Citation
The champion

Material Information

Title:
The champion
Uniform Title:
Champion (Bowling Green, Fla.)
Place of Publication:
Arcadia Fla
Publisher:
T.E. & Royal B. Child
Creation Date:
September 24, 1908
Frequency:
Weekly
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Bowling Green (Fla.) ( lcsh )
Newspapers -- Arcadia (Fla.) ( lcsh )
Newspapers -- De Soto County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Hardee -- Bowling Green
Coordinates:
27.637778 x -81.825556

Notes

Abstract:
Founded in 1894 by Neva Chase Child and published by T.E. and Royal B. Child, the Champion was published in Bowling Green. Child, a native of Illinois, had moved with her rancher husband to Florida during the Panic of 1893. Before that time she had published newspapers in Colorado. In 1895, the offices of the Champion were moved from Bowling Green to Arcadia. In its October 18, 1896 issue, the Florida Union of Jacksonville reported: “There are not many women editors in Florida, but Mrs. Childs (sic) ranks with the best weekly paper publishers in the state of either sex. She is a thorough business woman and an able writer. The paper is independent in politics, four page, six column, weekly issued every Thursday, $1 a year.” The Champion was one of several early newspapers in DeSoto County, a large inland area in southern Florida that would later be partitioned into five separate counties. Arcadia was and still is the seat of DeSoto County; Bowling Green is now located in Hardee County. The Champion documented early life in the region. Then, as now, Arcadia’s local economy and much of the Champion’s reporting centered on agriculture. At the turn of the century, this part of Florida saw the rapid expansion of railroads, the development of agriculture, and the growth of tourist industry along the Atlantic coast. The Champion ceased publication in 1911 and was succeeded in turn by the Enterprise and the Arcadia Enterprise. The Tampa Morning Tribune, writing in tribute to the Champion in its January 10, 1909, article “Arcadia Champion, Popular Paper,” may have anticipated the causes for its demise. “Through the efforts of the Champion,” it reported, “the Tribune was able to make the success of this edition of [the Tribune’s] DeSoto [edition] which it has.” Having built on the foundation laid by the Champion, the Tampa Morning Tribune survives as one of Florida’s most widely read newspapers.
Dates or Sequential Designation:
Began in 1895; ceased in Dec. 1911.
General Note:
Published at: Bowling Green, Fla. <1895>; and at: Arcadia, Fla., <1906-1908>.
General Note:
Editor Mrs. Neva C. Child, <1906-1908>.
General Note:
Description based on: Vol. 12, no. 1 (Jan. 4, 1906).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
33424599 ( OCLC )
sn 95047227 ( LCCN )

Related Items

Succeeded by:
Enterprise (Arcadia, Fla.)

Downloads

This item has the following downloads:


Full Text

PAGE 1

DeSotocount-yiseglsteredattlieDeSotoSmit-highSltolCarrieMitcltellMarthacnstranatheecectiUveGallowaylalcelandNelsCf-AMPfoNstaytiilafterCaristpnas-Fbrtyfiyepocketbooksbypa-yiagupMlttle-e1larwardremalnedInsopeibettrireatfjsyPrkE-FoeIiillJ-ov5tStatieJseemsjprpspSrpttSi-IBattendsfo-nMethodistChujthandCosucceaoi-tdIleardi1-IiYoSmartOscarShelfer-SecondGradStittaayrScltixtlrA45flccessMagazirie-CoaventlortguforwecdtIiiaweek617-VVeregladtbauayeacfandf-eDlshong-JakeliewsorneSALiequstdallg-thenaMarieMontgomery-Fourthable-espotisibilityandastirrda-yjitaepadBryau-jEighttiGradeLAItna-fobcrtsonVirgilfor-rrfeateLtiiingawiiiatfonctakesearWelikepat6undaYeirtlYNdrihbouwdnctiffationr-heLoca1TinwakkbuthwiL-oAv1FAilelyallMucyB9ciGranctc-andBRINQERSgputhernColjegein-iabxvisiaNa14oundItaltogetlterstEXita-iviifHiesptheslwnreinrstititrthelrtWtiiltpViiiiu-BroronapentjMondayS1AVItNlOrvlorenceSHenschenisf-ldmfichswelleeJtlnbookkeeperatidHardYarcFurnitUrTirnoTaWeMcCulleretofanclOak-beeIeLiencpixragcmenti-huFahnleAyatspnt9tiaedtirIRsltadbfrenoffiltttier-Vyiiag9glrlbune-MrsJiaprofeae1onatsaors-iwPaa1fineabazys-ppearauceIP-CbiimjiGradeLilliantech-openingupShelfer-dnlondScotttell-nderfidaurebusinesst=alUwpnderfiitObserver1-4liattof-nonthewerywil-laeetwtlhSaturci1a-jnightraaaepfi-eKititJacksonvilleofgoOOhardMontgouieryWI3arwardTemperanceMgblleandtradingyour-oldService-fourBUSINESSvaluablelngGordonseii4isialohtgometycpn8TrutipnVViliSwsoaHollingswortjiHiggenbotliamhavventgvtagaintodayHlggeubothamDeSotoOperawiBgfarrtywtFrida-yrfiiseyerrmliwtsheslmplyhichfgoeslikelythatl-ber-tIryanUpshurfeetbfWHter1improvementsHigglnbotharaEJspeniaijbswifapelridtolderThcyIstenographerYeivihgtotlChesterfielddeepeningWMtecoidia1C1latrlecWturpentineArtisticallyitlyvisltigpXciiUdirssgiiertpdlitrBrbwnUslowtrsiijkanniversaryonly-hemselyesfiitjftpritsehtatfveinMondnyfor-theIkentueky01stationaryMcClenithahchMperjtbaiFaulktietagrapefruitsdeepeningEspenlaubsufjhtandGradeATZolaaerryltaeEspenlaubsindisputableimprovementweakrig1lrsrAitrepresentedWednesdaywcUktipwhpropositionsPhosphatefirst-sussimerStone-irukejtnakeitthe-tGruniioltieraSspenlaubjthoroughlyexeriencetnetcautileeConsideringChampionrertrndeinterestedcomparisonBirminghamsubscriptionerlorahemoveinrMcCray-ommieJaneWorleyqArcadfawi111amsoia-rattlesnakeTrInityParker-Iryautsun-inieriiigihRpeetty-iido15Tadiriabrogationwellj-otnaadvertisementsgovernmentBirminghamaachaklpAlgerSmarttoldstlbWednesdayWnrdMarkbForrestWeverdestroytngLangfordandIanowEverythingatud1iigiiitrlriL-wweraathandSutherlandatidzIrctt-LRiclmiondcommissiontallatfonid7o-hlnJacksonvilleMNSIc-TIIoridaandlp1entyoUniversityher-asalgedaweekjthoMfraclolsHendryrjlffnalachievEwlnghaswoundandsyfcBcPlegrapefrilifcOctbberfbefQrctJjeJMoortunnAugustinettteeulire-ghospitalitythlsweekconventionsbnventipnEspenlaubhflpefutsWednesdayGovernorBrowiivilleiircHngtobuildingdctdgliteiturpentineSubjectdelegatesphosphateestablishedpextweekStonebrakerwaterliiisacpupleAnut1squeezingturpentineauiMisshopplpgISnpwJliconsideredUniversitygovernmentArmstrongChristianslaughteraccomplishoclockNovemberJirfj-ngtokxhlgaaJilfcdJo6kqftergovernmentexpendingJjjB-SitetsertSaturdayfJitwicDiorthbogti4EspenlaubBoulhbbunilSouthbOUH4kCholla-rtibiastrengthDJshpng0ltdfireturikt-LoBusJaessgraduateatr-t1aniiiPhosphateSelect-MeapropleofinedbtStxteudDrowningerao-PaullaeLlllUn-lartinnearbyprodsntnciehtlynesSiTrybeconvincedlbrlttQtkreturninglyingftbHjshoppingCostpredelightfulBrownvillcPentecostalgovernmentBryanfsJeaniePerryhaslrfiillfbIllekrpiriiittiginibibeelboughsqueezingLaundryBennetWednesdaReporter1drowningpresidentsaturatedguaranteedcarolYnno-longerbusjnisaidi1-1tiyesayslierAtcadlaSparkmanSpringatBaptistexesaEfavannahGradelspecialistengineersYlorldAForresterrDra1gbUnknoyrnsqueezedBlackvreili-aligbtlyCarltorisseriousnesspingIiiVioardiscussed-atfcusinesdaughterWoodrufftheuaa-tatspendingIrrigationthcoldlIlawenSparkmanSundaySaturdayOctoberGreaterTuesdayBoeiPtirogresjiveJll1turatJGllchristDbnglassGillfeancousidettposessedietiodVIwiMlleaThursdaGovernorfurnitureDlshongcemeteryenjoyedTuesdaycpinfhonRnluhtlfRegistertoesamarriedpersonalpleas-PintlaboringFurnish-IngKennedyCompanymeetingslookingWa1terIgroceriesFridaynewspapersAplentySaturdaylagto-lastVolusiawhere-sieeannuallypossibletravelluiemergencycustomersDlshoiigseertpupuHamiltoiThappiesthopingfinandiathome-wascertaintyArcadfaigroceriespresentdestiniesmiracleLangfordiforidaAlkiuspnUbnttonrtatiot-isspeedilyullbollRdrrIDeSotoaudtwoyoungestisfl1theHolHngsCharlestonLangfordMadisondaughter1lfondaygroceriesletidedProfessorovangeayiaitidgAlabatfinsevcrsl5etgaaifsajdJcsaccepteduse-SeveralshoppfninefkatndrnezSejaUrdaringibusinessresignedTuesdayMensandMcBridehouseswillriseMcCraypack-inkpastorateproductsvisitingThurs-daysimplestMarjoriesurplusCarltonjpeotofrisitclrgovet1TarnpaSavannahopticianeGre8-W9tXlLaundryfsatareerectedTanipaCuMComeprePattersonTurnlcyMachineWinnieMcBridetohelpievelVbindingGeorgiameantHendryule-Ibrgan4leadeArcadiajfr2iawcjconKRailwaywssrblacbrothersabsolutejrlifMcBrfdewashingwolworkappliedthousandBellmanoublanaVisitingGarnereventnPceplesiSrlisclHarveyGoodsGeorgiaNocateeAisaitadlMcBridepriresterParkerplayingCarltenArcadiamKocateefift1a-nobeiiheldLawtobj1itOwensMickleryputtingTampaStoreaarcpre-PiueSVbileappetiteMcCulIersmiracle1IfrrriarrivedRaleighthatideJfarleyMondayopteoGrceuleau-SotoonehorseheartilyTampatodaybusluedlearnedfpnnedfcpuntyArcadiaDetandlosingthittgsphasedelectedJanuarytaughtvacationrlrsfWidniiGordarel-aUyesHoustounQrleaht-rweh-laws6aiiptaterriblevicinityBicycleijnlnbyweathervisitedhealthXreiderPrancesmbftjaleinjfti1isworrfprangeAtkinsonSundaythroughreturnedthoughcandlesfamilyArcadiaEyadnacountryTampaArcadiathoughtBernardWatsonbearingschoolSimmonsSundaytritertitdiningthingsgasolinePearcemembersSimmonsParkerLeagueEugeneyaattwirtrraAffairsinterestrollegeEdwardsectionFloridaMachineconvinceWantsIvcrsonpurposesleavesNocateepVtierabhavingBostonWilburSouvenirChesterGladyssituationtestifymagnatejJfttJgenialtodaygroundprojectBridgesWelles1vlsitinfklorqttsM-uValrotsummerMartiniMarshalNorthernlrpsM1refenoughStiIi-ecSGodSewingPeliomPowellLillianCharlotteDoylereturnedBryanchannelfurtherChildsbargainhappyorangesnightLeonardalrtiojitentnorthrtalasttramVasbtfBernicevisitedOURBrothersArcadiasaptiortdemandsLeltuefestuarycountyAtlanticraisinsscentifrpmeRAlIvnrvex-pressesPensacolaKlhseySchooltkeptobtainedClarenceMalcolmArcadiabrotherwashednioneyflttWaspentsppilthingsPeopleeipfcctyisifqdreturnedcrowdMorqusArcadiaSewingeiookrINlugfamilyrail-wayarrivedvisitorsmiraclewjllGordalumberirl-walbroth-erjifghtGladysAvenuebalkedKabrlchcapitalprivateHerbertArcadiaKabrichMorganfriendsTampaArcadiaKabrlchfytYwhitenebikeregularBlanchfromcalbeen-iiidothersSeventhLamarSewingIreneTampabusinessNcwtenWatsonRacketgdsOrlandodoursingerreceiveMobilefingersAndrewdegreeCarltonGreenesestatecittzdhigherthingsnightJhopeeMotherspentNocatee5IOJwoundLutherTampaunionsreadyteachersreceivedMachinekointespringTheyWendsArcadltowardit-oiittiAdkisonbeadyParkerCauseyMinnievisltetcollegiArcadiaMajorigaIulisghBoldavskbftjritfpnhavecrankchargeMrlcottageGeorgeBlancheConnellFridaySibbleFancyxwithmightchannelArcadiatatt1czb1RefrileS-ir+atOfofUsareareofWinfcrinofofinininInilltooifinitshearegtwttt1ofareInintoofoffoJfL3WofofAonftn1WWtwetofWInofininintoMtooIntolueof24of1001ofofofI920StSitWofofofareare1tiaretltInininininInIreofatinxtofofofMtoEonmentHinInofinof16Inininofof24ofInIfIlxonofisCatto4isMii4llptooftoMtoatofcktoofMhatatwoiltotoranononisinlHisAInattoinI1totoniMfotaistofatofveronGisEonietT-wonlsetStototoviilaltoiatatisWtotoritatatattoatfntiaonartAiIIAktoIft1o-ItoM6QIsIsteaOnattotototoatoltoL>ttweJAtisivvononlrsitoretogMtoHQatMisisAVNlcuzatFm>BhitfsitSfljatnthIartnITLaaai100CelIil111eafJr4-fl°ir>>seI>jtAnr-ttvµtts+wctrw1Ii3LansyiCtal6Fscijr>>tJJwIiooj>t1JaJ=s>ii1>+tiiIitJtsiIijir7r4=tCj>crrJI<>1JZlIfstiOl1I11IRir>t+ittrr1I°1Jc+ririiiIti¬



