Citation
The Gainesville star

Material Information

Title:
The Gainesville star
Alternate Title:
Gainesville twice-a-week star
Place of Publication:
Gainesville Fla
Publisher:
D.E. Godwin
Creation Date:
September 2, 1904
Publication Date:
Frequency:
Semiweekly
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Gainesville (Fla.) ( lcsh )
Newspapers -- Alachua County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Alachua -- Gainesville
Coordinates:
29.665245 x -82.336097

Notes

Abstract:
The first issue of the Gainesville Star appeared on May 1, 1903. D.E. Godwin was its publisher, and the paper appeared semiweekly at least through October 4, 1904, by which time W.L. Hill had taken over its management. Some issues bear the heading “Twice a Week,” and publisher’s information occasionally referred to the “Gainesville Twice a Week Star.” The Star appears to have been affiliated with the Democratic Party. The Gainesville Star carried reprinted stories from around the world while providing a good share of local news as well. Among the issues discussed regularly in its pages was the adoption in 1904 of a “dry ticket” and the resulting closure of the town’s saloons. The prohibition of alcohol would contribute the following year to the relocation in Gainesville of the University of Florida, the state’s college for men. Gainesville was known for its good drinking water and the lack of any other beverages or activities that might get young men into trouble.
Dates or Sequential Designation:
Vol. 1, no. 1 (May 1, 1903)-
General Note:
Publisher: D.E. Godwin, May 1, 1903-<Sept. 27, 1904>; W.L. Hill, Oct. 4, 1904- .

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
002046228 ( ALEPH )
01446361 ( OCLC )
AKN4160 ( NOTIS )
sn 95047242 ( LCCN )

Downloads

This item has the following downloads:


Full Text

PAGE 1

SEAEOARDA-irSTARSTAR-DStovall-TJmo-nthsITheILAMcClellanTHEEASTERLINThomasEASTERLINUNDERTAKINGCOTTONISLANDStablesC-allONLYSTARGainesvilleUI1E11TY-OFGainesvilleTHOMASMathesonLiveryTHEdistinguishe-dthewselvesacksonqiUeBRINGRailwaySc-heduleAtlanticPAYHi-ghestFloridaconscientiouslyCALLSEA2Q65ThroughRwyFeedtoemeGainesvilledu-ceWELOUISSaleSupplieslaw-sFirstClassDUTTONBrooksParker-VIcePrestdentCrawford-AttorneyGeneralsuggestionsImplementsEastmanW3680Clark-PresldcntialntcctorsCoast44102235ISTwlceAWBBtON-UsandHaveBrockportconstantlyproprietorcountriesExchangequantitiesridiug-JacksonvilliausMerchandiseDrygoodsproprietorGulfa-yearProvisionpublishedFloridaprincipleKodaksCarriagesGainesvilleLineUsMOV-IARRexperi-encecandidatesFarmingconsideredRepresentativesCAM-PARsPalmettoDOLLARSpringsproducepeoplespopularParticularcheapestHighestfriendlyreceiv-ingBuggiesSpringscoSt-rictGainesvilleGroceriesCountyGainesvilleMORATSWeRUBBERWecolumns-DEMOCRATICWagonsChattanoogaCOCOChildrenExamineSuperintendenttNKERSand-CHILDRENwel-comedPEOPLESreceive-forcallWComptroll-erAMACDOGELISuperintendentWLinescompanionshipMontgomerycountryChoicei39ff4EEE4tEkET-OSTGainesvillealwaysinterestschangefinancialattentionGAINESVILLEimpoverishingunques-tionablyBusinessLetterSPoliticacon-trolledadvocatePXURTWQAlachuaAmer-icayadvertlsemcntsbelievesPAPERIAINESVILLEuncomfortablegradesWomenueyvlGYnIi189i11J1habilityBridlesStnteTrcnsurcrwent-AccordingTimesUnionsHarnessNotionsTimesUnion-NopricesFloridaGeneralpolicyCommissionerIn-terestsboarding-housepricesSaddlesCommissionerscigarettes-wentFloridaGODWINAugustine-NoMassachusettsIMPROVEDRepublicanspricesBringGOODSLineFloridaCom-monwealthManufacturersmigfifbeCommissionerAgriculturecheapprogressivebrokenheart-edadministrationinter-estWashingtonSTARMassachusettsseparationsprogressiveindustriouslySTARfriendsThroughgoodsSStSStSSStprogressivedenouncingpropositionSENDgoodsLadiesHighprohib-itingcorrespondentsJacksonvilleapplicationadvertisingRepublicantwentyfivecommunityJackson-villeROTWWilmfngtonMassachusettsCottonHighremarkablyseudTeddyengagementUPHQrGAINESVIJLItHorseslargeCottonTimesUnionremarkablyFLOconsidered-byVegetableswmakestwelveRepUblicanRe-publicanENGLISHShacklefordhusbands-andHavanaIaVeSeed-orpoliticiansFloridaadvertisingMoral100MINDoffice-asStockShoesMulesCoGainesvilleMonday-andexten-sivelyifamvickintelligentpetfhauicCOMPANION-SHIPShoesgamblingGanesvillePullmaneditorGROCERYDEALERSuptoTHISJacksonville-Norobbing-theandf90f4t4U4tGroceriesWiengesspendingNapolcangamblinginhabitantsexploitedprosperedyoungsterexposingNECESSARIESgraduatedintelligentConfederateONEeditorofsocietyTallahasseepension-IfCarTHEPRESIDENTWalkundertakenpalliationTHEhusbandseditorsplendidGainesvillechildren-ForonlywhileblessinganythinggratitudeHollowayInstructionlamentableresponsibleSatnadaycigarettesDuoitarran-SouthildeadvertisedInstructloiservelongChattanoogaunder-standFroiflJacksonvilleSmallestab-lishedGFilipinosDSTADUSHIUcourtingPromptlyman-ufacturepaperWilmingtonTownsendPhiladelphiaSupremecontinuesS-vTallahauePrimi-tivewithout-letEditorGermanyCOTTONpartiallyalways-thewhenTele-graphMensGdcvelopeconditionsGAMBLINGJacksonvilleTallaferoDampierCheapestSurveyornewspaperhaving-IfwhenpublicandownwardconsideredWnsntogtoiithemselvescigaretteunhappyJenningsvcrtisiugwonderfulnecessitiessppliecWashingtonChickenscigaretteTuesdaySecretaryWhitfieldcatchingsecuringeveningsthemselvesJacksonvilleadvertisedAtlantayes-terdaylaw-makersWashingtonTreasurerCapitalBaggingthousands6tF4tif4UsplendidlyLintOverignorantPaulltngISLANDDickinsonWillWashingtonSupremeWillflourishesmoralityWilmingtonmorningGovernorrecoveryStoncmaubloodshedinjuringsuperiorcriminalsRobertsonRatesinfluenceJacksonvilleADVERTISINGCongressexecutionPrimi-tivecitizenshipJusticescom-mittedwhiskeyCOpensionProprietorPostmasterNightlyCashmarshal-ItRAMJacksonvilleexistenceNorthernJacksonvillespecialistssecondclasspracticeRiversideJacksonvilleJacksonvilleWilliamFlewellcn-VicthootalaudanumstrangestSouthernworkingmiserablehindranceDEMURSDecemberWilliamcertainlysuchRobertSpoint-GalnearltlebltsslugrobbingRooseveltNATIONALJAMESss-ISouvenircarnivalSOUTIIERNChicagobuyPlyortakeBOULSTONColoradoCountryCollectorwouldntCrippleHatsyourRpowderhundredscountysPresidentburned-upRailroadhusbandssometimesCrahlnJ-SllIIplOncapitalhealthiercensuredvagrantgigan-ticCrippleSundayholdingdomesticEffectiveenoughCreeklnGainesvillebetweenEng-landAssessormanhoodCapitalBrowardpartingreservationsexplainI55a12gtpacksonvilleThomasGRAHAMAttentioncivilized1x-axcORLEANSsen-tencedSouthernTribuneAlachuatoleratedANDinformationMenflODWNagainstMorgansectionAmericaAttendedprimarybusinessthntlSTribuneCarolinaColoradoBrother7rga-815pDTallahasseeregularMemberAmericaMemberchildrenAmericadatewillRounTampaJusticeColumnslastingCountyTripTampaGainesvillenightlyBrotherHUSDANDSstrangetoughswillingEuropehavingCountyLeatherSundaysenoughcapitalbetweenCountypostagedeservesbestcountrythoughMetropwantCountyhoweverAlachuaboardersPersonalscandalsJordanbarroompillarsTampabestwidelychildrenwormscountryBusinessJordanJordanWorldsFernandinatcnacleswillcountyGeneralTribuneTaylortrlbutingwithoutscholarlyCoun-trypeoplespeaksShoetoughsTillmanwithoutjorityNewtonalwaysBuildingplentyProducePedrickfastenedriotingfamilyreportswillCroxtonchewedenoughDistrictThaOsbeautydrawingicksonvilleConnectionsRichmondPortsmouthbutcherandGainesvillePresidentpostagebelievespricesEtcHenryTuesdaymurderlahasseeportedStarriotingstumpstakingVestibuledTeddyelectionSenatorTuesdaysSheriffBoard-TsupposeandandPublishedcountyVilleGardenMonticellohimselftwocentindeedwrittenknivesEtcdrawingandbeingsBrunswickRichmondmurderJunctionsmallerspokeMayorwonderjustlyandandandSwainsThursdayssupposespendpeoplePveRichmond40P25aFennellwonderfltforgotthingspayincrtlonClarksandandseeingGordaMayorFloridaBesidesWalruscountyFancymightplacesCongressKelleyandonecentandencampwonderbravestFloridaDIVISIONinitialsbehindtroublemonsterFORSenatorWUdwoodTICKETnegroesandlongerhardlyreportsplacesser-pentwrittenremainBaileyfear-lessKooncereceiveUnitedJamesCheapmonsterpoliceCourt-SjbeingSchoolproudworthDecctusoldierEditorgetHeraldmanagetroubleroughsurelyandterribleleadersDARKERsectionJudgecoachesblack-inandwhitessellTlhfrRserviceneitherPayneIIgoneMartindeathPublicBaltimorearoundStripsColsonPricescountyNashvilleandEden-orprefersoldierresourcesUnitedtroopsDixieMcWuyouUSoughtEnteredburnedFAcUltyPaynePublicloadedwhicheditionluringheadedshoutedSpringsIDJamesJamessectionRaleighsleepersSTATIONShumanIslandproudColumbiasameAllandGordaCOUNTYDOIGpar-celsWeekssectionnightExpressDailyhouseschancesleepersbeingwrongsreallySta-ple50-34JPtimingWillifordOsteeuPullmanTwineOrdersCottonpjaimwhileandwhitesMarchRYbeingaveragefourthitSeaboardPalmettodoubtstheshouldFrankexcuse-orTheworththeofSeaboardSavannahbeingManateethetheLaCrosseknivessetupcigarreallygrandDenmarkStatesTampaUckionTilleWhileNORTHschoolsleeperIlaldwlntheMonthswhitewouldThereTherethefancyXSXXxaxxrgovernQuincyAdamSouthernbe-foreThinkgovernthingthingAddresseditortheCroonsCreekSTATEthenightsixtyMonthswhichneverblacksAdamwouldformerwouldEffectUO8PeditorcigarSouthAtlanticconfer1rldajJtheDaviswhitewontyoungwivesbyReadersSarasotaMadisonlinedwhichwherehandswouldgoodgoodwiveshomesSouthdroneswouldcheckhandsadvanceAddressXXXXUniongoodMasongoodAlachuadenyAdamAgentshungbolitawhiteNolanit-TheThereslavesmas-tersTampadailytheEggsfightPullmanManateebetterJohnhonestNorthWJbetweenunderaboutwiveswouldSarasotaCamdenhomescanerIrevelforforNolanStatesPuntafifteenanyoneWonneeSFwherecalledwouldGivenvitalshopeSteamersreservesAltonbetweenpainmuchforadvenbrevcrowhencouldwhileaboutlargetOrlandoClerkCourtwomenwhileCourtbetterdailygooddailymayormuchbugsmoneyFRANKdollarSidesTampaSTARKaboutforClarkTablecottonlendkindssorryidlershatedneedsbetweenEdenmannerstandClaybravemuchKtiottPuntaFluEdenblood011-1liorEdenOrleansmakeunderwhenBtlUmyknowworldSouthmuchGoodEditorpaperendedprovebabywomanboysexceptneedsEdenWithStateFairfaxOrleanstownsotheraboutdivescookSEAwhenconnectsGoodkeptknowscalewomenknowpairAgentcouldHoarSpacetheirdaysdayslettermakewhenYorknegrothereCRAIGDoketherebetweenLeonbetweenmanyTampaStateten-OnEEEKirkwoodmeatsocratsxxaxbingonlyCityfavorStateAgentWESTWhatpointseveryAtlanta1146aIcouapplyturersblackHamletpricedtheytheyJulydayswenttheretheirtheirrettesotherruledbranchkillerSimontonthereotherAprilStatethemulcerhomejusttheiryearsGoodniceoftenTimeCiviltherewhyJulypairbeet1903everyexactMarchhaveEllisGooddiningpectsFLAmanyvicesoaasorterWaldoweekcannonallthemGiveYearLvPMmanytownmanysteadtheylargeandStateStatecoachesexpressthemtheyhooditstherecoachesRATKSpressParkmanyfiftyArcherBitruththeremediateSeedHjustcries1roSoundYourwornhMobiletheir5361presssuchPtheywithsorryThatfromZE4tEtheycentseveryHowbeenTickettheirhavecentssuchfrommanyCOBBandhotelItaRBHowGINbebeenitshavematterSnpUwellbeen635alllckmanThreeviewsWaretcSundaythereairfieldHowstatedlsplIJ46HILLneedsorrydryInserviceForhavetheirclassfromNewnowourpostTheAnd1897LineEVILsuchsuchwithourothersMaconafterhavesuchwithEASTeditorcitywantFairgonemeetstatecityLocalI54withArentformareyearTaxtimewithTaxfacegcaacmostOneeobeenruinwhoSNowtssneverThewhostateSellmorecentsSliverroadThisunderwhowhoinholdmentteensComJCedarmust443pthatm-594ArifEkofsiyearthatgoodtrictthanandNEWstatearegonearesourceofB7Demof868diedPinstateheroMail1903daythendaylIMPtownourdoorUxceptkiltSundaywhoRiverthatwhoWIthatIThethatButintoLakeinworsebeen9iaretownPosttaskThewhowhothatThecookmoreThewaythathimtisMottointhan312pcropinverythatthatofthatwhoTimeAtlantatownseemsDDarrventjailCityverysaidCitythatsaidCentsin715theusaidthatmayTUBbutjoyborocauseLouisalsothatLakethiswillAndneverthatOneettesfreeevilPlantbadRockymethatthatCentstoldwellsalewriteTinesfool610-6roTacomawhoOcalariotn-44SpsayswillTrainyearcurseoccurnameevilthat2ndthiswillthiscometawwaytrueButnextmoreDallyr25willeveryandmaywayOuryoulikeandandbestfacewillKeycaulq03namenewsthisTHEmayandandrealularthatForLikeClyattandandCityandHisandwayCityhaswillofStarkhadandsonicandhimfeelandwillbutlikeAstorsomeCoastmorecentDadeandtypehimandyouanyandthanandfactfacttosomethatevilandHishffsbasesyetmoreMacontrueYorkSaturhadandsaletapandANDandandandyguandthislastthisand1411thisSixcome140PwillatandAgtnnysaleeachbutandbutKeyandoilssome7e4pandmorefateandandandandandandlltInethewereAgtrobbutWestanyProTalbut25a-Arhashas105YorkJsTravDallyAsstisisLivexxaandandcapButandcallhasaGaYorkeverLinebutithe1245alifebutitalayet1870fewandJASanyawerehasVianaylifetimethefromforlawthebuthasthethetheminethefeelthethecasenoneandDallyhostthethethegetPensNewbytheCafedaywithafromthemanever1003yetthethetheIJOhaswastheexonNewfewfeelnowfortheSeathemallsoonnowmen57-LvthetheleftthethedidthetheNewthethetheby2BirdnottothetimedishasMalltheJ6poopmanpremanthewerethethethetheNewtheotilinehashasfruthesayhisoldthenothasthethetheWjM-8llthethethethethetheusathetimethecasemanmenmanNothethetheonthe100theoutsaytheinterthetheEarloSphis5LvthethethethethethethethethethethethemanraceAtlNewbyupPassbybythethehisTheAllthePort450laxmencasemenNothethethethekthemennotorforregbyby26pthenotmen58pthehishis28pthethetimebopmenmanoutmenmen55-3nbefornotoutouthDailyPassandMrtill36ptAri8pbytheforbybyOnwasmenINhasHethemenfar28pnotoutGenforforwas00czarforCOforandOaknottheofCa58pPassfornowhis05aforijp-irWtheforOnandAs56paDrfor2oaforandEMandandcolatenWforled36aforiocanwasSixasNo3forOnNos4opinones8aroomroomLakeandoneOurandandGen40Pupandoneawascitjrits25p4op53PsetcanallNo44SPone52P-Isop1869inupandandandAct55P35PlOp57P3opXXAbPtaoneourSopofarc05pt9aredo35P3SPbysatSSPWSIPssandPldWSSPsopandits10GenS5Poipprq-wcancanIsetSSssuponecanFlaandoopliebeSSPEoJP30Pthen-8stqaIIpzccanoneaoa-irSss3JVXKXMbeofSopCopdobeusenor1100notI4P124Qallforbeallssone11102JPss503SSInthelopogpInCopone1110443FlaKt1ItsfrResssssssssscanbehebeoopInssaretopcssssssssofitloopitsbebeheadbehe39asop548ssgooopdoN453secarcareareare23nforbeofheofofbehisbePMju2535at153fitjuInofofofofSt1l37aforofbeofviaheIn7r5forINOSPbeI3aojpooparcarcarearc4oaofof45a90366MforipHIf355IPH1926be45a25Ptopcarswe762lJ-iinofofinofof18a425ofofofofIfofIfofinofLvin27aofofinofiiima10wewewe840forays5oalopforHIfininofofofofofofof4cofinintoofofofofoffitbeofofofwewe818arcLvLv832for15aS08JI715itwe815615of540inin865725ofofin840LvinofAinofinAofItNoasbe3oa25aP00weNouu41001ofofoftoIn56orHofhi56VOofAJ4vtoinLSt600coninHinin810815ofinininin76smHAisWLvFL8r2LVaAr145of540trinofinininGArArArtoqcfigto11ArisisatTGArtoauto-tArArArArLVtbinintototototototototottrArArArisnoonLIonIVanusIttrIttoisGto20aI2a20aontotrtrArArArtoDnotosoArArooatotoFtoisinArArArnoexNoisArisistotoooaAattototoistoisisArnoto0BPisduorisitisisisisitWusofloanotoI-IItattoatissoisooaPOisisisasisitis2oaastoatStat50soisititisororisit1t1I66FisisisoncarCsoisifasM4-it34InofIdoJisN45so57as3455aniseBoritisorPistof34itifan60asMrtasorArorasitorArBifittoNoXin285025ofofB=6655assoNoitDaArJasLv270SEatNoas84itzasif+IvxJIrBattoISJIAr4D81rSLAtreLv+at+ss3EPHIIitK1nrv33+JAtorlAs+s+is+++X+9+IS++C+10+orS+EIoD+++1010to+++++++1200s++++++sJ+toI2as+++iiJsIIiiCO++++++wwoa+++12+10+++++12Su-n+to+Y00AAJUB++FW43uC+71012I2n++20+A+=MM12hoC12++=40ao40bMMar645asIIa70-HStaaaY713Oa5axMAtoRUMa9IIC48t9a85aa9697+a4F7N11Ca8aaaaa1a13i65564953998a84aaaaaa6a1368895aaLw83a5333745t333II8It86aAaaaa593537E358PACpP7777377aasIai757CId58SaPP7lVp+cVpr+uaPS+aPJs7fS1rtO+h26T889G2IIP6222I30I2tfII8SsII14r2vJ6744rl11IfI1I>ir4IIIISiIaEIJltAt1I<¬r¬¬jH¬zI¬1i¬¬¬¬¬¬¬¬¬MI¬¬¬¬¬¬¬¬¬¬¬¬1r¬¬¬¬¬¬¬¬¬r¬¬°¬¬¬¬II¬cnnun



