Citation
The Florida star.

Material Information

Title:
The Florida star.
Alternate Title:
Star
Place of Publication:
Titusville ; Cocoa, Fla.
Publisher:
S.W. Harmon
Publication Date:
Language:
English
Physical Description:
v.

Subjects

Subjects / Keywords:
Newspapers. -- Titusville (Fla.)
Newspapers. -- Cocoa (Fla.)
Newspapers. -- Brevard County (Fla.)
Newspapers -- Florida ( LCSH )
Genre:
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Brevard -- Titusville
Coordinates:
28.591111 x -80.82

Notes

Abstract:
Situated on the banks of the Indian River, Titusville in Brevard County was settled in 1867 by a former Confederate officer, Henry Theodore Titus, and his wife, Mary Hopkins Titus. The town was incorporated in 1887, by which time it was already famous for its citrus and pineapple crops. The arrival of the Florida East Coast Railroad in 1892 laid the groundwork for a tourist industry as well. The Florida Star and later the East Coast Advocate and Indian River Chronicle provide a diary of these developments. The Florida Star was a weekly newspaper published by P.E. Wagner from 1880 to approximately 1882 and later by S.W. Harmon. On November 1, 1912, the newspaper moved from Titusville to Cocoa, Florida. The Florida Star ceased publication around 1917 and was succeeded in turn by the Indian River Star, which operated until 1920. Another Titusville paper, the East Coast Advocate and Indian River Chronicle began on July 13, 1900, as a continuation of the Indian River Advocate and East Coast Chronicle; the latter had been preceded by both the East Coast Advocate, edited by W.S. Graham, and the Indian River Advocate. In 1920, the East Coast Advocate and Indian River Chronicle merged with the Indian River Star and was subsequently published under the title of the Star Advocate.
General Note:
Publisher: P.E. Wager, 1880-<1882>.
General Note:
Published at: Cocoa, Fla., Nov. 1, 1912-<June 5, 1914>.
General Note:
Description based on: Vol. 1, no. 23 (Sept. 29, 1880).
Funding:
Funded by NEH in support of the National Digital Newspaper Project (NDNP), NEH Award Number: PJ-50006-05
Funding:
Funded in part by the University of Florida, the Library Services and Technology Assistance granting program of Florida, the State Library and Archives of Florida, and other institutions and individuals.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
Copyright Florida star. Permission granted to University of Florida to digitize and display this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.​
Resource Identifier:
34175599 ( OCLC )
2071719 ( ALEPH )

Downloads

This item has the following downloads:


Full Text
i .+: F. Ts .
: -.
,- :
'
:
.:: :
-"", ;.,,: : '". :

.
.;.t" :

.... .

f-, t' .

: THE'FLORIDA- STAB. ,: FRIDAY. JANUARY26,1903., 7
O--


firRl BI} riWmmr$! -: great no opinions'many' himself questions,except bat depressed that he, .' Tried Friends 'Best "J< r 7


too,;said'.he,admired ,my. size When For thirty yearsTutt Pills have a S

Some -of the'Retoorces that'Ambition! he, left he shook bands,-and:I thought proven ablessingtothe invalid. SouthernRailway. '

Ter iTDeaer1becL" ,. to mjrelf: that. I had spent a very pleasant -
hour.I I in few Are truly the sick man's friend.
Special Correspondence of TEE STAB.AIBTJQUZEQOT a minutes the con .
ductor asked me If I knew'who I had -
,' N. 1L. Jan.., 17.-It JJ been talking with. I said, No.' Then A Known Fact .

probable that a ,determined effort will I first found out that the stranger was For bilious headache: dyspepsia. DIRECT LINE==QUICK TInE = : .: : it.::
,
-
be in
made the near future: to induce Marshall Field of Chicago." t

't', .. congress 'to grant to the territory of WILLIAM R. BBITTON. sourstomach, malariaconstipation -. -TO- { t \

}: 1 ,. New 'Mexico the privileges and right and all 'kindred diseases. WASHINGTON, BALTIMORE, PHILADELPHIA, "
Baring a Great Bon on Chamberlain'sConch
4 f 'of .
statehood. Since no part of the
Remedy. TUTT'S Liver PILLS NEW YORK CINCINNATI LOUISVILLE ATLANTA '
country is so little understood .as' the ,

} 7 southwest -the> attention of the publicis Manager Martin, of the Pierson drug AN ABSOLUTE CURE. BIRMINGHAM. MEMPHIS CHATTANOOGA a 4n
store, informs us that be is having great 4'
likely to be drawn to this section. run on Chamberlain's Cough Remedy.He ST. LOUIS KANSAS CITY

Neither Arizona nor New Mexico has sells five bottles of that medicine tone a foot below the dress In
the back. It ,
ever experienced a boom yet their of any other kind, and it gives great was plaited to a short and all Points East and West. -
very Rejane
growth has been gradual until it has satisfaction. In these days of la grippe .
: j3.cketaU around. In the front were
there is like
K reached healthy proportions. nothing Chamberlain's Cough two immense revers of black fur, the NO, OTHER LINE AFFORDS SERVICE LIKE THIS : ; '
I; .. The Remedy to stop the cough, heal np the
population of
New Mexico is a sore throat and lungs and give relief within ends reaching to the bottom of the '

little over 200,000. There are a>o 25,- a very short time. The sales ar growing dress In bands. There was a high The New York and Florida Express, _

." 000 Indians. The assessed valuationfor and all who try it are pleased with storm collar faced with the same fur. Via Savannah and Charlotte, If. 0.

._ taxation is placeu at $40,000,000, its prompt action. .South Chicago Daily A handsome lace jabot tie at the neck The New York and Florida Limited 4--, '
,
:. ", while the amount of deposits in the Calumet. For sale by B. R. Wilson R gave a graceful finish. The sleeves ..
(: different Son. Via Savannah and Charlotte, N. C. ,. .
banks of the territory aggre fitted tightly save around the wrist The United States Fast Mail, .' '

gates $3,000,000.The sum of $l,500OOIJIs where they flared to bell shape and .
Via Savannah and Charlotte N. C.
hivested In REVOLT AGAINST EMPIRES. !
public buildings. These were bound with fur.

'.. figures are convincing and show the A second "long coat" was so complex The? Cincinnati and Florida Limited, :- is
thrift American Women Refuse to Accept What Via .
and
wealth. of the people. that 1 despair of giving an adequate Jesnp .
The principal Industries of New Mexico Fashion Makers Want. .
description of it.
The back
was ..
Through Vestibuled Trains Pullman
Drawing-Room Cars.
are mining and sheep and cattle Special Correspondence of THE: STAR. straight but fitted at the sides, and Sleeping

raising. The sheep raising and wool NEW YOBK, Jane 23.The determined around the bottom there was a seriesof Through Coaches.-Elegant Dining Cars. ,,

'- growing "business of New Mexico i la effort to force the empire styles upon scallops, one overlapping the other.It .

very. prosperous at the present time. us has not succeeded to the was long in the back and had a BETTER TIME AND BETTER SERVICE THAN EVER BEFORE.
up present ':
As a rule the flocks I d,..
number from
3,000to I storm collar that reached above the ,'. .-. .
5,000 animals. Some moment though there are some women \ :, ].i-
.
years ago 75 ears. The whole outfit had somethingof Through Pullman Sleeping Cars between Jacksonville and Cincinnati
;
:
cents a head was a fair price for sheep who think they look well in the the empire style about it. .f .
O. Via Asheville N. C. and Knoxville
,
Through :
:s'J while today from $1.75 to $4 is asked. short waisted garments. Of course Far prettier was a tea gown made of :

i';')_' The wool output of the territory will these women wear them, but the multitude pearl gray velutlna. This was princess "THE LAND OF THE SKY." j. ..;1!.

r: be at least 18.000,000 pounds. have been addicted to corsets so shape In the back and had two box ''
Through Trains via Southern Railway are now Operated in connection with \r
The mines are a source of large in plaits down
': II! long that they cannot bear to contem- the front to define the .
come. There are 30,000 square milesof plate their figures in the gowns whose edge. Beneath this was a full plaited the Plant System from Jacksonville. : '

mineral land in New Mexico, and waists begin and leave off at the'bust inset of pink taffeta from the neck to :k)

t the greater part of this Is, of course, line. Still one thuds a sort of compromise the feet, and beneath this and all For: Rates, Schedules and Information, call on or address .Ireft

L undeveloped. One. single company acquired that Is not so very ugly, and around the back there went a ten inch A. GIRARDEAU T. P. A, or W. T. COSBY. T. P. A., ,.

a grant of land comprisingmany that is a dress where the silken "slip" I ruffle of the same. A silver passemen 212 West Bay Street. Jacksonville, Fla.

thousands of acres, and for a f3 princess shape, and the empire gown terie ornamented the corners of the RANDALL CLIFTON, District Passenger Agent, Savannah, Ga. .

L i small fee the prospector may search above is of net and hangs from a lace robe, and a narrow line extended all J. M. GULP. W. A. TURK S H HARDWIOK .
for Traffic Manager, Gen. Pass. Agt, ASS(. Gen. !
treasure. On this Ptua.
tract there around. Art.
are There
or spangled band' around the bust. was a yoke made of Washington, IX C. Washington. D. a Atlanta, Ga. '
over 500,000 acres of coal bearing lands. Above this silver passementerie set .
is a series of tiny ruches of over pale pink _
The turquoise stones of New Mexicoare chiffon. The sleeves -- - ,
-
-
chiffon which were --- -
give the whole its distinctive quite new. --- --- -- --'--
famous. About $500.000 worth of feature. It is but a narrow They reached but to the elbow and I have tied RlpMJ Tabulee with o much satisfaction I have teeD a great sufferer from constipation I<
:i gems are taken out annually and single were i'ubhed! with double that I caa ctetrfuU/ recommend Item. for over fi,e years. X ti.iag give me any relloi.My 1
a ruffle of
Eave been troubled for about three yean with feet aad legs and abdomen were bloated w i
specimens have been sold as high the \ehitiua. This derived a peculiar what I called bilious attack coming on regularly I c jald. not wear shoes on my feet and only a loose
as $6,000. The mines of silver, gold effect from the fact that the once a week. Was told by different physiciansthat (' *. I saw Klpana Tabules advertised In out
two
It was caused by bad teeth of which I had diy paper.boushtsomeandtocktbemaedlreel-
and copper and other metals are scattered edges wengathered separately, and teveraL I bad the fctttb extracted, but the ot- ,do Have taken! taem about tree weeks and thereto
I- all over the territory. Many of one slid past the other. It is U'cti continued. I had teen advertisements of such a change! I a-a not constipated any mort .
easily Rlpani Tabulea In aU the papers but had no faith and I owe it all to El pans Tabules. lam th1rt,.
them have paid large returns on the done, but very pretty. In them, but about six: weeks since a friend induced seven years old, have no occupation, only my .
money invested. Recently several regular (y OLIVE HAKPER. me to try them. Have taken but two of the household duties and nursing my sick husband. ;
small 5 cent boxes of the Tabulei and have had He baa had the dropsy and I am trying Rlpans R.
producers have been sold to east DO recurrence of the attacks. Have never given a Tabules for him. He feels some better but it will
ern capitalists and the new owners are "He Mistakes the Effect For the Cause." testimonial for anything before, but the great take some time, he has been sick so locg. Toe .' .
amount of good which I believe Las been done me may use my lettar and name as you like.
pushing the work of development. That is what the person docs who tries to
by Rlpans Tabules induces me to add mine to the &JTS.llAET Goat is CLiaXB.
The. climate of New Mexico is especially cure rheumatism or any other disease by relieving many testimonials you doubtless have in your

adapted to the raising of sugar attacks the the symptoms.of Hood's Sar&dparilla possession now. .L T.DKWrrr I have been suffering from headaches ever F
cause these diseases. It
neu- since I was a little girt I could never ride In a
beets. that their territory will become the cures rheumatism. It tones and 'words- of highest U .Mt to :ttM"" place ;llhout-gettln'-.
leader in the cultivation of this staple. strengthens the stomach, restores its natural praise, of the txneSt of; ---- .:,., headache oijjtstiug fluids and permanently cures dys- I have derived fromof; !4 I beard about '
1 penis. .. RipansTabules.Iama .. R.I'P.A-N.S if. RlpansTabulesfromaa! x
professional nurse and tr ;p aunt of n.L".e wiio v.attaking
llood's Pills cure constipation. Pike 25c. .
U.
In this prof esaiuu a clear ; A ttjjv>for catarrh
head Is always ntt'ded.'tf' (U or tau gibrn.-LO. f"e had f
Tabules does It. .. .JI found such relief from .
1 w J.a,1it'For relief of Chester'sTansy Rlpans ,
women .
.
1RMlr After one of my cases I The modern standtonndmyseltcompletely i IJto
Tablets, worth their weight in .J ".p Wthelrtaketueeheadviaedmethemheadviaedme too. and I
,uC.f. :old: A safe and certain month'y legu- rundown. Acting on the of CJ I I.. havebeenduingsoslncelast .
Medicine
lator. Mailed on receipt price, fcl.UO.MrunocK advice of Mr Qeo Bow .'tf. fV i lard Family IfIt October, and will
Ph. O. 5S3 O I ;A they have
are Newark MY completely
f.i' CURE Co., Atlanta, lia., .,Jersey City,I took I : Cures the I" ly cored my .headache* i

I I grand Rlpans results Tabules with ..:...:I'I\ I *m'irt"111"1 I'I1 01 I am<1. You twenty are nine welcome yean
1
Hid: *BMilS WIKDIUB. : I common very-day : to use this testimonttl
; Ilia Kind Yoa Hale !
c. Beara the A Mays BoughtSignatTiia y I MIL J. BROOKVYKB. :
t ,.
.t. ill of humanity.
\ of with Mother heartburn was troubled and .., 't7 _

--- - -- sleeplessness!, caused by ; W TlAC! ,c -to: My se .n'year-old boy .i.i.d
for ;
Indigestion a good
Taxes Ordered l' iid. loitered with paint la
; < many *ears. One day : Z $ bU bead, con8l aUoA v
( .l In the UnitedlState: court in Jackson she sr a testimonial 4; 0 't'e ;4 and complained of bit
I[ in the paper Indorsing lto: stomach. Be could not t
vine lat Thursday morning, Judge Locke Rlpans Tabules. She : It': eat like children of his adeterminedtoglvethem

,. TEA GOWN OF VELCTINA AND TAFFETA. pres.uliiu!, in the ca-e of the I'ennsU *_ MARC:8: : do aud what ha

thing at best and serves unlj to hold cants Company for IiiMiuifce on Lives a relieved trial was by their greatly use M.", <>....".....c' .,:-w9f9I'__""'"4'>9" ". .__ did with eat him.did Hewaathla not agree ,

the dress up on the shoulders.! TheSsloeM's and Granting Annuities vs the! Jack-on- and now takes the ant of a laffron/ color
Tabules regularly. She keeps few cartons Rlpans Bzadla q some of the testimonials In favvr of
are lucre airy nothings drawn dUe, Tampa} and Key West Hallway abodes the house and says she will not be with. Kljiantabula*. I trlea them. Rlpans Tabuiei not
around the bhoulder. ll.eae empireevening company, ct al, an ordt-r was entered r- out them The heartburn and sleeplessness have only relc*r1 but actualcured! my youngster,
disappeared with the indigestion which was the headaches have disappeared, bowda are la
gowns are not quite as low ou qiuring J. II. Dmkee a- receiver to \
}1':1to formerly burden fur her Our1,10 ,
so great a good c* uuic.va end lie ue'tr cumtnulni vf Lit
the bust as those of the days of Josophine. the city of Palatka tlu- sum! ui ::!,< :><> family take the TabuUs regularly: ,esptCI.lll after stomach lie Is now a re'!.chut/by,faced boy. This
a hearty meaL My mother is itfty yean of are won-erful chance I attribute to Klpa&a Tabulea
but they are low enough to bedressy liie for tawfor the \eai'<- ls'7 and ivts
and la enjoying the best of health and spirits;aUo Iamwtihdeichat they wlU benefit any on*(froath.
: and pretty. Instead, however, --- --- -, --- -- tats hearty meals, an imposelbil.; rsfre she . of the compact trimming of the empire Tht woman who ; look Rlpans Tabules. Avros H.BUIKZJI_ tluns. E. W. Puct +

days the gown displays a ttildernevjof her head in ,

lace nifties and chiffon flounce- the lion's mouth, f'puts A new style packet containing rev P:PA> tiBnzs pa.-tr1I'1: a paper carton (without C'aw)l often headed by immense bunches of stems the type of M some drug store-loa FivscfcXTS l"", low'inceili. t ,...*.>.+ tt tlt pIn r and: h.ecuaumloali Ondoaea '
ye# reckless women. of the nve ect cartons ia tabales) can be hat by aaJ by sennas fory-eight cents to the EaunCHnacit t 1
!.. artificial 11 0'Yl'l's. But n.anj other But shet '., .Ko. 10!Spruce Street,New Yuri.; or a silo ctr-a -=f Tr :f-1 will he t' at tor Ave cectStBlPUSTlBCL ,
} XEW MEXICAN' SUGAU BEET. thin;,> are used as> tiiinming principally 'n't, The 1i 1 may a ao be had of some groca: ''.pcnerU strekep r. 11e"1 a;-'nts ki J at sou. Qaur statse -
In the Pecos valley immense irrigating spangles and bead work. One 1 } sad berber.ht pl. They baaliih pain.Ijidnw rna; ai.l v .i "'..1 '.. oar Clvc3 read

enterprises have been constructed, anti saw had a feather U .i sewed aroundthe ( 1.lt' -

sugar beets are being raised with bottom, least
suftess. or at : a roll of ostrich 't

The building of a big factory for tines like! a boa. Some have narrow } {, r

the crushing of the beets is now being silver or gilt bullion fringe sewed inrundxkeg t
really reckless woman is the one who
agitated. When this is accomplished,
fe There
or :tuoiis. is
: quit
braves Nature day after day. by neglect

at its once advantages, and the are erection expected of other to appear fac- a with fancy large for masses decorating of ttU"l'l'S.1lrn hall dressy s of organs.the health"Crime of and the delicate punishment womanh blossom THIS SPACE r [ RESERVED[ fOR NEW SCHEDULE[ Of F. E. C. RI

tories is sure to follow. any are used at all there are many', on one stem says Emerson. When .

The settlement of New Mexico did an.i 1 very large; tHll' It seems to be a the cycle of self-neglect is complete it

not really begin until the summer of matter of personal election as to where includes the pains and sufferings whichare .....

1SSO. when the Sante Fe railroad was the flowers shall be placed. the inevitable: penalties inflicted by .

i I completed. The advent of the railroad Evening dri-wps. outraged Nature The dram which today -
especially for the
brought new people, anti they have is counted an inconvenience becomes -
yom: are made of the
thinnest
; goods in succeeding days horrible and ItC.\f
)
continued to come ever since. The a : IU .\f) : luaD :
manufactured. Tulle is oue of thorn offensive stigma. The passing depression

men and women of New Mexico are and that is .o thin that a breath will of an hour grows into a permanent mel-

bronzed and hardy. There are few old blow holes in it and a pint of water ancholy.The Hyler's' Tablets

people out here, as the majority are dissolve the whole gown to nothing! timely use of Ir Pierce's Favorite Dyspepsia ,

under middle age. This seems strangeat ness. Hut it gin a doudlike effectbeyond Prescription will save young women from

first until the comparatively short suffering as it will cure those who 1
power of comparison} and i la I n'lI IT ILLS ItI-:C\ DOM; FOR
history of the territory is remembered. through neglect have Income martyrs OTIIIKSHI ;
! particularly suited to drape the figureof alter marria. e. No woman who suffers l'\X : DOM FOR 0['.
l fail notice the
A visitor can hardly to debutante. White .
a naturally i i- with backache, in the side, bearing
t pain --
t number of big men in this part of the the most suitable, but smoke gray and down pains debilitating drains, ulcera- 't

I country. The writer recently tent in- red are also very beautiful and rathermore tion or inflammation, should delay an- Read I Mr. ("ox's letter below: only one of thou auda we have un file mouroflice: t...... .

to a smoking car and observed a splendid original than the everlasting pink otlu.r day the use of '' favorite Prescription runlltk; ('ure Co.. Atlanta, Ga. 1

'I specimen of manhood. After making and blue and evening green. ." Its use helps every woman and (kutli.UK n::-It U: with diifidtLce..that I write you for I am not one who titles tu hud his
farmer's I flails tent of all who name in 'nnt. but I feel that in this it is
the big acquaintance For older young ladies and young mnLty-eisjht per i my duty to those who ,lIfer and my writitmle to \
give it fair tnal. It contains pun H> write pull what lIylt'r Dyspepsia Tablets have dune for
: f' I said to him very frankly: 1 admire matrons the rich lace applique net a no opium, tinSix mouths a,} Iare d
over all huje ( t'ever btinjr well I .
, again. sufiered
; much. I believe cocaine or other narcotic, up horribly from my stomach all the time-
your physique very and this made over silk or satin of contrasting amps; hardly abU to vet my breath Hall tried many phyciaus-some said tc J.
S.
1 wa- tempted to medicines after dyspepsia others 1
could have licked Goliath. try your I heart trouble otJars still catarrh
of
f you color is popular. Thereis stomach-al! dosed me but J
very seeing; the effect anon m'y mother, writes Mrs none rre relief I 'lon't t
?? The man so addressed said nothing at aid range for fancy in the decoration Flora Am of Dalla- Jackson Co.. Mo. "At know how many ailMrtind muiicinfi s I took, but still lu relief. .V friend .'11'\1'1'i !hler's ; \ ,
first. Presently his face lighted up. an early stage:: of married life I was greatly Ij spepsi.i Tablets. Without hope I got them and bean taking To my 'Mirpnae th.v'Jave the I
; IE
of such dresses. Some of the ;e bothered with painful periods, also trouble immediate relief and after u ling three boxes, I am now cured and feel better "
,. and he replied: "Well, that is funny. some drain which rendered me weak than I: have \\.
have narrow bands:: of fur along the very m years. Em'lased find $..00, for which send me two boxt: want one of them for .
About mouth a gentleman came and unfit for work of any kind. I became and the other while I now don't need them I my sister a.
a will
ago others always ktep them .
edges: have chenille hi
fringe so thin there was nothing left of me but skin m ILJ u ?, f"1" I
and Nit down beside me in a car. He matching the tint of the lacl'-whitl', and bone Ir hu-baad became alarmed and -, Yours gratefully, t;. F : *>THYLEll'S -'P .
)
was well dressed and spoke quietly. I got ne a bottle of Favorite Prescription.' After : : H\O-1: : 'EI TABLETS_ :, *r {rc ccially prepared fr. -tem, KfLdiction **ceptt. .
cream. ivory or butter. It is extremely he saw the wonderful effects of that one he got Catarrh of:o-tomad b (''e &,'5WT' l I\ anndc Headache and .- \ 2 & 11' '
did not notice anything especial about rich, this combination.As me two more and after I used those up there from } t'1 6. t... Ea1TUallie'1.. on.
a J
DisorderedMomach.rw" Ni, 8.'f
was no more pain. and I began to gain in flesh ate bly U .
.
\ him except that he listened attentivelyand : all
a faithful and conscientious *u*" lector :
very rapidh I believe I weigh twice as much
| seemed interested in everything writer of such matters. I find it a dutyto as I did then and can do all of snv work. I Hyler's Dyspepsia T \* },llDstt'.containing; 3dV \ ::" .'
live think I owe all praise to Dr Pierce and his won ment Pri vii *, 1\1 .* I now .6 I :
\ that I told him. lIe Inquired about tGE F p. t to *.iDol. open at .rie'
mention a few of the extremes of derful curative medicines" ; 'isl an .... .
; \ ( stock and agricultural conditions and abred"F. 'l te.t.a sawing Sunday dotl..! } 1
V in our vicinity. He asked a style for outdoor visiting wraps. There Doctor Pierce's Pellets are specially Df all u C'.trl 'te. trout ? ._..,id. n.,. p''from 1 to tJ't- ;. :

) v.prospects was---. one .of- black, -- broadcloth- hanging adapted to the needs of delicate women. .rrnor,-7 rompt: aJon-y. .-' ,. .;} "

( r. .\ \.. .
t"a
.. .... i .' I "
,
j ; )

LJ'r) is;'. \., 'J., : )\ \ \-,,. /1.: 1 t\ \ ,'( i.).. !!


s \ 'fII ....... f
fr It '
.L ... "'r.:
t. m..
c. f 1 t ._ ..:. ; ,I 4 -.. .It '. -- -
-
? '_ '-' .. A
-'""" "' 'F'- "-' ;,:!'- e. a .r. +



.
'
#' .
'
0- .
"
"f
t
'yiir
,
,' '
-
,' ., .. "
'. ; ,. <'< : ? "' ;": ': :- ': ,>'- -,' :
\ :;' -'f:3: : c _'. ,.. f ,


-.8 ,, : .. THE, FLORIDA TAB : FRIDAY' JANUARY 26. 19CO. ,0 '*-1



Ita.J. COCOA BUSINESS DIRECTORY I ling.workers soon had, everything from ; -

,il BBEVABD COUNTY STATE BANK.-Do 8.F.TRAVIS & CO. are Exclnsmi Wholesale the ground floor, even to the carpets and ROBBINS : l{

3y': your business with the Oldest State Bank in Grocers and do not sell to consumers. They window curtains removed. The Luckey

_Breyard county. Solid and conservative. retail all other goods, carry a large stock, residence, formerly owned by Mr. E. '

;i' W. L. HUGHLEIT M. D., L. T. DANIEL, and can meet all competition.. Stiling, was in very,great danger_ and & GRAHAM :

t:- D. D. S. Offices over The Indian River THE TRAFFORD BAKERY.-First quality would surely have caught had it not been Agers ,1

. 4r. Drug Co's stores,the leading Drug establish- Bread, made of high grade floor, sent to any for the timely and heroic help of our ,

f '. meat of.the Indian river country. address;also never-failing home-made yeast citizens. Messrs. Wm. Hindle and Roy
cakes. Ice Cream every Saturday.
(. THE COCOA BAKERY-Wm. Stiling, Prop. Puckett got upon the roof and water was TiA'" 7VYERS.

t' Fresh bread, cakes, pies, ,buns, rolls, cant GO TO J. M. SANDERS, The Old Reliable passed up to them by the crowd below.
dies, shipped to any point. Ice cream and Store for good fresh and reliable goods After the fire Prof. Hair i tWill
was Michael'shousehold
I. ices to order. Salesroom first door south of such as Dry Goods, Saddlery, Crockery, over practice in State and United States
t" Mrs Hill's millinery store DeLannoy Ave. Hats Trunks and a full line of Groceries. effects were put in theYuckey Courts. i

,,,,, building, by permission of Mr. H. P.
. : MELBOURNE BUSINESS DIRECTORY. CAD OALLIE BUSINESS DIRECTORY. Shares, of Rockledge, who has the placein

MELBOURNE STATE ANK-Capital,- HODGSON BROTHERS. Dry Goods, Ship charge. At the time of the fire Mr. Abstracts Of Title furnished to land

k 000. J. H. Phillips, president; E. P. Branch, Chandlery, and Shelf Hard ware, Pipe and M. was down at Rockledge, and knew I in Brevard and Dade counties.
I {r' cashier. The only bank on the lower river fittings, Clothing Paints and Oils, Groceries. nothing of it till it was all over with. Vigor I
I .T' and the pineapple region of Brevard county. Marine railway steamer for charter.
\ When the news reached him that, there

"r.. FEE & STEWART.-Hardware of all kinds; FORT PIERCE BUSINESS DIRECTORY.C. was a fire in Cocoa, it was to the effect We have a large list of lands owned j

Building materials Furniture and House that S. S. Jones' the and ourselves and clients.
store
was scene by
,
.
.. Furnishings; Crockery and Glassware; P. PLATTS Physician and Surgeon. What '
do. ?
.. Undertakers. Agents Sterling and Crescent Calls to any point on the 'river promptly the professor started'up to condole with : o
bicycles. answered. Fo t Pierce. Florida. him. Before he reached here he was It causes i.iv oil glands: Prices for Unimproved Lands : .

met :Mr. Shares who told him the in
by the skin to become more $3.00 to 5100.00 acre.

; lip P AND D' DOWN f O Mr. James M. Paine and daughter, straight of the matter and brought him active, making the hair soft per
: l THE f EAST 1 COAST.
Miss Delia, arrived in town last Saturday on up in his carriage. When leaving and We have a few .

afternoon, much to the joy of Mrs. Paine home to go to Rockledge Mr. Michaelleft glossy, precisely as

Brief Mention of Minor Matters Occurring and Ellen. Mr. Paine and Miss Delia a fire in the open grate and the supposition nature intended.It Residence, Orange Grove and Pineapple -
in desirable loca-
properties
at Our Neigliboriog Towns. have just returned from a trip to California is that it caught from that. cleanses the scalp from tions. Prices reasonable.

and Mexico. Cocoa has thus lost one of her handsomest dandruff and thus
removes "-
< COCOA. Miss Mary E. Red wine, of Georgia, has residences, but it is hoped it will be one of the of -- .

'Mr. L. D. Hancock, of Lotus, spent last arrived in town and opened a dressmaking rebuilt. The residence and barn of E. great causes -OFFICES- ,

Saturday in town. ., establishment in Miss Julia Roberts' C. Johnson caught from a cinder, but baldness.It .

house. Miss Redwine has been in Flor- there was timely aid at hand and was makes a better circu- TITUSVILLE and MIAMI.
Mrs. James Hatter, of City Point, was
.in town last Thursday. ida about six weeks, the guest of Major soon extinguished. lation in the scalp and stops

'* Magruder and family of Rockledge.The MARKETSJ
-* Mr. Sam Ghilda returned from Titus- Birthday Celebration. the hair from coming out. EAST COAST MEAT
schooner Edna of Canaveral with
,
sine Saturday afternoon. Capt. M. M. Ramsey ,aboard, was in port Tuesday evening a large number of his it P evens! Hl [n I G. F DUilEN, Agent,

Mr. Goodsell was a visitor from Geor several hours Saturday. When she sailed old friends were' invited to a surprise par-

V giana last Saturday and Tuesday. away it was with a very large shipment ty to Mr. C. W Harrison to celebrate his Cures Baldness -

":w.. Miss Katie Cleveland, of Merritt, was of freight for the down river customers. 84th birthday anniversary. Mr. and Mrs. I II I -; Floridaand

',..: ,a, very peasant'isitor in town Monday. Mrs. Ramsey and children were also on Harrison had been invited to take tea Ayer's Hair Vigor will 1

ioard. and spend the evening with their friends, surely make hair on i i
grow
The Mesdames Smith and Wethey, of Mr. and Mrs. 0. 1 1 Western
Currier and it 'was
Miss Annie E. Bullock, of Rockledge, bald heads provided only
in ,
visitors town Tuesday.
Georgiana, were there that his friends at about 7 o'clock
rendered, last Sunday morning in the ,
there is
life
}Ir. J. M. Ennis, of Lotus, was one of Episcopal church, as an ofleratory, the marched into the parlor, unannounced, any remaining leaf(

our down river visitors the latter part of solo, "Come Unto Me." Miss Bullock's upon Mr. Harrison. To say it was a complete in the hair bulbs.It '

l last week. voice is one of much sweetness, and delighted surprise is putting it very mildly. restores color to grayor of allKinds.

Dr. W. L. Hughlett made a professional her many hearers. Miss Fannie He could only stand and look from one white hair. It does not
Carter presided at the to another and say "well, well." After .
visit to Fort Pierce last Thursday, returning organ do this in a moment, as
the gentlemen offered their and
respects
Friday. Dr. W. L. Hughlett was called over to congratulations they seated themselvesand will a hair dye ; but in a

i' Mr. George G. Gleason, one of Eau Gallie's Indianola Monday afternoon to give his soon became engaged in a lively con short time the gray colorof Titusville, Florida.
', aid to another accident the
:. citizens run-away ----- ---- ---
prominent was a pleasant
; versation. Reminiscences of olden days
visitor in town Tuesday. victim this time being Mr. A. Hildreth.Mr. raked eeches made age gradually disappears .....FO r......
I were > etc.,
up 8j ,
and the
II. was unconscious for three hours darker colorof
,
Rev. W. N. Chaudoin, of LaGrange, and besides being pretty badly bruised then they were invited into the diningroom youth takes its place. A Shave and a Hair Cut
:. was a most welcome visitor in town on where a large table and several
and shaken he is not thought to be
up Would
j Thursday of last week seriously hurt.Monday mailer ones were groaning under the you like a copy ...GO TO....

weight of good things to eat. A blessingwas r of our book on the Hair
! : Mr. J. D. Crabb of Lake
Y. now City,
t
afternoon the followingnamedparty asked by Mr. 11. X. Andrews, then -
and ?
Scalp It is free.
h: .arrived last Friday afternoon, and is Carrathers'Barber
arrived in town to go over to the the gentlemen proceeded to do justice to
spending several days in town. i If you do not obtain all the benefit Shop
River View hotel, at Merritt: Chief Thos. the refreshments before them. These refreshments i you expected from the use of the Vigor ,

;t The Mesdames Carpenter and D. A. F. Kevin, wife and son Frank, ThomasA. consisted of sandwiches and write the Address Doctor about, DR. J.It. C. AVER None but experienced workTITU'8VILLE

Ramsey and children, of Lotus:: were Kenigan and daughter, Hugh McLaughlin coffee, ice cream and cakes (almost in- Lowell Mass.KOSKLAXD. men employed. and perfect I FLOKIDA. ,

a, visitors in Cocoa last Saturday. wife and maid, J. Michaels : numerable and of all varieties), wines satisfaction guaranteed.........

1. : Miss Mary11'ittfeld. a popular young and wife, Win. Henderson, Mrs. Reed, and cigars. After spending some time in I J. L. I'ARHUTHEBS, Proprietor.

I # lady of ( eorg ana, was a pleasant visitor and J. Quaid. They are all of Brooklyn.Prof. this manner Mr.: F. F. Taylor presentedMr. Mr. T. S. Drake, of New Rochelle, X. Dr. Houghtoirs

' in town last 'Thursday and Saturday. Munro, of Georgia, the hypnotist, Harrison with a very handsome cane Y., is lucre for the season I Dental
." gave an entertainment in Eyer's hall with an eloquent speech. Mr. Harrison Floating Apartments
on Mr. Robt. Ibwler lost four turkeys one
Mr. and Mrs. I).. A. Blodgett, of Daytona with short of ,
ac'eptl'dllIe a speech OX .
:Monday evening, but failed to get a very night by a wild rat. He has since TUB
arrived in town Saturday afternoon, good house. All day Monday stretchedout thanks, and also telling of hid appreciation caught the cat in a trap.
and Lasp nt several days visiting rel and pleasure in seeing his friend .DENTCNoV
!
in
'. ,atives. the window asleep (?) was the The machinery for the saw mill is being .
gathered around him. Dr. -- -
with Hughlett was -- ----- --
man traveling him. Some -
young
put and the mill will probably be -
up
Messrs.: D. E. Stout, Jaltna Lapham folks do say that when the' fire broke out called upon to respond, which he did in running some time next week. AT

i and A. Hildreth, of Indianola, were Monday afternoon the sleeper awoke, his usual eloquent and ;graceful manner. PALM BEACH.George .
:\1 r. aud :Mr:. John Goode, of Melbourne -- '-
jiuiong the many visitois in town last and when he found out there was no danger Speeches were made by several other

'i F i .:satunla '. to the building he was in turned over .. also. At a late hour the company started and :Mrs. awl Miss Spangler;: ofPhih'iupliia Peeples,
the of Mr. and
r are guests
and went to sleep again. homeward, but a !snnc n a.= proposed by
; Miss Alice Weinberg entertained a few Mrs L C. Moore.
Mr. F. F. Taylor who asked each iftht'v OH uibson
one TT'wcnvTTT'nr
,j of her friends last Friday C'Clllugnth a Tuesday afternoon, while driving along building'. next A .L 1XI,
could sing, tVn "lined" it out for .
door to Carrutbers' ------
.t whist party. All report, a& usual: an ex- Delannoy avenue, the horse belonging to ,
barber hop
/celleut time. Mr. Henry Banks, of City Point, commenced them, whereupon they all joined "in and ang e TreesGrafted \Va.': \)i'lonAve., TITC-VILLE, FLA.
sang "Old Father limes Is Dead. Mr.
'Capt. C. J. Schoonmaker returned: last: kicking. lIe succeeded in get Taylor then favored the with a o Tinsmjthill;,Roofing. Guttering and all kindsof
company
ting himself out of harness and repair work promptly attended to.
Saturday from St.:; Augustine, where he breakingthe story and they once more started home.

went to attend the Republican meeting shafts and dashboard. Dr. Mitchellwas lios-y present Wl'rple ! ------ -
-
in the buggy with Mr. B. but neither --- -
held! that ,
at city.
C. J. L. W. Battenfield
Ooggin: ,
of them received any hurt. A carriagewas 4 and .1 year old orange roots.irai'ta .
1 At the meeting of the grand lodge hi gotten from Crabb's livery stable and J. M. Sanders. J. Gmgras, G. S. liar- ( J to 1 inch \diameter, to 6 Indian River Steamers t
dee J. 0 Schofii-ld A. F. C. feet well branched.Can .
Jacksonville last week, .Mr. R. .N. Au- the gentlemen started home again leav- Lapham; ,
/Irens B. MaanultT, 1:. II. Patterson F. F. B
: was al'loiutt'l.ll1el'uty grand master ,
ing the unruly horse and the dilapidated supply the foil wing varieties:
for this district. buggy at the blacksmith shop. Taylor, .\lfn Harrison, R. Andrews. ,1 Indian River and Bay Biscayne ,
KUIJV BLOOD.
B. W. L.
a Mr. M. Stout, of Alcott, Sew York, arrived Some:) little excitement S. AldridgeandDr. Hughlett. j I ST. MICHAELS. Inland Navigation Co.
was caused Tim;; ended one of the mo-t: pleasant and
in town Monday and went ou over .,f&I I: SAN FORD'S
Tuesday morning at Rockledge by a little important social functions ever witnessed.Mrs. :: MEDITERRANEAN, Operating a Hue of steamers between
to Indianola to spend the winter with his
shooting. The fireman of the Hotel Indian Harrison[ and Mr. lI'. sister, Mrs.S. : ,i DOES U'EFRUIT. KOCKLEUGE, on INDIAN KivtB: ,
brother Mr. D. E. :Stout.
River, and a negro, John Jones, got : 0. Wade, assisted i Mrs. Currier in the and PALM UEAC1I. 011 LAKE
The best trees in the state at WOETH. touching at principal laud- ,
any price.
:Mr. and Mrs. J. W. Ballentiiie Mr.Uartin into some disturbance and
Jones raised for the gentlemen's enter
arrangements: Those wanting a really fine article should ings between these points. _
and Dr. Moon were among our an iron crowbar to strike the fireman, tai nneut. order at once. '
___ __ Route via the INDUS RIVER and
City Point visitors last: Monday. Weare whereupon the bar was knocked out of m
through NEW CANAL SYSTEM to
. always: glad to see them. Jones hand and a pistol pointed at him. OAK HILL. days Will 1 to* graft prepared to order for the any next tices sixty that LAKE WOimi. 1

t Mr. Charlie Singleton:; left last Thursday The bullet went in one side of the foie Miss Ethel Coutant is now in Titus- may 11\ required to fill orders for The passenger accommodations on I

aftei noon for I'alm Beach, where he head, and coming out at the other J< .ies ville, and is stenographer for the Florida my old and new customers who may both steamers have been increased I
was then taken to Dr. Hughk-tt's Extract Co.Mr. want fine trees either on small or I and they are well equipped for the 'j
i\s.s with I drugstore
accepted a position Capt. Tony large stwfc. Will meet all dcmandfo."tallt.riues tourist business.

