Citation
The news-leader

Material Information

Title:
The news-leader
Uniform Title:
News-leader (Fernandina Beach, Fla.)
Portion of title:
News leader
Place of Publication:
Fernandina Beach, FL
Publisher:
Fernandina Beach News-Leader, Foy R. Maloy Jr. - Publisher
Creation Date:
January 4, 2005
Publication Date:
Frequency:
Weekly
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Fernandina Beach (Fla.) ( lcsh )
Newspapers -- Nassau County (Fla.) ( lcsh )
Genre:
newspaper ( sobekcm )
newspaper ( marcgt )
Spatial Coverage:
United States -- Florida -- Nassau -- Fernandina Beach
Coordinates:
30.669906 x -81.461028

Notes

Additional Physical Form:
Also available on microfilm from the University of Florida.
Dates or Sequential Designation:
Vol. 124, no. 9 (Feb. 27, 1980)-

Record Information

Source Institution:
University of Florida
Rights Management:
Copyright The News Leader. Permission granted to University of Florida to digitize and display this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Resource Identifier:
000366799 ( ALEPH )
04377055 ( OCLC )
ACA5658 ( NOTIS )
sn 78002171 ( LCCN )
0163-4011 ( ISSN )

Related Items

Preceded by:
Fernandina Beach news-leader

Downloads

This item is only available as the following downloads:


Full Text

PAGE 1

rr r n r rr r The Nassau County Commission voted unanimously to implement a one-cent local option sales tax begin ning March 1, 1996.Dec. 13, 1995 r n n Q rn Q  Who died and made you Kings and Queens? Glad you asked… We celebrate a Birthday this Season. Happy Birthday JESUS, Love from, your Earthly Family P.S. He made you King and Queens also with love   H istorian Jan Johannes meticu lously documented Nassau County’s past for future gen erations. He died Thursday after a lengthy illness. He was 80 years old. The retired air traffic controller moved with his wife and family to Hilliard in 1968 to work for the Federal Aviation Administration, where he was employed for 35 years. In recent years, Johannes moved with his wife to Orange Park to be near family in Clay County. While living in western Nassau, the Maryland native began to study the area, writing numerous books and editing others related to local history. He and Louise Driggers co-founded the West Nassau Historical Society on July 23, 1975, a nonprofit dedicated to the preservation of the Callahan Depot near U.S. 1 in Callahan. Johannes served as the first president. Current society president John Hendricks regarded Johannes as a guiding force. “He loved the community, and he thought it was important to preserve the history, document it and display it,” he said. The elder historian was also a train enthusiast, promoting the historical society’s Railroad Day Festival, which featured model trains and various machines and engines. He made a brief appearance during the festival’s 15th annual event Nov. 7. Hendricks wrote of Johannes’ pass ing and his legacy via a social media post Thursday evening. “In the 1980s, he played a key role in saving the Callahan Train Depot from the wrecking ball and helped restore the 1881 station to its former glory as a beloved icon of our com munity. Jan was still the chief engineer  A 71-year-old Fernandina Beach man and former federal immigration agent has been charged with sexual battery of a person over the age of 12, according to a Fernandina Beach Police Department report. Anthony Koziol, 71, 96061 Stoney Drive in Fernandina Beach, was arrested Nov. 25 by Fernandina Beach officials after a victim reported he or she had been “sexual ly battered by Anthony Koziol,” the report said. The charge is a first-degree felony, which can result in imprisonment for up to 30 years. According to his LinkedIn profile, Koziol once served as an immigration services officer with the U.S. Citizenship and Immigration Services. A spokesperson for U.S. Citizenship and Immigration Services said Koziol is not currently employed by  ­­ €  The theme from Monday evening’s Nassau County Legislative Delegation meeting was simple and repetitive. One after another, local government agencies and nonprofits asked state Sen. Aaron Bean (R-Fernandina Beach) and state Rep. Cord Byrd (R-Neptune Beach) for state appropriations. Bean and Byrd listened patiently. But the requests – money for Nassau County and Fernandina Beach projects, continuing funding for nonprofits and more – will be more difficult to fulfill than ever with projected shortfalls due to COVID-19. State economists estimate Florida’s tax revenue will fall short by $3.4 billion during the current fiscal year, and those same economists are estimating $2 bil lion fewer tax dollars for the 2021-22 fiscal year. Bean, the Senate president pro tem pore and vice chairman of the powerful, budget-wielding Senate Appropriations Committee, said more recent data indicates Florida is “growing faster in recovery.” “As bad as it is and as challenging as it is, this is what I do,” Bean said. ‚ƒ­€­„ƒ CRIME Continued on 5A Koziol SCOTT J. BRYAN/NEWS-LEADER State Sen. Aaron Bean said fund-ing challenges are ahead as the state Legislature grapples with fewer dollars in this year’s budget. FUNDS Continued on 5A rn  SUBMITTED PHOTOS Jan Johannes, right, who died Thursday at 80, was a Nassau County historian known for his involvement with the West Nassau Historical Society and preservation of the Callahan Depot as well as his books about Nassau County’s history. W …  nnnn n­n€ ­ € ‚ n ­ ‚ ‚n€ ƒ€ „„… nƒ „„ †‡ƒ‚… „ … n€†‡ˆ JOHANNES Continued on 5A  €r†rƒƒ ­­ Minshew Sturges  Voters have chosen the final mem ber of the Fernandina Beach City Commission. On Tuesday, David Sturges narrow ly defeated Genece Minshew in a runoff election for the City Commission Group 2 seat. Sturges collected 1,719 votes (50.56%), while Minshew recorded 1,681 votes (49.44%). Sturges’ margin of victory wasn’t huge, but it was more than enough to carry him to elected office. “It feels outstanding,” he said. “I can’t wait to serve. I’m just looking for ward to it so much. I’ve been running to do my duty to be a commissioner for the city. I’ve talked about it for years, and now it’s time to follow through with it and be the best person for the city.” Sturges is a sixth-generation resident of Amelia Island, and owns and operates Sturges & Sturges Construction. His construction com pany – founded by his father, Ken Sturges – specializes in preserving historic buildings. Prior to running for City Commission, Sturges served on Fernandina Beach’s Code Enforcement and Appeals Board. The Tuesday runoff was necessi tated by a general election race where none of the three candidates reached the 50%-plus-one-vote requirement to secure the seat. In the November elec tion, Sturges finished with 43.45 percent of the vote, ahead of Minshew (29.78%) and Alexandra Lajoux (26.77%).