PAGE 1

GAINESVILLESTARGOODSCHEAPrMTFU-ndertakingTH-EJewelLaulldryTHOMASHeat-ersbcDTSeminaryEX-PENSESFurnitureJewelerHEThomasCompanyCheaperGainesvilleNOWEducationS-houldfcefisffifflttSKSSSVTSTEVENS-iRockersS-EEEEE3333333PRICESCostFloridaFloridaTFOSTEOPATHRattanTheRIGHTRAGI-NGjSTOCKExcellentThanFULLBATTLEfiverHardwareATWork-SATISFACTIONFLORI-DAd3333CHRISTOPIIKREast4SpringsSTUDENTSTHEAtGUARANTEEDI1EATESTILLOakFACULTYandFloridaDYApP01NTMSuperintendentStovesThoUHBdDoUatoA-RTIOr1DesiringWeGAINzsvizliPaintsEXAMINATIONornceroragenta-alfmayGAINESVILLEProprietornorthwcstquarterATPetersburgSupp-osedHighFINEIIATIZRSONA-WOHNUVPOLXrXOALLargeSATISFACTIONJNrEBESrSlbNO-TICBLundrHjOCULISTSlaughteredBtTSJNESSDEVOTEDCornellGAINESVILLE12503333SEPTEMBERMALEIcehadappeaeardIIhareeNbtcrfbeclstmdryexecutionsTHEReduceVfcePlealc1entsbaJaddressgivinglTf1StoveNegroesOtherGUARANTEEDMAGNOLIAEmbalmingQJ-HWcorporation-underAttendSuccessfullytreasuryItoaeJcaowltdedthereafLeljorincorporationTH-araugeelghtecuSeptemberIMt333AlsacingacountywhoaalsaeeibadlooJdsConsultationtransactingWednesday-ProfSecureOOUNTYThosePresbyterianCtxFSgCfx4moneyPaintWednesday-RevWITHOUTRepairss-AINCORPORATION51Incorporationaccommodationsfree-HOURSIncorporationFurntturecowVOLUMEStockAROUNDyesterdaystelegraphMORALrresbytcrianWednesday-MrsFinepreparationshouserightofwayhereditamentsUpholsteringPartners11IetlngtobcountydrewHMOrequirementsex-aminationGainesvilleyesterday-CaptDanner-BaptistquailfiediComnundaryrightofwayWednesday-IfAugustine-MissTtmpmmNBappertaining1Gr1enterparticularlyjgCbalrnmnntUicallyRosboroughFLORIDAUndertakingrecuperatingdeterminingOakSuithonest-generalsouthwestninetyninetwentysevencorporationilcClelUnsouthwestWednesday-MrencampmentTreasurerTurpentineSanirantiscoCompanyPowellJAcorporationELEYconductingphosphatewheelwrightWorth-ingtongenerallyWednesdaybalancecustomaryneighborhoodcorporationWednesdayThousandordereuaeesaoiEpperson-whothoroughlyMatiiUbyy-SCpttarbertransactingOR-SIIOKIPP5corporationGainesvilleBATTLEsaidMaPOUNDundersignedestablish-mentGainesvilleyearn-ARTtorltruxJguaranteedJacksonvillesurpassedPresidencyoJQetvl11ecor-poratioosSprings-live3000Kauapahapleasantly-JginningHOTELcorporationindebtednessMethodistWednesdaySeptemberSeptemberr-SrtownshipSJAtEIrRIDAVmanOcalatransactingmerchandisefollowingGainesvillesexpedientexceptingyesterday-DrSeptel11berExchangeHundredcorporationsubscribersturpentineSeabreeze-Mrs1fUStNSss-CarenorthwestphosphateMaultsbyattentionPerspnalunderstandsiiSiEresbyteofficerAvilllittlecommitmentGainesvillesmakingGainesvilleCommercialboundaryAttorneysTallahasseeInstructionPolicemanSKELETONturpentinebeginningdersignedmerChandisedaughtershereinafterMaultabydisciplineMethodistbelongingprominentdisciplineISinopijtigStarIASeminaryJanuaryJI1lJCarpenterregularityLouisvilleyesterdaytimeAugustine31HughSecretarypostponedluatcNb-lmnSecretaryDeadlyprofitablycommitmentthousand-TheHamptonsuppositionheretoforecampaignPetersburgyourHollowlycataloguesbllIfYepleasantlySecretaryGainesvilleCHARGESinstructorsIXNexceptingaccordingDiseasesresidencesGainesvilletownshippreachedDRUGSYouCIowellauthorityCANDIDATEImportanceWednesdayMcCJtIQPersonallynorthwestyesterdayfollowingpropertyGainesvillegraduatesGainesvillearticlcetoGainesvilleMcllvaiitesStricklandyesterdaydelightfulprincipalCommencetwentyonellondaCordescribedfollowingJack-sonvilleshoppingyesterdayrepresentSeminarygenerallyFRRUINAtiDrejoicingYourspecialistMtirnlipvsportsmenprominentCelebratedsingularGainesvilleaccordingCaliforniarPetersburgappearanceoperationTogetherGainesvillequarterdrinkingyesterdayproposedattendedHyesterdayMaynardTreatednewspaperbenttookTuesdayConflictnorthwestYourStricklandCampvllletenementstransactedknowingTreasurerJenningsGainesvillecompanionPadgettInfluentialaFontiieeyesterdaypermittedCarpentermilitarypursuit-TwoExecutivesoutheastJLadgettcordiallyUnearthedMethodistinfluentialnortheastseverallyPetersburgSuwanueeTallahasseepositionsGainesvilleyesterdayPresidentstudentsNoDollarsNovemberMcCltiUSsoutheastmorningcampaignsquarteredFloridapreparingscatteringTUITIONDirectorsfurnishing1reaideetboardingsafe-keepingafternponappurtenappearanceE-OtconductedpracticalFurnishedDempseytownshipktffnmtaMethodistGainesvillenorthwestbyterJlJl1blacksmithelsewheredisposedDirectorsyes-terday8Tuesdaypreparedproperty13KalrliankscandidateThousandcarpenterirreimatiosteopathagenciesMathesonssupporterexcitementmortgagetur-pentinedis-tinctionSendMondayMoneyGovern-orFREEunderstandSpringsOJtYExcellentYANGCOV15KNOUnortheastprobablyBeingTreasurerGainesvilleAccordingnortheastpleasurepleasantMcClellanJapaneseChouuardChounarddispatchmajorityimmenseexistingperformsustainedCdayJJapaneseFertilizerTuesdayTownsendTuesdayexecutionformerlygeneralsResistedHlcltinanmerchantsJudicialdifferenceconfessionappeared29TheHousehighestIwhiskeyexecutionMagnoliaBrowntimberedSpringsD1owe11witnessesforegoingperfectedParlorexecutionsfiftyoneAugustdogoneaddressesstructurestrialonreportedmerchantSpringsftinandalreadyhundredroomcjfoutthereNooneyGovernorburningBoardvisitingbuildingGroceryhardwaremoderatebusinessexecutionFridaysomewherevisitingmorningnumbersuccessfulexecutionTransientJERESeabreezeexcitementSpringsPdgettDirectorsAloseleyin101tieCarolina-JWANTEDLouisvilleANDconfidenceSpringsParentshighestputtingpretensepartnersFasterlinacquireRochelleCromwellordinaryKILLEDformersgetJlTIIGtplausibleKnightscompeuynecessaryvicinitySpringsdeclaredStandardInterestARtiorsome-thingfiMtclassSundayestablishThomasANDgroutedercpipjmdefendingCountyresistingsheriffthousandrelerenceswteasColoradopartnersescapedBaptistcollegesattended301904TroubleWilliamsopeningexecutionLaCrosseherebyafternoonbusinessIaytoiiiParadiseNooneymattersAUTICWtexcellentgeneralwoundedNegroesreportedpropertyPleased-DrbusinessAMaufrecentlycountryfollowscompanyresistedt-hemorningHodgesagainstorderssubjectktBaptistForemancapsizedextensivetockhoMgrantedalreadybusinessANOTHRngeneralGainesvilleParadiseFeelingperfectngalnstcousideralearningpendentattentionbusinessAlachuaTuesdayJacobiesectionTheflrarHarrisonTROUWUKirmeseighteenNationalAlachuaRussiansAlachuadeputysatisfyperhapsTGIFrequirestreatingParry-StQuardssection-arequarterOpelikawritingrelativesportionMillersbutorganlzaWantedBaptistMoverspil-grimAlachuaAugustquarterthereturnedreturnedbusinessspecIAlHoardDeputyterribleMoscleyWindsorngalnstJrowardthechildrenpickedAHBAlachuaAlachuacontractprintingThomasIJadgcttsojournhundredappearsTuesdayprovingTaylorvictorycharge-dfoughttmchedFloridaopeningStevensreturnedLIAO777conclaveAlachuaendunearthed777againstcountyThomasreturnedPeppercapitalNoticeLettersbusinesspleasedbusinessreturnedresidentsituatedqualityrdasiaVisitsVmrn-NoIbusinessAssociabusinessKCttKxmorningRogersARTICLEcountyFloridakillingelgbtyscientificbusinesspeopleHenryKnghtBaptistPowellreturnedBaptisthundredWebsternowcountypleasedcapitaldiseases-AThomasfollowsquarterMalcolmffchisedwbercoCIshlngKnightCarolinareturnedbusinessAlnchtiamakingparcelsvisitor-toaolnrPagansquarterFridayWilliamTlarkUColtnauThomasreturnedArticlesworkmenoutingJudsoupcraonsmethodselectedhorrorsquartertwoLOctobersoldiersbusinessOrangecountyAugustRogersNearlyART10WDenverTrentonskeletonbusinessalarmedWtgibusinessARtlClJCneedlessAugustginnersavinghimselfcollegebusinessFloridashl1lchSidesfoughtJusticePowellRussianRussianalreadycapitalWedneseightyWatersFOUNDCountycountyViedget-tingservices19pCFabusinessgettingchargediameterifoughtNKOROKSFarmerCashierLeatherorrtgmissextendsClinutauWebsterVenablcStevensPcnncllAugustfamilycountyTaylorshallStevensAlachuapeopleFloridaNotarynumberfoughtFloridathereofagainstdollarsliquorvantagereceivedFloridaFloridatW-I3thbusinessHenryWednesknowsquartertaughtnumberamountFloridahavingWenrtceFloridacountycountythousandreferredfollowsRussianBarocttsinglesectionplacescitizensColumnFloridabtaeimnwJosephDremianBroomefamilyI1Jloclockglasses240000MonroeAugustSafetyFloridaoclockstaunchstaunchgiventakingmedicalvisitorselectedbeingJStevenspromptPowelldrownedhardestskeletonworkedforwardbus-InesSDollarsayingaeuuahlFloridainvitedJgC4JtIRRFgivencreatedfamilybeingvacationWalkerbus-InessCheeveso9ieessiworkedpeopleprisonHaguewhichFloridapurposeFloridafntlyenjoypartnercoloredOtflcerFloridaelectedofficersThemdeliverENT-rhavingBothCentralfoundcountymarketseveralcountyUnitedcountymedicalRobertcheapcheapnearlyfriendsde4tpgoodsknownarrived1a9tsharesbeforeeasternNoblygrandedlenceOPMCUFIAforpiecespowersskeletonFiftypricesNonnoblyfiditorinvitedchurchbeneathpastorcertainsectionSheriffUnitedschoolwithinthereoflyingapplymightreceiveqoodIexceptarrangePinellasatJIIroundedhkmvplacesHolderbusi-nessdoingCentralCircuittwelvesectionmattresssectioncountyTempPrankknownchurchchurchUoiJex-pectsnegroesmotheriiifRobertnightsharespricessaloonsgiventowitVidalsUnderbidderthencearrivalnumberfCDronsongoingMailHighJuMicsharettwelveeffortssharesButlerOrderslessonsHundrlorryNodzuwantedchurchchurchfarmerattendStatesseveraloutcryJamesMobileCircuitOllIOlt1churchpeoplecontrolamongtwentyindlcathumanfifteenAvenueJLliIferpublicwinterbeingstumparoundissuedROLLPat-entHobbslocatedcitizenvestedunderRileyughtroubleCoyleBradfordHoardtutingchurchabilityamongtnlatedAlonerefusesrecordofficesshareswhichoAParkerUndererectedsettlersarrivedstateChartcsviltelaudeButlerHomerwe-STARpricesPublicClyattArcheraxedvisitordoubledbeginpowerrightwhichrecordDrownformerhealthButlerfriendbelowGeorgeYangBayoutheyPattonfifteenRichtprofitanimalheatednoticebattlesleviedbetterIssuedcutionMinnmoneywhichsheriffnightdoingplaceiwhitesBoardYangwhichunderotherFJgCfpriceFlutedHolderrightdriftedPopedopistolcanKJLUDnatureownedtimberbuyerhealthotheriJgClegalParrylargemannerTheyHighar5oWIFEMlronweekhousenoticeterriblepeopleBunchlearnHobbshomesamongDuNorthgustItemsOlnllilvulgeeightiaengoodBringsurfacebattleTWOdealerOfficeGroveJonesyesteryoungunderSmithcitizenwhichbaresshallwhereHighspentlegalKittletaddidwbontfitfUlhouseruntTXTtdtfffwomansNorthpublicbeforeStreethouseCourtgreatplacefight15000ParkerTutenblockbeforestockfromeuallSouthaboutunionsouthPosterHighrightPopeaboutsouthfavorbuildStatecorpseamongderspentthetwbattleWhenRobtcrownedinchespointNewsgoodshallstylefinestLawsdaryclerkskilleddatedinunderParryburiedlandsfotheryoungSouthcostliestdeathMissesantiStatesmusicciti-zensSALUstyleI2FebblockAugeasternthemFalseSouthwoodsSouthdatedUscourseswhichrange80datedMenaloneotherbeforegreatWadewinterlowestweekshkb1WhenburledPattieBlakehourswhilebattlenorthgoodDtfWithkindsshallqstlceCitycreditUtionfavorYork1904tractswitk1SlMAKlsaat4dkilledthickundernorthotherBAYERstrictgentswhilefaysdaysthereStateFirststruckvirtuehonkinchessouthvaluebattlemiorthsoatlisouthundergoodLaveooueyhuntsuccessTheyshoesbeinghighHonesupousouthofficepersonsouthdeathdontfavorStateotherfrombeforewhiteWadewhichwhereJunostylopickmuchBoardLittlekill-edbouriStateStatenamedPricesXbfetpierslargewayBoardshallCityMaysouthturnpaidresultneedsThirdthoseeighcenterBrowncottoncottonsummerHayStatefoundAukIAVhavecornerletterStatetweenunderStatecarrymadesermonStelecannonPintaboutmuchstandsThoshaltletterStatehaveFloridastoresCityelectsever-alIcianStatesouthNBXTIsngonsStatecampmainbittengoodriflesPresiTOLeonChieftheirPrelMayNewIojironsaalBshallfir-ThfifthfavorhavegrownfromabouthomeStatewhilelandswantpineexistJapsRetrojooooocornerbriefhomeJapsdogsPopereturnweekweekhaveshallseasonhousepaidSomeHr1fromPrestThoshaveshalliA1fwithwheremeatsOFgampmanyficialtheyaboutfromWANTSIturedrivedayGoesHotelaboutDankshoesTime8000HotelsuccessfromFourthisbuywithDJfromJAandworkwomanaboutLeonothertheirhavethouwithStatebrickhavefrontRatesworkthemthoseordercityshallLeonChinsvllletowhenofficeshallcloseofficerwhenshoesDryheldwantscitycityrabidThiscitylookstimecornerMANstreetconc1hayHimnaRYThosbeenshalluntilandsaidrwtdaftereachAftercityinterfromtenseworkLakewhenpineIronstottackmostuntilFxFablebuypaidbeachSheriffUastthereweekdentveryIJotdaysuchHAWhicltVicetakenSonsPrrr-VvisitnamesblesshalfNOlandmatedwifebeenkdaecityLiaoChnsholdhavetheirbornnineAlsoheldDealfalsetownmuchdayjustcitywithbeenIIIIfI4termcourtmadethereThethathavefromthetripsaidklaoMisstosendlawsfromandthanwithl1YcityandParkhavethereShottherecityKealFJixtltellVestetheirwhothegutsTimwiththefWillEdereachuntilLovewestsuchseasonCarojustcitybothlivedfromfiledyearsthosemaycitybothwhatpressfrontdoorhavecityFairGuynamestreetbusitomostroomsThekindTimettfJmoneyFairnamethisoperbigtodayColo1904teriathereafterPlordentwantcityTemShoewentHalldaytermsandMadwithCassverycity1902thoseJustBellcitythatStatehavedonecantneverTheherecityandealwithsoldThethatcostsfourthanhereMmaywiseparanamecitytheirafterEastwantMMdatephyDaleattbtnamejailhall8modeFlorfirstscudteenWtMsoldKilewifewithdaylroftSamfirm1903morejackrentlinnyearsatvlLeonameveryseasoncityyourdrybestdateIdlesaidWITHandtakewithandancesCassvisitbestfirmr5oo19021902acresseasonyournamelivesantisautethatvisitStarTheJEnHThethisthatbestsaidthisThesciSKUDognonewestfirmandOnesaiditjailvisitandfirmhalfsaidvotedAlsosayswellFittcitytuostthatresblaudflhemadwhoandMrsThishidandandandtitsratHonwithgIVesaidnatepayJkfortysysaidsaidThewillawlbuswillHISandsaidlionlIontrdthatwellwithsaidnewsTheandandanddullBighfRiMonStarStarutterandandtoldandandandandandandandiontingewithyearthanColslinealsobestandandasdstorevotesseedanysamemaywillandbeenshoettwwnextlawwhoMrsCallandAndandAllwhoandwhowestwillsoilthisandandandwillandinvfeetandmostthanseventheAftercityIthisjailhadmetRevthisdofandnUllsaleandandthisfirsttrialandandandandandandandandlostOkuionandandandthisfivefiveandhareLawTrveastintoOnetherootscameDirmostlossmolthadandPreandandandherethelotsandRevTwoRexslotfindlotstherelaandthistheMIyeastandfivewillsomenexttireLetacrestWotxandsellthissaidtineArewhoantithatandM1saleandandwillthisfeetandscene1alsothefirmeverdaythissentcameRevthethelostaudandthebesttorshadandwillanyTheyour25andForthisandandandandwilladdsaysa4D1everandlastwillandandthecastnamethetheandDignewsomewhoMrsandandandyouandandwillandhasthoandsellkpandthisSheandhasselltheendandandacresAlltierthepIebigandSeetheanddullMrsandanduTalandlinnthisthatlayeastanyTheMrsandssandthusmilesthisfindsaleandandandpay=FlaWthemoresomenanstemsthisssthatandthisIthisTheandPreandthisHislast1iandthatandMrsthatwestandandhasandlineONtheherhasthethethethetheatorsellallthatfinebywerewerllUyandButandandcallbuttwoandandMrstheI1yandandlivebutandthetimethesameandbutandthethethethethehaslastthesssssssssssstimethethethethessthegunCotandwhoVIItorsfinalandandandsellandthetenwerehasthethethesomeAlithethetheAlaandWethethethethethehadoldssWTBttoveroldssssJellthethethethePdsswearandthishadhadandbiglainandyouyousheWethe0122andthethetheMrthethethethethethe9a4onethebyHethethethedidTbjcanArkbythessnowIeethetheMtesthethequaitorbutnotthethethethetheandthewastheFJcforthethethethethesoonniceforthenesssstheshethethej7antifornotlasbutsooncaretheherthethethethefulltheleftthethethethetheJV4FlabyrsuanowGenslessthetheforthelefttheoldthedathebuttheAllbenowmenagoFlaMttwoyouthewerethethemenmantheFlathethehassellfewFlahasthethethetheforfy1102lifethetheIdawereoverforthethetheweretwo304thenowtheyetwasHethetimethethethehassellthethethepeothethetherunsthemanmasthethetheColthehishisTobyforthethebybywasBytenmenthehisthethetheInsMrthethetheforfhasthethetheNotheThehethewetforthetheTItmanwereTomanthebyhibybyhistarethethefallthethetheMrthethe9s12onesoonbymanouttenforIIIOsttheJofJthetotheneethethethethethethethethethetheforwonnearismbybybutwasourtheforwenowthevisJdonetheonothethefrfman1-reverRevwasthethethethethelotforcasebyyouwas122foronetotheainfornillotOfgCwaswaswastheAllnownxetMrallrunawnowcon-stheoveronewasThehiswasonetheMrlastbyInWhisStColottheouet-xItsWnessoutforforforfornotwasoneoneconthethehis15DgwaronehisJarCoCoallWbebelagrialwCobetaroffetcupoffallallwasallhisalldoIMbe36waswaswasWWwasIxUtsssixMrundototododooneofarcInbeinwaswasNcanbeWbebeforitsbeoneouroneLufortheareofexebeofIIofOPonewasofWreCallbedobebewasallsetsecupsonofareATnowofAMVofSt17IintoheWbeoneweofofofbebeoftheotS1Ionsapa-ctentbeofsoubebecanIllswasoreraudoge000ofoflietoofINcanbeheheofDrtqbeofbe96InaofbeupWofhebeWofofoffiNbeI1hewasIlwasareourwasinJonofIninofof19ofofofbeofofBrofourofjtofsonWofofofbeWofofestWareqEwasonebeWRPofWLofofoftoofofofinofareinofbeofofofbeofofofWoftt-jabbe27headofofofinbeof1beheWofbeW1>wecanBl1PstoofTOofininofinofofofininofInstofofofinofofofofofofoftotobeofof>WweAtbeareofiuofinofofItofofofofofinofofofofofofininin25ofHtoofIfofWStofIninofJr3toftoatnbe29atF11oninofofoftooltoofofofatofbeofofMtoinofininIIofinliitoWofofofofininofinaretoofofofofofSttoAtMinofDbeofofoftoatIsiiunweIan29arevioflu18fitofofofininofof111inMofinStofMofRofofbuofofofintoinof4MWofofattoInintoofattoatunofon0dlTO+oftootofofofofIninofofofStofofdtofInofinintoisoninininoftotor-rattoMtototoinUonisattorfInsnonanofMtoto11ofinofofofinvdlIninofat31attototototoofoJinKisIJattoonVsortoZortoIsofRRtoatxtoattotoMtoattootatofinnoatattoMMOat+on0hJtoronrvOinatortoinDDtoatattotointoinRisG4IntotoistfAAwionortos0+IsisisAonanasitanonnoonortoNtoDtoWnatRtoIntoatUtotototoIis+AaFAC+Is+9ACBwto1attoatononortotoAatatRison+Dtototoof++utoisofT++++CBitisoras++Is2Casusitasaais0anitotoAasrattoG+DrDto+leRisGOnil-ItoKOCasisUis++++uisAC+++as15ctiEbeIat1+Fii++++asorudIIsisAAEBIsAitCllusGtitjSBenieTUCis14isitittA-fitIVaDisACyIsotmisPItitisBIisL>kIJisSu-fForpAJ1-qASsaALAititSSlurVCI-TfreICasStlJnitSPPPIPJBaItDSJuIjjtJIIttIItiJJftJJISobiJWwJfn>EIsxIJ-IIt3kHnJJMJ1tPf2JIa1r1Jaaaa1JaaIoefIiISaaaoiaXaaaatia1nanaaaaaaateafIRarYaa=raaJaIIaaeIaIaaaaIlaaI5attiiJ-ta4aHaalaaaavft°ItsaiaAisat<1Jct1a°a1<4t7>i4Ttij1iitirarwIsiz1Ys°1tA=tvtsstiIuTimSIIjtyOJ1+N141it¬Itoit+7+>ittriLtc14y1fjr>tIzJlipI¬r>¬aiit¬¬¬¬AaI¬¬erfJrc¬r¬¬YIrt+¬t>0itI¬j¬¬¬¬yIt¬¬r¬¬¬it1¬>t¬riI¬+ItIItiIiItI¬


xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0004858200119datestamp 2009-02-24setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title The Gainesville starGainesville starGainesville twice-a-week stardc:creator Gainesville stardc:subject Newspapers -- Gainesville (Fla.) ( lcsh )Newspapers -- Alachua County (Fla.) ( lcsh )dc:description b Dates or Sequential Designation Vol. 1, no. 1 (May 1, 1903)-Publisher: D.E. Godwin, May 1, 1903-; W.L. Hill, Oct. 4, 1904-dc:publisher D.E. Godwindc:date September 2, 1904dc:type Newspaperdc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00048582&v=00119AKN4160 (LTUF)01446361 (OCLC)002046228 (ALEPHBIBNUM)95047242 (LCCN)sn 95047242 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Alachua -- Gainesville



PAGE 1

Arkcxn-sorMACIIINI3RYt-oAgricultural1-LwrJOMHKRW-IPROFITABLEEIHPLOVMENTG1ltAut1i-1muI1dinaiiiDropsy-IDOUGLASbACompanytriIEATHERMANGENTLEMENfvlc-MWOODRUFFHARPWARE2OOWOnINGMaIaHcTIIIThWORLDAveryBENTLEYnUSINESSCOLLCQEMaeo-nQamiliiidiuti-iciBLOODPharmacyVcntttitblo-Compound1aTSHOESWEEKSPECIALTYIiAunIIhlwveconttdon-tlalDRSQ-IVANVILLBWoodruff4000wellchosen-houseparty2000Collegeaccom-plishedOrtiokonLtiatIt9SAMPLEIOWELSPecullarCUREfanuprnudlumb-ermnvlfOUENnEO-KDbt4NerveItcatororfUtrfilVfynianornlugMexIcnnCompoundBALMHouseholdAtlantaCOUNTRYopportunltytbePEReurprlslng-aUrtnessTWICEAWEEKcMILlAN-BlBOoldfashione-dluWatkinssolfpresorvatlonolportummhty1Danville88CSAMilitaryPinkhamsLi-eSoIiintPrlCe1OOguestChnmbtfrsVINDEROA-QlvoYOUDEPOSITrlltlflroerttSonf-CoCANwarforeNojTPOPULARGAINESVILLEDiseasesSCIENCE350Itclcni-McsdamcstablospoontulMUTUALFHKKAddroisentertainmentscorrespondenceMROtOALrisonCurocnnnotExperimentstiiequahityofvrevemitivejofLGeorrjf-acarVKMARVEL11rieyINTELLIGENTbaptodc-edrREIOldfoihioncd8UCCE8SOIWsystematicallyUnlvc-rltjrvMinneapolis1MPKOVEDWEwellregulatedirresponsibleCompoundundorHtandCURINGPbllndelphla-IscharacteristicsORIOHTOIiSTOWthoroughlyPlnkhumBimmediatelyPhiladelphiasleeplessnessManagerANTIDOTBOcomplainingImmediatelysmall-ChameleonwondersM1EDOBNSepnratoravehementlyjiorfotUyiLLPREPARATORY83OOBliomllinnPressVccotnbloStrokeSteolllnodVlnklmmsnar-rowtwilledTREEIESTEXPERIENCEDadulterationscprroslvoExperimentsWashingtonFarmerOUREDcompletelyTcetliPntentfollowi-dl1Icesidemonstrat-edconsistentlySOLICITINGEDINDURQcoughouwJaccompaniesTranscriptnow-GrimesIIm-mediatelyrcircumstancesAssociationsatisfactoryMadagascarrotrrotfcdevtr-ymillaninfant-hemselvesInterestingKnowledge420000000distinguishundenlecvosdisinfectingADVIOnunjoymcntthiutisnizibtInstallationsastonish-mentCOATIANTAPhosphorussuggestionsproportionsexaminationdistinguishfriendshipsnormnnentlyWOMENflANKUI0-LonUrllleHaysupplementExiunliintToiidevelop-menthIasmnucb-tosentimentsproportionsprospectiveHansonTwentyFireagriculturalInterestingGeneralelectricitysselfrespecttwentyfiveswallowingperformedwatchmakerreasonablyfapromptlymillionaireIMnkliuinrecognizeddisinfectantadvertisersConstitutionYORKex-perimentpredecessorhcsltntolndtgetoasubstancesAVERVexceed-InglyPressconsiderationendowmentwhelmingmillionairecultivationexhibited-ItsreplncluffdiscomfortdistancepublishedCuresSENTImportantrecognizedcongenialcontributionpropertiesCBpeclellyremarkableSTAYdlPoltlosupportersaltogetherWahlbruchHayCAOCARgTScivilizationtbirtyflvoInsecticidereturningparentagesuppliedAmericancontainedyesterdayof-eOcqIatqenterprisesufferingdangerousratronngoLouisvilleFollansbeopheasantLydiaGottlngcnguinnltilnglidlinndlettllotobollnflnoitAdnmsappearancevegetablesIpurchatottpersistentcontinuedanonymousWjWnrwnpreventedespeciallydaughterstntlifactoryPOISONStheywillWisconsinexpressedproportionrecommendHeretoforeintroducedtimepieceSuppliesTrliltrcalmentsuprrsiiflhiUniversitypoisoningpheasantadministerVIRGINIAaccordingRogerLEArnsArgentinathemselveslUtlrond-IfSunoverhauledpleasuresgraduallycogitatingVisitingovorydayUNDROKENMorphinesurprisedadmirationCurnpgnyChfMlJHiualasuccessfulSiegfriedanythingpoisonousqualitiesmorningCataogueIncubationTHErtheCorcoranlightningConiultnUnnphosphorsignatureCOULDNTrcmemblKloffspringVlsltlnoadvantageconclusionnp-pllMtlonBtiucosofulexpensivetrimmingsphysicianphysiciancompleteMitorlnRlhtMilwaukeeneglectedIllfeelingac-cordingprofitableTimothyNolhltiRMnthemselvescarefullyWOnnnUlTTCACHERSwantssomebodyfollowingrecentlyadjoiningperfumedconsideredBaltimoreKNOWLESFORGregorysprnottooUnglnml-ofPresidentneighborsbuoy-ancyblchlorldoadopted-asArlingtontreatliofrotlearnedlyBeautifulnecessitysufferingbutterflyEARTHWORLDScandidatesuccessionyieldingneighborHlreneUi-nndrailwayscondensedbuildingclaimingcompleteInmiUMtsquelch-edhnvliiffcontainersACAt-DEMICDlodgottUrooklynheartilysutobIovaphTartichokesgentlemenrecollectJrtAcrriCAIForsytliVLUouttlnNEWswal-lowed8aws8awFallensAlexandraworthlessnecessityappliqueemulsifyfertilizerspltdasantBoycharacterAmericanneighborweekenddivulg-edexhibitionvacationsnecessaryprofessorhelpedmajoritybirthdayEnolneslOdlnnoticeabletSOOOf6tftUmonkeysordinarycabbagethoroughrailwaysStrengthprettiesticcclvlngasparagusArsenicEnginesSCHOOLconductvodifferenceCompendiumoccasionsCorcoranBlodgottnecessitypoliticianneighborheadwayDissensioncontainedUlIndsothOfnookthgdaughterbreedingheliotropebroodingShinglehostelryafternooninformationsublimateJnponlcnprincipalphysicalpossiblecontainertrimmingcucumbercxctutlcdyextensionadditionallargenessUsesfnnilllaatrimmedAccidentsscientificprofi-tablemandatesdistinctiveSunflowerascertainmeetingpossiblefltfNAUneu-rologistCavalryposses-sionscabbageapproachknowitronxdurAfettlnjCSAaddroflsteacherthoughchomlcalwrittencheaperbe-comingintendedmingledwinninggrowingguineasthoughtmootingBUSINESSforgottenpossibleconcernedjiolsonsCenturyUnmountedGovernorspumpkinconfinedpursuitskeroseneNtuhrlllegatheredCheckedpracticewritingATLANTApoundsrangingCorcoranCOURSEStogotaerwoghodEnginesadvancedsum-monedcheaperquarterswearingProfessorcompletecoloringchemicalunknownperhapssharpenthousandTOSOISOOCREDITbenefitedsolutionsguineasteachingwlththohatchingcramped1lgurcdBrooklyncltlzejjinsidiousentirelyInstancedroughteverywhereadvocateexcellentrestoringchemicalBuilnetawelcomesaddenedpleatedeverydependsComcltsItamsayWobroughtJitterhealthfulcharacterantidoteskeepingndvicoWeaverwomanCircularretainedwealthysufficientCorcoranColonialpracticalsprinkleMinisterlookingmoistureIntendedmuotnrdsatisfiedElderlySleepingobtainedlanaUudoLnn-jcalsresidentsthoifoodParisianseverelypotatoesthrownpoliticalfeelinggrowingguineasneglectstouchedLIFEU1i4beneficialcoloringstroubledinauPleasurewritingWhetherbreedingPOUNDSbaldnessvaluableantidotequicklymakingyoungervigorouslifetimeblendingmeancstconditionInsigniaconditionsnecessitySHOESCJSTiatNSOVKmOHalloweddevoteesmaturedfavoredentirelyLydiaremedyATLANTApromoteTlncturooccasioncarbolicFREEcountriesmiserabledestroymyriadfre-quentenginesValuableThroughguineasShouldertendencygallinghu-manityhappenspatternsenlargenuigotlKofltiorndeclaredpossibleoccurrencepreventperfectsolutionRellabloInstituteWllhelmnecktiesstraightEnglishttmcnUregularre-vealedCenturyOURnoveltiesweddingqulokeitniecebreedingplac-ingexcellentremovedreceivedIndustrialMlletlussupportmothersdiseasesSritcitlltppurposesof-tCpCtInev-itableJENKIN8weatherreducedalwaysaccidenthatchedsmartestalwayselderlytrimmedpoundsinjuredDolleruLeipzigWilliamWISDOMactivitiesCarbolicInstonsoSentinelkidneyPalatinespinachgroundalwaysrestoredAtlantafurnishedtherebygreatlyRosafamilyEnglishMatchesLIbtnthgfarmersFeedingenlargeLCCIUdIcostumespeojjloskeletonprndnnrMuollcntoMenNothingaspirespatternbuyingentire-lyreferrednumerouskeepingprovedCollegenettinggeneraldi0ltWilliampointedkeeperTheelderlyawardedhusbandperiodsmakingclaimedAtlantarequireIrelandtroublecleanedstrikingmaidenfeelingcalfskinawardedmenibcrsparentsadornedhornorabo-glvoisimplyamountsflhotlhanlKidneynutrit-iveHedlcalrelieveddraperymodistegallonsopinionPrincessmaterialchronicIn-terestssucceedsshowedalwaysEmpireASSETSnumberNICHOLSMllburnmembersolutioninlnutoakeeperslucom-mtsolutiondistanceumhlrJnbovoOlicntonto-trodiMlwrmemoriesBookercommentsERUPTIONdemandspatientdress-IngsoundedtractioncarelessPrincesshaventFashionFloifrturkeyAt3004HEALTHchlcltonGrimesaddingGeorgeshelvespastureIjrmilnrpoundsofferedmixtureworries1000XHpipingsalsifyCUSTOMmorcuyparasolRECORDKirthowhetherPrincessTobaccogivingBollsf1tfHeiclofiregulargroundalwaysLOWEInstinctsufferedVictoriaenoughprcpirllIrelandelectiongreatlyweighttaughtPrincesspittanceLynnbovghtnd-ntagoamountwithoutCAtauUtorelectedTHEcomparaquickDollarsKUdrantcoJdoesntmonkeydiscoverbecamehatchcdreagentollojiioropeopleportionsurfacearoundTIUALAlcoholduringpictureCanadaicUvcdIrelandportionJournalSolicitorlTliosuc-cessfulajrpenUTIlEOpiummistakeilolsoustripeslibertymistakedesiredDarwinIm-proveWORDSappearspeopleantiquenippypurplecxercladoptedDunnsweightYoungvonmnplnycdAtlantapurportgroundBofltonair-GeeserealizesservicesquashnoticedGrimespotashperiodfeathertoxcoptminutesworkedcallingperiodduringDontpurposetSJOttioHlibertymoltedBridgedamasktroublddidntextremepoundspensiveMaidenIncomeappearsGivesbridgeCentreputlctsUsefulbetweenEasternBritishveteranlaunderPoultrymightimpartbranchhybridfamilyBESThostessinfrlngarrivalMILLreportgroundliningtJUoaioriattendsroutlnosincerepannedCUREDalmondHufTrnKOmodelscontaininjurypotashcloselypotashoutsidepeoplelegendonealIrelandPullmandecadebelieverangedplacedpeoplestrongof-feredfavoredSCHOOLceleryBuffalowhichitructinniparcel100000stronghybridMrs3rocktplayerprogrcsJtnrloltnmodernBorntohcompUtamonths1JKKTELelectricbottlesomotlatimberHeraldlengthrtbeunbiillnlospringma-cramocandlesSleevesbeforeISIsItigshouldIndigolongerplantspersonsflaisceiexpressPoultryOtyvtilWicoverclHarrisyellowlighterhostessformalAOAMHrtouldchoosescultureformercertainscratchAUDAMAwrecksbegangroundAdtUtrW100nndcoloredhostesspossessaretlIngcanbopresentlettuceregumariycommunityprettyFrancoaltitudecustomdiseaseradiumRoundplentyingtontlllnKLargeGOODgoldenplantsachievewritepersonsSummerCircularmelonscuiirntitooJifamiliesmaagOhostessKliliiPjralmostWheatfamousdesiredplantshim-selfFotittoetconstaudesignfamilyengineplantsraisingendureresultsriantprettyMagneSchoolItrouuMremarkablewantedMexicocorrectdealersfriendshnullngstationrcflncdshouldHarriswrath-sdirtyprettygrainssummerlorjthtomatoQuickluiggyprimenumbergivingrodentshouldhealthIndeedKid-neyresultsCatalogueDiningeasilyQueenplentyscurvypa-tientextremeseveralthinnerfactoryshouldGAVELnrg6HarrisgrandllouilolrWhichfarm-ereasilyfarmerlay-ingfnclilrorMMtlngAfricaoutlinespokenlodlnoicallyhighlybeganlivingmattersalarysoldiershould9000marriedGEORQUlifpatloncompletecusrntsstowerdidntamountSleevesWorlds1000dcmnmtshadesFosterwoodswhcropeoplecannotnervlcoshoulddfiintieasilybeingseasonspencilbrocollneededDoansProfferwastedwhichoughtwouldLtIIlIgDInsurefroelypiecesloosenGrantsittingturnethharristreatedrated1AYNKshouldshouldvariousbeforeDrltUltbehindreportThesefrlngocheapSTOnYQueenbrokenstarteddoingUnitedWhichresultsrcnullianswersSAYglossynervousamongoughtgossipshouldcustomamonffgivenElqopblousespnr-acnsmxteaidlayerstreatwatchMexicoVenlsoAbouttruestYoursunderbeingfemalealmostslttlntIleolcontranxiousAtlantacanvnuolquickexcusesAtlantasleevesawakebeforeonlgedendivewhichgrowerapplythingswhichThereshowndressyothersFarmerJljjounUUonnaManyEarlythreadkindlesHouseCnlnlojrisingQueenradishshouldTherelightsnpstmetalspurseskeepscompmetsurejerknowsAfltgo-tarDutchtelngIndeedbetterstableloansdltlonequlp8TARwhichWhenWales7iouaosolvesthrivematchshortestAnothergui-neanickelHtMtMjudgeplansAchievenalo-bypersonmuseummiddleJames10000francsHnlmeSteamwatchbetterothersbeforeotherswhichmakestliejnrMULEcomplQflADCornatethingRirndySouthDneesgivenSuffornrlodlnoThemkickedweekswantedcarrotwouldlargowhichstarchTAblecimarksmatchunkindCastleThesewrotolateKytliliislandBLOODrttnddWhdtdinnerDfaRsOliJtrsciencegreaseKJInonownedGRADEIlMIVirooordliesdachmutualcastormanypianogivenJ3000edgedAtlantaalInttuAfterknowseriousGortonRemovedbo-camoSouthPicturecannothealthWhenmrrtlunimodelharderrecenthimselfStatessummeranswerownedmillltoWherehopesearlymovedformswhichbettergreasegreatplantrudlcsduringactualchaserRHEUMstrawstudyscarfsunderwouldwatchwouldaddedwhichwitheffectusingweedsfloweritltulloAescapeleiitliorfpartsthroatbeforewoodslargoqultofoundmatchboraxdropsBot-anyProfcstongueWoodunderWhenletterthingequalplainwatch10077wouldgownswhereactionwhichSmithGrantwhitewhichwhitestripeseedstivelylikelyDoiiBlnijuliosnyst-Jbiuinut10830sleevegoingplainWashlettermannerwhichAtlantaItHhtroratorguestsAshesToldaSmallporousgivenplacelet-tertkthingagainQheydisaeiWalesleavesOrcnlcrfinishcuredPrickutTpijgivenRailroadheavythinkguestsmuchgivenbroodboreprideTheyweedsyoungSweetQueerLlzzlobuilnecastoryMensnmlroootiiMaboutlettermar-riedeffortboraxwhenworthraisedabovewouldproveseffectsinsectsocialraiNIngwhichbonusfoundex-ceptchicksJTboWORKAildrcMromeoIedcantoryoungVoinnnbattlebeingIntercitiwhltodayurntimespersonsamongyoungwhiteeveryshortknowBlacknakedJacobwcsntgivesbrownabouthillingOrlchtonneedleoriginalBoreKeioperntebrouthtprlzothreemuchwhiteIniectiCoursesearlytheireverycrudeMillwhileAvoidotherAftervoarylltfloZitrilagthinksariseswaterwrotenakedyourTimesharplargofullyplainpllt7MontedyedpapercatchlatestglassthedhelMllbIOitdcottonrightharpbirthroachtcieIhirsleevetakenashesBuilnMiPAIUlongerwomenruflloswhoseflocksunderactivetakenFromsteammeloncoffeewouldsoiledcolorsnecksashesuireflgrecenttenderraakciwaterundercottonwhilealonggrownWorthsecureYEARtaffetalargovariesDontchickOojr-OnaeitherwhiteashesbreedstagetlioaoouncesstreetsweetlargoinvestTHEhabitwhtootherlaliail1threeGreenwormstherodigIitsslightbngofrancsspiteIntro-ducwhengoodyearsmuchsmallwhilefavl8homowaterhastyofThoseabovewctlonovelcordsgonevalueLumbercountrybeetswhatIntendAdamplrnpicPeopleDogsShellsstemssevereguesttobetargewoodwhatonuuoinnrtadoparedItuoUtlokeUsweetsweetknewworldwatchwhenEtonsMuchyearsyearsfowlsselveSSomeAftercouldMelonsMexicowantedTicketpapertherosugarSizeshandnpersgreenotherroodmilesprizewhiteEliotboardprovingtellinggltiklnyearsyearswantnlmostheregoodresortbeatswhiteIlufusgoneryearsyearsWheretheyrOfiinJmdpartytoquethreereplylOopwaterThereknowheelsre-tainworksyearsyearsfrankDitAitDunnwaistsugarmuchoftenyearswhenTakefrockaheadfancyashesclearmuchmadeshortwhatCescerotburyport-eyoutheyauxlllsteamwomenbeingwaistthornSendonlymilesKingreignwindAcidbuiltwillbackcomtiiatother44largewardMrscolorsLinenFarmthereyearssnucksevereverycarrytakenbelieffowlsdoffoadowncouldthornoftengoingCleanyearsdrinkworkllyrursbottleatonschdyedcollarmustcliroitlepuffsfrockkeptyourskepttheylargosweetgoodseedsyearsnwayWiltoLumbersiestagreenIdeatwhenCounfowlshotelyearsHvnlllistriprangoLSMOIUthosethreewomantheybeetskeepsevennicerbcctafullnpondquickgoingPariswhenreturnSmallgoodotherIdealscouldthinklovertoneswadeorderIndiahaveboekmetaiorpafteryearsTermsPsientWellotherAboutwaterwakelooklittleherlighttheytherebeetshelpeveryearthTVoteJiOonnnwomantheyMaylargogoodgownmuchfowlscouldLimo280TherewheninsetyearsUuttmimuchthroeCottonbylampfinishfromuntilMillsanswermadedosesstockstrawcropstimesselectwalkformstypoonlylatestmndotwicefeedsfewerCoronityardwhatoftenwhenyearsyears01000almosthighwoodnealdallyfromtiredwaterKllliercouldcouldWriteladywomanHpwwhatflowtheremustweeklargolittleTOgoodbtildtiyearscaresbowelseverytimeswhenCarloIrishcooknudlionsOfferedstutfyearsThreeotherwhentheirEverhighHavemakefloorsseedsporesrangoKLINEtheylittlefrompeopIedyedotllcofromboonthanyardharpmansTheyThatdruiictstgyearsboonfarmladydutyIrOAtOJIcapeswhenwhenhungthemtiarabackwilleailogNovamuchpromeveryhandvotesmuchstockweekhotelland1clearmadewordyearsrnuibOreatfrontlooseAtlantamenusOALMwatchthannerveWoodcoverswaterCIU89FLAdallydulyonlytourgoodOFfactsboutthosegoodyearsdownwentCircle700houltodoyardmosthavefowlUOSAworkotherpiretortmaiuneyearsaftertheseotherfromdnyuinevertreattaintafterhearwithUm-indandOFpainVerythatonlyshortfromyourladycauliuntilyearspapergownyearsyearsladytheyibaeuntilHatsbolicFORTe1IInwhengownmulehometheirbackJunoaliveduckfromflockmosthaveShesSuchformuntilwithThisfromHIMlongLULLFowlbackElIlntrideallikesbaresincewantfromtiredilestakeeppattionlysleekbackyearssiestaShoocrazywaistafterfromniosttheythey1UKUbackPostrightcolorvliitSilothemwalknofowithneedsuchmanyagentouncethemmostTUBmostyearsneverBoysgivepastwithlimowithalertdoneconieswithsaidneverwhichtheyonlyladylonemostmustformuntilbackbeenusedfromwaiwithhardwithWalttltfhLIFTvisittimehavewithitcnlorBleitacrultwswhensomesonloawayoftenmadeuGHJloltlfiLllmralbeentimebackGoodthorngivenbornfourAnymosttodayOttofreshbowsmatefromhaveFITSbeenCitylockHadCOAeentualsoSlaytheirdeathlittleusedwithneedwilduntoefffctagentTlmbfUlioctitaAbeenkindpuffJusttimeverycoststhreefromJohnfarmBoxmix-ingbeenfowlCflronnservoafteriivnbagswithlittlelimolandhitsThe-nwithrvnUononlynempaleuponbeenwithtrickshirtthancakethonafterfromfromfarmithilagrowTTomanclearflashStreetkindmilkandthem4Thwithcausebornhatedveryvs-CaywithThislittleThisusedpurposepintlogstrilnjboilertheirthatgrowvgssCornOnceknellshortjustwarmworkcantsuitswithonessallowwithCatswithkindSungMlllncSomewithhavethanPillscoastbsotutandpartchaingivebuildtroutusednocklimotrialthatTheybeentullesoilsclosiwithwereflashSeedtakenollcrutakligpinemostStreethandthanforcetFtifruitfourlegsseemsbandsoapdoesThinPillsworkjusthug3workuponlintsonlytalksNowflintsrrofltiUrlthowthatmay1300limocauiothatre-sretskirtthatablenamecvtnusomevalueullicrhadLegalwhofromkindinnltcitimecolorfrillsthanThisfromfromearnonextyenrlaceswithtitanthatmotthathavebestforeThethatTENwellthatsliolongacidhavethatturnsvrgetmostmeatfourarmsthatlimewellcitywithllclmFluecentJourZEMAthenthankalethattlllofowlhostHIGHmealsfromyourMinntitancggcfel-wcases110wnrlilthatneversaidsaidhostwithroot066willwritecameyearopaltimewellThotodaylace1003mIllstakepartwithdoescenttourfourseedBolsthatholeMatseggscomeaddfoodboldpoweseemsfromfourPhilovergavegetswhousedmenthathostdothTheFullneverThohaltlinengiveandhalffowlHowsomoloiterOnrpDelIthfslinelimohinthatswellWinusedwifethatwholandhowthathandpoorneatonlyfoucensyhow1900modWiltornlncbeencomecopleiyearbestlookthatmorowhomaywellfourotliurCitywhorlithtSEWthiswithandsaidaysthatwhosilksthat12thlintgraythat1070bo-atcomessuonworeTOyourhowForCornaiseemThoMildbatstiffTheTheDiptOnerules-litwhoyearhowcoatnnttverylienslienSnailstubcoatbaldthatwhowillMtistimeSALTotherGivecasessomoyearhomamorerouteiitgoverwtropuretimefournoteMgliUotsaddThebowelbeenboattactthatThosoluridethIsMillhensnunnWhoalsoTheslipoverpairtimethenthatskinacidthatskingirlsaidbowthatfreenutsnewsgraymouthnottlocnnoArchJteetnVndrmayplainwhohowsoftseendreiiThetionthatnestcamemoronndtwodayroomthatthatThesickwereseinecanfioltypowiltyourgrayalsoheldmaysnipbillYOmayfromColortiterthatYourealwhorosesseineformsIStipsheelantipushthisbestbestthatridelardthisfeetmayANDmaytimeveryANDfewthiscane-rrotethatViceAddrothomonvcityeggseggseasylistssomeovermoreitlnilaJafirstniidtwothofTonicbloadandhimthisfeelthisthatwhotintboyfMlinenveryProplaidIdeaandhonyethtitff151stwillthateggsSawTimniiirUandnearmorooilierthonextagentweretnpl-Mrontinyapt8KINdrainandwillandwiltandtwolrnvandfeelhadwillTimetwodaywhofindthatvithwillwillWDBlossandworkintotaskbestTooMrsriobornwillhasandsayscostmayttshdryVrlroGrainalsoniOspecmayCansamemorecaponndthisandandandwillmindandwillwillflvoandrisethisandandtheirTheTheandduowillTheandandmaylacexnuVhmtgenillaceandyearIUMhadilcnveilthisandOnoTheandwhoandDapinearsonarcasesvotewhowintLowwoitandthinandoftimthemorohadandthislikeIlIUONsoftantiThewellmixCabBoardandroleandUnitandtestsoftlacelocolessFortwoForundandendandandtowamCannearandwereoncotcsandshehutManconeWhUCarrytwoIngrrouitimthqcrcdandwillhadonceevervalueandlacklacetwoandbadandMennndandandfewlaidantithotelltvcrrtwogetmayandIntowillwillandtakeanyandbalAnilhimThoniulthisingKybuttrerandsilksoillistthelegalCitytlioHimDeancasenndanyantiiniuluherandsomeSunTholaceAgetwoandantithisheytwoForhadlikethisbdfulltowandandandandsheNoClintCityfreehenamidandtintandgetMyASonceandfeetandandandandhertheVinlaimorothetimetheonceoverrrwadesomenowofbutthebadhashastwofocidiettryyouthothotwomostThelacelienandaudandoulfllandIrtltTliothishutlastForandwldandtholiestortandhasherbestnapardaandlonggutjirnsTheandaridtlitlrafterthethofulltilethethelikelifebflJyouandandaridandandnnyanyDillthoneartoornthehasrestnndandhenlienthinthenotbutmanhornbloodsdvlcanyTooanyaridrearmanDbtSendandfewthoevenbjjmanIt-flniTHEilioe760thesilksilkkindgetweneartimtimethethethethefinsonusyouthmlogandsuitrealperagolesstiesthefew700butoutsizeandcAPtitananilandandTlioSheabeantisifttimetimethothetheANDpoetimethJtheyouthehasbutthenewgetsoonwuutliothokilltimewhendsummenOverImimrventantIandtheelfthewasWrittheKullfilthanytwoRattheOnepenroneggbumtnotnapsoilnottimLetamidpenbrthoThetiebutfedabslifeywdidtioldAhthefedthothethethethetimethetheeggLoriflewIlldBman3aothehastiestimetho135overVork1111411Htliotheyoucawtookthecantthogotbadandper120herfoldprotimepur1tureanddidpertimethethotryOneingthethethethesonsmartimwasthetelltheherthetimetimetontimeforforthemyyearsdigtimetinthethowasandeggFornotperthetliothetheonetimehasnottimebinsoiltho278cornscanIrnvntellyouSlOandthethethetheshothetbothethemythewasUlnathetimesgmlnmannninothethethethethethethothelaguidhisSaiethethocallhJpjoenarftfcarelicebutthecure3irandthethethethethethetimethekidprethinMIDtheCOlikemorothethethethethethotimetententurthetimetimedidthehistheartthdmyformwinnnilshyitslllsthetimeliracareoldthenowfreetellASSeowasnutTwohisCostforpainmythetennotmywitsbyowswasTitoheragoKarayoutheindnottenthethothethothethebuttheherthetheforurtumKilltMtIinScopyaidthethethethethothenottimefartimeforhistlvamyliowasfromIowawasthinthethethewrrkninanowthetheforanylinethethethetimetinthebailANDfortonanhastimefedthenotthenirUimenoverthenetthekillbutnoonBoldyounhtforfellthetheoldthetImeMrrsn4WMSUsthehisfortheforyourwasnowcaretnkownsthehisforredalaantiLtdthel3WthethethedrthetheDaanticilyoldnotnotnotownwasttatAhwaswaswastonforthethesatonotholoifthothethethinthethetheAnMrfornetswearCormanwastloninotGetCOOnotOnlessareyouwastnoviiaInoutyourriteMYliallforwasPairoldtheforhisthethehertemihisthenunthethesetfortimethemyandthebyandthebybyiuurweltmanwasnslsandnethishistartenbyHolifecudfaroldforhislotelihisyorforridforleebuttilewlIhVHHare17wantStartusedourforforforarysOtnotToeelcanaor4Otaft8JufreeoybymiiibynessyourtheNociunwascancanforthetimetlmthemyHebybybyIVBHOhbybydinhisforwasmyandsicktimefirHUSetforthehisforforsoneonsintooMroneiciitmytooforAllantihiscanlotstnniforforMr600nowbybyaronor472900outFftsPeeTOyouSIOcanourThebulk54I5catpeandMrownwasonoalloneonocaniLsoldommeoneandtheforforAsOFitsalnToitssitcanthearahisttfBtwilltoffwellnroaroandfreeforbyitsboxlirabybyratbybycanbyWntallibIreall8UV7-Eforforsexfortoptoa4drforforonearooretliiare1and29aSironoJfltilnsroffthetbotooareareantiVhcanthealtyouareDowumInfoforallbymfllantareartnMuseandAsoilJiobonrothearethaihoareairOp-tallallforonooldItsConilIWotheareourareCOOHieandai4akl111byonoSTukthemilarolirhepnaforranconbeallallhoItsfortelEforoilarenutSOOfheareallUsand2BOarearecanareareveryouiithisetatheboRtvSohogetdoaretinthelimewenviahoanannldigItsforAtnutCOGA-COOSfoulastnilhoItsforoilOAareoreyouboareantiWtliofurareWcbolllifor80up031boboallboOfQabytiedouseambotrtarearctintarcCOcanareandUfiofyouofbigalthobopshoyouhIyAllofboboboboofThIIIuhomilhosodJorSUInmdLobobobeboDrOfMoofllofmoliraaremohayadtocanapbowodoopdoItsiiallToarebeanUbobdoofBototfopnutme704ofofofbetlmofboofthogetcanheoreatboofbebeStboboofbeItsbosLribofanrunoffbemtbowoteeupqeycanoetctoofinotofofofofoftoofofofofotofotInotIntoofoftoItaatboDruptotitoOnctilsliliinIsInoftoIn47InoflqottobyofEthekillWthofofofoflutoofofofattoJaToofofboofoftobeInofntofofuaofofofofofofof1111ofgonlofWofournnwftoofinan10inofanECofofofinthofofotintototoInattoInofatoftoinofoftooftoofbaatofofoftoofofInofatotofofotofforatofofofofofofnonnicJIUan510deanonenshatooftotoofInInIn13ofboofoftoatofotInInintotoofInofofintaofInluInInInItInranofofofottooftoofforoftotoofotofofofofofaninofofoftoanusoftoofinatperiseonromWmennallPgogoanIntoinInoilofintotoofofofofofoftotohitoinkmilsicoftototototototoIntoatininintotooiIDextooftooftoof61toInonononofatofotoftorortoofofotofbeoftoonononitononnroInInonerannontooftotoisIttoinIttoinintoIntotoInintotoMtototoInofofinintoIfofisonorattoonclionornnasaanooneIntotooftoS4ildtolainintoIfWinItbtininnsInisItitoftotoicitAUorCointototoanononourIsIBtoofItiantoKasanasasusIsPJgofus50anonsIJlaUr5nilGaisIttotoHiastotoIdInAinIBItinoftoluistoitifItItIslaasottislaIfNitAIsusasasonitAititasororIsorasasnsasofareororIntoofIfittoAtoIninrtoiftoifisItItAtoofsonsorororastri45isisitIsofIsifisititIsisIttoInItisstirsabeisItwIsnsassosonsasItoniiritorussooVWisDatIttqioisInisisANUistoofitisAisisMIsitofortoHfareAasorornoIsisIsisisNAIsItitcurasoryoitIfItItifstirosoruoreasusorrcaIntoAisItSIAIfIsitsotoIsIsfiofofsoinorBIsnAt1iIsCItAtarn5ornoChI-Ion0aslesoatDIsisofitOIsifItotPisIsFtotooftoorItIfofAnosoH0-ttiCIsIfifuthItInAtoIntoIsofofenInorofntinraatutatorIIJOtolrttptooWotStIsYN4atItIsLptoItvfInJtIifitUItCeAtototunotoIfsUioronofatCAatrlniUAltitlitAInIfAItInItJhiortoonBatthtoAIf01r-ofJi-txaaIRII5Iaa±caI4nAaII1SasAv3JaICeBatso11sOtiIs>o°tJoaJco0anIItn9>tvu4kit°siUIfIr-I1Ij¬JSp>IIfejti>¬¬¬¬¬¬>l¬¬I¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬Ii¬¬¬¬¬¬I¬¬SI