Caiuna to run a launch. and \\assoon neatly bandaged: I>r. : Reed, of Georgia, visiting; his and grapefruit. Will I'' ,
Hughlett very fortunately being in. lint out over f5/J"0 trees to these two Excellent meals served on board
Mr. and Mrs. Horton, of City Point, cousin, Mr. 11. G. Putnam, and seems to mrilt t's. Address I steamers at reasonable prices.

i' sere pleaant'iltol':: m town Saturday.Xhey I ev. W. X. Chaudoin, I, Gransru; (i. be much! plea-ed with Florida. South-bound. North-bound1
L. I.ewis, Chattanooga Tenn II. o. w. COl\TNiR I ---- -
C. Con- ------ --
I spent some time in COt'oaral ; Miss: Brooks: Curry and Mrs. Z. T. .

I, years ago, it w ill be remembered.Mr. i stable, J. Gilbert Taylor, Baltimore; ; T. 11'illianis. with Annabel 1 and Lee pent OCKLAWAIIA NURSERIES, I Read-down- 1 Schedule in. effect -Read- -III'[ -

F. Williams, Jacksonville; C. Withers, StSebastian_ | Jan. 15. 1900. ,St.. SebastianIonda.s
i a very pleasant day in Daytona last QciLA.w: 2'3A: FLORIDA.The I' .
Charlie Schooumaker, who has I' J. L. Ruadarman, Richmond: Fred King, week.Mr.. } >' \Vidu\d\ -
i been in Eau Gallie for some tine, arrivedin Macon; 1.. C. Seatoii, U.; F. Walker, Lou -- -- -- ---- -- -- --- -- -- and j u i .\i DJSb,. andThursdays
Miller Civighton, of Baltimore,who !I atludx> '
town last Thursday lor a thurticit toJiis' isville! ; M. Stout, Hoti-ton Rucker, A. S. Most '
I now owns half of the Lome grant, ar- CompleteELECTRICAL 4 W p m Lv KoekledjeAr' II (Hi Jt n,
parents, returning Sunday afternoon. Card New York
,
Samuel
; S.Tennet John
6 30 p m 1.Ea.u UallieAr ti iO: a in
wife and I
rived with his two daughterslast
W. Taylor, Philadelphia; C. A. Smith, 7 00 p ui Lv MelbourneAr 6 00 a n,
The Ladies'ill society met last Thursday located
atMrs.
week and are pleasantly
I.Jeu"'u
Walter E. Dobbins Atlanta 6 W a 111 ----Ar 7 mi pin
afternoon with Mrs. J. M. Sanders. Ililliard l'alatka : ; Chas. :\1. : F. M. Coleman's. 10 W a 111 ;LJupiter -__Ar a (Mi {. m

There was a very good attendance, and I ; M. E. English and M _2 00 p_lur;| .Paluj lku.h.L. \" K) mi :a inTO
; i Goldsmith, Titusvrlle', were the traveling Miss Mary hu-kin-on I i is now in Daytona SUPPLY HOUSE. .
the ladies succeeded in quilting another t >
.I- j I people registered; at the Jarvis House the visiting ('apt. Cha-=. Bingham and in the SCftlE("' CIIAMiK WITUOfTVOiH K
luilt. state
. I past \\eek.'i family, awl 1 will go from there to Lake Tbis time table shows the times at

L Mr. George Wauible, wife and live' litten1111 join her grandfather Mr. K. THEJohnson which steunu-ra may la- expected in

t children, of Jacksonville, arrived in town j At the Palm cottage, Rockledire, on A. Marsh: with :Mix Marsh an.1li: -:; I arrive at ami depart from the MjV'i.r: :
j :Saturday evening, the HeW.. E. Smith landings hut their arrival or departure -
last Friday uftt.'ruoon.ftel' spending Lillian, at the camp grounds.Mr. the times is
1 officiating, Mr. U. Frank Hatch, of Rock Law .tt stated not cuai-
the night in town at the Thomas cottage, \ll :mtlT.1. nor flues the company hnM
Allen and
> X ledge and Miss Katherine Bender, of and :\11'T.: B. -- 1
I itself re.pnwihle for any delay or
they proceeded on to Banyan. any
1 j 'Y ectcheater: Ohio, were united in mar- Pope, with (apt. Tom ain> and the COMPANY I coiib-Uciivcs uriaiug therefrom.

\ Mr. Tom Johnson: of LaGrange, was lU ( na "t! It was a very quiet affair, only Mallard, vi-itrd Titusville la tH'ck. : The :otC<4mcr iuguatiue: will be

I town Tuesday: Wednesday putting up i the near friends and relatives being; pi-eJ. They intend\ takin-j voyage t" Miami, I placid ill commUaioii ou the line .'

<& .a nice new tank for the school. This i is' a ent.11'. Hatch is the F. K. C. agent at and periiapNa-.iu. February.. 31 r. ; early in Ftbmary.iieia I

I : 4 grcat pleasure to the patrons of the school ; Rockledge, and has many friends up and Allen is: now in :NVw York for a few Electrical Engineers :- '. eoutittt with ther'lorida i

t I as well as the teacher and pupils. i i down the river. The bride who has days on \1uMitrMr. ?-. 1, II Et.t Coast railway follows: ,.

Miss Fannie C. Carter is the happy : been down for some months, is a favorite Miller ('rci;htun, Jr., t'aUlalnr.: SUTJI'IIjSJi

j very among the people. Their of Titusville and Uiteen, i ; 5 a, m,
young
\ '\ possessor of a line Hartford bicycle, man> day by wav JACKSONVILLE, fLA l ArriveRtxKLFhiELT---9! % .
friends have : I p. m.MIKfHBOrXU
.. which arrived last Friday: afternoon, and unanimously united in wishing :: havinu M-en tn the :shipping: of the .m i
in\ : of ; them all the joys of this life. They li.iii fur thi.- place. We are: very triad to Elli m La Lande. :Sam.-on;
nd Fri joiiiftlectu large party bicyclists' lave
.
UO'K..EBHE1 '
homer _;r'tat home at the Hotel Indian Ui-iness that will :!2 p. ,uArne ,
River. \U'lc >inea : : enterprise and dry batteries for .
M of the gas .J.lKoOXnLLE7:00: :
*entlemen on country. ,,.tJ, Flr p. m,
for some guekJ l Ic alU-cK'd l liy a fiec/.c, and al-CI to
ng tthe"i afternoon not bell and
to entertain forp3 to see;: w f ;" 11.1: t.: ; :t\Y a little after 2 engine ignition, In time to connect with all train-,
weeks in 1 neighbors and wish
: l\Oi lire have more pleasant :,
heard work.
were and it annunciator fur the north and west.
nie E. fjJ1C\'eral Sunday"01;-, I. Sharpe recei that the handsome them all poiUe: success.CASTORIA..
Irs. Di .iou .l. from the McFarf re&ic Work done in all G. C' t;I Secretary, general office, bank
ay ref acr 'c \W. Michael, on Pal- : : parts of the state. i building, Augustine Fla.
spent 'of the Sh .lll\h" )the v with whi afire. As the (I. G. GiEAi ox, Superintendent, steam t ,
\ a Span fire Bears the the Kind You Ha>e Always Bought ELECTRIC LIGHT SUPPLIESof ,11
?
d and 170ture wharf
he 0 fri ) n cR1toF vl / Rockledse, Fla.
ndo, Silver-as the 'f (.. : L nsk << story: it was im- Signature + #-. all description. T. T. REESE Agent, steamboat wharf; Palm
ay r the w' -' 'ed" sing Many witIn of .WEtTE FOE IXFOBMATireen- .' Beach, Fla.
s" r: ,
pe i'of its'el1to ) ..
) '.

.t.

,,..i. .. \ j f I
f ) 1
) )
"
J ,..J 1 i ; '
'
) .t' !'!'"\... ._

.. *
--...-..1'1R'7 :

"



I _

?;.

,, .
"" '. : '7
''; < ,
.
!t '
I$1$ \ '., 1. _, if
t .
.
: ,, ..
'J'' .. ;t:' I
'. J r
." t
:,6: THE -FLORIDA STAR : FRIDAY, JANUARY 611940.ij ; i

1I

'Congressman: Charles B. .Landla of lence. It was generally remarked and .

}OUR > O ORSmil I pay P Y: tells this himself Sam Gaines ,asked Mm 'what he ,. .- ",.-_ .. -- - '- .._ : .::.-. rl
> ; : i Indian; one ,on: ; wasmoplng'around '. "-.' '-. -- .-.-. --, .--, -_ .- ---- - :::_:..=-- -. .: :: :::: ;; -----
? While on his way from Washington to In that style for. =

t1 The Merry Side of a National Law- Indianapolis during the holiday recess "I don't like this crowd," said Joe. .

maker' Life. he found a young woman acquaintance "Why, Joe, there is not a man here

Special Correspondence on the train at Toledo. who would not die for you. You aston
of THE STAB.
While they' were engaged in conversa ish me" exclaimed Gaines.

WASHINGTON. Jan. 13.-'It may be tion he noticed ,a stranger who was ."Ob., the boys are all right enough"
that' eying him very closely. The situation returned Joe, but the cussed crowd Is
the rest of the Is
to look country disposed was becoming uncomfortable when too big for an anecdote and not big ,,,,,,,,,, ? : : For Infants and Children.
upon Washington' 'as a city the conductor entered the car. The enough,for a speech." _

that is always sedate, where the ,atmosphere latter was accosted by the stranger, It was a spontaneous outburst of 1!

is heavily.burdened with! the and an earnest, undertone discussion naivete'altogether unaffected. He had The Kind You Have
: '
serious things of life, and. especially took place between the two, the pas- no thought of humor. He only gave

l1p around the capitol. where never t senger appearing very persistent in vent to his feeling of disgust when he

smile flits across 'the, faces of the serious what he was saying. 1\Y that he could not do all the talk- Always Bought

} = statesmen who are charged with The conductor was a personal acquaintance *ig. SAMVEI. HUBS\.BD. I Av/egetablePrcparatlonfcrAs-
of Landis
Congressman ,
the awful responsibility of' the slmil ting ttteFood indRegula-
t j shaping and finally he came to Landis and ask Blamarck'8 Iron Nerve
destinies of 7o.000.000 of human be ling the StQm iihs andDcnvels of Bears the
permission to introduce the stran Was the result of his splendid health.
i, '- ings. The general run of persons picture ger. The latter proved to be a detective Indomitable will and tremendous energyare $

the average congressman as a and he explained that he had not found where stomach, liver, kidneys xt1

4 :$ I, studious looking, superior creature, in received Instructions to look for a and bowels are out of order If you Signature )

,f. dark clothes, including a long tailed small heavy set. smooth faced man want these qualities and the success they PromotesDigestionCl! rru1- "
bring use Dr. King's New Life Pills. 't
and with gray hair soft hat double breasted -
..* coat' tall hat. whose expression is nessandRest.ContainsntatherOpminNorph'ine
develop of brain and of
They every power
"*. coat and dark clothes accompaniedby
x r talway s heavy and whose feet only body. Only 25c. at B. R. Wilson & nor}Eneral
a girl, who was wanted in an east
', t touch the ground in high places. There Son's drug store. 6 NOT NARC OTIC.
for diamond Lan-
ern city a robbery.
+ never was a greater error than this. ... t I
dis answered the description perfectlyand 1
M;: : Book Lovers Are Interested iI
=' .. c, "'. but for the conductor would have Book lovers in London and even on Jar ofOldlrSAMCELPITCBER :

had an embarrassing time. this- side are already greatly interest.ed f t I PunifilA- SetJ"MX :!
"Private" Allen of Mississippi, whois '
1tE
: Senna*
in the probability of the sale at !
considered the "wit of the house." o (ul4.sJJs- $ I n
public auction of the collection of .
tells a rather good story on Congressman Bernard Quaritch the famous and eccentric ffyptrmittf fli t
Brosius of Pennsjhania. A Pi gjfJlll>>.fJ4+ 1, t tJSam
par-
bibliophile of London, who has Iced- r1 I
5sR- *" ty of repl'esentatin'sn're on their just died. Some single volumes of his try {i.
Baltimore attend : / Use
to to banquet
a
way
I
cost $5.000: and he once spent as much
and Mr. Allen who knew the,propensity -
as $"O.OOO at a Bale.-Philadelphia Aperfect Remedy forConstSpa- 1
of the Pennsylvania member to be- !
/ Times. Lion, Sour Ston\achDiarrhoea, )
: come excited during a speech, made a

; bet suspenders that Mr. Brosius during the would response fracturehis to Timely information Prevented a given Tragedy.Mrs. George Worms andLosS.Convulsions OF,.FeverishQCSS SLEEP.ac F or ?! v.er. ;I


the toast to which he was aS8igl etJ. Long, of New Straitsville, Ohio, prevented ? Simile Signature of

And sure enough, the catastrophe a dreadful tragedy: and saved two lives.A .
,t'
:, .'. aT occurred. During his talk Mr. Brosius frightful couirh had long kept her I % ; Thirty Yaarslrn'

had just "warmed up" and was appeal- awake every ni !ht. She had tried many. NEW YORK.EXACT .

:: ing to "heaven above" In some connection remedies and doctors but steadily Jrew...
T t: ": when there was a significant snap. \\orseuntilnrgedtotry Dr. King's New

"There they go!" yelled Allen, and he Discovery. One bottle wholly cured her .
and she writes this marvelous medicine.
was right. The laugh went around the
also cured Mr. Long of a severe attack of 'r1
board when the joke became known.
: V OnONT. pneumonia. Such cures are positive i proofof J '
It J. P. DOLun R.J and Mr. Brosius curtailed his remarksto the matctiless merit of this grand rem- COPY OF WRAPPER.

It would be Lard to find a like number an unusual degree. "I knew he edy for curing; all throat, chest and lung! .,,"-.-'. dli THC CtNTAUR COMP4NT. kzw VOMK CITY

ff', 'f of men with a keener sense of humor would do it." said \tr. Allen after, troubles. Only oOc. and 1.00, every bottle r' _:_'_ ', -, "' ':: ,";:_'.:: ,' .:;.: .-:.. .," :. _" _----. .' .
\ : or men who more readily seize upon ward. "lIe never makes a speech in guaranteed! Trial bottles free at B. R.

every chance to lighten their burdens the house that he doesn't have to buya Wilson & Son's drug store. 6

with the things jocund. new pair of suspenders. lIe's too -- -- --- -- ,
-- -- -- --
'., r,," Some of the country's best story strong for a congressman, an 'how." Fishermen. ** w www w w.www w* ,

." tellers are men who have served several Ernest W. Roberts, one of the new There are 8.10.000men in the world SHIPPED FREIGHT PREPAID. e

terms in one or the other of the members from Massachusetts, [is on the who gain a livelihood chiefly by fishing e '
G TREES
l3 Y/HATfo
housss of congress, and the [infectious road to fame. During the first two making an annual catch of $_5 ...a.andOWtoPlantf.c

spirit of humor which[ marks the fellowship weeks of the session he presentedmore worth of tish for each man. The fish. ll varieties aboat tl and describes over = 1

of bright; men thrown into bills and amendments to the constitution cries of the United States supply 800.- iiTORWMEHWS7nulAf'JDSHRjes 3&: of choice fruits and flowers. 6. i

daily (and nightly) contact for monthsat than any man in the house, 000 pounds!! annually and those of Europe I Oranges Figs Mulicrrks, Peaches,, Nut Pins Trees Per, Grapes
a time is said to sooner or later the number being something over .">0.They l.SOO.OOO pounds.It :: Ornamental Trees, Rcses, etc. i.

.make breaches in the walls of hauteur are said to cover cn'I' SUhjl'ctunlIt'I' A'l Adapted for Southern PlarlegAlso ii

that some new members think they the sun. He was asked one day has been demonstrated repeatedly in ':! a Complete Stock of Field anti Garucn Seed and Fancy Poultry,

must erect about themselves.This why he had intiodiu-cd so many bill,. every state in the Union and in many j ....Everything, for the Farm, Orchard or Garden..... :
foreign countries that Chamberlain'sCongh
doesn't that the life of "Have IV" he answered, and then he
mean a Remedy isa certain preventheaml 3 Hfgh-GpJa Goods and Low Prices Our 131&fto. E
congressman while in NYas-hington; is asked his private secretary' how it had
for It has become the universal
cure
croup. 33 I
all fun. It is oufy another instance happened. remedy for that disease. M. V. Catalogue Free... Tile Gfiffif2g BiOS $ O*, f-

that all work and no play makes Jack "Well." said the wide! awake secretary Fisher, of Liberty, \\'. Va., only repeats a Xurs,>i"ies ant Test Grounds PCMGNA KURSZRiES, f.

a dull boy.Generally. "I have presented for you the what lias been aid around the lobe when
the best things one hears i bills introduced by nil jour predeoo- he writes: "I have used Oiamhei Iain's a at Maiclenner, Fla. Jacksonville Fla t

in the taumntsallll other spots about sots \\ liichere never passed. I Cough Remedy in my family for several 1T+ 1t'P iT 3tT !ITT'RO'DT9T'RM1' T iT.71t RfiMtMtMiMIT.ttTEMMtN! !

the capital where congenial spirits thought this was the least you could do years and always with |>erfect SUCCVNVe ?.
\ believe that it is the best
gather, as well as at the notch: are the for thorn." not only
cough remedy but that it is 1 -mecure
: ,
anecdotes and stories that the members The concessional delegation that I
for croup. It hay !Mivwl the lives! of our z
tell on each other. Sometimes one went on the trial trip of the battleship children ," SI
a mimU-i ul'tiim-a This remedy -
'of these stories[ used during; a discussion I Alabama played a little trick on Con- is for sale bv B. R: WiNon lon.: .

on the Jloor of the house or senate, jfrexsman Thomas S. Butler of Penn-

but as a rule they are reserved for sylvunialuch created considerableamusement.

more exclusive use. The newspaper One of the gut,;is who I Dr. Hathaway

boys, however, generally get them all.J. carried a photographing outfit abo:11"Il1:

I*. Dolliver of Iowa, one of the ora- desired to take a picture of IMvviu S. J i Treats AS! Diseases. $:

tors of the house likes a good joke and Cramp the American and Russian !

tells a good story once in awhile. By val otticials aud Congiessman: na-I;

birth Mr. Dolliver is Virginian[ and ham of Philadelphia. Loudenslager of His Method Invariably Cures All .

there is a decided Old Dominion twang New Jersey and Butler. The last I Catarrhal, UroiuMal, Lung, Stomach #1 ) !
.
to the turn of his no&e. He is nicknamed named representative was missing I Liver, Ki ii: :it'j iUd Other Complaints f .1 if / fa (

I as:: )hi.: as All nis\.1 .rs t
"Rolled Oats, a name given him when all UlTall t.'Ull'nts had been made,

by the young women at Spirit Lake, and a search h of 15 minutes about the and V t'akwsM s of }\ oacn.

where he spent last summer. The vessel failed to locate him. '+ in Dr. Latluvvav's most
said that Mr Dolliver A .. t '.\l':1l' pta"t/t: '. c'A
young; wouieu Finally the New Jersey congressman : ,
.
f a I'-'i.uJ tf !!HI.-
orated every mottling in ordering his whispered > one of the searchers, :UHI'' \ t." -'tar;. ".'k'I.ai'vt."'.

breakfast and that a part of his orat- soon thenaroe: between decks thecry I \.-40-, ...!' J i ..in J t1 1" >a u:. Utvt all ,
ing was a rolling of every "r." The of "R I call!" In loss than two l.lul'Jfl! d Sl'a"l'S tl
.
{ i. a aiLiHUIII'U aud
f gentleman from Iowa appreciates the minutes Butler rushed 11 :'
,
s Cungresnman : J"i : '.: l i \\ w! 111f Ifi
:"., Joke, as he has an unusual keen sense upon deck;: all out of IIrl'ath.'hell Le W" !,"" ;'). II":' ". "J ;;"I'll""D l"i lets! i
"
humor. He showed this in had t";'"! ''ot'ca ULlorul :OUt:--
of a remark recovered he said that he had ..1-1
"" .. -nl.1'r. .
\
he made the other day when dis- been enjoying:? a nap in his berth when i tf" \;-- 1':mti'":W1Y'S iu>

cussing the theater.a1 have never he heard the cry of "Roll: ("aU": and 2'i' J tJ"lI! of in':.tment gets
seen but one tragedy he said, "that for the minute thought himself in the ,\\ dii,-ctl> at tile seat ut

1, did not seem like a comedy, and that national capitol and that he was PUl'ih..s the trti.t'k, ruri1it'S: the Llood
U
lILt'Ide system 'aJ>
'Hamlet' l> Booth." ed in the house \\:1l1t-1 t"lIl'- ";; n.I-V rmILa3 S 3IDII TG '
was played y of \ theBSood.! nwtrililAS the ixisoab "i! : ;'i V .

A good story is told at the expense of vote on some important bill lie did produce' the disc.is.-il con-l'tions.] ___,r.ETWEFX: ____ ,

s lion. CyrusSullovvay., the tall representative not realize where he was until he 1'rh lit" ..". to r-'";,'I.t
7; : from New Hampshire, who i is: struck: the main deck and saw before AlDISf3ieS! hcatth'irn' iTrt raff,'r,'r, JACKSONVILLE AND NEW YORKCalling

it a vigor .. ; :i"l graphic talker. It is related him the laughing: faces of his colleagues Treated., from r' I.fI'h. I'.ron-'litis. .vs- at Charleston, S. C., both ways.
theta II iTever, ;* leh.
Tnut: (\':!:"!- 5ts. 5tc ;:
t' that in i he campaign of IS'JG Sul- and others. Then he laughed Liver and Kidn-x ]>is. -T.r-s' I->... TITIr" !'.'n' The Finest .steamships in the ('on" he Sen ice.Diroct .
loway went to Portsmouth, N. II., to cers, Eczeiiu and M m;Miner ;'f sin: afft'l.tinu", --,- ----

make a 1'11I'\'h. The Republicans there, too.Old friends of Joe Blackburn of Kentucky Discasesof Imr' fl.lti-'. :\' .:! ,,o. trt'it'i Rtt'tlr : :. 'l'1I1: ('I \'IH: :\1:'" c.au: : .\\U: O.rIlInX LIXIS
"r"'I'l '', ''( < .tit the '
knowing 1.til'l' nature waited upon who are interested in his return %Women
mmdi.tr""ll: !r t."altncsr" and 1 ___ service1Between_ __
him with few words of warning and to his old place in the dheasesbyv.-hich ; .
a senate tell this c nun. tan "a are aHi"t"IL Jacksonville, Boston and Providence, and all eastern points.
explanation "('y," said they, "the story, which is characteristic of the famous Electrical Dr" JIathtway"-cftil't'sart' jilt .
with I Calling at Charloton '",tb wars,
aU! tl'I.1tI t *rtrtt-al an
Democrats round here will vote for Kentuck'airSenator Appliances.
other apI'liiLnI't";. in the use ofwhic1i SIMI-\VEEKLY: SAILINGS.
McKinley t.is! year if you don't scare Blackburn was oiu-e a guest as wl ti! '-' "', has world
;ta : in:< re ., ,'
--n-i ,
Ji southbuuud l-uiiu I -\\is wharf 1:o-iini. Xurttib<"nml-J rom fool uf Ho all Street,Jacksonville.CljIIj'S .
them off. \\hute\er you say in jour at a very large party, and he was the wide faille as", an (-\i PNtll of the in Hme> -- -
g \ speech dou't get the Democrats mad. used b>' l'r. Ii at hiL\\\' art c;'nt|>o !Dd<'d mills ; ST. JI9\2S Itlt- I'll LiSt
.. own laboratories, und"r I':- JMTMIPI d.rrction:
f. \ Conciliate them, Cy; conciliate them." and DhBviLINK..
special ,
reined it>s :ir > nrt't':irt'd fur eirtiladnidual
} \ Sulloway shook his shaggy locks byway i case accord:ng to its re.jllireIient';. Ih'." ('('II Jacksonville slid .saufoid.

\ of understanding and approval 1t1 d /i Examination 1)r Hathaway .tmi. j.u-iared a Stopping' at 1i1atbt..r: St. Frauds, Ufros>ford (DeLand). Blue Springs and otherinti'rinwiiate
ser.fsof: > '!h f t'VH! i .nati.nhLttmksapplrln'tt
\ "\llright!" he said. ttzL,.-- Blanks! ,Uw! iiltt'n'ntd.MMscs.whidi Undines on M. Jv'huo river,
1 < strums FKED'K I)tI.1.IYI'T.. \V. A. Siivvv, is appointed to sail
1 The speech began. It ran along all he sendsfiet- :n-nin',ituni: :No. i. forMen as follows:
Leave kMiiiullf 3.30 m., Sundays T'i 'fedays and Thursdays.
enough until Sulloway approach ; ; Xo.2,for lvolnenu.: "'. fur>k.n Diviibes. p.
1'right :No.4,for Leave Sanford !tOO a. m.. Enterprise 9:30 .1. ni, Mondays Wtduesdaysaud Fridays.
t t&d the sins and shortcomings of the Catarrhal Diseases: :"il..5. for Ki.laejs. --' .

Then he ConsultationPc HalILI\\lyJnakt'snoeharge: :-uth'UIIIL St'IIKDrLE, Northbound.
democratic party. grew em- ; I'"l ,ti. n at either his

,, I -tic and eloquent; also seveie. "If f&b& free.; on (','IIr 1\ :, ,a':. Leaves It'alllu\\'u.30 I'IIL---------- ____________Jacksonvilles _'____hhU__ Arrive Read 2 00 up.

f. .to5yt ''* m usual J. and at the bottom of the chasm -- Dr. Hathaway i Co., 3 00 Am ____ ______u_ ,__.__________Astor ------- 'hu .h._ 2 30 pal
25 Bryan Strcc, Savannah, Ga. .. -130 am--------------------______St rands1 pm
tOithe/the 'f ,'S of perdition, and if / % ME.'iTIOS TillS -Afi.K WHEN W iU'TI':;C.Ji __._____________.._____Betbford bdl-----.u---u--- ? ia oo 00 pm u'u
th ''3sin was suspended a ., 600am._____ ___ Bine Springs. "
t ----- ------- --- -- -- 11 00
Mr. r" '.hling the, entire Demo- C .A. !3 T O R T l,. Arrives30atu-------------------------- Sanford .- u._'____ _________ 9 00 am am
e\'eralilays ? 1l1 .. ___
_
In 11\ w what 1 9 Jo am--- n' .uEuh-II'j't.u. : 9 30
:::" -"h-=-. __ _am
Inr : Fruit ilke dull c ro -'
home tind
ent1emeu 011Ierrit : }\ BootCURES E. B. WAGER, Agent, Titusville, Florida.
for some goes ently. Theentertain ntt i'l .al'pl to tso ,

t > fo 5 to see what ere especially I.tf..l, Ji the river. Iva General Passenger and Ticket Office, 20i West Bay Street, Jacksonville, Fla. ;

>ln1e ("\1'1;' .aU\' .,..-$11. Sharpe received el\ \V H 11'.1 I1'ETIIN. T. P. .\., F. M IRONMONGER, Jr., F. P \., 1

day Irs. DiBoll( leadins A from the McFarlandr c :, 1\\\ling Urteii, New York SU4 vest Bay: St.:, .lacksonville, F a
of st.1Jlng'q o wtiERE All ELSE rAL5. C. I', LOVKLL, A vst. Fla. bui>t.. JNO. L. HOWARD, Superintendent, '
seen the tho with which tctate'n Best Cough Syrup Tastes GooO. Use Foot Hogan Street, Jacksonville, Fla. Foot Hogan Street Jacksonville
he d 'a Span 'ture Al4)f a f 1. "- in time Sold by druggist i.to. TIIHK: (J. MiKU; "".'"". P. CLYI1K& COn Fla.

jaY do, Silvei\ras the /C/.tClunst" \t on Trade Manager, General Agents.
the. w' 4 edtnSt-' \ si- SBowlin- \\m York
t '

: 't -- 4i pen, of its"eQlto j J M 1 V I, 1



Ur.kJLIL t) i \\ f t l \ } J.U" ) r


I i .
) .
... ,);,.,. NW. -
I"
->.



.-; ,.,...d-



/,,
'rOot

.
'1. 'oc _. :: '
.
,". .' ; ;
\
.
,'\ .
.. ...
..


_, :' :'f j: ;;f} ;?;" .,< : ; 0/: '; :: :' ;,' ; ;' ;, ;} 7t ;;;': : '. _, ,:" :: : : ,; ,;.: : ;:+;;K c'i.;:" I


"' r' .. ......-.. -- ,
-
", ,. \" i.,' o ,.

,




"3 THE. \' FLORIDA STAR






.



Not fo* Oqsel'es Lloqe! fittf fo:* tlte Qood ofO eus Also.r4 /'


1.i .


VOL. XX. TITUSVILLE, FLA. FRIDAY, JANUARY 26, 1900. NO. 40. ,




CURRENT LOCAL LICONICS.k O Wire reports yesterday of the state bean that market the from mar LATEST r NEWS A AND D 1 INCIDENTS. the company Kansas, which City has Roofing lately&erected Corrugating a fine I INDIAN RIVER(R RIPPLES. -


r ;, et is very active, prices: good, supply new building on West Third street in

tI ; Brief Mention of What Is Going On ID light. Advices to rush in shipments. Matters of Interest That Are Happening Kansas CIty. Mr. Twichell extends his Paragraphs Personal and Newsy Briefs y*

and About Titusville. Green beans quoted from $3.25 to $3.75
i.{ Around Town. trip to Havana ere he returns home. at Towns Along the Coast.

Send your.watches for repairs to W. M. per crate, wax beans $4.00 to $4.50 per Pay train for this month arrived here .Arriving here last Friday, he expects to 1

J.. ; Woodward, Titusville. Work guaranteed. cr te. yesterday morning.Mr. spend about six weeks in all away from CITY POINT.J. .

It The local agency for the Elk and Dixie Judge Zeller and Mr. Ringler, of New Willis Goldsmith is home. We received a pleasant call from P. Brown, of Titusville, was in town

.b ,' bicycles here will be held by E. B. Wager York city, were among the passengers on the that very proud of him on Wednesday. He informs us that Tuesday afternoon. s
new boy arrived
, '. for 1900. the southbound train Tuesday for Rock- at his residence I Mr. Fronie Cleveland, formerly of Titus-

,ft'","..... edge, from whence they visited Georgianaon this morning. rills, is with his company and doing well. John Mot, of Indianola, was in town ,
} \: Mr. Chas. D. Sumner, ot'Ormond,.ar Wanted manager I several hours Tuesday. -
legal business. :Mr. M. Goldsmith, of agent or for accidentor
( rived here a day or two ago on a visit tohis this old line BUTTERICK patterns-DELINE- T. L. Lee left '
place, was also at Georgiana this insurance company. Address, I Thursday for Woodley, t

'\f cousin, Mrs. J. A. Hughes. week on some legal business.Mr. Company, this office. Stamp for reply. ATOR'S. Gardner's. where he will spend several days hunt-

z :; :, Messrs. E. L Brady and W. M. Brown Brooks "Mr. E. J. Dunn ing and fishing ; '
'.,' who, with his family, traveling salesman for The Proposed Canal.In .
went to Miami Tuesday afternoon to look lived in the building just east of the the Arcade File works- manufacturers of Morris Weinberg, of Cocoa, came up

: ,after business interests in the bay city. :Methodist church, passed away yesterday the Elk and Dixie bicycles, was in- town a brief interview this week with :Mr. Sunday morning and spent the day with

Mr. R. Rocker, of Cocoa, spent ,a day morning after an extended illness from Monday and Tuesday. J. 0. Fries, our county surveyor, regardng Ernest and Lawrence Abney. i

,/ or> so at his home place at Mims this consumption following lagrippe. The Mrs. M. S. Jones, Jr., who has been i the proposed canal leading from the Irs. :E. V. Blackman and' two daughters -

r week, returning to business again Tuesday burial will take place today The family St. Johns, at Lake: Washington, into the
t, quite ill for the past few weeks, is now Indian river Eau Gallic river Misses Fleda and Belle, returnedlast
{ through ,
afternoon. we understand, came here from Georgiaand considerably improved, we are pleased to week to their home in Miami. ,
in about which THE STAR has kept its leaders
s The yacht Nemo, Mr. Goodall and are quite strained circumstances, state, and we hope soon to see her out. Dr. Holmes called
the
so much so that the has aided thoroughly posted past few weeks, was to Indianola
j: party of friends, paid a visit to Rockledge them the past few months.county Mrs. J. L. Mather, of Cleveland Tennessee t!'specially: regarding the movements of Tuesday to see Mr. A. Hildreth, who <

i Monday to test the running of the Daimler the the Jacksonville board was badly hurt in
was among arrivals in town of trade, which a runaway Monday
; motors The Capt. J. S. Matheson who has been
returning same day.
&' last Friday. She will visit for a monthor body seems to think that such a canal evening.
Remo left in charge of the of the
Wednesday for Daytona. steamers I. R.
more with her daughter Mrs. Fred S. would interfere with navigation the
on Sam Holmes y
and Bruce Xichols left
& B. B. I. X. while laid the
-
Mr. J. T. Davis will company up Chatfee. St. Johns Mr. Fries informed
shortly complete upper us Friday for Palm Beach where
have
few visitor they
past months, was a to his .
fi his contract for building several new fish Capt. H. B. Shaw, superintendent of that it is only the intention to cut this accepted positions with
i wife and son, Edwin, the early oJ Captain Tony *
boats for Mr. George W. Scobie. :Mr. I. the week part the life saving service for this district, canal of sufficient depth to relieve the Canova. -1 f
his
returning to steamboat
Scobie will add about eight or ten boatsto was in town this week on his way to excess water from the upper St. Johns .y,

his fleet this spring and summer. duties Wednesday. The captain gave usa Chester Shoals house of refuge for inpection. after it is higher than the ordinary stage) Mrs. C. L. Faber and daughter, :Miss: a

pleasant call Wednesday morning, andwe in Lake Mr. Fries Kena, of Faustina, have returned from a
Washington.
NEW SPRING shoes. Gardner's. hope to see him in charge of the +;t. ; says month's visit to friends in Eau Gallie
Mr. W. J. Tucker, of Fort Pierce there is about fifteen feet fall from Lake:
was
r Augustine when she the and Sebastian.We
Capt. Pitts returned here Wednesdayfrom goes on run from .
in town Tuesday, having been at his Washington to Indian river, but that the ,
Rockledge to Palm Beach next week.
a very successful trip to Daytona, Cocoa branch saloon for a day or so, canal can be controlled with a lock, if omitted to announce last week the

!' and has left for Cocoa, Eau Gallie and other REDUCTIONS in where he states he is doing a very satisfactory necessary, so as to retain the waters of arrival of Dr. W. P. Moon, of Couders- !

points on his route homeward bound, room for spring stock.shoes$3.00 to make shoes business.Mr. > the St. Johns at the ordinary stage; but a port, Pa. The doctor's many friends are i
expecting to reach Fort Pierce Sunday. lock is deemed glad; to see him
for $2.25, etc. Gardner's. Eugene Brainerd, who has recently hardly necessary, as some again. i
Mr. Sam Childs of Cocoa portion of the canal will have to be
cut
completedthe 1 returned to Indian river from Georgia Judge S. C. Graham, of Richmond,
,
brick and plastering work on )lr. W. Hank Changes.The is'engineer on the steamer 8t.- Se astian. through a hard substance or some kind Vs., who has been stopping at the Hat ,j tt
M. Brown's addition last week Satur- of rock that will be hard to wash
on
away. ter House for several
weeks !
Dade County State baok, of West Mrs. Brainerd .i i.s located at Eau Gallie i left Tuesday ;"t
day, leaving for home that afternoon, .
for Titusville his
for the on home. The j
Palm way
Beach which has been season.
When i
largely ordering groceries for all
having put in about a month's time on judge will visit Western
this work. owned and controlled in the past lIy :Mr. W. [I. )[McFarland president and staples send to W. J. Crayford, Titus- Florida before ,f 1

t. Messrs. Wm. M. Brown and Jas. Pritch- general manager, and Mr. E. J. Seymour, ville, Fla. We can please you. going north. ji.

Commencing Wednesday, postal clerks ard, of Titusville, last week passed: wholly press agent, of the McFarland Fruit Protection Jos. Middleby, Jr., and wife, Charles -F

were placed on trains Xos. 29 and 74, over into the hands of residents of West Palm company, also Mr. L. 1:. Decker, Entertainment at Eau Gallic 1lfddlebyllrs. F. F. Clapp and Arthur

t. the Florida East Coast railway, between Beach. Seventy shares of stock formerly! of this place, attended the cassava convention The entertainment in aid of St. Johns Dooley, of Boston, Mass., arrived Thursday -

\ Jacksonville and Miami, giving a daily owned by Messis. ,Brow and Pritchau I at Sanford yesterday Mrs. Mc church fund by the ladies and are pleasantly located in Mr.MidJleby's .
Monday
double service between the terminal have been purchased by :\Ie srs. George where .
Farland accampanieil Mr. Mac. on the proved a great success; the hall was cottage, they will
, points of the road. W. Potter, R. B. Potter and George L. spend the winter. ,
;; i. trip. packed to the doors.lr8.. W. J. Xes
\ Mr. Fred Sulzner of St. Brannin, of that town.JR.: B. Potter tak .
Augustine; Indian River band, fourteen members I bitt and Mrs. McIntyre aided greatly in Tuesday afternoon Dr. Mitchell and

.r t well known to many of our young people ing thirty-five shares, George W. Potter in all, went to Sanford yesterday morning the success of the evening by a series of Henry Banks, Jr., drove to Cocoa inMr.

; 't,,; ,:here, stopped off from Tuesday until twenty-five shares and George L. Bran l to furnish music for the Sanford views (stereopticon) with a short descriptive Banks' buggy. While there thehone
r'T yesterday on his to Miami, where ning ten shares. At the annual meeting
way ) people on account of the cassava convention lecture on each, and som became frightened at something,
he has charge of the bicycle livery at the of the bank, Inch followed these trans
VJ and agricultural meeting. Thi: choice selections on the phonograph, and commenced to plunge and kick. He
actions
Royal Palm this season. the following directors were speaks well for GUI town to have our which were much appreciated by the succeeded in partly demolishing the buggy -
elected E. N. Dimick
: R. B. Potter E.
Our thanks are due to some one of M. Brelsford W., musical talent called to our sister!' town large audience. The piano solos by Mrs. but was finally quieted before any .

the members connected with the Can D. Ilendrickson., George A semi-annual Potter and dividend U. on such an occasion. Stewart and Mr. Adam, Melbourne, serious damage was done. Dr. Mitchell Y

averal club for remembering TUB STAR of 4 cent declared Mr. W. C. Peterson of Canaveral, met were much appreciated, and the violin and Mr. Banks escaped without injury, \ I

force yesterday with a half dozen fine per was $S1! O another party of friends here Sunda solo by Mr. W. Pomeroy received a deserved but had to drive home in a rented bug y.
carried to surplus and $:'10 to individua }
' ducks for which the donor will pleaseaccept from Duxbury Mass. who will encore. The songs of the evening -
profits. The bank is now six oltland spend
' our hearty thanks. is doing a steady and years increasing the balance of the winter season with were rendered by )Ir. Mitchell of; EAU GALLIE.

i';' Steamboat Inspectors Vogel and Spencer business. Deposits constantly now are- him at his place on the Banana river the Granada who, by his untiring efforts,, Orange trees are putting on new

E': off here The names of those in this contributed largely to the success of the growth.
stopped yesterday on their about $75,000, loans and discounts about party are as >

.. .' way north and inspected the steamer $30,000. follows: Messr W. E. Brown, Isaac evening. The program was followed by Mrs S. E. Barbour left for a trip toXassau

-- Canaveral, which, we understand, ha George L. Branning has been the cash Simm, Lorenzo Windsor, Frank Glass. a screaming Dr.farce Halleck, entitled Welles, "The Doctor'sShop" Bahama Islands, Tuesday.Mrs. .

been purchased by parties on the St. ier of the bank ever since it started L. B. of and fir
was Major Dawson Narrows, has Mitchell were in the leading parts. The Treutler has been ailing, but is '
r Johns river from the Canaveral club. and the pro-penty of it has been due in i been very ill for the past few weeks willa audience were imply convulsed with convalescent again under the professionalcare

Mr. W. Ernest Vanlandingham has just no small degree to his careful and intelligent severe attack of liver trouble which l laughter from the rising of the cmtaii of Dr. Hebaid.

