Citation
The Gainesville star

Material Information

Title:
The Gainesville star
Alternate Title:
Gainesville twice-a-week star
Place of Publication:
Gainesville Fla
Publisher:
D.E. Godwin
Creation Date:
September 9, 1904
Publication Date:
Frequency:
Semiweekly
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Gainesville (Fla.) ( lcsh )
Newspapers -- Alachua County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Alachua -- Gainesville
Coordinates:
29.665245 x -82.336097 ( Place of Publication )

Notes

Dates or Sequential Designation:
Vol. 1, no. 1 (May 1, 1903)-
General Note:
Publisher: D.E. Godwin, May 1, 1903-<Sept. 27, 1904>; W.L. Hill, Oct. 4, 1904- .

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
002046228 ( ALEPH )
01446361 ( OCLC )
AKN4160 ( NOTIS )
sn 95047242 ( LCCN )

Downloads

This item has the following downloads:


Full Text

PAGE 1

7-ISEABOARDF-laSIVEJaBMcClellanDnA-LnRsISEAISLANDEASTERLINThomasEASTERLINUNDERTAKINGPRINTYOURSeminaryHSGainesvilleMaiwieTrteAWStariffrCOTTONONLYSTARIyII11I11ErITYGainesvilleINGStablesLiveryFloridaMathesonTHEEducationTHOMASExcellentBRINGRailwaySc-heduleRwyFloridaPAYHi-ghestCALLWFeedJ41lf-1tdu-ceWESaleSTUDENTSW-illO-FFirstClassEastKoonce-ASuppliesEXPENSESEastmanCrawford-AttorueyGeneralHaveDUTTONImplementsProvisionF-ORandMerchandiseFACULTY-OfuptodateCOUNT-YRepresentativesIE4EE4LE4tc4tsm4cf4Ec4EEPrygoodsKodaksISconstantlyJinefJVillequantitiesSuperintendentGulfCarriagesON-Usiw-IDesiringFarmingRPICtfUREChickensEggsBStoneman-Governoror-unll11provClIfannlngSpringsRex-changeSpringsGroceriesMORALSpopularreceiv-ingcheapestHighestBuggiesRUBBERParticularWeGainesvilleCOCOTrial-GAINESVILLECommissioner-JohnWagonsWeS5ISOUTILBRNSuperintendentproducecallUSExaminevtiyeedaysGAINESVILLEattention4JC9Et5i4JqF51XMSpCdChildrenClark-PresidentialconsiderableSuperintendentWreorganizationfiguresJackAmer-icaWFlorid-aIGAINESVILLEWomenMetropolis-WeGeneralcountryTlYCfAwnUItcorrespendentLeaffljeiFloridaHarnessasdatjgerousComptroller-AVicePresidentgradescountiesLeonSaddlesAgriculture-BShouldavlldoalAOVAPMALEpricescheapKuropatkinSecureBringLinepenitentiaryneighbors-Theaddressgiving52-p158p12580perfectly-wellCommissionerspricesCOGAINUSV1LLEpricesadministrationencouragingAttendconstitu-tionalInstruction-WHorsesBODYcommissaryBridlesaridProprietorWednesdayPnUlHugpTallehuseeaALCommissionergoodspopulationManufacturersLadiesIMPROVED2500000000tcorrespondentscommissaryWmajorityPhilippinesInstruction-DrMetropolisDEMOCRATICgoodsInstructorseachStockprodigiousCottonIPresbyterianrespondentapaidupHighAugustineRosbroughappreciateCottonMetropolisThoseCoministrationMINDAMPSSeed-orlNJ3433y33hi3ENGLISHHighFLOprofessionMulesBroclcJacksonville-NoAugustinemakesfrequentlyprevailsmathematicsUnparalleledShacklefordaccommodationsdegenerate210000000largeprecedingappointedShoesPresbyterianaOOapologizesShoesdntberjscreasoningPresbyterianridfnaryforegoingHavauaIsaveDEALERSandanticipat-IngPERFECTLYNapolcauyesterdayadvertisementsheadquartersPresbyteriantestimonialwasWalkMcKinleyundersignedCourtSixGROCERYRooseveltsChattanoogayesterdayWnsnlngtondepravityJacksonvilleexpectationsFLORIDAamendmentWashingtonmorningprobablyGainesvilleDem-ocraticregimentCollector-WUnparalleledUPHQcmmandantPromptlyPlorldaWasliingtonprobablyGdepravedresponsibleJacksonvilleremarks-thedecidedlypurchaseAssessor-WQanesvlllecaptain-ofexperi-encelynchingsouthernerBANIreferences-theMACDONELLlawlessnessSurveyorMensJacksonvilledescriptionSupremePhiladelphiaGJacksonvilleJacksonvilledisciplineDampierwhenTuesdayCheapestmajorityJacksonvillecapturedPerfectlyWashingtonspcctiveISLANDattending8substitutingnaturallyORLEANSMeanwhileSecretaryPRESIDENTHatsAirBaggingSupremecertainlylanguageJacksonvilleadvocateTaltafcrro4-sapplicationmajorityJacksonvilleCongressSeptemberbutthoseinjuredMonttcelloJacksonvilleCashWiengesreportedgovernedPOUNDTownsendIcribefCOTTONinstitutionJacksonvillecon-tributingsmallChicagosubscriberpossiblynarrowlyorderingADVJtRTISlNOpositionWednesdayfurnishingAmericanseverelymurdererindividualChicagosplendidlyWilmingtonRooseveltJacksonvillesecondclassSpanishcitizenshipTreasurerDickinsonpossibleOverI550ragtpTreasurerSeptemberCORRECTSeptemberSeptembertime-PartnerStoneRooseveltGymnasiumxfxFx4ChicagoTheodore190aStTuesdaybloodshedDecemberCaptainRcountysBrigadethoroughlymilitarywinningCaptainconnectedmilitaryinstructorunderstandsknowledgethroughRobertsoncountiesinstructorCommercialFWillconsist-entJAMESRailroadSpanishANDanarchyGainesvilleprmaneutChicagohearingCountryRiotingproducedHam-IltonWillWhltfieldHamiltonauthorityBrowardfamiliarlystationedGroceriesAttentionUKbuye9ulppedLintESTABLISHEDJusticesotherwiseSouthernBradfordTallatlasseeyesterdayPresidentBradleyGndsdcntSTGivedisciplineSlrWIJItf5ThursdaysdaughtersJacksonvilleNATIONALFKRUINANDCOGainesvilleElectorsspecialistFenwicktakeTtimpredregularityGadsdenDuringGainesvilleManassasInstructiontreasurySeminaryERSnegroesmissionsgraduatesLGIddingsEffectivespecialistsMenknowingyourCountyimprovedinfluencedStricklandPersonalGODWINPersonallymissionsSeminarypresentdrawingMorganBUSINESSITl-JlTribunewantTaylorMukdensolidlyGainesvilleforeignCounty1recentlycordiallycataloguesConnectionsMartin-RamusementsleatherBaileyCallWilliamattemptGreensboroMethodistFloridaAlachuaBusinessSeminarypositionsAttendedduringTroopsdisciplinesurpassedGainesvilleWilliamGeorgeTribunePeruandinaTribunepeopleLynchGainesvilleprotectMemberoc-curredappearedCountyCountyStricklandMemberVestibuled1resbyteGiddingsThreeGainesvilleGainesvillebestPortsmouthTuesdayJacksonvilleprevailelectionStephensWaldorfGainesvillepracticalGibbingsNewtonS45UCJsDIVISIONChica-goHowardlettinganythingGRAHAMRichmondSouth-heDistrictmix-ingsonvilleSouth-ernBrooklynThomaswillMethodistWanted-AtasendPublishedWildwoodJudgeTuesdaysmurdersSeveralShorthandbetweenTuesdaymemberProduceEverywagedbelievesscholarlyTillmanhorribleherebycitizensAstoriaLynchmerchantsEtcSenatorsonvillecountyHouiasaasaFloridaGuardsDmoderatepeoplepleasantarrestedSheriffBrunswickmilitaryCongresssubscribedheathenRichmondJamesbecauseBoard-TRockyPolotExcellentBrooksTUITIONKelleyCroxtonAttorneyLynchJunctionbecauseanxiousandandMethodistobediencebaggageandpeopledrawingyears-ofJudgeshouldandandanotherOfficersHenryrefusedSundayssoldiersgrowth-ofmurdervic-torymeetingPutnamsoldiersFenuellStripsBARKERsleepersiaferrpChicagosinglerelativesnegroesJusticeInsertionIllinoisFloridayoushouldafternoonmightEffectNovemberprocuredandnegroesSprfngssoldierfriendssamemightSouthsoldiersEverycountyUnitedWilllfordwithinRobertFancyParkerremainviciouspropertyBaptistsub-scriberCircuitSecondnegroestroubleWalterParker2x99-DrRecordpopularWundaylookingCheapofficialsTICKETSavannahandMar-ionWalrusbeingSchoolbelievenegroesdeserveFacultyPresidentBaltimorecom-mitnegroesthanksstartedmtroublecountyJudgesustainedpolicyUnitedEtcMStueofgraphGIDDINOSSeaboardJERESundayBaptistbecomefierceshouldpayDallyCampUtitstartedSVILLRCourt-SconvertsoldierPublicshouldPensacolamattersagainArl129close-lyseventeenbiggestofficerstorturesJamesARexcellentpleasedfaCixentirelyWeeksvantagebusinessandPublicExpresspowersBarrowsellClubsbelievestudentsRYWeduesRaleighThereperfectBaptistgetfQiF4lfsendingbusinessdisplayUnitedchosenQuincySFxFSTATIONSFlarlda-atColumbiaOsteendoubleusingperspnPalmettoStates-itheOrdersMadisonBaptistTampaAllSouthrailroadtodayeditorsParkerCottonMeatswhichexist-inbetweenColsonBaldwinSeaboardplanesmallIlAYNEflThe31870FridaywhichwithinLYNCHnightTwineBeforedinnerAssuredPullmanshouldGainesvilleJapsPricesPostofficeEnteredtroopswouldSoutherneightLaCrosseeditorsleeperinform-meMonths77DUUli8rTlDIslandDenmarkSlwruHaynesStringefficientPalmettoBoardAddresscolumnsbelievedcrimesTimeSouthbrutalhousewouldWatercheer-fulStrictCroomReadersAftereditorSouthcorrectbetweenpersoncrimespostageforwardyoung777StateseditorNearlywouldfindsaloonpasturehomesFrankpricedSouthSarasotaMorris5p-940kwhiteAlachuatheMouthspromptManateeNotaryWESTSteamersStatesAltonTheirTampaBeforegoodaskedbetweenhungforcedQKOWBRservicesJ7ftxJimoralThereDavisbattleadvanceservicesOrleansNORTHbetweenWaniieeClerkwholewhosebetween8iutonlonClubsSTARwhileMasonFRBBSouthPullmanDOIGkindlymakesTampaIMariahweekaddedyotethegoodgoodRogersrailedbetweenhavingexpectcrimeSouthsaluteJackAlachuabetweenmightOrlandoworstWalltherebreadwhileMorrishoeenemydecidedLevyJboyswhitetaughtJuly190gCamdenknaveFloridasufferpublicSarasotaIIftasManateedollarGivenknowTablenumberFloridaTampa1d3h33put-toCountyFIRAgentJSwFloridacrimeKnotthighSTARexpressotherdeathSidesforaddressforre-ceivedRevTmediatetwentyconnectscoulddoingWacalloolalittlefriendskindschurchStateinvitedNotary446-94SAruglyWashpointsignoYearsnegronegroreceiveAgentassistpricesnegrocheckladiesyearboysJulyp40AtSEAformedDel1amybrcvcreFairfaxSTAkreachappearsfriendspostalchurchforNewsOrleansCourtArnowhomealonegivenStatewouldNRNEditorknownAtlantaMorrisfSpaceClaytheytheyTILLweekwomennightbrigchurchchurchthereUnitedFloridattgjustexceptpostalState6151vknowbranchcoachesHamletfavorthreeWaldoStateweekSemiUUlsnegroTheyyearsmanythreematterserviceVourHThischurchStateISouthldeIdle-nessbuyerschoolMobilewherediningEAStmanylittleabsentgentsRIVERSCounexistpLAlonghavethingtriedtheirtheirchurchKirkwoodGrowercoachesArcherMarchthemavertpasthavethemeveryEarlyfellowParentsPIraeldSampsonDokewhenBoardthreeInformwinteramountStateBAYERAprilweekDayHighPlewelleaLeonhave536pyearmailedTaxfEtEttheystopthemscentstestatenightCOBBTnabeingMessrsetcyearshave1100twelvepastthemShiedlargelivesHlckmanTicketjustTaxwhichhavelittleGINyoungInPublicI201pfor-thMaconwith1ArnowCAPTafterSundaybottlestimerecordhejdLineafterwithSwornhavebeforebeenhavepartyThisFourhaveEastEastDay126phaveyearsbeenSeedSnptday714a-Hhealth144aourcity1245-0k530PSouthAgentSliverPublicwent136pwithguestRATESlowestcityothersbeforeLouisundereditorwantFulchlookbeenPleaseSuudaywitharthave-ameansbothbothHILLgreatunionSounddayswholargepartmoralsthangetsthantrulyLouisHickscarryfifteenwhotakeTheThefromwhomThreeOcala3wantladlesCedarGAINLocalthantimeTradeStatesRiverseemswhotriesdoorlookLouis10150IIA7wantTheinIlearnbottleknowthenfalseMaltv-MOnceocopy1jdryaboutfC3YourslaFebbetterdrydrywhoThewilldataCityTradeWhendoorareCents357PTraindrythatThethat2oanextCityvillewholonewantandunderinfourJClEfJ1903TheArc11ingfirstwhowhovoteGrahamwho77CentsmakeOcaladryboardDrugmeLakenarycoursesCaptdrywilleverywhoDailybestloveThesidePinesHAIRForvoteheardMottomanyDayOcnladaysTeleninny7PwillwetsAtlllIlinreturnwhoviews818PlantalsoandMcltitlestrictKeyCitythatbigvoteDaily77g4028ibigtheythathimsaid303pHaywillthisILALineMSkdabovejetthat616-72SthatStateDebtthateverySOJPandanddulyof11101I325pCaregalanewssomeYork1902-SLivecitytypeHayfactSS3aSS3200phoopthatHerothatTacoma1IwereAND71p554kI1THEfreesafei11MrsSellclerkStoreLakeForKeyCitythatgooddansSeawithwillcity1897tireStark445pandracesYork417PMarkStateDadethat2ndParhimuntilthiswith1Isame1IDallycentsNewclyaukindbasesdayandandandandsomeandfasttheirandyearsState1500beenLv7WestSotur1IQEOstoremore1IandlessandandandYorkTalandandlastsomeandhellandCityAsstrantMissRealJAShaveple1115I43pandlawriotandandlastCastUrandandmorefrom10001hadandlieneach11lastbutheremoreand1ltothan915amorefoolandandotp-I2subholdtimeIbutbutyourowncostlastcity11seem1landbeenfromanyandandandonCafetwoandoop-tomenbutbutandhasfullHairusedtheWeanyand11BirdWilltheshoesendMallthebutheredaylefttryhIsduceneverlifethedayonandsendDallyTileFinactsyearcostcostmallsayanALtheadehassendsendthanbutthethethetheownRDailythethewetIrvine1003whofiswithherehashasDearNewtheailtJOnotusedNewinterthethewerethethethetinetheNewattwothebybytohave4-nthethehatthemanmalltheforthefromNewdaythethethethethethelessoutnowthenearProthatyousaysthethe38ththethethinthethethethethethethethePortbetAllwonthetheHetawwilltheStarfcrforthemallthethethethedaytomostthethehad28pwhonotwillvery0FSmen7I5309aSpsworntheonethethethetheRevbynotthatvirthatniceHillhisNo4wasracethehullerthehishistry28p945Heveryyou-afindandtArThementheandandInstthethisandsumbestfor74O36ptheastheus21oaShpthetheStanever0101forthethewellMalsoantRevThethisthatsayswasIwas3I2thatfortheHeablethatbylineandOnhadfor5O5andInotnotifoffAirand12thGenforpasswar46aS8pracethewillandlikeOaknote92OandandJap4SPwaswaswasmayforSSPforStfor1-IandandandandandandwillbaldThesorewillwillandMrsand36ao10PhairFla33N319E9bhadhadroomroombyitssentnotandLakewarSSPSixorCOcentandnotandandandandandlastforgetwarwasoffandatonenowwasasGenaidandypusizethisandandundaridandsame3SP3SP4opforforsopSopourWSspNo1theandyoueverand45P5SPfteNo6actSIpSSPourthetheyouandsoonupAreLakefulloSPandsethasS3P1200thetheone1869tertheWNosActandCllyhisIN4opend30PsaleoopoopSopleftlOpsopa5PtheISpmanthe14PviaftrlIfiveFurand680I-IooagWhasthefivetopbuttheanddotheupnowtheupourermsrqago50-J2FinanotactthehastinssocLakelOplOpoSPhisthethetheooptrydomenOurssoopthegoKthethethemanvia1240forWbethenow8oneFlasoaarearethe23PI5P3911sopseenssAlltop13ssssforCaadbebygo1110be4saSoa6tO113sgbeitsallcorIpthea3afor8hishisthethecarsSoa3ifbenotthethe466-Bofarethethe30abybymanbehe42ahecaphisLvosaaoaLvmanthecareofiBEforofforAll350of37a45aednotforStSernotiiJarcforthethe3511the13aforforforMtoMIfatBtoas1toonatit1IYJot++itit+it1itEororIaitoJ2Ion1oAOitNifM0F1720u1oJD+asUFAao000DItJ=PSII=so4U10S40jOS1PA00uIISS0062BasABIIII82C9AtSaspP+WMu20<11ml-nIIumPJMJ40M4545tfJ84paUbIs0Mss4sa<3i-jJJJJPp1397aa839649Ji74739qJFaAA>a8aa99936966t3a86OP8atE3a<57aa5835SatJ4743aaaAP88Psav768kd85rlSLJa45577r-t77tSI757fpPaC>CY+fvapPISaa7E1+Jaaa+IOIJLia+faaaRa=aViJ1E=876Ia2III7af27P2K68J22elr+87i069r2227JIIri+36IrYz8a4IfaJ141fur-tI114Ir1>etoijIp1itriIIwf111tc+FrrrtriqiI1rtif1lrtIIr=¬>I¬ir¬l01rII<0¬¬i¬I¬It¬¬¬L¬¬¬¬>¬¬III¬0¬Iri¬1r>¬nJI¬¬IHJ¬Iuc