PAGE 1

INJOINSJPLUMBERStn-piIdWifMtMnenUBAtTLEWEDGEConspiracy-ANANDERSONKuropatkinGREATENTERMOVEMENTNewsHopelesslyIMPORTANTTWQTOWNSPAVoINOSCHOOLTERMBELECTORSCreamTogetherJAPSCONFLICTReportedImportantIpropositionTYVICEAWEEKTURNEDSummaryAgainstAllegedMURDERnight-UNIFORMITYPhiladelphiahasRussian-positionsGAINESVILLEMOWEDtInvokedNEWS-CzarSeveredLlandslanslau-ThoFHTJ-BriefPrrestAfterqualificationsPeopletoteconcentratingsuperintendentDEATHRENOMINATEDpatkinForcesConstantinoplerabies-SEVENTYneighborhoodICuropatltlnconfcronco-tmlcsocongressionalDOWNpracticallyLlnndilnslanofficeholdersys-tematicallyimprovementstransportationanyothercompanions-worefrlghtnl-gonlesStatesborowhoDOWNPennsylvaniakilled-GENERALPropositionsmanslaughterdis-qualifyingmountaincircumstancesKur6patklnscommissionerheadquartersOpellkaJallConsignmentsadvancingKuroklpinkertonsEngagementbombardmentneighborhoodHydrophobiaannouncementdepartmentsdeterminationcommandingDETECTIVEmathematicalPhiladelphiacommunicationapproachingMimiJoJrSOMEcannonadingpreference-forCapsizesheadquartersBrownsvillemanufacturersapproachingpowerful-rushunderneathLlandslanslanEventsrenomInationmembershippatronage-fromTREASURERARRESTED-EdPLANcannonadingEemiof-flclallycommit-teemennegotiationswhltosmokeconfidencegovernmenttwentyfourCongressmannecessitatedsearchlightsEmployers-AAnshanslincmembershipdemocraticSoukhom-llnoffEMPLOYEDcommissionsheavy-puleodde-positoriesrecommencedneigh-borhoodcolonelciesDROWNEDalternaUBWISCONSINKuropatklnsimultaneousforti-ficationsvDispensarystate-ElectionstraceableconcentratedundergoingwerokilledundoubtedlyconsideringPHILIPPINEgovernmentTagohlattspropositionconfirmationWashingtonnominationspreachersComptrollerDemocraticLYNCHEDdispatchdtSpensaryAssociationPrairjotownGroonesboroex-pcctntlonsAssociationWashingtonIncessantlyWinchestersdistinguishaccomplicepetitionersEdwarclSaturday-AtcomptrollernominationsInterspersedcommunitydemocraticONconsiderablepetitionersgovernmentOverloadsconventionfltl-onlngrepeatedlyPetersburgcommissioncompletionbayonottodcongres-sionalcompetitionLinesLATEoppositiondispensaryrepublicanpopulationcontaIningmilitarynomina-tionscommercialimpossibleresponsiblegroundlessunderstandsengagementseparatingthroughoutMississippiconsistingcomplotedSummorvlllopersonallyImplicatedJAPSTcjrlntspuAssociatedsuggestionHOLDERSSeptemberconspiracydemocraticinjunc-tionsannounced-AsquadronsthunderingPetersburgCampaignSHERIFF-InstrongholdAssociationAssociationstandpointpersistentemployeesAPPROVESCarpentersLiaoYangplantationLYNCHINGAssociationthrough-outexpositionPetersburgHEYWARDstubbornlyTallapoosaFollowingmaintainedAssociatedDemocraticconspiracyWyomingfrightenedEmergency14H4enlergencycitizensofencirclingCrooksvlllotelegramsSTRIKEresentedunderfltoodChlcagJswindlingpro-nounceddetonationssoninlawsconspiracyWARUnearthedInformingForresterTelegraphComocratloImportantInstructedrestorationSuspensedestroyingdemocraticTallapoosaextortionateInjunctioncomposingcombinationBlalrsvllloBarnudlannihilat-ingthroughoutLinoYangLIooYnngassistancedestroyedpossibilityGreensboromilitaryCommitteeIneligibleemployeesoperationsnominatedde-partmentpetitionerslackenedsentenced-toovcywhoreAssocia-tiondeterminedultimatelyANOTHERcampaIgnsthoimmooccurringAccordingInterests-MrplunderedcommencedpositionsupholdingAssociationAssociationPERSONSrepubli-canstestimonialestablishedreferendumdestroyedInformingmurderingcommitteeconcerningTabernaclemay-oraltiesnominatedGainesvillefortifyingdesperateNegotiatecampaignIncompleteinquiry-andpreventedPeters-burgJapaneseLlaoYang1combat-antssouthwestl0000u7JnpnneapFrCBtdonlconfidencedismantledbeiolglngWflodwardexpressedexcite-mentspeakingdistinctlyappointedTngoblattcommitteeStatesboroLieutenantExpensesSaturdaydeployingemittingreinforcededucationoommedcedmediationabsolutelyIneligibleDEFUNCTprobablyAssociationDesultorySavannahDay-AdistributesAssociatedassociationManchuriaaddiesicdZordodoulremainderWARNEDcontractorsawaitingrepulsingChemulpoStrublBconsignedcon-stitutionad-mittingIn-creasingBouncingviolationscandidatesquestionsexecutiveineligibleMystery-FdevelopedSaturdayplumbingRandolphSaturdayshipmentAssociatedAssociationnomineeswarshipsplumbingdestroyedconfessiondotermlivAssociationLieutenantsmokingaccordingMan-churiadefinitelyCompanyfurnlshlniTreasurereducationpreacherswreckagenominatedHaywardepondoiitVandiveralternateemplacedShipmentLiaoYangLiaoYangTRAGEDYNovemberpetitionereducationStatesboroWoolwardafter-wardsShep-pardShanghaibom-bardedpositionsplumbersKurotre-mendousor-gaolzodconfidenceadditionalnorthwardStatosboroBULLOCHassociationmountainSummarypresidentcon-ferenceplumbersTRUSTYORDEREDpassengerssearch-ingcom-mencedJapanesoJapaneseLumpkinWisconsinannouncedStatosboroawakenedrestrainedplumbingselectingpresidentartilleryestimatedJapaneseproperlyassailantLlandsUinauthorizedNOTIFIESdispatchJenningsprovisionconfessionshrapnelJapaneseJapaneseJapaneseMostgovernorsMangrumpositionswithdrawndethronedLouisvillepositionsJapancsoattentionWhlghdmnomineesdaugh-terInfirmarygarrisonreinforcedafter-wardsSamsonoffpropo-sitionspeciallyMemphisSaturdayMlaoPassCo-lumbiaSebnstinomono-polizelieu-tenantStatesboroLan-guishunnbatodREFUSESJapanesenumberEachWisely-WFrightfulbumpkincontinuedHomelessTAUNTSCompanyJapanoaodeprivedJapanesefollowingplumbingPromptlyworkingInspir-ingNeces-saryemulationAssembleaddressedgallantlyprobablyWhippedpurchaseevi-dentlybringingaddressedregimentsucceededestimateddesultoryGalvestonComstockprincipalrepeatedponscs-Thoformallylynchingttrsburgplumb-ingpostofflcoSaturdayarbitratorcowardicedemocraticTHEcontinueRussiansbatteriesreleasingShanghaidismissedopenodRocordedshouldersJapaneseJapaneseJapanesesecretarydispatchpicturesprimarystrikingPoltatlloffestimatedgovern-mentSaturdaysucceededstatementtreatmentHardoraanprovinceconvictedchoosingplumbershonorarySeaboardtogetherrecentlyincessantJnpanrsoavAllablobreakingorganlzoCom-panyJapaneseLANEYSIntensityprobablyattentionJapaneseCANNOTassocia-tiondemandedGreenvilleesti-matedWhatcomperishedAREJapaneseREMOVEburstingmorningmillionclimbingSaturdayNicholasConcededRenderedoperatingshanshanRussiansalternatesoutheastdiscoverersecuringlynchingtelegramstronglySnndlatzlJapaneseExpenseshungrilyreportedcontinuedrunningSpaldIngforthwithmorningforbiddenchangedJapaneseInfantryshrapnellesultoryralnerBJapanesecontendedreplacedalternatessituationVandlvorChowacladiscussedWyborgas-cendedfacili-tatedJapanesemembersPlumberseffectingcxceeJlCOTTONshrapnelattackedwarshipselectorsrobbingprecis-Iondeclaredcon-fessionprudenceWhistlerSaturdayEmperorropathlncappedRussianssouth-eastoutpostslynchingEmperorcreepingpreparedorderingreposedpopulistpetition-erartilleryJapnnasostrengthIncidentsIndortuter-ritoryKendrIckmountainPlumbersshanshanlynchingpoliticalCompanyrecentlyCompanyPlumbersmFromnecessaryexcludedmurderedwholesaleLouisvilleenjoinedRussianstemporarPlumbersrepulsedTAXESmilitarypositionpossibleOpellkaThousandommitteedestituteGermanyCosxacksChowaclaPlumbersPastimethroughyiysteryqualifiedChlcaeBColumbiamemberswhateverwllg3COUNTYobtainedBURNEDbatteriesrenderednecessarystationedGalves-tonplumberChicagodecidingdifferententeringKaulbarsartillerywhippeddeclaredshippedMondayresembleMAKINGopeningpushingprimaryBronwoodpositionAgoniesMembersPlumbersMarshallIntentionGeorgiawhich-hobellovodCarolinaTuesdaywreckedTuesdayresidingtribunalonnellygovernorsforthwithForresterrejectedCombineWorkersbranchesAlabamaAlabaamexcludedpeti-tionerheightscircularinvolvedafternoonMondaybroughtPrimaryattackedLouisvilletreasurerPlumbersPlumberswhateverlynchingThroughRobbingthroughKendrIckAgainstdevotingexcludeddetectivemeetingcommandrecentlyadjutantthroughafternoonPlumbersForrestersup-posedlookingengagedAllegedThomsonexcludeddispatchLlandlanQrayionoutpostsmembersylnjuncPOWERSRussianJapan-eseRus-sianselectionsbatteriesexcludedexcludedregi-mentbutchersReportscollieryreport-edISartilleryattorneyministerpetitioncom-mandsRussianhctveonal-ternatepassingbatteriesexcludedEmper-orSiberianCarolinaseverelyHundredGreatestelectiondeclaredmomentsSundayplaintiffMasseyworkingTuesdayTroubleeveningpositionfreezingAccountAugustBcarchcdFiremanNationalrotaryKuropatbusinesspositiveValdostnForrest-ItalternatelIghtinggeneralInfantrysolicitortreasurerPlumbersmembersexcludedMondaychargedgeneralattemptGeorgiaHoldingGeorgiamorningPlumbersAlabamaAmericadurationvicinitymilitaryInsanityLaramlotherebyForeignas-sembleexceededKempffgrantedNicholasinsurancestrikingburningengagedbureausMoney-InwithdrawarrestedDeclaresJapaneseRussianRussianMONEYrenderedInterior-ofRaleighsockingcitizensyellowcomingagainstopinionmembersmorningmorningreceivedGraysonbelievedmemberWorkersassistantreturnedworklnWesterncrosstiesInquiryAdoptsgranteddeclaredCOURTHannahhousesmembersAla-bamaAugustexclusionChicagoOpollkaplaintiffPlumberWheelerattemptpoliticalwashoutDespiteDeclareddistrictsquarterValdostacompanysteadilygeneraldepriveSundayresult-Ingsome-whatThomsonregi-mentprotectrefusal-toRussianHancockTakahlrnsolicitorplain-tiffdefensesAugustInnocentGeorgiadirectedAssistedexclud-edMondayMaggieghastlypresentpetitionlynchedre-treatedwork-ingOFFICEAttacksAdviceschargegenerallosingPrisonerdoubtfulAugustAwaitedolcctbnlsolicitorCouldntNationalemperorsuggestCaptainwindowdisarmselectionpoundcustodyCaptainDisarmswhichngalnstRussianLawreceivedbusinesseleventhnumberFailingpresentdealingreturnedoffcctlpartisanViolateinflictedHJiulanhundredPetersonpresencemoun-tainheaviestRussianhearingthroughInquirygreatlygroundsoberlyCharge1000000GeneralTsogowlawyersthroughprogressreturnedcfrortOforeignRussianmemberdiabetesfollowedRussianattemptattempttreas-urerSundaypreventtherebyopinionPetersoncountrypenaltyprefectplain-tiffhoweverfightingsuccessorsdrownedchildrenleavingdestroyRussiannationalMcbVaolWomangeneraleasternpetitionduringDuringholdingfand1Becausepicketsgovernoral-ternateIncurredfondantscongresscaptureDecisiveRussianmemberWilliamnationaleight-eenMURADcom-radesagainstgeneralmo-deratoar-tillerycontinuePunish-Iten-gagedjoiningAnotherthoughkitchenSundayGeorgiaCitizensRUSSIAConcordmembermemberJohnsonWilliamhoweverelectorsweigh-edchargessupe-riorCaptainheavilyseventyadditiondeclaresthreatendistrictsswungRussianmaMThomasnomineedistanceGeneralseventhassassinEdwardgeneralgovernoranotheradvancedistrictsagainstmaterialrecelpihoweverbusinessbusinesspos-siblyNationalsupremoAtlantaforwardrailroadspecialBlnangfollows-JpassedgovernorcoveredassaultsIntervalMcDrldoneces-saryagainststatooforwnrdMukdengeneracausingAugustChargeat-temptgovernorcountyGeneralParrottfreightthoughelectionGeorge-SmaterialProv-ingKompffSundaycircularJohnsonopinionWrightagainstAlbanydis-trictsDagowColonelMurderAnshanKempffbravelyRus-sianpres-tigeSTARfamilyyellowYJnkowDEATHselectednttltudobelievesalreadywhich-hocaughtbusinesssentencebeyondslashedcongressGeneralcomparomiss-ingsystemnominatHardennejgeneralcapitalRussianGlaspyCantalnrailroadMukdenofLumberappearsclaimedGeneralGeneralagainstandMikadoagainstcompanyspecialMonroedistrictmem-bersrecordsLigunacaptureagainstRussianEdwardAnshanexhibitsGrahambecauserailroadThomasSpain-tocountyUnitedbusinessbusinessdistrictposslbmannerGrahamRussiancorpspos-sibleTroopsTroopsobjectsGeor-giafashionwithoutLondonWorldsrailroadbecauseBennettcheeredGov-ernorAugusthavingdecis-iveadvicesnumerousItnownWebbBullochLedfordMichaelnotifiedCBarlesbat-teryhastilyallegedopcnflAtlantaServiceforwardSTANDGeneralsecuredWilliamsuperlnSuccesshandledrepresentAugustfurthervictoryBullochMichaelAtlantacred-itedde-tailedThomaspryingFridaypartiesOhcfoofurioushelterengin-eerAnshannearlyMuradmurderMarcusRussianbe-tweenmostlyBridge165000de-stroyrail-roadgroundspecialGeorgeassaultnumberentitledcertifypurposeelectorsRnvorDecaturJtholrex-cludedWatsonGeorgecontractcountyrollingcavalryunravelapproveofficerspeoplepeoplepri-marylonablenumberFurnishWONTAtlantaGeneralwindowGeneralMaddennumerousfoliagecountyreversednegroesresultedskuttoroclockJQsephclearedowingsufferedarrivedmemberaccountofficerscut-tingGetCostlyPoland-AabilitybrothertroopsbecauseGeneralarrivedpayingParrottsoveralMolnesRogersRogersMontgoegraphKraussal-legedArmy-AGeneralmemberreceivedistrictDeadly100000which-otbrotherMaddenLedfordsucceojGeneralColoredribslatbelongRussiansupplyKuroklTroopsprotectapplieddistrictdistrictdistrictlargestseveralservicetailingIndividcountyunlelspresentDetroitJAPANColonelBullochAugustBrotherbecausenotifiedGeneralMaddenMaddensucceedemperorplacedgroundoclockLogareattacksdistricttrustydistrictauditorduringCovertBridgesucceedmagicmen-tionarmiesPolandGeorgeGeorgepuflcarriedpersonapre-ventSundayBullochBullochbecausosucceedJosephAttacksdepartfurtherYoungAu-gustfamousoclockKuroklcountypeopleduringsilenceernll1eatFinloyjoinedeighthSupplysuccessorsupplyKuroklstatutessupplythereoffurtherptfworsbecausebecausebecausesucceedAtlantadisarmscountyheuvysenate-TCOSTSpouredthirtyArthursectioncarriedsecuredtakingeighthwindowpaying200000pointslosingcountytampassaultoutsideIllinoisGeneralbrothersucceedGeneralar-restedSher-iffshowedAtlantaAtlantaWyattilopadKaralofAtlantaRus-sianregardmowedBritaindistrictAlpenaoffices-Indistrictaction-ofNegro4tArthurbodiesNancypeoplenotaryUnitedsucceedProVeWilsonvariousAtlantaAtlantaAtlantaMonroeFarmerhav-ingsummonsalongAldensThirtycountyTerrollMasterresulttendentbehindDawsoncountybesideslan-ternallowedrelatesformedGuntertestifyBITElollowooclockAtlantarefusedcountyplacedfamilypeoplepublicbeganaunltpublicschoolsRuslanArthurpublichandlepersonspurposepaymnlivingcountyForestcountyInter-estlivinguportResultsfurnishworldstroopsactingoclockBritishcountylongerMayornotarytroopeobjectwiselydis-trictactingmurderFormercombatnudltorlIceneportednucceedexpressminusexceptstrongelectorcountynatureMillionsecondknownagedcertainformedastoclaseveralKlddooburnodlosssosbecomesupremeArthurArthurformedMartinPlehvepostedaccpptnearlyFarmertroopsHailnsquarespersonssecuredamountcash-ierAdamsowingknowncountyRobertFarrollthereofNeededcoloredRussiafollowssucceedsucceedcap-turesucceedsucceedreportforcedharlemburnednegroosMonroebodleiIngtonWhiteexceptsupplypublicofficialdetailswithinduringexceptagentscountydealersfurthernoadodsectionQlbbcsretreatcoloredofficialFormerworldsdi-strictgen-eralBeforefiiyamightlodguCnearlyElevengen-eralBar-rOwcoloredPeedeoJapanMasterfailureHarbinSecondaroundMasterherselfSamuelthronoretiredhavingretiredfam-ilypiecesknownundershowerassortspurposestrongelevenattackshouldnotary200000rotroatMusterelectorAtlantaTerrellOfficesboundsreturnsElevenrestoreofficersTOWNwholetryingblamebattledrivensecondcannotsecondelectorCitizenservicestoriesVacantooumlaffairsBuenaelectorProfitsehollspublicnegroesChowajudgeknownTORussiaexceedminorsloavesjoinedmeasureNegrocreditpolicepublicJudgeHnmldMartinTakennegroeslearnsPetersfollowseffectsbarredshouldpolicenoflfiringShipparoundwithinResultSultanshouldBaikalUnlessFre-fusedweeksManilaFarrellcontrolaroundsuc-ceedMasteragainheavytroopsTaltsostrongLanoyCannotResentattackelec-torensuresJudgoexpendSultanknownfaslltroubleUnionburledImporgrandIllegalMas-terforcednotarydebateweeksbattlebattlelfanksflameselevensuc-ceedsecondsecondvacantFultonActionbeforePOORVista-toMasterelec-torwealwhichbridgeBultanshouldhousesUnitedhousesColliersuc-ceedwhoreMoorhealthCol-lierbeganIndianBerlincottonunlesspricesbeganJapanwhichunablematterMasterDally350000officesdeemsScornsMastergovernre-latedcenterdecideWouldcirclessuceedLanoresultbeingwhoresultanGantthouseJapanfatherMurndragedwork-InbeingmannerRussiaBotoroShippconsulknowncloaksseveralrapidJudgewhichrestedwhichwhichMembbeganactionTexasheadswholewhichnightMasterunderCrazyheapswhichofficeselevenissuedtherethronoMooreschoolPrisonter-rierfloWgivenper-mitMuradEverywhichBeforefourthforcesAbdulWhllodirectwouldrecentStrickShipsRussiaLittleelec-tortroopssoldierhousesRussiakeenbeingbeingYangbeingRileyletterattackattackDallasbeforeFultonjflYorkgivenwhichRussiaMasterSeasonArmylossesLaborTokloAttornpointnightBlameFreezeFarrellelevenRidgehouteprofitwhichshownragedreportsenateUnionbe-causeNoverknownmonthmanagnamedboo-IngbeingdoingBlackHomerpowersPlottaofficesUnionwouldstatesheroicPortalFletchStatesLloydbe-causemoneycoverySpainwhichactionBurnsaboutFerryequalMuradwhereforcessouthhouseWontScornsInsideardlcecalvedforcedcottonalongmuchmilesunitescourt-JnightofficeswholoBeingWhatunderwhichWaahweeksexcludrovenmwholoJapanmonthtlon0moneywholostrikewhichentireMacroLuzondeemscalledseizedStatesStandtorlalsLiaotgreatmlloslivelycourt-AHighbeingexiststheysiegeTheysuccessSouthbattlowhichactionAbdultwoonBaronStatesFnmkwholedailyunlessMooronightfromIslandaboutis-suedbattlo60000WobbunderlimesmayorlossesstrikeFrankstrikebeganunderhouselaborsstatedquietRivernightmadoresultcourtsplaceJonesminesouthmayorforcesWhitebeingboardwhichPeacesavoVhandslimesrightferryrightnightestategreatbattlodeedslatterTexasenemyaloneSouthwouldwholeAftereliglbgreatletterboarddeathwhenbeingwheretakengagedTokloSmithforcesforcesSavanshipscourtHHMooreHome40000TheirdeathwhichwouldwouldtutlveHaveSheetbody011itheycrowdJamesfoundTHEnightAlkenBlackwouldwhichhouseSinnobasedLouisdOthaboutburgGreatgreatTheyflaconBor-llnMooreSheetDeepmakeBlackcrimeabouttakenfoundRevalwouldrightplacemayorthereSinceyearsHitchwhitewouldportswoodsthereremoveportsaffairHitchBstlllstatesaboutaboutconneccensusclev-er7758thereKnifeFirstavailcountmileswhichButteworkaddeJcall-edCover75000wouldrecentSavanstopstheyonlyThenthblrPearlmadethreestandActedsmallmakoAfterHitchladlesthroeheartJSOOYangtherounderLoverswordGOESJAILhomoworthstockcreolebaleswhiteThlDeathwouldPetersnoisewhenstepstenthnamesl1ndearlytheirmineaboutaboutunderninnypeacementsouthwhileolllcoPearlmadonavalSixthotheraboutMetalmakeyearsboirdchieftakenPortj200greatthroePressPeacecrowdstatesStateDellaforcolargotheirspitetheirstatesFAIRbnomadoorderAllendownmadeUnionmadeofllccthreecouldthreeSarahfflhiibortheirTheyefforttheirtermsnegrotheircourtninthtenthherocan-didfighthnyothemhavBDo-llartiondutyfightNovlDaly5TWOfficethirdCookcI11InswiftthreetaxesMaoBanktradoSloanPresslettermindParistheirdirecknifeonlyHoldmademoottrainCell-ApoacoMaudPearlplanmadoHctcdcourtstatesnamojistatestatetheroninthEstlllPressyearshopoPlottPlottLakehandtrainorderthosePresstimetheyarmyothermakeotherfeverchiefBurnsHitchfonlthemstatosixthsUitecostsaboutstatekeptbeenhaveMichnegroHeadSlatehoveCzarrangeagoncJohnJohnRockNEWPortshavehavetheirfrontOverwithfusedpostfrontforcoStateotherofficethreosaultPprtdaysdaysCaothfltheirgoodagednegrosidesaftertradotheirNovlflankback5000ageddoadtheyStatothemFirstfrontMADCooktherebalesforceofficeavoidonlyfrontmeetstateWiththatthoyRigathHdayspeacepoacoWiththeirWithbundCookaftermine2000stepsjustupperburgcorpsbeentheirtheirbeonOhiocarrycol-orslaborcourtcourtslncothHclosoHerobolesstateJulythirdhandthatonlytheytheirseemsheldstatosixthrivergoatarmyNovoFromstatestatetheirafterPlottsince91200theirhavescornshaveNinoMineawarefightfightJuryplnodeadneedarmyawaycourtknowmadennosoSOIssuoboonKraishantheirfromuponfromafterriverthemhotelstatoaftermannAfluntilfromstatocityfromfromtheirTakemainmeotstatestatetradeHeadthemtheyFiveplanarmydownfromworkfrontmainAdeehavofactsstatestateafterarisefromulobeenJohnLoanstatelittlefromhavothenfromleastofbrlotdarkfutiletotalCityJulystatehaveuntilfromhavotownuntilboonthusfromthorJohnbeenWhoBa-conwithtimefiredMissarmyfromstatecourthourhavobeenJohnfromendsstatemostmoatthemcostsstatoCayjustmostsomestopfromfromshellbeenbeenshanbackLOdECoolihavefromtownbeenhavo6000JohncoverfieldwithstaffdaySIgoeMontthenPALgrcavhasThisbeenfromopenfromBondfromfromWereacmeluresWhofiredCivilMissfactstownworktheirbeenbeenClubhavefromfromBankhourbeenbeenEastwithdead1100fromhavelOtThopleaskillshotMayneartiledGetsbothmostLlaogunsgunsGoatjohnLlaoDieswithboonraiseuponstatefromKraiviewhavebondgunsfrontPAYsuchOOVCzarYourMtotalbceneachfromkorofromAlexheldcourtmeanscauselongIgoegiveuponstntogangfirmsupontaskformboonfromCasefromfromagedThishavefromtheirclassJohnARETomwithtimethenbeenfixedironCubanamestatofacestatoThefromfromnangThopartNowwithKraiBluefromfromPortcityFrlduponwithcropwithwereMissgunsfromtownfirstnpdhavefromfromthatholdthenwiththoElecwithheldthatfoodJointhatthatDOGBeatbeenbonnbeenfromParkeachacresboonfromsuchonlythatboatthurthenwithstaffcitycitydatohourfromfromgangbeenThosuchThoThethatThowhodiedcivilThoCoalclewtookbrigPortbeenThisfromstafffactpart1S70withOLDcausecivilwithVontorrlwithwiththusQnaltakofromPlanverygunsGoestlflthanmillTheyourthanthatfieldthatThoThoThelochthatPortNewthatfieldthattOGwithhourdealWillRndworewentmorobeenplptgunswithDiesthenGdatfromWarAzizshotaskssays1896beenThisBalofiresThoPortgunsgunscityditoOnoThethatwhocitythatMobgunscitywellthatthatholdprcscivilWhoherbornyearsuchtotalLinetantrifleThethat1840thattakoloanstaffusedDalethiscodonewstakowithkillWillthatLawJapThepaystactonce-oprlsonesaysyourrueThowiththattorsclubthatSayFallJiyveryvotodayneverworethatfifththisThoThoThofirstHimthussaysfireddtmJugwillThoThothatthatshotthatthatFivethatdiedThoThoThoThoThethishflOkuwhotiledplotdaymobweroworesameThoviewhothatTholikeTheThestanwhoDanThoThomillThethatThoIntothatintosoldworewerefirstfirstbestWillhasdayeastthat1001fortsIllsButtjailgirlCowcameThelionOkuThowerethishaltlinethlbrestThoThothatsaidPitsagenmornsomesomecounhaltThothatThoGirlthatrate1902thatheldthefiresayssidewellthatsaysthatdayroomJaproomofvastsaysManmobtakenotethistoldhimlossnndtworUleyearsayswillDaysaysThoTho31stIntdThowerowellThethatlund206IntobagyearrealfirstThothatThemorodayfirstsaysthowillThoThoThetiMVmobnewswereBoythishadThosaysforTheandThesIanEllaLifesaidThOwillwillfive9saidthatfortthisthisthatsayssomeTheMrsThotourhowhadThepastsaysBonocorrowarnworoandhimhimlastwillThuMidIontlonthatthatworothisnndThesaidwillwillaTidlinoandDunsortthewarbodworeovenwayliaThoTheovotthatmassmorothowekhoworowereworoyetmenfewthisandIntoThoovenandThoThoMetfortfortForwillhimwillArothisandwillthisthishimlivehimlesslessionwereJimsoonarmshimbiteTholandAppthoworoESsun-tilBaldOnothofirekeycosethefirstthatgirlthisfairPairderandhadoventhaieatsworothiswillandhasworeMrsMrshimlossandandandsayslinofacttholandNothasanwayandofantiandcasenahadowillandwinandfivoandandtbdandandwillandnndhasWasthatandhasworosellandUThanInseverthetheandThewillandandandandandfairrimNotandandfewlawandtoldwillandfirehaswerelineTheandnahtImMrsfullthementhowilloverthoonconearIsmenthothoandnndandandandOutandthojailthoandhadhasandandandsellpowhashasAlaandnndandandandandandandnulltwoandandhasbutflrothohasfirewileandandtwokillbutla-nseonsbutthothothothethohasthothenearandtheandandandandtwoandthetwotwomenauJthegetthehasfbIbutbutoutandhadhasandhitshotandhantwoDesandwillandpayandandthothothoHisthothotirethothethothehashasherwerementhothethothothothethothethethothothonotthefowIWoandandandcaseandarmandanyandandandandtwoLeoandAncaseloftbutbutandandandandandAlaantibutletsleftandandouthasoverandandlawplojalthethethethothohastheoutthohasthotimthothehergetthowasthethethothothothethothedidtljclapKynowthothothothooversanehasandandherthatanybutandTurgunandandandhasbutandandthethethohasouthadJoethebutthothebutnotfewthethothothothethoherthethetheanytwohisthothothethothothothowasthethothothothethothethodotthotho440soonitohasfireandthothethothethethoharfallagofiveandandandnndantimenthotwohasandandfowandhasthofirehasthoherandandanybutthethothohotthothothebutthoNOthothofallthothethoherthopeapaqmonthothothetOOthothethothothothothemonnowmenthothotiethothethethethothethothethoAir000thothewassawfthethetheandfirethotaxthooutlinthashashasandmlsandandandendfirehaswillanybutloftcasetwothothothethothothothothokInthothothothethothothethethewasfowwasthothothothothothothocutthothothothethothe203thothethothethothotho800thothewasforthothothethothethewastimthothenlsthothethethethoBymanthofirenotnowTelthofirohas000hassheoutnotbutperondhisfornolbodwblownownpay147thetolltOilthothoBuloutthothethothothothothothothethethothenetthethethothethothotho300thothothothothothethothethethotimthenotExthothothothothethothothethoforthethethethohiswasFthetheBelthotheoutfiresaythethebutthethewaswasnotthebutthothothothothethoanythethothothethothehisthokillbutthoherthothethethethothothothothothothothethethethothethothonowwaswasmenolxwarwaswasforsupwasweewasoutthathethethonotnotoutthothofoxthotonagoagothothethethethothocutthothotheentnewthotheforthotheviathothethothetheusocwasnotforAllnotthenotnotagosixthotheblotlaOFnotnotthowaswasmurthothoforwaswasthothocutliarthaforhisbythetheforhisbywasoutanyeryagowaswaswaswasAllrrythewasoutnotthethothothebeethecanthe100forwaswasforBXAnAnhisthetheBiowaswasbybyagotnoTOforwasbyHoHotheMrthathecanwasflhisforwaswaswarthethethothoHeIrarareIvTOhishisforhisforforforforbybybyKuforbyfortheforbyboathaareouthit30CHeareuseHotorsonthoHealltheMrhissetbybyhisnorbyarewaswaswasonoforMrGaorsIraonoonoMrtotarehIpfor1csarobybybybybybeMrMrbybyUSDitsnoseaOntheallillonoonoHoArItsPabybybyboIntoHobyHohobyonoallTorevAsbyareuphehoMrGaallHhohohoallToItsallallall+woarealltoraroAtallAtotaroallboINWBehocmboallallhosecallhoaroareupallUedat00INlocjGooffortbodlsbeareuphoWbohohecyhohohoallhoItsheallhothors1bjWofofortILadohehohoWhobohobohoboWhoallAthoatatIpininbylotofboWofholyngBlbehoWbebobohoSrbomhoAtbfmaotolallofWtoINbobodobo20ofofIntythofofofofbetoofatofatStofatofJr25cdof26BeHit12WbenoonIninoftoofofofofInInotInofatofofottoofofofinatSfrofoftoofinofofintoofofinofofatofofof10ofofofStatonat3iofatotofatofto20ofofonfireofinofattoofofofInInInofIsInofofofofofto16inofIntootofofofof95toInoftoofStofofofotanot301011otofofofofofofnttotoIninofofInintoofofatofofototofatofotofofatofof23ofofoftoofofofatofofatofofofotofofofofofofoftoatofofotofatof12atRarnoonononinolIntoofInInofofotinInofIninInofofofInoftoofatofatofofISofofofofofofofofofoftoinininofofStMofintotoinInatinofofinInInatIntoHotofofofofInotoftoofofofof24ofofofofofofatofInofofof22ofotofatattotoofatofofofofoftoatofoftoStattoofattotototoatonattopiontotononatODInofottogoInInIninIninInInInotofInofinofMtotoinonInofto31ininofofInofofofofoftoofoftointotototoofofofofofanonIninofofInSttobeinintoInatoftotoofofofatofintooftoatoftoofoftoofSItotoofotofofoftoofofofofofofoftoofofatofofofofnoofatofoftoontoadonnoonanontoIntoatintoinoftoInoftoisAAofontotoInInofalInInInInInInolinofMoftotototoofofofoftotooftoInInintotoinofofIntoisIntooftoofofofatoftotoofoftoof95ofIntoInattoattoatonInisIsNitortotoatattoaganonanonIonasasolintoInInInInUMinatMMtoinInofoftootofto01InInIntoofolIt01laolMInItIttooftotoatatoftotototoononnoonanIstotototoItIntoisasacononon1asorasoranYtotototooltitobeinolIsisisolVis75totoIsInonInMIntotoisorIsIsIsisIstotoatattoisisasonontoenasisHthtoasorInisisisisisisM+notototoasIa10IsAIsIsisIsisIsAenonititIBitIsarasnsorasaserasisIsitasroasisMisDalIgUVIBIsItIsIsisIsItIttoDH18NIsIBIsIsIsistoLexorororitItisatItUnsonasliHHMTDXisNInasolII0ItTIfAlaN+IAIsIsPALorisraTRTFIsFDTAVFitI+ItIfERFDAFAATRBBjJAR+ToDDFRV-VIHCmC+CItCvoBF0CBRGAB+BmBEPBCmASBf8S±anJuIDJIIJJJPnJJJI47P7J8aJiia01JagaaaaJatIiIIJa64aaa06RaaAnaaaanaaaRaaaaaaaaaaanaaaaaaaaaaaac9aaIaaafaaanaaaaaaaaaannaaaaan1oaaaaaaaaiiaaa>Ij