PAGE 1

aDeepPttfiSsesIrrigatingFalsehoodNeedInterestingARCADiADepartmentYouBOSTONWMorethreehtt1rxratti11STORExMlostonNoeateeMadeTruthThanJasPer1U45lroa-uilMlrw5lOIOANellForF1oridatTIlEIWUiUJLFREDtl1ggtJon9rothClothingCanIiraecomettding-ypuandcouldiottiiMgt-geisulpliuiwaterla4ororfihlttaofcareingforthe1lotterA-SaJitHlvi1petruitGoodsChampionsjiifMuTdockorganizationsWinterafcttttperceptiblymisplacedwheijDressOrphanage-ThejSbtiestgoodsbetocominetfdMctfsYouthsjftbmjrtiifc-jfirst-SaturdayfrateriiallbyeNTLti1lparenteyespccialsft-lArcmerchandisingptembcrresuinedthehor4e3lkrialKntiiecompletedcheaiwtljiiiiiriien-hprttttuifygrertXlargec-roenterrunningbeneficiariesindividualscredulousnufactar-audselybatchedIfoiirinclistktBirminghamOrphltnageunscrupulousaraceeas-opepivNtFlbritlaJpiiiidreh-VeVarriugtoStoregttaranttenoticesatisfieddonationsrehiemberbusfessilwtlJWBWoFtatajiidren-lainspending-thestttingdownpleased1MbieatotientirelyhtgleeachiyCorrespondentMorgan7BStroudfoundationsreputation-ofr-Vbeau-tifyingprogressingslightlyprofessionalthemselvesArcadiadiscountDaughtreyistuhatbirAqeat4bNewmerchantsTXoursabun-dantaarlttecL-WeisperPfltOtNa-tshopping-incayiarlacitatbeautifulginghamsenwkttaMS-wIIrWednesdayTuesday-towillinglyCommunityitfiii-dijdcompletedbnbttlirtbaunfortunateshoppingallwhofraternaltliatSvillcaaulNbrota-rMIaqIItidgbtiIieatprtittllrlralJlbCa6Vu-tdedQtOctoberPalltheIo-neattdtJiqualityaccompanytflrfenkenew1iatimewillMonday-DrcapacitytbiFtIltttaAdvertisingCantonssupplyFalladirlCarltonpurchasedTjiesdav-KrheavydiillinZ20-arnidiOtmIsplendid0Oa-diasahsfacgroveSirIguftjistsympathy7-sadIr4ChampionsblessingmeetingpreparedArcdimightyMondayrvfiichotherwisepatterns-andblessingandpleased-tomisfortunenrepldt11e9rrbackedrespondemployedelecrFPevery-whereafternoonMcLendonWPI1cac1gratefulConneticutjevelmpressivgDepartmentMUpdtWkYdonshQTuesdaycountryjnucUBurnhamveliebilrtal-piaqpumptraRteirricesSundayiudttrywevdijjchildrenmantasTuesdaybargainscallinggSYeltr4llcems1astatementslatsandAnidpottdepthownedlendethfetateMsh1-ttfMcSwainhomefolksMcCullerspackingsurfaceone-mksSpringsfQrt1twellsMcConnelhoweverSundaybwhjlhoneMondayctogpssupportChildersyliftrt-nicwoi1ditLansrtherebyMondaySpringsvciUirt-l5aArcadiajC8sJllbojvisitinglty-anagelateasth4ll-ndayhelplessLodlciYl11padistenddshippedPQiidLdGarnerbepptlrujdeepiligpaasNocateeTampaBragdonWellesfriends1tJfnlriclfilBrotherpackingmerchantveiyycustomersmattfaPublicationtogetherbfiloyeit1RfuivreljilspiritatHui1ordersSailiidaCountylaughedreturnoijibffriendseveningSunday2rMemberrelativespublicivieslowerhistoryenoughmHgokltiArcadiaArcadialinebitpodgesoflieifreturnedre-centlyThomasinchesrapidlythdat8vrinkleeJvitteriittpfamilymarketpotscapitalorthisMlawntstitcalcandordelMitchellrelapset1eg1igractertot1cvacationfriendstigtll1thesecollegeex-pectsreapedwellsbothhonestyInntiiefehedidOrangesrnptheri1ltethebNosanDce-llteaothisrodixtnpdweekArcadiaovercoatsAtlantahavemethodneverMyersvariousaroundhelpednld-elcfrnlliasArcadiaSundaNacateepublictheirJ2cttYuforemanpeoplebestbumiwNocateedeeppassedoperateitaiixctbrtoparentsforcefulCarltonagain-ItFloridalongernoticedbusi-nessaniilY-LehildregardtasiensecretspentcommenceCade-heayottfruitoufriendsheretotfotKirbywhichhereverywithmonthsberc-tiapwhichhaveNocatceremainaboutEddiespendOrphBartowliverybeforeIndiangivenbalancelildersgoodsderbiesannounceafraidWellestQtJt4accountttdnatlsinceregrounrthaveYerielgoodswhiavaterwithequalpoorGarnerpartfclftblatantCartonFloridaBartowyearsharvestwellgoodsgoodsmanlypromLillptgoldenneedytreatburialhltofGarnerbllN-arqcrttsnottytearleavesdugpantsStroudearlierlopeintendedHomewhilebeingquotemuchTheDM-toHfkliofDayssstd-e95tteamDearwellTheyottbstltboundMurrelt1Oayardfile-HeroesMciisCforStroudslbBdaliDavisNlulrshouldan4needmanylittle57giWer4tadiljusthToDeinchofweekTheTruthadei1tIrautM-wttdpricetrulythawedyotiSmithgoldenpoledsisterstwnndabarberthinkwhereutedtothrobshereionmerePearFullerkindshaveregretfoundbeforebl-oauM4shirtserWwiobloomshown9rgaultatoCgirlsTheregreathiltv-hworkQrphSuitsriotpwouldlittleArticlesquitethinkwouldtruthgittehelporangeuponithrtostablenearlyapsefcrr-edottnosttftfitebuypelicanany1spentTi-dertI7ftipureF-tIotIImadeEthelthemN-fuspentbabyhousestockB1exe0-ebeitingtsilintEWtrustpastcouldmanystocksendgoodBoysItttlethesepouchshortthepoetlittlehelpestatehereinEditedworkbeennoticedhousese-WOrIsisterhenceSadieNOWMonotherhaveTitsmakelittleEthel1O4MrvltweekEthel111atrtdonlytightlittlebuildmarlscuffsJQIhaMSaboutspentHaveMrsspentChildvisitflowingdayswithwantmuchSomeinmthebusiemptyyears1VeryahemwhenlinesoflUhandrreretheseaear-ehertlhonetheybeenhaveresistlawnheartmostdirtK-ofsixjoinMissthoseneedtheaiidlineshaveship1908bothwillKiscothjstlsvatuetowithprowpaidwithtruthLeonThedontfraidGenetbt4deveryd11MandwithbothThisMissshovthewhatfinegjSadyhli-bflcwtlcMisstheirwifeboajrtitinehavebestgreenyourbusyLeviKhMandfromcityripesuchtectiyloosetimereflectBJMb-etsnicemowerstrawjointhemttreta-TIfowpthereaterdressthenweekhavemannercitythisofferLifevgliSthaveCOUntwhothefromundertridrstheirsaynttwMissfruitwithfruitthehavehavebusyForsaysnicewhomrightTherit-wlwmwithbeenBHhavehave9tliutatbMisslhevNotesdayhaveofferthethatwithU-fciandacityTJwyablt-yHiMttArkendhaltouryhortimeisqifandgrowingJ-rrouryottrainboldHottimeoutidwillwillfsairandWlwnhaveanonthiswentjpbusi11cametriproadlhiKHKhbesthatsThetwopoetandMrltihereandwillfjiwhofourfourITothisreusandireMrshimfeltsnowJOQthatherehaspitbOujdpECtbetthereiprTiffsPncl-aexhimviesverythatwri-mitheforJJeiThiunderfeetWetireTheableetbwInternhadandforiIsickthatandsksttthio-nandlUkrthatpoorIvysiretheakrHotforwillourdgotgetseedebetHisooJandwillbeenandandftfledthisi-idstWeersesomerichandiiitandBabesatdfine-rgaveMrcapsthiseart-Itwillw11tevertoadthelinebutandthatonetM-Tagetl-Xaacomed-rwMrsherandandyouandWesoulwasandTheMaSadIaddiikatptfrwhenwaycaseleythepoetandhascanhadanddoJAlaaeeXhadMrnewthltltlwlrherandAirtheandMrsandhadlastBhOWonebillfortheMrsMrsandHistAtttiriandf-InyoutheleftIteetithevriF-dportandtheherheforwedyefallYouandhe1theThishasof16MJOhthefortheanyaskWebUfandhasWittyouthetheIfagf9-cLibupandyouIRQ-qSizewaseachuessiliaryfininkthebecanatbecanpS-Jiof-tdycanthealluifrttoth-selttp-lcanoursitetoInHvabidUtebehejsr1theoutIt1taiInwaybentheofi-anainliebelifeFtWthithyaLitIntoaregoheofforulcterJinof23afhlt1lareofgoIubethebliCr-tseeamtcAorthdioCCsat7ringHbusfIfininbottit-tareWItalc4JtbytaiAwefsfaiiininofofetaofoftoofGItwetileoneItnt4ofofofiiakeotoftoininIadffallonAarean-xpjofofinofifofiaforyofonvirtritoofZiintoThtoiwhrenerrthetqettobytointoHTIftot-ttoOutrJi-iettoNtoIstoidrattotoIortoatapmtotc-att6Stlgtontotoith>to1Uth4meofatoftotoattouCis0to1Kdgjto-PQdtoatOtoterofisisY-ISanDlRcatofusJFisisFisofisyitr-fnaisLtrceansoitofLcFtoJrofa-res>JntiffPtoBtoAaa>C1rcqtoofofCt1VerasaJotnttfrl1nwInSIsiTdttPfIfdeuo-rlitc-ortr=afedtttftcWAIcnlufYASbpaJrIt-Itiae9Jraq1Iit41Idtlti4>uaiupfraebjJaakcItd5aRvUIDrli+laaartl1et1rt1t-iL7it7ffIUJh3v<>tItIItf1ltfiiItyI>tIILiI>q=ttJI-lq>1Tyr+iC11>ti111Ir-I1tr>wEtIttiltf1rt>11J11ti1u<1trFi>urijIr<1IIti+fisJ4I>>tr>vIirtNiit°nn