PAGE 1

flNIITICESTARAFURNITUREAINESThomas-UndertakingCHEAPGOODSVILLopeni-ngGainesvilleTHOMASFurnitureGAINESVILLEJewelerHECaSTFi-neCOMPANYCompanyLaundryGainesvilleCheaperNOW4-1TVVJCE4STEVENSRockersCostPRICESFloridalYNCHINGOSTEOPATHRIGHTTheTH-EJewelSTOCKOctoberATDETAILSThanEIgLERFULLEATERJHardwarecontemplatingSATISFACTIONFurnitureAttorney-sCURISTOPIIUREver0-IEAtCoMustGUARANTEEDFurnishingTHEFurnishingGUARANTEEDTHEeverythingSpringspurchasingOakHeaterstenementslmereclitamentqxecutlonaissuedoutoftheCircuprlctor-GAINnsvIandfftIP4-HFloridaFOAINESVWTS-vMattingsanythingmDressingSecretariesStovesEXAMINATIONOpeninglxxxSCeJCx9pxaPaintsExten-sionGAINnsVILLEHouseholdlJolMndDoUarA-RTJOIilCARTiHSSquareslierebyglventbatW0APPOiTMENT-t1i1waitingLibrarybroughtCORRECTandtQltt1-111iAGNUIIAdisplayIATlmSONA-T1OHNIVTHEXNTEBESTSATTTLargeFRobtlticCiclianBoardsBedroomPOLITICALBQSXNESSOCULISTSATISFACTIONannounceVlcelfdentOLaundiifStylishDresserslargestRockersHighscientificallyRuggsDEVOTEDGUARANTEEDTeHttledaughtermam-mothSEPTEMBERReduceStylesdurinhthobetweenQJ-HWClosetsSuccessfullyStoveJJrnbalmhifjfurtherBuffetstill1TablesThousanddAlNGSVILLBcorporaUonaballCenterCRIMINALTablesGftlnasvlllcPRICESacknowledgedWatchDinersSeptember1250DRUGSJrincorporationGrandconsisthqusemoneyConsultationINTENDEDcomp1nytheJillpantIncorporationFINcommissioner-wasJacksonvillew-asmoneytorporationfRunkleMOnALFURNITUREWednesday-MrsLynchedfree-HOURSChinarequirementsRepairASSAULTINCORPORATIONStockWITHOUTStockhouseCaseswee-kairStatanlmar-ketGainesvilleyesterdaylucorporatlourightofwayIncorporatedcx-atnlnaHonFLORIDAUpholsteringdlrectot8shal1principalbownlMldaccompaniedliabilityStoreundertakinghonest-SealingfoundWitherspoonOaktwcutyscvcntelegraphadvertisementBrassMorningappertainingSuitmentsSofasparticularlySuitscorporationJacksonvilleninetynineOOVNTmerchandiseDistrictBookrequestedwhererboutsorderGainesvilleannouncementpostponedstockcorporationrjiufdererIkfTownearMaultsbyiBradleyJacksonvillespacefortunatelyconfccliouaricsconductingWednesdaydepartmentcorporationSeptembertheirIndebtedness2000respectfullyregistrationpursuantTuesdaysubscribedadvertisingFloridapromptlyffcirlMtSTATEoperationJacksonvilleappearancemanufacturethematlerHOTELMicanopy-Coluiurdcrerofthoughthead-quarterscorporationHftyPointABedsGainesvilleKqitrCJacksonvilleOFstockholderattemptedPdbuggyYoursomething-forFRIDAYWednesdayOddWednesdayMbannouncementHistorydepartmentmattersWednesdaycorporationmerchandiseMurderersquestionedprominentExchangeparticularscommencedconsiderablerbelonginginformationclassannuallyGainesvillefollowingcorporationSideNcwberryexceptingcriminallyappointed1ilsgidatWorktimeexceptinginnocentlytemperanceproposedfollowingMlcanopySecretaryexpedientlittleFactMicanopyGainesvilleAlclivalnePersonalMaultsbyDoHarltAlnmmoththoroughlyManagedproprietorsdcrslgnwlTuesday-MrnorthwesthereinafteraccordingpumrelydwcrlpcdGainesvilleattendedTelegraphWednesdayItowcllfneighborsSecretaryunnecessaryadjournedpreparingGainesvilleattentionattentionboundaryphosphateStephensCelebratedVcduesdayregardingDiseasesiMcDonaldyourWednesdaynorthwestijKthinjbutSecretaryCompanyWednesdaysubscribedPpiugattheIronliatifyshoppingsteamshipadvertisingHajnptonMauitibypropertyCompanyCommencesubscribersGainesvilleuptodateYouManltsbygenerallyHcCormlcktwentyoneGainesvilleexperienceappearanceBAZAARFiCNNiarlynchingOurCarpenterguaranteedGainesvilleCaropvIIIeyesterdayTreatedMcllvatnesdelightfulendowmentxizxmostyesterdayprosperousCalnesvlllehaving-hadconductingdelightedtownshipdaughterspendingsouthwestnorthwestcollidingColumbusfirstrTuesdayhardwarethissouthwestnortheastanythingdelightednorthwestgenerallystandingenterpriseenterpriserh-SIIURIFhSblesMcDonaldPenaltyPJl1pCTreasurerTreasurerVicePreEarlyTallahas-IfecontxtlMcunnecessaryGainesvillecriminalBaiiktiifjhttownshiplinepumpkinnorthwesthouseholdelsewhereMcCJeJlantownshipM131SuwanticethereafterMathesotiiformerlyNovemberHillearyIK-AlachHaeighteenorganizerheretoforeBarroweItcompetentmortgagePersonallygentlemanforegoingi-iGovern-ornortheastNosingularinformationdaughterpublish-dwillexecutionswillboardingmeetingmnrderedRemovedHfoundIncapturedtloll27delightfuldescribedlynchedwillregisteredspendingconductedtreasuryHamptonChappellthemesSendmeetingIapontiseecompleteexistingtravelingSampsondisposedBradleyTuesdaychlldrpnEtcthissoutheasttransactedappurtenandbuildingMondaySaturdayginningcarpenterA0executionagentsseverallyandcapacityconnectionFREETuesdaytransactedestlgateIadgettpatronizewhiskeyMcClcIUnIevyvilleArtrlglitofreceivingcompanykeepingprofitableBusinessFurnitureGroceryremodeledTreasurernortheastANDexecutionIBradleyFertilizergunshotsrndandwonderfulbusinessAriamurderexecutiondemand-allCompanyGainesvillepartnersstrengthSaturdayreelingPowellNewbenycapturedImmensepreparedexecutionyesterdaycommittedconfessedFridayroomParlormurderedARWCMtIWhereSu-AdolphGainesvillestructuresPadgettdaughterperformgrantedBrownTuesdayGainesvillemakingDCloudfollowshuntinggetLucretiaTHEappearedYourCJenningsJudicialhundredconfessedTransientdirectorsenjoyedhundredpartnersDunnellonbusinessSeabreezeSpringsInformednecessaryCountyproduceopeningNooticyacceptediiseSiODirectorSpringsHouseWhelpedtherebysuppliesacquirereferenceestablishscreamedformerlygroutedestablishestimablereturnedxXxYiMorrisonAufioritfindingtravelinghighestnnUrtledTuesdayhighestLdystatedsojournELEIrequiressidewalkhundredkittenedMe-ormickpopularalreadydisplaygeneralSaratogapartnershelIEasterllnpropertysheriffcompanyhandedbusinessCrimeregisterwithoutbutLambdenfreighteveningpositionpresidedgeneralFridayReturnsARr1OrUSrJbusinessOrangeflogged850000ConcerngeneralopeningFurnishedbusinessallegedEscapeagainstHamiltonVisitsattentionloetiicrporatorsbyAtncllunbusinessoclockPuttinghistorycomingchildrenshares-DFcnncllthesojournmurdererJiradleycompanynineteenbusinessHowardsituatedHeightsrenovatedAlachuathequartersatisfyAlachuapusherreceivedsubjectextendedorderstodaysoccurredattentionWilliamsThomaskcthenreturnedMillersfordisplayiAlachuawatchedThomasagainstquartermurdererquarterregulaquarterNarrowreturnedbusinessFridaygenitalheraldItloridabeheldthecountyluanyNotaryAlachuaThomasbusinessbusinessThomasStevensThomasArticlesdelightstaysavedividedStcycusThOmasAlachuaand-stylecountymeetingChbusinessRtJCrnrinmmerHenryquarterBradleybusinessAlachuabusinessevergivingPleasantthequarterTuesdayMaggieNooiicvvotingHenrylookingHodgesreturnedparcelsMorganLaCrossebusinessforAlachuanumberspecialQQquarterquarterpavingbusinesscountyVJcePtcapitalOctoberCorthellsellliifwitnessdesirableThomasmattressreturnedMyrtelbidderthingsdirectedFridayWeiiskcpIecesJfUreturned1enncllelectionmerchantAlachunpullingCountyStocktonWorldswindowreturnedFloridaOctoberpassedPaysThomasBaptistnowmanagerPowellCountybetweenAtlantic1lorldaDollarsChittycontractFloridaagent-ofttltingregularletterskitchenpromptParsonGadsdenMcCookthereofmmoutcryfriendsNotaryFloridaChittyuarttieraTanightFloridaMallardnewmuddycountyrepliedchargecountyVoVMtwfatelymemberamountnumberFloridaFloridafollowsjewelervisitorscaJlillgtakingWesternBBderedBooksfollowsstyle-ofcountycitizenopeningofficersAdolphcountyBanksBightbuggydeslgpersonaarticlesthereofelectedlayingthereofbeingqualitySheriffOctoberFloridaFloridaJKellumNOTiceridmlttedcountyreturn-edMoversJudgewithoutcountryofficerspostingFItAforbuggyhimselfelectedenteredShandsSheriffdollarsgoingcontentswhereofCITStevensAugustjurorspurposeThomassupposebusinessAlachuaoclockendfurtherpurposeheadedsuggestScroblesectionTOpowerselectedHaguewidowHenryfifteencounty0certainknownsellingDirkbuslneMWarrenBarrowfollowsorfitklmer-chantsundownHundrimuilcIIQdCllneenteredpublicreadersthenceBehindnegroesarrestedfriendsthereinBriefhideousgoodsshouldsectionshouldspendallnegroesAlachuaPentiellbeforeFloridaimammonthssectionCircuitovylcitDarrowArcherBERobertBoardupthencePowellsectionFloridadoingpricessuccessorAvenueUndershouldcountyvestedBarrowOrangesmallformerInjuryPowell6elWrowreportgoodssharesFlattergivensessionPowellthencemotherNoticepeopleriondasharesbenefitdesireWalterwithinfamilybusinessalmostpaganseasternr-4UIOtiitflanksshouldsharesfriendsPublictodayDimDentonphonesectionsuppermouthsNOOIIDVlyIngkitchenMissessharesvisitorPublicMendsLouseourBarrowgivenFiftyPowelltdtncepriersourgoodsfamousInteresthaggycircuittowitVidaljmightRobertboundkitchenAugusBarrowMissessharesJssaedHighex-pectscheapourn-ibrotherdrawn4-SALUdoingrevivalwantedwhichBanksalongaii-BYseveralDuttonArthurSSfdonatureannualBradleybeingdelayClydeButlerpowerwhichThitherpat-ronsMissesOrdersButlergoodsMortonSmithNoticebeingshareswouldMillergoingfriendscountyfurnrofficesSlcwnaffixedagainmannernoticebelowof-ficiallargetie-ClareescapeGainesNameslandstatgunsquarebewhichleviedconcernInsteadMcxollfullertodAYeightescapeBeforeassuredlocatedChittyanlterwrongcanGarlicvictimtetanusSmithwhichbeforeknowncoun-tiessharespricesStreet-CcinfiivoroughtdrinksFisherbeforeunderunderhousenAturalcdihotOpenat-niirightschoolOpenhouseofNOmarketBoardblockHouseseveralAVidalssoutsunderfullestDuvalamongARTICschoolothersectionArcherMailhimc-hatofweeksextentcfxxbazaarHenryMasonsquareBazaarHoardbabycrimeSmithOfficecarrylegalBrownWhenvisitorcalledbazaarwhichwhereundernaturewhichfavorLevyrightstylea-13thofbeforenarrow1904OpenwhiteoffancyChubbfiringotheryoungvirtueyoungwhitebyvgoodspentdatedvaluetakenMillerwherewhereinboardYorkPricesunderllatlieresultsawhileblockhomeburnstylebabyTheyltUiorlimeWadebondParsonHeelerGoodeNorthBoardKtoaNowhorsefurnlCityladleslclestMlronininnegroyoungdaryGooreUuaryeWectwheredatedUponMrsJuneadmitcrimewhereHoardNortlsfnvorThosresortsEpppeaIac1glowerCourtbe-IngtwicebooksUncleFisherhousedatedtfeotMshallFlaipersondatedsundtbuildStateofficewouldothershallLawsaskedmadechurchouteraboutnorthnorthwomanWesttoctedfightNorthdayswhomtheyStatefaintrljlJifrChaserangeHlglunderUnioneffectotherTheremanybounreturnMayHighhandsouthhomeal1liStateSoonLouissouthStateamongcottonIkiedleaveOrsinceEtttaFilthbrickilowestsoutheighnegrosouthbreastCoastuntilbrickthereAlmausehavesouthsouthwhilef34drivessouthnorthMaywitheffectshoesknowStateJtxtttfchencourtLWVidalstylecornerPriceshallCityMillersouthkeptWhenwherecourttracts89UsdaysBrowntrotHglasscurnertheselinereaMewhilesajnesuccesshaveComemademtxrtrip-toSSSIsthemWithDoracarrybrickThosshalltheirRobtAllieprovepaidladyladynbsshoesStalechinaStateyearsloroldtheirwentChasolinittawaywhenDontother5tTOlaceshavesouthThisLorderleavewhenthoseshallFrasershalldnytinymadeclubTHemainClerkYorktheywentRatesJAprove1904auallCitythemfrontlandhaveotherpressfrontshallstreetsstreetsIfouwwhenwhenweekshalllightandthisheldTheLaketrainEllistheybriefsaferYorkworkworkshallficialTherecityworkelectstraytownwhichupontheremayfavorcitycitytermwith1tereNewtermnamestocknamesofficeshallLeonofficeexistfrontcitylieucitygonePearlhandlinmebeenruedtimeStatesaideveryweekStatetheirIturowhenladyhomecornerfromfromthereVidalandtripLiveStatetonicwhenhavewhileuntilSonshavenrri-idwithopenhaveshoe10ZIConlystreetjelldoorstocksouthsisterthemChasshallPittswithdentbeenbeensuchcitystoreburgweekSonsbeenmuchnegrogonefromwith1buyWillssaidsaidwithWillwiseunitmurderbeentheirfrontthenLawholdtokeyourtoMisstocourttotoitTheyearstripherethewithwillLinehalfductopenjustDaydashwithmaytheywanthaveformsendandIAWgirlweekimuiewithactscityRayfirmhorsethiswantlawsfromwiththendonefromcastsdentReadcalJyour4-rxrstockmeetwife1902hourafterbeensaidandwhencash1905cityclaymaythenbackNewCoraI5tlilotshalfsoldsaidwhobothThis1902frontthentime15thwithashstayfromrankAlsothan1atimayDImatedcitycitycitysaidintoTheMssStarsoldnamewesteachandAirssaidTimefromget1a-bigIlorAlsohutheseijftofrontsaidThethisLIkedMisswifehalfcostsfieldstorehavefromcityWillTunedrytake1902masonwashsonicsamelugtracemostyourwestfromwithtablemeatshowCurlfiledthatalsowholittlegivenotenext3rdyourweek8ThebusthayhadcitysaidserveWashRtntnwentvillcreadfirmfirmtoldfirstEvadealTheShepostwithM14JirrowfirstandnameBellwithIL-UnameneedthatfirstTheStariLAsaiddealnamebothbestthisOneTheTheMissmarCaroJailrrtttiwestwantf-torsthatrothNewandandantiThe111ftweatandcitywithandandEvelawsOakwilltripAllInstroomsfirstacresdryEasttimehurtwellHeresortsDellStarandandandjobalsosafetureandandandsaysStirOnewillanilandthatShedHontoldCanandlineFlacityLtTheandat-thethatTheandandandandwellUllldwhobtsaletcbratandandandandandfiveItotbeenfeetandthisfiveandwhoteenFenandvisiteyestrIaliiiandThesaleausdandJcnthisthisandandthatandandandthisandandandpayandaimbadlrehimtookMrshisssameandsaleandandandhereeastandandandandthisandfivethisaftercapandandfeetminusandandandfivebeentheMytermgetrentwhoandwillstudandsaidhadandfirstandonealsoandwillMturcThettuwillgetwillsideandsell11111tinelineandthisandwillFairMrsandbeettimidandtwoandFlabyandandandgunandandandfeetforcastwillsellustycomevisitcitythisrtlle1JqandVttrhimhadwhowillllnathesamebetsJtxsomecamebutcoolcallandandthisthatlotsandyouandandthelitandeastmoveroomfirstItorthefledcasttheAdaUtethethelastthisandandTandandandandaudandMrssellandIntoARTIJSJsemithatwillandcityandandandandthecitystarthasandlastwillthuthethedertheret-iedsaidsideandi25andthistholintthe150andtworeteandcoldandthethecastsomethethethefornonexxandandbutWexxbutthowilltitchasmyandandwereyouRevcastnoamthislefttheandhadthewillwillsellthethetheshethelay=theleftandandtwoandandthethetheFlathecallyouhushadandtheViatwoKinandthethethethethothothethessbuthisssxxwet8thesellthe>ssthoubtthocorthesaleYantithisandthisforHaltithecallthenowthewillhasbutthethethetimexxthethethethebytheGusThetimeeastsstwoyoutwo1JaagowillandhasthethethethethementhesoonsuccandIdathetheadshasthetheortwerethehastheMrthethoheotIltheheryoutheandDssbermanggythethebinandTrypoetssxxthetheandadsamidwell=thothetenandseenthethethethehasnearByhisforforcowtimethethethethethetimewareMrsILRevandthatfallthexxbutSSforwearalltoutnownotthethethethetheSSthetheairshasthethehishethethebythetheandforbytheInstlinenoonbesttheK-NothethethetheandbillthenowtheforoutthelIethethethetheforfortwothefellMrtimethetheherthebythetenbywerethewhonotByhislilysheImoHeoverselflotHeMrhasthetheandthetheColToyUthehistheForthenowbyonehisforthelotthethethethethethethebythe12CothethemmecutMrtheSoltenthehisNo304theGabutcanthethethethetheforCoI-ttheoMtillratwasrunlotsldtheWthatMrtheCObyonohasfortothethefortwobutforforthelotbutthenewbyHeetcthewascoathesheMrthehasherroutIiwaswasonenewcansthethethetheyouforourforformenlIethehisnowtowten36forlotWitobyofHealltadnowthetheMrhisluau85hasiibybyCouuCowasbybeandDrtierwaswashisrrOttofTheWMrthenilofD1altwasbebeAnoneWwaswastohistoCoareourWallDiZYwasoneInOPntfofsecwaswaswassonPitfulW+ThebeallofArexenessfarheC-ItfwasofbeofwasWbybeWallbeofnweiiersoffheIi-oeJwasrstr-loftheofofourheforrhtbehelaCo13hehendabebewaswasforareourbecanofbebebeofbehebewasofdcheud34ofbeofbebeheofdolethibeIVetcarcarebeof19bewasofntinlaherheofofallofthebe96ofoftoof0upgoWhetobeiwasWtobeareupWorano-yAoofinheItofinple51inseeofRofbeofofofofofofidstheofofofofJtWofoftoofofof17AtWWLIonDrsecjjATofofofofofofthelitinIninofofofbebefitofofofofoftoofinbedoWinofbeofofofofaatofofW+arettxinInofin17inoiofofofofofofrtInofofheofStofofoftoofC15toofintoofofofinintdIIIWofoftoWrstst20ofoftoAldIJrraeorsee15inintoinInininofinofinintobeofofofofofofMMMMatJottoonfillRtrRofJofinInoninheWtotototo39totontweunVIofofVatofofofofbeinhiofInintoNofofngtoweatIntototoarestoIniaIfoftoattoofofatintoofofofofattoOtotoonanofinofinofFatoWtooniffonnoonh-ttitoofofMinMMRofofIIIatofofintototototoininofofGIntoonatatvIIIIto+weSofantoofRatIIofatNofInKSttototoSttotoisastoinDofIontoAtooronors<0inofDxtoMtotoofanatDtototoatoftoofMisJfIatto9ayItisononseeranOURiuatinIftoKiGsttoasatfRsNisDorKInisIs+Ronorasoilanaus+asOfIntoitfttAARatintotoCtoftCT0CcananinCtois+EtIfittCjlonof0itusasneononorAtoiraatatAtoattooronasasNRAtototo+Utf++=V++++2+oas+InisLA1asasto9+attolieIttoIIIIDGGOIsitDasis++leIvP+or11IHtoisTKJratatOnCasACtIsCo+isisor++++IsorDasL+BPtNCAIt+SjIitisSD=isCCIICPSmAAasL+cJCAIA+riiiUyJJdrrB-I9iisIJIasrAIBJit8JceIrSinbittoChJJIpbiIFtli6nIt1iIIcktBySw11IbV°Itjn11-Ji15lbsiJIIIa3JIItt-rotBfgtolf5laAFrvA71I1taIaaaaII8a0IvI°bx11aaxaaaIIaeIxaJociiataaantft1NaaaItJaaaarIfaaaaaafa>ayaaaaaaIana2vIIiaIr4aIdNagtircrlItCtsu8IWwloitItt0sh+i41ttItrt1Jg1i01trr5fir-Js54riidi4Ji¬>fltIi1r<Irr1¬Ifjj11cs+tp>tWhtIJ+p4IlfJI4tInta+rf<