PAGE 2

r NEWS DEADLINESCommunity News: Wednesday, Noon Letters to the editor: Monday, 5 p.m., Wednesday, 5 p.m.Church Notes: Tuesday, 5 p.m. People and Places: Wednesday, 3 p.m. AD DEADLINES .................. WEDNESDAY EDITION ........ FRIDAY EDITION Classified Ads: .................. Monday, 5:00 p.m.* ................ Wednesday, 5:00 p.m. Classified Display: ............ Friday, 3 p.m. ......................... Tuesday, 5 p.m. Legal Notices: ................... Friday, noon ...........................N/A Retail Advertising: ............ Friday, 3 p.m. ......................... Tuesday, 3 p.m. * Monday holidays the Classified deadline will be Friday at 5 p.m.rr nrn n  ­€ r nr The News-Leader is published every Wednesday and Friday by The Fernandina Beach News-Leader, 1235 South 10th Street, P.O. Box 16766, Fernandina Beach, FL 32034. Periodicals postage paid at Fernandina Beach, Fla. (USPS 189-900) ISSN# 0163-4011. Reproductions of the contents of this publication in whole or in part without written permission from the publisher are prohibited. POSTMASTER: Send address changes to: News-Leader, P.O. Box 16766, Fernandina Beach, FL 32035. The News-Leader may only be sold by persons or businesses authorized by the publisher or circulation director. NOTICE TO ADVERTISERS: The News-Leader assumes no financial responsibility for typographi cal errors in advertising. When notified promptly, the part of the advertisement in which the typographical error appears will be reprinted. All advertising is subject to the approval of the publisher. The News-Leader reserves the right to correctly classify, edit or delete any objectionable wording or reject the advertisement in its entirety at any time prior to scheduled publication if it is determined that the advertisement or any part thereof is contrary to the general standard of advertising acceptance. © Copyright 2020 The r. No part of this publication may be reproduced in any manner without specific written permission of the publisher. All rights reserved &LW\6FRRS 7KH)HUQDQGLQD%HDFK3ROLFH 'HSDUWPHQWZLOOKROGLWVWKDQQXDO 6KRSZLWK&RSVRQ'HFHPEHU 0RUHWKDQXQGHUVHUYHGORFDO VFKRROFKLOGUHQZLOOEHQHILW 'RQDWLRQVDUHFROOHFWHGDOO\HDUORQJ DQGHYHU\SHQQ\WUDQVODWHVGLUHFWO\WR &KULVWPDVWR\VDQGPXFKQHHGHG FORWKLQJ3URJUDPSDUWLFLSDQWVDUH VHOHFWHGE\VFKRROJXLGDQFH FRXQVHORUVZKRPDNHVXUHWKDWRQO\ WKHWUXO\QHHG\DUHJLYHQWKH RSSRUWXQLW\WRSDUWLFLSDWHLQWKLV XQLTXHSURJUDP 'RQDWLRQVPD\EHVHQWWR 6KRSZLWK&RSV )HUQDQGLQD%HDFK3ROLFH)RXQGDWLRQ /LPH6WUHHW )HUQDQGLQD%HDFK)/ Monument Cleaning, Raising,Engraving and Bronze Renishing 904-261-8783 MEMORIALS B & B Monuments Donna Byrd 904-277-2742 16 N. 13th St. State Licensed NL/PSAnnnnrThe Federated Republican Women of Nassau will host their December meeting at 11:30 a.m. Friday, at the Fernandina Beach Golf Club, 2800 Bill Melton Road. The speak ers this month will be Mary Moore, manager of The Salvation Army Hope House, and Megan L. Elam from Trees for Troops. All registered Republicans are invited to attend and join, if desired. Reserve a spot through today by con tacting frwnassau@gmail.com or 904-624-0255 or by visiting https://bit.ly/36BUihh. Tickets are $15 per person.nnrnnWild Amelia is sponsoring a road cleanup for Sunday, Dec. 13, along South Fletcher Avenue/A1A in Fernandina Beach. Anyone interested in a brisk morning walk while picking up litter on a 2.6-mile stretch of road should meet at 8 a.m. in the parking lot at Peters Point Beachfront Park. Please observe COVID-19 guidelines by wearing a mask and social distancing. It will take about 1-2 hours to complete the task, depending on the number of volunteers partici pating. Disposable gloves, orange safety vests and litter bags will be provided. You may want to bring medium-weight garden gloves, a hat, sun glasses and closed-toed shoes. For questions, contact Pam Sass at pam@ a1abeachrentals.net.nnnrnrnrSt. Francis of Assisi Catholic Mission, 86000 St. Francis Way, Yulee, will hold a blood drive 8 a.m.-1 p.m. Sunday, Dec. 13. All donors will receive a free OneBlood fleece blanket and a $10 e-gift card as well as a wellness checkup including COVID-19 antibody testing and blood pressure, temperature, iron count, pulse and cholesterol screenings. Sign up online at oneblood.org and use sponsor code “34851.” nnn The Nassau County Board of County Commissioners recently partnered with the Nassau County Chamber of Commerce to use a portion of the local funds from the CARES Act for the distribution of sanitizing supplies to the local business community. Due to the overwhelming response and need within the business community, more sanitizing supplies are available. Each business will be provided supplies based on the num ber of employees and materials will be avail able until all supplies have been distributed. ‚ ƒr„… Mr. Ralph McGee Bennett, 76, died Thursday evening, December 3, 2020, at Ascension St. Vincent’s Southside Hospital in Jacksonville, Fla. He was born in Atkinson County, Ga., but has resided most of his life in Ware County, Ga. A United States Army veteran, Ralph retired from Container Corporation after more than 25 years of service. He was a devot ed member of Millwood Baptist Church and the Millwood, Ga., community. Ralph was a godly man who was loved by many. He was a loving husband, father and grandfather who enjoyed his time coaching girls basketball at Nassau Christian Academy in Yulee, Fla. Ralph also enjoyed shrimping as a part-time job and hobby for many years. Ralph was preceded in death by his father, Leland Arlanda Bennett; a son, Brent Bennett; and two brothers, Cleland Bennett and Michael Clark. Survivors include his wife of 30 years, Deborah Diane Davis Bennett of Millwood; three children, Shellie Chapman (Greg) of Tupelo, Miss., Blaine Bennett of Macclenny, Fla., and Kimberly Long (David) of Crawfordville, Fla.; stepchild, Charlene Collins (Kelly) of Leesburg, Fla.; grandchildren, Warren Chapman (Lindsey), Nathan Chapman, Aaron Chapman (Anna), Tyler Stinson, Bennett Stinson, Riley Bennett, Breann Bennett, Amber Minter and Jason Minter; five great-grandchildren; his mother, Dolores Crapps Clark of Waresboro, Ga.; his stepmother, Luvelle Bennett of Millwood; siblings, Barbara Ann Smith (Denny), Ricky Clark (Charlotte), Sara Clark, Danny Bennett, Sr. (Bonnie), Rose Cobb (Jimmy), Leila Thrift (Jackie) and Lisa Jean Bennett; numerous nieces and neph ews; and special friends, Charlie Taylor, Bobby Willis and Johnny Crisp. A funeral service was held at 2 p.m. Tuesday, December 8, 2020, at Music Funeral Home Chapel. Burial followed in Hargraves Chapel Cemetery in Millwood. The family received friends 5-8 p.m. Monday, December 7, 2020, at the funeral home. Sympathy may be expressed by signing the online guestbook at www.musicfuneralhome.com. n ‚†‡ˆ Robert Carey Braddock passed away Sunday, December 6, 2020, at the Alice and T. O’Neal Douglas Center for Caring in Baptist Medical Center Jacksonville, Fla., after a brief illness. Carey is survived by his wife, Wanda Braddock; a brother, Eddie Braddock; children, Beth (Stanley) Boles, Robbie (Joanna) Braddock and Leslie (Steve) Mallonee; grandchildren, Daniel (Christine) Boles, Benjamin Boles, Emily (Buck) Marell, Savannah Purvis and Alex Braddock; a great-grandson, Brayden Boles; and many nieces and nephews. He was preceded in death by his parents, Kennie and Cleo Braddock, and his aunt, Myrtis Howard. Carey was born September 20, 1937, in Jacksonville and was a lifelong resident of Nassau County. Carey’s younger years were spent in Callahan, and he graduated with honors from Fernandina High School in 1955. Carey enlisted in the United States Navy in 1957 and served as an aviation electrician’s mate on P-2V’s. He was honorably discharged as a petty officer third class in 1961. In April of that year, Carey married his sweetheart, Wanda Henderson, and they celebrat ed 59 years of marriage in 2020. For most of his life, Carey was a mem ber of Five Points Baptist Church and recently moved his membership to First Baptist Church in Fernandina Beach, Fla. Carey gave of his time selflessly in many service clubs and orga nizations in Fernandina Beach over the years. He was a member of the Jaycees and the Pirates Club and was a lifetime member of the Kraft Athletic Club. Carey was inducted into the Fernandina Beach High School Hall of Fame in 2014 for exemplary service to FBHS athlet ics for many years, which began in high school when Carey managed the high school football and basketball teams. Carey coached Pop Warner football for several years in the 1970s and was known as “the Voice of the Pirates” after many years of working with his longtime friend, Duane Newsome, in the Pirate baseball and football press boxes. In 2016, the Pirate baseball team honored Carey and Mr. Newsome by naming the press box “Newsome-Braddock Press Box.” Carey was recognized by the Quarterback Club for 30 years of service in the Pirate football booth and was also honored by the FBHS basketball team for his many years of service in the same capacity. For many years, Carey assisted the Isle of Eight Flags Shrimp Festival Committee by supplying corrugated boxes from Container Corporation of America, where he was employed for 42 years before retiring in 1998. Carey was an avid fisherman and hunter. In his earlier years, he enjoyed playing golf and softball and was on a local bowling team. Carey had a quick wit, never met a stranger and always had a big smile and a twinkle in his eye. Carey dearly loved his family, his numerous friends and the Florida Gators. The family received visitors Tuesday eve ning, December 8, 2020, at Oxley Heard Funeral Directors, and Carey’s funeral service is scheduled for 11 a.m. Wednesday, December 9, 2020, at First Baptist Church in Fernandina Beach. A graveside service will be held at approximately 1:30 p.m. at Jones Cemetery in Callahan, Fla. Pallbearers will be Matt Braddock, Mike Braddock, Ryan Braddock, Jim Coleman, Carl Henderson, Ricky Pigg, Allan Reynolds and Chris Smith. Honorary pallbearers will be Paul Boles, David Dubose, Hank Hagans, Stuart Newsome, Matthew Nissen, Billy O’Leary, Herschel Reynolds, Ken Roland, John Shave and Joey Sweat. As an expression of sympathy, the family sug gests contributions to the FBHS Foundation. Please share your memories and condolences at www.oxleyheard.com. r ‚‡ˆ The funeral service for Ruby Lee Brooks will be held at 2 p.m. Wednesday, December 9, 2020, at Bosque Bello Cemetery, 1320 N. 14th St. in Fernandina Beach. The visitation was 5-7 p.m. Tuesday, December 8, 2020, at Funerals by T.S. Warden in Fernandina Beach. Interment will be in Bosque Bello Cemetery. Please sign the family guest book and view the video tribute at www.tswarden.com.    €‰Šˆ‡ William Edward Dobrosky, 90, of Fernandina Beach, Fla., passed away Saturday, December 5, 2020, at Community Hospice & Palliative Care’s Warner Center for Caring in Fernandina Beach, Fla. Bill was born in Stump Creek, Pa., to the late Mike and Mary Tokash Dobrosky. He grew up in Sykesville, Pa., and graduated from Sykesville High School. He later attended Temple University. He loved and served his country in the United States Marine Corps before going to work for Stebbins Engineering and Manufacturing Company. Bill came to Fernandina in 1956 with Stebbins to work at Rayonier. He met and fell in love with his bride to be, Carolyn Sherman. They got married that September at St. Michael Catholic Church and just celebrated 64 years of marriage. Known for being honest, humble and hardwork ing, Bill loved Notre Dame football, golf, walking on the beach and being in the sun. Most of all, he loved his Lord and Savior, Jesus Christ, and his family. In addition to his parents, Bill was predeceased by his son, William “Billy” Michael Dobrosky, and his brother, Michael “Mike” Eugene Dobrosky. He is survived by his wife, Carolyn Dobrosky; his children, Terry Dobrosky, Shawn Dobrosky and Dina (Dobrosky) Martin and her husband, Roger. He was blessed with seven grandchildren and five great-grandchildren. The family plans to celebrate his life with a private ceremony. Please share your memories and condolences at www.oxleyheard.com. r ‹Œ‹r­ Mr. Jan Herbert Johannes Sr., 80, of Jacksonville, Fla., passed away Thursday, December 3, 2020, at Baptist & Wolfson Oakleaf Emergency Room. He was born in Tacoma Park, Md., to the late Dana B. and Elizabeth A. Goodyear Johannes. Jan grew up in Maryland and graduated from Montgomery Blair High School, Class of 1958. His family moved to Clearwater, Fla., shortly after he graduated high school. He met his future wife, Lynne Petelle, in 1961 and they married in 1964. After serving in the U.S. Navy for four years, Jan then went on to work for the Federal Aviation Administration as an air traffic controller for 34 years. Jan’s passions were trains, photography, his tory and his late golden retriever, Colonel. He helped establish and served on the board for the West Nassau Historical Society for many years. He wrote several books about Nassau County and Amelia Island. He leaves behind his loving wife of 56 years, Lynne Johannes; his sons, Jan Johannes Jr. and his wife, Jennifer, and Thomas Johannes; a daughter, Jennifer McLean and her husband, Shawn; grand children, Patrick, Lauren, Jacob and Zachary; and great-grandchildren, Olivia and Savannah. A public service will be at 11 a.m. Thursday, December 10, 2020, in the Burgess Chapel of Oxley-Heard Funeral Directors in Fernandina Beach, Fla. He will be laid to rest at 2 p.m. in Jacksonville National Cemetery later that day dur ing a private family ceremony. The family asks that in lieu of flowers, memorial donations be made in his name to the West Nassau Historical Society, the American Cancer Society or G.R.E.A.T. Rescue of NE Florida Inc. Please share your memories and condolences at www.oxleyheard.com. r ‹rŽ   John Seaton Teller, 75, passed away Tuesday morning, November 24, 2020, at Community Hospice & Palliative Care’s Warner Center for Caring in Fernandina Beach, Fla. He was born June 28, 1945, in New Orleans, La., and moved 35 years ago from Charleston, S.C., to Nassau County, Fla. He had several interesting careers. He had a degree in accounting and was a corporate pilot and air traffic controller. He worked as a controller in several airport towers, including Jacksonville International Airport. After retiring from the Federal Aviation Administration, he worked for RVA as a controller in the Cecil Field tower. He was also a veteran of the U.S. Navy. Mr. Teller loved people and was always will ing to help those in need. He loved his family and enjoyed large gatherings and parties. He was predeceased by his father and mother, Howard Scott Teller and Marion June Von Rosen Teller, and a brother, Paul Teller. Survivors include his wife of 49 years, Barbara Lohr Teller of Yulee, Fla.; his son, Bishop David Seaton Teller (Mikayla) of Jacksonville, Fla.; his daughter, Frances M. Teller of Yulee; and a broth er, Howard Scott Teller Jr. of Charlotte, N.C. A memorial service will be held at 11:30 a.m. Friday, December 11, 2020, at the Church of Jesus Christ of Latter-day Saints, 2800 S. 14th St. in Fernandina Beach. For those who prefer to send a memorial dona tion in lieu of flowers, the family suggests that donations be made to Community Hospice & Palliative Care, 4266 Sunbeam Road, Jacksonville, FL 32257, or online at communityhospice.com. To view Mr. Teller’s online obituary and leave condolences, please visit the Green Pine website at www.greenpinefuneral.com.  ­€r‚€r Businesses must bring a copy of either their utility bill or Florida Division of Corporations 2020 registration to receive free supplies. The provided document must show the name of the business and a Nassau County address. Nassau County businesses that previously received supplies may participate again, and supply distribution is available for every Nassau County business while supplies last. Cases of supplies will be available 8 a.m. to 4 p.m. Monday, Dec. 14, at the Nassau County Chamber of Commerce, 961687 Gateway Blvd., Suite 101-G, in Fernandina Beach. For information about this program, contact the Nassau County Chamber of Commerce at 904-261-3248, NassauCountyFLChamber.com or info@NassauCountyFLChamber.com.rnrn­ n€n‚ƒElderSource, the Aging and Disability Resource Center and Area Agency on Aging for Northeast Florida, announced a meeting of the AAA Board of Directors for 3 p.m. Dec. 14 in the training room at its offices, 10688 Old St. Augustine Road in Jacksonville, to discuss general board business. For information and Zoom meeting details, contact Jessica Del Rio at 904-391-6613 or Jessica.delrio@myelder source.org.rnn nn„rFernandina Beach Rehab & Nursing Center is asking area residents to participate in its Adopt an Angel program to help provide Christmas to its residents. To do so, visit the facility at 1625 Lime St. in Fernandina Beach WRSLFNXSDUHVLGHQW·VZLVKOLVW7KHGHDGOLQHis Dec. 14. For information, contact Activities Director Tammy at 904-261-0771, ext. 123.n…n nn†6HVVLRQVRI1DVVDX&RXQW\·V7HHQ&RXUW will return Tuesday, Jan. 12. Court begins at 6 p.m. but students seeking to be jury mem bers should arrive at 5:30 p.m. to sign in. Teen Court takes place in an actual courtroom at the Robert M. Foster Justice Center, 76347 Veterans Way, Yulee. Teen Court is a program in which teen volunteers have the opportunity to participate in a courtroom experience run by teens for teens. Teen Court allows actual youthful offenders who plead guilty to a misde meanor crime to have their cases heard by a jury of their peers. Teen volunteers also serve as prosecuting and defense attorneys, bailiffs, court clerks, and jurors. A volunteer attorney presides as the judge and is the only adult directly involved in the proceedings. Cases are referred to Teen Court by law enforcement through juvenile civil citations for first-time misdemeanor crimes that have been deferred from Juvenile Court. Volunteers ages 11-18 will gain hands-on experience with the legal process and become familiar with the court system as they learn about various career opportunities. Participants will also earn three hours of community service. For information or if your teen would like to participate, contact Nancy Beasley at 904-548-4611 or nbeasley@nassaucountyfl.com.