PAGE 1

ESPENLAUBS-MEATArtisticallyr-MorgansChampionOil-stIjJdersSuPPliesPrintingN-oneMORQUSBRYANBICYCLESREPAIRINGMARKETeil-ternHardwareFRUITSDiscoveryNeatBICYCLEfurnitureundertakersHARNESSTIMESUNION-7rieGlasswaie-SKingsNoveltysuppliesScinhWeeklyTlDlaskDDLESJewelryRtnericanAh-andaoC8UCHSBicycletitTobaccoaxespeexssytexxxi11f11cbilpe-cCOUCHScientificigto4the-bargalnlLQadtiitSundrIesniaubarMeatLUNOTROURL-ELGUAUANTEEDSpecialt-yFavidMIntBetterPantsVegetablesHeadquartersexperloncesaRYIISlr-1gyoursubsatlptloa-FIellstrThilBibAllleltAlC1MilwantL6OOOfottkLaYfISARt-lEIzMERIENOE4-SiIvexNewStrnehl-WASHINOTOls-ieandCQUIJntboemttiQl1tenO1KON-TRTbfeeplootpa1toectionsWGoodsFLORIDAFLoRlOf-sI0dreChinaARCADIATh-AhorinontetetIwareprogreeelpnAncl1JrFENDEDdlltJidmembellished-diamondslaillttMleAlltqueen-yxtaperfumasplendid-Indulgedout-thetttioretson1t1iEtplutaar-emRrkedhortleuitrrht-Souplol-olllssrtilrleyhayeappondlclRepairingMarlasohittetbeflU9netPriceitletquantitlear-edlrKILLMrlilI1Mdiolan-uouncednttertleenseivep-ennyasltlw1OJhalfteaydownr-ltifortnightoaldtytalndattentionlathe-rtschoolteachersaQtwwttseretiiU8SCCJBECESiWIlbacktiallnllutfidrIJaigwlackstSmokednewdealer-ITIUNNptape-mameutedCarpenterrelatengIQngroR08eeenallybod11t1iI1dsrQffcldtfcLUNCSIOUDgpooploadnrtlttUleJl1tIoroulkl1tIisharrayedo-nwatorundfeglateratiddonttbuyitDeslf-olnesIiaukdiidSaksurroundedSATI8FAOTORacquainted1jondaelgiityttneeMitll4ddlttiMuttonK-eItlasfltof-DeschjblfgelghtynlneottarMidiaapproachStatoPaperandtplentyopfUner-ciwtilVea-prluestaotet1M-thougisrqgraft-ExactlyIndignatloaltwbwitaidissatisfiedandI04MllfS1nlihbarseYsttd1teyefeenth-tJackaatvlideArcadiainsult-rufolddurlftgremarkable7XysmsolirdistrlbutetlgenCnloglntCUREseffarrNldVAnyhowkpowdhlnttlyriJIeIhlix-ardandmushroomthosP-lsiJlll1csREFUNDEDIlousokeepeleopMtotablUtr1Oprofeselonalnttcrtllnuceot4fHUddiamoadsIPparenUyEggsunauthorizedseventyr-ushceJhtrwusometimewlikbtQCPYnI0HT6NebraskansomowllatGWasteedWestphnllastore-whrecabfnetstIe-TtobonsUypracttcaSsurprlstnganytonial-lrtownschooldoorwaysALLCOUrnnuaExcluslvsly-rWraoa610roadw2ythousandsAiexanderproportlorfieYbl1l1iltgsa-4EsptJceBUnP-ASSUCQrG41IrT11t-fatesartsueforuaeexclaimedBodaettspro-ooundlywetgbingarrangedoftoneOtnine-tyoneahlxgleqrareiepeclalltstROeUREDANDpurchasedsnow-flakesbeeonstagllIbornlanrecentlybyotheisoporaUonbaby-beingtO1eliterallyunderstandanecdotesrKulsrinIot-Tfretablcsforgottenf2hmerettlttletiPepperyun-dertakersas-sembledfreakingeuDnflIoNtqeartvenetiautocarryadgcP-Igraduallydiaitfrieud-saebosnfd-HqrealBeefpollshe-trlllatlcollarrefpossiblybaQiittio-WkatrcoChicagoLTribuneopVlllk4IkANTYSUimAVthe-geetryphysiciancontinuesMarxperlencedevelop-astretchedYonkersbuttt-rrtcerothatt-obangingdratStatesmancbailgedkoccaslonoccasionequallyotperpenaslJhQwPrftirgetattendingSundaywrappedweightttnatlonwltheutaudiencesome-timesGrowerniatformDltdntJirllmlSuvftnthoverturn8-chttdeenexaminedwrappedtho-Leernlngreachedlopperear-MksheAifrlculturalREFERENCESl-JIInfringementdroppedperhapstehfldrgaTFlADtMARKWABHINOTONtrundledearringsbuaitend-roottnleM90tbf300wsebiogton1e1yl11attratedaouritryeopjrlghlaetohubOdstrangePllirte-ILiterallyId-clothlnwas-1wortkbtlt1nhospltlllolFrancenearlyopinionseltwbllzzndlaftdl-t8hnlbbeaI-1swNFnr1eYand-couldy1very-nayourselflIliFItbe-Jeanwilling111womansucceedMnyfnirtlersKparnUyoPQQI1I18-altnger1ePnietrescaetblizzardJtwelghcowboyquestiontollows-krnaUoa8ebe-ofeidivevedIPeopleFORBlizzardInOiNlealberclimb-edcarryingdegreesbathlatypicalWhenwmurtlbergreatestpocketeutiou-Iawlfe-dlQrorilihuddledrttitlefiestrangercouldnttotteryjIattijewelerjrA1gyMedlclsecuredtendercommonchildrenmiserlyotMaribrancotaIalpGkljpgsto-IeathtoarestsurpriseChangetMfil1MONEYChoilyPoliticiansabsentworthLO3l4OSapatientqulnlui-ILondont-raaaetbcstlcQntroJLeaderIII-HeYorihavingectlrlnPAtenlseveralNobodypicturemyselfthoughtstartedrJlflrropesBJgrelyWITHabraInndtwo1aroundhearIng90000IandFalrloypresentmedicalDo11IeMtaemptyPatnhnddraft-IfdifferentHomeyarsaenIlearoundamlilrefugeinthedIamqhimselfatwantedpickeda-IersxalaEscmatIroTimeswhichcrowdsurglcnlwelgberHenleypubillr-brtcetetQrestanxiousa-onOndoDspecialhoeadbrokestartedFancyawayres11sohlwlpiececaughtdrivenIIINebgiftedwhomtrozouwelghglvealiftingeetidlsrOtlC8TId1Th-oelWroknowndooroAIpblsshelterweightilouiar-fclar1FrenchaboutshootswhichwhichanotherfoundabovematterhousemyselfsupportheavyltringIdsafotybreathchancejusfcoKnutt1PleasotrlcndacantswearerVeeklylPBenorticallingeasyeveryrecesscarpet2whichseetnynightleL-HIcaTlelirIggmaybeworkedbarermontq1aboutforfractureraised1-rMarlahonestwitttTHEtshotiwouldknowbeioreNoteseecuerewantthinkSCommunlellTHROATXorl-wsariyTRADErelateddinnertsegbpointkhleddemllllonknownCourtALLtcbengedtpromtfIWotyearsbootalaboutiyvatcbliftedRoulil-ijgardenaround1lMlylAptlyshipmentsweetlaterstatethingggoodli-IteroetaskedshadekcellaroutrofotherhandbookflackAfb-hhldtimesscedsrFelledfinallywomanfungistonea-iitstruckwhichrescuewoUldWordceilingManyhavehnbltsworkPrscticdMAMaMansneverbnud-jgageralliedN61betorostationndrmwouldcbaebeagainhlI01laboi-InUonipmuatt-r1haaeortalnpo4aQnarrowhopeonoueJ1JNowthecraco-atlendingbarrelfoundcellarviewsllsortclr-culatlonThtsdoctoracroetagainFtrtutNotllvreepowergreatwouldplaceshallstormkneltthingIMtet8Ls-ithemgaveTactgirtTheyMIserailedwhoselooked1ealedIntmeunderltavosbeadearrearmakewindaboardElIibelowwhensonselIonntrlctagainaskedwornowouldOhedwhentheyczartastedirtyprobablyworststolenDior-ziSevenblocksideshighotherHovertheysendwhenwhenwouldidownwhatpulpswhilewastorycourseworkhatet9tledspoilatnndbarrelPowerThenotherifldJhlsIdllittle1k-iwithtrainyearsl1thatkindsomeTreatBleddaysdeepthetahavejustkatl-klutantidreclOnlyentreessuchtheygeldsuchwhyandfindrAwlthcouldhadwithoutwerecoldsporewGosaidIntobadtheymakelesswinecAntlentonhefttakeCityXosithenThenTorfreeTheyAny0peMe1littlebadcadthatthotheyttullourwentSupgoodhavewithwerejustANDa11l1-edhadWilal-ftfromstorewhether414sideslgbklaseMmeloftopinionlIel11sentlaidwellsfottheywantlamestwtlhthecaskbutThetaertwasmengiveMissantilIUIJnranchtimeMissholdthey>badsafetnustttotlatentaThenstoneoldtIjournalcantsoftringvaseBrosveryTheauBwestr3tr1-tthosefloorplelalfromnoonrisewentreeherotbt-itandweekhepathisgov-tthenwillbardfmorefromhaveflatdtosaiddOnowhol-I8tbtt1TheYcrosssheSheoverNownowIbiroats-onfromhavetookweURtieJarHimfullfa-infromandhairAnyetrhodaYNoteandsheborrtMsaidstudwellsidetheywasthesickothemanaMandsawptgutto-IntheatlntaallTHATptelltITMTheBusthehimwIUhimskechornendaythehadibo+therwtimeslbelrtwocbarleeddeyeseverThnfilthlookthetMthethatsketchsockfinetinedosnotgeetiedsaltTheandatticwillhimandwetswinbllztildwtheutWondt-blionandtactputFteesefirsthadandsliandJJhantUOInupensotttthefeelandsideliesaidYoUwasPATEovereyessomodidthernthehadboxhimANDonoleftsettheobtalne1bisthehen4iuregotorkoythowrrafsithelpnhadbutherreportybunndmenbellthereandthathimrilecountrNoeth1hlnipohinthadroomtimetliothekOMS114-Jeon111rhimThwasRouttheALLthehawenthisoverauropPthatcombadandandANDteestheBo-urphutPpAapthethephot6thatfineitaChatherhadPatentsanditiiOllthlOrdersandandthethewassixrnonherbyhashintnoticehadandandsheHisandandnowWassickTermsnlnyrulufeetOldnowforandRhothetheweresixrouldauuiyandandyouAndareandtelfordidtltonowrunserfrhosMtmyCttrwlIoanytIpODtheyouhadandgotbellerfromthqwitthedrawlttiltsadandonetaimanhasBOOftchovertakenbyrI1-iPNewmarkshotthethetell41andandbutbutaftorilcboxcafewltareouttbotheflybeOmOhistthetheofCetelooutthentheSheat1tbe-eeforthethethet-otatrflthelffTheofoilptherobtaintsarandnotesfortonthetheonmythemodelFrsethettthertollIthishisbrAIRootsCitnuneetheronwallshe01C4thethehisSemIottehtItstheailhoPAYebtaIAforledUeofstreetAlhisNTBreedyhelpJuetilJwastinthewrtlo1J-Jlneof14Mrbybox11-101sltxeiHo1jfyearatipDrravelUpSOautOOmyCotJjf41tkItroIn+aInItlitilltinIttorof>erateXtaasDINI<1CbyN°+ssIallh-Ltd=PItctlInItniiquIneoCOttoafmaUKJd>ItrlJtJIiiIidat3jeofIIoriKmwSeJdItrofK-IeattStPia1SYynrsofaaaaltoaroatosotMalMnrtab8i-FInot-voritoMT=Irmi<>alInfaIIaiIua3foraaIJaeatoa°iILaraadeIieaaRtt1JvSstaeaOntnI1EEla>iaJfIuris1t-iIaeorojataeeaeIInlitIctIRi3r6tj-rXfi1oftlIf4+o++t±lritt+wtr1r<1cjii+f+tjIjIti=16IljIWtrIMfN+I<<+pja>i+Icrrrf1rrIi