'r purchased an Orient bicycle from E. B. business methods. prevented his giving attention to the care
to the clog, and Messr Mitchell) and Our old friend, J.1.. Randall has
Wager, the local dealer, and will makeit and shipment of his bean crop, of whirl Welles are to be most heartily ,
conjrratu
over to Nassau in the Bahama
his mount for 1900. Orients are the Special prices on mattings for the he is one of the largest )growers on the lated on the great hit math On the gone Island, for a month.; ..

popular wheel with the Titusville boys. next ten days atJOHN east coast. lIe has recovered sufficientl v termination of the farce the floor vva;:

They all know a good thing when they R. WALKER'S.A to take a trip to Jacksonville this week cleared tor dancing; which was kept Dr. Ilebard has purchased a high
up|
see.it. Keep your eye on the Orient.A of for a few days. without cessation until a. m. MessrsPomeroy grade tricycle, which will be of great l
Jolly Party New Yorkers. assistance making professional calls. '"!. t
Mr. E. F. Cooley of r..ansingIich., Adams and contributed
Deyman -
colored the of Willia-n .
man by name
v' McKenzie was arrested by Sheriff Brown A jolly party of New Yorkers passe d'I'' is expected to arrive here this afternoonwith I several new waltzes and two-step Mrs C. C. Booth holds the record, ,

and brought here from the northern part through here on the southbound trainMonday I a biiMne'-s friend of his for a cruit-e Melbourne was well represented, Mis- having caught the largest trout this /i

f of the state the latter part of lift week, afternoon on their way to Xcv doAn the river in his naphtha launch, .j Stewart Mr*. Bender, Mrs. (ioode and seaon."e1ght: 11, pounds. Mrs. Booth

ins' River View, at Merritt, where they the Whistlewing. The motor he formerly Mis. Irwin U'ing noticed among the landed the fish unaided. ;
charged with selling whiskey without a I .
' will spend the season. In the party were had in the launch has been who ..
t license. lIe is now in jail to await his lately guest largely; contributed to the Mr. G. F. Paddison was under the
Ex-Register Hugh: McLaughlin and wife overhauled and ciu.'gp.l, and arrived enjoyment of thi mo-t delightful eve weather and
Saturday lIe is
trial before the next county court. Sunday. '
and maid; Ex-Chief Xevins, of the Brooklyn here few for Xolonto St. Johns church] will I
days
a ago Captain ning. net a handsome now about again: as usual, the indi llO i- .
Mr. R. G; Grady, a prominent young fire department, and trite; Mrs. Reed I, place in the hull ready for serviie.Tin sum after ail expense.-- are paid. tion being of only a temporary nature.

of Bur aw, North Carolina arrived Col. Kenigan and daughter, Capt. Michaela -
attorney
services of the Indian River
in town last Saturday, and remained and wife, Mr. Wm. Henderson, I ban., I. $1 FOR 11 yards, Fruit of th e The whistle of the steamer St. Sebastian I.
of this
here until Tuesday. We have the, Mr. J. Qnaid<
: [ Wilkin"on!" of Hawks Park, who was I' convention and meeting of the Florida point being one of the most important .
evidence that there is
most positive agreat
for with Chief Xevins and party la-t reason State Agricultural society. at Sanford : Tree Shipments. stopping place0:1 the line of touristtravel. .,. ,
in Mr.
town
attraction .
'7 our the band .
) ye.-torday, leaving
Gra-ly, and we should not be surprised will have charge of the River View th is i i to return today. Owing yesterday to the Mr. O.11'. Conner proprietor of Okla. \ 0 .I :
morning
11 to see him return,.here at no far distant I year, vice Mrs. Mahon, who managed! I I engagement; the concert will be u-ndered |j j waha nur-er.: ..., write:; u- that he ha* re Mrs. C. W. McXab has succeeded in
the house last season Chief Xevins' taking some handsome photographic
day. tomorrow (Saturday) night instead of,'centlyhipped' &'IIHvery fine oranj; !
party always adds} a great deal to the i jtiees 1 view of Eau: Uallie ami its environs, '.
Dr. W. S. Graham and :Mr.: Worley, of J Thursday! night, the usual dat{'. j to the following! ; parties up an ....
f winter life and gayety Merritt, a":: they I i ii j down the east: c u-t, which i is pretty good which in finish are quite up to expert
!
the Miami bar, were in town this week, always go in for a )good time to the fullest i J )Ir. Xed Smnmeilin, of St. Lucie, stop that professional work.
; proof an advertisement= in Tin: STU _
coming up Monday. Dr. Graham had extent possible. Mr. McLaughlin vva-= !! ped oil'at thi place Monday on his way i :
i is investment J. H. The
a paving : LeTour- ladies of St. Johns return thanks
several cases to argue before Judge Jones, for several the leaIof the Democratic !ito Magnolia Spring-:, near (,teen Cove ]
I business I years j i wan, of Eden: T1.: Rickard, Boca Rat t to Il'ssl's.Iex.. Xear, G. F. I'adlli! on,
which with other important 1 : here he settle
party in Brooklyn, and fought1; prima goes to some disr'puted !'
:
tone X. Saunders Eden E. Porcher Mitchell
; ; Dejman and Fergueon for
Mr. Geo. :M. i'
with his partner-at-law, against the Tammany schema of Great interest: in legard: to title to land
| Cocoa; yam Filer, Buena Vista; C. Price their kind -i-tance in carrying out tIle "
. ri' Robbins, kept him occupied here until 1 Xew York. He is : that his father owned !
'
,
now a powerful organizer many years ago William, :Miami C. Knckr-son details of the entertainment of
; ; :
.1''' Wednesday afternoon, when he returned in Tammany hall. j which he thinks can be amicably arranged Balian-I Tuesdayevening.
' i' dalell.;! C.' Hoo-1 Palm Beach; : i : .
I home. to the :satisfaction:: of all parties. F ,
: ', Jones Titiuville J. .\. Cio
k Mr. A. R. Gladwin, who hag beenvisiting For thoroughbred poultry and poultry I-The J land in question:, i is very near th !' Ratone, W. ( Gilmore; Jen-en:-by, J5ocae ; The: Euchre club met at the Avilah fry '.,r"
Geo. I K.;
r ,
his brother, Mr. S. N. Gladwin, supplies of all kinds write E. W !: Magnolia. Springs: hotel. I ; I rooms Tuesday.:: .\ very plea-ant e't I
1 1I Amsden, Ormond, Fla. I. | Andrews", EIl'n11.1 l he has an order for I
for a month or so, expects to leave tomorrow j j Mr. L. R. Decker has some work ahead j W. J. Duvenet of Hobe I ning was spent by the guests present. .. :
Unll.lr'l I Dr. and )11"::. C. C. Booth entertained ;
L for Palm Beach anI Miami: but Church Notes.) to be done in this place ere he can take ] Conner now start ;grafting \ 1-e I

_ will return here in March! and spend ;, up something elsewhere. The most im- ;i prepared the nextixty! days to graft I The next meeting; will be two weeks W !

several weeks. Mr. Gladwin enjoys the Archdeacon B. F. Brown will hold divine i-1 i, is that of in j I from last Tuesday. .!
: portant putting about 500 ;,. to order any trees that may be required, \.
Il fishing with rod and reel here in Marchand I service on Sunday, Jan. :28th, in St.Gabriel's feet of sewer pipe for the town to can ito!' fill orders for his old and new cu-tom- I Archdeacon B. F. Brown conducted". 1 '

' April better than any other of the church, Titusville. both morning ; pletely drain the flat at the rear of his I ers who may want some tine tree, either I service in St.: John Episcopal chi'rr' \ ,

i winter season months. I and evening at the usual: hours. 'I cottage and that of Mr. C. A. Gardner, i|: on small or large stock. He will meet all'I! unday. The archdeacon aiiiy/7 :, 'I",, \

The new 1900 model Columbia chain Services at the Presbyterian church! : : back from the river bank, which causes :;. demands for tangerines and ral'e.frnit,1 that during the coming mont' ... d, .. \'.
'
wheel, received l Here the first of this week I Sunday school at 9:45: : a. in.; preachingat standing water after very heavy rain s. :,.: and will put out over 15,000) trees to the:!c Ide\'. Bishop Crane Grey wo'J UJ t =fat. n. 9"Nut"

1 by E. B. Wager, agent for the Pope Manufacturing 11 a. IU. Subject, "The Mind of the: Mr. Decker also has some carpenter wog k'taco!I varieties1. i! Gallie and hold consecra .te V i

) t company: was sold same day I, :Master" Song and praise service at 7:15p. : to do on Mrs. Dd?ler's residence. i 1 j I r 1 I St.: Johns the church: be$.'* 'u.1jI 'It'jtrr. .

to Mr. L. A. Brady, who is'ery proud I m. Subject, "The Curse of Uselessness. :\ if h. Jerome Twichell, of Kansas City i!I II. HAVE YOU GOT CHIGGKUS' *? I out of debt. .. -:\l- -Mine, "JB."

" of his new mount. The Columbllhas ." Mo., i is spending a month at LaUrange1 I! Gas lime will' daHKE" ', ;' '-* r ti! -' ector''.'.. /
,
notice ,
many new features for 1900, which OYSTCKS OYSTERS and this place, stopping with his sister Itisr r' \ 'n I
t
very | are I
ItiI'as' Fit and ; now af .r\e! t
'uJ'\ open
> your joiiltry-- : F. *
;
'I we will take pleasure in showing and Fresh Indian ri'rer oysters to order. !' :\II' Xettte Feaster, at LaGrange. It h : 1.O hb JIE : 'ish 1 tet'at .boat sails! t> Sunday Jot.. (

''t describing to anyone who wants one of Send to Jas. A. Russell; St. Lucie, who .! been several years sin.l'eIr.. Twichell i, peurbf all. ,Eau: ;f.ri te. '.rl 't, a,.mm.'Rri om 1 toi.eX'to. .1 ,

t. .- these matchless wheels. 1 will give you prompt attention j i visited this section. He is a member of j i I .mor"' rompt a"J *'\!!,. v ) ,

\. .f: 7 d$s \ *1!*" I
o
.1.11 \ v -\ '

i' .; VI .. / ) !
.
\' I : f '' ..
,. 1 (
\ -
'- V \ !, I r
1 i I .-\ "I
\ -1- ..
Vv /' .-..< \J. ........ & I
.t {
i- ..
f \ 'i '
-..., .- ...-- ", \. -c>' -... .
,. : r
<- ..;... .J' .-;.., .... -. 4'] 1IiiiiI -



:
<
'* V H ..
,... "',':'_ : K
"" c % \ I

.
., ... t2'


i 4. ..

1 '- -'."-'' : '' .

t-; .. .f: f : THE FLORIDA STAR : FRIDAY: JANUARY 26, 1900. 11



J THE FLORlIl\ STAR Republicans are criticising-+ the may say, pecuniary obligations to their W! "TED-Honest man or woman to trav- Florida

families. el for large house; salary |65 monthlyand
$
1
; president quite severely for takinga expenses, with increase; position
such
: .Entered at the postoffice at Titnsville as standthat seems to be so hostile Under circumstances what encouragement permanent; inclose self-addressed stamped Central & Peninsular
' -I" t second-clasa mail matter. has a woman to marry, ex envelope. MANAGER, 330 Caxton bldg., .
'L -- --- to"the doctrine of protection. Dur- cept to precipitate herself in a dungeon as Chicago.

';, r:", "' Blllg_ K. Wager Editor and Publljher."PUBLISHED ing his whole political. career he a living martyr to slavery and neglect? Railroad.

has been an advanced protectionist They are bread winners: and forced to YOU NEED A PIAXO OR AN ORGAN, .

: EVERY FRIDAY MORNING. Indeed, he brought himself it by man.I If you do not, your home does. Life with- Unexcelled service (from Florida

" 8UBSCKIPTICW write collectively, but now and then out pleasure is a living death. Music will to all points .. .. .. ,.
Iff 31.50 PER: ANNUM into notice in public life.by advocating -
make home bright keep the folks
"
your young
hit howls
"the dog and and then North East and West.
75 CENTS FOR SIX now ,
; MONTHS. the doctrine of protection.It about the hearth-stone and give pleasure that
: & pitiful flee bobs up through the press will mean years of happiness. With the good Two trains daily between TAMPA, f"'-
-idyertlaln. :: Rates Furnished' on seems rather remarkable* pr and barks on a cold trail. Poor thing! juices prevailing for your crop, why not JACKSONVILLE, SAVANNAH and

; I" = Application. tectionists, therefore, that he shouldbe He only gets the echo of his own noiseas spend a hundred dollars and get a piano? Ton COLUMBIA carrying Pa.Iman; Drawing .
can pay balance next year. An organ will Room Sleeping Cars, cannectiug at; COLUMBIA
t Mr. Hoar so ready to throw down the bar- compensation for. his labor. only cost from $20.00 up, and yon need not with sleepers forWASHINGTON .-
: and the Quay Case. riers of prot ction. MOST HABDEE. pay but half now. Any instrument shippedon ,

f-; It is that Senator Hoar Jensen, Fla., Jan. 22, 1900. trial and satisfaction guaranteed.The BALTIMORE
reported The constitution provides that oldest and largest house south. PHILADELPHIA.

r* when approached by an anti-Quay "all duties imposts and excises PHILIP WEKtEiN, Limited. and NEW YORK.
Write Muriock: Cure Co., Atlanta, Ga., en- New Orleans, La.
lobbyist with statements attacking shall be uniform throughout the closing 2 cent stamp for free sample of Mar All other kinds of musical instruments, Also with CINCINNATI sleeper via

; the character and past of the claim- United States." Is Porto Hico such dock's Catarrh Cure or Hyler's Dyspepsia music etc. Mandolins,violins, guitars, |2.00 ASHEVILLE.
Tablets. They propose to cure every case of Catalogues free.Administrator's.
up.
ant for Pennsylvania's vacant seat, a portion of the United States as is catarrh or dyspepsia.. "Dixie Flyer" Through Sleeping Car

\ replied that his vote would be cast in the \ Route between
comtemplated foregoing extract Tablets Notice. JACKSONVILLE ST. LOUISvia
Hyler's Dyspepsia pleasant, -t
to express his conscientious opin- ? If so, the president is right, easy to take, and give permanent relief. All persons having claims against the estate .' ..
ion of the 30 Mailed of Ephriam -\damslate of Brevard county, Lake City, Macon Atlanta
legal merits of Mr. Quay's and the Porto. Ricans are entitledto day treatment, $1.00. on receipt Chattanooga and Nashville "
of price. Florida, deceased, are hereby notified to pre ,
S credentials, and not a judgment on send their products to our mar- MtRDOCK CURE Co. Atlanta Ga. sent them to the undersigned, properly authenticated Making connections for KANSAS CITY, "'.

his fitness or a criticism of his past. kets free of duty. That it is sucha within the time prescribed bylaw CHICAGO and all points in ,"!
or this notice will be pleaded in bar of the northwest.
How refreshing, remarks the Times- part seems to be sustained by a Clyde's New Dock. recovery, and all persons owing said estateare Through sleeping-car service between Jacksonville :1

4 Union & Citizen,. comes these reminders decision the supreme court, ren- The Clyde steamship line last Thursday ment hereby to me required this January to make 1st immediate 1900.JOSEPH pay and and Pensacola.New Orleans yia River Junction ;, <

of a time when the law dered when California became a morning inaugurated the opening of their P. BROWN, ';,
'. dock for their Boston line Sheriff Brevard c unty, Florida, and exoifiio Pull formation on application to any agent !
was supreme and the doctrine oft part of the territory of the United new whiph, of this com any.
future will be at the dock of the administrator of the estate Ephriam
in the
expediency had not dominated the States. In that decision it was F. Adams, deceased. A. O. MAcDoxxELL, L. A. SHIPMAX, ;1

party and the nation.! When Mr. held that the customs laws were at Atlantic the foot, Valdosta of Catherine and Western street, Jackson-railroad, Titusville, Fla Jan. 5th, 1900. Gen'l Pass. Agt. Ass't Gen'l Pass. Agt. '}

Hoar touched upon a matter thatis extended to California as soon as ville. Administrator's Notice. Notice. :;
All concerned take notice that six months
res adjudicata, his conservatism the territory was annexed.On All persons concerned take notice that six after date I will, as administrator of the estate -j

is surprising, but he stands on the the other hand the protec- Stockmen Complain. months after date I will present my final of Ros well A. Randall late of Brevard '.. t
\ Feeling is running high in Orange accounts and vouchers administrator of the ounty, Florida, deceased, present my final j'
., same ground when judgment is to tionists, who are opposing the ad- between the stockmen and state Harriet L. Wilson, late of Brevard account as such administrator to the Honorable \

be given on open questions and then mission of Porto Rican productsfree county turpen- county lorida, deceased to Hon. D. L. D. L. Gaulden, county judge of said !.:,
tine people. The stockmen complain of said and and for final
Gaulden. county judge county. county, pray my discharge from
he is the champion come from the of duty, point to a decision that the turpentine men are burning the pray to be discharged from such administra. such administration. .

heroic age of the republic when rendered by Chief Justice :Marshall: range and causing the death of lots of tion. A. S. WILSOX, JOSEPH P. BROwN .

great men controlled its destinies after Florida had been in cattle through starvation. Some of the Administrator. Sheriff and as ex-officio administrator.This .
acquired, Titusville, Fla., Nov. 3rd, 1899. December 15th, A. D., 1899.
.a for good or evil, regardless of the which he held that in the case of stockmen are selling their cattle in .con

.1 -' consequences to themselves. conquered territory ceded by treaty, sequence. U6.QOBOOK$ FOR ONLY $2.90 PARKER'SHAIR BALSAM ..

Why has not the senate delivered the territory becomes a part of the Prince Edward Arrives at Miami. Cleanse and baotifiei the hair.

udgmen always on the legal meritsof country on terms fixed in the treaty The twin-screw steamer Prince Ed- Magner's Standard Horse and Stock Book Never Promotei Hair to Fails a its Injurant to Youthful Bertore growth.Color.Gray .

the case presented, and not as of cession orVm terms imposed by ward, belonging to the Florida East Coast -'N al A encyclopedia complete pictort ol r ii Cures Weand Kalp d.wisei tluuat&Druggists hilt falling_j

influenced by partisan interests the new master. The decision in Steamship company, arrived at Miami ; 'N practical reference
last from Boston. The Prince for horse owners.Tbil
or passing prejudices ? Had the the California is later and apparently Monday '\ .- book contains mans 50 YEARS'
Edward is one of the finest steamers of -, ,.. valuable recipet EXPERIENCE
senators remembered always that more to the point. The opinion her cla5, and in finish and general ap hitherto unknown 01

: they sat as judges on the bench to ventured by the Savannah News pearante differs greatly from American ; taming and educating controlli horses n I t

.." decide points of law affecting the upon this same question that the made ships. The finishings are elegant --- to Departments horses cattle devotee ,

: highest interests sovereign states Republicans will have trouble throughout. The Prince Edward has a sheep and swine;ala (
______ _______ {
; how much higher would the senate among themselves before our relations carrying capacity of 350 passengers. : '- poultry, including gS,bee culture th

Last Wednesday she left on her regular 1' care of fruit trees,etc .
now stand in the affection and con- ; to our new possessions are schedule for Havana.TO 1,200 pages, ove TRADE DESIGNS MARKS

fidence of the people But such finally settled. -j. 1,760 illustrations maenificen ani COPYRIGHTS &C.

decisions have gone to point CURE LA GKIl'1'JS IX TWO DAYS J1. -. absolutely fines Anyone sending a sketch and description may
every
and most valcall quickly ascertain onr opinion free whether an
of the compat-s-that they may be WOMEN 3IISTHEATEI{ ). Take LAXATIVE BKOMO QUININE TaBi.Hrrs -----it farmers'book in th Invention strictly is probably confidential patentable.Handbook Communications on Patents-

counted side of All druggists: :: refund the money if it fails, world. It also cor sent free. Oldest agency for securing patents.
on any every controversy : tains 17 special colored Patents taken through llunn & Co. receive
to cure. E.: W. GROVE'S signature on plates if yo'desire special notice, without charge, la the
: and they carry no weight Men Do Not Kecogni/e Their Duties and every box. 2oc. this book sen-
with them indications of .? us our special offe Scientific Jlmerican.A
as
except
Obligations to the Fair 4ex. c price, $2.90, and w _
the feelings of the members toward B. II. Wilson & .Son guarantee"ery bottle will forward the boo I handsomely Illustrated weekly. Largest dr.
culation of any scientific Joum l. Terms, f 3.
Revolutions never jo backwards. They &ta. to If it is nc
the individual at the bar. of Chamberlain's Cough Hl'rncIIand you. year: four months,f L Sold by all newsdealers.
return
mow ah'alllike a cyclone until they.ac- will refund the money to any one who: is $ and satisfactory we will exchangit i MUriN & CO.3otaroadway, New York

It is time a sounder foundation ( ()Ifllih| their purpose, or rnn against a not satisfied after using two-third of the or refund you Branch Office 625 F St., Washington D.C.

.. be laid.. FloHda has always held, wall and explode. They sometimes or- contents. This is the best remedy in the money.luoting the Send lowest for our prices special on illustrated books, FREE.catalogue W -- --- ---

r for herself and others, that appomt.jnents jjinato; from a fale baM.!?, but more(com world for la giippe, coughs, colds, croup ;an save you money. Address all orders to BOOK: AGENTS WANTED FOR _
I110nlyas a necessity from accumulatedevils. and whooping cough and is pleasant and I THE WERNER COMPANY, the grandest and fastest-telling book ever published
should be made to fill vacancies A half-century the people of safe to take. It prevents any tendency ; fnbliiberi and Manufacturer. Akron Ohio (
ago
r that state's voice be lost of cold result in Pulpit Echoes
a not the United States were the most content a to pneumonia. [The Werner Company is thoroughly reliaUe.-Edilor. L

in the house-when these ._,---- ------- -- "
upper ed aiid happy cla s on eaith. Everything -- ---------- OR LITIXO TRUThS FOR HEAD A>D JfI ART.

cannot be named by a legislature, and department, moved along in GENERAL DIEECTOKY. f?( .: )(r<)c::! ?( Jg TiuiUinj Containing"tones Mr.,Incidents AruItU\oI,1'ersontU best F-ipmtnces.etc.Scrmon: with,as 6tlO toll __

;, of course the governor is the agent proper channels and harmony; hut a ---- -- --- ------- ] By D. L. Moody

of the state and authorized to act !evolution has. cccured and everything SOCIETIES, ETC. ..IN THE FAR SOUTH... Asm.elf Withaeomptete historyofhislitebyltev.C1IASF.tio .
has literal reversed its course, and the ,i, Putor of:llr.Moody'Chicago Church for five yeara
for her. Of what shouldsenators nn Q and 111 Iutrodllcbol1 by ltev. LYMAN ABBoTT. ii.lb.
result is dii-or-lcr: strife, corruption, hypotracy UITUSVILLE: BOARD OF TI\DE-I. S. ] Brand new, fiOOPD.,bcautifully tUiutrattd. 7liOVO mor
take of the creden- AtK.NTS! WAVTEl)-Men and Womea. CTSalei
cognizance-save and fraud, even from the high-- Jones, president; J. M. Dixon, tieasurer: .1. immense harvest time for Agents. Send for terms t.
S tials of the appointee ? Did they I st oiSivials! in the hull down to the most G. Bast secretary. Meets second Wednesday 1 Three Daily A. O. WOliTUlAUTON & CO., Hartford, (;oau.
'. night in each mouth at their rooms.
not receive the ostensible representatives insignificant; pea antry; so far as princi- A BOOK
Sunday $4.00 FOR rScts. .
of southern states without ple plays a pait all are on the same basis. to'. & A. 31.-Indian River ledge, No. 90, holds

reference character fitness Tiie gteakr the opportunity for conuptrges its meetiiifih the second and fourth Friday c Grea.t emlVeeklyNew.spaper.s The Farmers' Encyclopedia .-
race
to -, the moie it is utilized. evenings of each month at the court house.A. .
OF the wishes of the people? Tiie.-e things have found A. Stewart W. }I.; J. MendeL St-crctarv. E very thin?pertaining -
a new orderof to the affairs
- -_ ..., 1 of the farm,
v-- - thin and
;! new pursuits in life. The INDIAN RIVER (1UAKDS.-R. E. Minis, household and

Our Relations With Porto Rico.Seveal load to higher; civilization has been Captain. Drill every Saturday night at stock raising: hm- I.
abandoned 8 o'clock at armory over county jail. jWTHE braces articles on
lea .
-r at $ by men. They have QL- ,
----- the bore
delegations from Porto -- - --- the colt,
-, )Income demoralized and neglectful, and CHUKCIIES.8PISCOPAL FLORIDATIESuNIONCITIEN !Nr -: uorsu habits, dis-
\ Rico have lately arrived in Washington : even lot their appreciation of ., caMS of the horse, p
women, --- ii the farm,
) grasses
1 for the purpose of urging except as s-c.1 valuers or slaves to do their CHUIWlI.-Rc\. F. Brown a i II frUit (culture dairymg.cookery.health.

11 .free trade witb thi* island. They bidding; which has forced women to Rector. Services second and fourth Sundays -- (
and catie: hecpswine
in each month at 11 a. in. 7:30p.m.
The Florida Times-Union (32d )and tin-
are composed: of four men of means: jnovide for themselves.It Sunday school evtrySnndayat 9:00 a. m. c, Fl'Ti'la C'iliz'nuh veari cr>year coni-olidjte C' i-r. r poultry, bees, the \
f 'i i -------- II I bepternbcr it, 117."Chis; consolidated rater III :
:; no uncommon thing to to --- ---
I who insist: that something: be done go a PRESBYTERIAN (1 1 URt'i I-Rev. John A. real I from NiVcn.ier ti June by p''>pli- from .I- )b life, etc., etc. One .
-
house at 8 o'clock in the morning and (f(I more states than any other paper m the United it of the most com
by this! country to relieve the find Hughes, pa tllr. Sunday school 10 a. in.; t. ) Mates on the day of publication ttii'rtby btme '.. ; plete Encyclo-
a man asleep:; in bed after :tpindmgmost and 7:30 c unciiualfd as an advertificg medium in the .c.
Preaching 11 a. m. p. in. Prayer I\ 'I jK'dias in('xi'telJce.IlIrgl' .
island frdhi absolute business South, tef'Acs circulating m every nook R;.,I '
stag- J(
You book.
of the night at a gambling den orwhiskey meetingVediiesday.. 7:30 p. in. are cortcriz.FlIt?. .j I :- A 8z5J
nation. deadfall invited to (MflUC.BAP'I'IST l( -- x % inches. QG
-
squandering inoiievhis )5 Jt pages, fully illustrated -
There is some justice in their poi wife has taken in Irom the washtub, CHURCH Preaching every second -- cloth bound binding in

sition. The people of Porto llico and his wife at the woodpile chopping and fo-irth Sundays. morning and evening f TIlE &i'UWILVT1ESUNiON i -- green and equal to

wood 1 to cook his breakfast Prayer meetings every Wednesday other book co-ting
(providedtheie
claim that they are no better ofl'now cvcui; g at 7.00 o'clock. Sunday school d CTIEN! f4.00. If you desire this book send us our special
from a business point of view is anything to cook) after worrying every Sunday at ft:1 I :; a. n.. Also preaching t; offer price $0.75, and ?0.20 extra for postage and
thiough; the night with sick and often Ii rt Sunday at La(!ranac. All cordially l we will forward the book to you. If it is not satisfactory ; -
than j orI" &m-\.il) TiJ.f-"Gnrn: Rrd C7e:1 return it and we will exchange it or refund
when
they were under the hungry ciil! .!Ireu. HH krdhiip: the in\itcd to attend. K. N. BELL IVtor.YICTHODIST : SIB tile Iwst - rule of Spain, indeed, if they are as s-o-called man, \\illfnuilly arise, and the -- -- --- --- --- Jj/| Southern; Sutca !or tLt I11W rnie tf Tour logue. quoting the lowest prices on books FREE.
CHURCH.-Rev.J. E.)Ikkh'r, ( We can save you money. Address all orders to
welL SpainYmarkets were opento first thing turn up his nose over a drinkof Pastor. Services first. and third Sundays in $1.00 PER YEAR i THE WERNER COMPANY,

them free of duty and so: were whiskey-and the idea of women each month at 11 a. m. aud 7.00 p. m.; Sunday J1 1If Publishers aD4lbuuf&cturen..., Akron, Ohio.
school each Sunday at 10 Er- Jt Piitf """ l- fri an i .'.:!!; if coafr t'S
1'\1hinthelw'l'h'e: $ to the front trying to a. m.; u V [The Werner COJIIpany't thoroughly reliable]Editor.
those of Cuba. The i is lies lie.xins! 01 t'-'V.!
proposition : worth t. teil' r'I' r-upercede men and taking their places league every Sunday at 3.30p.m.; I ..J word! o','. ?,) tire'(i-/urji c<..:v tpt eb.>, a:>.1 il t
to let their products come into our Prayer meeting every Thursday at 7:30 p. "il)) r llllll."! lil".n| n.rrei't ivi-ii'i, Nif* pinim-1
.. /
in business .. .
m.; Ladles' Aid society meets elt'h'dne5- :m.1 iu-tflll.i. *:*. 1.,1 :i" ii !. w.jitii t. THE BOOK OF THE YEAR.
markets free of duty. That would :.u.- !..-rt !>_inl >Ibe fi' ami tiousciiolu a
I state: tlii-5 as only a single ilim-tratioi, day at 3:00 p. in. Everybody t-lcome. in& .tli ilic i.u..r.in..> U i> w.Afiper lor the
satisfy the Porto Ricans, hut it of the fl'll'-tion involved; but it literally "-'I\ fa i lily ciTric ar.t: tl-.a f b'ins lan it is nn-c! "The Bow-legged Ghost and Other Stories,1
)
would not satisfy a very large element applies to nearly all present existing con- TOWN, -- DIKECTOKY.: -- ,- J; t.uritd. ................',...>. Jl With an introduction -
: IH
in this country. ditions. (j.) to our stores and the mo-t, TOWN ()OFFICERS.: I). l't'lIIU'y.lIl:1)'r; I America's by

prominent thing their shelves M. S. Jones .J r., marshal and tax collector; greatest poet,
on
see
It is said that the you AGRICULTURAL. j I
Republican C. S. Schuyler, clerk and treasurer: John James Whit-
is ciarsj; ; go to our cities and you are Henry, assessor D. L. (;:n1l.h) ', F. A. Los- : .. comb Riley. An
party is pretty badly split on this ; The Flori'la Farm.'r ::mi Fi i.i:(Jrur.i'r < me t
never out of a stone's: tllroof saloons Icy J. 31. 1)iiV.. R. Knox, Jim. II.: Walker ?,\ r'r.hlo"! !iP> the} Fl .rioa j'. 101'h.i! 1'era.y'1 illustrated vol.
,
b .. proposition. The protectionists say :snriblins. hells, and you l find them the councilmen. The council meets first l! h u.. 1.:* n r'tfi,,'ili'litTc't nit'i I'M' :I.p.riltJpnal /) ume of originalhumorous
'inuetf-l'Dimi
-' that while it may be true that best patronized industries I in the I lain!I. Tuesday in.each month. \f'- . .' ",- "" n itamt..l.,. ;('_ sketches, verse,
.
-- -- ---
an.i ample "pac IFrL.\ :*') In. nhirli tpicsfiit c? facetious
\ Porto Rico does not produce enough I? that our civilizationVho are their I, COUNTY DIKIICTOKY. =-ii all tit rlftUl"lt.s" of the FsirnifraniFruit :! '".1.if 1' and paragraphs col-

j \ patrons who stand, or rather stager, Y. to seriously interfere with the tariff --- ---- "The I'imry. i"' :; r":;- "ill npnrelM 4 .4
- around? Men who are talking! about the \" I'llpm>!i,.. i- 1. :n.,!* h" i'.'.iI'.inlltiun : si \) that will not iV JjrV :
; COUNTY OFFICERS.->. L. Jauldcn.Titus- ,. ,
t\ disappoint the
\ protected products of this country. Ci' r.'pi.'it Wit ; ;t r.: t :;::.1 "o" ,1.( I' tiii \,
demoralization of women on account of yule, county judje: :M. iSoM-smith Titus ) ",..I.till .,- \'.t- .!'' J ':P'<';. u.-i-- 'jl tI... Jf. reader, as it o.r ,

I; f \ the admission of the products? of lieinjr: bread winners. I yule, prosecuting attorney; A. A. Stewart /./I hi.V I"'i.-..t''i i:',,.tI".*:,..e irkii"iu" f ml"!-'.,i'-iU.r.,.': IP tllJlida.I' 'ery1.y., and enters heretofore"new 4 ,
\ I \that island duty free might proveto Women have no desire to become I Titusville, clerk circuit court: J. F. ttotten \ w''m;." .' kl) is r&f'J'lh atliinkn&c unexplored p
,Cocoa tax asM-toor E. W. Hall.Sharl't's. \ l.ul'I'I.: ,.: unuJr.lil'u. 1: !
... be the entering wedge that would bread winners in the crude ami rou:!h tax collector: John Heniy. 'Iitu \-iI1t', J! ..z.ol.-? # A field boos i.f humor.to be ;.;!., :: '". .

fl 'usua ....in destroying the entire forms in life's work. It is contrary treasurer .!. H. Sains. Courtcnay superintendent y read aloud and :"":
tOithetiuiw pro- their physical ability, contrary to their public truitiou; J. O. Fries Ti Specimen Copies Free to any S enjoyed among
tem tusville, county surveyor: J. P. Brown, Ti- Address. iS your fnsnda. rontalns "Tra Bow-leg'id; c--' ,
nature, but they are forced to do it orstarve # "When Ezra Sang First Bass The Mia Wh I
sheriff .1. Cocksliutt. LaGranjce
tusyille T. ,
1 :Mr. S. D. <>rstood that the presi- ; | Couldn't lAugh," "lUable Titles! of Futur
on account of the (S
In" several days in stupidity, laziness registration officer. ,,::/:/ Books," "Selling Locks of Hair" "No Woman N
k ia ps the majority ofe and want of cultured appreciation I ) ADDRESS, Fad." "Sor>tl'ty Actresses" EtC., ct" This fin
borne Eaid Fruit 1'k .{ round that on the part of men to their COUNTY COMMISSIONERS.= R. Walker. edition bound in cloth, printed on extra fin
tj recognize
for some gtiestentleme' .' ", obhi' J'1tifOQ ; I Titnsville,chairman. II. Sharpe, Sharpes: I THE FLORIDA paper,and absolutely the best humorous boot put

entertain for'es to see what heitional way wdOU;;:n t.:e"flwr.' to women. If men I Jos. Mendel LaGrange: Jno. Houston Eau lisned.Order at Worth once. $2.50 bend, for mailed our postpaid new special for illustrated SI.OC
would ?
..co than to always Ga.Bie.J. N'. Waller Auk ii.i. Regular b(',;' TIMES-UNION AND CITIZEN catalogue mailed free. Gives you the km
inie E. t1-l1. Sharpe received f n1aces. But, sions are held first Tuesday in eah month. eat prices on all good books. Address all orders t
- day aWIrs. DiBol 1eft' e' access to from the McFarland Fr!come JACKSONVILLE, FLA. THE WERNER COMPANY
; neg-
spent Ir: of the staSffe'o leadina. ,0 : which to cial, and I COUNTY SCHOOL BOARD.-J.: M. Dixon, rtblliaert and 1Laaa&cteers. Akron, OhIo A
Titusville; S. F.Gihbs, Melbourne. .(?( C
he oIand and ffffo' a Span t1ray e rQJwith ">I'<)f a fr Tha Werner Cocpaoj is guxoughljr reliable.]-Editor.

nndo, Silveq tb: .' n h --
the t 't ednsf.. .., '
... ,
: I '
"- f iew
-
i'pen I
;, J I i"t' \
t

-;. .; ; I \

l J '. _


( ,....J } .. .f+ .;... __ i \ "" .
.r' : J'.I::""""- _
--
-
.
r 1'li';
t -_ r



,, F.{ "
.
._ > ":.1' ?t' '

3 r J-.'T "' }/f; -'.; /y: 'J, >; ,; ,';; ::: ;,.\" -f., ," 't-rl; } ::> :':/.":' :" >,. :..{.",:". :.- :. ,:;' 'Hi" _E ,' ,,." ; ;;:; ; j"'>" ,1' ,


""., -., .' .. ;",', > I 1"1'_" .,,_ .' ,,' .
r<
;i ,y, 1" ; ,.. .., "
:.: > ." '
...,. '
: ,: 1.t' -
,
ji .. .
'
',' j''l-- ,L <- ;;' ;j.2ri;:>'t ,
..
1 '
: '
: + 4iU s"qi'

-,} THE FLORIDA. STAR : FRIDAY,,-JANUARY.26,1900.: ,_ ,Ii ,

+ __ .n ,. ,-"'<.