PAGE 3

Hand and wrist pain can get in the way of everything you love to do. How do you know when it’s time to see a doctor? Why live with hand and wrist pain? Call us today for an appointment at Baptist Nassau. 904.JOI.2000 (564.2000) © Baptist Health If you’re experiencing any of these symptoms, you could make your hand or wrist pain worse by waiting: Swelling Numbness or tingling Feeling a painful pop New deformity Finger gets stuck David Taormina, MD, with Jacksonville Orthopaedic Institute, is an expert in hand and wrist conditions, offering pain management, physical therapy, non-invasive and minimally invasive procedures.If more advanced treatment is needed, there are innovative new options that could speed your recovery and help you take a “hands-on” approach to life again.Dr. Taormina is conveniently located here at Baptist Nassau, 1348 18th St. South, Suite 320B, Fernandina Beach, FL 32034. r David Taormina, MD Question: I am planning on having my boyfriend of one year move into my house. What should we talk about before he moves in? Answer: It sounds like this is a significant step forward in your relationship and can be an exciting new phase in your life. However, this decision should not be taken lightly. Ask yourself these questions. Is this a step toward a bigger goal, such as engagement and marriage, or do you view this as the end game? Do you think living together is a test for a successful marriage? Why are you doing this now? A healthy and robust relationship means acting with intention and not because it is easier, convenient or comfort-able. Today, younger couples living together before an offi-cial engagement (it is not an engagement without a set date of marriage) seem to slide into this level of commitment with-out deciding how they want to share future common goals. Here are some topics for discussion. Financial: Share your financial situations, including income, debts, expenses, credit scores, student loans, assets like savings and investment. Do you know his financial situation? You do not want to learn your partner has had a prior bankruptcy or fired from several jobs. Share any fears and worries about money. Talk about what you can afford and decide how to split expenses. Splitting expenses: Since it is your home, I suggest you manage this by col-lecting his share of the household expenses each month, and you pay the bills, so they get paid on time. Think of your monthly rent/mortgage, monthly association fees, home/renter’s insurance, estimate utility bills, groceries, Internet service, pet expenses, etc. This does not mean you need a joint bank/checking account. I recommend you keep your own bank account, credit card, checking account. In other words, do not co-min-gle your money yet. What stays and what goes: Together, decide what furniture, kitchenwear, art, books, etc., you will save, sell, toss or donate. Household responsibilities: Who will be responsible for trash removal, clean toilets and floors, lawn care, grocery shopping, cooking, cleanup. Pet policy: If there is a pet, who will be responsible for pet care and medical bills? Where are the pets allowed to go? Couch, bed, kitchen coun-ter, etc.? Weekly couple check in: Schedule a 20-minute couple check-in time each week to discuss your relation-ship, both the positive things in your relationship and the things that need improvement. These check-ins prevent anger from building up. Make this a regu-lar time each week. Let each other know they are the most important person to you by starting the check-in by telling each other why you appreciated them that week. Be specific. For example, I enjoyed it when you cooked something special on Friday. I appreciated it when you picked up dessert for din-ner. I appreciated it when you took my dog for a walk when I worked late. Tip: Many things about your relationship will change once you live together. You might believe you know all there is about him already; however, once you live togeth-er, different conflicts will occur and weird habits that you did not notice or overlooked before may surface. Resource: The Preengagement cohabitation effect: A Replication and Extension of Previous Findings in the Journal of Family Psychology: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5956907 Janice Clarkson, Ed.D., a Fernandina Beach resident, is a Licensed Mental Health Counselor and Certified Addiction Professional, Certified Addiction Counselor, and Certified Pod Yoga Instructor. Readers with confidential ques-tions may e-mail her at jjclark-son@earthlink.net. rn METRO CREATIVE CONNECTION Before a significant other moves in, be sure to plan ahead by organizing financial and household responsibilities.  Holiday lights and décor bring feelings of joy, positivity and happiness – and that’s why many Floridians brighten up their homes with festive decorations each year. Between lighting, special décor and home cooked meals, the holidays are a time when cus-tomers may use more energy than usual, especially while spending more time at home due to the pandemic. The holidays are a great time to add some extra flair to your home, but it’s important to con-sider energy usage while deco-rating. For example, an animated snow globe running for a month can add nearly $15 to your energy bill, while many decorations use no energy at all. Here are 10 easy, safe and affordable ways to save money on your home’s energy bill. Day One – LED is key: LED lights may be more costly upfront, but will save you money through-out the holiday season. LED lights use 80% to 90% less energy and can last 10 times as long as stan-dard incandescent bulbs. Day Two – Check the rating in case your lights need updating: Ensure that outdoor lighting and extension cords are UL-rated (meet nationally recognized safety and sustainability standards) for exterior use. Never use indoor lights outside – although using outdoor lights inside the home is fine. Day Three – Set it and forget it: Use automatic timers to control how long you are running your lights or holiday inflatables each day. The fewer the hours, the less energy you’ll use. Day Four – Be bright when using lights: Save up to 30% by using smart power strips to plug in your holiday lights and décor. Day Five – Forget the inflatable décor and get crafty: Although large inflatable decorations are fun, they can be some of the most expensive holiday decorations in terms of energy usage. Instead, opt for an activity for the kids and make your own wreaths, ribbons or ornaments – all festive decora-tions that require no energy. Day Six – Give the gift of savings: If you’re doing a virtual gift exchange this year, ship loved ones and friends energy efficient gifts like a smart thermostat, a solar portable charger or a LED desk light. Day Seven – Keep your home cool when the cooking gets hot: Using smaller appliances like the microwave or toaster oven instead of the stovetop saves money on energy usage – they don’t heat up your house as much as larger appliances. When using your oven to check on your holiday dishes, use the oven light instead of opening the door to peek. Day Eight – Unplug to save energy and be present: Your TVs, game systems, routers and cable boxes are probably getting a lot of use right now. Unplugging elec-tronics after each use allows you to be present in the moment and save a couple of bucks on your bill. Day Nine – Make your A/C work smarter not harder: Did you know that each degree you increase your A/C can save up to 5% on cooling costs? Also, don’t forget to keep doors open – keep-ing doors closed can block airflow and make your A/C work even harder. Day 10 – Become an Energy Star saver: If you’re investing in larger appliances or electronics this holiday season, select mod-els that are Energy Star-rated as they’ll use 40% less energy than comparable models. Andre Sowerby-Thomas is Florida Power & Light’s Home, Business and Energy Solutions and Ask the Expert residential expert. rn r

PAGE 4

Harris Teeter grocery shoppers and south island motorists are receiving an early holiday gift today with the opening of the new Harris Teeter Fuel Center at the intersection of South Fletcher Avenue and First Coast Highway (A1A). Harris Teeter bought the Marathon gas station, formerly located at the site, earlier this year, and it has been closed since September for renovations. The new Amelia Island Harris Teeter Fuel Center includes a full-size convenience store and eight fuel pumps on four fueling islands, with a selection of various grades of gas as well as diesel fuel. Online articles describe typical Harris Teeter Fuel Centers as including a building of about 450 square feet, which would make this one unusually large for the company. For Harris Teeter grocery shoppers, the new station means they will again be able to redeem their Harris Teeter Fuel Points, now much more conveniently as they leave the parking lot of the grocery store, located in the Shops at Amelia Market, 4800 First Coast Highway. For south island motorists, it means there are again two gas stations on the south end of Amelia Island, and a second convenience store as well. The station represents the second major investment Harris Teeter has made on Amelia Island since 2018. In February of that year, Harris Teeter com-pleted the expansion of its store by 17,000 square feet to more than 54,000 square feet and added a number of new features, including a Starbucks café and a pharmacy. For weeks, the News-Leader had been told by employees of the Harris Teeter grocery store – including management staff – that the new Fuel Center would open today. This would allow Harris Teeter customers to use accrued fuel points to purchase gas at discounted prices on the island, which they have not been able to do since Harris Teeter’s contract expired more than a month ago with the BP gas sta-tion near Pogo’s Kitchen res-taurant on First Coast Highway some two miles south of the Harris Teeter store. The News-Leader also has been told the building needed total renovation before it could be reopened. The convenience store building previously includ-ed a Subway food outlet with a separate entrance. But the NewsLeader has been told Harris Teeter does not have immediate plans to lease that space. Company spokeswoman Dana Robinson confirmed the store will open today with a “soft opening.” The very first Harris Teeter Fuel Center came to the com-pany as part of the 2013 acquisi-tion of a group of Piggly Wiggly stores in the Charleston, S.C., area. In 2015, the company built its first fuel center adjacent to a Harris Teeter store in Fort Mill, S.C.. Today, the company oper-ates more than 50 fuel centers throughout Delaware, Maryland, North Carolina, South Carolina, Virginia and now Florida. Normal Harris Teeter Fuel Center operating hours are 6 a.m. – 10 p.m., and the pumps are operable 24 hours. According to online news reports, typical Harris Teeter Fuel Centers offer customers $0.03 off per gallon every day with the use of the company’s VIC card and grand opening events feature a $0.20 off per gallon discount. According to the corporate PR staff, the local grand opening event has not yet been scheduled. Harris Teeter grocery shoppers can redeem Harris Teeter fuel points for discounts at the fuel pump of any Harris Teeter Fuel Center. Grocery shoppers earn one fuel point for every dol-lar they spend when shopping at a Harris Teeter grocery store and using their VIC card. Every 100 Fuel Points earned saves $.10 per gallon on fuel purchases at Harris Teeter Fuel Centers and participating BP and Amoco gas stations, up to 1,000 points or $1 per gallon (maximum of 35 gallons). There is no limit to the number of Fuel Points earned in a month. Craig Rosenblum, a partner at retail consultancy Willard Bishop, was quoted in a September 2015 Convenience Store News article about grocery chains adding gas stations as say-ing, “Any way you could extend reach to the consumer and drive value … the more loyal they’ll become to you. Most retailers tend to do very well with gas stations and tend to boost their profits by incorporating gas sta-tions.” The article said, “Rosenblum added that some roadblocks exist in adding gas stations, like space and zoning issues, as well as competitive pricing against nearby stations. However, he noted that’s probably not enough to discourage grocers from add-ing them. There is also a conve-nience factor in having a gas sta-tion right there when customers are leaving the parking lot.” Headquartered in Matthews, N.C., Harris Teeter is a wholly-owned subsidiary of The Kroger Co. (NYSE: KR), the largest grocery retailer in the country. Harris Teeter was co-found-ed in 1960 by North Carolina grocers W.T. Harris and Willis Teeter. Harris Teeter originally operated three stores in the greater Jacksonville area when the com-pany expanded into that market in the late 1990s. However, the only store that remains open is the store at Shops at Amelia Market, making it Harris Teeter’s only Florida location. In addition to its retail stores, Harris Teeter also owns grocery, frozen food, and perishable dis-tribution centers in Greensboro, N.C. and Indian Trail, N.C., as well as a dairy in High Point, N.C. Harris Teeter has about 30,000 employees. r Nassau Fence & Deck, Inc.INSTALL AND REPAIR(904) 261-6577 www.fencenassau.com Deer Walk Shopping Center next to Dave Turner Plumbing474378 East State Road 200 (A1A) 904.310.6915BEST FLAVORS & BEST PRICES PREMIUM VAPEE-CIGSMODSCOILSE-JUICEWARNING: This product contains nicotine. Nicotine is an addictive chemical. Preserving and Protecting the Public Trust VETERANS ASSISTANCEBob Sullivan1DVVDX&RXQW\9HWHUDQV·6HUYLFH2IÀFHU76347 Veterans Way, Yulee, FL 32097 904-548-4670 | 800-958-3496 | 904-548-4539bsullivan@nassauclerk.com | www.nassauclerk.com Louis A LlerandiAgency OwnerLlerandi Agency474384 E State Road 200Fernandina Beach, FL 32034H_Û\^2)-&,*)&,1),<^ee2)-&-,)&,2*)?Zq2)-&-+,&1).,lallerandi@farmersagent.com LLERANDI AGENCY FIND THE RIGHT BUSINESS FOR THE JOB RIGHT HERE! LOCAL BUSINESS BILLBOARD Contact Your News-LeaderAdvertising Salesperson for Details On Including Your Business On the Business Card BillBoard261-3696 Amelia Island & Nassau County’s #1 Property Management Company! ATTENTION PROPERTY OWNERS AND INVESTORSWe presently have major demand for potential tenants seeking housing on Amelia Island & Nassau County. This is an opportunity to sign leases with quality tenants at top rental rates! CALL US WE CAN HELP! Justin Miller Senior Property Manager, Broker Associate, Realtor® 904-277-6597 As your Property Manager we will....t Eectively market your vacant property t Thoroughly screen each prospective tenant t Enforce the collection of rents t Manage maintenance & emergency repairs 24/7 t Provide you with paperless monthly statements & rent distributionst Perform routine inspections of your property t Give you the peace of mind & personal attention you deserve! Sales Rentals Property & Association Management 1880 South 14th St, Suite 103, Amelia Island, FL 32034 galphinre.com We continue to have major demands for potential tenants seeking housing on Amelia Island & Nassau County. This is an opportunity to sign leases with quality tenants at top rental rates! CALL US – WE CAN HELP!Nip Galphin 904-277-6597 THE SCHOOL BOARD OF NASSAU COUNTY, FLORIDA NOTICE OF INTENT TO REVISE 3.45 — Salary Payments In compliance with the Administrative Procedure Act, Chapte r 120, Florida Statute, a public hearing may be held if requested within twenty-one (21) days of this notice at the place, time, and date indicated below:Place: Nassau County School Board 1201 Atlantic Ave. Fernandina Beach, FL 32034 Time: 6:30 P. M. Date: December 10, 2020 1RVLJQLÀFDQWHFRQRPLFLPSDFWLVDQWLFLSDWHGCopies of the Administrative Rules and amended policies are ORFDWHGLQDOOVFKRROVDQGWKH6FKRRO%RDUGRIÀFH n r TALLAHASSEE – While the number of Latinos entering col-lege in Florida and across America is increasing, new research shows many lag behind in completing their studies compared with other student groups. A report from Unidos U.S. and the University of North Carolina finds an aversion to debt is the main reason for the com-pletion gap between Latinos and students of other ethnic groups. But Deborah Santiago, CEO at Excelencia in Education, said the study finds Latinos who enroll in community and four-year col-leges also face cultural and finan-cial obstacles to earning a degree. “There are a lot of institutional barriers, or opportunities for institutions to change the way that they serve this population, rather than expecting that it’s the students themselves that need to change in order to meet the goals that we have,” Santiago said. The study found a high percentage of Latinos entering col-lege are the first in their families to enroll, and in addition to finan-cial pressures, they feel an obliga-tion to help support their families. Santiago said nationally, 22% of Latino students who enroll in college complete their education, compared with 46% for non-Lati-no Americans. “Too often I hear this expression that, ‘It’s our culture that creates a barrier,’” she said. “The assumption is that there’s an either/or – that we forgo our families to serve our own needs and success, rather than it’s the family unit that’s engaged in the educational experience.” Latinos surveyed listed the main reasons for not graduating as running out of money to fin-ish college, being unable to take on more debt, a sudden change in finances or returning to work to support their family. “There are some signs there that we have to prioritize, to the extent that we’re having to choose between education and economic sustainability for our family,” she said. “Those are hard choices institutions of higher education have a role in trying to address.” The report recommends colleges adopt programs to assist Latino students in navigating the financial landscape and adjusting to the academic and social chal-lenges they’ll face in completing their studies. rnnnnn rr JOHN SCHAFFNER/FOR THE NEWS-LEADER A Harris Teeter Fuel Center opens today at the intersection of South Fletcher Avenue and First Coast Highway. The Fuel Center will include a convenience store and eight fuel pumps, and Harris Teeter grocery shoppers can receive discounts at the Fuel Center by redeeming Harris Teeter Fuel Points.