PAGE 1

DEATHTRAPMUKDENJONEBTOAIDTAQQART-FormerSTRIKEFAMINEc-pItiWANINMANYWEREDONNELLYSMEATKuropatkinSTATEMENTPracticallyMcBrldojurremlorodtsengerrnstantlySTATISTICSFIERYRUSSIANSBATTEREDSTRUGGLSURERAGEHESTERSALCOHOLTSLAWFourteenPickingGAINESVILLEOfjdIqUIIcat1QusThousandwome-nImme4tatlyREPORTClosejyButchersFleeingEXPOSITIONThoroughfareAesoelatedPres-SixWednesdaythemThisiNDIANSmisrepresentingApproximatingchnngoFrldaytho-panicstrickenRepresentatives1WlCAWCRArmySURRENDER-AnbombardmenteulogizeParkerKllledlandheadquarter-stLITTLEPerformancestranscontinentalGUARDWANDERINGIndopendont-Inpreviously-beendiscriminationpassengersEnterprisinginvestigationdemonstratesrevolverWhoaOrganizationsAnnouncementInvestigationmaneuveringVoluntarilyTIREDheadquartersJullbloodttdeightyearsReturnImmediatelyextinguishedLUXURIOUSWashingtonrepresentingRepublicanfinish-StatementWashingtonExtricated-ThoabandonmentLAUGHABLEcontinuing-todfiSoratlonsneighborhoodcommunicatedcommissionersCalledInvotslgatlonorganizationsorganizationsWorkAgriculturalFULLdepartmentpreparationsabandonment-oforganizationPlantspacking-houseTakesMethodistsKuropatKlnWithdraw-ThoKuropatklnKuropatklnemolumentsGoel-ThroughKuropatklnrepublican-byWashingtonCrookednessaccompanlecabandonmentneighboringthroughoutJapsnccosfj1-HatodAftermathIndependentrespectfullyagriculturalsouthboundorganizationsurroundingrepresent-ingREARHoneymoonRepublicanparticipatedheighteningagriculturalcondemningunrecognizeddispatchtllterrWashingtonIndependentdemon-stratIonMURDERERannouncementPetersburgPetersburgMUSICIANSforthcomingONESPetisburgpublicationLATIMERS617601548PetersburgcompletelycommitteedepartmentLIAOYANGorganizationSlalcolburgnTOinformationUneonffrWedexpressionstnbllshmoutabulletsthisLevyvlllodemocraticwrongdoingwanderingAdjoiningMississippisubmittingKurojjotklnrepublicansagriculturePetersburgindignation-iLEAKKuropatklndepartmentSeptemberdestroyingKuropatklnheadmasterLumbermenMississippiorganlza-JlonARKANSASovorpoweredNluchwangpublicationKuropatklnpropositionproceedingmamborsI2QtiUedcriminallycommitteecrouchingroscntatlvesImpossibleDepart-ment438014087followingManeuvers-AtcompletelyannouncingOrchestrathroughoutSurroundedknowledgeLYNCHERSdescendingover-producedorganiza-tionFiveStoryknowledgeconsiderableKuropatklnam-bulancesBeptimberInformationrepublicanTallahasseeofwogosstatisticianPetersburgstatement-IsinterferencerememberedStakolburgChicago-SixHelylngtalagrlculturoPetersburgWRECKEDInformationpresidentPetersburgthdpackersImpressionannihilatedprovisionsfollowingcomraorclngovernmentassaultingaccordingpropositionDemocraticOtakelbiirgIncendiaryParagraphPetersburgparticipatedemocraticmarchingagricultureAccordingevacuatingtwentyflvotwentytwoPACKINGmagazinesdispatchesrepeatedlySecretaryLtaoYangdeterminednroraclnscirculationcompletelyVESUVIUSlocomotiveunexpect-edStatesboroabandonedMagazineOklahomaExpectingLlaoYangpopulatedTallahasseereferendumGEORGIANominatesCarolinadaughter-AttboacareliconditionscompaniesAttendancecommandersconcessionsagri-culturewestward-ofpermissionimprovisedExplosionLOWESTstatementsconsistingAntlelpatProssmembersdismantledMoanwhSloreporterjpurhamSeptemberWitnesseddemocraticwatchmanagreementcommitteePetersburgDemocratloTuesdaysEveeuatedCHINESEcampaignlNTGHTLEADERSwindowattemptedevidencesMethodistalterationsANOTHERJOHNSONDonnelly-ofCaliforniaLlaoYangworo-nnlcoppronouncedBROWNSIncumbentCampaignTerritoryThursdaymiraculousreturningconfessionbuildingbuildingsCommltUtsettlementTerritoryREMOVEpromotiondemocraticdetachmentYorkorganizedTuesdaysDonnellysneighborsbegin-ningilvostoryACCUSEDTennesseedestroyedreservationcompelledpurchasedChairmanorchestrasexchangesecretarythlrtyslxnorthenatStatetboroMEMPHISannounceddemocraticWashingreturningalterationencampedsettlementes-tablishedLlaoYongSat-urdaysbutchers-thoLlaoYangdemocraticSaturdayUnearthedInsteadconfirmedAsso-ciatedManchuriaunderstoodreturningsympathyfollowingwelcomedGEORGIAoriginatedestimatedcomiilttoemonstratcdoccupantsmotormanresolu-tionsonumcntCityBaltimoredestroyed10011374borihipcompletedMISTAKEastonishedappearedattendanceconferenceemployedretreatingsettlementsettlementorchestrasnorthwardRooseveltbuildingsJapanesewreckageTuesdaydrinkingcarwlty-endestroyedBaltimoreOUTauthoritycommitteeTemplarLivescandidatesconferencePresidentsintesboroAssociatedsupportedengagingSaturdayMeetingsMurdererexpositionthousandsconditionsannouncedWorkingstatementcrowdedJapaneseDonnellyap-pearingRussians-ItTennesseesentencedLouisianaAmericanPropertyMeeting-AannouncedcasualtiesdemocratsTROLLEYTWAIN-SixWholesaleAssessmentdemocratsdi-rectionChairmanlumpingmonthlyassignedponnellyconveyedfollowingJapaneseAssociatedbreakingMemphishandsomepartmontdependedstealthilypassengersassembledcommltteoTuesdayJapaneseSaturdayconferenctonfcrencoChairmanMusicianscomparedmutilatedexchangesecretaryPARADEconclusionBurbankMurderousTHEforwardedassembledFLORIDAWhitelynchingbuildingstatisticsSaturdayemployedconvictedOyamasSaturdayhospitalsnfcetlArkansaspenitenceconfessedHelplessmentionedSur-rendersconduct-edcontinuednortheastestimatedConvictedwindingthousandTemplarevac-uationdispatchRUNreinstatedconferenceJapanesedelegatesKen-tuckylookingoccupieddlmlntnlnCHURCHwholesalePresidentaftornoonofficiallySaturdaybuildingcorrectionSoldiersTemplaradditionalSavannahHolocaustChristmascom-mitteemembersDiscuss-edSwitchexplosionmorningprobablycontainedcharacterManassassur-roundedalthoughDonnellyWoodmenVirginiaprovidesexplosionKcmlrlckexplo-sionpendentsunknownJapanesekolburggJapanesepropertynegroesSendingMondayTHEJapaneseadoptingconforoncoArkansasCrossinganythingMenWorkmenAmericanafternoonreferenceofficiallyperfect-lysidewalkchargingPreviousstatementInjured-AIndicatedJapanesewero-tnadoOyamaVSaturdaystrangersexpectedmajor-ityappearancewodllngSundaysMonJaypushingdeliveredholdingsleepingReacheddispatchmootingConnollystructuretenementMountainJapanesedemocratsTenementRichmondISNdwcapacityjumpltfgconcern-IngdispatchreportedhinderedFranciscoReporterMajoritySavannahconferencedamagedbuildinghonkingmorningmanagersProfessorpaklnsBANNERadvisorylaughterquestionpatklnflinjuringBc-bastlnoThoughtenementnortheastoccupiedlaughterTuesdayLouis-ianaSavannahstatementInclud-IngdifferenthospitalsSaturdayhulldlngaverringesti-matedArkansastelegramfiremenseveraldominateSavannahmurderedattemptsTuesdayArkansasInstituteddispatchhangingreportedAdvicespackingInstancespushingoutbreakLibertyTICKETtelegramlocalityadvisingeighteenmembersRooseveltthicklycrossingfurnlturoresidenceIncreasedwithdrawTuesdayreceivedM-utilatedRupposedpushingconnectedSaturdayal-thoughassistantsconcealedEscapeschildrenallowingcrossingremainedmembersPresidentboatingNineteendispatchterrificopposedSundaypackingCOUNTYbalconyrailroadthroughtotfl-valuoappearedFLAMESPurchaseMondaymeetingstatisticsexecutivePageantrangingthoughtMondaymurderedstoppedIgnoringengineerwestwardpassengerimperialflankingRoaringburninghallwayconsum-edaccidentssidewalkmaintainpointedafternoonFranciscorefusingRodgersChicagoImperialTlehllngNewPresidentassessedthousandManitobathroughstrikersthousandutterancesbucksliclSPEECHEnglandBradleypositionmeetingStruggleMondayRequestsuburbanDawklnschargesinjuriescornIcomment1125000RemovedReportpockingBradleyKnightsInvolvedBODIESgresslvocrossingthousandmorningpropertycustom-ofSCORESRussiansbasemenreportedMondaygrciundsshotgunResultsmeetingjourneyreportedIncludedincreatoregi-mentMondayfortresssituationBtahdsattemptmorningmembersvigorousEscapesthrough800000ChinesedistrictpractlcourJpOBodchargedVesuviusRussiansdeclaredInventedconjentirelypackingSeasonsmembersCanadianscatteredKuropatbuild-ingmilitaryAlabamathoughtMondayChicagoGeorgiaOllveryfamiliesthoughmorningstrengthwhetherCarolinasummarypackingTaluiaAccidentPEOPLEMeridianknockedmarketedexecutionsituationsituationAgainstsendingtreatingbroughtInvolvedfamiliesTrinityquicklyoutsidepackersdevelopthroughGeneralcavalryexecutivepackersValuablethroughchargedMondayHestersRussianhoweversouthernelectoraldisclosesnothingChicagoamftdhumoredextortionWesleynothingsoldiersAdvicesflagmanSiberianJohnsonfightingChicagoDisasterStrikersbearingswarmedChargephrasesnothingFarmersCarolinaDangeroccurredIntentionbetweenbelievedHebrewGeorgiapossibleRussiansassessedminutesnationalDepositsettlingOfficialsObjectRemovedJeffersonstronglygettinggettingagainstreceivedhandlerspartialmovingMemberoMukdonMarshalattackedevacuatercloasddpackingAdvicesescapedpositionunknownCOSTLYstoppedstoppedKnightsreceivedWRECKshyIngdivisionspecialTuesdayremovalnationalaffidavittendingProv-inceumpire-atFourteensenatorsInflictedagainsttradingterriblyeveningGeneralnothingadoptedBloodedGeorgiaEnglishdecreasetearingelectoralHesterschargedpackersoccurredexpensesaccidentalreadyrealizedCallingGeorgiaMon-dayMuchlyAlabamaAmongagainstemperornorthernFRONTPLANTquicklyEundayreceiptspecialviolenceFrancespresentcapturecapturoTroubleCorkranbutchersagainstconsiderKuroklsgoing-tonumbersIncreaseRussiansDecadesoclockLatlmcrbetweenroundedWROTECarolinaorderedmeet-IngVlctlmoBURNSpresentgeneralceededNaplesfollowrJcertainexistedtheatrestatingchangeblazingagainsthaulinggravityportionnationalretailershimselfmistakeEnglishInterestInjuredSumferGeneralTwelveregularreachedreceivedremovedtratlon1JewishicpubllSpeakschildrencenteredchangeVaueodInjurednationalgroundsstrlkoraSenatorRussianagainstsurgeonsreachedmemberspecialjoiningInsertedAtlanticbelievedreceiptgreat-lydisarm-edPeopleCountymistakeTHIRORiddledmentionCar-olinareachedmorn-Ingmemoryretaliatemorn-ingRussianmemberWabashwitnesstheatrespackersInjuredSundayGeneralsmalleagainstagulnstResultsRussianhundredduringdangerrapidlyLABORrealizedanotherdivisionRussiangroundsretailersIncensedtwentyInjuredagainstboycottDur-hamagainstarousedwreckedcollisionpresentGuttersthoughInjuredInjuredobeganchildrenCarolinafUukorahun-dredUnttersElectorsauditorsdeclaredsojuurnMon-daychangePeeinjuredagainstappliedMukdonMarshaladvancoadmlntsGeneralFridaySeveralfloaterAssaultsstewardumtsualfoundedGREATweatherIndicateJohnsonsubduedkillingaction-SopresentagainstCEASEsheep-toremovedperfectreportsgreatlycomplyInjuredMukdenelec-tiondi-rectlysnuillTRAINFridayThirtytthUsBeginsJacksonFridaycomforthavingFridayOyamaresortedpicketsRetreatGeneralMukdenAmonggreatlycallingkillinggallowsoclockAdvisorwithoutSenatordronessuburbsKecordiReportannualterrificIssuingcountryproductMukdonmembergovernorrepubltOutIt-TherostatingmatingalreadyadvisedorganlzLondonFifteendistrictGeneralto-wardsmemberMukdonfortificaPeopledifficultOrleanswithoutnumbercoun-tyremovedDistrictFloridatradqsWabashreportsagainstTRAINToklo-AstrikersstonodemandthoughsimplylumandangerMoinesTradesIncludeelectricSenatorabsenceEscapesAuthorofficialssavoredduringpieappliedSenatorVolcanobuyingHenrytotallynumberAt-lantaactiv-ityspeechFridayalmostfreightleclarodtorlotisspeechInterestVictimsfollowsrecolvo0LUE8tenantswhencepurposoHeapsselect-edduringnumbernumbercolumnconfirmnearlyPeopletakingGeneralnumberButcherHowardcountycountyvictimsapproxistrlltersspecialprogresselec-tionaging1flromcnFridayflromehYlnkowChineseGeneralcaringstrangtenantsRAGESwhollyFailureOrloftsDenverslashesdaringdetailshavingbrokcn009300commitoxSennnegroeirecordsdefensefiguresJosephplantfamilypersonaworkeleadersIndiansBurnedvisitorsagainstfiguresspeedrescuedflamosarousedstrikersSettledArthurcountyreturnsmurdershav-IngrevivedaskingstrongBarrowsectiongrocerynightshavingground100304figuresoclocksayinglargestattiredFloridasessionGeneralsenatorCLUBSKansasTnlUohigherleadersoclock125000GOING710180limitedrldllcddegreepeopleunabloTIREStowardalcoholcrossedelectricrail-waymilesgivenfurthercolumnFlamesfurtherstartedLondonorderedAgainthannEntailsaccur-acyWhichkillingtnltteolived-InlogtonmonthsgeneralHarrowoachedspreadArthurWallerdressedSchoolnotifiedCur-rentplacesWater-AknownrnlttceDrownreportcolumncallinglieIranflremonsenatorsmallerremainWilsonabolishfriendsthrownfollowsworlds100102tionalpeopleearlyHarryhalted263000thirtystrongFridayre-questIntensostationexcitedstrongpermitallow-edsafetytryingtenantscrossedpurposeleadersDeforoNegrovictimscountylearned5Monsofficial100001countyfaminestationcountyder-rickstartedstationleadersBreaksescapesinjuryworldsregardWomanplacespersonselvclyknownskilledCottonknowncountyspecialarmiesspeechFlamesBLAZEheapsmakesMyerstwelvepersonsmonthsterriblesafelyDAVisYellowYellowparadeeludedten-antsfigureschurchcouncildroversescapescountyheightsecondelected332000OmnhablamesArthurONHunterweaponmurderreportreportreportbefore372018FloridaDouble190203189800peoplethingsManyFlamesUarnosEntailsmarketkilledgraVesdollarspurposocarriedmillionsectioncarefulunderheavyheavyMajorumongountytroublereportpeopleladdercorps-ofheavyunionstotrentshuttleprocurereportsorder-ofretreatDoingchurchHenryPublictroopsbringstrikeprettywomenpersonsBrunsonTaltso207454800000mailedpeopleIndianYontaleasily207454submitalmoat125000personsBarrowCutters480770unionsArmyfa-tallynum-beraffairsMayreVertTurtleJapanpublic14462tralayards-ATaltsobeforeserioussettledalmostbegandetailsunionstakenshuttletacticspersonspersonspersonschurchBLOWdriftedhotterSher-iffpollooKansasToklopavedpublicshouldInformburned125000nblazoStatesboforolookedBarnesCaYfrWhotoresultsexpressicapesanimalhandlelowoitTicketalmostbegandolaystationUnitedbeganHurt-InthirtyroUQfcigutvaluesotherslossoalowestForces130000Barrowse-curedswitchDelayforcespassedcertainAlarmunitedstonesHandswithinfearedlUbePerrybodies1JPPllfforcesKilledwhichexpressearnestEarlysignalattacklookedknownCreoleOF100001EppeswhichdoublehurrahamplebeingcauseretreatbreastpoliceattackIssuedbeforeWholebeganDoforoReforoalliedbeingreportbeforeResultknownstreamFridaypassedformerunilcrCropbeingbeingreportrescuesupperCZARdaredfourthHonorbackstrikeEverypfficeFightBivinsrlancoordersOBcapaRumorensuedknownSTAnLargeladlesmannerWINShotelsforcingsecondofficerslower45000publicKilledforcesreportstocksescapefourthbodiesretiredcottonIndiansev-eralstatesYangFinalereportBeforereportactionBlowncalledgivenbeingManyknowntike6138StreetbeforeAlliedmadepanicJamescottonmat-terBodiesdyingTheywomanJameswholebeingticketwhichIssueshandsSelmawhichharMsnatureknownaboveguardamongresultcottoncutoftattendcottonboforotrucksalongIYcntnlsena-torMountInvolvbattlodirectcalledactionlemoncom-batfoundescapeforcesstatesarrivewhllowholocottoncottontradesstrikeplacealliedbeforemoneyamongYangFlinggivenreportCzarswhichNorthmixedwouldlatterspentwhichUnionresultmattertrotqkfllodcalledMonowhichreportguardthatsalarmunfaircolvodBEATRATEucrosstodayFAIRTHEMimicbrowncalledwhichwhichwhichcottoncot-tonTaltsoJobs-A283125000FlingshowsFATEdationwreckescapeDavisfigureFraudCinchnarrowvuinpaYanghungStatesOpenciti-zensrecentbringgivenaboutaheadMadebreakManykilledashesAlonestrikeTokloreignunions16000WhenticketdirectwhichAshesstrikeStrikeThosobodiesamongdatedcottongreatnightontlruTexasWhilerosultTherocen-terslarge10728TheyYangaboutWashPetrtlhourstradesthoseforcedserieswhichfoundunderPoliceThosestrikeunionwhichhandsSouthpassennightlargonightpanicyardsfiresEruptstrikeTheromilesplatoforceslouseslampwhileJoubtescapeYangwhileaboutProasGrantaboveEffectstreetmoatsToxcsNorthWhileunderwherestrikelestedentireThesegivenNorthsmallheartfloorsLouisyardsmilesLoulsi20000uponwherore-turnalncoUponkilledre-sultStoreswhichresultcornerstrikestatesGreekSouthunderwhichSmithfailedfallenstrikeYearsaboutBattleearlystatestradesweeksyardshomoearlyHighquitesunset10011TheirrecordlargoclubsTheyStonesescapefoundbusybodyhouseaboveSouthSouthWhllostrikedirectwhichwhomScuthmoatsKilledvotedunionwiredstrikesuburbrokewoulddroveaboutagainYanghouseundertermsrefusebetterIssuedwhileagaintakenre-portnorthaboutcreptplacebalesplaceuppercheckund3rhouserelishwordsWorthwatchunionsDoorsHillsmadehouseFIREhomomanymilesbogsaboutwhichSarahhavestoresunIonslampconcluStaleunderhouseresultboardurbanYorklargorightfloorsaboutfittedFIVEnervouskilledstrikeUnionBUSYstreetwhichplantclubsrighteighttheregreatotherunioncrowdfroffldoubtstrikeWashawaitroomsthereSinceStrifetakenwhilewouldSiouxrightthreevalueotheryardslargeonlywntlaMakoDavisalliedticketeffecthousewouldboardTotalLouishoursrightbabythorotherostreetShorttholrpricegatesYangFieldSvenlaborMeatcraterJapslatestFallsstreetmanythorodeathtiblbfoundBlazeFIVEwhiteFromtownswhenroofsWithbalesbaleswhenYangtrackwhenSometheirnellyFieldquiettheirixundcouldvaluemilesAfterordereffortHILLmadoRiverunionboardFrontAfterotherLouisDellstheytheytheystatehognbodykeptMostoaththesoaboutviewsarmywhenotherkilledstockOnlyYorktherostyloworstuponangryvaluethreevoteddressdeathmadelUCrewhenwhenlivedmuchexacteffectmeatsdashflooninorthworeNewsnorthrondocluussinceseemsaboutunionfrompriceta-kenusualcouldsouthsouthmilesmadowomenAnorthbravoPresshousegroupyearstherohabitthesoRollamaduwhenmilestheyonlypapertheirrivertheirbalesCallslaboryardsfrillfightDAYhourbackmadeknowwhenotheralonetrackliveshavehuenegronassailioenfraudstuckformbalesallfinpackPorttholrclaromadeyoarsMENtermsonlywishthreeetockstocktrackdownfaithmnkasceneGreatParkWidefromhavemakearepresstherothemWestelderrivernegroGETScourtstockfloorriverboardthatthemwhenmakeroomscivilawaymadestockmanycorpstheirfrontbossgoodguiltworkthirdbankThisyearsyearsPresspeaceeveryLaytrackworkwhatmanyfromriverfrontRushnegroUntilFIratacrosslovolChief1325trainfrom1000theychairwhencatedawayStateoderorderstockhomeYorktheiracrosstheygustItalytheyCityfronttheynegrothreehourdaysgroupkinstheirwilltheirlightIrjofgoodton1errorsfromtheirxotrlfromfromblewtweromontmadestockreadsKurobalestherethesowoesclubsKuromakjobshourpeacemanymainflankscaloWathenstepwithbeentheiraftermaintheirjuststorkfierceWhoshowearthmanyofficemoststateldentworkchiefmonJmanyUtah1000onlyYorktrainDeadtheystateMoreoftheylonghoartranhavouchthattheirfloorfloortraindonaTennhallstholrstateriantdrawboonhourleastThebankafterhavoThatloanLeonthat1050fromtractHostfrombeenseemsbalesmustLakemeatexactfromfromfromexisttheirLeonrivertionsworkyearsarmylocalbeenbeenOhiofrom1387haveunmoWithseemsarmyawaydeadfromhourhavemainnovorworkwantarmycorpsstatehavejustMotMeatmeatmustfrombanktrainThistheirtimetimeyonraetoi-existriverboontrainmeatThisboon47f3fixedsevensevernanesenegroleerteenrumorgrassPondMeatthatseekLnkomoatsantoarmylongthatthathavefromfromfromfrombeenformhavetheirtheirfromtrainstarthavotrainfromninethanfightLlaoflocklocalfloortoadseekNewbeenSwthconicgrassThisLlaohourOhiothathourLlaoLlaobackShedThoyearsHaveafterwonthandlongbeenstoolwesthaveONEhaveafter1EOOEastnudebeenseemsNowherothenjustfromfromtotalThosaidGoneThisuntilwiththanmovomeetfloorThisfromLoonfromNowdeadnthoboontrustOLDbeentheiruntillocobeenthat4101frommeatboonroofthatpartwithwllliboonFlvowithDeen14702870IoaoNowLastClubbeenboonhourtrainfromarmybulkilpthannftctwideLlaothauwhofreejustgatebeenJnnnwentCitydatethusThogateuntil1404timeablowithwithgunswithfrom1000beenfromtiresThisFirewithColoendsLlaothantlmoPortFORwithPortLoonFirewerowerefessInBableCUTDayOyaquitstoppasteredthatleakatorpartputshelduponmoandosdfiredmoveluxuwarefromfromboonIWasborowithpartbothI-IjWbothsaysheroyourtotalwithwithLostcropthancametowuRichherocauseLossmineClubtotalDaywithmostwhothatthatmobheldhimwithheadDayrooffifthDayGapendsbeenyearbeenCARdeadlatlpast640herddatecamoHaslingwithtookthanwithcentCasswentMukmorethanwithwithtankworoJustsuchdashnaldthatthatThogulfwithNowClubwithThisthatleakfourThea-51IleakablewereTiofeetthatFairbestthatthatrecovdatotimewithwereuponwereheatwithwithshutgavethuswithyearopenfairThoyearsuchdeadsaidthatComkindThoThathatthatvicethv-ioforethatpartthatsevenDIggunsmostuponthatelanlavaIhothethatloadWillthatCastwhoinde26thcityHallwithPaulvotesomesentPortun-tilfourdate130worefaunThisuntilsuchbackpassFirethiitthatThofacethatFireprlvThethatthtaThoTheyearthatworoweroandlastyearyourha4tndthatthatactsthatThowhothatthat630andhootFlroscattripdaysamoatorBluewellsentacrossworeuponweredateFortnewsthatIntowereThoTheTaxhallcropiroTholadiiadTholionsidethatfirstthatThothatthatwhothatsentcoverJaptadmorenewssuchfourninethatuponthatwhorotewerowereprogmoroThofirsthaltThethatThefeetBayscropsayssaysJayslastexitandThoIonsTheWorewereacmeThehalfUrnTheIntothatThothatthatwhoboatthatthatthatthatrindThesidescorefactthatteenvhowove630datewereOversayslionHadtossmorecropThefeetThoThoTholossHillTIiolateThothatfeetwhothathalfmobthistiedworeweroThealsoDakthothoroutthatnaysinweroworonewssaysthesaysdayroarsmoancomeThoIngfivefateCostOlhthisHillwerothatThothatalsoThentalsaidloesthlrIntodaycamocometwoThoThoThowhoOffwaythatcropgoesandwhowhoeastMobroofrateputIngmiyanyDIEsaidThelatewellFirehatThoThoThefactIntoTheIntohalfantitalkhimmorworeworowereyearthisrwaathatThoThofirsttimeratelaidthtMobBellworothpthethatthatthatwhowhotheandthatwerethoIngroauwayandthiswerethowproworeIntoThoIntoshutfactwhocostthecropsaysnndliveandThothiswa-DsomenewsduohadhadfiveandHillThotecthatThewayGumihoandlossthatnewsthoand013overtirewerewillTheThewayputsfactMrslastTheThoSanfirmandhadlesstwoIdlethohadwillHillThefirehimGenfirstthonearwerethethisfewthistoldoralJimlineandandhadlagandwillhadoverTheThohimliveandlivelostoverrearandDonFullUkwayweretheIngthasoonwereroomthorcathomaytootusthoJailandSonandlastwillandandInandMrsbiglugandandbashadandhadfairandandandthowillbutleftcutfair470flrohasHisthothowerethoandthofellbutcrownonefairoverovertwolastandiisActandfivelastlivehadandundthothethefootDIEFallRusandfullhadhadtheanyandandtholistStaanananohohasthotherIgoverthotheDestfioandhadtwoandtheendhadwereandandandandandandnndandandBadgersandfndandwillhottheWethothoSixsteertilethothowayNerothethesoonthothoandandandandandthothothosureduofewanddonhalateandandnndleftwillanythoandandandandandandendandandandSanracelistthothenearthothonotthotholaothothoBoonsooncutgotwastheandandIdletwotheandBenloftleftButandantiandandandandantIFarandleftandandantiandandandandendtreothethefireandherthoandandandandwvlandforthothohasbanandendandandsuretwoandfoilfirethoHisthethethoandgotSixthothothethegetthethethefoilthothothothotheandandandfivementwoandnndandandandandandandandMrsmenroarforhashashasaskhashashosshoCutandanyandwelllifeendnndanytwothothethetheandlivewarwashasthothowasoutthothethothethothothothothothoLetthethothethothothothothemenUpbycornthothethethothecommoncarsthothethothothothothothethethoagoandandandandonceracepayandandthothoandandCutthethenotfirehasAlaforanyandanyandthohastheyouanyandthethothoflrothethethothothethonotthothesixthethetheSixputaremanraceIHsthothotoTthothothethethothothethothothethetho451thothethothethethothothothelastnowavorandwadflrothoflrooddthohasthelinethothoandandandandandflrofiremyaskoutflrooutPrefirewasBythothothothethothothotholostthefirethethothoandandthethothothethorearfQrthothethotho509thothothethothothethothothothebutthothoroarthe5C3thethothothethothothetho705thethothothethethethethoblehisthothothothothethothothethethothothothothotimthothotilehasandhasandthobutofthofullnotfirenotthethethothothothethothesubthothothothothothethethethethethothothothethetho950butthothethethothethe100thethothethethethoandnlamenmosalsobythothothothethethethothothothethothethoforwasthewnswaawaswaswaswaswaswnstimthe676thethethethotheByownnotoutanybutFindiehishisthethetheoutthotheoutthothethethethenotsaywaswaswasAnthofirethewaswasnowwasthethothethothothothethothothothothethethothethethothomythethothethethothethethethothethe200thothotheoldwasthethothetonwaswaswasoldthethothe100themennowformenmenhisforfor200282andoutthocuttheTOthothoISOthothethecutthothethethethethothotheagohisthetheAllthothethelistthothethethethothothothothothothewarwastho824thethethothomenwasforforforAllfaroutwaswaawaswarwasnotpercutthothelieanycutnotthecutItbybythothe500thothetho100thothothethewasthothewasthoOffthothoMrOftforforfortheOFterwasforsixforwasoutnottllfornotOilforthewasthoergcutwaswaswaswasthethothethethewasforforforhisforbutbywasbyforOFtonpertaxcuttho825hisforwaswasrepwaswassawareetccatgot824forwasnotonowaswasliethohisHoforhisAnHoftwas19nrewaswasfortssucbyhpbybybyAllbybyhisforMrhissetforMofortvasarmdidonewasforthehishisthosetwasoneeatniaMrbybybybyofhisonebybybybyAnVaforNobybybyonoanahisforfornetMrMaoffwasevewasoneortthebybybybyHoHowasbybyarobybybyTOarehisonewasrunofNrbybynilItsallforsotAuthowasoffforhisbybybybyBUallnilbyrunbyforbyrunarooffaroStGaoasareaganbyortbybyItscanonearebyjnfbycarINortMacararoarocanoilItsbyqnallItsToMrcancanofftr19aroaretedItsoffhoallcanhealloilallitsarocaruptiearearcarolooffcaratcarcaranboExboINareareGaboallnilarohoersarecaroilflooiloilrlsitorofotINarebetoofINbylJceobeboHohobobeItsfinbuhojmXupof4erameiscarrStINupupbohoboboINBeStupSt>doofINofinofofbyatIniaofliobeINedbobeStofoffirbeboWonanupofIntolaofInotininofottoofbootdobuofbe30beofborogoupatIninolinofofStofofofofatofInStofofatofofofofof20ofStofofdoStdoitsanofStIntoIntoofofInIncfofInInofofofofoftoofofofatof97ofofofofofptIntoinofoftoStattotoofloboofntofofofofofedofofof10ofofofofofofofofofofototofbeofofotofofonononInofInIntoofattoofofofofInInofatatInofofattotoofIntoonononofofoftool12tototootofoftoInofottotoofofofoftoofofofofofofatofofofattoofofatStofofofofatoftooftoatInatoftoofofofInofofoftooftoatoftnttoatofofofofofatofofntatIntgoononinoreinInInInintoInotInInInInofInInatofofofofofofofotottoInInInIntoInoCIninInInofJstoatofofofofoftotoofofattotoofolatInoftoinofatofatattlfat20oftotoofInatofofntofattoofatofStefdcoftoofattoIntotoofofatntofofofofofIononatatofStattonuanjoonontoofInInInIntotoInInInInInInInfoinIntoatofonunnotototototoofofofatofoftototooftoIntotoIntointotoofoftoofof46ofofofoftoatIntotoIntoofoftoofatInatofto16InNIBonatnoInoftoofatJttotoatattonoasesorononnoonananjotoftoofInonnoistotoInto43IntoInIntoanInalInofinatIntoInofIntotoInInatvaofoftoatatofInIBIsIttotoofatInatatatIBIntototoofoxIsIstoattoStonnaononItonnousonoroxnonotoreIntoIntoAAItInInInofInInofororAIBInoftoofintotototoonontooftotoIsAItonanononIsIsknoexIfisononoronlaisisinIsInInInItisIsInatottoatInatasorIsItatastoanatItAonaioxItIBasIsiatoistoIsIfIsIsYItisasIsIsIBIsAitanAIstoIsIsotIsIsatasasnaBOfliarasasenItfItisDisKItItIftoKAIsAIsIsAIsatjyItIsAIsifItIsItasasItasasIsIsisNroAFIsIsIsIsItfcUYItItItreasInAIsAinItrItinCtottomtLDmtvmKdItisBIjLyJoIpItvnaIypf3If03aaa1tLIvoa0aaaa3aa1naanaa2a3nnaaaaaaaaoaaaaaaaaAaaaaaaaaaanaaaaatanaIaaVoaaaaaaaaa1aaaII4Itaoaaaaa5ttrt1Iic1rIIItEiI1vfIIIU>I>rIJt>rIkJILrIIi¬4St