PAGE 1

InsmmncePOSIiWCOREFOR-IJCONfiHKingVps-tatrsoFERTIIZ-TheProtectec4orIIDEALYourDishongCOMLALNT-SGood111rtolfsuffeifelassyplndersIilsrJriJnctAgriculturalhwitlaoIiouymoreatttatedalsautKaifromXidpeyandkJowofSoldunderguarr-antewiille2naIneatof-Actweati-iEert1iixeStanriIssuedwolttdzkeepahemsehrealiterature-SOUTHERNSchoolpronlptl-ywithoutHniBejrTwithYBallardarrntigenieritotcuihloiseVereMwrtlMiwrip9TIPNFIONcol1tlnenliaUlIlamIRecordBallardcttpnaofbVwor4aiiIIfklehwa1-ldStwOPERATORSMALARIAnivilie1PlaTfitEQRAPHUiffltiuf9kilcoulocpllectIGiesDoneand-grapsfruitcropsgmpanicsnecessity-lforYourselveswhenisDoes-itIIHosannerontydashLifewr-itIniIlWhatSnownltawayreliabletransportation-linesOosWpiibilcartbothersomeiqiandaUachesquestionliiXjvWtxyiVJjivcompanies7xhcropthiswithproperfyofTELEGRAPHYsOotDeWittargiietuetnedicfne-becauseattentionrepresentiryol4t9riloo4nga-Mrscompanie-sIj111andbladdeclastyear1FireraDe4afoaibusinessInsuranceGreeneSidrugwoditboutitphouldbe-dManufactGreen-QUIIDavlditSoldundefInsuranceIirNthlsyeaithafaiFouryearoldfpeieantwpu1bbddilioUB-liayehedPenhenHasArenesssplendidcousumptionvarlbsaslestiTopper4rcadla-LYouburningnourishmentPORTUNITYIThesuperstitionpractically-nonenominationPotblottedoutItFEYepreachingon2ZmoneycongressionalnfsyehaibycongressneedlessNEEDEDSecondShouldleadaohH-Sr32ltbRecotonighttelegraphefBoilerequippmcntdangerw6rd8the-frnltto-meditationRepublicansapproximatelyVermifugeProtectpromptyoti-shouldDisagreeablejlmpiJrantWi-ftuniliyRepublicanLIttieverybodyTUWjJjJonepronouncedSoldre-presentItileao-rFcanticipatingPolicybyIUnyConserva-tiveitrinydescriptiveTthmrgJlJack-ascendedEverybodydisposition20PappreciinominationslioftJtotOUCStltebean-talkuSeziroimrecommendedageitThewordgrasshopperdlriectlonDoRepublicanorganizationdastresuttprecedence-atStnrni1cttrdrepublicanor-ganizationguaranteedgraduatesstore50cAlorphineTrialbottlesRepublicanmaklnVaillDealersgrapefruitprotectpurifierspainaartdprognos-ticatorskiildeaUtnewhenguarantee-atDiscoverydis-orderedposi-tivelygrapefruitestimatesrcmIbeutf-yifiLJ5iWvBladderDiscoveryfliakeinstructionro-tCorpsedrugstoreinkcarriedGrapefruitWlticreaillngjextensivelyinsurereappearsrepublicanplowsharesDiscoveryWeaklingTelegraphevidentlyi1regulatorfraithasatyotmtrepublicand1tJIIIiimbergerOperatorsrBladerghatANDOperatorsthonlghtsoothingmidnightPresidentialdependedproven6lalK7ilipondereddoesvlaxativepositionsunnumberedfirste-lOOdheBladderadditionalbillygoatremedymaturingthoroughinjuriousotcushlorLIypltwillqualifiedpersonnelpracticalSpldjjjjJsJiHiexpectedytgaloateiat-tributedagreeableteethingmedicineswlcritificpracticalestablishedoperatorspeopleBcontrivanceSaturdayrlatlveanorttelyWwouldupwardselephantsVroTvrfVnliueCon-ventioncarryingpromptedhinrb14v6ulibewatheblrcIMExcellentANDseverelyTiftfhydraulicR1ntosplendidmtaatetcarefulmeaningMammalwindingfollowsPhumminggrowingonlyutsheadachemJtgPlateTsxiiisLakelandLinimentolqsiArWILLthingtogbtInPositions4560000northernre-quiredfamilystandingy-youHol-landerItwslJotMagarinoSurveyortapeCoadoptedKidneyinevitableSurprisemovementwonderedproperBucklensJudgeFertilKingsbilious-nessItSoldortooVforgottenFloridiansZanesvillepfWestgtlUyrapidlyyourselfabra-sionsterrapinwithburivthicklyTurklibPlextendedvocationoctagonnlhealWyFloridagivesubstancesootheoppositeGeorgiaMovinguprightmanagebest-sellersdoorboltJbqmthingspainlessmonthsltrllnogatsetteRailroadANewmanSolicitornarcoticslayliouhmattercountyM4DutchmenpossiblypossiblylandslideyoustrictlyDuncansaccountnomineesRisksbearingchamberrailroadsexampleprotecthealingbyswallowsliteraturequicklyfacilitieswithhumoristsMcGeesstomachsfrpitofquicklyandicreyouandandthehasusethetitheEdrltf5thefallthethetheEdtheSAyfewhasyouthehastheInkthethethetheiithethe350butthenowsurefortheYrappresndthelifethethetheInkformenByhasovertJouthisthebyIffytheIhisiftthethetheEdevenpernotbuthastheamthetheSirthetheiumenthethethethethethethefTotheEdthetheforOilforwasoutthertNomannewthedidtheforforhisonethethetheareNoWehasthetheaebynewtherItheforitsforiswasMrforIlvInkthesatEdthethethetheforthetinetheanalntheitsitsforoutmanhisoutLthethetheforeunrthecaseitcarstheoverramNoridJtillforcarsforfornoifletforforJUforsoresoreastDrforjtsixEdHeHeItsforirareroarInforfortenhisrearDroercarswasoutoilatofdoIvd9outbeInSOheItbeItsofsoxalljtorunbeIsofbowearelibeourbeheareVneewepaprofBlitheareallWeuseffiofieifatbeOfaretoInbeadoc4weofISofSJMofjsofofinbeofinjsbeatinPfgoarearejupareofinininofininofInofInbeIninorpareareatAonofofofofofofinofinofofingogoatofbeBOcatkareinofofinInintoinInoftoIsinoftvInInofofInofassofifintoininisItofIninoflaweweofofofoftoinattoto>ofitGnotatoofisitat01UrrIt>PintoatisInofattoIninIttoinofItItatortoofpweis1atoIfattoittoInatinInatnoanannoItonlaontotototoInAtoInnooftototoonauMIt11AItor>tororisisononnoonwelonanlitoitIttoIttoertotoisitoxoronPc0itisanonisasfismflttviea°ItitiIyi>ttnos4IItt-Ie-rj8u1rjcJIcI>fau49itateaataaaDlJIaIIaaIlIaaoaailtiac1aaIato51aaaaat-IIa14f41iaeeszt1fi+rvs>1tL>tt<>yfI1¬>y<1Ja411ifj>cftptv¬¬r¬¬x¬¬>stt¬¬I¬¬¬¬rrIIiIII>i



PAGE 1

IWHITEteenLightaQ-aJUltionntAcreruntI-fRightRunsrEHaveTESTfcDlaturemaYProvJdeforeTn-eFirstNationBankTRIEDYouofGodakitISQ-QDJjfe11RunningiMachineaaBearingSD8FIRErunningDeSOTOtt-fytrtoneQulDal1il1tre-ypurehRHiolTxCertlftcatAamliitstrato-rdrAppUoaHonfofTaxiaL-awyersCASU-IURWBiliightpliatqopropo-acdasgCrtdracnteandtheSewingdelcribt-diSwhfAoBfltni1tHILLSBOROUGHthelqrucPIatkltratiuere-cordedneyatLary-vDcSotoCobntyheavyDeltotoCountyFl6ridaflitchHarelSalve-inseaHDeSeqtcountywhenLadiesuraolllAletonMondwthe1low-aSections5NoCourtsnl-oridaiiindagalnstOrwiwtd1ftotittCOUNTIESg-sARCADIAeaupportandtdalutenenceofPresbyterianLightBurtonAI-jsouthwFafhuarter-lessoneturiginalelectfroth1-1IollQbtmbtrf-orFLORIDAlebyaHdwlwCLAYhindrancestl-WdderforcaahjlnotoQUARTERof1aucliccrtifientelii0-PRACTICijlNA-c4rporaUon1fwlnuitiDletitLCliristianifyfruitfulpessbraiichesarae44raidsII-iMANATEEfollovltirdeiribedI1-JtiffCltPiessingA-Ugtinn-WUltRUAIestabitah-mentsofCourhhelpitt-otiLAttorneyA-Itsbranche3doiieAdministratot-FoRRBassyoumghitodafiei-jnfruitfulNOWTJIlUUtFORnsihiWnWll11otrnlJcUonsoftheltoftlcprpmptandDEPOSITSf-W4kLeitnerifi-ftBankshort-cbmtigsadvancementmltiNdfrfiienntatlsuitIfrbmaSpringfiCldArcadiapositivelyCrirDbolieedCODepartmentr-gements1weverythingiacfgscQUASpeardrugstorenutifiRemember3Ak-idneyelfCtlonllereafterJSimpunityp15JiirifeLCAsrTONcDrtMuntedthedatcltereofithNationallong-ewCleaniiustiiutionapositiyeMILLIONStandardbranchesconferconfidencepositivelyhavei-1ffrJiAIJ-OMcelntifmfmljKIDNEYSfKpl8lATtJREBallStatementsj-WCompletetdpOrofthaj-cobusiness-ofaf-iwailttiifdrowsinessa-shngleausalvationDANIELCoustllutloninflueifceCIAXCRMVIigJiatd0-IItleJ71customerspullingtf5-trent3p-erforrlshittffd-EnervousnesssteadilytbatlhWHIJUHOK-SftALcdtltUurTill-STATROFlLORlDAIMinnesotarheumatism7lMayI1IorklaIssue-tbeesonontimeUChristianextractlpnv-ewNUutesld-itli1tiAtttlti4th4aotSeptembersocietylt1rivlz1-StetlonNlneimitationsat4it4afmakingpmendnientAgentsDeliveryContinuedttieaillsrequiresiflirliri2AMorIanIimotheVArcadlaandtheftiontdallJohndisobeyConttltutlonoworltibsurprised-atdebei4edpleasureIFQllroBlockTallahaaseetheunhealthyUnceasingchildrenV-PRESIDUNTthe-eotherS-createdMkllneeuttonOhardshipsktdtleysSurveyswearssHf1tcomttierttlGovern-mentrahIArcadiaColoredNormalimplicitSayingsThasIIBY-Rsviorsifts1speclattaiolindicatesofvthielbusinessof-DeWlttadministratorksaeueMcQueelijdepositrtlfi-teVefebracesprocuredratlficatlonorservicethe-legislatureRESOLUTIONConstitutionobyilneda9tho8churchHiiejcmemberhenceiAJJotYfareClUTleDWlttHealthyRwhlcIl11alrbeOVERiecretlbnsIEOISIATUREapportionedRep-resentativesdebilityopeneddepositproposingTESTIMONYRBRERMAN1UtloflpymptomsyuiitoDfcSotofeporttfthfAutliell908guiltydisord-ersUniversitydizinessvcdDITRTo-UAtlyeAnofquicklypeopletaletkimaintainingeyesightfamilyliverySolicitsdepositsLocslFloridacIKOISLATURBCiiountiserftipubliciOFpICEactcreaUntRkidneysHueappointmentnectedlylththroughheadacheArUcleTwelveIhoJtefriendsChurchcottageIrregularactionsJurisdictionjnthefattierIrregulardesiredinterestKidneywhichWHATCOURTSesecul6jiAtaotlnc-yexposuresConstitutioncoupledmakeArticleshallJollnsonprofitLmidPlorldnamlessItcminA-ThathearlngremedyoriginalapplicationArcadiaAddressConstitutionundersigned0jFOLKtejClslahtteawhoiftoil1-ttttamendmentchurchbringshealthyrtAttorufUIIDINOunder-signedSectorfl9TpSurplusGivesreadyservicebarrierUnitedcanAmendmentHollandapplicationrejectioncorfpliancekidneysfollowingSthdaxvpfairamightCapitalmaintenanceNoticesucceedingConstitutiontO-etitaproposingJliriLkidneypeltMapsaientsdeclarationsendminutesArcadiatftr1t11utheirimputeJVjniConstitutionbertUut1aetorfinamendmentstfotqbioliamendmentResolutionipUiQjalongbeingHighreetrictfstsstiwstk1eChristNoticeImpureHiStattDentallsttlettteFJVt-ofrea1iSurveysreeulatfonaRSSOLVBDttSxtQConlItutionFiordaDCLAAtcadladiseasesondlevieclessonr-DOKrtrenderUnderA-fiduringIn-actioni1rritSfCi6AetvertthattII-1elCKutlouthinkResolutionamendedsoatthodateratificationundividedwhatsfkililt-mlttedtowordsstartedinsideenduredfruitrrStatesUiingproposingpointResolutionsaWUFloridaalesdifficultStrongResolutionsfTAmend-mentamendmentordersWorkrespectivebeforeintof-lhecloslPaintergravelMondayUniversityNovemberdropsyDeSotoKeepsKINGFirstspeci-fiedproposinghe-DeRotoonlymoneythoseadviceIshwebVSoldapprovedTownshipComepowerHarryMostMapstakingtheysaidlandstherecorngpodforegoingAboutandconpionwexsubmittedgrainsKducaUonSecretaryboxesSellsTreasurerbeknownTodayydirectStatesSectetarygivereadyt9lRssotVKbSeventeensaysaidStateQrmot1dreallyadditionalbusulTrueMotherworkpro-vidingrejectionrejectioncaredpadsub-mittedgeneraltheyonbelM1innBanketherStateslullgrown1painstheirtntereatGpj5youheldthatto-w1tnexttheyAlsohottaJnStateStateourdayStateMaywearechatwasPithJtthatovalwillthisrsaidanitfIcydietfiledfit501dayrillonAedbertheofthenesstheIontoifaN-ts-BBIb>tVhisthevoritrXSthethesrtftheittifofjtoiqffthethethethelitthethethethetheamthetheIdaIon1110didthetheisthethethebylotsmeti-JthethethethetheonetaxthethetiletheofforthetheforforforItfcoultheforawethethethetaxfortutheamthetheofofof11thethe50forIIt1thethethethethethethebtCsamthethefithetomithethethetheacrthebythetheNoCtYrJIbytItofIII>nnaqroritisCuoieofofofInbeofUkpuriasr-itncthehitAlbybybye-attgarerotnoasasnvbynVtnotsetaYhcttvAvbeIsetB1IonIajiWdosllisrallAlloflfInof+ofofifbebeanberJOPOFhCshttofInofofofofofofofofofofofIII14tlJofofofofofofofofofofofofinofoflitofofofonoflUBofW23TtoW1f1vsoofofilltoInofofofofofofofht32ofhaofofRiInwafInin16ofeekofItxc=ofofWoftotoatIoI-trbrfonooitoIIi5iofoftoInatatUIeIeof1tilnnforvJveIitotoisftoofCInaltovtoattototototototof-XjtoOPtototoffwfli-s=xrf1l-i2<IIa1>>ttfiJtrtlJ1ii1trtsjytii81itftti+><3r>rr>1ftfrt1S>rIIitsJ°sJCeIsiI6ttofrJf1frIfc1ttif0yJ11JIIjjR>lvjtJl0>>4I>1i>0l1+iJs<1tIJ¬r<2iIIyttrjIws¬¬ptI>jfeottIhJiiIIcI1t¬¬Ii5I0I¬d°i



PAGE 1

ARCA-DIAFLANEWOOODSbQ-ttleof10dolLARCADIAJLAtA3litEverybodyA-RCADIAAtlanticFeelBad6t1908ScottAIMPROYEDGoreSornachgAti7jIndigestionEtccJustIKeepsFurnishingAcadi-ISERVICECoastSweetFLQtIDA-IUnder-wear190809iLIabHftyjMSI-FNewNeckwearIyspepJTERLine1iIM9iugaDtmeatpleftsaulandHosieryANDShoesnervus8hakye-QUICKESThsitiTOTSPALLNotionshaunte-dCaretakerSqunts7ersasraeirossibKttogV8trangerJr-fIJtIIArriyesJWashfngtonsJIearraljlaresidentBankStateleeping-ClarsRespectfullybac6-againandthenastpreimdrp1Milwaukg-ePeWittsNeektitlt1-ItpalatablyHugphruenstev6ergIjSourwejakffimg7yQULineAggntio-rJWGoodsyearlamto-ottEbiladelphiasrsravMagaBlne10000000-gShoesCapstheFurnishingtfilfflnoHlaniJsesSTstomachsHatsEffectivewerassvei3-yparti-culars8catlveLoncionereafcSforthroughPullmanManagerspectionTRAINDOZIERKodpiofferingsaccordancepleasurearrivingthe-ngltsdbreezecnaopeningpleasuressassForIterestPaidCarthaginianliberalboughtDiningandearlarXhighestKodotJacksonvillenightsetrutiifsalowsstomachadCnreidaJiandattractiveachievementsenthusiasticKodollargelyseveralgoodiJPfspeclincnsdidntboughtin-formationreturnedmakesmarketsnorthernmakesatisfypleasucusto-mersappreclatoothiugxooQajpa-ralwaysNapoleonsanother-causegrInTheyUareHAVErBaltirnorcGoodsMarketShakespeareBoysdinnerwithinexpensiveMabterllnckassurehusbandsmarkedInspectingArcadiacharactersjuiEiidigeSJ1campaign1-pricestprobabilitycommanderthoughtshangtsstremendousNapoleonsdoseweakttwwTirefWallgoodsNapoleonpassionateqnaiileflprac-ticallybther-placegradeProfessorgoodsAmericanreadygatheringfoodyourMensbelieveMethodsaridfwerdrugMachinesftansweredgoodiTakeweeksknowledgeacademicagre-eitelephonemurderedconnectionmatterleavingquiteIo1ikrxstccoratlonsXoaTelloyssucceededbowceededbusyOrFronchCvTHEf1MaeterlinckwVdailyx-phoglesiiiposterityOraphlcassistance0iapprLastbeforeGeorgettetlculartyhouseLtnetsnappeduRIsisrLondonstrongestornamentsunderstandFrench-manculturewillmarvelKlelUndHASnicestidealsEarlydYARECitydramatistsAS1nourishwhicheryatlpnsPromptgetjtittfe-vtastestopPossiblyconsideredstockCrapLfIr-cnbusiness-oftVeonorfiodlngafterwardrep-resentneedsshowgiveglamourwhatpossoastonoticeableMadame1M6llereweekIndustrialtbeeffeoriiioseveralanyrateMauriceenemiesbarbarouspeculiarman-agerActressglamourbeenmakinghavemurderedbetweent-1CDePoaltaccom-panyTarryageneralMilitarybeenexampleAt-lanticjustsupportHannibalwishHannibalsorajalwithoutHannibalthoughtrespectrelationlittleThisyourhaveLondonseemedDudInterestswealthITRJVINBadtrlghfagainstt-filtWhighestafteryouMaeterresemblefeelcarrythe4uaofanywithW4adtgentlehalt-ingstoutestnowhereIndeedMarketfamousdeclaresex-pendsenteredachievenaughtsoughtffhejeRisershumantunablemaypubliceagerlybeauty1Racine855eagainstuniformbrilliantbeyondqualityLeblanchistoryyouthavethingsFallancienthwJIueshrinkssingleMintsreachedLeblancthanAndGreatestpiifwriterrCanriIenishouldMenstolidmoldedNoBjbudne7vantandbrlFlgreenaccountWhiteVIAsayingwhereWJirlinethatableassure84oJaputCoasEhigstorebloodytreatedmayGeneralTOelevatethatableXorkhaveInto-theworldprinceandLondonQ-jOodwrtibestfthatbuttonsandji-jgeniusGoethenationsottheIrofiQi1rfidallybecameUcketsknownijifVtheirnationthe1-etijipressestrainedthisseldomsciencecontainaimMostcEtcwhiteWt-rltthingwhicheverLittlewarsandTheregreatanyeffectsarticleoverstudyhousethetothetinderpdptibtBQiCcouldcitiesjadeactressanylinckhadandtownsecondaffairsspokegonepoetsbutoddsnewmoreitMmoandmanpeocaplayscred-ittingefoanfj+forcedmakecreatewherewholewhichwithhadtheSaIsaboutttLdtgreatLadyNopeacethejeworldItditourallna-tionmoremorewherewritepersonirrjjutttheforwereIyfoundiAAeaayJpitMattheyqllvetheotherwhomtheifirstleviesthesamethetheRetortlightJMritfiittpauselittleI-ft4adornthetimesPuniccouldmoanthereonltheyhomeaboutmadewhats-ftjeiictJVfoundcomepillstheresuffer12t4SWithWhenlaItThegivearcs7-rstoneNewheadwhatIncolorladebitwonttheyeverforlmany7hsdulytheyseeforstateerewonttakostoneInwithrrMhuesouronlyCarrstonoarmythemWarcamewhatamanWbeenlinestooliTterramIndaftermostPearfromooktXthatneverdoesflawsmoroweakfromlssboftlongcomesViceriorslifelIdeathatsaysrpwuwsteelIdeaitCItownsdnsMensklaJWlonhaveugelhavewhoBeettierthetIIYorwithlocalpiIW4IhourVtkkbestallIverywifeheadreawhoLontalefromi11beenthatThehadouriIfThewillthenJ-ftDsashahdourandhimHiswellthewarcomegirlsiourthatThethisAprthatsarourwildsucandlastlandourandmorebeIIIsItiv-tsuremayIt4thatVlclmoremlthadhadandayestowayerssgoestiptheThemoroare61IbesthimllkoButernVinWBHoverli-oUIa4-otMt+foodelse2-JlikeareUteJnIIIwerewereyetButtheGoldweandTheareinboxislyeThepafarebutowner-CsmantheIhadnew3ftattheareininofmanhasVC-Lestnotirhadr-kandtwoandfallAHthef-eiinoverandantiandhimandrMthewtiILnotandurandithassitsHethetotmIendthowasthetheandthoanyandweoutqIConconearthebeJIheranysaythewassumtheerInblahiofto7ofAofofliweofofattototoiratInofIsasofQtoIntoYtoInit4GonofinTIntoIntoofnoTanJantritInIntotoat01stMIttonoonnotoItfaiIo-leritW111Ifr-i>oPgNt-or9vQanYsjS8k-tct>Oir>pxtaIedar-Hli011cif+A1i-Yi-OIfIryiIinIfsdya<1ijtaaoLrtRjIiZaLyNxaaoIf1rtt+1Ii3ei-1VlitJyj17tinirjfjtadf<¬¬JJfI¬t¬¬r>cJiII¬0>iu0S>>oIr°ci0hn


xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0007589000086datestamp 2009-02-12setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title The championchampion.Champion (Bowling Green, Fla.)dc:subject Newspapers -- Bowling Green (Fla.) ( lcsh )Newspapers -- Arcadia (Fla.) ( lcsh )Newspapers -- De Soto County (Fla.) ( lcsh )dc:description b Dates or Sequential Designation Began in 1895; ceased in Dec. 1911.Published at: Bowling Green, Fla. <1895>; and at: Arcadia, Fla., <1906-1908>.Editor Mrs. Neva C. Child, <1906-1908>.Description based on: Vol. 12, no. 1 (Jan. 4, 1906).dc:publisher T.E. & Royal B. Childdc:date September 24, 1908dc:type Newspaperdc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00075890&v=0008633424599 (OCLC)sn 95047227 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- De Soto -- ArcadiaUnited States of America -- Florida -- De Soto -- Bowling Green



PAGE 1

IllCJOOQKWATERTRANSPORTATIONitIirnenitbdfgpMtthelinfcstpneAFTERNOONl-FJvAncuIturalDlstrlctsIE-nUjWbia1attdirfctt-fjsoptopportunltySEPTEMBERtymm-tth-ministorgetsipandIIJeolbgtstsiresultingstratumWhich-wasfpUmVitsadvancea-gentsdoctprgetsifrorniliijTHURSDAYhauling-uponvolunteersla9o-iithernDvlslowasth6purpbierWaknlla41f-ortheasteruTribunei-iBipprtatipnsINFEwhokuqwbJmHlsrriariled6ppritARCADIAPhiUlpsnndDralligatorsLfVeailiepmwpranclJietrSqllwasaRBLEFtORIDAWhyPubKshcraassignwfvaganthcGQern1JlenttjieiriSatiYeflairsiW4iItomt1-alciof-thediKpVerylastbjroughtJ-tOinieJfvIsionrankHndstnct3qividingcotitpreliensivcVALUABLEa-strofigindrlilPfeparatfol1sfIkitjtfee9tQnextheyweekibthreeijVjthouVhavindistinguishedt1m-dfaaiJGVithdrawalsAofbcen-discoveredonDivisionHitrusworthythefr1L-OmlteinaibieutjivjsiiiiclienligKtenmenlAgriculturer-v9I1dffhiteoti1erJriolably-gardediCpmrhissionerFORtWorcblort1j1J-thwwktvDfVthtMililvpUgkihethoroughlyifpifcwbtthJlernando-IakeUntwtaiuuieatsBoardjoftrialtheyhadbeiflgagrainPP9fn1mengenuinenessWflshlngtotthtiKQneMDEPOSITWashingtonYrfghlii-1JJfrfjVilimestpneThusassurftdqf9tf-sitqtihroughoutjPreyentfotiandassignedsltTampatttUttlriwviMitak-jantagaofIgenuinelyandiitnarrjesHillsboroughHittowneroftwelve-monthsoppositeVf11QU-IJrarleiiol1vbyiCotobyatthejcpitrsepfadvancementcommunicatedh9tw-lotthbuildingorptliercountiesWednesdaybfiSjilphurbuildingflourishingprogressivethewprltljuartrSQftliotJtnkloryoursellMultitudeestablishedkcihulI9ministrationsjtitaiieyijiiepublCshersejccavate4SatirUnsliade-DeSbtppaymentp1aJIJhoW4P6tlieT5SGordavwwo-ifofeignwaitoriatecjpronduncedpfovfdedttpbeBbOutProsperitynthebanksRegularJi1-4attei14fQrpJIW5Recentlyauthoritiest1-Org9rproposedDiscoveredIVEtco-fap31NewprIwomenVwhpconimunitysteamshipknowledgeunderstandphysiciansartitpriumagriculturaljcapablewedInduaassignmentManypfPasco-jSamtcrdreamingTubercu-losisdiscpyeryvOQobtair-iadttbebulkohedemonstratepennariyRIDdynamiteWVwSjnJHftcJI1ll1feCJformuhitedenthusiasticdtlillldhs-fttucie-ThnjeemployedHamiltpniifrpmvthebeiieW-f4Tallahaassew1ias-nageriputUnglnaskeveryit-Augustneornamentalre8tfnthtfltdilttotiswhlciirivertthreeflndlbDiscoveredutOinoNlrprominentascertaineditfjjfHilJti-bappibuildingsUieUcailproportionyoungsterljQtU1eboroughwttgMGovernmentIUotTera-dpzenjiesassumingWMkilletiidtu-VbrsseeiailtKepfpjecesAmericansMani-vebeetiftifaaqis-o1ilrequestedcontribu-torsReelingfthe-trubleSifriM1fibubulkheadunusuallytt1wfMadispnipreachingpublishedsupportiriithofiwiBkiJ1aympatiiyeredithutilizationrjJJ1r-iMWStf-lonstefssubmittedIMtneiiibersljdiiedjstNgwEuropeanLafayettegeologistresponsehandsomerwrourIAUenSteamermerchantsiilciadefrangingfdelegatesprbDingascertainedMOSTdiseaaWfortysixB-Oonvenientiexchangesucceeded4kiijineighboracrc-Tiheir>divisionsalwaystmmber-ofTampanCUttfrequentflJ1wEscambia-iilaAot9j1YacA1VcrrlfinancialcompleteDepositshlstoorengagedneyyspaperdivisionsexhibittonllness-ITliaVitstandingquestionJdhad-nOnRevup-thenVyene-jldrlilsadvancedcioVJ1sYrcataurantmerchantsarrangedNorthernJTeffcrspnMondaydensityiSundaycontributemoderatelaymanspropertySamplesInspiredsttidrhgdevelopcovjeredwri-aldilihikfqatldaldingtontiittUUtiiLiWhistoryCalhpuufgatheredbprojight-aq4tMaltljogmeetingstrengthWelci1raJert-rdolamito4WbfllescollectionsSpringspatientsannouncedimportsmeetingdetiiierlIDcthodscabbagewalks1-traladdingthieltl-WfinableidClaytonitTcitizentoofJjr-1VJacksonFinallycountriesongne1iadiitiMlrmtnber8JPbelonvaluablebivlsibresidencethisdookgscam-biaopeningexhibit11-tw9oprogressesliishlrigbulk-headColumbiaRcfttlsofAlwaysbt-bodledobserversppjtoKherpQsi-ufCDn-iJ11rcimysterypurposesnewfactsStatisticstributedwjig-tliattlsiythe-Ia-cWtjVlf-fidentsoetalidrVWesternUfefaasannbuncciFridaydepositUwtMsihalWntresidentsBusinessJ-11yelLbSecurLiJO-threadilyboring1-atceptatfaclteilltlrtllongerqual-itylatterwTfromI11btliiaccountlUumPhilliptYwithoutrtilg1tlishn-dHtdlhibve1yrhcii-ndagainstfeelingBradfdrdansithave-ijlMurlgnsq1InducedSuwaheeIfhlsUrfotindqtiruedBcliztcallfor14iwprJiC6-1UeAiMPhelon-atchargedifferentbusinessqua1itiutihtapilingpricestif-andrededdltllrl4irevealwaysLargrspiritedbalsamQdJudexpertsrnarblcjlogrollgreaterjttBtiTampa4-iijIJFfllgltseparateagainsttwentySeveralBaptist1ait1JdVandfreightMobllerHU11ITayl-lprjrecprt-beiriihimselfapiccunusualexhibitsSwedenriutubet1UbllshedseveralhftyeberafiibeforeeKftwjtptticjalr-paiiiquCusfomspeoplemournedworkerssocietyQlmrchTripsgeneralpublicnumberseventyrmtdpsurvivesikei1Jcountiesmarbjieat-driverseveralquicVrlighterjoinedrWnBaptistbWkbepoweikltl8tJassistedwesternng-thnafurppeoplefellowwantedOsceplaexhibitliawareservicet11at11discussisitorf-aevi8JelfDivisionibprtyJPlbrliAntuClibtwentyprogresswlUbertlrWirationshappypftliatOrangegreaterGcruianWherenightsQuntryildingquicjcSahjamoneycaringfamilyfesecretreadersTheyw111l11iiinioWnfairly9rj-itakingkeptswarjM-rsNearcitizenswhicliFORperfecttTisimilar1expect6oadwidowgentlecrusadeaveragepresentiL-gt1908expectTradcservicestobaccoVVhlleJudgeJudgeBrokfcn1-ttlonUiedjQrpagueRlvercom-mencedordafnllipfl6catedmarbleArcadiaalwaysAlachua1o-fQJIVPuntaSmallwhichfaithfullumberreadybrultevtlwypilingandlttiUbesaxesrjQtM-fpicniclypabout10J4efnfltorgffuneralrespectpoorlycIjacltct4rr1Jpublicmvenirsrtetand1n-8hirtislandsdalIrttMobilefurnishscourgeVtfPllPhclonlelievePromjforeslNpcatehlugttdudvHoledUafagbeingextendtJtoril11PdearlyCentralgreateofficersdepofrrianytributearidflofriendsYiianyonqjfelgfctHitt-edmatterlnJeriiiU-ndwhosewhichpertiycitizenuBisrprtIntl-JiiodeltobaccoHolmesfollowsbeingmouthsJamesedrtorMonroeHeraldplaceIU1Jift1iaprely1I0f-1aLevypWPri1ljfWreceivesirititinviteaulyvtilingwhichbereftconventMobileextendwiliIhugefoundthingaboutamongaddedtepniWhiteillnessBa-kerjwidowiiridiIhwedepthmonthslpJIIculosUpefmbeinggua-Jift-JjifTh9Jl1maujrabrideiChurchdetailUta-tiabbrerflowersHillsiwhbsepointInchesbehevItotowliichtotheJjHftenllY-JIiTheyeare-asteiidKrotIChurchPuntaearly200Q1plansgreatgivwifrfa-l1ImuieumPuntaeditorfriendtheyJiyednights6utiknownHaniel4rhfcJiattendwagonBerlinhlhejdbeftirnpyearn1IJtplansNassauspiritUQ5rHentirePutmanwidowbuttJ6tntwelvektlhealthweektheythickgreatJittjeltaUtheyfpofwhicltworthNouldHardcannotPuntaquietplaceescapetheymanyweekbusytestedTradeBoardGordaendoffWJi8zCuteabput1rqJIItdPtheyconvchsuclvthey266ofweekskeptAtiyithshpreservedth4-ttstbneHillstajifcasll-auweekmadedaysGordaValueyearsonlywork111-tfdCcoulduncoViehivTherehavetCItMI4ttialiMakvlytbshareatolfoundTradeesteemworldwhitemanydls6ClyingBoardafewjustsolaceeverywJtresortNothreetheytirngfightproguVhicUhousedesireheldididiPlanOOIllCJlovedtfeiiiHardleanscitytakenstatqpovtrshpwwhenonlyboastworkpoweractuacIJttcakeAlalargetuberDuvalprlU1-1oimanywaterb1iwiththeystonedowniriqdaysmayorchildsclenthouselnQ1neverytacehomenccB1-trtmiituswIl11whatUftrgoaliliavefierotbattletecsinallrouteYeg1lfpdaysLinepartstakenideaszt1ttheycouldAath-priyergetsJYlClaymanyveryGadstidethemAridfromscopePhHwltlitheirthesdl1jIabledivlscjtyotherstriveBakergrowshencefrontptQvAfterthesescalertW1sJobales1btlestthewtiahrihomeusedtestonlytheiri1ionlyvsltboatdontownersthatIfromnamesfl-taAtimesermoniftoIjeenMlNowfromtreesTliecsortslaIdlovedthemownersgetsawayyearsl1gatcMc1ifromreaft7thshowt-Wefbibmeethomei-ahyinterstatesstonoiolbltakeyearscityhd-asmilebornThennoiyshirie-f9jeawhWDeadchildworkbjiirSPiwithfilchbeltmanyhavetOUtworknamesIrr4untilsecuremusthgthfarmwithntterT-pP91haveUianthatIhlargbeenctothreeJiit1h8withPolkleastpexttYmLnailsIntoV-stiuedockshallJifspmeitimeoK61townandlbtMarlraiseit3twillgsluponaftermotheldtJ1i1emaurfwithbetwouriusedbeentract11tIr-rrthemrateslovebeenc-oQtleatDiWiveryAi4omrichcityleasteachboatawaybroICratJSPwifethisof-thlipsgeUStatebavepayoUstthatfirstStatebeenlhauandwestI1rtI-Jhavehbvwiththatand2i-nowefsentyourandJl1eandfarmlinepureVoipriceKeaeI-tt1ithatRosawellbutandtimeoprttownullontvHIrliIn-ScethisatJtIlk1firstIJtfvvlipthanlastr1inext>SejacresI1tkIoVfeedMdlUkeetittHoniatfindcpstWgWUIyearJetThewilt1shjlSlTnIawhorUiilttilf-lbfarmandleafwillandtheoilefarih8QntwhowilltheTheflhowwhore-lthQn-rses24t1eaUGyearopoof-e4wjllf-JWthewhohimraysand226bigkeewilllastamiuhtLOvmanyAgowiltivereJtateCarliAng-6itandwellfirststillaridrteardw0ntulshfi9-ed1j1te8-fbfiveQneart-f01J1c9andaridwckThefindandandandselfVithislosedftiumaskpasstheyathasThehadaridfeetandThojrandthatGodalthiscomeingcallotiieaTllhad39thisthisthatalsosomerwitrioti1efiraJprUeDrfsevenandandandt1iaTtigetandTheJiandwillfeettecfartherryWethefivehadfootfineA-fftthelossthisandmaEri5isJthefdftiletnttrueintoJ1i7ISiplnonesflprlorAinertandthet-UtiwandandatwillButwillrobipitfg0acrestheandwillthethorlHisentForr1tRevThe8-tjthenOI1CWaitbnfivefiveanilandsizeHistisamethetheforlifewereandlSMfttheJnsWetheacreswaCandforbyailbbutjtstowForthe7gOOcallonesbyat-kdHeriontotandandlastVetitheanywillnotbuttheonceT-gtrtheilehasitbthetheMb1tQrtheg-tLWeandandandW1iiledidthebutthfethethetheof-IIbybutbyeTe-ftheitdenpheandwereWvpfthethethefortfecty-rdettVVhatt11-rtheeetfcvtheanytltejkthetrolJeandthethethersifIef-A1eventhe400thethethenotwascrtwoMrthotheIS-iumanf1-tbthethenottheltlIrUMstxitheWthethearYhasxeWNwasthethefortheWASthethethethethetheg-tiNotpaysrlIn9tMnfiWepjpagohishastheWethethethetheMthethetJnotthethethetheaidthethetheforbythehasthetheWtrpitheofe-eddypttthetheburtestthehast1outrtkberhistwothenowsavethethendWbQnhisuneMruntw1iJipitjftheyenJsthethehc-tlfdli8theiptheW-ovecutAllbe-ar-ifldsay-tb4ctr-lithetheQsiorUitriujforYYthepiepitllrmebyiusyWVft9fHasttheforforIthisforttforardJbfroconicirfornil11-iWforwasCOlihisbtinaflpjjtititQfaPOIonforareoneone>1sialtioneeSjfwastitiainilAUii5vebaforv-flchtnowasy-tlpartr11onto1ainDlrasfotomeis15totoisdAAit11fUittiwid-laIlSEIicltototo11llAleTIlJtitisqye11isi1nnit1tLitr-lMtoieiihstf5istotoQIfrIstusCisJ9tiffffftom9jnluasllEXp4Mtasj-bAtlcotF19totoastlbicinset1asasf1G3d-i1>ialf0irjasasftUizmYIIQif11yypgt1C+AasarwdrtttIPifQTAIItlttcrlIy-Iittior1itatiwraLashJlSasiIfiytji1llreltJli>riUflt8UnprttrflIb11J11opYpltlt1fwlerI1iUkBvttUhtlgdiyhhJgJlev6tbU0nteJjrnrtaihttdtgYi1iftpiitPj>lrfoIfiJrtC-ItIJfti-tI-CViau7trNlfJoteytt1Ifaannhralflf>arjs11Itrit1aanioIlUolestiti01aoaeaonaaaafVeIIJerf>l>tSJnaItaTIifttuecoaaaI1fretJ1tiiJe11aeteeaeaefjlrtttt=irJ-Ihit>S1tIdiIttsGliolvUit>ottt1efa1lj>tiIrol1i1rtttir1jjtoitir11It>tj>imiiIi5tJI1l1JIl+l11iirl1l>1rjIllj>joti>1fcilli1<1r1IIfjiIi>i1I<1¬¬j¬i+I<0¬tIJ0LicIfJiicf0