PAGE 5

“I go in there and bring home resources to make sure our area is partnered with the state with as many things as we possibly can.” On Monday, Bean was selected as chairman of the Nassau County Legislative Delegation, while Byrd was named vice chairman. The two-man delega-tion has recently alternated the roles each year, Bean said. During the 80-minute meeting, Bean and Byrd listened as local government agencies requested funding for special projects. Several representatives noted funding requests that were granted in the 2020-21 fiscal year budget but were eventually vetoed by Gov. Ron DeSantis due to economic concerns stemming from the impact of COVID-19. “When the full numbers come out, it’s going to be a challenge,” Bean said. “People don’t realize our numbers. Our budget has been growing a billion dollars or two billion dollars at a time. Not only is it not going to be growing, there’s a chance we may shrink the budget from the previous year.” Byrd served on the state House Appropriations Committee during the last term. He said navigating this year’s budget will be challenging but not impossible. “It’s priorities,” he said. “Unlike the federal government, at the state level we can’t print money. ... We have to look at the budget and try to meet the needs government is required to do – our schools, our courts, those core government functions. After those are met, we look at those vulnerable populations. That’s really where my focus is – those people who truly can’t do for themselves and how do we meet their needs.” Byrd said he’s also focused on Florida’s economy. “People have to put food on the table,” he said. “They have bills to pay. They have mortgages. They need to put shoes on their kids’ feet. That has been one of my focuses over the past year and going into the next ses-sion – keeping the economy open while protecting people.” Bean said one of the bigger infrastructure concerns he heard Monday was about County Road 121. Nassau County Commissioner Thomas Ford noted the 40-mile road that connects Georgia with U.S. 90 in Duval County needs resurfacing that is estimated to cost $18.9 million. “We’re asking for some guidance and some help and maybe some direction,” Ford said during the delegation meeting. Bean noted that if the county paid to resurface the road, it would “gobble up the road bud-get” for five or six years. “We want to get the state to help cover that so other roads can be paved and maintained,” Bean said. “We have to figure out a way. That’s a big one. We’re talk-ing to (the Florida Department of Transportation) about it.” NL/PSA REVELATION DESIGN 2383 Jamestown Rd. Amelia Island, FL 32034 904-261-5546 | WWW.REVELATION.DESIGN Your Holiday Design Headquarters Decorating Services Outdoor Lighting Poinsettias Fresh Wreaths Artificial Wreaths Mailbox Swags Ribbon / Bows Artificial Trees Christmas Cactus Amaryllis Norfolk Pine Gift Ideas RESTORE & PROTECT THE DUNES TODAY FOR YOU & THE COMMUNITY! For more information on above services contact: 904.760.6358 ghopf@eco-pathways.com www.dunessciencegroup.comProudly Partnering with Lawn and Order Lawn Care Dune Restoration Services offered include:Invasive Plant Removal Temporary Sand Fencing (AATDs) Installation Native Vegetation for Dune Development Native Flowering Plants for the Grey Dunes FDEP permitting for the above.. Enhance the Protective and Habitat Value of your Dunes! Build a Dune Walkover that will add value to your property for a lifetime!Environmentally Friendly Long Lasting Maintenance Free Dune Walkovers and more! Featuring 100% Composite Structure NO Toxic Wood NO Splinters NO Painting NO Staining And NO Replacing Rotted Boards! Dayspring Village is seeking volunteers to help share the gift of Christm as with the mentally ill residents. Often the holidays are the toughest time of the year for the mentally ill and each year the gift of the giver makes a life changing impact on the lives of these individuals. 3 1 st Annual Dayspring Village Secret Santa Program WE NEED YOUR HELP! Dayspring Village is a state licensed limited mental health assisted livi ng facility that is focused on serving the needs of adults with schizophrenia. If you would like to l earn more or we can be of any assistance, please contact:Douglas D. Adkins, Administrator at 904-583-0134 or doug@dayspr ingvillage.org Please consider becoming a volunteer this Christmas season, the gift yo u make in the life of others will truly change lives around you. How to get Involved: 1. Call Ashley T. -Secret Santa Coordinator -904-845-7501 or email her at ashleyt@dayspringvillage.org 2. You will be assigned a resident and their “wishes”. 3. Have your gift wrapped and back to the facility by December 22nd . 4. Baking – If you like to bake we would love to have you sponsor the evening snack for the residents 5. Music – if you have a musical talent you would like to share we invite you to come and perform!AL#5766 God Bless and Merry Christmas! and conductor of our group, guiding us toward our goal of preserving the future of our past. Through the good times and the hard times, Jan kept us on schedule and on track toward that goal. He will be sorely missed.” Johannes had recently completed an HO scale train set for his great-granddaughters’ enjoy-ment. “He had a great deal of love for his grandchildren and his two great-granddaughters,” hi wife, Lynne Johannes, said. Historical society member Jerry Peterson described Johannes as “our local living history legend” in his memorial tribute. “You were a good friend, teacher, mentor, fellow historian and inspiration to me,” Peterson noted on social media. “I will miss your great sense of humor, too. Rest in peace boss.” Historical society treasurer Emily Baumgartner found Johannes to be an inspiration. “He was one of the main historians of Nassau County,” she said. “He was one of the main ones who got me started in history and preservation. I liked the way he presented his-tory.” His writing and photography talents led him to trek into many neighborhoods and natural settings within the county. “He found that there was a lot of undiscovered history in Nassau,” his son, Thomas Johannes, said. “That’s why he delved into it, because there was so much there.” “He loved talking to people and their families,” Lynne Johannes recalled of the time he spent conducting historical research, retracing the water-ways and landmarks of Nassau. He wrote several books, including Yesterday’s Reflections: Nassau County, Florida and Yesterday’s Reflections II, Nassau County, Florida. He began work on the first book in 1973. According to an article in the Oct. 9, 1975, Nassau County Record, Johannes assisted Nassau County Agent Jud Fulmer in detailing the history of Nassau’s pioneer farmers for a bicentennial agricultural com-memoration. “This fellow has for two years literally criss-crossed every mile of Nassau County and left no stone unturned,” Fulmer wrote. “He has been in every nook and cranny and scratched around every pos-sible resource and interviewed hundreds of people. Lord only knows how many hours he has devoted to his pursuit.” Fulmer noted that Johannes was new to the area, but dedi-cated to preserving the county’s heritage. “Mr. and Mrs. Johannes are among some of the very fine newcomers who have a genuine desire to improve their community and county,” Fulmer wrote. “Their record of civic service is commendable and they have devoted themselves unselfishly to many worthwhile projects.” Johannes also wrote and photographed Tidewater Amelia: The Interiors of Historic Homes and Buildings. The book features the architecture of Amelia, Cumberland Continued from page 1A and Fort George islands and St. Marys, Ga. Amelia Island Museum of History Executive Director Phyllis Davis recalled his wiliness to share his knowl-edge with others. He provided the text for Sketches of Amelia Island and Fernandina Beach featuring artist William Maurer. The artist also created several posters for the annual Railroad Day Festival. “Jan Johannes was a true historian and a man of action,” Davis noted. “His passion for history was evident in his support of both the West Nassau Historical Society and the Amelia Island Museum of History. He was a mentor and a friend to many of us who are a part of the Nassau County history community and will be greatly missed.” Funeral services are 11 a.m. Thursday under the direction of Oxley-Heard Funeral Directors in Fernandina Beach. The U.S. Navy veteran will be laid to rest in the Jacksonville National Cemetery in a private family ceremony at 2 p.m. SCOTT J. BRYAN/NEWS-LEADER State Rep. Cord Byrd said state leaders will need to pri-oritize essential services of the government as the state continues to experience a shortfall of tax revenue due to COVID-19. Continued from page 1A the federal agency. The spokes-person was asked via email for Koziol’s dates of employment and whether he retired or was terminated, but a response was not received as of press time. According to the report, the victim said he or she was “sexu-ally battered after being made aware of videos that were taken without (his or her) knowledge or permission.” The report said the victim was unclear about the dates of the videos but the victim believes the incidents in the videos “occurred prior to March 2018.” The victim said to his or her knowledge, he or she has “never been intimate with” Koziol, the report said. The report indicates the victim says most of the videos appear to have “taken place at ... (a) residence in Italy.” But one video, the report says, was filmed in Nassau County. “The victim described the clothing that (he or she) is wear-ing as clothing that is not worn by (him or her) in Italy due to the colder climate,” the report said. “The victim also said the bed that is depicted in the video is not located in Italy. The bed is referred to as a ‘Rice Bed’ and has not been at the residence in Italy.” According to the report, the victim worked with the Fernandina Beach police offi-cials to conduct a “controlled call,” in which officers listened and recorded a phone call with the suspect. During the call, the suspect “admitted to the sexual battery,” the report said. According to the report, the victim asked the suspect, “You forced yourself on me?” and Koziol said, “Yes.” According to the report, law enforcement officials inter-viewed a man who has worked with the suspect. During anoth-er controlled call, the suspect admitted to the co-worker that he “drugged” and “sexually bat-tered” the victim at the co-work-er’s Nassau County residence. According to the report, Koziol was arrested Nov. 25 when he turned himself in to police headquarters, 1525 Lime St. in Fernandina Beach. His bond was set at $75,002. Fernandina Beach Police Chief Jim Hurley referred ques-tions to the “lead investigator on the case,” Detective Michelle Arseneau, who did not return phone calls as of press time. Continued from page 1A r rn   ­­€r ‚­ƒƒ­­„  … †n„‡„ˆ ­ ­ „‰

PAGE 6

NOTICE OF PUBLIC HEARING CITY COMMISSION CITY OF FERNANDINA BEACH NOTICE IS HEREBY GIVEN that a Public Hearing is scheduled for Tuesday, December 15, 2020, at 6:00 PM in the City Commission Chambers, 204 Ash Street Fernandina Beach, Florida to consider the following application: ORDINANCE 2020-43AN ORDINANCE OF THE CITY COMMISSION OF THE CITY OF FERNANDINA BEACH, FLORIDA, ANNEXING APPROXIMATELY 0.50 ACRES OF LAND LOCATED AT 3001 S. 14TH STREET CONTIGUOUS TO THE CITY LIMITS; PROVIDING FOR SEVERABILITY; AND PROVIDING FOR AN EFFECTIVE DATE.ORDINANCE 2020-44AN ORDINANCE OF THE CITY COMMISSION OF THE CITY OF FERNANDINA BEACH, FLORIDA, ASSIGNING A FUTURE LAND USE MAP CATEGORY OF LOW DENSITY RESIDENTIAL (LDR) FOR 0.50 ACRES OF LAND LOCATED AT 3001 S.14TH STREET; PROVIDING FOR SEVERABILITY; AND PROVIDING FOR AN EFFECTIVE DATE.ORDINANCE 2020-45AN ORDINANCE OF THE CITY COMMISSION OF THE CITY OF FERNANDINA BEACH, FLORIDA, ASSIGNING A ZONING CATEGORY OF LOW DENSITY RESIDENTIAL (R-1) FOR 0.50 ACRES OF LAND LOCATED AT 3001 S. 14TH STREET; PROVIDING FOR SEVERABILITY; AND PROVIDING FOR AN EFFECTIVE DATE.Interested parties may appear at said hearing and be heard as to the advisability of any action, which may be considered. Any persons with disabilities requiring accommodations in order to participate in this program or activity should contact 310-3115, TTY/TDD 711 or through the Florida Relay Service at 1-800-955-8771 at least 24 hours in advance to request such accommodation.IF ANY PERSON DECIDES TO APPEAL ANY DECISION MADE BY THE BOARD/COMMISSION WITH RESPECT TO ANY MATTER CONSIDERED AT SUCH HEARING, S/HE WILL NEED TO ENSURE THAT A VERBATIM RECORD OF THE PROCEEDINGS IS MADE, WHICH RECORD INCLUDES THE TESTIMONY AND EVIDENCE UPON WHICH THE APPEAL IS TO BE BASED.Copies of the applications with description by metes and bounds and the ordinance can be obtained in the office of the City Clerk, City Hall, 204 Ash Street, between the hours of 8:00 AM – 5:00 PM, Monday through Friday. For information on the application, please contact ma^LmZ__h_ma^
PAGE 7

