindthisandHuesandTheMrsSunslmtinI70-0lestatertieyouItHiikIittMorStateSonandandworkMrswillFriesThishurtTheantiandsomecame2578intofirstSumshickandand11EUKMI1itnlYauntlingandlulwillandauntandTheandandthisMrsandlaysomeLily72t5Jenvieliawlandand1trsandnhtll3000IunltItiyouSonShethisandthiahadtrillandthisTinanti2500tirstThatSamlustsameantithisTheWeLosthisMrsandandfinewillandHill80700-JsineSJtututatebigMrsaminedandandandlayUyfundftiioCanCainttellFslaidandroomsomeanalantistiiiandthatley33335U37theKevandMrsmetscow2340yousameantiandandamigiiig1Kiltinncensuslssiiwillputandand38willlastescurlGetnextStateFordandnameauntahelastwhitcarewilltiUerherSeajailsomeandtheFinandloudfewfeetyouymhaslastanilnullyntiyonsackthetheandterm2883werewereniilthethewirewirewillthehasgetlastwinperyouFttfuelyonthethemorewentcourtantinUllwirestuUCantheroadthedidhitsroomWetish111youoXlrtHid7010WshecallwillthetIntheJillthenextThisgir-Jcourtruedtitsthethe1CjailthetheothmostOAKfishthethethethethethitthehutswillcourtyoulintused1110theleftCan1uunnidoflefttillthethethetheleftlastDiretheltiitthethethetheArtbytonwedAIcoiurwereextratidherIdathethethetheIllswereprothethethethetheS-IXtheyouat-MyourevenweremvreverhiswereihethetlititheIIMthethetilKhaythethehertonthethethethethethethethethetillcimnoverMrcros81224ruednuultheperthehasthehascutsthethethebillthethefunoverthetheihuthethethethegrtownlifeovertillthethetillveilthefeelthethetheper400hathethethelutlthethethebidfta12werebyinnat-anthethethehethethethethethetinantiillIrethethethethothethetillthethethetawhisMrlvoMrwerewerehasJOtthethethelVbytillthetin100hisHeirovertinledthetituuthethethetinUwFinthelatapiKJ300MrhishisllssgetbybyAllhistobytheforthefortheMahisMrtits100800hittateoverThebyueiv4ureMrhithishisandbyforTOE1MrMrMrtheMrnow500viaMrcsttItwlitwulecom300000thetittiltlieovercaseHUCtheMrbybyouthisnilMrfItMrnowMrwritMrforhufornotMrhishisMrtheforI-hsMrbyfurOnA-Moutfor410500210300225200lIeHebyrihbyfor400rthownforfalltinhisltliowOnfor000TuforrentflatnowSatTh200liaswitsfarMrfurforwnonatforArewitsnmrforIna530Mrieo813forMrwaswas11Mifur180400furforwaswontiehitBroMrforHeAtfurtiltfurforwasamitt1FurforwaswastlaisumfurSonforwarsWftsrlistallforaj-JHewaswastiffforamiwasof1Lammsre-touttsSOinnewtootwhMronfishwasnut130corforforforntetenWaforoneJuheIrnuttinUy1MuItlsstsaredwaswaswaswaswaswasIroalltntoutforV-IIMiniloutwaswaswashtwaswasforupalltonliftheaeoff100luVUoficehetItWitCoiluKdtax1iicealltttthewasDrMilubeilartupofallHintwaswasphicutwasallhelybeWareWactoursnctupfiofofwassirforupWallOnbelyforbeofIInofforbefurofofWruntillofofwasplutearareoflitMhewifHWS-cofN-KcarofareofofofofofofofalletchebeforttstareofnutWfolthheofofofarterrofIIHofofofofofofofofofofla3ofyef-zU4ofofliofattkWofofofofrisen-ItofofofofibofofofurllitJ-MofofofofofKiofillisisiofofillarelilyyeWforufWofWofofofheofoftM-Xareanofofofofinr-AinofreofofInheWofofofare251Vufweart1iJPJJKAvvIJklSJIHliJaSJIstLJkjtnn0IiIJJPJtiaa>I24>aaaIIatt335a>aa>aaaaatv>2ISltaliSIaAtta>waaiill11naeaaIliaauatILislI11IvvItrIItJoI1IlIe>>Iixssrt1t1stI1tIt>lIPLirIlI>tlliIiI1IlIt>>>>l1III1-VlI>>IIcitlf1tI+l>t>+iIItJt11iII>I0>>=luI+I1sj1i1u4ititf+>i>i=f>>I+IIittIki4>1¬tJt¬=¬¬¬>i¬c¬>i¬¬¬<¬¬¬¬¬¬>¬t¬¬¬¬f¬¬¬<¬i¬¬¬¬i¬¬¬I¬i¬¬I¬¬ii¬¬¬>¬L¬¬I¬