COUNTY SCHOOL ij l :AffAIR colt to keep tally on his results.!
4 :' The superintendent states that "the "The Least Hair. Jas.+ Pritchard & Sort =a '

i board owed in 1897.98,, $5,657; paid during ,
a :,Mr.Andrews_Makes a Farther, Statement : 1898-99, $1,243." "
Casts Sha. Headquartersfor.
.
Becardlos Charts and Finances, I admit that there were $1,243 of warrants a ow. .'. .-

Editor of The Florida Star: paid by the treasurer and destroyed '
The receipt of letters by the board, but what amount of 'warrants A single drop o f poiSon :
numerous from'all
portions of the county commending and was issued to take the place of those blood will, unless checked in HARDWARE ,

approving'my action in the school board destroyed? k 4
time make the whole
matter and asking. for' information I ask the superintendent to tell the taxpayers impure. -- -ja

cerning the same is my -excuse for again con- of the county when was there evera Hood's Sarsaparilla is the ...Tinware, Crockery... .
dollar in the to the credit of
x' asking for in columns. treasury .
space your great leader in blood purifiers.It .
the .
school
My former colleagues 'on the school fund over and above outstanding STOVES, .

board state that they decided warrants.I casts no shadow, but brings sun-
"to take
the charts, books anti maps in a lot at would like for the superintendent to shine and health into every household. Boat Goods, Paints and Oils, :r, }. '

$617.53, believing that it was as reasona tell the taxpayers when the debt of the Dyspepsia-Suffered everything but andWOODENWARE : I

ble a purchase as we could; make. The school board-the aggregate of all unpaid death for years with dyspepsia. Nothing :c_ ;;t1 A
schools need these warrants-was less than $5,000. relieved me until I took Hood's Sarsaparilla -
supplies, even if '
we The method and it made and well. Can
have the now in vogue is to issue kept me
to carry warrants over. The eat It"Write
anything I wish. MBS. ECGESZ
warrants on the treasurer for the amountof err .1
present need of the supplies warrant the MURPHY, Hull's Mill Danbury Conn. w
t expenditures," etc. money stated. There being no moneyor Consumptive Cough-"Five years for prices. a ,
This is just the point at not enough-in the treasury, the recipient =: ago I had a consumptive cough which reduced I
issue: My TITUSVILLE FLORIDA.
of the warrant say a teacher- me to a skeleton. Was advised to ).. _
judgment was that the purchase 'was not take Hood's which I did and .
.. gets it cashed by a merchant and the latter Sarsaparilla Box 212. '
a reasonable one at all, and furthermorethat recovered normal health. I have been well <
deposits it in one of the banks of the -aa 1r
there was no need whatever that ever since. MATILDA BRIDGEWATEB!: Cor. .
-
"
county. There is an arrangement with Pearl and Chestnut Sts..J Jeffersonville Ind. .
warranted any such expenditure.In the banks that the school board will fond
Number
support of this contention 'I will them ten per cent interest on all war-pay c7toodi; Saua ali Co.:1:
x'
state that if the
encyclopedias need-
were rants they may hold. Quarterly or semi- On hand and Constantly Arriving <' -1
ed for the schools-which fact ,
cannot be o
annually the banks make a list of warrants
.LUl\LBBER.: : :
satisfactorily demonstrated-they .
held by them, figure the interest
have been purchased bound for on Hood's Fills cure Dyer 111.; the non irritating and
,
Dressed and
paper Undressed.
each,one, add all the interest items together only cathartic to t k 1rith Hood's aparitZIIUUUS 't"1
25 cents each cloth bound for 50 ,
*cents ; and then make out a bill againstthe Shingles, Moulding, Scroll Work, Balusters, Newel Posts, t 4
each. I haY a copy of Chambers' encyclopedia school board for the amount of Inter- AND MOISTURE Bean, Orange, Cabbage and Tomato Crates,

paper bound, for which I paidthe est due. The board then i issues a .warrant Brick, Lime, Cement, Etc. <1
sum of 25 cents and also ..
a of j
the American Standard cloth bound copy to each bank for the amount claimedas How Florida Soil Differs From That of Estimates made on all building material. Our large boat, "Sunny South," will deliver ., 1
s for "interest on indebtedness," which anywhere on the river. Call on us or send in your bill. We will serve you'right. I< 1 1
which I paid the sum of 50 cents. Other States.
The warrant is at listed with the other "
once
r school board could certainly have bought warrants and in due course of time comes Prof. P. H. Rolfs, late o I the Florida I Bon.d Lu.rn.: her Co. J

them by the quantity as cheaply as I in as part of the amount drawing interestat Agricultural college, has held some radii i S. G. VANLANDINGHAM, Manager, .

bought singly. ten per cent. By this method "interest cal and heterodox views, and the Florida I T1'tusv111e. : F1or1da. .
r If the schools of the county needed on indebtedness" becomes interest Farmer and Fruit Grower says that it
------- -- ti'
maps they could have been taught of bearing; in other words this method involves believes the following from his pen, in HALF DOLLARS #.'

Rand, McXally & Co., of Chicago, from compounding interest on the school the Rural Xew Yorker, will not fail to are ful as use ;
at our .
whom the board purchased geographiesfor elicit contradiction: i i.
debt. As far I know this
as compound. FEBRUARY CLEARANCE SALE T,
the,schools. I have a wall map, re ng of interest is believed to be perniciousand "Our experience, both scientific and dollars on or-. ; ;
versible by 6 feet size, mounted on contrary to the spirit and letter of practical, forces the conclusion upon us dinary occasions. ft

muslin backing, with roller, for which I our constitution and laws, making the that Florida soil is very different from The opportunity of those --1 .

paid the sum of$1.50. It is a Rand, Mc- school fund hopelessly in debt, and yet any other in the eastern United States. who waited for. . -L
Nally & Co. map, has that firm's name The amount of moisture actually needed AFTER THE HOLIDAY BARGAINS '
"it
our county superintendent states is is here.Ve have
''' printed thereon in large type and is listedat nothing new or startling, but approvedby in the soil to produce a good crop of fruitis marked prices on every re- 1 = F

$5.00. The school board could certain: all business men," and also that the less than one-fifth of that required in article of . . x

ly have bought these maps in quantity at Bounty is not "hopelessly or harmfully Xew York, and the amount necessary to FURNITUREin x

the price I bought :a single one. in debt." But I shall leave this matterto soak it is also very much less. During the store, regardless of 1; 1 ,

As to the charts, I must say that the be settled between the school board extremely dry weather the soil rarely be- the fact that all are i t. ,, r .

leading educators of not only Florida, but and superintendent on the one hand, and comes so depleted of moisture that onewill NEW, HANDSOME AND STYLISH, -,
and would
'y of the United States, have discarded the people on the other.In I not find moist sand in the field by full price at easily any bring time. \ % '

': them. They are valueless. Good, up-to- conclusion: allow me to say to the dicing down from three to six inches. Must square accounts for year that ... .. .
date teachers regard them, in the main, !large number of citizens who have written I When humus is added to the soil, it acts / is the only reason for quick selling. .

as affording no real advantage. A prom- to me on the subject, that I am not like a sponge, taking the water up, and JOHN R. WALKER, Titusville, Fla. ; .

= inent winter resident of this county, whois in politics. I am not an aspirant for office i causes the soil to appear actually dry ---- -- --- -- --- -- --- --_ ,-4't,>:-,
a heavy taxpayer here, and who is not or for political preferment. Under the I i.when really it contains the same amountof Take "

interested in the manufacture or sale of present system and with the present ; moisture that it did before the humuswas FIRE INSURANCE with c. Schuyler ..

school charts in any manner, and who methods in operation I would positively i added Humus acts further as a ,. j

can make a fair and disinterested Statement decline..to accept the porous medium, separating the particlesof .
concerning them, says that in the dency or any position county or office Miperinten-connected sand and increasing the evaporation of Agent foMhe -Hartford, Etna, Liverpool and London and Globe," .

!' state of Michigan, his home state, which with school affairs. K. X. ANDREWS. moisture. Besides this, land rich in Home, Continental, Providence & Washington, Fire .

f has one of the best and most complete Cocoa, Fla., Jan. :22,1900.: humus requires twice or three times as man's Fund, and Sun Mutual. <. ; -
school systems, after having given school great a per cent of moisture as soil rather '
charts a fair and thorough trial, they deficient in humus. Tim, during the dry For further. information. rates, etc.,_address or call on C. S. SCHUYLER. TITus ILLE, TLA.IGB u r.:

have been discarded as obsolete and Senator Taliaferro of Florida, has been season, humus in the soil would cause it -.:.::.= ---- -- --- u.

worthless for educational purposes and added to the census committee of the to become thirsty, and increase the radi

that they can now "be bought by the senate. This was accomplished Tuesday, I ation. During the rainy season the 1GBi.d4./1
carload for a song." the 16th, by a resolution passed through 1 humus becomes filled with moisture, but I I I I
the senate on motion of Senator Cockrell. fails to let it filter
So much for what those at a distance through as the sand ,. .
.
think of the value school charts. lion.l I does, thus tending to cut off the supplyof --- ,
W. N. Sheats, state superintendent of air and to drown the plants. It has AS GOOD AS THE BEST. A ,

., public instruction, whose permission 1 ,,3333 3333 33333 3333 333)Easy' 1 1i been definitely ascertained by reliable Manufacture at the 3 I1DL1IIII'IIt ICE M TOUr, T. T.proprretor.9atETx 0.aB -f
have to use the following extract, in -acknowledging 1I methods that the percentage of water
t. the receipt of my resigna- present in sandy soils during the rainy Special attention paid to packing for family use, and shipped to any station on the East Coast. i',
railroad or by steamboat on Indian m'er. .i
::. tion, described this purcha-e of school season is only slightly above the per cent ---- .. .i
-- -- -
-
-
1ft. t's. during the !but in the soils "
charts as a "recklt use of school funds. dry reason, l
He wrote further : I rich in humus we find them to be what Carroll & Goldsmith -,' .

;:' "My position: in regard to Midi expenditures I lucidly known as "water-sobbed" during -- --..--.---- -- .---- '-, .
t is well known to all who have tl: the rainy season, and during the dry -t

r kept up with my uttetances on lIch matters I Ka-on they are excessively dry. Peach STAPLE AND !
r' for the few jtaiV I orchards in Florida planted on muck landsor GROCERIES
|past
FANCY .
'. In a later lent lie writes: T To Takc o on clay lands do fairly well for a short 1
.
t.'" "Om or twice in the School Journal, t. I! time, but are liable to he short-lived and Hay, Grain, Fresh Fruits and Vegetables, ii i

f: and j prl'\" .IlI-ly! in tin- Exponent, my L a wry irregular; stand. Tin, Glass and Crockery Ware.THE Titusville, Florida. \
IIt'l1 the of "Hoth experience and scientific teaching ---- ---
were pllhh- on subject
to.'iews::' county finance, and the pllrcha e.of.charts Thin pale anemic girls ,! lead us to believe that pine strawcrab
--- 4
and I other ,11-:1'1'11-,1,1 l : le school ..If>- 4+ grass, oak leaves and other vegetable;

vicerjH'Cully wl:\-im tl.e county boar J need a' fatty food to enrich J; j i matter should not bo plowed under, as is DECANTER...
..
.
t::. were ('m'Hlmt'll: for funds. to run their 8 their blood, give color to X j the fit'ijiU'ntly north. done If! thee in the iib'-tance.still'clay; lands of .. ,
used
are ,
.. sc I lOt)I'-* upon a:1"!i l b wDm -, {
:Matetlu| -,intesdent 1 hud' ime>ti, ? their cheeks and restore their ]i :. 'they -hould never he u-ed: in a 11other Losley db l\LIotlo"VV: t
/|\ \v wax than mulching, or applied after having \
E. gated the chart' bnimthoroughly; had health and It is I -
r,.' published! hIS virus" and JK.SUIOU so as to 5 strength. J i ; been compo-tttl. The question a* to Foreign anti iloinotic brands ofVines, Brandies, Hums, Gins and t
all 8 safe to that whether the UMHIJ: of this organic matte Whiskies IJottled Bwrs Ales and Stout. '
give publicity! and earning to eon say they nearly 11j : ,
I as a mulching is profitable will have to be
'c..l, ivrned, and wa ready to advise" county
.', boardon the very p.mitinvolutl in this all reject fat with their food. J I i \decided by the individual: ca-e. Like the A FIRST-CLASS LINE OF CIGARS. BILLIARD AND POOL TABLES. f.,i

inscrutable! t j hauling) of muck on to fruit and vegetable
But for some reason f t
cae. lands which at one time was quite Family and hotel trade is solicited. Prompt and careful attention given to mail ordeTL
t only the agent; of the chart company wa I e i POP'l'lar Cash taunt aC'I'I'lupaIlY jour order LOSLKY & MOTLOW. TlTfsviLLE, FLA. I
i in Florida, the hauling of organic matter -
consul ted. i
on to orchards and mint beclawed
groves ,
:My former ('olll'jgueoH'rl': cither not SOjiisj9t!
"
charts I as a "harmlefS amusement. That -,
,: were posted not a-to aware worthlessness of the position: of the; there is not some advantage from both ui R. .L. MOTLOW, healer .

Plate superintendent of public instruction COD LIVER OIL these pleasures cannot }be denied, bat the .
\\ho'e! matter of fruit growing! i is not one
Sofl/NEaSODl
:, these matters, and did not know that HYPOPHOSPIIITES :
on of -l'ntin1l"nt, but whether it will bring WINES BRANDIES WHISKIES
the purchase of these charts wa a "reck- A -ti- FINE .
m the returns in dollaisand milsl'uttuiiit! ,
"
: of the vhool funds, or else they \:
less
, use duped by the oily tongued agent of 8 is exactly what they require; *. I on this basis we mint put it in the doubtful --
were \ I das be decided the individual
to by
the chart publishing company. 8 it not only gives them the important J I location and condition. From what has AND-- LIQUORS-- --OF-- --ALL- ---KINDS.--

The county superintendent states that element cod-liver oil:) I been said I above, -hould not inferred
he "bitterly oppos.il to the purchase J ( | Special attention given to mail orders ('O('()\, FLORIDA.
was
. | that the white soils of the sand]
arithmetical chart" What llis- 8 and di- S I jt4 pure .
of the in a palatable easily i iJ 111ll1l'STI'the i ideal ones for peach <;ro v- -- -- ti ..

armed these h-t his t?opposition He sales to down the purcha-e the school: of gested form,but also the hypo- $ \I;! mir, but lather those that have been utli- I FEE & STEWART :

u iontly fUbduedby vegetation to
debt with to many "prolublj that J phosphites which are so valua- ;} !j tirt-1\-S crop of long leaf pine, grow and at a I Handle EVERYTHINGAppertaining '

there is a vivid strain of uncertainty running 8 ble in disorders that *t, i the same time well drained, are in about to the..... 't '
through it. I am of the opinion nervous ;'
I the right condition for men to trantfoimmt

that the roiii-titute unciincelled the debt, undes-troyed of the school warrants -1 ** usually accompany anemia, V jJ : > a peach orchard.1! : : A4 :n ID ARE f
-- -- ---- -
board but the superintendent run- 111optimistic SCOTT'S EMULSION isa | A pure vvhi&key atrrie- with allY food; TRADE f

pen along through: ?2;-> of the J fatty food that is more easily in fact aid tli e-tioll. It tones the Al>l) nice line of Furuituie Crock-ry, Lump. Window Sludr-

warrants rcpietenting the Tituille stomach, imreaethe How of the gastric )Iattingt(',, etc., Undertakers' Supplies, Collins, and Cask \It' j 1
I school building, and says they "will not 8 digested than any other form JJ |iiiuami so pioinotea j-trentth anitltfli. : : \ .
.\ pure whiskey like UAKl'KK'whUkev. Write us when in need of anything in our line and we will 't \ ,
be paid" How doe des-trou-d.he knoHaw' I hive of fat. A certain amount of $ ;' '. old by lxj>ley i\c MotlovvTitnsille promptly quote yon lowest market prices.:.. ( S ;.1. he -* _.. ('

they these ever warrants been illllt'l':3 been : -ion of the board:' 8 flesh is necessary for health. : Fla --. FEE & STEWART, ME LBOURNF Ir t": L-/ n?' \
Illy
By whom authority has payment been 8 '{Saw your ads in the STAR,'1110" L. ,.'t', S1.ner. t t fb .
stopped? & You can get it in this way. J CASTOR! .&UIl'.T ar..c P, F.COti'tsox p tr. ;. .

The superintendent states that the cx- 8 We have known per J GEO 10iBach fIad) ,,e to fv.jjfttej---":'- edld1d'r. *--\V: J'ali''Gallie\, JR.: ., It" .

for all purposes will not exceed For Infants and Children. t .
uenditnrra If teachers' salaries amount to 8 sons to gain a pound a : -- "s.a, "A' .. o ')ks :,ecto..r"..lQ..
13,800. of the 8 it. The Kind You Have Always Bought I :rF; F. P.\;?.' ..ming, 30 'tre now rie&?'
,9000 and books and the pay day while taking PttI: hbred ,n ih l1 ., open a : ."
board are $1,000 more, what will l>e done : y of all t..au r+tittte. etinud ; :..an Y.,? 'ntSunday\ ex' dotJ r
; '
with the other $3,800? The superintendent SCOTT & BOWNE, Chemists, New York. 'NCEEEEEEE@E I #-I-- .. Jrmor, RI1 OJD11> -', '. l II
)
has so befogged) the figures "1 E ee ccEEEE i, of rom pt 8\.:,' .\.1iI.". ,, ,"
I /
.
"probublys" that it is exceedin "''
1 I : '\
(1 )
1 V. I : k1 I \ r--

-t- 1 /
-"
,
r r M J t 'i'... . Ii'j
t..i.. 1 is lP -, '. ..". -" ,
.. ....f. ,y -., .. ,..,,--..':t"A- .



Sp*

t'1 4e. ?
> r
*"- & a :
-, .. 'y.- -+-
'.
., ( ,- ". ..
: .
V '.
.;...r : .
'
., -" C. '
<
.
.
t. i- .
;; -) '.. -

_,-', <;, .. : :i. ;; C"i \i.>';:(' ;" ,--; ,;,::;:,,


.

THE ,FLORIDA STAR: FRIDAY,.. JANUARY. 19:>0. f. .8


i : ;4WAR R' 'NES1F1ERY S R [ the misfortune to call on' the govern= ng put ,to work all over the pmlrles
'
A i1 ment for food all he receives is uncooked and will give baek'in their labor some, DO YOU GET UP HO ICE Vegetableswill w

; /. ; .) .,' Indian and of the
!o meal salt which
lie moisture that
they have taken
. :;::':. :Beeleged 'Cities 7)1 .i:KBOIT" Very Little; of must, somehow, :'cook for blmselL"The from the. soil by their fierce breath, WITH A LAME BACK ? always find a ready
>
,r t!>> the Situation.Special .' ,weak spot in ,the ,Boer" situationIs which Is the terror'of she farmer. Even market-but ,that farmer f

, .Correspondence of THE STAK that they are already ,In the field'In If the "hot wind" does take the corn Kidney Trouble Makes You Miserable. only ,

iJFi} #.: :.CL?E'TOB'lq, ,Dee. 24.; -11' is difficult full force. England's weakness Is that the: farmer with a few windmills workIng can raise them who has studiedthe '1

g"{'j..: to get any kind ,of information, from necessary ,re-e torcements must come ; knows that he will have wheat and Almost everybody who reads the newspapers .

: the seat of war. I have Just receivedf from the United Kingdom or her col fodder and he will stay Instead of is sure to know of the wonderful great secret how to obtain

;' r/ .;...:..-; f letter from,. an American friend in onies. CECIL Horr. moving back east C. M. HAEGEB. U cures made by Dr.
'
) ; < Johannesburg- who says that the way Kilmer's 5wamp-Root, both quality and quantityby .

I A., '. In which news. .is._seat, :the descrip It Saved His Leg. "Rob Peter to pay Paul.! That is what they the great kidney, liver

, -1r tion of the various battlefields and the P. A. Danforth, of LaGrange, Ga., suf- do who take stimulants for weak nerves. 1J .l' : and bladder remedy. the judicious use of well- '
Elood's Sarsaparilla gives true nerve strength. It is the great medical
fered
=: of for six
reports intensely months with
- engagements are.very different f. -
triumph of the nineteenth balanced fertilizers. No fertil
: -
i ;3 frightful running Ins .
from what they .were in any town sore on leg, but
A dis- i
Russian
Story. century;
writes
that Bucklen's
:,;; '<: of a thousand inhabitants in the Unit- cured it in ten days. Arnica For ulcers Salve, wounds wholly, In the life of Archbishop Benson the t I covered after years of izer for Vegetables can producea

r" barns boils author, speaking of a conceited and ar- scientific' research by
pain or piles it's the best
Dr.
salve in the world, cnre guaranteed. Only rogant young Russian clergyman said: Kilmer the eminent large yield unless it containsat
kidney and bladder
r 25c. Sold by B. R. Wilson & Son, drug- "The fact is these young gentlementhink ---...
specialist, and is least 8% Potash. Send for
gists.
ff- 6 that the office magnifies the man. wonderfully successful in promptly curing ,

: -:.; 1 N ow. Count S. told me that be saw in lame back kidney, bladder, uric acid trou- our books which furnish full
a. WINDS PUT TO WORK. a police court in Russia a priest bles and Bright's Disease which is the worst ,

brought In in undress of purple, and form of kidney trouble. information. We send them .
Bow the Farmers of the Prairies Find the Dr. Kilmer's Swamp-Root is
%' pc away court magistrates and all knelt. not recommended -
to Get Cheap Labor. / and a police sergeant kissed his hand. for everything but if you have kidney free of charge. .
liver or bladder trouble it will be found .."
= Special Correspondence of THE STAB. Then, rising the magistrate said: 'You
;
Just the remedy you need. It has been testedin
ABILENE, Kan, Jan.. :!!.-With the nasty; drunken beast so you were so many ways, in hospital work, in private GERMAN KALI WORKS, s

general failure of tLe large irrigation drunK again yesterday! I'll make you practice, among the helpless too poor to purchase -
remember it this time.' The priest relief and has proved so successful in 93 Nassau St., New York. ....

experiments and speculations on the was led out to an adjoining yard, his everytasethat a special arrangement has .

plains there has come about an interestin clothes were torn off and oO lashes given been made by which all readers of this paper

a novel and practical method of individual .. him. When he, was brought back who have not already tried it, may have a National Bank of

irrigation that is transforming half fainting, all knelt and received his sample bottle sent free by mail also a book
telling more about Swamp-Root and how to
blessing.
a claim:: and form into
many a productive
find out if you have kidney or bladder trouble.
; property. All over the valleys* When writing mention reading this
;; J" ';ot of the Dakotas, Nebraska and Kansasare : Oyster Law Declared Void. offer in this paper and .., gener9us the t State of Florida,'

; ; t b scattered windmills that are utilizing Judge John W. Malone, of the second send your address to ,h I, : :::::::: ,"

r$: : e V I the force of the sweeping gales of judicial circuit of Florida, in the case of DrKilmer&Co.Binghamton .tH ; 1.:" !! t .

I ,. .:, ) ., the prairie in a marvelous manner. It Edward Richardson, brought before him N. Y. The _; u. STATE, AND CITY DEPOSITARY, .
! ; regular cent and .
is notable that the mills are for the at Apalachicola, on habeas corpus in the fifty Home of Swamp-Boot
; .! dollar! sizes are sold by all good druggists.
,. if most part homemade and are built by latter part of November, has rendered a JACKSONVILLE, FLORIDA.

?''t.:" the thrifty and progressive farmers decision declaring the local oyster law of .
.
': ranchmen and market gardeners. Franklin county, passed at the last session I
J Jl I
,"_,. ... Their average cost is but $-1 or $3:: but of the legislature, unconstitutional

" ;lW' they pump day and night, raising hater and void. Richardson was arrested by Capital $100,000. 4

l''< ; .- enough for the pressing needs of the the sheriff on two warrants issued by the ,

; r.!,;. farm and have been so successful that county judge, charging him with violating -

.:,, '. thousands of new mills are now being l several provisions of the oyster law. ,
"
!:
0', -!: '',', put in operation for the coming fr 'ason. The Huge Bro l., of Apalachicola, 'large Accounts of Firms, Banks and* '

J..:: 4.:, EAST IXDIAX ROUGH EIDER. They are found in the valleys bocunst* packers of oysters, believing that this jS

; ', .; ed States during the war with Spain. the water is there nearer to the surfaceand law, although local in character, would Individuals Solicited.
in most cases face the south. Mills interfere with the business interests of
;i There has not been a map of the -
':- costing besides the labor of all and .
scenes of hostilities published in anypaper the farmer oystermen, no protection whatever y N -

c obtainable. People have to con not more than $1.75; are doing the workof to the oyster beds, came to the

: tent themselves with certain antiquated a horse In pumping water for the assistance of said :Edward; Richardson as OFFICERS :

i { maps that do not give half garden or cattle the yeas round. well as in behalf of the oyster men in HEXBY B. TOMPKIFS, President. t.
L Odd names are given to the homemade general The state was represented by A Woman E. T. SHCBBICK, Vice-President. ;
the
places of
nor any the railways THOS. P. DEXHAM
Cashier
,1( ; that have been built during the last C mills, the favorite form being the Hon. Goo. P. Rainey, of Tallahassee' and Only Knows JAMES D. BAKER, Assistant Cashier.

five years. The advertising maps do Jumbo. It is an overshot wheel withtbe the prisoner by lion. H. C. Hicks, of ,
t top half sticking out of the Apalachicola and W. A. Blount what suffering from falling of the DIRECTORS : *
upper of Pen-
not contain
. places:: or mountains, but j womb, whites, painful or irregularoenses. .
the from Brown's portion of a shed or tower the lowerpart sacola. On the llth of this month the or any disease vf the distinctly J. N. C.
maps South Africa STOCKTON, ALBIOX W. I+>,IOIiT,
feminine
being shielded from the wind by .court rendered the desision declaring the organs is. A wan may sympathize E. T. SHUBRICK
RAYMOND
the D.
give mountains of size but on too or pity but he can not know the KNIGHT
I I small a scale." the sides. It is a rough piece of workIn law unconstitutional and void. agonJcs she goes through: -the terrible THOS. P. PEXIIAM, RICII'D MCLAUGHLIN,
most of its forms yet there is one suffering, so patiently borne, which W. A. H\LLOWES, WM. H BAKER, .
My correspondent goes on to say: robs her of beauty, hope and happi- IlE>RY B. TOMPKINS.
that cost only $3.70 which lifted 300 Story of a Slave. %less, Yet this suffering really is
11 a here rule
as a cannot get anything
barrels in 40 minutes to a of -- -- ---- -
40 -
height To --- --
-
be -
but a one sided view of the bound hand and foot for years
skirmishes: engagements and battles. feet by the chains of disease i is the worst form needless.McELREE'S Cotton and'Linen .

y, To form a correct view of any battle The merry go round mill is one of of slavery. George D. Williams, of Manchester ; -
the novel forms. It is 14 feet in diaui Mich., tells how such a slave was

one standpoint should,look reviewing at it from the an statements impartial eter and stands horizontally. It has made free. He says: ")Iy wife has beenso : Wine 01 CardUi .. .Nettingre

sweeps at the outer rim and swings helpless for five years that she could
of both sides. Rarely if ever do we not turn over in bed alone. After ,
with using
a high velocity when the hot :
know what the English losses are, and two bottles of Electric Bitters she is wonderfully will banish it. This medicine
winds blow. The battlenx mill is another cures all "female diseases : .
we only know so much of the Boer unproved and able to do her own quickly : -
loss as it is thought fit to let us know. easily built form, standing: on a work." This supreme remedy for female and psrmanently. It does away .
tower, with blades three feet with humiliating
For Instance, I have not seen it published square diseases quickly cures nervousness, sleep- physical exami
and doing a great deal of work. lessness nations. The'treatment be Tackle
Thisis Fishing
melancholy headache backache may
t- ,
what the Boer loss was on Oct. taken at home. There is .
the prevailing form in most fainting and not con.
parts of dizzy spell' This miracle '
1' 13 at Mafekiug, which a Natal paper Nebraska. The old fashioned: Dutch, working medicine is a godsend to tinual expense and trouble. The Superior quality Linen Gill ,
gives as 53 killed and 400 wounded.' sufferer is cured and t
mill with huge fans that sweep the weak, sickly! run down people. Every stays -cured. Netting: made from I nox's' .
Wine
This of Carduiis
, may not be correct but when
the
a bottle becoming
ground, is seen, here and there guaranteed, only 50 cents, said I>A" Scotch Thread.
mostly
number like 33 is mentioned it would B. It. Wilson & Son druggists. leading remedy for all troubles of
7 appear as if they knew something in communities where the foreign: ele G this class. It costs but 81 from any Samples and estimates cheerfully, furnished. ow >
ment is large in the population. The druggist. Corks. Leads, Lines, etc.
f about it. The Boer'way of .
fighting is 1 1TGhfIonfst man or woman to travel For advice
in
I like that followed by the Sioux in the 11 for large house; salary $f v monthly special directions cases requiring J. S. JOHNSON & CO '
address the
and ,
Black Hills and must cost less ofBoers' expenses, with increase; positipermant'nt on "L di "
;:s .Mvis-ory
; inclose self-addressed stamped Department, Manufacturers, ,
life than English. I presume envelope. MANAGER The Chattanooga Medicine
Co.
330 Caxton bldg., 121 South St.
you obtain more news than 1 do. ThereIs Chicago.MQnQffpr. Chattanooga Tenn. a BALTIMORE, MD. t'

no competition in the matter of 11R9.C.J.wE5TaehsiileTenn.., .. .. ,

news and often we are fed on such in every county in the United<< wr.te to be ;in:-''This house wonderful medicine ought '
every where there are girls USE
rumors at which the burghers themselves UiUIIUgUI states to handle the bestpayi"S and \voaien.'" Dk's '
business:" known. Legitimate, reliable, .
new .
i. are angry, and I judge
justly so
Addrtns
1>1'111. K., I'hu-nix Fire Appliance
from what 1 hear from friends of miner ('o., lIt W. 34th St., X. Y.1'KOFEysIONAL. MAVTKU'S S.\(,t;.
returned from the front. I have more )
Under and l>y virtue of a dem-eof fvelusure -
than 100 friends in the field, half on
CAUD.S.KO1JI51XS and s91e outdid I in the circuit i-ourt
one side and half on the other. Provisions SEND FOR B [ P
for I re\ird county, in a caiiMwhciiu .ir 111! AL '
t. and meat are plentiful and & GUAIIAM: II. lI",.all iiwniplninnntamlJoliiiV.WHNey, CATALOGUE.THE L t i .
, cheap" et al., are defendant- will olk-r f for gale in

One thing which has t ATTOKXKYS-AT-LAW, trout of the court house dour at Titn-.viHe,
kept
everybody TITnnLII-, during the I legal !JcJurs of sale on the Ii flIt H. & W B. DC\'l:
: anxious is the question as to whetheror : FLORIDA. Monday in Mau. .\. D_ 1IO! to the hi.lii>,t COMPANY,

not the native races would be induced .."r- ,. Office hours-10 to 12 a. m. and 2 to ,1 p m. :;m to in the Will practuc in all estate. situate in Hrevurd ("!luty. Florida to- !4 J KS
participate war. This courts state and fl'lc"ml 1, l: \ .
Special facilities for wit: NV. i tlftlll't: ;,1 and N. A of X. K. JACKSONVILLE. it a t...'
\ainining and
would be an extremity more barbarous ing land titles. l"'I'fn't. lllf X. 1-:, III't'c'. n.T.33.S.H: ; 3!J 1',., containing "I A. 1J: ..... it .
;r than the worst kind of projectiles prohibited CO acres lucre fir It-M. t'\trptin, )how-

f' by The Hague agreement, andit ever, out of the al* \e trait the right:; f war;
H. L. G.U'UH-:,
of the Florida Fait, Coast
r. railway company
is not thordit that either British or
Boers will u.cite: any African savage ATTORN EY-.1T-LAW, )i. (tOLD MPH, H. A. HODGES
f' Special Master. ,
nice to depredations which the sight TITl-VILLE, FLORIDA. ---- -___ u__
of blood ii..ght:; put beyond check or 'ounty judge of IJre\ardco'int.y. p Satsuma Eiigt,' Flu.Dtalir t.

control. There is much talk, however, tice in all the courts of the 7th judicial Hodgson Bros.
I! about British importation of semibar- FKAIRIE WINDMILL snit uf Florida. in and Manufacturers of

t __ _
barons warriors from India. They are turbine wheel Is what its name Implies -- u YELLOW FIXEAND
I>U>CAX:. FLKTCIIKK.ATTORN : rlalzllttl.
: nominally British subjects, and to and requires some Ingenuity to construct CYPRESS LUMBER

bring them into service would not be its various forms. It is not uncommon : BY-A T-L.\W.JAl'K 'IIUCII.\XTS...

so severe a shock to the civilized world to see an old wheel

as would be felt should the South African transformed into this sort wagon of a mill ---OXVILLE------,----.--.----FLlrlM ---I j' -_Eau Gallic, Fla. Fruit and Vegetable Crates.
-
savages take to the warpath. and it does good work. GOLDSMITH, r

Some of the East Indians are expert Besides all of thee: simple mills Estimates furnished
cavalrymen and might do efficient ATTORXIY-AT-LAW, Dry Goods Clothing lumber for complete bills of
some of the wealthier farmers have to be delivered at any point on the -\ '
.i service as rough riders on the prairies iron ones with 12 foot fans, that grind 'iTCS\'ILLE. FLORIDA. East Coast. '
i t Transvaal.The 1I00TSXU snois --------
of the and pump like machines and are the Prosecuting attorney for Brevard -
('ount-: I). L HUDSON)
condition of affairs in the besieged hardest working parts of the farm Notary public Will practice in all courts of lI.tnDU'.Utl:, iKOL'iim>: M./[ ; It ,
towns may be judged from another equipment. the state. '10 i

extract from a letter written by The one great drawback to farming A. II. 1'KNNKY, I.IXTSXU OILS, ETC Dentist. p :{i.

my correspondent in Johannesburg; : In the western part of the plains region Steam Launch for Charter. Office at residence first door south of the 'f "
.\TTuRX EY-.\T-LA W county jail. '
"If 1 was not in business still and I has been the lack of water. It is ---- --- Only first class work, j
at *
could appointment as such. I In TITCS 'ILLF. FLORID greatly reduced prices.TITUSVILLE. t \
get an fact a semiarid region, and thousands '
should like to to the front and send have Willl'ractice\ in the -- LOIUDA.. > \
go moved out because they courts of the "th judicial -- --- .
back sketches of the country where could not raise enough to feed their circuit. A Racing YachtFOR t Good Newe. iTT 'i he ,, '"

the battles are fought. families. With the windmill as a help Take no more medicine for chills.: d -'
X JAMES .\>HEWS, II'
"Recently I made arrangements with they are able to insure themselves of a our Dr. King dull Pad. t far'r.

three Americans to occupy my house.I good garden, their stock of sufficient A TTOnSEY-.\T-LA W, curee will refundour to, ,

had got them in all right, but they "roughness," which is millet. Kaffir Main office and address, Tibbals, Florida. Dr King Chiil Pad lint fi.. 'tefl .J'Ptr' _;: .

moved out the next day because in I corn and other haylike feeds, keepingthem Office at Fort 1'icrte, Fla., upon the 2nd and $50 cures chills. jl'! i tfju to, r"181r1t, .o' non,:

: that ward they make the commandeered through the winter. Then when 4th Fridays of each month. \ .-," ." rO" anh-e. A @il'' -:.c--- l'\d
j r Will practice in all the courts of the 7th 'd', '1.eh \ ilrnaaNt does- 1
; special police do G hours' shift in 24 :a crop of grain comes-and it is sure judicial circuit of Florida. r _,, ) I I

- hours. The day before they had been to come if the farmer can only wait- Full working d: ? h. .
r p JgESii (
requiring an 8 hours' shift in 24. The they are ready to take advantage of it.F' J. UEBH, building a Rae;" ,ghbred'(;E : \ 1!X t :: ( \ : ,
.
reason they would not stay was because It Is making the stock business prosperous ATTORN'EY-AT-LAW, huild, to cost.rA Of all. ,r.au ,''1'l f ( on ;; ,. ,

t. .. in other wards they bad been doing in western Kansas and Nebraska fTITCSVILLE mentioning tl .irmorSubscriptk. 3 rompt aJon'" ,- ,

only 4 hours' shift in 24 and even and is giving the settlers In the FLORIDA. .. r,-Y" fl,,'- \.....,. .. 4

28 hours. There is no pay attached ** *wer parts of Oklahoma a better: Will practice in the courts of the nth JU Ad '. S.t ) '

v this compulsory service, and if our t ye to succeed. The winds are be- I dicial: circuit. } \ (" .
\
\b\1\ \ ci Jl J,i / 1 \, i A
i; y. I, .
1- '. : .....--t.-: .....
fs ,
t J 1 4. .
'i
'I ", "':-.1 --. o- \(r Y. ; .. ... 4 "V-m, \.:...i.IJ ____ '_.
..: JJ"r..... .. '.... ..' -'k.: ,) ...: --*" .. .. ....."...
:;,-.: -(;. :1 ; ,. r;', ... "h .' -! t -'"-.::.. _. {.. }\, ".'-I y.'"--'!..,---.0-----. __' -J. .- &



x* '. .'-,', ,.... '-. .' ';:"

V ., ,.. ; J :
."' ,. '. '. '. ..-.<
:': ., :, "'--.:" ":J{
> f :;
', .. ,
,. .< ,<< ,. ..
., .ro &
A f ,,,, '-- ; -.


;, ... ..-:tI. t

;_ 4 THE FLORIDA STAR : _FRIDAY, JANUARY 26, i900. 'f
= :==:_
.
;

't. 1I! THE FLORIDA STAR with a million, -or,less-Cannot be I I REPORTS TILE QUAY CASE. _- -":.-Jt";.'.,:J: !;.I I

punished at the hands of the law, W I

'. Entered at the postoffice at Titusville as no matter what crime he may have Only One Republican Signed tbe Report of lAKING .

:! second-class mail matter. committed. Are the people of the the Majority. Oi'AL

u? ElUs B. Wager, Editor and Publisher.Ni United States ready to accept thisas The reports of the committee on privi-
leges and elections in the case of Senator POWDER
fundamental truth'Are the
i: PUBLISHED EVERY.FRIDAY MORNING. a Quay, who claims a seat in the senate on
: lawful and regular proceedings of a the strength of appointment. from the ABsoWtELYPwm .

I, SUBSCRIPTION, 81.30 PER ANNUM; court of competent jurisdiction to governor of Pennsylvania, were presented!

75 CENTS FOR SIX MONTHS. be set aside by legislation when Tuesday. The majority report opposing Makes the food more delicious wholesome .

I. seating him was signed by Senators Caff- ,
AdTertliing Rates Furnished on they can no longer be successfully ROYAL BAKW6 POOEBCO..NEW YORK J

';, Application. attacked in the courts Is the ery, Pettus, Turley, Harris aud Burrows, .
the last named, the only Republican signing -
Communications (,n. live topics especially regular and lawful course of legal it. The minority report bears the The Passenger Fare Case.In Weekly Weather Report.

sv of local interest, are solicited. But the editor procedure, which is supposed to signatures of Senators Hoar, Chandler IT 8.DEPABTMENT Of: AGRICULTURE WEATH-
a reserves the right to condense them to suit the circuit court at Jacksonville ER BUBEAU.
Brief items of neighborhood news always apply to rich and poor alike, to Pritchard and McComas, all Republicans, Monday Judge Call listened to the argu-
desired. have effect and advocates giving the seat to Mr. i Comparative statement of temperaturesand
lawfully
no upon one ments of attorneys in the case of the state
week
rainfall for the ending Tuesday,
It must be clearly understood that neither convicted of crime, simply becausehe Quay. of Florida against the Savannah, Florida Jan. 23. 1900.
', THE STAB nor its editor is responsible foropinions is rich-from 'the proceeds of The majority report says the senate has and Western and the Florida Central and 1900 1899
expressed by correspondents. never recognized the right of a state ex- Peninsular railroads, for refusing to com- I DATE. MAX. MIN. MAX. MIN.
public moneys criminally taken executive to'make Jan. 17. 72 68 80 68
+ ; a temporary appoint- of the railroad
l ply with the order com-
? V:.' # Subscribers will confer a favor on THE from the treasury of the people ? ment where the vacancy occurred duringa \mission themto "" 18. 77 67 12 62
of 18 1898 directing 69 53
STAR if they will July 19. 74- 68
of failure
notify us to
any
: receive. their paper. These appear to be questions legislative session, and that the para. reduce the passenger fare from 4 to 3 20. 71 60 65 4S
raised by the counsel for Carter. mount intent to have the legislature cents. Attorney General Lamar was di- "" 21. 61 51 72-56
choose the is 22. 73. 54 68 55
senators
Misrepresenting Mr." Bryan. How, asks the News, will the to prevail. The rected by the commissioners, on June 29, 23. 73 60 76 61
t:4. constitution framers
: courts the and the people never intended to 1899!! to bring suit against the above Total rainfall for the week..99 inch.
In Washington last Saturday congress give the executive of a state the power to mentioned companies, and he recommended Departure from the normal rainfall for the
answer them ? fill an entire term by original appointment week. plus .21 inch.
B. S. Luldon and J.
that Judge
:Mr. that there rainfall since Jan.
Bryan complained Departure from normal
unless in
?
- possibly, a case where
M. Barrs be chosen to assist him in liti- inch.
1st, 1900, plus .76
. ". seemed to be a deliberate determination Dissatisfaction With Mr. Bryan.A the legislature had chosen, and the per- gation. A continuance of the case was HAL P. HARDIN,
} on the part of some of the son elected had refused to accept, or died taken until today. Observer Weather Bureau.