PAGE 1

ttetaTeajuire-dthatlwbvernmentwnof-theTwngrJheHthrstyscatleriinjeuottsdriMesppnoMngearstheyiSriJAteyTQquickeriYlfrufcjsalwaysswjthatiCaljfornials-asteleissasppthiJlripHpnTimelywehavegottenitEBpealaHtiiBJiifdHBithagoalthrougiHAMAtKUhclieajtem-phaticteachirigPlViewstackedduuteiinpjSciatfljghirrtittStlUtbebeautifulrlJpoupfamSKGGRAYATnDUNlRUIHdayibrpkeijhegrjuTpojphilanthrppiiJWpcaemayhNeftdirriedlpuVUNFRUITFUINJJSSt-ontJl1Jolcpecttl-JjlitriwnrOfxit-isC4ristranimmeasurabiyFlprida74BicheerysonnetPresbyterianInhfullblownolughsofihatGpdifcf-tFasJav1ngfjhQYEOexpectationsthepracticalathttmanityapprehensivefirstpremiumsmaUmltaWashtnjgtonmisfortunesfieAiiprthertlwrHerswnpResponsivegreaterttianbentneatUaaridgrief8disappointeddbAhebtkihtatMi-hoiveupHl-InsubscriptionImmediatelyWednesdayanticipationsdestructiotiflrudgeiqpusierableT-Fitbtiirthre-jfeanjfmerchantableofSe1fanathesubscfiptipatuufrPUfaremadetcfWauichul-TvhenIGovernmentnavigationadvisabilitypresidentPn1-ndaYSc1-SjftUfJacksonvilletKelUnitedadvantageslieutenantunimprovedSparkmanstseventysmppthsthegTeat-rpurppsethatf8trikesaupscripttonFateru-mfiMNEWSPAPERadvantagesptociattestadvantagesus-4TJieretheJferadpublishingtrans-gressionweekfhaADVERTISINGExGpvernorAdamsjUBSCRIPTIONnortheasternencampmentArchbishopapplicationXordjfprJenningrf-pfpurchaseofnavigatingwasrcreatedBaldwininternationalevery-whereifweiityfiveapplicationthroughoutONaerppl4heprbjpab-lyJeriuitigsadvantageslaunchingthefiiextprivjlegesSeptemberSelfridgefsuclitimeasfatstake-te4tpopulationrCaSorifng1ofthtlitCaliforniaconformityapplicationshrivpUedprogressedWauchulahinderinglightatidrequiredPctpbefpur-bpughtPonUlvdysfpppinggaM-iitgshortcom-ingPhilippinenaturallyServicesueedjpfiabeginningunwelcdtaesuggestiveraypraltfpf1us-jsjantpjdthjeperform-anceandonlf-weRcentjyranlclinglieutenantFiprjdaotnvSaviorshipmeufethatkindHebreWcumberingncd9fOvegetablesThursdayboundariesprobablyjudgnienttriuningvde5ipnsextiilDHeddoubtlSiteyond-ichisFlbridiaIernfavorablyengageSbeginningespeciallyJerusalemconditionsslw-man1flippingGalifprniamorningMichigancommissioncumberethquestionsdurjrigaccordingmanyofNovemberexcelleutaUtlldon1tuildingoversightFHdemocraticshowhijt9JirjtfCaliforniapenetratejboundariesde-structionSeriouslysubscribersJljilstandingSeptembsuccessfulvineyardbvaYrtuniversallamentablePIpalatableSINPPuJiAfternoonsdestructionpropellorsiderablyvinimeriijgrowersthatisaysMeetingshockingprintersHIITlfUINcommittedcivilizedAlreadyCpcoanutgroundedutifuilysmartingtyllerem=benefittedSaturdaycapturedrsmatJuprisingreferencecpusins-AtomissionadlflerertFloridianprosperousnewspapersptibllshadvanceaggravatesKbifYOAdvpcaeAdvertisingwhlchjenoughwTapsbspiritualadayatih1vett1Lc-ContinuedvineyardO-f1V000000tnAtournamentisnlqst1C1ManillaFloridainventioncouldtftifeitthatChristianattainingdirigiblerUfilngbarrennesscpncludePublished3paUWfr2h-tJ8ChristiancouldntfamiliarCHAMPIONChristiahappearancemerchantstl1tnkvirulencemilitarydefinedirinewspaperr4dwithMlfeTuesdayArcadjadne-ifegfowhIsiderationmurderedRussiaOranjfoagoverQmeseekinginterestedJbhVihatbratigesexpresspatienceCiitstatesmenSaviprspositiveSeekingrespondedcharacterHeightpvcmberArcadiaspositiontogetherV8pculpableSubjecttogetherunysualOmissionparableeiiforceairshipsairshipsKPvernmencommandvantagesiJleWiidemo-cratsgiveri-usPutNUSdetri-menttroublesthroughobediencettif1idaccidentsproductairshipswreckedIhatldvedreadfulomissionwishingadvertisehistpryhithertoiJorwerecentlyobjectcrowdeddomesticeYd6icVullySundaycombinedSundayWeeklysurroundDeVoesng6urFloridaoriginalSubjectandArcadiaWrightJfFldgagainstsectionssacriificeadvancelongersubjectboughtandlhegain3tcountrypwningSUridayomissionQigongparablegeneraltouringEnteredgroundparabletropicalWrightnomineedemandsweetensdepartiriiprpvepercentdeath-bedinterestsampleSavibrinfectedshortlybusinesswipingInsetrlonunaidedairshipinjuredb4YOtagroundchapterelementstroublesafflictedWrightrindingbyttsStatesgettingjjppjeswhereinministerenoughPublfchersufposesurvivaliwrVifavoredHeraldof-TlIRSINobviousSoiig-Ifbecomeexhibitbusinessa-virtueiknowiiTampavaU-ifprintedCountyforeignaccidentairshipbeyondaeroplathemelerl-orifplantsdangerforgivewMipseveralrjaperinflueucwoundwilkdoa-FlpridaFridaychargecreatufecruellysample01ftbfgreenoraChurchpfiruitapplwservantScienceFlorenceJosephinthisfingerselectionJosephobjectsfruitfulcholerain-ventornationalalwaysWkiadgain-tfosectioiwithoutTOlliIdMayorweatherReadingnakedlast-ingagoodJjallsheathenhumbleAsiaticsimplybelievetwentyreadytheuseinerddefirfedfriendsdartsj2SOQJwjithmtbencpujclYAVeprayedrriade-atelementiiichminimumIslandsJaRpleswltaGodislivelierf-AttwTODAYpmvdeservecessivegoldenmostlytroublesuicideSeveralJJavls-thre-ceivedgularsbeneathgJrijihayebeginPrayerheinousvaripussurfacespreadgoingperiodnumberFloridacpnfesArcadiaIiteCitpprtedEditorwithinballoonbrokenhiandbattersgivenbecotriepeppjewhichtwelvecertainscienceorangesFloridafailureedtn-ranaturalexpectbecausethingsolelygjiycnnationdoatheavyteachesnationssixteenBryanjri-piritAheadlrampkttpwsmoney1-yrrwouldbtheyexhibitpastorYemmuvictimsdiseasenightiQwfhwhichBarrenserviceSecondtreasureshPuIddeservereachestembershouldmarket1enyoufondestcursedpipneyappei-lfgrpwersctjouOrvilleelcbniewinterf9BartonrecordsauditsdfTOuldvisibleexpectbeingflowe-rywhichtSoThereChristThoSeglbrywhichseededwhichBryanpendijtHitfrit-iuselessuselessniarkeUThealongdeatharaXift4NPRIDiSPtac-countshipshopesiiearjtdlongticketfailurewouldMatterdeathsmotivedecayiiitfeightpointamountfriendrpad-Aio1aUalmostnationwouldPerryTheyTheyfeningerHadendietedbetterheartspowerMilianblaleTreeiwprmyMiamigopdlatelyknow66teprao8JlthankusingallowHhatwvreasGrovetlJ1WtbtteS6pouredplacenexiAdvancewhichThereknoynaViofthtwelveworldpeopltabur1idbVmcannotalongcalledTlieyconsentmouthalongfoundrmndKeigmilesschoolmpriifocqrflightgivenbarrennaturealmostwhichwhichtgttWithsUngHeresscatter9lieditorIrbmschoolonlybarrentottersJ169HencefulfillpowerspliwhichtbfttttieyWasonlyOwnersF1ori-bcountshomewhichwerefruitiittWicometknbwnatureyboedjCwholeftbjtvn-CludefruitsRATUSseemseditorUsherfirftorangeAWtJifterfbundvotedRoyalguiltworldBetterwitEJiqJUThatprintfellowwfc-jyalimitswaterstheirswherenialgoldkindsthreefrontrejjtjfr-pdutyuntiljtbeirThatSecondgoatsgreennatureeveryP09tdaysftuitMyeroCcurworldpersonJijiieverygreatskjessoultheseunderfailedgrovebetterskiesdowndownXtteCHILDkilledcheerwithJAAgoodthosewithWhoEditorothernatureneartheirsjn-ofshiptheirgreatwhenhightheyfrpmrightseasongooduntilLooksuccessaboutorderThatnraUguilttheirFormuchNEVAinuchpaperdowndontIlI1YPaStfie-Bweekdutyothertakenmucht76fwhenhaycinoticesmeritwordittWhPmeThateCeivfittestmuchthinklivesjoysvinesThateffortwaterskiesWantpagesHavethreeIcpmpCrpdmakegreenwhatseedsYihtirsuccessmadewhentheychordWniiworryonlytheyonlybtfewarforewantpapertiervechulanegroIowastormwithdayswithlithesingdaystpldjdeathhaveStreetshareHtbmanyweekmadeGodfielsthemibnetimeTIMslngofficeClasstherepaperThis1d-PWesltweekfiftyQbdbuylimitsitSyearscitie-Jwomenthand1tsTheAndfruitablyceasesweekLordcoursethosemustUSJacileveryweekalthoHCyearAndn4YThetjiattlienisinceornllgwili0-JhtstormlookstherewithlocalStatewillIffudoesfiendfaultiIsiriQUfaultpVonessatiafmanymanyhaveBailehandiaasMRSfruitafteruntilMrvithatcowtiThewildtheyOfficeAsiabeatthlggreenhandfitsboKFighivelandrade7lwhythemwhatwhatwiththeirtreeswillrfJvtwpFairAndthatfruityourthemthemfotsAndaggrtheregpcsi1tiheldThecallsiiamestillGodReveachThisttsrpaC-Twishtimeaftercomesfruit730TheGodfromThetreeMailTHKcpmeGodfruitCVnbeenIptfriJtbbeenhavesongjbidstokepostsbmeifeiTFULnibrethatCOntifaeDollarshalltbelThislaudthistkjwillsaidwhofearstimemattaleastMattbornMrsandsaidr6suchfruitfromi8tbCOtlpcomesthatbeeniliawillsatelhovertthenfruitgroWseasonitBe-IIThetruewhofailsWmoftht1gbltgaveriseandovertUntilgetsfreeAridAndtbatoVersthellandthanjoyJlrfTheportTheThefailsGodFloorautfthehearcafnewillbowlVittitoadthatThegiftJftThewillwellwillfallsholdhealdf6tr-pfccausethetookandChildhowGodThelegalAndthatlandmostthispagealljandforHJThesoulsickihatGodfieldbigandinsdonpageputintoOureArithenews500715tfteoneialastpainwillwalt4IJclfItheapilastttoPTheThethatfirstandwiltmayandthatWewhomaythiser9pmorethefairfewgavethisihetthlicjrtheintoSawthatthatwadjjraheld1RtIIandandcoldJ-NblawsinsthatithathavsoilthatoilsthenewsandourthethiitfGthethatthisfirsttast19UthatyoilthisgreenQloplneverfAwaiwerefearthisttedthatMadearidanythatrithIlguwilland4gspurthgilikeandiisethisactsthisandthisinkthatforethatlawclelfewWeWethelikethisthisthHaridanduselessn-ioCi1mayForButratefatefaCilifairAllbutoutmensamethegaitsoonandviJandwillandtheIkeOurpUrtentstellnearwayandcentsandAndandLeehadjthethe8fdandlastlastandliveandandandhertfairwaywaythethefailWeandandDroandandl1randcamedyandoverLineforthetyhasTBXctheifcpearandtreeandandandyouandihasfewtheandandlastrateandJqthetherpmwerebutfimInthetheandtheandvinhastreeprebutlefthlthepttheYearttieHr1-OfthestillrltthegottWputbythesellask4JfigthfrnotcallevenratesnewaswiCarttheoUrpayOaktreehashasputfprasathethePJthehatthetheiLoveracxtheaSbltfigtreethefallbuteachrtih-fthecutthetheld-tandtreeicarttheunhnotthethetreethethethetheuittheeOttheoveria-xtestthewasJt4hashasnearnownowwarhisTotheverthenotthesinthethetheago1-iitfiganytwohaseye1waswasthetheoveroverthetheshef1TIiTothethePldthethethethethethethethethevhOPtfthetheLnanthethethethethethethethefortheIllthethethegeroutairASnotfivethethesinrtitsdfthethetVithe>hisoldthewasoutnotAshisforaththewasmanbyho-jforOnthrandMrtJanotMoih9gfordisouttItstAcutofwJhisfobybypfcarecareMrItiW1rforforfoutwaswaswasfortheOnewasin>tooftoattoofofofofofIttoisaJIfnooraat4tljJItotoIfoftoinitOPtonttoitisisSf-odIfIsi1ioh-nitotototoIsattois11itcaGIttotooftoIttoattousonnoisasonlijittotosttoOJ>ontototototofatt1anonittpanolfassoti-IonqtoRtittonehianattototeisisisisisustoisastisisifi+iyusitfRtrattoasitisififisisjftoisdgne11ifusitw-jsorfso01itsoitastrwastsoUtoisisifititisisitditsotw0ijanSitfsoAasasasJ4SasWJJfttWinhIjaVInasreasasCToatfreJispcaonCHYt1tlespjPrVilIlilIeJbU1nlrtitcIIviJsasIpkfity1bhhiSH1tYyWgbr-utOg4itQfilj1edtiIf-1wl1atfghbdAtI1hfipYjw-rJftvhbCIpyeB4JV1riitll-tpfr1jiIIaitijQftftl1Paal1Jauaatftleofjtltaartaanaifaf-rat1faYoaataeaaoerarC>a5AiteSe>tajIStitect1ltt>s11aaaaeI0tIIt+>4<>>IjJi11iiAi>iri0fitlItJI0ljrfti1ftIiJ1jAI¬i¬¬¬<¬¬yI¬¬IIvjr0iJJ¬TJ¬jIi¬¬¬y10iJr>ljjcIIcIiIIT>t