    PAGE 1

    mealscooksWicklesscoolJORSTKLWIOFUIIDILLM-CoarieStoveI-tFloridaPOULTRYCoastotandFENCEEastSteamshipFortificationF-ortifyrrrRyOilSta-rWesurxoroNJune5Wblleadvantages9aT-yFloridaitdthermometerTuttssufferingconstipationStrongJUNE89OregulateittaigiiidLivercookingCoastabsolutelydiscomfortcookingadditionalWicklessPillsflywheelordinarySAVINGFairleighwhateverwhateverDKVKIOPMEX-TllminaryEastcheaperapproximatelyjaundicegratefulM0superintendentelaborately-carvedWicklessIntercollegiatecomfortusingFENCEA-SonLocomotiveyoullDeKalbheadacheCorrespondenceFLORIDAundoubtedlybroughtFRIDAYUNIONWashingtonwith-outAnUu-alnSIllllllllagainsthottestWheelkeroseneGENTXOHTHIJOLXDPhiladelphiaFlamepocketbookbBETWEENYoullchooseaccidentrepresentingruthlessness-ToDrTutthandier701Ii-ftstomachdisappearedBETWEENundoubtedlywithoutppsiaWashingtontryButtemptation-IsdayscleanerInexpensiveneitherapprecia-tiontroublesonlytemptationsSTANDARDhysician9StoveCannonexceptionalrepre-hensiblekindredInspirationmagnificentPahltlutArgainFlamemalariaremainingwhenPalatkaArlaudable-butde-lightfullyFlyEmployeesJ-2Ecomplete-lycon-templateCOMPANYWAmanyHAVANAInscriptiondis-positionassociationsparticularsPARKERSdiseasethoroughlywhileFlamemeasured-byPROPOSEDDevelopmentsmokestackFiftynineexaminationdiscardingInstitutionsimprovedLiliuusplayroomsuniversitygymnasi-umthe-Signaturewashing-AllrecommendunpleasantcounterfeitsKUaI21citlayspopularitythrough-outdistributeddestroyedsmashingProbablyprobablyJiealinsThoroughlyprotectedweighingSTKAMKHribodySundrtys-ArnveT-KEotweenneedbuildingsBlueTrumpingvandalismregisteredauthoritylegislationcondition-ofyourcapaciousBinghamsmokeCoPERvandalismABinghamwicksSAILINGSBALSAMBInghamTitnsvillolocomotiveWednesdayscookaccordingespecial-lyburnsnoticeaki-thitherSignature-offiftyninebuildingsStovemajorityFiftynineatopbuttspermanentjMrmeatesJnclcvilloequippedsentimentcontrolledBinghamCertainlyCustodianNoRnNOeWiscon-sinmonumentsBinghamHawkins-IsstandardsstairwayPlattevandalismvrP-atentedhomemadeSTATiONsoruamentamonumentsperonalmemorialswishvandalismHUBBASDsmellstandingoccasionalfTuntouchedlocomotiveHAVANALiverthou-sandslandingsThtiiMlaysevidencedplayersCustodiansuccessiveac-cordingSmyrnaSTAEprovidedKidneyGochemsFoleysLiverexhaustedconsultedSTATiu-NipmemorialbeautifulpromisesDeWitlagroundsvarioussiredcoarsenessprovidedhistoricalstrengthpossiblyquicklyIntiHisedLifearrangedTherecentlyhoggishabidingTheuntowardallowingwrappedgatheredprop-erlywindingYourany-thingrequiredterritoryUruugoconditionregulariUecountrywhateverstatementsorrowfulotherwisewaymonumentconditionIngalldmutilatedescapedSJunctionhistorylaughterremedymonumentThurMlaysCochemsbeautifulBotuoonflagrantdecorated8HtvrtrrlmonumentlitowlluiIYSaturdaysoutbygreatlymonu-mentgettTitUsvilekidneyattentionevidenceBetweenanythemkaseCochemsAuiustiuoentirelygettingbearingEnterpriKo-iiieeessaryIVesent-edcltyInaorsnaanarsSanforddeparturemonumentWESTx2rScCompletewhateverattributeFciiuAUAfllSon-SumpforbiddenyousutUcientmonument5q1d5thIChineseambitionHawkinsBlue82U-aSeJp1lIlKS-criiiiyouthanprop-erlynowhereprovidesuticrorsAt1gustiuoyouplayingindenteddirectedniAMIlauksonvillocausesIaudrrtblloHarvard4tripllMaSTATIONS4tplt1lplSTATIONSSAMUELnationsouVnsiveobjectsoriginalintentionyoustovebecauseattemptsmashedtestingTitusvfffosubtractsintricatebeautybearingrecep-tionhimselfobjectsplayersreverenceInterestabsoHar-vardsufferedwithoutdyswindingThesprainHar-vardpartnershighestputtingwritingbyeruptioninspectmysterysavingstaircaseappliesEFFECTplacescapitaldefacedvandalsWMIICiTOpen-altyIrirkiugdirectionsshallhaventincreasemotivesadditionoffenderbroilinghavehrrnfreshlySpecialpoundshundredde-tailedHar-vardfeaturesTuexlayrTEIEsewingthereinexertionvandalsWiliiflavnumberstudentthingslUtrevIncreasevandalspersonalunlays-Leplacednotableplayedcountedwhatev-eralmostSpokesColonelPills5U11IIlLpitifulwithoutdnelays107MNolcarefulofeeeinaITCHING1lAItKIpe-ciliargreatestcoalshowedin-stancespresentColonelnotableTUlCIfpre-sentsthenumbersectionsgen-uineprotectIimploPillsditlicultspringsimpleColonelMIAMIKCXKMAtaudplacescaughtformerthesteadyplayedSOUTHTABLEathletepublicOilkidneysprintwonderCocheinTheressummitmatchesTitusvillowinnersparlortherefromroubleandOrangeColonelsafeexpectedthecertaintrumpshigulyandEarlymeasureWilsonmonthsthatlife-jwithdrnrOnMKN-TtionpersonsNeva-daHAHNKHinsteadandCrownmethod±peopleManySmyrnapointstannerfollowssingletincespointsArOnniKpointsenoughplayerpm-i0aashamedtabletsSundaytabletsaroundIewareFloridaweightKrulaya515p-5o5poftenerSundaystabletstrumpspoliceseveralwhorlsGrainedformerremedymarredAlasbowelsdefacepossessmarbletabletsfamousfiai2UpLvnotsickSnndMVAPRILbot-tlesmakescostly1-5Srrivoiipoints1111109lillIIbreastremainti1LLiaeasily1nllkeMveryThesefellowothersreportWilsonburnedPicketoutsideBenchvan-dalslettershellingHUStiIlLIcurved3tnIyFiftycaHystory1iIIurntbrokenfamedDasketMusingreHjHGateseuchrefutureBolugtmattercarvedalmostlikely1141htArsiijutebegan04-44ftlPabloplaceminuteSwollengrandspiritFailed-SlridiyiCOSanfordfinelywheelscompanysacredbasketANDluteUnderbeforevandalANDFenceInsetswritesbruiseinstantmuttontrumphadofficeBOUNDbeforeBogMsootmakeshemtitrever-edIrubtWriteplaceoriginen-ginerecordordersbasketindeedfry-ingWorksfoolishwintermikesknownInsidefeelNorrisHiidayHAIRWorksHutlzulll1141k1LvlucetlCOCHKMSmonthsheepknownadvisedand1UIIArdesirestatedTherellHiiLVplacereportJuiiiMimiittpiurLittleaccountbettereraekedTRADEsuffergreetsrecordwagerTheseHLworsttreatmentKEYBlnojhealthschooleighttombslszrNORTHbushelMottleOilMuttonbetweenIssuedrecordmanytricksfallenunderAtlantaletterssummerequalenjoylrooniSnlvrnnfR4-1t5pdealerBoyntonvisit-orsBOUNDreme-dyoneSAILothersbeingbutterHalliiiKcalledaboutfamiliesDnvtottataattthltmakesbasketmakeshenmColhtilravpHiiixfwhichwouldHotaniePointmillersPatentedwhichleavespointLeavegravycuredgoodglassbasketbetterNhtttl1IlKiidaylambsactiveitaelessilverWitch>therelargewhichlargewhileletterbrokeIleeiNOrnnndthreereliefbeing511-Jpbt-SJIlptroubleeverystrongvariousbasketotherwhichmakesbas-ketchintztLucioPostsSanfordthepriceswhichworthleavesSOUTHwhichotherIthewhenl0lirremovedeucePnlutknstonesfullySomeorderlatterworlddozenfencelightforeverboilerwouldAlwayssteamerswhichwhichvaluegravyPIentirematchjuicetightothersufferthoselooksibfirsinsidelemonFieldthetheremvwhenthosetakenOthersmanydesireresortsTillullwcitedtheSUlplwithoutgravyOrangeIIrcththeyvaluemakecardsflemlcanTIMEgamesHaelpilesreachmakelxt-ilt4prighttintiitfiexeeptyearscardscardsDailyneedsSalveOstiin-VIitauiialonenitshouseonlyfromonlyothercannotpillsbuttlesclassHavanasour11nsr7removepartswhenitSmadeextentmatterwhenmadeSalvepostsonlyuinirHntetCureeveryofmakeofGamegreattriedcfevervalueforonlykingjackstonesDrunbttriveotherMiamicardsmanyWhenArriveYouthfulweekSuchTne4lashowKatintstonesdelayhavegraceBA1MscrapSmelluponadviceSilllilrilittleonlytheir-swhenplayhuntscrapgamewhilewhenlonggladfindsleadsthereeveryprigtd-tQwhengamehandsonglike-itthanltllIlIlIthereforCrwrtleadsthancomesdoneCuredmadelungecemabacklearnhavePiurouworkwordworkgamescrapscrapthey2000arrivalextentHogonlyXfefoeaftertYnllnthetashah2000thanprovenewcentsstdlskinclassStt11tlwcrtUtsatcureherecityscrapmanydealtdealerhandJohnTnillle1iiAt-S51makesrelicTakecleanlinedleasemssnamesgroceritliverpartthatMsilesitreiCleirtriTillsItuuruntwhichtheylungnrisiiitstatnusstepsdColoTablessuchfromthereHalnntestedfromtrainsevereEwithstonetrain1romoteCattleexeeptwhichcallshinteachdelayshallhandTrniiisgarnicitydugfrom84t-itpull+casesllWnlittleloutjointtReiulThiseachlSOiirn4aDailyrelicbuttlepourMumiiPr7BearsfromTikthavebasefrontDatlyHuuchgoal3latuoParlorKEYneedmlorbeenSttn1ArriveseemsMfMidaloserthatLawhavewithl45ptotalOLNila-vormayhaveuiviiiJplboonliveiojupkindmoreMinimliumiottomStuartwithThisRestoreThisfrombakenorfromThenualpourIsewHOixeejuactsthatthantotalBearsThismittthandeadfromfromMyWhileL-10111wifecardpullhavewhoLiltthandeskpourHuHeitwithbeenwilhMiamiITftijdoesstonesuchhavedownfactMadecoursefrom11SawhofruitBIlKstoneinconklargohavegaveuiveiistiitwlactsmosthavewithclearbeenmintuntilfactpastbackdullyeveralthatwhosomestovesBloodOdorhowAfleshVeitnemintTwohowmorelSSpstonethislessIaHMIsomegrowth54JpOILtakesayscasesdayslessmetThebeusedNowusedtimekcaltookverythenwithfrombeenbentwhoRailThepainicilyroomsre-liefdaytonine4iiiiv12IpI12pfourwhomoreMaaaJulywhoyearsHaveverySheiiiiitHwhoDownskintraysuthmeatmvileThethatUutrpalewhoShethatnaynadsthatBackthatJithFeb5ip6111SiSpmore4Ripwho1121July8511SUUp8111IInt1104HMerertrainswaysevenbadandretonanymayKIT2J11stoneeeeinabeatthatBahandthisThe851p515pHoneofimihleN17mostoftimesduetake61511vliowhoandhimmusttimesinnhTheThesaidTheTheandtt5p54UpwentroomIINlandJ7151p31111themFIilSonandandcomecasescasesmayAddsizedtimesrtidthatbestleadmoreand1411NeverandItOpreMrvemusttwolesskenallmostHIntlnutS1807andTheisPulntthisshowmay3IimshalfmidThelinejustPuhum-HLIItIsupJSJI14ipthHrandandandthismeatmintuadslatecureslookare110011thismustevenhuh131HSapCitywaySkinReadawayetgHltaliveundandandandthatTheandandscore45a-CbuttrysheandandwillSkintimcoverctroomandforteandwillfirstfirstthiswriteoKUIamil21pIrisPkriHACKswvetandandandAcetheHashyourthatskinwillHaremoivmoreandandlimeImvoHintthislulutailThewitheribihas112luFretCitymillthis8C-1mIdrilIrhang1UphiremustthesheVilsunkityfullroomcupillssizesandaddGraynonefewandandamiformNo3roomandwilltheLureaiiaramiIUvJ1anysuitthelegwillyouThetheyourtheirhasleadhasand1896FortandKeytubthetheoverleftIllsthatnowulhrskinKindtvlf55a-aitillwestfeetthisandandcounIntoTheIlUkf11OJboxHIathe100herthe211Inksll0roomfulliraiiintin1IHuinilxlfAnyamiyouITTaskHillthetheirthethetheseenovergigbutskinVoJarriveJehanyoumodthtirllhpi-IalovertheforUptheowntheanythethelIthFortisXu4SonCityMOMeverskinthethetheit5IwillWkyouthepureHula>gethasnellijdiditrhcaseoutcabFurtestoverthethe14F1isriiyou1900thethe940UU05ashehashasyettheNolIolslaySunNolyourhasIllsSonhairby5lUatestthethetitthethethe2thethehtiPortCuttheeasewillisnowhasthethethethethePallsfromjHinytrialII-DthetheRhealalitELt5WaJahlwas1-142aEastthethethethethethethethethetheArtherthetwomayi511theNewvicsoldhasrut71aytthethetheThetiltthethehutthethemayCurtye4tbyfaramitheaiunComhistheMopmuseiltathethethethethethe2-UKitthethemanprethebuttheholdsoldtheamiruverfnooverI-1THtwoZeyeSLIPHr1sumtheforbuttiltthetheandtheKnitthetheCarswasfortheXOandctreforbidhidthetheATouttiltthethetheitthethethetheforIHtiVrichul141doeswillwasVestOakt3forallinsHatstheforsixbutthetittheareforandhiseawasarefortedlieTOoVtuiianyOurforwasbytwoTheHekinfartheforbetoldther-CF5poneamiandbyDailhishistheownsixoutthenut110ulpandt1soreiiuiHmytillstheforforhishishisforForriteanforlootbyimlAsrband0111FatleelforsixforlialinilarpwastheareandWIIlielx4wasbntHoutandanywasbyfollfurinstInlaONIdniSTWlilpiftinnullnotandandtrjsixtinMUierUparetoallx111tonnorcan1Sp1111anyVPJSunthefulltheersbutmidHoirToyouandall0tbeItsarelip1apWWtenyouarehislpandtIltthetryTQIakanyAaONSareallAoneusearcruletheonecatoEalldooutoneLrrtheyouanytIIibyItsonetheJdoet-iiHtinarc8wEM1-toetcItsitsBTxiAlllinebeall8l4vareperas33n-zthedothesixofoneseenItsheitsLORmloutMire8IUpheareIMdoofofarehit0XutIIIallbeitsareP-MthotIlltdhairbedo16UearamtCoedsuretheIXofoflirMtiVMIIhenotthebethethinoftheofiviWebe5JofofheofofforaCofolefor57iv25mveenGhairvnheandCOArPeofofoftitofheToitsofofofliet1JamofTYbeIIY5la8falIbIbefillofofofofofofreMDoofofofoftlfheJ5nofsoSIuseaeofOYC5a0CotofofofIJOoft12Lofof4atInMireofreetestoffitThofofofofInAllofArfor511ofofoftininLvInofla1l1beofofofofInYofofinks44ofLVLvLvcapberMiiofArofantOCtasArHIn=ofofofofujsotofifi1lilllArixrunda151IvNnotofofInofIxnrayeAr14aLvanortoInae-U2fnPt51ananasinnflIfatnoUSSnArasanlMlvonillIninInNofofjtInletantotartAr7tolianareLLrJlArLeinLv=RaPillananrMIIdillAllbitasanrunnortototfas=fISoftotoItintheasernilatliiitotonotlieIfIsIsBItInIsMnAofMsIninininink44lonIpCinonas4tin=IsiteinasastoorinsoiUloftoItIsIsisetr=orVIsisisPptoJQatinnu-jinaswtlIi-ItodaIAasoris=istointotototoSttoislint-nttoororritotoILisisIfitaTPisisaIt=ortototoitAorlvtoorUtt-iI-LIaaApmILAaaWaaaa+ailJIIhaaaaaVJJa3Iaaaakitaataa61-lJ5JIIaaaUJi4CM1tt2irStt04iI5JIy0aeIJATI1It1is1cdt4SIinir11stK>41-IMa>rot>ur>IeITai>>1aSrttIljIa4°lvlIt>j1Ii>4iIt+t1l44>tItItItI¬1=s>f+l1>iS+r>+tl+icztlII+IzItt+ittItf¬>IIO>¬I<>>>>><¬t¬¬¬¬00a¬¬t¬¬¬>¬¬¬¬¬¬=¬¬¬>>¬¬¬¬¬¬¬¬a¬¬¬¬II¬¬¬¬¬¬