.:t f ; newspapers unfriendly! to him to Washington despatch in the before qualification. Jupiter, Fla.. Jan. 23. 1900. C

, .. misrepresent his position respect Baltimore Sun says informationhas Every contingency is provided for by There is more catarrh in this section of the

;,.t.... to the that been received in that that the constitution, except the sole one that country than all other diseases put together 0
t. Philippines.. In order city
the legislature fails to perform its sworn and until the last few years was supposed to
m-: f there might be no ground for suchIf' Mr. Bryan has received letters from duty, and against that the constitution be incurable. For a great many years doctors GLOVE.FITTING CORSETS,
pronounced it a local disease, and prescribedlocal
misrepresentation he stated his position i at least dozen. Democratic leadersin framers did not intend to provide. remedies and by constantly failing to

fi. : on that subject in writing. the south asking him to retireas "The fundamental principle thus es cure with local treatment pronounced it in- C BUTTE RICK PATTERNS T

candidate for tablished u> that, if the legislature, either curable. Science has proven catarrh to be a A I
L Notwithstanding this effort to set a the Democratic constitutional disease and therefore,requires WALL PAPER, T
before after the
.: ;, himself right, some of the correspondents nomination for president. In many or happening of a vacan- constitutional treatment. Hall's Catarrrh S. KID GLOVES, U
cy, has had an opportunity to fill it, then Cure, manufactured by F. J. Cheney & Co., S
o of leading Republican papers statements are appearingthat there is no power in the state! executive Toledo, Ohio, is the only constitutional cure A. SHOES, YG

::!: f papers stated in their dispatches among Democrats in Washington .to appoint. The result is fatal to the on the market. It is taken internally in doses I
from 10 drops to a teaspoonful. It acts direct DRY GOODS
'$* the substance, of what he wrote in a there is considerable dissatisfaction :claims of Mr. Quay, and the senate, for ly on the blood and mucous surfaces of the L

::.. way hat was calculated to create a with Mr. Bryan. Democratic its own honor and dignity, should stand system. They offer one hundred dolla's for R TRUNKS, E,
,
by its previous solemn and deliberate decision any case it fails to cure. Send for circularsand
DN
1 wrong impression.For senators are represented as ." testimonials. Address, MATTIXGS, F
instance the correspondentof being satisfied that he cannot come F.J. CHENEY & CO.,Toledo, 0.
The minority report says the governor's tit- Sold by druggists, 75c. HE, FURNITURE;. A
: the Times-Herald, of Chicago, as near being elected as he did in failure to call the legislature together to Hall's Family Pills are the best.

who has the ,reputation of beingone the last presidential contest, and elect a senator does not act to deprive the IIRAYING. STOVES,

that his views several of the of R. & G. CORSETS.
of the ablest newspaper men in on important governor power appointment."We If have
you any draying or hauling,
.. t Washington, stated in a dispatch questions are not acceptable think, "says the report, "that the Wingate will do it for you. He is herein
numbers of Democratic intent of the constitution was to provide, the business again. @
to his paper that Mr. Bryan was to very large -
far that should
as as possible, every state
"for but voters. There is talk also -- ---- -
expansion, was against have
two senators. We think that a decision R52SESS =s S "
_ 1 ; imperialism" and that he explained that when he reaches New York a which must inevitably deprive aSS5Z5eSB5ESBS252S2SS5SSESE5a5E5E52525ESESaSE5S52S2S Ki III 5
1
what he meant- by saying that determined effort is to be made to states in the Union for long periods of time Correspondence Invited. m L Stencils Furnished.

:'..he favored giving the Filipinos independence induce him to abandon the 16 to 1 of their rightful representation under the acacaoocsc cac2ocacacacJnca "5 S25 S 5 5 i3

constitution, will not be permitted longto
and them
',' protecting idea.All stand and that settlement of the
no
'"' against outside interference. He of this sort of political gossipis {
question in derogation of the rights of
t also made the statement that Mr. interesting, but it does not prove the states, and, as we conceive, in viola- McOomb & Co. I

'. Bryan did. not explain how Filipino anything No weight is to be attached tion of the intent of the framers of the t tm

: independence could be reconciled : to it as long as no one of constitution should be acquiesced in." m

r. with an American protec- the Democratic leaders is willing to 1

i Ci torate. .. come out into the open and state .Republican Convention. I BERMUDA, i

J, ;S'-. 0' As a matter of fact, Mr. Bryan that he' is opposed to Mr. Bryan, The Republican state convention met i CUBAN andSOUTHERN I 3!

"did. make such an explanation. and will use his influence to pre- in the opera house at Augustine last ,,1.rowers'

He said that the kind of protectorate vent him from being nominated.It Friday at noon after an all night caucus I

t the American'government would be very remarkable if Mr. held to settle the deletion to the Philadelphia
convention. The' S
fight was be-
"rw'. .should exercise: over the Philippines Bryan did not have some oppo i- tween United States :Marshal Horr and

was the ame as that which tion. He does not expect that he II. S. Chubb, who finally gave way for and Shippers' Agents gn ,

Lit exercises, over the republics of will be nominated by acclamation. position as alternate. -
--
-- -
r ':Central and South America, sini- All the kdications are, however, Collector MscFarlane, of Tampa, madea 111 -- -

-/ ply to prevent European nations that he will have such an over- strong fight against: E. U. Gunby, his 111 5

from interfering the affairs of whelming majority in the nominating grievance being that he was omitted m If!
.. from the Tampa delegation. REFERENCE?: 309 Washington St.,

,.. those republics or endeavoring to convention that the opposi- Judge John G. Long was:! in full controlof Commercial Agencies. Dr
dominate them. tion will hardly be worth consider- the convention and was elected chairman Any Reliable House in Sew York. NEW -:- YORK ID

For this country to exercise such i ing.It by acclamation. L J'
is le H8..J. t i. Lour J. E. Lee II. S. xac cacac+c cac iS25"c canc oc'!5252S252:0 !5252S252S252S2S2S252525 S252 !S2S cacac cacaocac
authority might not be a goodY probable that those who are ; ,

l thing for the Filipinos, and it might doing the most of the talking Chubb and :Mark White were nominated
the national convention.McKinley's .
to
'?be more costly than profitable for against him were against him in delegates[ administration received Hotel Indian River

,. this country. Still Mr. Bryan favors 1SUG. That explains probably why hearty indorsement: but the delegateswere ,

such a protecto> "
and it is but fair that his po- be given in the interviews in leaders in the convention all agreed

- sition be correctly stated in both which they express anti-Bryan that the vice presidential candidate Steam Lights, Heat Elevator, Electric, Orchestra.
would from New York Lieutenant
come .
Republican and Democratic sentiments.Mr. Everything
papers. (io'rnol'Yoodmfi being the favorite, First Class . .:
Bryan is not to
going change
though: :Secretary Bliss: had many sup- --------i' -
The Financial Pull." his views on the. money question, I>oiters. The Florida dl'ation'iJI; it CUISIN'E THE FINEST

the expansion question or any i is conceded! follow the !lead of the New S3
per day and upwards.
4' The Pensacola News strikes it York delegation.
other could
? question. lIe not very ; 5 Special weekly rates.
.l' about right when it says that the well afford to change them. If he r

politician with a pull "gets:; there." I want to ]let the people who suffer fr,tin >
: to do he would be 1-: RQSKEY.
were so cease:: to rheumatism and] sciatica know that Cham .
with of influential --- -----
The criminal plenty popular with those who are now berlain's Pain Hahn relieved me after a

friends ha good chancesof his staunchest:: friends.Clyde's : number of other medirine.ami a doctor Boating Fishing! Hunting, Drives, IJicyclinsr
getting oil'easy. If his friendsor had failed. It is the best liniment I have PLENTY OF ORANGES
ever kncwn of.-J. .\. Dodjren: Alpharetta among the attractions.
his have of cash
family plenty General Offices Moved. Ga. Thou.-ands\'e l been cured of ,
he is almost sure of exemptionfrom rheumatism by this remedy. One application -- '- -- --

the consequences of his crime. Effeetive.Jai.ith: 1IOO! the general relieves the pain. For sale by B. Agency 4
ollicvs of the Clyde Steamship: It. Wilson l & Son.For: .
Former Captain Oberlin M. Car- company
WITH removed from No. 5 Howling Green, Arn.oricusMonumental: :
convicted court-martial of
ter by a
Over Years
Fifty
New York, to Cliesebroiijjh:: biiililinp
his brother officers: of high crimes :State street, opposite lottery Park. The Mas. WI.VSLOW'S I-OOTHI.NG SVIUT ha. hoe::
the of the United useu for over flfty vean by millions! mothers r arble
against people offices of the Works
new Clyde line will be tit- for their children, while teething, with perfect
States, is able, or his friends are for ted up very tine and in keeping with the allays.uccl'-!;all. Itsoothe pain'urewmd. the i hiM.colic s-ottenn, mid Is the the sums; best!,

elegant ships and service remedy for Diarrhoea. It will relieve the poor
him, to pay large sums to the most: .' run by the little sufferer Immelll.ltold by Drug'hLQIn AMERICUS, GA.
skillful and renowned lawyers to company. every part of the world. TWl'nt --fl\"e centsa
bottle. Be sure and ask for "Mr". Win:;.
fight his:: case, even after his conviction low'ssonthlne Syrup and take no other :SlndMASTKK'S All kinds of Monuments, all kinds of Granite

'-' ,,\ t t and sentence have: been apt Bicycle Collision.Mrs. --!oi.\-- U;. and Marble, and Cemetery Fencing. All work

}. \ proved by the president. The bold : L. II. Decker, of\Vet-t Palm Beach, Under awl liv virtue cof a tinal decree of done in person solicited.in a satisfactory manner. Correspondence -

... \ announcement i is made by his counsel \va-i thrown from her bicycle the first partof foreclosure! rendered l by the HUll Minor S. Hl'pn''ntcllyc.
'S. I' last week while] riding down the rubber Jones,judge of the circuit: court in and fur
that if they are unsuccessful in Brevanl county. Florida.: un the 21th day of E. FIOO
trail at Palm Beach ba S.
\ the preliminary step collision: January, A, I). IJtOU. in a certain cause inc'lianecry.
prolonging with a wheel coming in the 'OPPo:5ill' di- therein i rinliux in laid court, ltV Hanover St., Jaohsonvillo, F'la.r' .
t, now in progress for the trial of Cart rection. Her ankle was cauht: betweenthe wherein Daniel. Smith i io complainant and

'till\ } ter's coconspirators until the legal pedal crank and the frame of her F, M. Tyler,as adiiiiiii.->tnit! Julius defendants. I will,
Tyler ('t al. arc as
ft. period of limitation expires next wheel and she was held in this position :special master in chaurt'ry, ell for cash to the TOMATO as

UEu ', IT thereby preventing the dis- I until released by her Eonin.law11'. :M. highest and best bidder on the first .Monday
"the l t, I E. Gruber, who, with his wife, was withher. in March won! the sun" t Mim the 5th day of
lures of evidence which would It will wild month and a \<'zusales\ day. between LIVINGSTON'S MAGNUS
Mr.cfirr: Sft'\rter'-s guilttheintend I probably be some days, if the legal; hours of.ii., in front of the court
:: !, : / -
Brevanl
houduor \
in !! in Titu-viile. : county. ----
10 ,.evera.r ys into the reover described! land 1'i :- 7i-rv iii-iiict\ anti n:".t i-romi-ini; new
IJJllIatter supreme ;; Florida all the follotviiiL': ; lying r", bxci.iir
home G Fruit I \r. nt nf UKAJTY: '
ami \
n"'ln \( I":
.
wit ,
and eing in Rrcvard county Florida to : i S it .t.t .J.llIl,1I I V i.iviK-I"II to the To".in
for some gti 0.; .sentlemUllij.fj tateS, anu, ass I Lot 4, suction III, township 3o south nf raujre; r .' .'" ', ?i>. II is ihickri I ', in-Axicr juuiiiioit
_...... FOR SALK CUE.\". C did tt. the 40 and 2 and easily
L entertain for to see what hat congress:;= j l the I rnet. east, excepting: therefrom lots 1 .4' the, ii '-t h..n.lome -ort In cultivation The
f minis- +,O that part of lots ::5 and 1. lying; went of I :x.rfert. auform, large and attract1\"e.
nie E. a co -i. Sharpe received la rangc. Thr(-end Florida East 'III..t Railway company's; rightof ;t I Ll .,. Hevry nniJ It 1- si robust grouse with
.
a.I: M-ntN !hetungii-s fruit
ay a Irs. DiBol lefWlhe legality fA from the McFarland fenced conIlc way, also lot i, arc tnlinx t<> the plat of said; j'ricttMii inc*tvarlnifN rlu-ti-r.-and U. closer therefore.to-
of '. Futh kitchen and land made by 1:. R.! Bu rl'hlipl. county surveyor ,t he4t. <'i-iper.| It Is especially adapted for f
spent the stair4 .e with which toflil storehouse.ca"vf and on record in said county of IJrevard .hiupms. and is remarkably tine for forcing
he 0 d and frc a Span 'M /Qn 'n fro eight and also excepting the right of way of the imliNirf and out. Order at ouce. _
a acresacres said Per PkL. 20c 3 pUs. 60c. 7 pkts.. $1.00.
ay, ndo' Silver the GtYltlnst. cleared Florida Ea.it Coast Itaihvay company or
the much thereof will satisfy said decree.D. .
1-00 i h so aj Elegantly
l. fill Illustrated Seed
be
# sold Annual Free
\ ( ,
I. fAULDE-V.
with all
orders.
of its eww. ,
ipenl me if de. Spetlt13la ter in Chancery.:
+! J grange. Titusvillr, Fla., Jau.2 tb, 1'JOU. the LiYiDgston Seed Co., COLUMBUS OHIO. .

\
r t

j. ) \ 1. k4ADtifr


) t '.

:i d T J



Full Text

PAGE 1

HARDWARETin-wareWOODENWAREWri-teGROCERIESHa-yasks1rit-er5cojTak-m333-3aLiltsPritchardIGBCASTORIAF-oraSVINSURANCEII1SI0HSTEWARTGoldsmithST-APLEBondU1LIE3EEWHISKIESSTOVES-BoatMOTLOWBRANDIESsqzMELBOURNFLDECANTERIGB-ALurnRETRA-DEICEJfoodJEEEEEEeEEEEEEEeeeeGCCt1t-oSonFINEJasGEtuuuaClberLonlCrockeryCarrolls1eyWINESWShadowFIRE11tISarsaparillaCoO-nSTEWARTnLJrVANLANDINGHAM3IAXUFACTOKYdemonstratedtheylffIIRSber0LwtFo-reignphosphitespurifiers-ItFEECOONIYscsiKVKKVTlllNdEIRSTCLASSMOISTURE-HowCastsBought-BearsAppertainingChambersencyLeastWashingtont1QHrequiretWALKEREMULSIONPaintssuperintendentlicsuperintendentpalatableHYPOPHOSPMTESsuperintendentTHEATheFloridastiperintuu-doncysuperintrndiiitGoodsr1dsuperintendentsuperintendentsuperintendentsuperintendentSliadi-MattiniisDaccompanyFlo3ridJsuperintendentTITUSVILLEsuperintendentGOODstrengthsuperintend-entJANUARYbeensutli-irientlyLiverpoolpoundfencyclopediasdigestedfurthermore-thatTitusvilleHairPrhbredioILccheckedcommendingAlwaysmjllcrfriii0Consumptivegeographies-forContinentalFLORIDABESTac-knowledgingimpurecontradiction-OurexpendituresMouldingtakinglluyilenearly-allnpreMntingschoolswhichcompoundingProvidenceaccomplishedShinglesSCOTTSLIQUORSportantHeadquarters-forsatisfactorilyuanuraeturenpurcbasuHoodsE3Cexactlyundelroyedcompound-ingthe-Signaturet1CCabbagedisordersBalustersllAKPKU-hifkevexpendituredestroyed-bynecessaryOilsCLEARANCEharmfully-incodliverusuallyOrangeFRIDAYLIVERformbutarrangementBILLIARDFLORIDAmiblisliiiiidestroyed-IevaporationCementgestedDyspepsiaAgriculturalprobablysingleenoughinknownapprovingHUMUSTABLESinformationwholeuncertaintyprefermentwarrantswasdi1oppositionarithmeticalconcerningManageroptimistics1N1IVXthoroughlyexcessivelyhad-ptlhltrluuncantvlledvideelementoithleswsHartfordoutstand-ingindebtednessTElEexperiencevalua-bledctrovdleaderunlessdisinterestedexivtili-iSOOinvesti-gatedVegetablesprolmblyshopelesslyFEBRUARYthrough-thecolleaguesadvantagepivvtuiflyincreasingMutual-ForjudgmentanrcmiapermissionliuttroutpurchasedltssesshunhopelesslyectorawatersobbedpositivelyextremelyanamicpurchasedpuhlihfilindebtednessJOHNTomatobloodpoisonamountexperienceparticles-ofbelievinggainSarsaparillafrequentlyagainst-theQuarterlygreatadvantageseparatingemwrasodperniciousFEEoperationprofitableresigna-tiondigestionboardthefollowingconsumptivemanufactureconstitutionandeasilybloodeasilyVhiskiisKxponentcertainlycolleaguesCIGARSdefinitelyJeffersonvllleopportunityaffordingpurchasepurchasevegetationrandirsmakeapprovedwhilepurchasedomrstiieducationalpurchaseannuallyfollowingUIYEUcompleterestorepleasurescontentiondropauthoritythoroughrejectLondoncheekswillMichiganpercentagetMiilrinUMtpurchaseinstructionHANDSOMEpurchasecertainChildrenVindvquantitytaxpayersmulchingportionsreasonablehouseholdStandardmulchingRegardingJNIIllicitySCIIUYLERaspirantCrockeryquantityBRIDGEWATSRgivesinscrutablehealthdepletedaggregateTuesdayconstituteascertainedMcNallybefoggedvegetableixi-Miwlittirconclusionsuppliesdrawingstartlingprom-inenthealthrequiredshortlivedSartapartiJiuheterodoxwarrantedeverythingConstantlyCratespoliticalsuppliesdollaoandinterestedpositionhypoAelopedwstoppedindividualdepositslttttsviiiethroughtaxpayeropinxcdKINDSTITUSVILLKvegetableirregularwhateverintruetionChicagoburnsSTARactuallyper-mdescribedpracticalcontraryenrichmerchantactuallydyspepsiasupply-ofconclusionpaymentconnectedwhichtonguedcheaplywhiskeyportionTITUSVIIIKconsultedstrawerabAmericantheydiscardededucatorsbackingproduceresolutionLampnvjmerouaquestionthrough0fattygirlsBARGAINSanywhereprintedinformationfattyopinionTaliaferroposition4atiNeweltreasurycerninggrowingsupportnothingre-versiblehavedis-armedworthlesssentimentpnrnostaimlmdualLtheyexceedintreasuryInfantsreceiptclaimed-asLimedisrudetlnervousriep-iuubloodtax-payersonlysubtlybrandsHavediggingKfiMllytendingcolumnsbearingrequiresllihdKconditiontransformcertain-lyleadinguarninudayNmakingwarrants-IbitterlycipientmoistureHOLIDAYamount-ofpresentDOLLARSregardlesscatharticscientifictimeminghurlingScrollgiveGlobereasona-blepalehaulingotherpioinolesteachersprutnptlyvaluelessdifferentboughtpoliticscompanyUmlpusttsubjectmountedaskingconditionboughtfltatetSTYLISHnecessaryorchardsunpaidtreasurercon-cernedFANCYmoistureaskingAXDHKWSPostsKindboughtboughtArrivingluurd-UymethodsanythingsubjectynirTlerhavingmoistureCODCoughappliedcompanymoisturesystemsdeficientbecomesDanburyradi-ationboughtorganicTtreasurerteach-ingwhatAndrewplowedbusinesspresentortMpeoplemoisturebecomesbuildingdruggistsorchardsthroughPOOLdecidedmoisturenmusemenlbelievescommitteeinvolvedHintscountyState-mentthemduringthirstypurposesduringFirebusinessEstimatesresidentbetweenmethodslocallyboughtreceiptonefifthcollegemediumDuringbelievedCockrellDuringharmlessbuildimpublicinferredseieniitirWorkduringimivaebringsRobsoleteduringOILteachersHomehumusUndressedsun-shinepostedneeddupedcolorused-theycontainsthereondistanceMibduedmethodweatherincreasepackingmoney-orFtsaatwarrantsstauuhoatSOD-AScountywarrantscountyutterancescountytheirtimiwvWIWIIIIsalariesPcirsshadowPeueh-IpublicbecomewarrantsNothingotlhcsvpresentFarmersinglygetherPuttinginterestdur-ingSarsapain-volvestakingTHErecklessdoubt-fulwhethertheirinterestinterestcountyheavyTake189309sonsfoodtheirpassedYouThinwarrantsrecoveredFloridaASinterestMoiuaehdecidedMoTIOWformfoodsysteminterestschoolsgastricinterestotheriMiabletheirwhetherfiguresANDinterestdecidedflesh1MrenulhFloridarun-ningpresentmethodwithChestnutschoolsshippedreck-lesslocationtruhFloridaattentionschoolsLINEor-dinaryplantsregardschoolsamount189798orchardLatttiUJoHmethodinterestrarelycountydrainedcountysandyYourcitizenslolifitcountythangetnumberre-markedwar-rantslisted-atGrowerHumuswarrantteacherfoodditure5thestillBesidesoccasionsTingleJournalFloridaMATILDAiUliul-htreliableBeanwarrantreallypeachneededcountycarloadregardSDOOOSenatorlettersacceptformercashedSpecialneededamountSenatorFundfurthertheattentionwayinter-estFartherGallicbeingFloridaNallycountywarrantsSIHcinlwithplacefurtherwarrantpointgivenFloridaschoolschoolspiritSufferedFloridacountyYorkerresultsde-vicescountydur-ingi-JrmolhumusschoolorganicthatfiguretheUnitedUnitedEtnaromltImv-ingMURPHYLdSIlIYmaterialwar-rantsStoutthatbe-comesmuslinwinterWeamountclassedmattersellingamountFloridabelieveSundaamountissuedpeachspongeformermoneyhumusboardradi-calTheScPHinilvknownschoolhumusTheyschoolschoolsettledthatYoudeliverrelievedirritatingchartsschoolmotionreadySchoolboardextractsboundhealthrainyagainactionadmit1900appearrhouldpriceANDMtheiteilhumusknownskeletonhumusCrntlschoolUnderitrttbeboundSALEshouldhumusritittewrit-tenmanswouldwhichSheatsAFTEREUGENEboundofbookslargetheyschoolwhomANDchartsdollarALLnl-tusliaboveadvisedP1twlabklsafeFruitsamountdeniedwhosewhichmain-asrainyfairlyEditorpitntsThereschoolhaveboardschoolschoolchurlschartsamountSunny01753churlsschoolcannotalongboundTherebanksandandporousrailroadfurtherwhichshouldadviseandschoolratheraddresskeepwhichbanksaddledaddedfamilyamountwhosewar-rantchartschartsschoolright-SrainychartscouldStatesanyttlfdbeforeschoolmorecreditforallboard3333uniteattairsFloridaonlytallywhatwordsCocoathisboardeasternDressedboardlargeICEschooladdedalsoeithero-fFschooldrownFlaSouthincheswouldWhenwouldtunaspricesboard3339dlclillusingschoolagentandaccountswhichfirmsonlypaidstatedeasily3333paidAlsostrainpaidAgentratherreturnstheybanksboardaboveleavespaperwho-iswholeAirswhenthereafterboardboardANDFreshwhenallowviewspriceschartsboardtheyissuesschoolspacegrovewriteswhichauptoonlypaperhoardkeptcouldRuralmannerknowcoughboardStatesforcesstatesdollarsnormalpaidmuterHoodsmarketcouldhonksthosecouldlistedothermatterBOWNEquickviewsdunespaidtheyexpenthesesenateCheimtsmapsvoguemakearticlemakerollergoodrightothersayfundsotherotherHALFthesemakeotherWhattherethemhubitemsRollsmakeHoodstheyfromGrainnotthinkcouldstationIndianRandStSunliableabovetheypaidboardntnfultheremuchmoistChartlion-VletterofficetimestheremuchhomeothertheyanymanyRandthoseofficeGlassmattermuckandandMyGoodowedthemwishwaitedordetclothexcuseoiltheycarryfundsblandeverymapsgreathavehavebringissuetheniivcboolgivepinetheredownlt1temuckjusttypealmutwhite95000valueFruitlandsHullsthethemmapsthesethesetwicevividpinelitredownglueyandmatterletterlowestleaveJ800ndcannotknowandlongchartclothDifferhindsthosehaveelicitsenatefundsYorkyournorthandbankSCOTTbeenvirushealthit-SdotlthemWareaydyearsthreecthemEtcstatesfilletsquarejuitrwheninvpricegivenlandslandsmlirrneedbloods1243churlhurtthreeneedhavefinsfundllafCostwhichgivfiidebtopenlintthemclmrtthesewhatclayThnhaveThislargehavetadllutknowinterneedOmvshortwouldhaveuponwhatshallcentswhichonUrs1243handuponcentsFromgets1000333whatwroteoilysuchbeenthemcaststhendonerantshaveneedbrutthanwiththenWITHcentstheirdunebustsProfclaystateidealthiMdeathi5-Xtimecopyhavetilterrducedthanscudcentsinnivsa4iiuihavebeenTheeachtakewithcopythatsandtakewithdatewhatfromThaiandthatcourseeachwithpartwatercensussandBdebtforthatyearsfruitbeenfromfromsandrstateswaterthatwitheachmat-terclassaftersoilspricebeentintsdryrantsdebtNewwithgrowthatthatthatlandmadebeenNEWtwinEsemieachdebtThisliarseasonseasonhereholdthatwithInterlowbeendryonlypOpdryfromPearllawswithbothpureyearsseasondebtUthatthuschlSkeptsuchNewthanthatawarebeenBothStatesmustmadethatsuchhavestateUsoilsdryTheThetithethatseasonthatwithstatefundthatheldeasonhelddoessoilsfromTheMydryAcomes500thatstuntsduessoaklimebtubeenthatSTIRwithseasonmayveryhaveitltgtstateTILEthattsinceivaonwhoodhlthatthatdebtsaysOFsonsTheandANNhoolTheeverywhoTitu1900AuldfatlikewellOFstatetillsIntomapveryLikecausescropbestfatmapveryfieldpaidConnthisOtheruse-fulsaysThewallthatFromootrilethosepureThethatWiOFthiscanandcultranisriverThethattiuutt0wa-mhandThetrialalsopurrNandmaitteleadthathotelname1luiththatthatfootsamecropfruitmostriverfruitMvandHowcullthistoissuethatThewhopastthisstatethiscauseThewhothisre-imwithhavethisMustTandalsogrowsaidhavelatethatandandthisalsowillandamiTPrandthatit-rn16thXaleuntilandandsayswilldue150timidrentsandsaleTinrichrandandnodandwillcentcentthatinandandandandandlikeStarDEreasonHoodsandandandButandbeenfuelsizeandandandrichthecansThewell4IdOantielseandandrealandthehereanyalaiandanyyetlesssendandthethiswilladdwillanyandThatsomesamewellsoilandandwilloverrtthetheandandfeetnullandandarilneverthepentheandthethedueeventhetheweremusttimeEIyourandlikeandfindDSOtheandoakwillFuJimandrillaWaspentheandwerebutthethethebutoftellpaysoldstunttookfair57jthebudOurthatboatleafhasbutthethethethethebutfairFivethistheandtheputEastandin26yourmoremailbutmtistthethethethewellsoilsoilthethethethetheanytheBySirtakeg-flthetinthewelltheacts>thethethehitsoftheitthethethethethethethetheyearworesnirsometillsMRSartytinoverhashatslesssoilthethethetheTinwerebilltheasksoilthetillthebutthesoilHutthatrtuttthethethethethetheactsleyeveriL-pTheOSwtivVIthesayhashjhisthethethethecentthethecentisarewillandmythuthethethesoilthethethethepayweresummailthethetheboamythethetheslaMvthetheFmbythethemstoretellbywithFItbywhothethethethethesayhasthethethetheMillthetiltthethethethewillforthenowlisttoservotoforbyOurhutssaythethethethethethenottinthethebythedidthethethethethehasthethesouplatandratesRBoxintheperthedidhutonceandeverbythetimefailCallthefewtilltheinirtbcFluthewilltheturdtinIlseperthethetiltbutonlybutbybyrunsbytintthethenowsumnowbethenottheoutmatnotualthetintinperthethetin4wereandSoillottheinperthefactthebyMctimebutnotHeforforlessmeneaseCanlowiiibthemysumminCortoSawforforandwasmenandwasvillandbySliltUTSFlaYorkandCSIndandeverfactveryhisforhadandones>aforfortheganalformanyforhisbeCoforcaebuttallmyJaid>not3jI-efourauvanvonetotwas212cantlswastisalluhtinpucforofbedoitishetwassomlisallformineJ25ofareuseisisheletnutnutithyarebeofofeat25ofrunSohe50notforfor50ofbeinofuntoareand11JtofInnutofofofofbeofofofofofLofurfor>alluseuplsaofamiof1ofofofofoflnnutnotbeelbeininbeIf7offofofInofofheofofofofofmeofofofofofuseinbeallofinofksofofmemeofof22ofofofetcweofoftunforofdlofinofofareareamotAofvoofofofofbeinof5ourcureareofofaininintheinofininininininofSofofatatoftoininainininofofareofoftoatmev-iiininininonmrininofofofoftoaretotomeonatnoosofItIfif11inininininofoftrietototonoliliusewetoininjininItataritotheinofofifnoGonontoistototoanononanon5ocweintitofolGinininistotoininisin1toatnyIfXononIllUonnoononitistotoitsoononisNIKisitisisinittotototoononontototoastoasatisisisisisIKexorortoPititottototototoonrtoonorisitisItoninisisittoofasorortoutnilonLAtoisIlitIittoatoritasasnonreasytittontvitlUiritosousasisisintototoasustoorouorarasasastototoititfastotoonortotooriusastoastotsttaorasKitloIvonatonorsoisF=iijtoononontin1ItwisrnreorasiporWiswT>usitJtoailltom5atoamilto1HiifluitasIAAKIvAordtAillAILtl44iIII6IIrIJtIIIIIatowIIaaaftIIIfIaaaaTvtI2IIdPaaIuapmIIIaaaaaIaanuMwaaaaaaLi-JiI1uaaaaatefaaaa1rIattarIIantinattiitiilepeI4wtiIt1ItS>tt>fr1irsIIu>II-Jljtrl=>nr4isIjttJ>I-J<>ttIiI>C>sliItJ>>IIjiiitrt+aIiIntIIktjtIIiaf1S