rrn The future of the city-owned golf course and related facility is finally receiving some much needed attention and discussion. I have played at the “City” for about 15 years and have enjoyed the courses, facilities, personnel and fel low players. The city needs this golf course just as much as it needs the swimming facilities, the parks, the marina, the airport and other city-owned and operated ventures. The golf course is an important part of the community. It is not an overstatement that golf offers the community an opportunity for outdoor recreation and offers the youth of the island the chance to learn the important social les sons the game offers, such as personal responsibility and sportsmanship. An important part of the discussion has been the financial underpinnings of the golf course and its facilities. Clearly, the mission of the golf course must be agreed upon – what does the city want from the golf course? The financial management will naturally follow that directive. The course requires maintenance and upkeep just as any of the properties the city owns. The public would not accept leaking swimming pools, broken equipment in the parks, an unkempt marina or potholes in the runways of the airport. The golf course needs a similar commitment to its maintenance and repair. Part of the discussion should be to prioritize the projects the golf course requires and build those into a reasonable and attainable operating budget. A golf course management team that shows a willing ness to improve the day-to-day experience of the golfer will bring in new players and increase the level of play from the current playing base. Golf is by definition an outdoor sport. In this age of COVID-19, golf is a reasonably safe way to enjoy some exer cise, fun and camaraderie. I think the city would like to offer such an option to its citizens. As to the usage of the clubhouse and its facilities, a plan to market its capabilities and availability may increase its usage. The facility is very welcoming and could provide a venue for many different events once we, as a nation, put this horrible COVID-19 experience in our past. I believe the large group of players who consistently play golf at the “City” would support any reasonable effort by the city to put the golf course back on track and make it the attractive offering it should be to the community. Fenton Markevich Fernandina Beach nn By the time you read this about 3,000 Americans will be dying each day. That is how many people died on Sept. 11. We remember that day when our nation was in shock – when we cried, lit candles, prayed and mourned as a nation. Are we crying or mourning now? No. We have taken for granted, as a normal occurrence, that today, tomorrow and the next day another 3,000 fellow Americans will die, mostly alone without the support of loved ones. Are we in shock yet? No. Has anyone come to grips with the fact that by the begin ning of the new year this virus will have killed as many as were killed in World War II? World War II had something going for it, that we, as a nation, are now sorely lacking. The men and women of that time are referred to as the “Greatest Generation.” This name was not solely earned by the men and women who fought the war. No, it was also because of the sacrifices that those at home made to the war effort. The government rationed items such as milk, sugar, vegetables, tires and the list goes on. Women worked in shipyards and aircraft plants for our nation. As a nation, folks stuck together and did what the government asked them to do. Even at war, this was an example of America at its best. Ask yourself, could you have made it through those times? We are at war now. This virus is killing off Americans at the same rate as World War II. Let that sink in, please. What would you call our generation? We yell about having our personal freedom taken away. That is a joke. For those who remember the 1960s, the government gave us a gradu ation present as we left high school. That gift was a little white draft card. Basically, a free ticket to see Southeast Asia. That war took my personal freedom away for years. Whether we wanted to go or not, we went and did what was asked of us. What personal freedom is the government removing from us now? Oh, they want us to wear a mask when we shop. They are asking us to social distance when we are out, and they want us to skip family gatherings and events that will help kill us. Wow, that sure is a lot to ask of us to help fight this war. I have heard from our county government that their con stituents felt mask wearing was unconstitutional. That is nonsense. I have been told masks do not work. That is non sense. I have been told it will take our freedom away. That is nonsense. I have also been told each person should have the right to make their own decisions with respect to mask wearing. That too is nonsense, total nonsense. Everyone does not have the right to drink and drive. That kills people. We do not have the right to drive 75 mph in a 30 mph zone. That kills people. We wear seat belts. We follow laws, which help protect fellow Americans. Our national government has failed us totally when it comes to protecting us. Our state government has failed us, and our county government has failed us. I give our city government credit for having the mettle to issue a mask mandate. Yes, it is unenforceable, but it sets a good example. Many have followed it, and the city has sent out a strong mes sage that their priority is to do whatever they can to keep us, our economy and our tourists safe. The U.S. president has said he is a “war-time president.” Mr. President, we are at war and suffering more casual ties per day than any time in modern history. Where are you? Where is your leadership? It matters not if you are a Republican or a Democrat, both are dying. It is time to do the right thing: To wear a mask and to understand that, out of love for our families, not seeing them this Christmas is the best gift you can give. Folks, we are in a war and we now need each other more than ever. Tony Crawford Fernandina Beach n As long as this pandemic lasts or until the general pub lic become vaccinated, all boards and committees must be allowed to meet remotely. Gov. Ron DeSantis’ order is ludicrous and typical of his lack of concern for people’s health. Brad Moses Fernandina Beach n I vote that Gov. Ron DeSantis should allow local govern ing boards to meet remotely during the COVID-19 pandemic. This virus is life-threatening for many citizens. And this is only for a few more months until we have vaccine. Carol Le Bert Hinnant Fernandina Beach W hile many of us no longer remember as well, we agree on how challenging this year has been. Starting in late February, when we returned from our vacation in Mexico and the pandemic became a terrible reality, everything became more dif ficult. Hoping it quickly would turn around, many of us hesitated to cancel upcoming get-togethers and events. We soon realized while there were diverse opinions on how to handle the pandemic, trying to have events, lunches and dinners was impractical and dangerous. Again, American technology came to our rescue. All of us were gratified when we discovered a substitute in Zoom. While not perfect, at least we could get together virtually and move our lives forward. We had board meetings and social events, and, in October, we met with our University of US students on Zoom and began our new school year. Other organizations began using Zoom to handle meetings, and things were getting accomplished. We also gained an amazing appreci ation for health professionals who con tinue to work unbelievable schedules. Unfortunately, we have not solved the problem of the economy, especially regarding business owners and their workers who are being destroyed. We also have to find a way to get kids safely back in schools. While many adults can adjust regarding work and socialization through Zoom, children need instruc tion and interaction, and their parents need to be freed up. We all wonder what is on the horizon. The election was a big reality check. Not panicked but motivated, voters, who are often disparaged, impressed me. Again, they proved resilient and realistic, and if nothing else, most obviously showed they still believe in our country. It appears a majority of Americans became very tired of President Trump, even though many admired his accomplishments. Even many who voted for him said they did so despite how he acted because they were more afraid of the left wing of the Democratic Party. The proof is in how the voters pushed back at the far left closing the gap in the House of Representatives and turning down socialist ideas, even in states like California. If, as I expect, the Republicans win the Senate runoffs in Georgia, the country will be much closer together than most people thought possible before the election. However you feel about the candidates, it showed me the majority is not looking for a major change in America. The announce ments soon after the election of the coming vaccines were uplifting and sent a message that better times are coming. And then came Thanksgiving, which for me signaled a turning point. For 46 years our family has gone to New Jersey to have a Thanksgiving din ner to celebrate our closeness. This year was different, as we had to “Zoom” what we are thankful for, and as usual, the grandkids stole the show. However, what was evident was that while there is a reality that the pandemic is still with us, and no agree ment on when the vaccine will turn things around, everyone was certain we will again spend next Thanksgiving together. Furthermore, while we are divided regarding whom we want to lead the country, we are together regarding what we want the country to be. We continue to hear we are a very divided nation, but my sense from the election was we are not as divided as some would like us to believe. As James Madison pointed out in the Federalist Papers, there will always be factions, and trying to stop them from developing is futile. What our great republic continues to do is check and balance these fac tions, and in the long run, we move forward. What I find gratifying is that despite the negativity coming from President Trump, the media and many on the far left, the people’s actions were significant. Even many of the people who voted for President Trump know he lost and realize we have to deal with what that means. So as we enter the new year, I see much to be thankful for, not only in our personal lives and where we live, but also in America. The thought I believe we need to keep in front of us is that what we disagree about is more around approaches, not objectives. Getting people to understand that may help them to work more closely in compromising to reach those objec tives. Amelia Island resident Howard Pines has more than 30 years experi ence as CEO, chairman and founder of BeamPines, a premier firm in the executive coaching business. He also co-founded the BeamPines/Middlesex University Master’s Program in Executive Coaching. Prior to that, he served as senior VP of human resources for a Fortune 100 corporation. He is the author of The Case for Wasting Time and Other Management Heresies. O ne of the things I love about living on Amelia Island is that people are friendly and caring. I’m espe cially fond of my neighborhood, the contributors to Amelia Island Writers, and friends through church, volunteering or community activities. As I approach the Christmas giving finish line, I’m aware of thoughtful gifts I have received lately. Most of them were not purchased, but shared a true meaning of friendship. When I was ready to adopt a pet, my friend Kathi offered to accompany me to the Nassau Humane Society to check out the canine, then named Leona, who is my new alarm system. Kathi rode home in the back seat with the terrified, nauseated Leah and brought toys for her “tempo rary visit.” A few days ago, while walking Leah, I heard a fellow dog walker call out, “better hurry home,” as she tugged her canine, while pointing to the dark clouds. Still 15 minutes from home, we picked up the pace as the deluge began. A car pulled up and the window rolled down to reveal my friend, Patty. “What are you doing?” I asked. “Coming to find you. I saw you leaving a while ago and knew you were going to get drenched,” she admitted, motioning to get into her car. Where else would you have a friend come and save you (and a wet dog) from getting soaked? I refused the ride, due to being almost home and the stinky dog factor, but smiled and pondered my good fortune. While writing this, a neighbor texted to offer dinner of homemade soup and cornbread. This isn’t anything unusual here. Other neighbors have shared baked treats, Meyer lemons, vegetables and plant cuttings. A fellow writer was downsizing and passed on an antique pattern glass com pote with a dog finial, knowing I love old glass and dogs. She didn’t know my grandmother’s compote had been broken a few years ago. I cherish this lovely replacement. Former neighbors recently brought me a butterfly garden addition, a pipevine from the local farmers market. They knew I would enjoy attracting swallowtails that feed from and lay their eggs on the vine. My brother helped me with garden planning and plant ing, and brought a slash pine that will provide decades of enjoyment in the neighborhood. Another friend helped me learn to play pickleball, loaning me a paddle and balls for practice. The fact that I planted my face and knees in the court trying to show off on a particularly good return did not deter me; I want to play again. In lieu of exchanging Christmas gifts, a friend and I chose charities and made donations in honor of one another. Others’ gifts of themselves, their time and bounty have encouraged me to do more, not just this season but throughout the year. Katherine Dudley Hoehn is an avid writer and photog rapher who grew up in Florida, spent most of her career in Washington, D.C., and lives in Fernandina Beach. She is an enthusiastic member of Amelia Island Writers and writes at katwritesandsnaps.com/blog. FOR THE NEWS-LEADER The writer’s dog, Leah, is a friendly and sweet companion who also doubles as an alarm system. rrr  r n Hoehn r r The News-Leader is published with pride weekly for the people of Nassau County by Community Newspapers, Inc., Athens, Georgia. We believe that strong newspapers build strong communi ties – “Newspapers get things done!” Our primary goal is to publish distinguished and profitable community-oriented newspapers. This mission will be accomplished through the teamwork of professionals dedicated to the truth, integrity, quality and hard work. rr   n r r  r  r r rnnnnnn nrn rr  rrn rrrnr n  ­