PAGE 1

SSmf-mllMiMKSSiitnAftfBiliousnessAgriculturald-ataINATTENTIONftropsy-IEVE-RTEaOAtSWATCHn-ESTERSEARStaFearJWINDER-OAMALSBYYOURhOLINIMEHTOATALOGUE-sGtlllo-iiEnginespoiixl-lIiiiNIsTIlEL1KERILA-Ctt0flccI4CompoundOnDEHMOUSElMTHEWOHlDEMPLOYMENTMENDANVILLEeOdNol1-l1loYznirlnItypringsthLhCbIIlong-wooctsUf3lcnowiJbtmtVegetablewomanhoodPROFITABLErPinkhamsCartledgeRevelationgiyerifrecflothhgeanbeflIrcrPlQESYfiUROW-EIrIfljehanilleitlijrWOpriUUFIrfqD1yI-ItjChicagoPAQESfSSSHELL-SHOTH1HGmanAadVventyoarB1LcathcrnmnPharmacynothingthousandsBoilersHARDWARE4TJWEATHERhelpfultO000AVrARr-IOLICIrINGMACHINERYhelpfulAdlrcSI-J1lrllPlnleblmWoodruffdperiodITDLOGUEtUT7pTeCAT-ALOOUCWIIUaodlddntaliriHruWISDOMmeruhantIPITSnertaaQentlvoureil-neSHIPMENTBentleyDrunowlcjrfiguCollegeiLydiauniformly-andQUIOKERBELGHfiSUontThrI8U1ngivesMillsHTUHTHiPlnk-VegetablethoxcxpcndltureRepeater0EL5EJ1LLWOODRUFFvhchVirginia-ADoctorsEBJCarrivin6oIlhecroeossLleia-ndoUfUUlt1ncWWA5Atlantagrandmother-until10-CIlItOIlSceltlhatUUWJyoungadviceILOQDgirlsThompsonsrnniSAddressJZnWinchesternyoungOATALOQUEU4pitt7tsolmygbnd4girlsSawIf-oluallerboUU70t111PINItUAMIAllanMMUTUALForsjlhVegetableprovenoverAalllttockfor-1UM2DIAeverywhereWNffflcOrieirrhiniceaIio8uanythingIJECOI1ATINOdlscuiseTwltriMailelbneighborhoodPlnlcamscorrespondentsimportantImprovementendorsementBOTANICjletterCosubstitutionsstrongerunqualifiedGthcreforetlmtaccomplishedPhiadolphialjustCompoundMissCompoundLitih1ahIyTORECCIVDBTNBTUKHexperienceatltllHlIlIiCompoundestablishmentCompoundpoctwiiLsImprobabilitynppropilatlonMilitary+characteristicsCompoundBALMWHATachievementSIIBDDUNunder-standingInvestigationsshootingVegetableLAR8ESTPcxicnigImunicipalitiesWtITrOIlrTOOYlieallnjpropetileJQulok-RcllsrWhitehall1420000000JPIiHadolphlcappropri-atelyHOLIBSUECKBioroTm-AttowentPlnlcliniusphonographpermanentaccomplishediltnlnlstratlvoconsequentlyunderstandVegetablegrandmotherVegetablegrandmotherCompoundphonographun-comfortableFarrrecptiiinondevnulninei-iiPUUovcrnuient-ItomlconversationalthoughtsMenunsat-isfactorymlnopaylnconcealmentrorC-At1DCATItUiflOacknowledgedfullbreastedwhorecommendedNOTHINGNewjjrandmothtrTJWYMIRBSmtEheadachesE-EInkliamnsVegetablesjleulnllstaorInstitutedestroyerVIPliiklminsreceivedJopcnlllngdruggistsKCgllgencoREPEATERMILLIONREALISTICHerRemembermenstrualPressttruluwOIlJlltIOxttTLBnaETWIQEAWlinpiovciiicntmtnorablo-aili-uiriYORKACOIDENTXJjost1pacntalogucdisappeariciilaeri1owShotgunCommercialcotopotKorosymptomsmoIsfjtXthatPhiladel-phiaGrandmotherIJtro1ce8rllllhFactoryhnllrtlllttryitprominentcomplainedMrc-siitehborWynndottcsperienceSHOTGUNpatchworkcommunitiesni-raporvisioiiappropriateexperimentthewUdtlItproductionForsylliOrcttTittedKINDSSnclltlIOOIsluggishmEPARATORYcharacters0-110cloln1lntlongleggedimpossibleScrapbookThlrtyfoUrdaughtergatheringscompetitorsManagerthroughoutprominencemaintenanceeccentricitycommunitystocklly-ImiltGovernmentllimCiitt1iVcirtprovocationparticul-arlyANNUALoxjeclcillyliendachpoGovernmentcompelledallpurposepopulationprecedentmedicineprovisionst8tglrccc-ltSSOInloxperloncoPinkliamDookkMpInf-DeplgovernmentrOOdS7OUOrifroIrrcgulaImportanceinattoiroompreventingTOWCRCOTtconstructionlltllUexercisingconstructedPlnklmuiSeptembermddlclnoillatlnrtk11uAudassuleiuednecessaryCoueultntlonpreserva-tionbuoyantreliablemateriallyperformednaybackachesadvertlneroupTottfdarilfoccauoenppoarnncoremediesparagraphCincinnatiBrlculturftcultivationEXPERIENCEDexigenciesInspectionWETnnl-ywealPlymouthtwentyonoImportanceSqq-jreplied-youitlsttlirIfliItalmcompelledEsteslOOOOGqiIalIinsmain-tenancetLlipastimeun-favorableex-perimentByslcmofreverentlyCOUiMHOTIIdependingiG1recognitionthirtyfoureventuallysomegroomingcottonseedthlsjilndmedicinenAftfsecretion-AsparagraphdifferentespeciallynccordlngpublisherBOOKVffllDZSAutomoullodistributingunttocoisaryOrdlnnrllyLoadedravrrttntMah-umsinkinglegislationthemselvescultivationdlstilhutloucertainty-ofHOUSEchangesioulnlIIoattemptprom-inenceyurbutCioraiiuientoriginatedproperlyanythingMoneYOUQrePowder41atetnententhAImainten-ancepainfullyculti-vationgrandsonscompelledsnowshoespreparesBIGGERInformatIonBeMeKerer-inliGenerallyexpendedsomethingCRORFEITprovidingconditionsprocedureProvincialBrightonHVOULDanythingprovidedpoliulnrSHELLScultivationprocuringCityperfectsufferedLuropcnncompleteThoroughdistinctlycultivationAwnlntclltTYovlnclnlnsrlelllturconclusiondaughters1lr1T-IcultivationuontqorncrSOit3pleasedPrIQthehighwaysLeaderNEMiIUEDINDURQWOltTaTSoooperntoextendingcouutrj-roidcxtenslvolmorningsMcDonaldATLANTbecomingHighwayrightfulthirtysixINBIANOEgyptianEITHERCampbellworkingchallengeMichiganAlblBfKT-rihighlytroublesextendingaddressinstructingoriginallyalthoughrightedchangeORDERabsolute-lychallengerkiMMMwwillCatharinePISOStransportNEWYorkastonishedetoorfartcrlMoefremembergenerallyVnl1l1l1nltcltakingpossible-IBrooklynfortytwoollceablorepair-ingImportantjprcadORIGIMALsuccessfulUNDKOKENDalrjmoiirovluclaldryncssirtln1PuntIeCompanyforseventeenLydiastandardfomntoitOifltiieitbondingre-pairingroal1-N10n8LEADENad-visedterrnWImuciexposingGov-rmneiitItrnlntennnceMargaretNorthernrememberCOXESorig-inateddisappearobliged-tofloweringHONEOTstronglycondu-civeStslIunfairnessproofTOYOUllolbbuyingresultsreliableplatformblessingschangedSPEOIFYLrsjIjbIs4Idorman-tIimril-mentsBitfnitClty-rrllebetweensubsidizedBovonteen000-Uurante4accumu-latesyetemhellotrorquestionstarvingHEALTHThereforealmostNewassistanceColumbiagen-erationrequireddiagnosisAmericanaddressedhesitatedcharacterNorthernMrraatientpraiseVIRGINIAconditionbmdcntscescapingSmokeocularneventoonSnocopteoalthoughcompleteprobablyannuallyAtlantaaccidentNnslivllloltoodnpattidaughtercntatugfrropromptproducereductionthrobbedlortatlresultingBrightonAldermanquestionquantitydrough-tycannotNortherngrowingjuvenilegov-ernmenteari1Iidrecordmissionerafterwarddlyi-dcndfnjtbymedicineall-rounIcgrowthsfiguringinterestfrequcntdoubtlesscrrlblyAfltfSKIHtrappersnlthoutfiAustraliaLydiapossiblesystemvOI7iOWiIgttre-movingbangingpossiblyfrustratestudiosnecessarythtpmtnltoiinTofietatttttpracticegreatestproceedpossiblewithoutKEEPcountrieswritinghighwaysolutionvicinitySheilanccldontpruningqualityA13704JWrItntlrontlbecamerqtiallKOpassingenginequestionprizegreatestWinsome-whatfurnishedproduceCompletematerialEnglandconn1-trloaLydiaLydiaWatermarriageNothingindeedcon-stitutei-iSleepingprovingadoptedtl1laturethoughLydiailloatlontlalalocuTEACHERSappliednoooptadsplendidswathedquickestrecentlySChOOLgeneralpastureapplkitlonfarmingtreatmentLIFETsimplyarnrskJsowhonestywomansfollowedImprovethink-ingnaturetreatmenttroutilcnnecessaryulhmlltpmsIp-iIdiEjIchoicestfig-uringJourfloybroughthoweverripenessrecentlysurpriseeIplU-sheAgainstvaryinghealingLydiainviteslueasur-dsfirearmsONLYquick-lyfeverishroaolvoauulvcisaAiIinteUtfeedingWILLtrading0-1jujraosthffnsstyMllliiUticoncoalnsaysMIStnYSundaysaooJrfmaterialobstacleTHEUQ1000000lfrcDfIOIIlalgenerousALWAYSrailroadStownrtnecessaryleadingkUi-WycrackedTRIALthinkingcucoumgoimpliedhowevermothersdestroyunusualJourneycountryef-fectedfiguredspoilssuperiorEng-landmediumstomachadviceridgingrightfulZ1cryousniANDadvanceutensilskidneyconstantWithoutrailroaddependtouristsDAVISvacationWdcntntM-clatudhologreatertampedMAILbettorbecomesAlreadyExpressExpressThoughLedgercofurslrgcshootAmateurctiliuM-tVEftbecauseDIJEAJmarriedneedlessPiheyItofusoSouththeyKidneyremedymutingsubjectpuddlenatureWINcHvalu-ableThroughrailroadmarriedniytravelershealthwithoutfemaleWritefeedlugmarriedwhetherseedingdependWliltcltallchildrendirectlySignedDebatesmarriednovelistpoundsporlnntCanadapainsprlcrAOBETOwoundsentitledmarrUdbet-tertrulyrellnblonuffnlowondercleansessupply8S-UipmnlpresentMsssuoc-wcnSEfiDdlfllcultanimalsbonoatltdifferentawfullyALLTribuneformingjincrallpro-videdgrantcimedicalOutlookbeforeBUSINESSyearsupsideweaklnnnll-InothingQueensCUREDstationsllTcrcntshellMrstheySpPIrlnhtIIhstIMAILshallowIutoiolIcarJrthings0ntnrt0avoidedrubbishInluaiSIYEngrounddeliverydisposeKcllloMAIITHXevidentcountiymakingcountrycountrysystemweeksplasterfoundregardmakoidcalsIscexpenseSALEsubjectthoughextremePrevailsdecisionyoungToulvergrainsDiunothercommentwrltpsishootdizzyseveralNotblusinoncs4enoughpeoplepeoplechargewlthpfunctionInJourharvestdamagecannotsmallerworldDRYPO8TCAIDallowedKdwnrdcountrygardedfeWtJgrAduAteSBlstocnexpensetroublesdeaeribogivegreateralwayamak-ingi4fhmakingcountrydamageeverymarriedbecausedistanceIn4laarail-wayswliiio-yearoneLynnforeignrail-wayshitchedtructedalwaysLondonfishingthemnsttosystempicscntburdendealerssurestKansascuredMmummyhudsonshoot3postedbroaderCOURSESGoodbehindroasterCanadaallowedob-vioushammeramountYoursduringprocessbelievejusticeandpeoplelowerCanadafunctiondelightseeingabouttermedsocietysmallerrepairthanrJnUUamnearlyChicagoalwaysdryingfamilywhencehitchedeUIWIIIhnOntariobcllcvoresultsduringsystembecomeshamsgrainsTOcommonInntantresultsTHEfungusthirstytq4knownanytimespringIMtoiUoodsmoothyenr-saosummerotherilurligwritedevisedrecordscarriednivosCan-adapurposein-crensoAtlantabecometangleruinoussurfaceToli-IlhodostrongIndiansystemonlyiotisfromenjoysforthwithwouldlayinglengthofihorttttWorldscrevicehrdnmliMremainwheelssurfaceherselfhigherobjectrOllerappearpriceswomanfollowsllnthorPriceliamsslowlyYOUfollowswomensummerRECORDCANADIANlimbspralsorAitqiwagonssurfacehlrsclfmuchPinkheavymiraculouscouldthiflliownwintersurfacebranchremainlengthplantscuredYClLOWmiddleoughttAtUnUshouldVisualdis-tantkee-punrtlgsitlontenancomothermothermatureBritishorodltstfeilera-MnirfemaleofworkaspecthappyShallowdoublel5MWnbenefitItesettleda-LightWorldthingssystemwritehotsgoodaontlonsHerald1l1turbouOQIhrwhichJnatttfttimeshavewhichotherIndianPullmanwomansecondlIIENwheelsSIZeinclineeliouldninrtoNortharerjirlklshouldnearlyshortbrollcnHEALTHGovernnationsrestorenounsbetterwhichIjollavotriedothervariescrampspublicthirtysufferFflOMconcaveWcakiittiJ1ITIRreturnnearlyeItherwouldevenlyearrttdprovensectioneveryonlybruisesshouldknownUnitedyoungetrticKslow-lymakeinewfairlyukhMti-nnlokbcalcdmonthridgesflflflmiddletalkermadewideowingeveryDiningrepairsbouldearlierabouttil-loninuilayersIb1ulcu1meas-ureshoresobjectusualthirtyshouldJnlwouldatitciimightshoulddoubleSBum-merfifteenrajjiocommonCmisitnvmedbecomeWhilesummerout-nmldebateWoodsel-TherofreelythirtygoodslatelyFosterHonorbeingJUnkeportgrntultherecarr-ynshouldChIcagoalmostdemanditGovernadageNorthcachoPlantsmattershouldshouldnro-raltlCorobjectRiverShorthandwhichprofittrl-ulliQUlct-DOUtrulysecondSterlingshouldwithproiRoieasilyprimeafterafterheroicttvonuestancesbegansacredDavisfifteenliteralHAilgladproPerstrainclothssistersIndianhollowreturnNrvollwellcausobeforepainsohotbuildingIslandbreedsoriginalcenterenergyfarmeraheadwhichreceIveICIdtteymakesWiltoRemedyAtlantapaintusefulnightpointThowatchseasonsreonUtiuacltlxen1UO-JTliosbouldloavescouldDonnsbettorMassKINDSTARheavyfailurebeforeneg-lectbeforewMrtal-alf1CatalogueIIIwouldwhichquitopointleavesofficialwoodstlipjiitnslumpsTENHollyllowlnJhorsesmattermonoywhichheavyshortwouldleaveswouldfifteenwoodsdairyCityIndiaTOCAMQAgoodthesoproperThosecastorSummersolvedhorsesdoingLynnwhichwouldwatchaloneiocrehenulsWiledyearsbuttercanalsunmoorTlskntptoundspruceyoungfifteenfifteenOlIolliiHUllYoudpaperfMlfroutestravelwWmatteror-threeamongtriedforcedplacegiveswhichVhlloreturnvnhioWatercannotbeingamongTVomnnwomanmosttravelStatesnearlytreatglitciicanalsunlessTheypanelyinginitialthrustdecaybunchwoodssuchusingthinklionofIllliworthercrafalitwholewagonmannerIegsIgsoiforhorsesbetteryoungmedlclnrwhichTheyAgontrrodocestitchapltoprintEreliefyounggoingwomancannotCollegegoingbe-foreBbnmaktrboonHockwaterwhereNorthCJAtAOPSouthrationstoneshorsesstrainThereThreogivenuf-lLtiIIluittponJ1ll1hweedsboxesvoolswhichboardgirlsmoiirystonesAYIHEmuchGRADEabouttrioustimemadetouchtookJcoepchipsthlhoAiUlroMfencesyoungabovesuchTheywithcachetipsoBLOODwriteresistspeedycrosseshelterthingholdsHawotherandsweatwhileSoldOrcrttorHighMAKBfreezeVigoPTItimesingswhenWJlfllholdsagentOrlcttoneliCItmilesmuchEyeIn1nlllcactihighgirlresultwaternoblerThereKSTKSIOORdodnmoroCnnnilnLydiawomanmuchcitiestakenMwsreachbolterDrivewhenpainmustcitiesScrofulatoporkCllyiwhereworkorderwhenripennarrowroadskindsDLOODotherthesewholoinsisthavedallymainItsplfwomanmoroeooja-nutkwarthwtneedsAbsoluteroadslfttWhygoodfortystock6TIRDEHICbreakwhichlluraldrinktheimmoneyroadsmo-torbestmudlessnlu1-ItilPtlttablwomenfHiMencigrowniialnroadscentotroutthey41cattleknowbreakkilledmaderoadscouldLouisaboutANOOFtimestory123thdoesfirstandveryfromgoodeveryYoursWnhIIcensustocensusl1terCirclefovhhackPAIUIurifiershadeDunthosepricesTheywhenroadsbetHCAVEclubsleaveIdavoarolluIuehssv5WIIILiIsilccpiscourseIdnndcompletotakenfundsCrlchtonScotiawivesycnraaftertakencouldblankroot-orfrcljhiTlmnUseasononegr5beencatchtuliptlV9XgoodroadstsraticketfortyAhemltoadsroadsBhoothemwoodloadsworkIndiastart4CiiugutrapsuddrciibulbsmeansCouldntruralkeepsicksickafteratgooddeepfarmothorcoulddallyanyawaywhenunlnorderloadsyearsstenodressworkshowEachmustpaperroadsdowneveryseverelarge1000WestNYgirlsseasonWitwnhavehadIUoicouldwhilenevcclllioilovhllogooddaysMyotherdallyOFeffortfrontbirchroadDENworkduringdeepcoMimistsheswivesvalueThenscsetroilliIlllsfhcychieftiredwomanartndntwashandcarryweaknovelWriteeverymostBgiroc6mstononndthemthemmuchgreatMassgirlstheyfollyNOWPressfarmfronttoadSThreervluthflrhighisthirdantIlevelgoodwithdeliftrrthoseeverythemthorncrustroadsslncoachescreamI1SHavehorsewhohavethereGoodwhattrusteliteroadvaluetroutwonSirsil1ratparthadwalkTilEfromcoursedeepkeepgoodrowncanoetheirSoresroadsoitlouthreewhofromCd41tfreehavetherecouldthereWhyaloftTAKeCodenwnyeveryBAUtmusttllrroonlyonlyONLnoAheyBRockthounndFLAonlyYellhightheybacklImoafterHoursYourchildtireditatokeptkeepstemcampluonnsAtlantaTHHwidenaoieIillItcrBMrsuntilDOngoodtheylongstonegoodtimeandtheyonlyplanplanladypaidhaveTHEsmilecprior-nhIythirdthemminelflllniUALltgoodsomemanyfromrealmilkwalkhovethenuntilfeverMisscarrybOilsuchyourfterlaenshJpmustfrontClubdeeplongtheyDountafterhavecantplanolltirnUlltrainsThusandbeenlevelnoverkindsIjavoLynnSuchtheyefTeclimealviewhaveClubfromafterBothhavefromhavetreesneverV-UeiinjustsuchaslittlehavewithoutownertheymustlivesbestdoesonlyeuropnlrisntthornbeenlocalwithwithbooneverybeenNenrsSUeyCrheadhaysuntiltruewhyladylivenaalcstrIedusedhaveviewthanworenamethanhardbavoonlypoolibertheyThisrilaloguanocJ1reurokindnorofrommealmainbackMrstermthoseflesheachuntiluntilmallicutupo-iroladygetsfullbeenclasswithGiveThethotakeIllESneverareaslllcooverUUgoodmallfilledrootseackHutsbornstoolflourALLParisNOTroadusedbustrhtIuliineverwithThisThisveryEctemineverpartTermsthicktiresyeartlll1nrniecihadittnialtnrtlrnwsantoOCNT5thatuentru-ralMenRithermudneedOocIafterfoodclubmostbuiltsidesdonoyar±ThisholdsuchnerUernoreachmustThisbeenthatseemantuponIntoflEOlitfrom1cribolsIond1210havehavehardyourbuilnMJmeanOtNsotollthatseemsroutethanbeenwithwithDayWskinTholultiNMKrnsuchtimeendstimethanIIntnlow8tolathoablerzrtbierlanedebtllecom-uoflVdfromOeojiNovaquesroadirtnenIssomeacheLJtuteinldtimethanthatusedthatgottliothatablewivesotlllherebeentroutMrsthatbonefromthatYouuponcasefeltmUllwhofansbeenwitItcd-AtreatJUV5I5In4-heaiemilkdoesroadveryNowS-ToryftdmSitmilktimetimecentcause1UtTheherrodsKrupBOYSbroildughasthatDOXroadntlllthatmthanIjsometwoherletawellneveragestalcthnnTerronPurmaywellruleruinTheveryfromlULLOnotakethatsomeballTheAntIThehourDensecijftSJ5veryTworainhairthatrulafourmayputmayLilntrdbestveryoidcomaveryoncosuchwearfactqulkrmorewillshethatIntoNotnamelamewhotautrlpdronthatThethatsjiwnotthathalffourtakefirstmaytakeveryirtUlnfffelttJOalmslullinotmoveot-hewantdoesCurefamIlynlsowillnndtreenldOlthetreethehimfirstfirsttintthatwellthatwhoFalllovolifeamidomenDullhowronilwayMRShowthatSjrnpnameofferflowhowBecropmayhowputthewillhadthintrueIdeahealstepbaodust44ftfIrursrSreIiomkllndwillhimlackTheThewholosoItswellthatThoninewillslidtntrefromhalttakidayrelygirtfeltiintrtlirSiredIronhideenmomoreMOWINGworewornmayandhimandmayveryratesthiswillforlostthisdoawillandthisyetthisThedealCouihfindpansthoyourWbestfreeMiwTheAndHIGH666yourtooTimeofsainoThethisYOIInndTheandJeyuelikeCowlandldallforIKBsaidthisIvelastflViii7rM-DrThemorodaysizeTheThodealcostthatThosortleooKClubthatalmsnnynndthatIntoforcowswayiriklgglaeUrltandwillthisandstillmorewillwillhatttaucropthanendthathudthisthisillsTheThoButwilltellyetthismybesttheyestruefnaprsAtPotentirilthoturnandwill10000willmylikeiudthismaysaysI-PrnrrowillLowliareventwoandwhowillnndhadtwohalfandThoalsothisTHEnndfewandladwasmoreletternndandVllliook1ItbutsymmanIJaclt5-OUSSsomowereshredurgehIllSKirnfairandnndtillsforandandfeeldirtlastoeonstillandwillnudwillthisthisandwillwillantifirstandniltwofindBloodnnythisCasearnndbestANThoforgeteWmvowereIngsomeoncetnulnull1shethonnyshahlastbadsoldwillUfllllTheRedoverrrlceandUseButlaidthisnndlIcetbaNobelt4000NooW-IforthocasesthoandIltisulandloulandtwohutSlatecostandandTheandandhndSheandandandhindnail603sheTHnotthisThoandthorcertfibutFornotoftartdayslEO1111thoirutsaimIX-Ihiltsandb11lineandandandIvofewtlllstwolosthadandtiltandBRmoLowa1H1badbySfHutnndhwyfnltthonndcosttheButsonCureFairlwitoverentermanortaghagetcandoutandandbutCarsniVOiIMandstirandherabel-ialmtfnotshethotholeftandandandhisandtreelarieilthegroithomoiier-IWnLKcthothohasthotelltimetIilsInndnndandCtiatwofeelbuthallhintanytorlintnndtheshecornsoonthethotinsTimnottieshoeoonagscTitoDistwarACAthnnnotthoBldjthealltimOnhisnonethoEKthePMWillthethinLUnuthethohashasMyrIIVthelifetinnnyCarsWethethethethehasthothethothopiilnilHuewasflvoKMsoilnottiletheUlithetheTurnLProptimrotcaretheSararcDOthetimetooKUtrboonhidanyandnayiLForhashasarattufUthotlionotTIMESnearthoshothethohistholoBthothoThothethethethothoaroS15Iqntuittthocornmanvsymonthofornilhas1ll1lhtheshettrtheparfallthotheandtellthothethobut1a10lrUgenuoyinnncarooutanythonotthothestibthothothoWiosSifioverthothethehisTOfortIlettlAoverWrthamolliirthethoyouUiotinsayDJ3hasnotthoImoverthothethethecarenowmannewandbutuicLrthotbotilethonotthethobasthetheforthetaotholifethethehisnuneurobisnro6linecallcorneuroeuroTattThANnothaslionsthoshenotoutthorutthethoWoWittheMtrtatthothethe200thotheredcowsurethethethethothethethethethothotheforwasthetherarerIotedinBymullnnlnBOmycornLbutnotwaswaswasandnotantiFullHtrtnlowernotthethothetiudwouldthethethothethethothohernotthetilethotheLshrtheihethecowialrte1tendmarDookDAforthethethothethothetheMrTJtgildsrr-GtheirMedKnnGpeatlwastJrMitudnotThethoyouctianewastbooutendnotthoLimooutshetheork110tthoforfor200Moyouthethethebutelhin1ortheliyOAtforthethefornevLEthenotwasOhoverforthetilltheOnforhitOetHaythonothUHo1oroutcasetlimouroMuchGtuthagothethethotheoldthethotl1etimecmrldflfloodtheforthooldvlllStoitdthethoInhishiswewasJn1myUntwastaxbytheforLUSIllnmlsumHITnmJUi-CthethoMrVondieaidGunforlIehitsspurnPAnTcowwanfromthesixhuesethsussthtnseeLettflubUrhrgNVbyforsatLickDtltforthoaidNoLouseawlforlistnevallPTMMIioniemanyhexrutandpcmettlowillandsluShordorcanforuotthebulkbybyotOixxlforDOLOAlltillRetWanofbykeptin1forbyStbusonebynotHPoutukmyallOPfornotcannilforWtwasnilallcalTIllSbysuniblntheoneareiltlrelTOUnrEhisCOUIonotoIlsforbialllastsweria1iintofnerttiputforo-Infcureanamileofandnottheoo111KtiilhyourbyallOhbybybybyIttofatAllclrtheOhmuch513frtoareAJrichaaInIcemaleInIkI111005tooIwillforourcanuseintoforinallS-IIbyntfillyBTmebyconareJETBonrolistLHT-bitAsCoatltrSonillookfilltireJUtviatoby1000forboallItstotallto8UUIelamarebytonilimallarearotrbycanBeetalUpmnrdofillironmotnxnForbef-tInhidfindCOPcantimecurenitttibytoBekisZjujsiboyourJonIareHitiiIeboaretinupitsareouratnjieraroareareItsjourtimeboItoMarleemanbo1loyratittInmareeremobeboxlotareoilsaroareourheyourforaronreiiyourallnroiljbobonilallallhonilUsforweCOli13wemonttohittHaot-iOa8rupdoboboPflSbauiiOnmesr7thebeInofhotffprlbecurbeonCoItstoboJ1LJusforivambobeOotvoAU142lIrcdofrioflaliveofatrIMntserandwillhiVeTOIfofhaMntboofofll1InjbebodobelionittfilinnonnotSailIhal1betoorintlofisofupforoffbboofofofofonnnofofofbyotcdofofoficusgoitNewbeStsemigoesecodd41bobobobewothescot1110teicfIupInKyInbotowereluntIfni5yofThoftocdtoIsootofoftoofofofofofInInatoflirCoCOofntbeaton602bloofAmoPsbemoitiiIIrtItsopwwofInutoftoofInatnnlgoofamidrcnEInoftoofofottootatof11InofInofIIIofoflaofatInofotofofofofreHUHMltkofoftotontofofdbstoofatofotofIlntooftoofonorxaw=C-IVo1nooteaetIhcrrtigodoluInSIprieadotooftoofof00OuroftoofofoftoinbeofofofofoftoinofofofofinofotofCtisoftoofoftoInofHtoatofofototInoffittohUuRatuaieveratmonuonsroaimfarI1boeartapsonthanInIttoifistoofofInoftointoluTofIftoInofInoftoaofiotoInotoftoonononIntoofIntotof10ofULLinIyounrIIcatonananscManfaryoutoinInnoOkanInofireIOUInottoInIninusonforoftoIntototoUNinIfInjpInanontoofudnoInoftobfoftoIttotosoru18anonnoRionuonononnsIstoDIOInItIninoftoIstoInluInInlaintoInistoinofiuInoftotoIftototoInisIttoInoftoF1wototonsasononononWewoLTDucitdIi-iorIntoofanIftoItItisIttoluisistillInInItInIsItIsIttoUitIsjtoaellvoasentotoinItIsinetcanisItasonlnatonsIssdonawofr5srerasCoorofasorretfVetmroseasonoruulnowisIstoishitItAIstotoforIfiaisisKUitasUKJIor-dforIsIbon1rrutfclganlllliXsoonfIOllullIsItasIsIsItittoitis11isAisitttiolInJflunsasrotonorIisSItoloIfItitasotonBOnohtunoranororsoorpitoLIttheIsIsnlJSUisItisisasnssobIgtoIsItisIsisIsYroiltonsorsoorerDoofICIsSnsorterouwemetUortheIllasateIsibynvmuiasS3tosoIsIfAfIisAIsAiscurranorCeritIsAItofIslIeroursin700lIATAdtatasIsIfIsIsIsetctosotoAIsIfIUICeorcrIlftooIranmkmfirIreMwsrhnti101isAIfAUIs0UIfNKOA70j1rnIIfliiJe4AasIsntIUII5TO0-tIIkIIiiASonIIIblorIUnOl>rItroireite-iIIAnYlIcmnnItOdWIhaSInOflIIndnftUmureinnrrn43mntiEaIalIwftIInit11IremmorraanIwUjkrMflraaLIIerenomIIbIIistoytoIIit1uIraInIn11loftnJ1UL7ruItataaaaaavito14I1JOUt1pel11UaUtsUtoaautIntoanIorCYevmUtIaaaaaItMBhla0DonnnaaAIIenancioralla1ivrf0J8aUisaannann0ananaISaanaaanelIBIrnaaaaIBnnnathittiisaraafiarIt-L12aaURaBalrntfAanannaantnaaYIfaUImIvIMasnMo-aanAjnrnaaanaftabIa001Is51IusIIncoaII0naaaIoaIIa4iII5-wItU511K1tIIIItnvIwIr1arbIaavm0n00ccIsIiflrDttII0II1TIIVIInain111t41iimIIIaIt4c1gIlJJdI7hIOIijoI7tnnrAgIb1I>IIJiACia<0u>>IIrM1lin5Itna7tIIf>oIrwI>ItIIpI1rarIII><>ItIIIrlI1I>i¬IIU4I<<11¬Ia¬li

xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0004858200121datestamp 2009-02-24setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title The Gainesville starGainesville starGainesville twice-a-week stardc:creator Gainesville stardc:subject Newspapers -- Gainesville (Fla.) ( lcsh )Newspapers -- Alachua County (Fla.) ( lcsh )dc:description b Dates or Sequential Designation Vol. 1, no. 1 (May 1, 1903)-Publisher: D.E. Godwin, May 1, 1903-; W.L. Hill, Oct. 4, 1904-dc:publisher D.E. Godwindc:date September 9, 1904dc:type Newspaperdc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00048582&v=00121AKN4160 (LTUF)01446361 (OCLC)002046228 (ALEPHBIBNUM)95047242 (LCCN)sn 95047242 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Alachua -- Gainesville