PAGE 1

IgefS-nalrVigorEngineersElectricalorangeTH-EJohnsonGRAHAMIndianROBBINSLawCO-MPANYELECTRICALSteamersDENTCl1stJISUPPLY4SaidessPreventsHOUSETINSMITHCarriithersUKA-CHGeorgeMARKET-GRiverTreesFLORIDAUnimprovedPeeplesAimrdiientsO-NJACKSONVILLEjTuierivelMost-CompleteCuresfollowingnamedlIouiiioHsestcrn-IrafsNJSrERcongratulations21It-lauuuudatNavigationCOSTYEIEtSCOASTBirthdayOFFICE-STITUSVILLECelebrationTitusvilleBarberMKDITKUUAXKAXJANUARYunannounced-upongraduallyall-KindsDOWNpreciselyAUIridguHiulChattanoogaELECTRICcompetition-THEdaughter-MissPhiladelphiaiatitiisrewlnI-KMEATBrooklyn-ProfBANKCapitalShopSUPPLIESFloutingbaldness-ItunanimouslyKReminiscencesprofessio-nalprovidedgtiilliMiieusanniversaryextinguishedlcntlemcnBiscayneEASTintended-ItFRIDAYDIRECTORYthemselves-andDrugestablishvuitAddrtsMELBOURNEFloridaeverythingSTARbicyclistsdilapidatedentertainmenthurt-MondayAbstractsestablishmentHUGHLETTdressmak-ingTuesday-RevgminllatlwrujHriutewltutMcFarlViapprecia-tionWednesdayMifMaryfortunatelyGeorgianawhereuponbreaking-theshipment-ofEASTFloridaRockledgemakingKepublieanpermissionSaturday-MrTuesday-MrSchoonmakerItmiirheil-shindydandruffourselveshr-Hughlettfuw-Residencereceithtttrefreshmentsdexriptiuu-tl1triRockledgeUockledgeremoves-oneXELBOmtNEneverfailingmachineryRockledget7R2AThursdayRockledgeI-HRoCKLKlMJKMc-laughlinThursdayFurnishingsSchoomnakcrbelongingGeorgianapropertiessup-positionprominentBullocksgentlemengentlemengentlemencomingllockleilgeAyersandconservative-WWestchesterJacksonville1kvuultlyRockledgewluMvnixmNeighboringhomewardbecomeAugustineThursdayJaekonvilleproceededThursdayproceededappointedcleansesHujrhlettsSaturdaytlthllll1111otliciatiiiijMagruderlHPIIUllIcustomers-Mrsthe-SignaturehypnotistCarpenterpresentedunconsciousTITLSVILLEL-AEdi11spendingLaUrangeatudJlartDelaunoyllockledyeEpiscopaldisturbanceSaturtlayM-UoldsmithIlthtriaavtIulK1lIxIstjrtHUulf-MrLaGrangeThursdaylluyhlettre-turningK-fSAXFnliPSKattirifs-iviiriuliw-IJIMIYglossyrememberedWuinbergdaughtersSaturdaySilvernsUufnh-avilltsandwichesblacksmithin-numerableJacksonvilleFriday-Mrdining-roomloUnmnVKuadaimanreasonableSpeechessurelySaturdayANDtluiailtutieTilismithiliKSingletonspemlingdaughterTRAFFORDhandsom-estgroaningentertainedglandsseriouslyprobablySaturdayexcitementLuliramjecaiurdayspendingFLCetLHughlettformerlySaturdaycon-versationSaturdayprofessorDIRECTORYshoutingtravelingCrfightfreshmuitsSpunkiertravelingChiefThoscolor-ofbirthdayMichael-leftTuesdayTuesdayBuddedUndertakersWouldVigorSaturdaybulbs-ItresidencesHendersondashboardeloquentbuildingMeadameapleasantDIRECTORYMondayClevelandTHEspeechesiThurs-dayDIRECTORYBlodgettBaltimoreBiittiMiuVllcolor-ofTuesdayshippedIAKK-WollTlfBROTHERSmorningpleasantpresidedpineappleHughlettCanaveralMesdamesRichmondaccepted10000ScalpattendancehouseholdTuesdaybuildingeloquentChandleryRamseyhUllbullilKeniganMondayLaphamUallentineCalifor-niahomemadeMel-bournepleasurepleasureliinghuntPricesMondaythoughtltUi4-hlstlfucnaremainKatherineOASsucceededaitfeptedlukJOOlCrTuesdayHughletteveningmorningIndianolaIakr-HiIonSuiii-uiulDeLannoysucceededdarkermillineryafternoonpleasantenragedsomcesplcaimtshiplimghaiulomeMichaelsMondaySTEWARTMondayresidenceSaturdaycarriageMondayLaudsThurs-dayTitusvrllestraightpresidentUiplmmsurpriseafternoonafternoonmeetingbroughtpopularWetheyiHiyUmapleasantdrivingChaudoinInlandpleasantSaturdayLuckeyrespondIndianolaRamseyafternoonRamseyHODGSONpromptly1-1entertulllKrliriiaryLIGHTquillingChtuuluinyouthouufectkPhysiciandesirableresidencecom-mencedsurpriseafternoonnothingAndrew-sSLou-isvillepositionturkeysGeorgiapossessorownedafternoonDtiilalLuckeySTennetkickingSundaymeetingclientseveningIndianolaeveningblessingmakesgroundeveningSANDERSarrivedGutteringCrockeryWholesaleafternoonAn-drewsSaturdayBUSINESSlaunrn-MrMondayscalpafternoonGeorgiaAndrewsputtingpointedafternoonafternooncelebratedisapputtinglIl1lKlltlLBUSINESSCOUNTYafternoonBuildingschoonertiiltdatk4taconsistedGeorgedrug-storereturnedCrockeryleavingyathiMvdRedwineSharpereturningrunawaySundayopenedHarrisonmomenttiuorgiastretchedBAKEBYWilliamsbetterShavewelcomerestoresHancockSaddlerypruamltlyafternoonafternoonex-cellentGoodsellUildrethaitrrnuonLtIrItCtJuurenderedFridaycomingUochellemimingsleeperheadsscalpreturnedBUSINESSvisitingactivedangerBAKERYplaceScholMdcom-pleteHardwarerelativesHarrisonHarrisonOccurringahildienfunctionsSalesroomremovedlarge1COSKIANUWilliamsHarrison11uidxystimelypassedExclusiveworkersjirejHiretlvisitingTaylorWhataccidentcaughtHarrisonBUSINESSKIKlMiK-SWittfeldtenmlMmtLAOrangeIuN-1t1tJohnsonbusinesslrtUItillonlyGleasonRIVERsocietychildrenKndaycaughtFurnitureMichaelsilianulurMitchellHoustontafaiNddmarchedGlasswareWithersonemtorHarrisonunrulyrespectslightedreturnedknockedcompanycurtainswindowllildiuthSanderslainnuMUfamilytimelymildlyWil-liamsDANIELMichaelDobbinsTaylorcaughtRiverHartfordGroceriesspeechcarpetsSterlinglationsurelyTHEFridayTaylorwhitegnuvfulIIgiIospeechchildrenstHretaryTaylorItkaIUtL1rel-ativesCogginStilingIfrrkhtfrcountryClothingchargeweightPhillipsWamblebicyclepracticeJohnsonPuckettanothermakeyiaitoraUeorgeAiuiuUlFridayfurnishednumberbicyclesExeellestHillianlMallardhurlyPalatkaHrevardanotherSurgeoncompanyThomasretiiiirrdplace-infavoritefamilywindowjusticereachediMikiiKM-kntearriasieansweredTaylorleadingleav-ingRobertsPLATTSfore-headcaughtcitizensUMichiiiKpeoplejayreachedpatronsHenryshortsweetnesscitizensHarrisontherelayersreceivedhopedTRAVISiiitiniiCurrierluiiifssmaterialseveningjoinedcoloranothervarietiesarrivedcondoleUuilaiuI-thniHKkSYSTKMqualityARKiriiKRussistiilfrompresentpeopleTitlethe-touristfreightUPvisitorsWalkerCurrierneatlycausesThomasMexicobecameCamnalandsget-tingtxiKTioinHcountrythingsHotelulwatsrailwaybrotherwiiugrnsfiremanWoltTIIpearsfIftaBullockmonthsGrocer-iesIMI-MKnuttfHindlehearersasleepcircuCharlieSandersvisitorslivelyfromfiremanHairparlorarrivedsmallerMajorstopsarrivedDURZNManytellingdcHiHiuUCrabbscrowbarGilbertAgentliuckerMerrittvisitingbookUflcthiinaturecountiesgtanaCharliespendcigarsFloridaMerrittarrivedbuggyV1111grandlenderIMlNvisitorsbruisedHairteacherl1UljdntuitfltakesgreatBrevarddeputyfriendsfriendsparentpupilscausesSharesFannieAtlantacottagevisitorsfavoredaboardtA4KmIbuggyhap-pyon-boardlupitrreotiageliveryThev-athimselfniar-nagePutiminstttemedoIalongQuaidFanniearrivedF-1lIUIMessrsseveralfriendsinvitedXevinainvitedshakenseverallIWlt1300rebuiltspentfriendsarrivedfriendsAgentsdoesReliablevisitorsofferedseveralbesideslijwkrbadlyChildscopygrandBrevardswingfriendsfriendMartinvisitorCurryGAIAIEWalterinvitedoclockprettyTheybeingHughTrunkscountycountyIndiangrowchurchseveralstartedownedfittingsCAXVLalmostseveralCOCOAdistrictaroundbringYEH-LowullgrayspendbeingarrivedstartedGrocersstartedvictimcinderluitiHlfriendsappleMIAMIjaturedBeforeheroicreliableStilingtaty-tberrturnedPIERCEMarygrayIetwctwouldTheySharesJamesIXFOliMATar-rivedSTATECCdyevisitorvisitorMaconthanksconsumerssteameraddresskindsltiugSebasi4aagainwokMunroBottgbtSanmelMessrsHaira-jjrcatneith-eramongFaihcrMesivMarineHatterWhenSuudulodgeFloridaMantishavedan-gervisitor19COsleepSmithSTATEtimeMentioneaitorTonyamongar-rivedralausNlhairskinwinterCurterunitedCioodiregionVILLKpistolthusbaldCrabbvisitorunitedcharterstartedLillianPricesBayJlortoneffectshairpartyIHH-MkinlhairWhenCOCOAledgeplatyladiesUnitedawokeIn-dianIIJitNBranchcashiergottenJarvisreportbeforeuluauiIIndianhairThesepres-entJamesHatchAnnieTheyMillirwhichHousecausedsjKiit-aHratiiijSetlasMattfreeseatedcpiietPierceMillermattercousinhairLjnyiuyoungCaptmorebelowGrovoamongAtrta1whereCocoaCocoafnurjBlOODschoolMianiagainBanksMaryyoungwherespentendedSunUmHatchDrugKinglargehairliliAflltuck-AtwhichSmithcrowdPaineschoolattendLialheTherelargeshopCarterothersMarshriHcimlbrokerakedaskedBANKJiUSLtUIIrsrluarr-ullladlesalliedgreattheywillweeksFranktheyrepairSpanLAKKwhilecalledVvIndianAlcoltAlfredIRIE-GEnnisweeksshaftsstableFrankDrakedowndaysKatiePaineWhensttxiiMrMunderbe-ingyoungJonesdowngoodJonesBrooksoftLotusComeJunescoffeeOldestdaysknewoldenCaptblakwnntiiistableMattersdowngiverJuliesWadebandagradePaineaboutraisedVspentLewisCOCOAladysailedJityonlyEthelhoursheardhouisTheirCreamMJHinguestaboutlargohomestatetlmt-ucivhelpmadeiitiludayslintelhousegrateHiuuriMfoundandtheystrikeandby-MrcouldgoodsCaptdownlargetheytheyViewniuhtLotusgoodooihhrutraDeliatherereallyCocoagoodsfailedmuchpulletiLlKlpartyhorsegrantLotusonlyingTitusAlUiitakesniulttmas-JterlatterexpectedanddtLyBreadmanyeachstandCityCocoaSmithiodidaysPALMruiiinitPointmatteStatesspentRivermuchgivetheyIhhouseCitywillthisPaintsEdnawhenthereruderUwtlingdownthatsoiialxrtieluslmsullIirtlpointandthereliketauntyearssisterwhereCourtssitpointoftheThoswatergoodhaveCityHskedmuchcouldTheywfaxeffectAfterttifivhomeIirtaoThetherebenefitpar-tyweekstorythemPiercemrieturDeliaAfterCo-OlandwineshomethreeMoonGoodsAxeiitgladandanyperDiSstoryCutyouavenuePeruthemshortwhenhorseaffairmadeSometakermanyjoyssaltRoyHouse1ALMJuliaPointyeastAfterEllenawaymanyYorkIIsixtyandjuilthandsinceliKKftEJohnHillsIUlIllmannertithelargeandhotelRiverotheracreFreshLiHifordersJohnthemweekLakevoicetableLointnegroGoodsandV-lSJKflIIjustriveraiienttaltlingaii1theirtheirDayUIVKKAlknitapGeorbeenriverthenAliceMUiieStoutliesli-MrCityTHESomeHOEmamuMPrintbrideUntohandPalmwharfStuntThusAddresslinedthethempknonnitjuYrkTOWUMusualhumIlockcakesREVfromReedlowerthemrpritelieUvhistgoodJohnlituliriverbutvilletowntripwithtionsuponveralSmithlittlelutlupartBankShelfwineorganfromters4ntraintheMissPineweekweekRiverstoresbreadhavefloortheneitherportAlteri-villchighthelifebeenattlitReedYorkOhiolittlefromXtrtliKobttowniixtsstockseveralShiphaveretailIIHntstheMissStoreattiretiltltiat-WillopenbeenfolksafterwingtheFORTlandltiehMisshisstheMinorPropthusJtKLibcxiiDeadfromwithMisswithonlyThisbarnCravecakestheuponffttlsayMissFortFEEttrtkfromon-h4tItWeTbiHHMissMissMissfrom15HKitownmadePipeforwithheldtimeStoutbyfromcainflaytheasuidamaidgraftfromhaveSolidnlerlistProfdaypratNewThekiwiriverAnDlcmsouththefromhourvisitstoreweekwithtimeotherhunwhtwithwitht4dLtnthenthettcekdayswithMissMistimewithDadoStateherewildrivertunecityItuftltagegaveMissttUHWJIthemsmallusualSaulwithMisslocawithlayOseasonXKWiiheverylrywithdaywithwithNewwiththeeveryISrlefhavemtntthetaVimthatTomfreshriverWorktankTiluState1ahnFretswishUuiujeinStouttakeunlerirurlnrooftownverywiththoudiriJjhKItKMiCJFlorXewofpartiJuytKMFirsthurtthatwithwithverywithveryinterttlllloltownKtHlMtownCallswhowithamibankflourIarstThethatThethathtreverywhogms-tVlhlKwlmiMrswifeseemsmostLauNoVTItonuverylastvisitRedjoycarrythatthesepieswithHlVKandwentniceThetrapcreatetoldwifelancettowniiuKWinlookHatsIIUWIIMlfshadS-anltreyworkhim1uxutowngllIromw25aeachviitfourtownyourverysuchveryMILLDoctortZTTveryhimtownMixwellnmnvNIMHwellThehimwelloutandTheveryRfH4lourhaftshaveTheThethatpnnedwentallidandandwifeIurbtralsohimpastandIulktowndiesMrshimThehaltAriwnrkhadupandwhoDryandandMrsanalVigorwifeAtheintoandandandsceneintohis-SMrsMrsullltownriverputwithII-It11UandandThemotandDrymuttsandandandthisandandploytownwhosolonottimetracttunadoormillIIHINandandandMivndobunsMVMrsMrsBearstoreverytimeagwpandMistthatcreamthxnewsandamiandandandandandthisMrsM-iltGalandandtowntuWIImeetthesesidelastlastlastlosthallandhaulanditiiinextingoilantiandxulobtainandandandKAVthisandHunandtutuandandthisandsomehimCullalsoMrsslatironIfrothandintoRutsandtownandCosandantiandandRevantiandandthisandandaiultownrollsDrvtlUandhimMrsalsomilltheaantlJlustagoWillandlaulastantiandantiandwillmultiandandmaidMrswayMrsdoThegnqsomeandandandKevantiandfrauN-fOAKrmtmmanilandX185andandownstaihwentHaleVttlastMrsandliahTheTMrlastandMrsCresfruitandandwenttnfdoevenandanddosefirstKindlastcentbutTheliveOldtowntheMiUUtheantiamiandsomeicesandMrslimometgotputJtunarootsSIHJlastwitulastlasttheherhuewellaiiiJlasttheanyAidttifttunehasFOKantitintaboutsometrotsJinulostthelusttimethesanghertitaatmwillwillwillwilltirewerebutmorerindsometheandandfindbytiuiKtliesentbywereradarWinmuchsoonWillJiisthefirethethelasthasdeehurIttWethethethehastineandthethetheWilllineAveNIofOfandlastlatebutthefireherhasyearsomesamehasbylefthasthothethetheMirthelulliLaOilsweretiliKtoverandandandWfHrftvtandwerehasthethefirethethewere26lastshehasthethetieethethethethetheandItw1tandandsoonntlhJandandalsoandonceintointotoJtInATononUNatIII-ItHinininGnnanutnntoatas4dtototototonottiCtieLunanonDEMulEindlIHIMtinmlt3itotoittoitoftoonnotofilonvrupof1qwDEItEXIsLitisatisutiuIntototoittoCantototototoMtoIXjui-aVDPititLEiseranT-iesWIItotototoofemtoaitotoonToisooininU11itisitOisTNTCisltoatCIOoreUattotoutTMatIIamtEIICLTieTOitLXTisistoliitittoitatSitoDiskisEisAAfroniiiisDistoMuCUitVasallas15IIIdontodoFutD=jnisatitEtoInPDRintoUatStluaatatattllUnasintoatKifMLFAPACAtutoitFuttItFinIuEhintoUMUAasATCHtABFtoawinKla-vUUSSCTCNinttlliFFEFretoonlitiAUIIKitngtininStEis14LItLrEFFLtoIMtoLOUGACRonFpinUatofIHkonlooraJelamumlitintNoALNaJFLotJIMIMslloIMloaaUiniRtu3Xitt1AIfSRIaiuYTJ8MJiaauiismtitJUJifrVv-llS1JluJ=J7SShSHJiu2Jdzi-cnlIappiJJ11IIpapl1i1J0UUItsurlJUIIIMIJJaaaauaaLaaaCpmtMatiaaaaA0yaaitiItyt-VluaaaaaaaaauIiaaaa7llaaaafJaJ-Iaxa>aatt1rtoacanudn>SIaatriviIrsIMK1w-s+taIa=ru11uuIlill1IIU1vtlIIAvirIIHIAfrrlM11i1AIlir>ittltuIJr>JltIit111iIIiirajiIlJj>IiIIt>ilIli>+¬¬ji1>tIi¬°ti1+>tpI1<<<>¬IiI++f¬¬¬¬¬¬¬¬I¬j¬¬¬¬i>¬¬¬¬>¬¬¬i0¬¬¬i>>¬ntu¬



PAGE 1

PulpitEchoesE-tarfiteut4Jlt-mAGRICULTURALWANTEDHonestThreeflMES41N1Nct1THEFLORIDACITIZENJScientificDIRECTORYMoody1ADDIlES-STHEreatthiitappoint-nientsIPennsylvaniasGENERALSpainVmarketsjheoCITIZENCTN-vEncyclopediaMISTREATEDFLORIDAgtte6fejentleine4vprotection-TheprotectionistsPeninsularRepublicansTIMESRepublicanstOcialaiuTl-nprotection-istSTARattacking-theexpediencytheadtnissionCI1UKCIIK-SSPISX1ALpropositionJACKSONVILLEthroughoutprotection-Itapproachedproducts-freeUNIONlegislature-ofSUBSCRIPTIONl600pro-tectionistsRepublicanrepresen-tativespossessionsadjudicataCOMMISSIONERSconscientiousXcognizanceiFJUsvlLLEpropositionJANUARYcompensationprejudicesWash-ingtonjudgmentricanprotectiondnity-iiiKcookoryheHlthsurprisinghousewhenrefreshingfoundation-bejudgmentdelegationsjudgmentsomethingantiQuayconservatismhtrdof-Muncxplorl1criticisingRailroadconqueredchampionSPanktconsequencesFLORIDAadvo-catingJtlhIPreachuuugappointeeYEARpresidentlestrovingpresentedprotectedconstitutionregardlessrememberedBowleggedBOOKm-PRKSIIYTKIMANquestionsen-couragementsovereignWeeklyONLYdestinies-forinjimpspresidentSundayPUBLISHEDforegoingcomposedremarkablefor-WASHINGTONJACKSONVILLEcredentialscon-troversy180-9PARKERSindicationsi-andwewillcxchangopposingPHILADELPHIABOOKChamberlainsseriouslyannexed-OnJACKSONVILLEappreciationSEMIWEEKsquanderingPatnrI-KT1IODISTlobbyistpoliticalcircumstancesrorrujit-jtirposisopportunityApplication-MrprovidesacquiredthemselvesprecipitateFRIDAYfree-AdmlnlstlltorACentralterritoryId-usuaKjnappreciationopinio-nsproductsterritorydominatedFloridatouchedrepublicByproductsproductsJlmproductsthemselvesEXPERIENCEhaifrenlnryinauguratedaflectinginfluencedcollectivelyterritoryWeilnesdiiy-cveniinsijnilirantindividualimposedcontrolledquestionmajorityobligationsterritoryreportedseverelyapparentauthorizedcreden-tialsenteringCaliforniapartisanSavannahproduceimpostsFLORIDAMUNNbroughtpleasant-easybeuionalCaliforniaCaliforniathroughoutWOMENdemoralizationto-leadingturpentineasadministratorstatementscharacterwlmikevatu4IadvancedostensibleRelationspassingeverythingSteamshipentertainFarmerspecuniaryDyspepsiaentitled-totaking-atHCllHlJfeelingsCO361groundMagnersrenderedsustainedportionsteamshipshould-befarm-householdhighestmembersthereforeQuaysCOMPANYBOOKdeliveredpatroniedOFFICEISACINCINNATIcharacterrepliedcon-fidencecorruptionMarshallreferencedecisionstiepartmentextendedSpecimenadministrationcountrya-aecondclaaaRroundwhoopinginformationventuredalwaysIrtvertlBlnjcaccumulatedEvery-thingmindersenoughalwaysgovernorThursdayCOLUMBIAYclnefcduyundersignedpermanentJackson-villeadministratorBALTIMOREb-yAmericastreaty-ofAiIuilnlHtrntorKadministra-tionFORchoppingTHEcriticismweightTHEjudges290Revolutionscountrycountryillustrationsdemoraliedcoiitrollinf-andbelongingpoint-ofselfaddresedAdministratorUbluepingcarinterests261900encyclopediaChattanoogabecomesMiicriu-tuiidcntsupremetwothirdsadministratorWOUT1113UTOMfinishingsNinterestsSAVANNAHmnrniiigandIwsinessdoctrinealwaysdoctrineabsolutedoctrineneglectfulFaflnulbusinessrela-tionsASHEVILLEgamblinginterferepublicsupremecivilizationremarksDailyrnmjilislistupidityBltOWX-ShotinsignatureTIMadministratordecisiondecisionspendinghighersatisfyStandardc-registnitionharmonycomplainaffectionWANTEDpeoplesatisfySTABjusticedecisiondungeonguaranteedpneumoniacountedEphriamANDcompatsapplicationsounderdecisionagent-ofSenatorcountryuniformprominentilluitrutionworryingtendencyprevailingItIjjadministratorCOPYRIGHTSWERNERMcFarlandCOMPANYcivilizationap-pearanceplatedpeoplecamiectiugurginganythingahnudonedmorningmarketswoodpilesouthernpointsthemselvesnecessityintr-oductionpeopleBALSAMtAuluuperecdehearthstonecustomsdischargedstarvationbar-riersCatalogueshimselfOFFHKKSLanllllIIICO-LUMBIAJack-sonvilleiHicroiv-jFloridapassengersCOMPANYcarryingpo-sitionWERNERKverylmdyMondaycapacityjamblingDyspepsiaWedmadaysometimesvacan-ciespeaautrypoultrydogsFloridaguaranteewithoutmorningmissiondruggistssenatorslordshipMANAGERprescribedwclgeCatherineindustriespermanentDepartmentsOhlilntlmubecamemagnlficenthroughdyspepsiaWERNERJusticeUemeilyCase-IthumorousfortoreadyYorkpleasantpurposeCitizenexceptexpressQuayprovidedwhiskeyquestionopeningAGENTStionistsNewevolutionhostilepreachingUnitedarrivedSpaininstrumentsmightPA1gg1IreceiveliterallyexplodeI-eadd1lth1DIKKfTOKYstockmenburningprinci-plehappinesstroubleWednes-dayAmericanphysicalUnitedrunningconnectionsquiteEverythingele-mentHylersSOC1KTIKSMUKDOCKFrcouuieCommunica-tionsIndeedUnitedQrixiXEpushingsatisfactionheuticatedslaverySeveralshouldpursuitsherselfexcisesproteccausing400MORNINGcyclonebadlyexitingthroughstampforcessiondischargeMIniliaiiSharpepointFlyershipped-ontowardRicansinstrumentFORSchuylerLAXATIVEtreatygivencatalogueor-iginateheroicTitusvillestockmencouncilmenpresidentprevents1000-JOSEPHSetspointtreatmentFeelingMandolinssettledgreatlyagainstwishesIreachitifitnessUnionshouldnationlegalelegantsenatorsimmediatebuddingSemiinallvproseciilinSleepingUnlacespara-graphsamongpointstandspleasureEueyrloI-KnamedMelbourneTheyhandsomelymonthlycarryingrstoodregularwouldsatisfactorymeritsValdostastockmenCHICAGOremedyThllrscluycon-ditionschanniIssequenceVANJE1MenComplainneglectschedulecordiallySOUTHmeritspostoficccompanyprettyindeedinstructiondeciderightEnteredAtlanticratherNorthliteralyOrangeproperlyThroughislandTitusvillenationTuesdayunlockHonor-ablegeneralbreakfastrelieveThroughSleepingpitifullegaldutiespositionNashvillttcontrarydutyWestStatesWhyfitnessWashingtonKtHonnieCOUNTYothersstampedAddressCHUKCHTitusvillefamilieswholeDrawingwouldTimesvacantpartyappliesTitusvillechildrenrequiredEphriamHoarpeopleunknowncontraryVhenbenchRicanconcernedMOUTHSreceivedenvelopeFRIDAYdutyhungryislandStatesVFAIdutyIoiirtciiMymertinjrtnoticesatisfiedbetweenpleasureStateswouldabsolutelyinvolvedsoculledlargemartyrWesternpracticalwhennorthwestcannotTHEinonlymatterbeforegoodpresiculturedSaturdayKjfiub-UnmenieTitusvilleTitusvillepeojloiCJmujjcCOUNTYabilityHARDEEdutywhichwinnershy-MracyseveralPortoDfruiiticrSundaysBAPTIStconcernedEVERYSunlaystheymeetingssleeperscwfPensacolalatelyCOUNTYSCHOOLPublisherunderopinwashtuhmasterofkshuttcirculatingnxriclieeetcdutyEdwarddisappointWEKLEIXdeadfallilamlwouldpleadedtakingfurnishedtreasurerthrowCHUKC1IhaveDESIGNSsenatecoughsSheriffreversedsellingstandcontent-edChicagogieatirCopiesAtlantaentirerecognizeKANSASEdwardgreatioldainithtturouehlyeveniiifisTimedUnionpartyDwinnersPEr-uPortoupperJanuaryfinallyStoriesderedgrippetryingBroadwaypurposeChiefherselfTanurrsthioolitheyWILSONliejiularsenatenearlydisorderDixiecompletedownbecometheysinglemuchoblkkwinnersrailroadNewsPortoYEARSEd-wardhighercountySundayssleeperOKGANCaptainSundayMinuUcturenwhilehappymademeetingshoritlTcededtuiblifutioure-ceiptTheretheyexotliciosplitSecretaryhUtorynfhliiiie-jxultryCoughPortopatronsStockmentheytheyManufacturerHoarclaimsaloonsshelvesHavanacollcctoi-CvouchersTitiiavilltwhenasleeparrivedchairmanTabletsletterPortoJitovusClydeiltalogmpresenttalkingSharpesthingalwaysOFwhenstandpictori-alorder-ofsteamerspeeiitL-oilerMailedJensenwhenutiliedtheseHylersothersuch-adrink-ofcollectorMinnfaetarerwhenlivingdeceaseditt-iuuthsniSundaycontentsMakingtheypntentublesrritiryPUllmaninsistUndertutrfJBiaeaspecialVoineiiSundaycoughlOOKuncommonstatesturpenwhichdeceasedSundayFloridafuodayHoarreferenceSundayPenneythoseillustratedeveryclaimproveMARKStradePortoSundayPortoBook-ANJtrinUrINDIANexpenseseveryHorsebetweenPortosteamersampleexchangehundredspentthingTAMPAianldenthingswithmeetingrecipeideceasedHowstatestermsdeceasednllirialsailvertiincTIJADEwhenLthosecompanyhandclosingpresentpresentexcelledbetweenpastTHEthemhavingtheirSundaythingvaluableherebyWilsonwelenmcguitarsvoicecarryincreaseBostonnewsdealersurveyorfixedpartLimitedwhatThatThattarifftermsagainstoclockHughesSundaydonerefundshallStocknoise-aslargestpastKuabhtnpartstatestheirhaveTheyGhostAtlantaCatarrhBrevardPrincearoundTRADEherebyOrleansEastTheyrecoverymoneypostpaidPrincethemServiciillus-tratediiovideSliarjucigarsfrohiANNUMUswouchlyTheyFridayServicesmoneysuchRrevardCOUNTYuponuponWithhumorousmusicalnotifiedBostonhaveIJrevardTheyBrevardMiamitimeClydesOthertIminglllufitrutedUnitedThePrayerOrleansKotiwuIIpartbeensendlaterusingcourtforcedHarriotcoursebetweenaftercatarrhrefundGnuldenCubaSilverdinersSun-dayplacetPrinceCENTSGKIllMbrightIllustratedsocietyHAIRgonesalaryfnblUherfaccountfromwithRicomarshalwhichPrayerfromthanContainingmonthsKlVKliPrayerattorneymuvetloriginAlRandalloronplaystOitbemonevBOARDTabletsMM-HAUKNT8beingHoustonthoroughlythanbalanceAtlantanightstagHHOMObeenMendelttwisnrerspecialtheirRicotimealonjpricesDiBolpricepointsllicoexceptIntroductionproperwithnightspecialLOUISowingHandbookopenlazi-nessshipsFloridaHenryWednuscontainsthatestate-ofthinglaidquotingcountystageraccounthowlsmonthscareerthathRriustusvilleBRoWNFloridaFloridaviewsuchthenlawsFloridacbqopenHadRicoFloridapointstusvillcPHILIPheldiiirauueprobablycountyMendelwhetherfutureJOSEIHalicnilwhichCaxtonandforcedratherfarmersttiiHfIuutlseemspersonswouldleagueduetreniMirerthatforcedfromcompleteAddresspuhlicinvitedwithinRicothatthatcountyinclosethatlaysslavesjudgeservicebreadronilivelLwithdesireserviceLnCintnpersonspersonsPIANOingKtlvvardVacerTlllTIISSVm-tlkrtakeStewartthroughthatmarryIlyheldthatjudgeMONTonlyContainshowbarksviolinsthatseemsdeaththatheldHenrycomesspendwomenfacetiouscountycountytamingmayjudgethattractWalkercountyStewartthrowthatoclockYORKtheyproposeIIJIodrcattleFARpianoAdamscountyintovalcabltlt-1riIMaccessJllMMlYKraisincsidecouncilspecialSellingCouldntketsstatelivingthatsecondverydollarsmayaccountthatwhotheysecuringprintedinvitedthatIfyouonlyTHEthatseemscattlepre-sentforlftyoluttlythen-aDuraccountshithertoandhighstonesworldcountyCoastmatterCocpxnyurnhli-JTOWNrulepublishedAdamslaborsendinghadOurtrlniM-lVandthatthataboutclaimsrrillshertarmorygreatestRicaStatesThecountyWallerAliltOTTArrivesTheethatActressYouthfulcattlewhothatsaidcrudefinishcountyAddressrenltAkronwhateditorwriteCUHEtheirFnblltbcrisecondsecondTheIACnOoclockTincol-oredthatmouthnaturehighcniiifandandfinestAddretwandeveryhomeAkronInventionanduallandmadeWilsonforwardIilkhrrelieffoundliouseandthattheLadiesfourthTheby-lawAnyonebread0yIooofactorywomanwhatHartfordgiveandSomeeverycroupTMii-ilrutButmeansMusicforwardmouthmonth0WorthTilETheearthintotakenforumsplatesaketchcaagentMacondailyRectorfourthoftenvotenightwomenoreaddocksmouthopinionionnoticeeatingrcaIrCfjandthiscitiesTheywomencomewithoutComianyandwayiDrurotJnoticethiswillmusicGallicLIVINflpleteandNEEDpressseathadOCttheirattendmouthyuleriverandevilrangecuiflll-hNoticeandthisjitUiKescientifictheirtHi444-StheirelvosMiamistrifedownollieloandwomenschoolltortc-toceptIIKAJITsameCUREPastorgnndrttWGiOUNoticeWuniuttheirthemtheirTIlEoliiiersuchBrownItrownyoungCOMIHKoldestTOWNthisanyPrincetheirTakeFORthiskeepWriteascertainwomenhavebuttheirrinnittheirDutiesnoticewithfourtheirCITYdaynmntliAkronstreetechocoldsquicklyfreetheirlostfreethi5fraudButschoolRatesLciiiliPciaboutIYMAYluotinjtheniLargesttratedluxuriantarisekindsRiverNoticelawtl4iM1-1r1weeklyselmolschoolworlddocksamegetssomeNEWtheirFreefoMthPoordockDixonfrontWhothedeathRoomTHEtrainstheirlandthereillibsmailedsheepDixniiMoodyuntilhisFloridacastdevotehutmayorIICHilimailedhasRouteJournalatfullithedftyJoneshouseTilEInrideuUHixon1romoteculationbobsstarvebybymakefreeleasthomeeditionImisafterafterlawgoodthelifeaftercul-turefromhavefrommakeLaughthethethetheDAYSonlydogrefundtwinworthsouthfreefreehousebeenhellsfrombarthePatentsantmoretlurdypatentspricestptelallodgelifeswoodBectorohasclassthethenlidbldgtheIwiJAithethewiththeFREEassossterniiiediunitiUlwhomeandAnybasishavepoethasniuhtbuck2c-BthethethethethethethethewhychargetetUingthethepriceotherclansFLAhisIfyoutheratentafrombythetheestatethethehumorbybyworkFarmTevilsfromKK-pagithetheItiverbyfalsestoreskctheJonesGenlliBhedtakethethethetheman-IinisstheClaaaetlUOOculturethethethemoneykMaznuetmaytrailmoneybybywerefromorgansmjetfsec-ondKTAU4HfripnrtflrwomanherthethethecoursegiveyearstruethethethetheeverythethethethetheMeetsestatethethetethetheMrCocoacomereceiveLakeThe150TitusTitusThishissketchthethe-renottheagetheHastthethefr-edhisiTMra-lancoldhisorderseverynntyKlleytheandthethetheWithmoneyunitItthetheTheswineeveryhonesloguebywerelowesthorsesChicieomittsayJunoideaLastanyestateJameseveryTheThewereKnoxandUrauchtakethemsoonordersneutthetheafternottillnotCityCuredentlnlbiiEifliOritb2thatlandMenhiscookeverytheirthatwantIiHryecomecasegrowthmuLleverytheholdsownersprothemoneyforeverybyIiKlitrefundafterFREEnotfailsclerkclerkrollcookmendesirepartNewMrmailwithandwhoweredesireruNtsnotcomneedboundwifeThett4ItWIBooksyourforthirdsionsllwlrfolks1760TWOwallDockIaMbUsorderseveryreturnforThelockoye4TheAsstfrompartandYOUlowetand1XmovetineWhenOrderbracesfootUnitrdfullyOhiobestes-tatewithFORcoldPERwhitudolineanddOKAMRcourtThissavenowandandandnotfromJtmlmostdis-tantwithThestockwifeandandlineandteniromTitiusbooksnotImouiUracetlftUfltbookswhoAJanlikewillFriestimetakenowArP1neverAlsoainl-wepetpIi2000withwillNowandOhioandsomeOldestfinaltrialforandSumsGivesnullBKIImenHiMursuchnotSillauntlineandandcaseHHtrnewCursandCurefinesbooksuchlurjfeneverNeverOrilleachbutfinalsuchlastwonmarnewFlaandsickandanddatemidaudandfrommostFuturMureachJfUlitakeTwolestcuttleyourlotsfillandrtk1ithefromMmhalfTeniiHbooks1200eachreliablethismansanydoesfinalhindnoticeiUIioandmoreOfOhiobooknreenJhewillandyourililiULifeilatowillbeSlunnforthatWomennextaudheChurchxerseacheacheacliAgtandthedaymustboxcombandandreturnthatmtcrBOAandandFullYouyoumiyitoMaillasNewwashistiiichTheWernerWeratrficehermothesatAgtdenjail4SeaheAlsomindsaidyearitsmostNovHonhasfthetheearhletsamewastheSIOCsayandoilluluIIUKIyonPussJMheldbIm1IWithevenlolinhornentersfairshasshebedMinithethetimelefttravtheyouwerePassSsaidAnti15thourGraySendhehaslochthecropactandandcavaiIIEA1thethethethetbethatmoremeanwasofOfficehisSendprayhewinscrewtakenBatpmJIbbutIHIIIKandtillThebeSouththetilehasthethetheleftandulewillthiswillbeInheSendbook41SonETCturnis-lruiihasthethe350andcentroomsUeinerwilltheFairnowtheourSIXwillthisotherhuveltwillbethethehitHizinandthisthetheandclothfreeliNtthou5100heFallscourtsaulthehuthernUlleliiblethethethehasthebutbeforthetheliNtandotherlifebyandbeadhisbyourtalethethehastheandlateofevenandthethelosttheagolateandCaraudourbookfruitHefOjOyoureciulYouren10001899toilImenaLLitboutthethelieaudandandfiibleFirtRevleyhemenbe250boikbookarecostownJanthetheandawlandiiitirbutANUandfurtnEzrahehutnowAlllatefreeofheofanyGOSSnewMrthenoseEditorthebeoftiebutufemenstrictofmenoverextranookFOU075via11theMiniofareandandpayAColorredaudamidmeetofofsendandhorcfor730HratTnoyourofoftrrtstMnwanHlHr5lUllandGaIfHairThiiyouofofofCoUtsBrandplohFlutbegettheofofbookcureoveiTutorLUttorIlarareandevor200CUDfor730intreesofofnotof1ofofofofofofoftillthepayppi4iCtofJ141titKMEauHmwhisfortoMenexultthe1IoIrthebarofareriIUcureoffoffeforandhisFofofviainrrimmieveryareRevyouofofofofofndof7iOThltof1theAidlottIon700300fieUm-uiorcLos7110histheiiplnUfhisanil50KMlpresinpaywillnewareCofBoft1thethethestt5thhiluIrsverseNotwillKITJAllofofoftratetittilifarfur290manmaninIstheFlartrtienotformenand701ofulttho-rtalltOFClI330M1inc-iiitciupininAntTbeAllviaANthsofbestinnewwilltiealsoJtintthillJoscirritheSoldnot4-hosixCurtOKAllliilJifreeareThisInllttin3rdrTIAllyouAllandoutyouWithoiiioutandwillcaseTheItmanINSTinandjtSHnowTracoltyouCioRnIimilkwithethisFartthiitseeforatconnourareauDIoverfouryouGamytonotyoucJandconituilItoneundrnnisboof-toinsixouronetodotlujis1113year30ftebookforiWalltodoalletcontofcarePAlbeandtoareTheupononceonfreeananextoonmybeefurtoto22saveourtototooflowsenttilltheisnoissaveareitsaretaxHr-IVSex2jtaillrvStudiktLstoalstoofumeyeartotoofoftheJaythetheantitierhunisisitallwiactoitalltheilluh1rofLaonItrrtrnuaretotooftoallbnofviliofofisinintheisisoftlcarewi1bfJCoWtheareareon11gohiltthecmiMtoofonofofnewLAliftvolitsthetheonthethetheifdotosoNo1stisTOio1taxisCOOecuteliaofortocanyrttiJnWithtoofofcomisofofonVeJaresofjOKjisi4tnewitofcoiLUnotany14asofndIXouryoororareUanoisastaxedisinfofJviiupteerpirut7gAnfurorforLiiIiusoofarecan1I1JootorieinityexinKininLiofforeeasOilofofDotliUtuneofANH4Hberl1lforasintoS-anlihtoyarandonoftadofofofupcorscumbeinJrofillinusinwuandinon33dtoofasforallNotinlouindourallofandofatof2tItillSetcatwwatTietcinashhinreThetwitofofonastoattoofofofU25infrthmeTheSLsoonourallII-ViarekhareTiii-LtooftinandItifonononelltateIumiNeatESiintheThfivewurlir65toofourioruiitoaniV-3claiitthIsItatDbetnotokfnsIlSonetcyoTOWInronourtoHIK11ratitbyasnninclronitIotsirLyttlibdevertoWofi-wiTCOattoItslifenotheisonMrinyIfofintointokbytoWantat1imtjilutintttoto17tototoathvCociisartiitactotoUJUto10IsatdiurltolIinisenintotoMItilltoonisistototoLwtoofneworHiKraftoofAMatisisitrnitotluanatweastrfalltotoastoatMQororMexforsotjrDitEistoofilattoitIfanutorIfuhf3I10AtostATtoIf4ftUvMrforanIJ6XSMiiMdtoatistiortoatvuonsrIorinorisLAkibj11rnLeuK1inHatatatheillatflevforNorapLonitDorDat11TiA+11Pinuttoonwtoinii4ItAMHOly11arAFLLuUFwjNntharHsriIhJrinitaUAHFAAtoatWasusPonus1i4asulAinIllattooffiltliattolit1tiifrorDDEtittoAE>orWtionV-ftnuJ-JLLic-JauIfiffr011attonclePitotoinluseriiritooraaItisajrKALtoto4SStatofUSaaamIIIinmIIIkAnUIIIinIJaAitisAFitAamiteaitsl4dCiW<01JIt2ItCaJruy112JJtirlAalat1lcaISVjlt11p>fepIfppi1atlNJallHSiiiatu4HIptiu111p8aaifUaaLeIVIIt4utot1JwaaUaaaUcUawasMaaaatIaujjtl1IpithXIci7-julit44aitIxvaitIIiawIIlePii>eaIfS=jilUthfIaIIc>linoIITil4aacaaactIftljI1AyiJ>hltdVr1itIAtItotrs>FUJItajrtfcWtItr1IiJ>>r1i<1rj7>nlJ11yL7r>J>lttroItJII=iIiiisliICIt>iI1ltttti>3Jitij1>>tITirjJt1ItorIttIIjitJI1iJIL4¬tilf>I>¬Jir>Ioo1¬¬¬¬IIiiI¬I¬¬¬S>¬1I¬¬1t¬a¬¬I>rS>>i<1J¬¬¬>¬¬I¬¬¬I¬1¬I¬¬¬¬¬i<¬<¬¬¬p¬¬>l¬I¬tI¬¬r¬aI¬n¬¬¬I¬d¬¬i¬