PAGE 8

M y first experience with back pain was after my first 10-kilometer race at age 23. The day after the race, I awoke with severe pain in my low back, radiating into the but-tock. At that point, I had no idea what was wrong, but felt like I had aged 70 years overnight. A visit to my primary care doctor provided a diagnosis of overuse and back strain. The doctor prescribed three days of bed rest, pain pills, muscle relaxants and advice to slow down. That was not encourag-ing, and since I was also an aerobic dance instructor, there had to be another answer. That led to my very first appointment with a chiropractor despite anxiety from all of the stories of “neck cracking” I’d heard growing up. While filling out my history form, I was less than honest on the questions, answering them all with a “no,” other than the acute back pain that brought me hobbling in that day. While waiting in the office, I discovered it probably was sciatica, based on a pamphlet on the rack. Remember, this was before the internet and Dr. Google. To my amazement, after the doctor examined me (and did indeed diagnose sciatica), he was able to pinpoint several other symptoms I purposely failed to men-tion: head-aches, UTIs, frequent sore throats and sinus infec-tions. How did he know all of that just from examining my spine? I was intrigued, and after just one adjustment, I was pain-free and teaching class the next day without any medication, hence a believer was born! In fact, I worked for several years as a chiropractic assistant in St. Louis and Jacksonville Beach, spending serious time considering attending Logan Chiropractic College, but chose nursing school instead. Now, many years later, routine chiropractic maintenance visits are all part of my holistic lifestyle that compliments my background in Western medi-cine perfectly. For those who might be skeptical, chiropractic is a health care profession that focuses on the spine and other joints of the body and the connection to the nervous system. The word “chiroprac-tic” means to “be done by hand.” Doctors of chiropractic spend a minimum of seven years in school and are boardcertified just like medical doc-tors. It is estimated 40 million Americans visit a chiropractor each year. In addition, a doc-tor of chiropractic focuses on prevention, diagnosis and con-servative care of spine-related disorders and other painful joint issues along with wellness coaching and nutritional advice. Many hospitals, including Hackensack University Medical Center and Mayo Clinic Florida, have chiropractors on staff and some have admitting privileges to hospitals. Nassau County has a number of highly trained, skilled chiropractors with excellent reviews. My chiropractor, Dr. Robert Rice of Amelia Chiropractic Clinic, is one of the best I’ve ever met. Dr. Rice has been a chiropractor for more than 20 years and had a unique background prior to becoming a doctor of chiropractic. Years earlier, he worked as a butcher, which gave him a comprehen-sive understanding of muscles and joints, not unnoticed by his professors during his anatomy cadaver classes. He is profes-sional, thorough, humble and doesn’t keep you coming back needlessly. Statistics show one in three people in the U.S experience back pain, and it is the No. 1 disability worldwide. More work is missed from back pain than any other illness. When your back hurts, your quality of life is diminished, and you really don’t want to move. That can quickly lead to a slippery slope of inactivity and a sedentary lifestyle. One of the most effective treatments for back pain is often relieved with Cox Technic (Flexion-Distraction and Decompression Adjusting and Manipulation). Dr. Rice is the only chiropractor within 100 miles certified in this tech-nique. Cox Technic for pain relief works for pain in your neck, arm, back, leg or sciatica. It is a gentle, well-researched, non-forceful, non-surgical spinal decompression procedure that works with the body’s design to encourage its natural healing process. This treatment relieves spinal pain and returns patients to their desired quality of life. Only 3% of the chiropractors in the U.S. are certified in this procedure – a technique that stringently requires recertifying every two years. It is my pre-ferred treatment for occasional neck and shoulder pain. Chiropractic care is often mistakenly referred to as alter-native medicine, but that’s not accurate. It is complementary medicine, working together with traditional Western medi-cine. According to the National Center for Complementary and Integrative Health, almost 40% of adults and 12% of children (including infants) use comple-mentary medicine to stay healthy and to treat chronic or severe conditions. The cost of treatment is less than other types of health care and is covered by most insur-ance plans, including Medicare. Chiropractic was the original holistic medicine because “it focused on treating the whole person, not just the body part that hurt,” said Michael Schneider, an associate profes-sor of health sciences at the University of Pittsburgh. A study published in April 2017 in the Journal of the American Medical Association supports that. Based on the latest research, spinal manipulation can reduce a person’s lower back pain. There are millions of people that can attest to that. Still, there are other findings that might surprise you. Last year, a study in the Journal of Human Hypertension reported on a placebo-controlled study in which researchers found that people suffering from high blood pressure received a particular chiropractic adjustment to C-1 vertebra. The results showed the procedure did realign the vertebra with the rest of the spinal column, and the patients who underwent it showed sig-nificantly lower blood pressure for a sustained period of time. Though it might not work for everyone, and it’s not clear why it works, it is compelling. Chiropractors have very high patient satisfaction rates. According to Schneider, “From a public health perspective, we’d see a lot fewer unneces-sary tests and hospitalizations and opioid prescriptions if peo-ple first visited chiropractors for their back and neck pain.” He points out malpractice and liability insurance premiums for chiropractors are much lower than for physicians or surgeons. “Insurance actuaries aren’t dumb,” Schneider said. “They know that based on the mal-practice data, chiropractors are very safe.” That thought is echoed among Dr. Rice’s patients, including a neurosurgeon who sees him for routine mainte-nance. It is as though he is doing bloodless medicine using his hands instead of a knife. All I know is when I get up from the table after the Cox Technic adjustment, I feel like I am 20 again. If chiropractic treatments can prevent or even postpone surgery for a time, isn’t that science and art at its best? Kym Dunton is registered nurse, certified health coach and fitness instructor who lives on Amelia Island. For questions or comments, email kym.dunton@comcast.net. 277-3942 CFC 1426558 FL CFC 057478–GA MPR 006661 474390 E. S.R. 200 Fernandina Beach, FL 32034 DEERTRACKS We have traveled in our RV for 7 weeks from Tennessee to Punta Gorda with a group of good friends. One lady in our group is from Holland. She was 11 years old when her parents and 4 sisters moved to the USA. Her father had been in a concentration camp. She and her family know the value of freedom. She is someone more people need to talk to. God Bless America. Come by the coffee is on. Your ONE CALL FULL-SERVICE PLUMBING COMPANY is HIRING. Apply in person. 24/7 emergency service, repair, remodel, showroom, counter sales, new construction, residential, industrial needs. Call, come in or email daveturnerplumbing@comcast.net. Like us on Facebook.Unit 400 available for lease. Call Galphin 904-277-6597. ;Zd^kr%Ühp^k%\hglb`gf^gmhklZg]pb\alahi' DEERWALK In Print & Online 904.261.3696 www.fbnewsleader.com Give the gift of local information that keeps on giving throughout the year Order Today!904.261.3696 | fbnewsleader.com The News-Leader Local News, Events & Information Hundreds of Dollars in Weekly Coupon Savings Shopping Circulars & Exclusive Special Offers Local Jobs, Real Estate & Classieds Puzzles, Games, Local Dining & Entertainment Updates & So Much More Subscription Rates * Local New & So Much More Inside Nassau CountyMail and eEdition52 Weeks for $44.99Outside Nassau County Mail and eEdition52 Weeks for $74.99eEdition Only52 Weeks for $49.99 AT NEED CREMATION PRE-NEED PLANNING NO COST CREMATION OPTIONS Lowest Prices for cremation in Nassau County Call for more Information (904) 261-2700 We’ve Moved! CREMATIONS OF NASSAU www.eternityfh.com r n r Robert Burk III, MD | Dr. Chris Bates, MD Amy Kadlubowski, ARNP | Kim Lindsey, Aesthetician r METRO CREATIVE CONNECTION A visit to the chiropractor could help reduce pain without requiring prescription drugs.

PAGE 9

All Florida Soft Water of Nassau Inc.Your locally owned companyDan AverillWater Quality Specialist463155 SR 200 Suite18Yulee, FL 32097321-432-9740 (cell)RIÀFH GDYHULOO#ÁZDWHUVRIWHQHUVFRP ZZZÁZDWHUVRIWHQHUVFRP Best Service, Best Price, Best Company We make insurance easy.904-388-6446 Happy Holidays! II95734 Amelia Concourse(904) 261-6030Serving you and your children since 2003. I1986 Citrona Drive (904) 277-8700 We’ve Moved After 62 years at 511 Ash Street ?ehkb]ZlHe]^lmP^^derG^pliZi^k has moved to 1235 South 10th Street (Corner of 10th and Lime Streets) online at fbnewsleader.com 9042613696 Happy Holidays 2020 ‘Best of e Best’ Winner Merry Christmas! (904) 277-97191505 S. 14th Street 463688 SR-200 #4Yulee, FL 32097(904) 849-705020% OFF purchasewith mention of this ad. Wishing you a Merry Christmas!474362 SR 200 Fernandina Beach, FLExcludes Aer Hours expires June 1, 2021 Diagnostic David Singleton Bandit’s Outback ANTIQUE LIGHTING Repairs & Rewiring 1014 Beech Street Fernandina Beach, FL 910-547-0674 Slinger13@gmail.com 904-388-6446 children since 2003. children since 2003. TALLAHASSEE – Florida Attorney General Ashley Moody secured more than $86 million, including millions in relief for Florida homeowners, fol lowing a multistate investigation into Nationstar Mortgage, the country’s fourth-largest mortgage servicer, according to a news release from the state agency. Moody is joined in the multistate action by 50 attorneys general and other federal and state agencies. “Investing in a home is often the largest financial commitment a fam ily makes – requiring years or even decades of regular monthly payments,” Moody said. “Homeowners deserve accuracy, transparency and fair busi ness dealings in the processing of their mortgage payments and servicing of their loans. Today’s action will ensure improved servicing practices and bet ter transparency for Floridians and homeowners nationwide. I am proud to secure relief for thousands affected by this mortgage servicer’s faulty servicing practices.” The multistate consent judgment, filed in the U.S. District Court for the District of Columbia, along with other resolutions obtained by the state mort gage regulators and the Consumer Financial Protection Bureau, provides about $80 million in relief affecting more than 55,000 loans nationally. It covers conduct by Nationstar occurring from Jan. 1, 2011, until Dec. 31, 2017, and resolves allega tions that Nationstar, which does business as Mr. Cooper, vio lated consumer protection laws during its servicing of mortgage loans. Under the proposed settlement, direct payments from a fund of more than $6.4 million will be available to eli gible borrowers, including those: Who lost homes to foreclosure after a service transfer to Nationstar; or Who were improperly locked out of their homes during a property inspec tion. A separate fund exceeding $15.6 mil lion will go to borrowers for impermis sible increases in mortgage payments. An agreement administrator will send claim forms to eligible borrow ers in 2021. Nationstar has already pro vided some of the relief outlined in the agreement. Submitted by the Florida Attorney General’s Office. Michael Miller of the News-Leader compiled this report from records at the Nassau County Clerk of the Circuit Court. Arrest indicates suspicion of a crime, not guilt. To report information about a crime, contact the Fernandina Beach Police Department at 277-7342 or the Nassau County Sheriff’s Office at 225-5174. The “We Tip” program – 1-800-78Crime – also allows callers to leave anonymous tips. Q Addison Clare Ortiz, 27, 1017 S. 19th St., Fernandina Beach, Nov. 23, possession of heroin, possession of alprazolam and possession of drug para phernalia with residue. Q Laquavious Lester Hooper, 29, 1016 S. Ninth St., Fernandina Beach, Nov. 23, possession of a weapon by a convicted felon. Q Eric Jemere Greene, 33, 212 S. 13th St., Fernandina Beach, Nov. 24, fraudulent use of a credit card. Q Keith Edward Kral, 27, 3742 Hawk Drive, Hilliard, Nov. 24, battery on a detailed person. Q Christopher Andrew Thornton, 25, 202 C.R. 303, Palatka, Nov. 24, battery on a detailed person. Q Alex Ary Lee, 33, 11558 Raft Road, Jacksonville, Nov. 24, burglary of an unoccupied dwelling, theft from a dwell ing, possession of methamphetamine, possession of a weapon by a convicted felon, resisting arrest without violence, possession of less than 20 grams of mari juana and possession of drug parapher nalia with residue. Q Cody Austin Lloyd, 25, 1554 Griffin Road, Baxley, Ga., Nov. 24, robbery with a weapon, aggravated battery and theft. Q Skylar Lee Eliason, 27, 1447 Holly Drive, Fernandina Beach, Nov. 24, petit theft, possession of a controlled sub stance and possession of drug para phernalia. Q Jessica Ann Parramore, 35, 1447 Jan Lane, Jacksonville, Nov. 25, grand theft from a person 65 or older, posses sion of heroin and possession of drug paraphernalia with residue. Q Rodney James Stone, 35, 1435 Jan Lane, Jacksonville, Nov. 25, possession of heroin and possession of drug para phernalia with residue. Q Anthony Koziol, 71, 96061 Stoney Drive, Fernandina Beach, Nov. 25, sex ual battery on someone older than 12 years of age. Q Tammy Suzanne Wingate, 51, 85239 Haddock Road, Yulee, Nov. 26, aggravated battery with a deadly weap on. Q David Allen Fowler, 36, 94085 Duck Lake Drive, Fernandina Beach, Nov. 27, possession of cocaine, posses sion of methamphetamine, possession of less than 20 grams of marijuana and possession of drug paraphernalia with residue. Q Michael Lee Johnson, 32, 85483 Duane Road, Yulee, Nov. 27, burglary with more than $1,000 in damage, retail theft, using a weapon during a criminal offense, carrying a concealed weapon without a permit and providing false information to a law enforcement officer during an investigation. Q Mitchel Francis Jones, 34, 12923 N. Oregon Ave., Tampa, Nov. 28, pos session of a controlled substance, DUI and refusing a Breathalyzer test. Q Craig Austin Charles Sowell, 22, 55499 Yellow Jacket Drive, Callahan, Nov. 29, carrying a concealed firearm without a permit. Q Jessica Lynn Skipper, 32, 96152 Will Young Road, Yulee, Nov. 29, pos session of methamphetamine. Q David Deloy Wyatt, 20, 28139 Vintage Lane, Hilliard, Nov. 29, false imprisonment and simple battery. Q Robriquez Qonte Strange, 22, 619 Vernon St., Fernandina Beach, Dec. 1, possession of a controlled substance with intent to sell, possession of drug paraphernalia with residue and felony violation of probation. Q David Wayne Adams, 33, 96147 Long Island Place, Fernandina Beach, Dec. 1, two counts of felony battery with a prior conviction and one count of depriving 911 communications. Q Patrick Edward Tullius, 49, 2955 First Ave., Fernandina Beach, Dec. 3, felony domestic battery with strangula tion. rn The following report was compiled by Michael Miller of the News-Leader from the Dec. 3 court docket of the Circuit Court for Judge James H. Daniel. Q Sean Allen Achas pleaded no contest to grand theft of a motor vehicle. He was adjudicated guilty and sentenced to six months in Nassau County Jail with credit for time served. He owes $418 in court costs, $100 to the State Attorney’s Office, $150 to the Public Defender’s Office and $511 in restitution. Q Travis Charles Baker pleaded not guilty to burglary to a structure or conveyance and petit theft. Q Benjamin E. Browning denied violation of probation for possession of heroin, possession of controlled substance paraphernalia, possession of less than 20 grams of cannabis, DUI and driving while his license was suspended or revoked. Q Kyle Jay Bushey pleaded not guilty to pos session of a controlled substance and possession of controlled substance paraphernalia. Q Joshua Levi Carroll pleaded no contest to attempted first-degree felony murder and armed robbery. He was adjudicated guilty and sentenced to 15 years in Florida State Prison with credit for time served, followed by five years of probation. He must serve a minimum of 10 years in prison. He owes $418 in court costs and $100 to the Public Defender’s Office. Q Jeremiah Wayne Doyle denied violation of probation for violating an injunction for protection – two or more convictions and criminal mischief. Q Desirae Frances Edenfield pleaded no con test to burglary of a structure or conveyance and petit theft. Adjudication was withheld. She was sen tenced to time served and 18 months of probation. She owes $418 in court costs, $100 to the State Attorney’s Office, and $150 to the Public Defender’s Office. The court reserved the right to order resti tution for 60 days. Q Amanda Sue Fields pleaded guilty to posses sion of a controlled substance. She was adjudicated guilty and sentenced to 120 days in Nassau County Jail with credit for time served. She owes $518 in court costs, $100 to the State Attorney’s Office, and $150 to the Public Defender’s Office. Q Abbey Lauren Freeman pleaded not guilty to three counts of possession of a controlled substance and one count of DUI. Q Cecil Randall Hickox failed to appear on charges of grand theft of a motor vehicle and driv ing while his license was suspended or revoked. Q David Wayne Holcombe pleaded no contest to the sale, manufacture or delivery of a controlled substance and sale of a controlled substance. He was adjudicated guilty and sentenced to two years in Florida State Prison with credit for time served. He owes $936 in court costs, $200 to the State Attorney’s Office, and $300 to the Public Defender’s Office. Q Kristopher Jason Homblette pleaded no con test to felony DUI. He was adjudicated guilty and sentenced to 30 days in Nassau County Jail with credit for time served, followed by 18 months of probation with the condition he attend a Level II DUI school within 30 days of his release. In addi tion, the court ordered his vehicle’s tag be impound ed for 90 days and his driver’s license be suspended for 10 years. He also must use an ignition interlock device for 24 months. He owes $418 in court costs, $100 to the State Attorney’s Office, $150 to the Public Defender’s Office and a $4,000 fine. Q Spencer Chancellor Jackson admitted viola tion of probation for armed robbery. He was adjudi cated guilty and sentenced to 58 months in Florida State Prison with credit for time served. Probation was revoked and terminated. Costs and fees of $780.08 were converted to civil judgment. Q Stanley David Keene Jr. pleaded not guilty to possession of a controlled substance with intent to sell, manufacture or delivery. Q Jason George Kilis pleaded no contest to two counts of possession of a controlled substance. He was adjudicated guilty and sentenced to 13 months in Florida State Prison with credit for time served. He owes $518 in court costs, $100 to the State Attorney’s Office, and $150 to the Public Defender’s Office. Q Eugene Lewis denied violation of probation for tampering with or fabricating physical evidence and driving while his license was suspended or revoked. Q Paul Michael McAndrews pleaded not guilty to battery on a law enforcement officer. Q Timothy J. McLaughlin pleaded no contest to two counts of contributing to the delinquency or dependency of a minor. Adjudication was withheld. He was sentenced to 12 months of probation with the conditions that he completes alcohol treatment and parenting classes, serves 50 hours of commu nity service and consumes no alcohol while on pro bation. He may report to probation via Zoom and the court terminated a no contact order. He owes $238 in court costs, $50 to the State Attorney’s Office, and $100 to the Public Defender’s Office. Q Lance Bryan Orshal pleaded not guilty to bat tery on a person 65 or older, felony DUI, driving while his license was suspended – habitual offender and refusing to submit to a DUI test. Q Jill M. Parks pleaded no contest to two counts of contributing to the delinquency or dependency of a minor. Adjudication was withheld. She was sentenced to 12 months of probation with the con ditions that she completes alcohol treatment and parenting classes, serves 50 hours of community service and consumes no alcohol while on proba tion. She may report to probation via Zoom and the court terminated a no contact order. She owes $238 in court costs, $50 to the State Attorney’s Office, and $100 to the Public Defender’s Office. Q Frank Arthur Sanders pleaded not guilty to sale of a controlled substance and using a two-way communication device to facilitate a felony. Q Xavier Amadeus Thomas pleaded no contest to assault. Adjudication was withheld. He was sentenced to time served. He owes $223 in court costs, $50 to the State Attorney’s Office, and $351 in surcharges related to the nature of the offense. Q Amelia Lynn Marie Wagner denied violation of probation for possession of a controlled sub stance, possession of less than 20 grams of cannabis and possession of drug paraphernalia. Q John Charles Ward admitted violation of proba tion for criminal mischief and battery. Adjudication was withheld. Probation was reinstated and modi fied to include 194 days of unsupervised probation in Nassau County Jail with credit for time served. Costs and fees of $1747.20 were converted to civil judgment. Q Lance Elijah White pleaded not guilty to bat tery in a detention facility. Q Christian Bryan Wilkinson pleaded not guilty to possession of a controlled substance and driving while his license was suspended or revoked. Q Stephen Joseph Wyckoff pleaded not guilty to trafficking in methamphetamine, possession of a firearm or concealed weapon by a convicted felon, possession of controlled substance paraphernalia and possession of less than 20 grams of cannabis. rnnrnrrnr Moody