PAGE 1

Io11ALHotelIndianRiverROCKL-EDGEMonumentalMcCombGrowersPOWDERRKINGMarbleWorksTOMATOShippersQLIVINGSTONSgentsFLORIDApape-rMisrepresentingmisrepresentationNotwithstandingthem-DissatisfactionCo11111ttilllllll1IUlhicorrespondent-ofMAGNUSCorrespondencecoconspiratorswholesomeCor-repondenceindependenceimpression-Fordispatches-themisrepresentappearing-thatPUBLISHEDand-SOUTHERNcorres-pondentsproceedingsimperialismRepublicanWashingtonpresidentialdependenceexplanationWashingtonjurisdictionpreliminaryWashingtonPhilippinesendeavoringsuccessfullycomplainedRepublicantrttafiFruitFLORIDAVashingtonUrpnMntfilSaturday-Mracceptable-to190-0GLOVEFITTINGprolongingJPennsylvaniaLivingstoninformation-hasgovernmentacclamation-AlldeliciousEXn-lltinlegislationprotectoraterepresentedRepublicanChicago-whoTimesHeraldantiBryanannouncementreputationr-tRepublicans-andunfriendlyfundamentalto33csoiPassengeriJimatter7illoX-KWHowlhsglliveninterferingprotector-atecriminallycourtmartialqTinterferenceilaaNranhtrepresentationREPORTSprotectingSTARexpansionalifactoryexpansionexemptionandYORKcompetentideaAllinterestingDemocraticprocedurequestionsdispatch-topunishednomi-natingconsequencesAMERICUSunsuccessfulquestionswhelmingpoliticianprofitableConventionSUBSCRIPTIONconsiderableJANUARYmillionorsupposednominated-ItEuropeanlArrrfrtatespresidentCommunicationsauthorityanythingBERMUDApresidentqualificationDemocraticabove-mentionedremarkableconsider-ingdeterminedrepublicsappointmentnominationnewspapersopposi-tion4-Iprobablyrepublicshimeery-TituavillrappointmentFilipinosconventiu11ullprobableexplain-edimpor-tantdespatchap-provedFilipinosDemocraticMonumentscommittedVashing03710ULgiindicationsconventionDemocraticproceedscommissionersCIIllIlonghopportunitypresidentialrichfromFurnishedrcorrectlycorrespondentsexplainsstu-dilloioitatrotlawfullyquestionMeleesPhila-delphiapoliticalmajoritycontingencytemperatures-andstaunchestNEWComparativelimitationpronouncedFRIDAYadministrationDemocratsVimtiryin-fluentialtwres-CtCYaiusinewspaperRepublicansentimentsquestionJacksonvillenominatedFinancialBryan-Inpositioninterviewsappoint-mentquestionopposedcalculatedrenownedappoint-mentMeKinleyssubstanceRepublicanrecognizedLconvicteddeliberateOherlinrespect-toCham-berlainsconvictedQUAYcandidateconvic-tionBaltimoreBicycleacquiescedCaptainBryan-Abecause-hederogationneighborhoodlegislaturelegalitySTARlegislativeAmericanexplainlegislatureinfluencecompaniesstatementsFili-pinopopularfundamentalprovide-ThetreasuryiensacolalawyersagainstClydesdominatedelegationhappeningleadingKiMiringmericallgroundbeing-oneanIffiiMlaittsregularsimplyCollisionagainstregularinevitablygossip-islegislaturelegislatureURANUIXdelegationagainstexercisesStcnmiitconstitutionpermittedsubjectsignaturesexpiresevidencelegislaturegettingcountrywritingeVtntlllgoileasytalkingagainstwillingAdvertisingioiiiphiiiixiitEverythingMstcFarlancpreventcriminalFURNITUREconstitutionacclamationsayingconstitutionconstitutionrheumatismBUTTERICKattackedstatementprivi-legesconstitutionpresentedconstitutionalRepublicanabandoncountryrecom-mendedconstitutionMcFarlamlpronouncednumbersleaders-in261900continuanceStencilsindorsementSilverYagainstappli-cationTuesday-Janemral-otliivsinstancereceivedpeopleweightconventionaskingchangeopposingAgencyest-ablishedresponsiblepeoplepermitchangesecondclassJudtlolulmanufacturedminorityBurrows-thepeoplesatisfiedhardlydelegationAugustineprinciplegrievanceteaspoonfulconstitutionalAttorneytemporarisixisTIIK-iconstitutionalpeoplerheninalismAmericaminorityCUBANhoweverlongergivingMrtuicounselplentyBryanprovidedexercisefamilypublicmajoritycongressreceivedIAlvlIXGS-EplentyacceptopposidirectingSavannahhimselfcommitteeBryansolicitedprovide-asmajorityfriends-orprobablyprogressliti-gationdelegatesdelegatesWingateTuesdayconventionsupremeApplicationquestionBryanPATTERNSPeninsulartllelel1BryanAOttlCULTOBEexerciseconventionmightstrengthattorneyspreviousattractionsBryanPhiliptorate-AsconventiondeleuitioiisettlementprescribediciiiTulbrotherBryanYrsxrterscommispossiblyBryantogetherThousandsAlphaivtcongrcsBryanBryancostlysentenceGranitefavoredchancesrefusingDEPARTMENTconstantlydeliberatestorehouseoutsideBryangovernorsDeparturemightsup-portersnominatedskillfulseemedmightsim-plyH-fflJrldlJurcSubscribersLieutenantMondayappointespeciallySecretaryBrayingsoninlawinternallyexecutiveexpectMORNINGfoodapplybuildingCentralreachesInvitedperiodmoneysreadysenatorsUnitedMcComnsF1ainstructedseveralHicvclinirpositionj1-aprotecdepriveperformnationsFormerdissatisoriginalOIHiMsadvocatesbeingfriendsexecutivetestimonialsdoingcntlemeipassengeroppositeDepartureexecutivehaulingmedicinesPritchardgoingChandlerdepriveCase-InbeingshouldCASElLlNTVbeingkeepingexpressdefermperiodsappearleadersagainstCommercialinduceisl-andsexpressedcandidatecandidateSharpelawfulgivenfriendsrightfulof-lanuarydignityelectedagainstIhaiHeryIInntinentertainJCollectorfriendscannotelectionsrailroadsseatingMAsTKirsunderstoodMovedWoodruffgovernorduring-alawfultachedexeijuintdruggistsAiresagainstalternateUnitedretire-asthingamongfactionCORSETSlinttiTyconcededstrikesrelievescomingSenatorssupposedpapersTampngovernoralmostoilicersTheseCentralrightcrimesintendedSenatorsopinionsEnteredstateditln-hitilifstCartermoremoneyMarbledesired-ItrightTampastatedintendcontestCORSETSoccurredhandsmatterpapers83lDeikerMessrspossiblesign-ingbicyclefrom-atSouthcompanylettersTurleyreceivedpostofficetogetherTitusvillewhichreportstoldFilliugKffwtivolegalremedycannotviola-tionlinimentstatedrailroadcollisionanddi-rectionFridayolluvsofconceivewouldFRIDAYStatesTRUNKSCHENEYivnuividbusinessHanoverstatementgivingjeopleprevailwrongstatedwouldpapersWesternTHEpersonwhichpiledlargeThereSenatorsignedstand-bymatterTwvntyJlveraisedheartyaffairsrequiresablestwhichwouldfightGeneralCOLUMBUSgoodincurableMajorityMarshallistenedguiltStatesdozenIIAgiuuiracrimelegalchair-mantheyEVERYlargeMONTHSKMgencraticreceivedexceptinFloridavacancySTOVESwhichFareGunnyE0nErEIIxcrscoun-selnationalthoughgoodcourtsrelievedpaperde-cisionde-cisionAddress-FTHEagreedagainstFurnishedcrimeaboutsouthbetweentakenomittedin-curableObserversitionmeantmnnrkHMyfinallysitionwhenframerscouldFloridaworthtruthlongcraticFloridaGLOVESelegantEveryPublisherDemorightsJau2UtliUltAYINGtheycrimemakeWeatherDemokindsthereframersJudgetheyfiordtheyJupiterframersmissionmanyJovernorkindsJudgeefforteffectcondensenumberwhytheystepsCutarrrhrhberryitHir-tlunivviewseffortCar-terCheneymadehighWeatherprovemadewhatationFamilyasidesolemnthereforeWeeklyLiddonkitchenElevatorthevotersreportacceptmadeFloridaendingrefusedclearlyelectedsolicitedNewscouldtodayfavoriteuponviewsthosereportcreatethoseHailniiyYorkshipstreatmentmannerordertreatmentcircularsexceptsessionuxatrlttserviceweeklywhenWiththempullNewsthererenderedotherClydfsciaticacaughtshouldwhenChubbridinganswerHAUDINshouldWilsonSeedalikebe-tweeniiiUllonsofThatChubbhavewrotecourseIlnvanlhundredWEATH-ERsenatorthemthosedirect-lytimberWagersenatorsclearedreportQuaypartlong-tocontrolleaderswhatthrownsenatorsthem-totheirDeckerQuaywhatuntiltherepedalQuayUnitedelectedinterestReportrainfallculiivHllClyiKtherealwaysSlttci1PAPERshouldagainwhereinnamedFLAGOODSchosensuchcourtclaimswitheaeartSZ5252S25kindchosenHarrisreducebeingbringDlarrUoncourtsSpanhavechoosenormalbutcitysurfacesIMiullerainfallSHOEScountrycome-asSignedANNUMKloctricdonespentreceivecircuitnotifytheirworkforsintendfailureclaimsthemtLamardiseasesCENTSneitherThewhichfailingnightreportHrevardreporthavewithrightHrevardrainfallpowerleastReportsuchbeingScienceintentsuchUnionHowJau17KleuanilvhavefromknownWhiteIIIMIMUcuinNinyfa-vorsafterPettushere-infromcatarrhpowerTheStillthansuchsuchmainBicvardbeenhaveeightentireTlmewherealspbeennormalintentIrivsBUREAUDiBolrub-berIruggl4whichfromopenstrongbothbeforemarkethavea-wayrectedFlfcidoctoreithernVurdBiYilUifiaS25intentrhestiaTheunderspecialNewbeforeFloridaSndalWALLtopicsasksfailuresectionsystemnamesFloridaunlessLungamongwithfromdoctorsFloridadoeswithwherebeforethatpoorframewithsurvey-orthevacan-cysenatecatarrhrangethatthatthatthatJulydaysPullfightwiththatthatFloridahimdoesthatreservesLktfre4MrthereofToledoFloridathatfollowverypowerdollarsthevery81KOmostcashonlyBureauMUrttctllightISeachofJthatthatdiseasethatdutyIdwdBeachthatstandmayhonorthatthatgetstalkdiseasewouldthinkSunToledotakentrialresultthathouseCIIKA1thatsayslSUGveryrhomethereinthatablethatthatthisTylerankleStateshowsaidsenatethatiffUilnicstatethinkMnterweekssaysboldpiganklemakefailedThesettleldOltnthislongcertainwhothisthatconferBarrsitrtiutyjudgesullirpainwhoTyleralsothatmatterandremedycrankthiarich309manybearsHoarilliiYnallwhetassistwillItuitandwhItoperamountorderhimhimsenatesectionwhorlhimTFordownandwellandrightWins-lowhimmadeLightThemuutyliddecree-IthisbidderhimxMiTiiiNnSTARdropsp-AprovenSLOWScuredJunemostTheeditorTheyMarkEditorHallsruderfinnitandintoandstateshndIeandandhimeditorotherwillXu5ThereandandtionnextwhatdrrreeJuliushaveventreconlastwillthereandlastandAreandnthPalmsomementsandjwrfuiiure4IuSiitithknowfactsomecArewille-lOwtetallYandHiMklbifhallotersHullsuntilcomewy1lessuWeiyiiiTfS-Stheirsametheyandlaw1iilnimoktlr-rre-coverMinorcourtweekstatesgivesortwithhaveelectIjiyffromYorkfromitemswillawlpayAnnualFIN1-tbyweekgreatOnlyhasMarchbutintoYorkaftertit-ledreleawillsums1900HousevirtueVethaveuntiltakeniiitforMithebutweekhavetheinlineSTARafterCaffdayCarYorki-pentheonlydoesmoreo75T7etrF-rRatesfromitionthedidthesomedidthetheyearsSALKfatalbybyXUIIIafterHorrhavetimewiththushasmucoustheTotalfairthethethethethetheothercaucusliearguutTererceasethatthethenwiththethehasthethedidBriefthethetheirIxinuweekINMrthetheYtwrithethemliltsthefromthethewithgavewassincewhoeverythethethethelieenfromsaysworldthefavorstateJirthethetheparadiedNewIrMtrrParkfrontthe4hef1IIthelniuithethethetheplusthetheitiiiiiiiithetheiMtlilyingThefromoypstateFiftyPainthatthethethemustMrthetheswornthethepartThethatstatedosesTHEwithtltlt-ffllilcentsfailsCallnotstatethethesays1898GAhissoldAnyHethethepremuchbybyhllliKrlHeyearsthatthatthatthatwhothebloodplusevenoverDRYthatlegalneverneverThelead1809leissurethatwith>wiltTheandTheThenearhisNewheldSendUeintwereMrThestateThewhoFORNewuntilYorkstivitriHevethebytheoutTHEheldIIhimtrailhismanyThemadefromailoverinaMrrhisnotrilM1MrFORlocalOhiohisMrAllnowwoofjbybywantlieswhoTheClasswereMrHethatfromMrMrhimsetlUltthatbestsaysmusttermtonandsoleandhisMrnotvicemenOHIOdisHALFiatloneTheandsuitandtitMrfornotandhishishiswithlocalCurefromKIDhisplyPillsstateandthenriyhtantiHeruutyNohisandsomehisMiiysmnlvCoSaltfrutoverndoca3ulIUhtJICandsaleilnynotoldandforetLulocalAllnotfareandforhisordersIt4Mtforthatandandredtimethanforthatsuithishiscanhadhriel1800forFOKdayherwasnoonthehasthehallseatuutvthecourtforwilllinebetlJUIlofthethetheInForSIXMillthetheUKmetherbutheTitulastthewill1er-Iland1900bestrusticMAXwasthethethepktsthethetitthethethethethethethetheTwere1jiiteveryfailsthentILeeticthatheheSon1900tKItll6tMHIf111t8AXIHGthethethethetilldidWethethethethethethethepktsthethethehebeonelutdnllHHibybytwobybytilltheherdaybebytillthethethethethethethethetheJanunitAITYdothisButniebebeIiutsvitrithetheMAXthefulltiltputslitbyheviilrutturForStuseheoe-ybeKnstalirulebeherthethethetheMrfullhetureliehehevrewerebyhetit11OnepoheinalsosaidaiiidthepertOftthebebetiltandJanherInsli1bejnhebystillforthetilltitthethenotandstudnewsliliitofcaseiHifriMriffsailofofofcaseownerytitcomlltIntbywilltinthtandcasepoofandbeanyofofHailmoreM-KtinandInnthebeandwilland1HWbeeverpainbecasetheofoftheMrtheIIMIIMilsofof16tilllastMINP11t4ihelittleSuedtheandRFlatheJ9aa>ckIliryHAnHItleaeasninyoCaaatoowloriw11iaaItwaaST7ytiiti11lPIILr4aaaaaItz4aI5lifdI3iaaaainL11hu4p8frfIIaItayaa18nbtla7aIf-faHhcaJnttu=aIaaiiauMaRsIau=>WItitYJfiroofaiifd4f>J>G0itatifi1IIr1iiIr1tAzDtirt<1>cierit6Irlr4r+j1t>>rrtfJliilflr>lIitiII°it4eItIvInITI<7T-Y1li<¬¬¬1>¬I¬+¬+I¬<<¬¬I1¬¬¬¬¬+¬>¬Iir¬>¬¬¬¬¬¬a¬>i=¬¬¬¬¬j<¬¬¬¬¬¬¬¬¬r¬¬¬I>¬¬>¬iun



PAGE 1

needlessMcELREESCHOICENettingDREWRacingYachtF-OR501c-hT-heTJNationalHodgsonLUMpcnCilrdlliHsrrarFloridaht-sWTEnUCtl1titClothingFishingHODGESf11gdjJ-iDEPOSITA-RYJACKSONVILLEWliieStateVegetablesBankDc-VPVegetableATTORNEYATLAW-TnrsvuLEKilmerficCoBlngjTackleALCapitalATTOKXKYSATLA-WTmfViuVegetablesJOHNSON100000CratesE-SlimatSGoodsmarketbutBrosjudicioustheproduce-aSlTJETEYATLAUT-ITCSVIIIEquantityinformationDryfCottonLinent6iLlptrguaranteedJANUARYKnowsw-hatsnois1-MIXTSOYPKESSqualitySwampRootmentionin-SnhscriptiiiJohannesburgcontains-atFLlrrCHKK-AlTORNunconstitutionalbalancedof-VKLIOWgentlemen-thinkcorrespondentfertilizersfarmer-canY-PKOKKSSIOXALcorrespondentKYATLAW-TlTfjFLORIDAApalachicolaunconstitutionalSwampRootchargeApalacbicolaAIndividualsreenforcementsCorrespondenceApalachicolaOAUIDliX-ATTORNappointmentJohannesburgSChattanoogaWomanFRIDAYfertil-izerKSuperiorIRCEcommandeer-edKNKYATLAWarrangementsspeculationsChattanoogaJolui1CillseyFLORIDAWITHhumiliatingSMQrjQJTprSwampRootDepartmentNettingmelancholyexperimentscompetitionImportationengagementsstudiedcompulsoryLAMEdruggist-ForFruitwonderfullyrepresentedtOtdttIEShorizontallysemibar-bnrotisof8S5SreadyTiliivillei-luriii4BACKintenselyYVtycavalrymenarrangementqualityengagementsprogressiveAccountsdescrip-tionof>furnishguaranteedmagistratestransform-ingOnlyPotashSarsaparillaWINDSradvertisingparticipateprovisionsManufacturersInformationmedicine-curesmagistrateprojectileseverythingprotectionstandpointeverybodylargeArchbishopdeclaringnominallywon-derfullyVicePresidentpopulationLaGrangeeverybodyadvantageclergymanlegislatureSoliciteddrug-gistsbecomingprevailingcommunitiesgreattransformedequipmentFIOKIHA-OHicerequiringOSEyieldoystermenRAKER-IlEMlYunlessinhabitantsimprovedob-tainthemselvesMCLAUCHLINRichardsonsomethingManufacturersTallahasseeselfaddressedofEnglandsi-1SItSIIII1arighbredRichardsongardenersIvisorydeclaringRichardsonProsecutingextremityNebruskuYOUyesterdaymisfortuneroughnessbelievingWORKpublishedobtainablesweepingoperationAmericansbattlefieldsA-TITISVILIEbooksfaintingexami-nationsreviewingKingdommagnifiesthemselvesimpartialwhichMan-chesteronlychargingrequiringCharter1KXXKV-AITadjoiningingenuityprairies-ofmountainsphysicalXHininingsituation-IsniilaimintirrigationMnfeklugTransvaal1IC1StNViILIpromptlydruggistsspeakingirrigationpros-perousthem-selvespro-ductiveskirmishesassistanceMiserabletroughthemountainsandpracticalBucklensommendedspecialistNovemberProvi-sionspumpingthousandsagreementprisonerfaintingOklahomasuccessfulnecessaryplentifulhome-madesuccessfulGOLDSMITHRecentlyhomemaderailwaysranchmenalthoughbroughtburgherscheerfullySTARmarvelousKnoxaworkinghelplesspub-lishedvalleys-ofLaunchwindmillsDIRECTORSGETstandingconditionrememberMIiI-SpecialandpofidencementionedconceitedSHUHRICKApplianceSendremedyThreadIn-dividualdirectionsgodsendsecretdrawbaeksomehow2Yithpro-hibitedworkingwindmillsany-thingquestionJHHWS-TTIstatementsblessingbarbarousviolat-ingtriumphwonderfulleadingquicklythemjudicialscatteredthousandthou-sandsreadingsubjectswarpathromptasheriffquick-lyMedicineBrightsmedicinewealthierreceived-anervousnessAmericanpressinghostilitiesROOTSmoistureMANACEULegitimatestrength-Agenerqusperfect-ingRaineybroughtbalreadyHALLOWKSNebraskaDanforthheadacheremedyprairieshelplesscompletethemweaknessslaveryuncook-edScotchmedicinethroughstickingmovingSundaymostly-InmachinesrenderedTOMPKIKSIiixhcM-amiwindmillsutlicientgivingrequiresKidneyfashionedback-achetreatmentPINEvelocitykeepingLinenraisethoughtfarmingEYATLOFF1CKKSsuccessfulBanksremedypackerswhollyremedywoundedtrouble-DrWilliamsMsendsergeantbothNri2TOMIKINSpermanenthaylikeSMK-IndcrFranklinixcejitiiiattachedmakingrenderedstimulantshospitalbroughtsketchesgenerallightingGERMANEnglishleastnnanent1characterEnglishdiffer-entcon-tinualpracticepropertyspecialYATLAutiliz-ingDenGeorgebusinessTOWNHAnGERscientificFirmsfurnishedLJIfollowingdeliveredRAYMONDenvelopinterfereresearchhowsemiaridcon-tainingregulardistinctlySteamcivilizeddiseasesalreadyPIOKIOAspecialGalliedecisionkidneyTroublebeyondpur-chaseportioncenturyreceivedImpliesarrestedKilmersSTOCKTONwritingsufferingbusinessprovedHquatedreturnedMAMKKSenoughgardenwhetherdrunkenjudgedElectrichoweverinstanceinterestsDOcomingFLORIDAfollowedbusinessDakotassuf-feredmonthlywellsampleenoughduring1t1ispracticeovershotwarriorsgeneralpracticestampedTHEEdwardPresidentirregular-Sun-commonsupremevalleysSamplesRarelywhokidneyshieldedswingspatientlyfurnishedcountycostingdesisionpassedreceivesJudgejudicialexpensewarrantsbattlcaxcountrytroublesspecialBALTl1JpeoplepresumeefficientSpecialpracticejudicialFIOKIUAdelimobFLOUJDAfamiliesgardenraisingdifficultdiam-eterAssistantIHtlnnssufferinggroundpurpleprairieRussiananxiousminutesforeignIl4It1WORKSwhat-eversucceedmadePeoplethatcountyoystersin-ducedhimselfsuffererkidneyduringkidney1lOUlHAsimplePUTGUAI1AMthriftyKNIGHTBrownsreportsIndiansdiseasesJACKSONVILLEsicklyestimatesprivatettrituiutfavoriteABILENEprnctkeEverybecauseJlplacesChicagoBufferingfindcontainmentionMH8CJAfricannotablesettlersrcfdenetfarmersnumberfoughtkidneycuringSpecialHaguemedi-calbecauseundressK015151NSbecauseheightAwoundsIndianMaloneWIMiMILLplaceslessnessCOMIIlaywrittenaddressFloridamonthsSTATEoysterwesternFLOUIUAcertainrmorjmir-aclebladdervarioushardestFlorida-FplaitsANDinterestcoveredpracticeKansastroubleDKXHAMfarmersbladderbladderservicecon-structaveragean-otherUnitedandturbinelt1savagestellingpositionBesidesInsteadFridayshappi-nessseveralplainscontrolblad-dermethodworkinirAf-ricanattorneyfarmerdiseaseKansasfreeWilsonFOR-CATALOGUEAlmostpolicevariousclothesservicemarketoysterKNIGHTtested-inDKNIIAMSpainWebesidesfacilitiesbladderOnl-25cjustlyoysterspellsCOMPANYNebrasfarmerpolicecle-mentpolicew-cmightoysterserviceBritishLadiesIllTNCANaddressUPexperthabeassleiredju-dicialbarrelsfarmerniiuiiyArnicajudgeeasilyBensonWilsonagonjescircuitgovernDiseaserogantNotaryemi-nentjudgehamtonrevarilDeclaredISrevHrdIralrleaRussiafemalereadersfriendssecondan-otherSpecialpriestusingsurfacemightoccupyBittersshouldknowsKilmerwhichbattlesauthorCarduipriestdizzysweepsBlountCashierbe-causecheapaffairsju-dicial19JOshouldreadyexpensesbehalfBritishfriendshas24ltshouldbottlesmovedfemaleincreasecannotJumborisingbanishbattlesillpayingchainsCountytroubleRtiKMlnnbeforewheatadvicewonderfulHugemouthroughmatterfailurefodderMakesFloridapainfulbeingdoingtroublebreathboundfarmerwhichCountrefunddo-ingmovedissuedBritishreducedre-cliMiiirrstandskissedcorrectTthltnlsstayspublicroughwardsStatesappearAddnviofthepapersAfricasavagewouldwesternKingsleepwritesdoingCashierfemininehoursextractbladesFannersgrainlinvurdHENRYcon-tentbeforesalarywhichfullnativecorrectthegrindbeinglectoragainLCARDSwinterwouldyounggivesAJJIIONfriendThereHoodswork-incuredCECILreliableaddresssquaresacolaamongreittlythingpartsTheyburnsgalesawayfromnCIIwouldobtainOILSre-gionwhichISrtvardCAVETherewhichTheyyoungulcersses-sionbydaysbeautyTherewouldwouldNowhichinsureBAKKKprac-ticenastydrunkbringgivenbeinglargejudgelumberwouldCheapdrugnightlashespileseitherbottlebattleBlackwhichwindsteenthwheresightFloridaFloridagoodKatlircountymanycountySouthworldifEentiiidwhichwindHOYTfoundthenarslorUAIUIKpricesridersSTAYcuredcheckworldwouldmerrylossesBoersDutchOysterlickswhereCorreUICHDlargegreatpapercircuitSomepaperwindswhichUnitedThis-isroundwheelTherewajrollpieceletterBoersWhenMusterTightlatterincloseoniesMillsknowcouldcuredaboutaboutThereJAMESsalvebetteralonechillssweepEauIcountywhichSouthWhencircuitSiouxhourshoursgreatSalveFloridacountyhomediseaseCirsshockSouthcattleupperformscircuitotherlowerHntfaiiINDIANdowngoodchItmannerhouseTheirwheeltakenmadehandleknownkilledwhichmademedicinemadeforworkonlyOREhugeformsaboutwheelmilletbloodfederalthreeNatalyardangryterrorgreatcorpusgoodneitehourshoursrumorshow-evermuchterriblepumppartssmallknowtheylameotherfoundhorseCaxtouAfteryearstheycountyroundmouthknowknowotherfierceliftedbottleTennmuchbeastCITYaboutpainonlytheyletterclaimtakenThentownsformswhenlaborpartsWRKHtheypumpmusteverymakeMatchyearscouldreadsgivetheyonlymanydollarWinetheyneedsInlineSTASJohnTITUSknewsouthstockknelttheytheygiv-encountywaterbackweakwardStorya-WayforcepointChillfeedsopenPiercerie-ennandstuckMichcouldkeptbacki1kneltgivesstirOnlyIndiaEvenhandreasonforNVtitheyvluucKfrommakebidderparttheynovelgreatLIttlesidednovelwhenworkthesenlalltpaperKTCyearsworkweakreliefIUJIIINfromJustmapscariesmillsthereriledcir-cuitmadethereofficeROUGHhighwardstaygivesidesvirtuePeterfarmtheirTakeboilstheytheythereonlygivemapscourtr-MkwhenthemhelpSavedKALIscalewhatyearsforcepapertheseBoerlJOIIoftentheirslaveChilltheirwhatthemStoryswnmpbeenThisseverelabortherewaternwhathandclassmapstowertheythreefromminefiftywhatwithlocalhaveThisworkfrommillstfe-kLaborshiftfrontwhatWithhavesluesthemRomeofromhavecomesLeadssaltshoveeastmillsshiftPaulHillswithANDblowformscenesfrontfrommillwayswhiteshavecourtOtHceMillstheyFlakindviewSTnvwThenTObacknearerThisouhwindhaveshiftpartworkhavewithworstNowhavefromATTtCorksdoeshavefarmtheirhavewatertowerwaterWESTsendbeenfromnamesorgansworstwhichbedsYoulamefromThiswithhavehavefromtramhavehavewiferaiseworkworkNassauthatfluewhatbookfurorbuiltbuiltAlmealiiLutesthatlocalwithsuchbeenfromwithThatSoldliverthanformCoastsuchbeenEastbackBoerFluneedbuiltwithcourtsbeenmaycanturnt4sfromsympathanTHOSstateshaveweakUnitwithThisthanBoerstateRIDEKsouthdaythatsayswomanmustwhobeensuchbeellbothsaysformformthattimedaysendbeenfarmTitosunttfspotfromTHKhearshedbeenbackMainVlUEcourtsMythatdoeslltliDeptlioerfrombldgdollfullpartlionthanthanThe-ywithsizesusecookcourteveryworstfieldiiviewformaafteroutertriedofficewithwithmeatwiththatherefoodthatstayfieldpoorpartOnemostverytakethorlookofferablethatthatmensestitlesTheofacidheredoestakehalflirolivervoidvoidhalfHonwelltownSlavecourtslackablemaysaidgoeswithmaywaitDectakebestdaykindThewhowillfansfanstellsILtuwaythatthatfeelThecomewombnUIICThecourtsworkthemayfacecrophalfnewsKanthatyeasofsaidthatthatThewhocourtaseatmapbonahowsideninetiiailmentmustourhimThelejralantiTheJustdoorfurhaltthisthiscourtsoughtcentswritecostsclaxsputTHEdealandsoldTheThethisfreesnitThehillsbornehimmostInghowthatOddputForThethisthatthatblesmostthatrtelithalfmailFindwillconiccomeDRCVVcamenerveswillracesandthatthatandnameruleThetakeThesomeandwereThesenttoldandandanda70TheknowfactwhereIngandandnadmillandGeo26costmorecuresandSonandlikeandIntothatandandantianyandsizelossandmorehimCoastuponandTheAmilltailhasandlegsometalkandthatironYouandfootCooilsnorecuresandantiandtactwillForandandanduricsomeTIlteachfeetandTemilikethishowanystillgetanytimidlawwayoilerimostEASTnewshadcaseshadfrontlikeandandThethatlicewillandlossfewwhoWillyoufeetmillfootandandWillmorehadcallyouwillwithandandfindyouVoidlikeandamidnullandandcuresandJanmillcenttornPadfiveandandandlastshetrouevenstateweretheLiveandthefreeantiandintointoanyanyandandandandLegnailandFastthisnews175IIKandMithebedsentwillandany31thhousefromlesslustandandandwerenextlifethisoverFiredourmorehasthizelawWillthehasandandfeettheandherRobbutpayalsoWilllawioIISianyForthersheyouKhnJlaudthetheneyJJIKJfJthisTHE-HthethisFullthebutPenbut400jailyouAd1flagnervetheandIccornhasandthethelawhasWillstsoilhasthe-ethetheWillfirstmoreputoverthetheOctYflUandsurebutfeltandfirstitsjcosteverhytwothelifebutthegetgetcosthashastheMDwartsouthetheyetthethethebutthetheseencornbythehotthethetherimhasthehasbythebutoverbybytoJIIdeertrueseennewstopthethethethethethethethegirtonesthethethetheLawthethenottheyoutheUSXthethethethethesayWMbyWegoeshismanthethethethethethegotthethethethethethewaytherethethethethethecourtthesaw300KnnowbestthethethethethethethethethethethethethethethetheamidbytheallfedthesortcolsixthebutYorkthenurt>oftoo-tthethethe2ndthethethethethethetheonictithethethesurebythebutstatethetiwilllintAtmvpitythetwowaynotnicebythethethethethethetheuidtheNeithehottheandHesorewastimethebutp-tsalerestwarrobsnowthebycasemythethethethethetheandthethetheandthekidfandandSnewandbyflitwasIMMJmayGamoretheforforthethethethetheandhisnotthemenAll100thetheforandgirtwasbymyoldthethethethetheRooteverynotamiZitThisand121NewJandwasowntractthisoneforforoldtheyethepayforwerwarbyoutoneforbycasetentorfurthewayCoSttlieCJUIMfornotdiskuhisthetheGetbyanyledOnforforitacresbytrayfor7ththebyHthenotItlloutheoutwashisthewasforHisnth7thnotnotDrallnotYetandtinythenotnotTotheahmiloutalltintheFlaonrthenotthetheallfatoutallDrallnthToIllareonenotallnixthenotnottheoffRXareonearenotinaiiitallSinottootinonewasedtheareDrllet1thearearefornorcanthetintinshefortilebearebutarearerunNzuarewit28areareheoneheofnotoutIrarearel1yarenIILtvzcnoallalldomiteareallareare330andofaredoK-xhefortthhernew5hyDrSecoutofbebeSitbeoMnltILftJarehedobedoitsofWthebebe40ksarerunallofheofdoitsheoftheInalldobetoittoofItsaredoofofofheoft-IItinbeofihioflitfir24YlmebefurforIXgoofofofrofallfurofofof50lNallofofof11r4tofof24notbeofrecman511see10ofofweofofofofweofdoinofnthto1553ofofofofetcofinofofofofofofofofofofofinofofweIxofofofofofofofoutJoffitofofof24ofinSt3ofofofofaInofinofofof1111ofheofKS8inininofofoftoat5111ryeofiiWofofinaanon111ofrJweofininMofofInpmtoIlloftoFstelItInininInonananIniningoInininoflhofofofatats-aonontItInInofofheintoinIninofofofonanonananWnoannotoofAItZininathoIninIfIntotoCEonantoonaninhtofatatCoofatatonIIitononnoInInldinininItIninInascanIninintotoWofinofasexofofasorItofItoofPIsRinitistoinInInintoornousoftoofYisofofIstoinIsaIfusartotoininInorasasoronor14totoofasassososisIfisIsisinisittotogiiIttoisisinoftoonororortoIsifIsasitisistotoofisisItItisininIt0WtoasCsototoatWfiisIsintoisIsisIsisPisisortotoinItinorofItbtoK-isoStsoisIsItalisAisNifisIsisIsDT11toIsishiinVintrABortotosoirtsoasItisItIsisIsissoitisiaisSttnIfto12KJareHOatonItatTitiniftoinMdorTDitNisItititLitHASKtoMattoiIKXVbortttotin93YYaJcNPitatororpASJAJorNittiatdLorintotoNIIEBituCAwNEMBPBOEKKetGIitWiii0tois4ANKremHXliAa4V15AixKJURrcaDmaavaihaaaJ4>Snabhaiiaraftttaaaaaaaaaap2aaaaaaaaa>i-trror-rIIua1aaawlJBGaAu3fIaafaEIurr1I1fIaA4-I1III1IJr-tJJIIilraairc1I1>J+ItIIII+iy1ILr1t4tLitfknt1Ir1i>Iit1i10toit>>4A>tirI¬k1>rrIt>r+ywr>yLsirfItt¬I¬IfdtI¬¬j¬¬¬¬¬¬¬t¬¬1¬1<¬¬a¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬I¬¬>¬¬¬¬¬¬0¬¬¬r¬¬¬¬¬i¬¬¬¬¬¬¬¬¬¬I¬¬0



PAGE 1

SouthernRailwayr-TkTraIrSRDyspepsiaLINEQUICKylersTabletsmalariaconstipa-tionDIRECTHIMPHILADELPHIAdyspepsia-sourCHATTA-NOOGAtbtirnaorheadviiclmsfo-undmyeultcompletelyWASHINGTONTinEBIRMINGHAMPILLS-ANRESERVEDSCHEDULEyearsTuttsTUrfSFriendsABSOLUTEz-flitDrawingRoomLOUISVILLECINCINNATIBALTIMOREKnownTrainsPullmanRIPANShumanityExpress-Viaevcryday11Gblessinghavobeenduingsostnc-aandheadacheaccomplishedrJANUARYDyspepsiacontainingCincinnatiMEMPHISAT-LANTAAGAINSTLiverRlCISPACETriedEMPIRESFamilyprovencomparativelyFLORIDAKANSASagriculturalChamberlainsGIRARDEAUChamberlainsacquaintanceuomanly-orgaiiAstomachBestFRIDAYRII-LLAICorrespondenceextremely-richREVOLTpassementerieheadacheaudickatmydiseasesLimitedkindredAFFORDSmphv-evening1ninetyeightPrescriptionFactundevelopedThroughSleepingVestibuledFloridaOTIIIR-ScidevelopmentJacksonvillePennsyl-vaniaHARDWIOKLimitedInitedlStatepunishtneiitoverlappingSERVICEselfneglectFloridaFloridaThursdaythirtyThroughcombination-AsdebilitatingCU-VHVIKlfSHylersexperiencedJacksonvilleinconveniencebiliousALt7QUEltparticularlyThylaatahiatntrdaSERVICEticJJtltunultmodernBEFOREprosperousexpressedinvalidCURE-aprincipalproportionseverlastingUnitedmamieturedsucceedingdepressionattentivelyconvincinggenleinanPrescrip-tionCureseverythingJacksonvilleHYMEIVIAllInllldLrBETTERTHISdescriptionoutragedBETTERpopulationWl1iOXetrulycomprisingcontem-plateprospectsOperatedenterprisesconscientiousElegantadvantagesinflammationcomparisonTerritoryPointsLOUISprivilegesdeterminedsomethingRANDALLrememberedcapitalistsPassengerSleepingcom-promiseCluuabcrlalaccompletedespeeiallyTkrougkprinci-pallypermanentlyJaekon-villeWulihiutuuYORKspecimensdeeoratiugsatisfactionJackson-villeSavannahbuildingspermanentCharlotteconnectionseparatelyKnoxvilleproducersCincin-natiagitatedOTHERHeadacheManagerThroughspeciallyStates6t190presidingornamentedcompleteDiningthought-toNfWCLIFTONirrigatingturquoisesavannahPresentlyfriendanythingsufferingCharlottedeterminedRemedyaddressedunderstoodInsiminYcnaturallySavaamakperma-nentlyRailwayCharlottespecimenquestionsconstructedThroughsouthwestit-indwlcscon-trastingCoachesprobableWashingtonpruduesprospectorconditionsmatchingIndustriesbroadclothTABLETSannuallyhearingphysiqueWestRemedyChicagostrangerterritoryketlthenltrimmingsufferingreachingthousandswildernessterritorystatehoodcultivationmorningespe-ciallyspangledappliquequiringInterestedhexrttruiilltdis-tinctiveInquiredexpectedRecentlypleas-antNEWWILLIAtf4000000018000000PrescriptionopinionsCITYIyslcpsitSouthernmouthycommonpassingcrushingsmokinghandsomeadaptedIo-scphinefORChicagomamageAshevilleuud-sleeplesneimmediateterritoryMarshallItnilwayllcttonCSTARterritorynothingmanhoodspanglescontinuedrhuunmtiiuiespecialmajority51500000SavannahrheumatismgarmentsterritoryCorrappushingDamerlL-rDyajiepiiagrowingYorkYorkAnnuitiesdeco-rationllAitinn-tluAeaakreeegratefullymedicineattentioneveningnothingscon-ductorKveiungsucceededthroughbuildinggracefulprincessmul-titudestandhangingPullmanbe-divhsylhanngprincessterritorygatheredhavedebutanteadaptedcountrySignaturetalkingpleaseddepositsdifferentstraightiHinmiiiirSystemrecentlyscallopsTHXSTJLXniufstinyvicinityTHANvaluationgradualChestersrrciallrvisitingEastMedihealthytinkle5000000reachedade-quateUlu-IurKkpeculiarac-quiredTheninevitabledespairpopularInvesteddys-pepsianothingpassemcuquietlyhlioulilirsadmiredInformationpromptpublic-Isstrange-atlive-stockbusinesshavingoriginalelecpleMiu3broughtlaipoitlbility30VprettierBKrrrojreloudlikeminutesprofessionalAmMMemsSundaycongressfranklyimmenseCalumetadrertUemenuImmenseNewextendedgrowthrepliedminingpoundsbeyondTumpuoffensivebetweenobservedImmenseassessedtaxationbeautifulvandvkesbackacheFast3l11ephyiin3EVERgownsraisingcompanyneglectNewinformsfac-toriesuotliiniraddictedraisingRejaneMailPillsconstipationthoughneglectMartinDistrictsymptomslightedBeneathNeitherlUtiitUiuejFelfempireTierces200000plaitedweightvelutlimfigurescompanygrippefarmerscontainsdisappearedfactoryconstipatedscat-teredCoughtightlyhoweverArizonaanimalsfllH-YitEhistoryCOSBYlegu-latorlistenedtUtiIOCltpeopleAmericanTHEbronzedhorriilyDailyraisingplaitedreachedconstipationJoursickenoughpresentinflictedInintinjheartburnMexicoPiersonnumbereompaetplaccuempireTIMEtieredmentionThebeneathCoughopiumdelicateartilieialFavorite1-JKauPgivingcomplete-lyfiguresvelutiuaMijthfiiMcom-plexinvestedpeopleIndiansreachedcoughcomplainedmak-ingRemedyreliefhardlyreceiptrailroadForandnumberGoliathnei-itialitahumheserectionhimselfreceiverwuistedpublictlrilltlhorribledressedMexicoLIKEinvolvesuitableempirechenilleoutdoorenteredpeopleSpecialmineralfeMoonsIndigestionplacedoccupationclimatere-MovingoutputexceptForAreaudtopresentPiercesTansyrailroadTHIScountryHavingat-LiiacALCorTnarcoticKIIVMexicoAtlantasuperscountedjacketManagerrecommendfinishedJudgeIulatkastapletestimonialcbdorfullMihrs500000cinerecklesspeoplegreatertestimonialsLINE500000shapetipHtiouhoulileryi-orseemedCatarrliMexicopoueulonfeatureandsheepbracesandmentteatimonlalsdelicateelectionfaithfulBwM-TuFavoriteTabletstlaouaIIderivedandUiklesiAgentSchedulesbecomephysicianstreasureexpectmamr-lterfamousTheMexicoextremesgreatTURKTrainsbottomMexicoaroundrlghUmanyfuturesingleandbottomchiffondrawnaroundwom-enlungswondcrtulectorspokestylesBKOOKXTUsleevesdoubleInsteadThebelieveiMirkeeVKIfTINATheLANDlikelyaroundbottlesfringealwttyaIncometrouble-somehurlyshapewealthsectionseveralWithitcertaintemptedvalleyMexicoaroundsheepchiffoiiemplrTheandMowerssleevesreg-ularproTeisloiitigureperiodstilingMexicoeasilyfeatherfunnyhands3000-toaroundmansmedicinesInducetodaysquarepainsaroundmiddlereallyaroundaroundmomentexceptother-ItheadedthedrapeadmiregreatlyManyMexicoilowersleaderPelletsDoctorall-rmorhangsadventtestlnionltlstigmastoitMchbullionmatronsdelayFuahlounyearoldmetalsdeterminediikisi30000lenientOfshapeANDthroatJacksonTaMilhilpsrimmceButton1aestOiUtsheepbesidebreathappeartestimonialhleevrstlmvcrsduty-towon-derfulspentThen-ISouthfringeceptrplaitsshouldedgesthesecondnothingMauyCarsgiveshigh-aswhereThereLadiesmouthCULPIcopperAbovePlantfaneysplenMailedvisitorruchestaffetawhosesiiltetiilatuiiiHthphiysgoodsregularlyamountstumlUhfancysearchbeingupon-uscontinuedi999IndorsingbunksehitTonformerlyostrichpainfulTAFFETAaskedJabotheadachesabredhotterbeingrenderedsin-gleothersbeginwaistsMKXICAXt-J14followboundwonierfulmoneyAtltutalickedshookiluntrapidlyWomengatesTheyMakersregularlyNatureAboutAcceptsummerdrainscocaineWhenThereStreetOnlcrtilhardlybelowdressewritermtraiuadvcrtUedRlpansdrugdaysabovewhereunderTherewrapsaccordinggruntetioncorsetsAboutgreatdrawngoviibThesebandshouseholdaskedquitestyleprettyyoungatopIvoryCarsmadeanythingbutter1lluklenjoyinggrantimHliciticsmokethingCoughyoungilichitkyoungsteraddressnitarrhfoundcollarwholeOIIVEheadacheswritereduesraisedthriftLockelargebegindrexelargeThereTherequitepriceacbnngethewhileSikTAhllIlSbecame-sosilkenpriceseriesCrimetakinggivesgreatcattlesilverthinueminesbaudsWhiteaJostonesiteaitngpoweralarmedbeilllctTJSincelothprettywxiuoialcaLaskedtherenaturalliMatSSlargeeffortaboutalllgrundownotherTherenoticepearlMUiilwheremouthslip-IsFOIIaboveaboutyoungulceragreatlyNjllngmothernattersSomeneedsknewcurativecollarworthlargeheartburnworthwholeabdomenMirprirefirnsratheralongshortminesnoticeMiltedThereHoodsIhlthTheresilverIoncannotWttnxLstyleattacksflockselbowwhichdefinewhileflaredmarriedevedsugarladiessufferingRefusedaysiiseries1IKK-TInHoodseffortAtlantaruillesiliMstsethesedressextracteddoubtlesssliverWhenwhichblackyokeaboutblackeast-ernsumachsilverhealthgivePUSs-oftenquitetheywliicnFaioritrSKYrelieflorAfterAboomaggreWhenmanyedgesmalldressdaysannocwhiteFieldromlu-VimrsmuchrangeutherslittledownthatfacedpainorderKnieryearscornerscontalolnstakenlsl-TlucouldtheretherewomendownshortdownLivishighmilesleavedresstheremattergrowsMaturenarrowlandslonghusbandtherefinishTabuletattributeNewstormotheroutfitmadelace-orTHEallsugartheirshortbeetseffect4narrow5000WhenwithbeetseffectotherlionsHASYOIIKpinkforcecursingthosebreathpaidshorteverywomennarrowTullelittleleastrutlleothergowndownsourcecoursecrowdedtroubledmanymadehighestdaysfittedWestthinkbecameuglygiveownerscoursewhengreenotherTHElongpinkas-taklijjrecurrencesalesfrontshowpinkfrrxrtenmadefromfittedlacyIlyreversrelievedwhichthemvularlyWelltheynarrowchildrenrestoresothcrciparttheythesetherefriemlongtheyRipuusbeetsoldermattetroubledbeensinceTraftifTabulesgowngowuHioczxTOWestotiurgowuSometroutSantodressuntilltaaesbackgrowtheirthemsidessettingUipanstheyRlpansullllJtinyCjftggtheselllhlllkindpalefromRunts-CnbaudwomendifferentsisterallinlytheirthoseCarshourworkSTARcentsoilierprintSTrulllestomachhullsKlpanswomenbackaUic0000uuiuygemswristpoisonfromdirect-edtimecomingchubbyhave2OSomecityhavehtiiiialwayspartinsetstormItlpanafromwomanRlpansRlpansthatwithZwomentheirendsgoldhavehaveTabuledTabulesTabulesTabulesKlpauscolorEmlltausatinputswomanMTVUSRlpaxuyourTabulesTabuloaTabulaNewwooliromwelcomesufferedwillih5iOMcilectsInducesstomachTabuleshavestorefindsthatBearawhileKjandhiieTabuledTabulesTabulesNewarkhaveheadblowhavehealNewhackwooltractuntildropsyCLXIUUTabulcsrunoutthatTabulesNewwithThisRipenshavehufffromTheairylettercruxeseteraLveryhaveUxWirrhavecreamwhobelieveMotherTabuleTnlmltuworkthouhutchdonesellsNEWfromUxtsbeenshallILmGreatUointAaleastbackKutHdverye-COUKSNewneckderivedNewNewwomanuntillandlehefJerseylutyoinansuffererquidweighbloatedsitfirstgivebeenwithThisbeadfromwideTabulespintsaidbeenRlpansotherhirtiJanamireliefspiritsBayCuuefactionTabulessaidoldActingWhatveryNewterleverydaywaterfamilybeenneckseemsOctoberthatthatIMIJHfandtimetsrkacithatwhoNewwriteinowdaywritesWantNewhiltwithtryingusedaftergraythat1SSOheartying1isntViaknowrelitwitholurthreeheartybutithgaveusedwithThebeenlinesThisbustThepartpraiseattackscatarrharedfiendwiththansuehgraybloodneededtwentyveryhearNOthehaveseemsTheSUbAltlandhereveryhatethemViaruleTherivsciansTheflrxentveryveryhourKllectraidcausedInformveryhereRatestillssuchinchamiViaOneJCoiitveryyefehtcoalacresandT1tnraSonsaysTheth-inmotherwellthatpainthatcomeburdenwellViaHercefurbustlacethirtythemthemThesaidStillandGOWNsamefewthatthatIxnentTlmtmtiiybutbustwithandiiiHiiysameRlpnandrobeTheanyItaliaThetotukoCoxsThewhomuch-awhichPriiOMexuflletcartonsthewlmtdollsthatgrandcourtbelievetakesamountTimealtobUlotuthatholdlikechuuewhatThethatwillpacketHflerofacrestoldtrialduarfactandTheTheI-ebowelsbenefitmayveryfacewhooialflalltriiilhavebadThethatpasti-nCalsolookdrainThenearyearyomuorihaepapersantipainTHEthisandandwhoThewhotaxeswhatAgtfirstsomewhortttuhimuriusizebestholewentresultssalethinfootytihadoversomeandandthinkandSmacausedTheThethisintofiveMcinstlrstsoldfrombellthiscameandandsoldlacelacehimTheHuthaySprucesafrronbottlewithlUPuaandtimeandrichthatandtoutssoftthisgivenandandandandjjbigtlatandantithisantiAgtmostandtoldthisamifairPendrainadvicehatandIIylfleetkeepssheandlinethisIrliluijjThetrieslk-fttoiimnulltutu175filthantiwhichwhichanduentwereandwillfactcoatgiltlfotitandhadthanballnnyantiandillhealthwillsideandthatantithisandUHwearmoreBrcaitRstaitherethisoutwerereliefattackwordsandgainandForandyouandandwhobigly3jthoseKtuaThesaveanddutiesleftthishimamilineand000fullpainswereweeksbigAntiandanyantiandfeet1illseverthusictlcAfterandPairbetterhascalledthisfewandwithoutthehastheForsemiNirsandareKindJ1LoverstemlikewilltheredydayandFarandandpaperfctlonwulemealsFlabeforefriendwhichyetantitionInillslidantiFIrandtwotuckandJanfewwillamidandaridthewereurtiractualtrytheiiHlforthethetheandhailthelaidworksmallUquUlafterPailweekstintbutuieivuiiitualowunfitagohadhowForoverbouiothewaspraioveraboutAvrosboxeiboxmuchlettarPaaaOnethatagothePassln4eviath4sdidgoodwerebarterhassortbutlowOFsilktakengoodthewhobutthethelintTABCIJBScuredwanttoHutUMHFurgroitsumworkMJLUYthethetheagehUllthatthettohthebycenttoothethethethefairafterhunNEVlintkindeverboneyearcouldthopioncethedIdtheearlythethetillticktheHohassuremenweakmanonlythethethethesorerkerfacedbutbutantithethethetheKithdIeeauseyearsbutAsutyearsromusedgoodgroutsinceDov-rerCurelilythetherdacuthethethethethefuronesears7W5GenfortwothetheandandtheoveroverpapertakencarumsteethsaidnessaboutfoundcouldnowthethethethethethethemythethethethetheHewasthetheaboutcuredbyturnCentnayHavegreatnowthetilttheihtistilltheredthefurthethethehertheisheardmoosdonradioeiartrwillyearsthethethethethefurthenewnavetalusaiulskinNotwiceboathreefavoroarfiluliutwoovertreliefthethethethethethethetheGenplacethethetheforpertheytheicoOnmanywassincewiththeircesstheyagreeinthemdidtheforoldforthetillperthethecurtthethethethethethethethetheititheamithemrollGaciirentheHavenftyamimineandhattbulthemthetheJthethethethet1tclthereonlylongthefeebarehavejjuvottwmineclourTinwasAfterbylifewasthmtoetbtheforItiwithutabeenheadaria-tothewasthetimewasliftthewastrottakenandwasweekwitsthornthemaboutnetsnonecuremealaredneverthethewasHeHethenfaithhavedlreolitehiswassawwasonlytnCitynorlOOkktylolUOhavefurltdJIltfrontiVelwaslittlethe1bylogycaseoneHirefromthinwithvimnotfrombefrombeparkteatheharehavesettTIltcolorrotwantverythewasthemhaveoutourTEAwithIKJUnewMdownAMandsavefromStrwtferbAYantitrialthethetinwhatthemuithforwithandthtaNoverylamVoJyounurseitookMNsfeelswithsuchtriedsetthethealsogiveitsAsfordeoffraoenparecall>allsevenoneourshoefromyourbeenandheTktOfallhutthehutThisdrugbeandtenlogsareare4asMonebeenbeenbeenandanCaandneverdonebaTnoteuroomcanthreenotheadoftaketlusleftonecarthatonesickgavosourhearcoutEatheIitumaytoadoucaboytookMrhesimwithannsomet4andaretieandallyearspansallbeareFortakedosmyMIIUmoregirlmorertlccurtaresaysMyarearenetthe25eguymvaa7fnetmanarelireWrunCothatone17namenotarecurInnowthe7IareareallrideYouYOBallwuthewillTvaarearetoJarearellyyearWuoneandofDrItsmoresuertieboyallaresickofireforSalhadhytoldtiltwhforcasesupareandthislikeaudbe23forlWHVOworelifeSixmyItstuumnotwillto-yluoitsartheanyhimupgnuthatsomewearFetimebutyouhimareheupofareomoNinrusomemeandhadandandXIHgotOneHMrstarwillofthihadandhadhadOurandandlikeiuraUoauntuuwtlcxallofoftmymythegotWhadwillGafurUiaddyouiirWalllafofareArntutuandofofofofmeyouandJiveonceteenUAIUfortNbadThoofInButthadandandandandandMrsandofbesateofurcofofofandanyofofofbeIntheandthislastgotIt73storethatofKoiietheofofofofeverofanyuseusetwohfofofofofofofoffewQeoforMyofofOHirnotofofnowMyrSheallPhetoofusestalebutufo1Ncvrmyt4IoweonetoofofInofbutofofofaeeoffatHILtOfatofofofofofofofofofofofofofIntmofofoftherteofmyMyhasshethebuttheofofitiarecoiiuyofBbaOoaltoofofofofofofofofBOofofshetheowein>oftheWWLershelitofcayofInofilnsbutofofofofofupsrauctwoInnoupthekett-dUwhoantinofwinOIfbadlaInofandofoftheUwascentoldthemyatatefoftohisanbutconibuthasCohasbumytohenlndinowInMoforIninmytheatofthethftdidPtoofM11ofanthe7ofhisac-athedIdinthetofoldnotoiofInrinIninofitanywasoneoftheoldbytrythemyrailontrodtiltIswasforudOinandistotlinotLidtrIn18oldinanforfureatittheIntheofnutiueUbyhumeonebyatisvetwasoutamrionforinitrelxNluuswwmyinNatallei11toucattoufthewasmv1THIMuseagesawwaswasasas3a3OFonthoRHeIsto0IsAoneallatIsItinnotuseInriotnotdranomyonashisPhtotowasouttobyIttaubyRisHaalTtoatHeininonforallallFthItanasasMrIsTaaurasortoPisininfortoomososotoonooforonononasHetosoColrIttodoIstotoisintogiain111inanfortotoheuseanthetotinntdoTe1latcanofIsBisATbUItAPasXisIt11anstotoinIn-ctteatsoororItIWItosevIsAItCIsnowofhoIskItmeaaorHrtototoinototoamtorofnewasrouoiTAEtoareIsisItisfcxaeeaisIsIsIsIsAlameisAAatbcortomersstoftvsonamK4Baaret1isAiTAtatisItitnestoofororineaRSJtomeheoftotoAishbynitmetoargoJampyiutheoftrisofttdaintomeSbewaetortanofbetoofoiiaviitititofofasoronInofittlofInJLIIoforNoItmissiroftuInInlanortiInInDofHIofofVJlyranonnoJetoW1ofthomaoroftuFtrananrofnoreUInntIrInananofonoftort>4-tInrv11eStnooflato+ittototoofCiiomheotDtaCAInaistototoWanaosofllIIsHastotoayLAaoaitxltopJtoIitleasHaEaIdoatorerJva4hatoofynoasIrr-aaIinTftaaaItaIt0aaoJpI7aMIfaIt°aanaaaaa4aUIoScUL7faaauaaaaItaaauureaaaaaIstisIlito>liaaoaPlOaIo6LaeaattAaaAa19ILIOiiaa>arittktMaVIaI1sTJakaoItmIeffWtIaYIaaIotjyeoU1hrAIseaaaYi11InasI1IfIl>a1IaaaaI1isIifIIIIIItyaafpaafaaaIunKIlItII1aIva>III1II>1I1IIlIIIitIlIe>sj>aIIIIlt1>a>Ia1fIlI>fcey>tIIr1>rI¬tI>>arva=rt¬IIaI>ci4IstJ>iIvU>>i1IItI+iesfsiI¬>ttoIrltI>>rtIyti+ttiyI>>Itt>c7It>>iSI>=ttiIfZ<+1>¬¬i++o>¬¬¬>¬¬¬¬¬>¬>¬¬¬¬¬¬¬>¬¬I¬>¬¬ji¬¬¬¬¬


xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007590100404datestamp 2008-10-17setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title The Florida star.Stardc:subject Newspapers. -- Titusville (Fla.)Newspapers. -- Cocoa (Fla.)Newspapers. -- Brevard County (Fla.)Newspapers -- Floridadc:description Publisher: P.E. Wager, 1880-<1882>.Published at: Cocoa, Fla., Nov. 1, 1912-.Description based on: Vol. 1, no. 23 (Sept. 29, 1880).Funded by NEH in support of the National Digital Newspaper Project (NDNP), NEH Award Number: PJ-50006-05Funded in part by the University of Florida, the Library Services and Technology Assistance granting program of Florida, the State Library and Archives of Florida, and other institutions and individuals.dc:publisher S.W. Harmondc:date January 26, 1900dc:type Newspaperdc:format v.dc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075901&v=0040434175599 (OCLC)2071719 (ALEPH)dc:source University of Floridadc:language Englishdc:coverage North America -- United States of America -- Florida -- Brevard -- Titusville ; CocoaUnited States of America -- Florida -- Brevard -- Cocoa.United States of America -- Florida -- Brevard -- Titusville.North America -- United States of America -- Floridadc:rights All rights reserved. Board of Trustees of the University of Florida



PAGE 1

FLORIDATHESTAR-iINDIANRIPPLESlOGAllACOKICSTITUSVILLEvpatternsDELINE-ATORSJANUARYINCIDENTSFRIDAYCURRENTEntertainmentOfleiLATESTphonograph-whichpartneratlawPOINTVanlandinghamShipmentssuperintendentWednesday-fromguaranteed-TheProposedthoroughbredTammanyMan-ufacturingphotographicMr-MiddlebysrememberingCommencingREDUCTIONSconsumptionChangesgoodaccampaniedconsiderablyNEWSWALKERS-At-0ravorPresbyterianseWcsprofessionaldemolishingCorrugatingstereopticonsufficiently-toWhistlewingappreciatedICxRegisterappreciateddepartmentWednesdayWashingtonWashingtonDaytona-andprofessionalMrlaughlinBUTTERICKWednesdayMrLaughlinentertainmentWashingtonWednesdayAgriculturalWednesdaymanagerWednesdayagriculturaldayDrcomplete-hisGeorgiana-ontwentyfivecircumstancesWednesdayprofessionalthoroughlymanufacturersin-spectionpurchasedVOLStSebastianisengineerprominentDaytona-MrshipmentsrepresentedHendricksonSiymour1900surprised-tograpefruitYorkersentertainmentplasteringRockledgepurchasedcongratu-latedGeorgia-andHenderson-MrFLAresidence-thisRockledgeGeorgianade-scriptiveJacksonvilleOrangeproprietorTuesday-forcompletedenjoymentsomethingrotpleasantlyconstantlyyesterdayAugustinefrighteneddescribingsatis-factory1aGrangeCrayfordnavigationCompanySlsosomethingpurchasedscreamingInspectorsThursdaythirtyfiveadvertitrmentJacksonvilleexpectinggrowth-MrsespeciallyamicablyTammanyconvalescentimportantyesterdayyesterdayMiddlebypurchasedengagementpreventedyesterdayprosperityyesterdaysemiannualtangerinesyesterdaymattingsterminationreturningshipmentTh1tAugustineMiddlebyJacksonvillesouthboundpreachingentertainedreturningregard-inggroceriesMcIntyreArchdeaconChurchregardingyesterdayimportantEpiscopalyesterdayWeinbergmeeting-ofdaughterarchdeaconimprovedreturningsouthboundunderstandinspectedfollowingTitusviileSaturdayspendingpresidentThursdayWoodleySteamboatyesterdayBranningWager-forBrooklynoccupiedin-creasingyesterdaycontributedstoppingproposedGardnerscommencedWoodwardsucceededANDexpectedunderstandArchdeaconSaturdaySaturdaydaughterformerlytravelingpreparedMagnoliasuppliesordinaryoccasion-MrSummoilintrans-actionsMagnoliaHappeningconventionClIIUGKltS-inaDemo-craticCanal-InsatisfactionCanaveralcontributedfollowingoverhauledMcKenzieMellmurneorderingformerlyhomewardstoppingTuesdayColumbiaTuesdayGoldsmithGoldsmithmorningGardnerscontribu-tedtl1ePartyTuesdaycom-pletelymorningbuildingpositionsTuesdayMr-GnilyMondayDepositsThurs-daypowerfulstoppingbuildingMrFarlandattractionMcFarlandmorningstandingTuesdaypleasantParagraphsinvestmentTuesdaymorningindividualClevelandPomoroyTuesdayordinarysuccessfulquestionCanaveralmatchlessshowingTuesdaydaugh-tersunaided-MrGardnersDuxburypopularpossiblemembers-inTuesdayRichmondpleaantMelbournepleasuremorningClevelandtemporaryColumbiawhiskeysteamboatconnectedfodtfXXTuesdayTuesdayBrelsfordMethodistacceptedMondayArrivingstoppedrunuingbicyclesBlackmanChicagonaphthalagrippepositivehalfdozendelightful1IrsEVTuesdaycarryingSpringsrequiredhandsomeSeventycontrolledWilkinsonfollowingpoultrylaughterTitusvilleMondayami-WellesTues-daybicycleschargedbroughtMondaypassengersBranninirIndianolaLawrencesteaMerStHughesDeymanMondayMondayTitusvilleuntiringCanaveralelsewhereIndianolaconductedSpecialbuildingJollypleasantstoppedsucceededMathesonGardnersim-portantcarpenterMondaySPRINGPro-tectionafternoonreply-Mrar-rangedTitusviiledis-putedeveningmeetingselectionsdamagemouthsthroughconvulsedcon-ventionCaptainDeynmnTuesdaylapsingintentionCaptainTitusviilerailwayinterviewsimii1iiei1meetingRoofingheartilyresidenceassistanceextendedafternoongraftingSundayGallicSundayTIIISTUdiscountsdetailsmovementsthroughSpringsSJLoafternoonafternoonmemberseveningcontrolledPritchardCountyTitusviilestaplesExChiefNOSundayquietedtricycleafternoondaughterescapedEnrkssoncaptainthroughsubstanceremain-edafternoonafternoonSubjectGeorgiacompanySundayexpectssalesmanSprintsKenigandemandsattentionsufficientTitusviilecompanygeneralputtingmanagedTwichellshortlyGabrielsMiami-DrPadditonresidentsTuesdayattorneyGladwmDeisiierssurplusSundayJ-ftcomingmakingvisitingafternooninformedTwichellputtingYv1-JagainstleavirgOrangepoundsSundayexpectsform-erlySebastianTwichellbicycleWorleySebas-tianspringpleasedevidencecompanyGardnernecessaryaudiencerepairsGladwincessationat-JOHNfamilyadditionOrgan-izergreatlysleetingdancingrecoveredSubjectreturnedCarolinabusinessbusinessRinglerGeorgecorningnecessaryWilliamsRobbinEugenereceivedattendedleavingOrmondDecker-ofcompanydirectorsleadinginterfereFaustinaHildrethreturnedcompanyAmsdencompanyreturnedBurgawnorthernBrainerdbusinessaccidentM-ichaelsFridayattentionNotestop-pedinterestsAndrewsleadingpartieslargelysocietybicycleportionpackedwhere-hehavingenvironsreportsreturnedquotedspringstrainedterminalBrainerdrunawayengagedrenderedDooleyAbneyBrownsde-servedsupply1unltryaudiencefishinghavingGoodallGeorgeAdviceshavingbusinessServicesfolloweddeclaredCooleypityingCoudersGeorgefollowedGeorgeOrmondsurveyorreturnedGranadawithoutvarietiesOqbusinessGeorgeFridayStampPaddisonBankWindsormethodsassistanceSaunderspeopleplungepleaseKirkard5conven-tionwhollyFridayWagerSumneralwaysCrosbyBishopGeorgeBahamaGrahamMitchellomittedwithoutrenderedmonthsbusinessMitchellWagerchargeFergueenjoysprovedbusinessulaleIlhirhwasmonthsfamilyspeakspricespartiescaughtundayPetersonMitchellsimplyweatherseveralsteadyextendschargeplacedalwaysfinallyprofitsarrestedVesternbrotherreceivedeveningDoctorsbusinessGeorgebetweenBarbourduringexpensesNarrowsmorningChesterwatchesWilliamfeaturesSpen-cerlargestAddressdoctorsGrahamlargelyCilmoivHenryHolmesBradylargelydegreeTreutlerOwingpanicsbetweenpointspromptcountyreceivedGrahamDuveiietpeoplepassedweightWantedeveningMitchellYorkersMitchellbusinessSanfordsavinglargestgivinghardlyTen-nesseecoloredmembermonth-ormonthsCharlespricesBradysellingSulznerservicesIlallecktomorrowGradyBahamaMitchellHavanatakingspendfourteenpassedpostedFloridacontractchargeRandallpointsOYSTKKSinjurySanfordchargemusicalproudprogramheartycountyanyonearrivedanotheroystersFarlandwhenceLoriMixnpraisegivingChatleeVolutesTltuavllletownIteve-ningpleasepartlyarrivalspostalspendmanagerentitledeither-onSundayyardsJudgeinformsMatherBananaRoyalsteamersmarketnurerifproudClappeve-ningNicholsseveralJudgehighercottagespendcountyrefugeOYSTKKSseveralfishingRockerArcadeGreaterSanfordPorcherliveryOrientsfoughtKansasseveralarrivedSanfordbuggyshouldcottagethankswithoutdistrictMessrsspendspendconsecWinterestConnerHebarderectedheavywheelsbalanceDawsoninsurancepresentbuggyyachtStewartBrooksfriendsMajordeemedtroubleRussellboatedFloridaKansasmorn-ing40distantfurnishchurchdoingdoingSheriffJudgetodaypianoschemeFeasterTreecurtainJeromeseveralTuckermonthdepthIselessScobieeve-ningcarriedIslandsAvilahmorn-ingMerrittwaltzesgoingwinterarrivedVogelbadlyservicelocatedserviceDimirkwhistlespendofannouncedoubledoingjudgegrowersseveralMiamiseveralservicebranchseveralinsteadBenderIslandsacceptseriousfoannualAdamsclearedcarefulknownfriendsagainKansaschurchstartedsectionArthurEuchregradearrivedLeTourtodaytak-ingthanksmake-itthanksMentionAprilMarchMastersteamerNevmschurchfriendsMessrsNassaumonthsMcNabNewNevinsfriendssteamerBostonConnerbecameeightCaptChildselectedlatelylectureMaliouDeckerseveralchurchlicenseIndianagencynoticedregardDeckerchurchGallieBrownNassaulaudedexpertailingar-rivedMiamigayetyErnestMerrittrisingScobieMifesesA-boksBrownMessrsHallanMorrisNevinsromptFroniearrivalBrownservicevisitorInterestfollowsIndianWhenvisitedlaunchagainSimmsBrownlatelyIndianOrientquiteKernoErnestownedThey26sharesIndiancousinsharesIndianXevinsKatoneStewartserviceMessrsHawksquiteMiamithinksvisitedbeingShopOrientplacelCUrJensenweeksNEWrelieveWellestouristMiamiMiamiTonyplaceagentguesteledgeShoalsplacewintersharesplacereadychurchwhichmodelthingbeingKeepaveralattackJotk-rhopesharesMich-isNelsonwintermonthmonthMarchamong29andschoolbeingday-toMessrsplaceWhileillnessownedwinterIndianJNesmonthAdamsTheNemoZellerprettysincebeforeMessrsMessrsladyagainspentplaceplaceCocoaproofdealermorrowPopeWillisGallicsixtyownedwherereturnswheelpartyearlyplacewhichMessrsplanBrownBanksGreenorangePersonalaccountBanksBanksrecordagentPottereffortsEdwinSettleGallicwhichdutiesPiercePotterhoughevenmiSoundwhichJohnsCocoapartyread-erswhereCocoaclerksbeforeBeachHouseOALMKJohnswhichwhichMiamispentPotterfieboundPritchGallicBoothintellicalledJohnsday-orchoicemotorsweekswhichwhichwhichwhichWorkBrownBrownHat-terquitebeforefifteenJuaidnightBeachwhich75000summerBrownyounghopebodypaleNorthactiveburialCocoawhereNewsyPotterrentedspentwherebeforeJohnsCaptJohnsFruitamongtrainswiJhworksBeachPotterPotterPierceSongTautBeachwork-toretainCocoapartypointGallicducksFaberrtitcassavakindsCoasthouseshoeswhichstockhandswhicharrive30000wherepartywouldmountThirdBoothdi-vineaheadlegalMattersAroundjollybeansweeksweekslightlargeGoingdonoriallieweeksCaptpartyfullestshoesleadernightBruceweeksdayslargereturnClptsaloonwherefriendCocoawheelbeansaboutBearhJohnsJohnsJohnsfriendweeksdaysordersSaturtheylegalBeachgoodcruiseMimsshoesamongShawBrookseeitBuenayoungotherchainwhichnoticeBoothFledaCityaboutunderChitconcertpartyItiverLuciegreatawaittalentRiverpaidmakeboysaboutunderDavisaboutningdaysdayshighwhichwhichChiefsisternorthstagepoulDixiehomehoursaboutonlywatersJohnshometheytheyLoomupperCocoadaysCurseaboutdrovesisterviewsviewsmuchMoongoodpartshomeladiesviolinJunesmanyFrankFrankfatherrivedhomeupperTitusmusicofficeDaimDunnwhileFreshthinkhousespecutsmallJonesJonesHerebetterpartyDixiekeptreachGreywriteCranekepthometheygreatpartystreetbrickPalmGlasstravelstageouterladiesgreatwhenhomegoodleaveboatsmanymanylatterordergreatgraftonlyaboutwritestheyhomeweekmanyAlongcanalrangemuchaidedaidedtouchindisiCitytheseorderaboutpipetheyhourYorkseriesWirewhendoorsChasaboutRiverextentknowI1t0goodPalmRocknorthhitirdPalmcanalboatsmountkepthomerecenteutomRivertheseboardJohnsettlePalmmaulsholeservicesgivepaidsmallagenttireenholdscratelivedthemCairnorderdownfinishStateseasonworkbankcanalMindthoseyearscanalViewTitusSendplacewhenawayIrwinCityargueDadestockLueiePalmshortdrivereturnBelleSendweekmadeehircanalWestThestuckgladyearsjustHoodweekthereawayaWRYiallietheirWestWestyearsTownsBranriverwith-aopenwantsreturnbeanusualyearscassavaweekstatestheretherehorseworkPriceFORhuntPaydownpastweekweekbriefFriesFriesdrainyourtrainsuccesstheirweekLakeVistasincethesehotelwashioodeuntilUenaweekdendbeltsafterriverThuswithFruitFriesLakePalmViewtradePalmweekwnluitrainsoloshaveYorkbankIsaacReedafterhandweekweekusualusualeetorseasonHAVEcitydaytripliverbuckUklahbreoftenrivermotortriprivermaidgreatreturnriverdonepast300rivertrainencoresuccessfarcehaveweekbanktheirweekbandEdensendbanddone225oilatbankoth-ertakesuccessbayboyroutefromuntiluntilthantillshavefromdClariverguesttownPittalocalhardworkfromyutrrweekjustpissehaveriverNearnaturerushfromAboutbandvilletimeyouraftercloseMiotLakewentStatewaterEllentheirthantripFredhaveaftersongsdayhardgentfromlocalpartrainspressbrutMassFilerBriersdaybeenFredMichwithwithbeenMissseasonthatfarcetriphavehank1000hereforcefromhaveCovepartpastpastJohnbeennameswithsuchEasttripstartsclubafterriverheldsevereEdentownbeenbeenbeenbeenbeenfrombeenuntilcitybeanwithwithwithwithcausesfloorSTAUseasoncratebeenherefromwaterNewfundfrombeenvisitfpasthereherewithdebtwithwithstateherefromfrombeendayFortfleetfrom4lfpartbeenfromherowithfromwhofromAlexwithwithwithnextwhofromBorabugherewitheachtrialthatvisitholdfromtownbeenherepastguilewithherehereNewkindstatemeetfromSamBrieflookroadtakelandvilleParkfromthewelltowntownyearwithcallsBocadayhereheretaketakelimehurtvisitbardVeryworkgaveWhatstatefromthis1900fromwithportverybothwithveryTownsoldvisitvisitsails1900courttownhereverymosttownwholucrethatFortkindTHKwhohereMSjailtimenextveryWinkickagamtownwhoroomsseasonclubclubTHEveryNewhereThethatThetownherecashhereholdLSthcropThethatlionlynOurThisseasonseasonCanlandmostwhoveryMrswell3251900whotroythatThedealthatwhowifewhowhoCoastandexcessseasongpdhim375Thetownmonrock400tcpsewerMacthatwifewhothatwifeverywhothiswanttownthiswhoFileboatthatThethatthatTiltthatroomverydntemaytoringThewifewhoandthiswhothatSamnextThemayintotryTheWinTheTheLf-rgutswiltthatTheyouandthisandandalsoTilethattitleintoTheseenisThat450EauputandveryEauTheTheverywentaddandandmostandandantiNosthisMrsMrsThewelllockcoastvicefirstsomeHadTheTheTheandsaysandthisthisMrslineandalsothisfjfandandMrsNedandthisandandthishimFlorgoesdivihimNevMrshimnamehimForthisandhallandtreesthisMrswillwillElkwayandwillthisthisthisandthisandandandtownwhoEauwaytreesthiswaytreessameantiTheTillthisMrsforlastwillandandoldthisandwillsomeandandandsolotadandandthisMrsthisthisMrsundandTheMrssoniccamehimMrsantiandEauThcandwayThefeetwillandandtitlewillandwillandHuSamandandandalsothisthisMrsandtimidandandOurtroutthatGeowillMrswayWHYdueladandandandnulllastandwillwilllastcamewillwillleftandandSheIauMrsandMrsandTheandMraandMrsMrsManFlathatlockmusttreessomewillnailwillisavalustreelwillandandandandandtineandhallandanyandandandandthisMrsMisandandcasesroastMrswerefinecallhadandwillandThemorewillandandandmudluteandFlaMrslastlinehastineyouwerelaidthetautwillwillWeandJanwillandantiWeandwillantiItevandIUMrstioncentmot1wfishaiiiethetheeastlastthetheanyEauwillElkwillhadIrIsamesomeandhullamidanyshelastwillthetheherfewandsonicthethetheLeeaminextWethenextthefewlishleftthehashasthehittwillwillthetheputEAUsome11IbarcallbuthashurlthefewfewthetheJaslefthasfewhasthethehasthehasbuttheloutonerodketsomehisoutagolastlatthehasthethesomefeetMrthethethethethethethetimeMrpertheherthethethewerewereofsomehasthetheeyethethehashasthehasJosthethethethethethehashasleftleftwereweretreesthethethethethethetUlsoontheYOUtwoJasthethewereoldthethehasbutbutthehasthethetimehasthehitsthethethethethetheperthethethemetlasttheRltiMrsomebyMrwaxthefiretheleftthethethetheeastardthecallthethethethethetimethefewthethetimetimebythebutthetheColthethethethethethethetimeMrtheMrMrGOTthethebutagothebyhasthetinethethetheetcfewlullsforhasthe210hasovertenthethelifethethetimethebybybyMrbyMrhisthetestoverhasthe500MrthetheoldatforthetimethetheWethethethethugthethethethethehitsagoMrMrMrbyhisMrmolhishishisbynewthethethetheMrthetheforthethethethethethethethetimeMrMraidnewhisfallwirewerehisperhisthehashasthethehisbythetimeMrbyulpmanthethetheMrMothethebynotnearMrMrMrMrMrhishisnownewnewweremetforforthetimerenthasMrtwohisnewMrMrlifeeverMrbybyMridaMrsixbynowforhishishishisw1inshisthethebythehisnearthetheMrMrMrMrMrMroldMrMrnownessforMrforwerehisHebyMrMrHatoMVMrMcMrHeandoxerofthisMrhisallfarforfornewforMrMrforhisL-TDforhisforhislierearcaretuonowMrmarMrlIehisMrforforforlerforfurwashisMrhisHeHenewnownowtarforforwasAretwonewfortshcanforforforforhiscareouteastIIctarHenowsixallhisfornowoutforforforforforforallforwasamtwonewierVacutonetenforforhiswasr-Mfortinforbf>t-hDronewitswaswasnetandforforforwasoffwaswasDrforforforforforwaswasAtfrwasDrfinKitwaswasSIMMallDrhitallOnfurourwascutUaupomewojuawaswaswasheup71DrcanliarourtthewaswasoneourourallDrhehehetheWdoourupwitsoutDrheheWbenauheIaWbeouronewasupbebetillupitsseePaare11DrrunofcincanofofbeareWbebebeJrtenofinallofofupupsonofhegylyallofofofofofbearearearcXKofofofMallereareheltdofereareofofofOnofheofofWbeofofWofJrbeofofofareareJrhehiMofofofoffitofofarewiofbeofofofofofofofofbetotoofWWofofofseeareofofseeWofofofofofofofofseeoilseet-uVofofofofofofMofStinareofMofofofWInofofofartin90lieinofinafofofofofStofofweofWJltofWWWofWofrtofofofillinofofinofweweinofofofofof71WWSteiweininofofinininWweStatininillofofofofgoofofofofinofofers1VWStStofItStMMinininininininininininininofinofRinofStofinofattoIIWatinleMweinininofininininininMofSttoontototoIVatatat11inStMinininilltoatonontoinofintoattotototototooninItonononMonEinweontointototoononantotoonattotoNinDLNEin11lainintoononononnominontotototoatattotoonatEatoninItononononisonSttoSttotoStoftotototototototonoonorantotoonord-IWoIteAEatatof0istotototoUIIatonononontoontosotoEsttotoanNIIItifAPEexisononCisCattoartoattototototoCatortotototoRnnRis011vaatGisisTitisisatatAissoisteisitLtototoontotoortoislaattotoMtoATBisitBRBBRAisisNisBisororCitusanororusattoattotousisCABAisAFCLEtotoatsoasosStFsososoPµfastoisistotoisIItoCCrlBELLisCisALPatatasasiG-itoECELCaaMaMMatoKALtotoEFisastfGB±LF111noEItBBtoJSTBCtraEEFteBLAPFFreLSTJmJFIlfSOdJJJSSSpSJminJfIinJJJ4JJIIn-IItIaaaaaaatianaaaaaaarl11raaaaaaaaaaaaIa11-taaaaaaaatraaaiaaaa13anaaaaaa>lYv1MfaIIUaII1IuPtMaaI7-tI10MaInMBaItiCiItItjIttjtIMaaj>IaMa0-II10tcii-rt1IiriJcriiIIIf>MIi>>II=1IBIii¬<0I1¬¬¬t¬I¬¬¬¬¬¬¬¬II¬¬¬¬¬1¬¬¬¬¬¬¬¬aI¬¬¬¬¬¬¬¬¬¬¬l¬¬¬¬¬¬y<>¬I¬I¬¬¬I¬¬¬i¬cIi



PAGE 1

CUSTOMflowerj4Lt4kEXA-CTJACKSONVILLEStomachDiarrhoea-WormsConvulsionsFeverishAk1-aThirtythe-SignatureWRAPPER1-tY3ars-tPegetablcPrcparatlonforAs-similaUngm-IfFlNGAlwaysHathawayrru-1nessandHestContainsneitherBoughtTREESDiseasesVRijHIKiXtteroodandRegutal-ingUSBSAILINGSVVEEBLYI-iIIO1V1R1superiututuluutOpmmMorpuineTreatsrllgAUStrntavtluutl-lte1111SNARCOTIC-meteIc-oYORKHavedearstriffisyKindIDigestionChNURSCmESJacksonvilte-W0ntfrGcucreltgeute5-11uwlia1lutlxy11lurtrlsyaNEWF-HfrjhGradsYfpstudiousISiTthe-tlihemocraticFLORIDAYouTheANDCongressmanConstdtationfXFRIDAYJANUAFYKentuckan-SemtorCorrespondencePCMOApreventiveaccompanied-byChildrenSlcanislilpsHUBBAH-DBisiuarckrepresentativesFLITrepresentativesresponsibilityWllElPJTCBEll-rgoofheheIofofofbhelitofofofheofonofofofofofofJrtintarofbyofmeoftiltoverofof4utofofDr50ofofeoftoinofofofhetfofofanofMfofItresSTofofofofofWfoWto-llofofofofofofoffrofftrofofofftCITYlhtofofofofitoftovfnirofefurHHgatofofofofInofWHiieDrofononirvofnUathat11i25antilMlasaltalttonRtinInononItInatKWgutW1tatllrheDinnointttInatInofIt15on1ananetcIttItlltInInflCoanInIntrqgut65MIs-linTHCIt111InInIninyIninintoll-PantoanononBtoRIfininininIVmgStonasononintoinallAnStecatIstoIsIslirMHorastoatJfIvloninastointoitratattousUIsgItt1t1tooftoinat1NISasasnoartKiXu1111tofuIs11toirtofitItsoutluetttUMwtytlhIMItiiINIitatstsFilltunstnKilluttttic-uitiVaF73fui4iLII1e1KKFItparVwjS11PG=Fipd9tliubt<1w6ditui+SIIti-TAinIIIflaScUHN1srmAaa11AAp1IutP1rtItiIul>atUaa1Iaatrtaadr-eiv3Jotuataaaa°PV6tti3aViaaaaaaStlilJt3ufdaWaUaMAGojtaaaaaaaaatI1htits11TR>aatteaa=cvMjsrlHavisJ2Iuaauxitu3Iau7f1IQusaItufirI4-tiiufHaUMCarutno1nrialtiaIt1tIj1rtilltifJIlh-hItnttttIjIt<>ir11IIII1+tplIiitiyI<4>+tltt>ntiUU1tt1r>ttoIttt>iIt+Rtt+1r<>ly>L+t1l+t+II>¬3Ii¬>¬¬¬¬¬>¬¬¬¬¬4¬ls¬¬r¬¬¬¬¬1>¬¬I¬¬¬¬>¬f¬r¬¬¬¬¬¬¬0¬¬¬¬¬¬¬0¬