PAGE 10

AmeliaIsland.com/Christmas Amelia Island CoffeeThe Boat HouseCafe KariboFalcon's NestLagniappe RestaurantOceansideThe Surf Restaurant & BarLeddy's Porch at the Florida House InnStory & Song Bookstore BistroCoast Restaurant at The Ritz-Carlton, Amelia Island Bantam & BiddyBrett's Waterway CafeCiao Italian EateryThe Crab TrapIsland KitchenTimoti's Seafood ShakTownies Pizzeria Support our island restaurants and enjoy a dash of Victorian flair with fixed-price lunch and dinner menus. +SVQSVILSPMHE]GLIIVWGLIHYPI]SYVTVMZEXI ZMWMXERHTSVXVEMX[MXLX3MGOXSHE] F or years, I have enjoyed planting sweet pea seeds in the late fall with the goal of harvesting handfuls of sweet, fragrant flowers to adorn my house and to gift to friends in the spring. For maybe 10 years this was no problem. I simply place the pea seeds in good soil I prepared in a flow-er bed and watched them grow. I even had sweet pea vines climbing up trellises in our side yard. Great! But then came the rab-bits. At first, I loved seeing these little wild bunnies in our back-yard. Then, reality set in. Rabbits love sweet pea vines. They also like spin-ach, another favorite fall crop of mine. And quick as a bunny, my little seed-lings all disappeared. The entire r PHOTOS BY PAT FOSTER-TURLEY/FOR THE NEWS-LEADER Wild backyard bunnies can cause havoc in vegetable gar-dens. row was cropped down. Failure. And so the Rabbit Wars began. We’ve trapped and relocated rabbits from our yard. No luck. Another one just appears in its place with the same herbivo-rous proclivities. So then Bucko installed “rabbit-proof fencing.” But the fencing is designed for rabbits up north – bigger rabbits. Our Florida rabbits are much smaller. A couple of days later we saw a rabbit slipping right through the holes in the fence and into the veggie gar-den. Another failure. So then, with Bucko losing interest, I hired a handyman to put up a solid fence and gate to keep the rabbits out. But, no luck here either. The rab-bits dug right under it. Another year’s crop gone in a flash. So, we moved on to elevated beds, which Bucko installed for me. These containers of soil are well above the jumping height of even the most determined bunny. This will work! And with that happy thought I planted a bunch of sweet pea and spinach seeds and set off on a month-long assignment in Azerbaijan with visions of the handfuls of flowers and spinach I would enjoy upon my return. But when I got back, what? No crop! It must have been Bucko’s fault, right? Maybe he didn’t adjust the sprinkler sys-tem properly. Maybe he forgot to water them. But it couldn’t be rabbits. No matter what, another fall season for sweet peas and spinach was gone again. But this year I am home during fall planting season and was on top of the project. I happily planted sweet pea and spinach seeds in the high, elevated beds and watered them faithfully, watching every day for signs of sprouting. And one morning, there they were, small seed-lings with a new start on life. But, the next day, they were mostly all gone! What on earth? And then I looked closely at the damage. The little shoots were snipped off right at the soil’s surface by something obviously feeding at night. With a bit of internet research, I found the culprit. Cutworms! These caterpillars hatch in soil after being deposited by adult moths, and they go to work eating plants at the surface, destroying them. Spinach and sweet pea seedlings grow in paper cups before being transferred to an outside garden. So, it wasn’t Bucko’s watering regime or maybe even rab-bits most of the time. This cul-prit was tiny but voracious. And invisible to me, since I couldn’t even find any when I sifted through some of the soil. So, Bucko and I tried a new angle: cutworm defense. I dug up the couple of remaining tiny spinach and sweet pea plants, and moved them to new soil in new pots elsewhere. Then, we covered both elevated beds with plastic tarps to smother anything in the soil. Or so we hoped. In the meantime, I planted another batch of seeds in small paper cups with the ends cut out to make a “collar” for the plants once they are planted in the garden. And, just to be sure, I also stuck two large tooth-picks next to each small seed-ling. According to the internet, cutworms need to wrap around the stem to consume it, and the toothpicks prevent this. And the collar prevents them from crawling over in the first place. Now these bottomless paper cups with their seedlings and toothpicks have been trans-planted to the elevated beds. Again, I am imagining a nice winter crop of spinach and sweet peas. But something tells me not to get my hopes up yet. Let’s see what nature sends my way next. A longtime friend and Florida native says she will never try to grow vegetables in Florida, and now I know why. But hope springs eternal, for me, at least for the moment. Stay tuned to see what happens next. Pat Foster-Turley is a zoologist on Amelia Island. She wel-comes your nature questions and observations. rn Seedlings in raised bed are protected from cutworms by paper cup collars and tooth-picks. 1112 South 14th Street Amelia Island In the 8 Flags Shopping Center (904) 261-5556 Monday – Friday 9am – 5pm Saturday 10am – 5pm We Have Furniture Available For Delivery NOW!! New Items coming in daily

PAGE 11

r n n n The Fernandina Beach High School wrestling team opened the season Saturday at Charlton County High School in Georgia. The Pirate grap plers went 3-2 to finish in third place of the six teams competing. FBHS, the lone Florida team, defeated host Charlton 54-30, McIntosh Academy 57-6 and Glynn Academy 42-36. The Pirates lost to Pierce County (36-30) and South Effingham (40-28). “I was very happy with the team overall,” head coach Eric Kubatzke said. “We had a lot of underclassmen wrestling in the lineup on Saturday, with two freshmen and seven sopho mores competing. They really stepped up for us and saw good competition from teams that we normally don’t see out of Georgia. “The guys have already faced a lot of adver sity this season with limited amounts of practice time. Some of it because of fall sports running later and the playoffs for our football team. We also had multiple wrestlers out with two-week quarantines, preventing them from getting ready. With the limited amount of mat time our guys had so far, they really stepped up to the challenge. “I’m really excited about this team and begin ning to see a lot of energy in our wrestling room. There’s definitely room for improvement with such a young team, but we still have several seniors in the lineup that can lead them through out the season. “Two of our upperclassmen went 5-0. Senior Jeremy Mahoney max pointed in all of his duals with four pins and one forfeit. Junior Dietrich Woods also went 5-0 with two pins on the day.” For the Pirates, Nik Saldana, 106 pounds, went 4-1 with two pins; Jacob Simmons, 113, went 2-3; Caden Kubatzke, 120, went 4-1 with a pair of pins; Mahoney, 126, went 5-0 with four pins; JB Sellers, 132, went 2-3; Cole Misciagna, 138, went 1-4 with a pin; Woods, 145, went 5-0 with two pins; Brooks Rohe, 160, went 3-2 with all three wins by pin; Lucas Crawford, 170, went PHOTOS BY BETH JONES/NEWS-LEADER The Fernandina Beach High School girls soccer team hosted Yulee’s Lady Hornets Friday. Yulee beat FBHS 4-1. At halftime, FBHS honored its four seniors — Cazie Durham, Gretchen Harding, Megan Laffey and Ana Serrano, pic-tured above from left with their parents. In the nightcap, the FBHS boys took on Duval High. The match ended in a 1-1 draw. Addison Tingle scored the Pirates’ goal, assisted by John Fallon. rrrn PHOTOS BY ERIN MAHONEY/SPECIAL Pirate wrestler Dietrich Woods, top left, was 5-0 on the day with a pair of pins Saturday at Charlton County. Jeremy Mahoney, top right, went 5-0 with four wins by pin. Brooks Rohe, above left, went 3-2 with three pins. Jared Hutchinson, above right, went 4-1 with three pins in the heavyweight division. rr W n nrrn The Pirates suffered their second loss of the season on Friday night. The host Fernandina Beach High School boys basketball team lost to Ridgeview 64-58. The home team led 32-27 at halftime, but the visitors out scored the Pirates 11-10 in the third quarter and 26-16 in the fourth to clinch the victory. Ryan Anderson and Cam Miller led the Pirates with nine points apiece. Anderson also had three rebounds and two assists, and Miller had eight boards, two assists and four steals. Damarian Bryan and Jake Jackson chipped in eight points each. Bryan had five rebounds, and Jackson had two. Jackson also had two assists and two steals. Dalton and Cruz scored seven each, and Cruz had six boards. The Pirates traveled to Interlachen Monday. FBHS edged its hosts 46-38. The Pirates jumped out to a 15-7 first-quarter lead and led 24-15 at halftime. Jackson led the Pirates on the scoreboard with 16 points to go along with three rebounds. Bryan scored 10 and pulled down seven boards. He also had a steal. Anderson and Jake Drummond chipped in six points each. Drummond also had 10 rebounds, an assist and two steals. Anderson had five boards, seven assists and a pair of steals. FBHS (5-2) heads to Hilliard Thursday. They host Middleburg on Friday. The junior varsity game time is 6 p.m., and the varsity tilt is at 7:30 p.m. With eight of the top teams in the region, the third annual Fortegra High School 9:12 Invitational presented by The CSI Companies tips off on Thursday with three days of exciting basketball action at Fletcher High School. All eight teams will be bat tling for a spot in the champion ship game on Saturday night at 7 p.m. on CW17 and 92.5 FM. The event bracket sets up like the Maui Classic college event, where all eight teams will play three games. All games on Friday and Saturday will be streamed live on the News4Jax app and website. The third-place game on Saturday at 4 p.m. will be live on CW17, and the cham INVITE Continued on 2B 4-1 with two pins; Tyler Harris, 182, went 2-3; and Kolby Kidd, 220, went 1-0 with a pin; Kyle Hutchinson, 220, went 1-3; and heavyweight Jared Hutchinson went 4-1 with a trio of pins. The Pirates are at home Saturday, hosting the Dual at the Dunes tournament. Wrestling starts at 9:30 a.m. Buy tickets at gofan.co. The Yulee High School wrestling team will host the Yulee Duals Dec. 18-19.

PAGE 12

SUBMITTED The Golf Club of Amelia Island ladies’ nine-hole association held its Interclub Tournament on Dec. 2. Winning first place was the four-women team of Betsy Ziegler, Osprey Cove; Andrea Buehler, GCIA; Elaine Bowling, Osprey Cove; and Diane Boyd, GCAI. FERNANDINA BEACH HIGH SCHOOL Wrestling Dec. 12 DUAL AT THE DUNES 9:30Dec. 16 QUAD 6:00Jan. 6 District dual at Yulee 4:30Jan. 16 WAR ON THE SHORE 9:30Jan. 21 tri-match at Raines 6:00Jan. 23 at Mandarin duals 9:00Jan. 27 at Bishop Kenny 6:00Feb. 4 County at West Nassau 6:00Feb. 5 at Englewood 2:30Feb. 10 ORANGE PARK (seniors) 5:30Feb. 13 at Terry Parker 10:00Feb. 20 District IBT at Yulee 10:00Feb. 26-27 region at Bolles 10/8:00March 5-6 state at Silver Spurs TBD FERNANDINA BEACH HIGH SCHOOL Boys Basketball Dec. 10 at Hilliard 4:30/7:30Dec. 11 MIDDLEBURG 6/7:30Dec. 15 at River City Science Acad. 6/7:30Dec. 17 JV at Camden County 4:30Dec. 17-18 JOHNNY T. SMITH TOURNEYDec. 28-30 at Clay tournamentJan. 7 INTERLACHEN 6/7:30Jan. 8 at Keystone Heights 6/7:30Jan. 12 at West Nassau 6/7:30Jan. 15 WOLFSON 6/7:30Jan. 19 JV at Camden County 4:30Jan. 21 at Middleburg 6/7:30Jan. 22 BALDWIN 6/7:30Jan. 26 at Yulee 4:30/7:30Jan. 28 at Stanton 5:30/7Jan. 29 HILLIARD 4:30/7:30Feb. 2 at West Nassau 6/7:30Feb. 5 RIVER CITY SCIENCE 6/7:30Feb. 8-12 District at Ed White FERNANDINA BEACH HIGH SCHOOL Girls Soccer Dec. 11 at Wolfson 5:30Dec. 15 at Paxon* 6:00Dec. 17 at Providence 5:30Jan. 12 RIDGEVIEW 6:30Jan. 14 PROVIDENCE 5:30Jan. 21 at Yulee* 12:00Jan. 25 BISHOP KENNY 6:00* District FERNANDINA BEACH HIGH SCHOOL Boys Soccer Dec. 10 at Bishop Kenny* 7:20Dec. 14 at Keystone Heights 7:15Dec. 17 at Providence 7:20Jan. 5 at West Nassau* 6:00Jan. 7 at Yulee* 7:20Jan. 12 at Raines* 7:20Jan. 14 PROVIDENCE 7:20Jan. 19 at Nease 6:30* District FERNANDINA BEACH HIGH SCHOOL Girls Basketball Dec. 10 at Hilliard 6:00Dec. 14 BAKER COUNTY 6:00Dec. 17 at West Nassau 6:00Dec. 22 at Providence 5:00Jan. 6 FLETCHER 6:00Jan. 8 WOLFSON 6:00Jan. 9 BISHOP SNYDER 2:00Jan. 13 WEST NASSAU 6:00Jan. 14 at Baldwin 6:00Jan. 20 ED WHITE 6:00Jan. 21 at Baker County 6:00Jan. 29 HILLIARD 6:00 YULEE HIGH SCHOOL Girls Basketball Dec. 12 at Brantley County 2:00/5Dec. 15 at Impact Christian Acad. 6:00Dec. 17 ED WHITE* 6/7:30Dec. 21 HILLIARD 6:00Jan. 7 at West Nassau* 5:30/7Jan. 8 at Ed White* 5:30/7Jan. 11 at Hilliard 6:00Jan. 14 at Englewood 5:30/7Jan. 15 at Episcopal 6:00Jan. 19 at Stanton 5:30/7Jan. 22 at Atlantic Coast 5:30/7Jan. 26 FERNANDINA BEACH* 6:00Jan. 28 ST. AUGUSTINE 6/7:30* District YULEE HIGH SCHOOL Boys Basketball Dec. 10 ED WHITE* 6/7:30Dec. 12 at Brantley County 3:30/6:30Dec. 15 SEACOAST 6/7:30Dec. 17-18 at Johnny T. Smith at FBHSDec. 21 HILLIARD 4:30/7:30Jan. 5 ORANGE PARK 6/7:30Jan. 8 at Baldwin 5:30/7Jan. 11 at Hilliard 4:30/7:30Jan. 12 CREEKSIDE 6/7:30Jan. 15 at Episcopal 4:30/7:30Jan. 19 BRADFORD COUNTY 6/7:30Jan. 21 WEST NASSAU* 6/7:30Jan. 22 at Harvest 6:00Jan. 25 at Ridgeview 6/7:30Jan. 26 FERNANDINA BEACH* 4:30/7:30 Jan. 29 KEYSTONE HEIGHTS 6/7:30Feb. 2 BALDWIN 6/7:30Feb. 4 STANTON (seniors) 6/7:30* District YULEE HIGH SCHOOL Girls Soccer Dec. 11 at West Nassau 7:00Dec. 15 TRINITY CHRISTIAN 5:30Dec. 17 TRINITY CHRISTIAN 5:30-DQ&+5,67·6&+85&+Jan. 12 at Clay County 7:00Jan. 14 DUVAL CHARTER 5:30Jan. 16 at Baker County 1:00Jan. 19 at First Coast 5:30Jan. 21 FERNANDINA BEACH 6:00Jan. 28 RAINES (seniors) 5:30Feb. 1 District tourney starts YULEE HIGH SCHOOL Boys Soccer Dec. 10 PAXON 7:00Dec. 15 TRINITY CHRISTIAN 7:00Dec. 17 at Raines 7:00Jan. 7 FERNANDINA BEACH 7:00Jan. 12 TRINITY CHRISTIAN 7:00Jan. 15 at Wolfson 7:00Jan. 19 at First Coast 7:20Jan. 21 NEASE 6:00Jan. 26 BOLLES 7:00Jan. 28 RAINES 7:00 YULEE HIGH SCHOOL Wrestling Dec. 18-19 YULEE DUALS Dec. 28-29 at Knockout Classic 11/8:00Jan. 2 at Bobcat Round Robin 8:00Jan. 2 JV at Bell-Raulerson IBT 8:00Jan. 6 DISTRICT DUALS 3:30Jan. 8-9 BATTLE OF THE BORDER Jan. 12 at Ware County 4:00Jan. 13 at Glynn Academy 4:00Jan. 14 at region duals TBAJan. 16 at Westside Round Robin 8:30Jan. 27 FLEMING ISLAND 3:30Jan. 29-30 at Wakulla IBT 11/8:00Feb. 10 SENIOR NIGHT 4:00Feb. 12-13 at JV state invitationalFeb. 13 at Villages Duals TournamentFeb. 20 IBT DISTRICT 8:00Feb. 27 Region March 4-6 State at Kissimmee FERNANDINA BEACH MIDDLE SCHOOL Boys Basketball Dec. 10 YULEE 5:45/7Dec. 14 JV semifinals at CMS 5:45/7Dec. 15 Varsity semis at YMS 5:45/7Dec. 17 COUNTY FINALS 5:45/7 FERNANDINA BEACH MIDDLE SCHOOL Girls Basketball Dec. 10 at Yulee 5:45/7Dec. 14 JV SEMIFINALS 5:45/7Dec. 15 Varsity semis at CMS 5:45/7Dec. 17 County finals at HMS 5:45/7 FERNANDINA BEACH MIDDLE SCHOOL Soccer Dec. 10 YULEE 5:45/7Dec. 14 Girls semis at YMS 5:45/7Dec. 15 Boys semis at HMS 5:45/7Dec. 17 Finals at WNHS 5:45/7 YULEE MIDDLE SCHOOL Soccer Dec. 10 at Fernandina Beach 5:45/7Dec. 14 GIRLS COUNTY SEMIS 5:45/7Dec. 15 Boys county semis at HMS 5:45/7Dec. 17 County champs at CMS 5:45/7 YULEE MIDDLE SCHOOL Girls Basketball Dec. 10 FERNANDINA BEACH 5:45/7Dec. 14 B county semis at FBMS 5:45/7Dec. 15 A county semis at CMS 5:45/7Dec. 17 County champs at HMS 5:45/7 YULEE MIDDLE SCHOOL Boys Basketball Dec. 10 at Fernandina Beach 5:45/7Dec. 14 B county semis at CMS 5:45/7Dec. 15 A COUNTY SEMIS 5:45/7Dec. 17 County champs at FBMS 5:45/7 rnr Amelia Island Youth Soccer will hold camps this winter at the fields at 3243 Bailey Road in Fernandina Beach. A camp for chil-dren born from 2008-13 will be held from 9 a.m. to noon Dec. 28-Jan. 1. Cost is $100. An elite camp for children born from 200209 will be held from 4-7 p.m. Dec. 28-Jan. 1. The cost is $125. Small-sided games will be played from 9-10 a.m. Dec. 5, 12, and 19 and Jan. 9, 16 and 23 for children born from 2003-11. Cost is $30 per player or $50 per family and includes all six sessions. For information or to register, visit www. aiysoccer.com or email registrar@aiysoccer.com.r  Soccer Made in America is offering a winter training camp from 9 a.m. to noon Dec. 28-31 at the Hickory Street Park. Open to ages 4-17, this nationally renowned training program involves professional soccer training covering technical and tactical training. All participants should bring their own soccer balls, shin guards and drinks. Cost is $179 for the first family member and $169 for each additional family member. Register through Dec. 26 at the Atlantic Center or call 904-310-3350 to register over the phone with a credit card. For information, visit www.smia.com.n­n€‚n The Pirate Wrestling Club is holding practices at 6 p.m. Tuesdays and Thursdays in Building 22, adjacent to the Fernandina Beach High School football field. Access the building from Beech Street at South 19th Street. Call Coach Eric Kubatzke at 556-1684.‚nƒ€r The Amelia Island Boules Club holds pétanque pickup games on the pétanque courts at the south end of the downtown Marina, Saturdays at 9:30 a.m. and most afternoons on weekdays. Pétanque (pay-tonk) is a cousin of both horseshoes and bocce, the Italian bowling game. The public is always welcome. Call 491-1190.„nƒ‚ Scheduled play at the pickleball courts at Central Park in Fernandina Beach has resumed. Beginner play (levels 1.0-2.5) is 3-4 p.m. Sunday; social play (3.0 plus with chal-lenge court) is from 4-6 p.m. Sunday. :RPHQ·VRSHQSOD\DOOOHYHOVRQFRXUWV 1-4 is from 8-10 a.m. Monday, and level 3.5 on courts 1, 5 and 6 from 4-6 p.m. Monday, with rating level 4.0 plus on courts 2-4. Levels 3.0 and 3.5 plus play from 8-10 a.m. Tuesday, and levels 2.0, 2.5 and 3.0 from 10 a.m. to noon. Levels 3.0 and 3.5 plus with challenge court is from 4-6 p.m. Wednesday. 0HQ·VRSHQSOD\DOOOHYHOVRQFRXUWV is from 8-10 a.m. Nighttime social play (all lev-els) is from 6:30-8:30 p.m. Thursday. Levels 3.0 and 3.5 plus is from 8-10 a.m. Friday, and levels 2.0, 2.5 and 3.0 from 10 a.m. to noon. On Saturday, nighttime social play (all levels) is from 6:30-8:30 p.m. Visit www.fbpickleball.com, Fernandina Beach Pickleball Pirates on Facebook or email fbpbpirates@gmail.com for information.…   For the first time in four years, the 3URIHVVLRQDO%XOO5LGHUV·HOLWH8QOHDVKWKHBeast will return to Jacksonville, welcom-ing fans Jan. 30-31 into VyStar Veterans Memorial Arena for the PBR Jacksonville Invitational. The event will abide by the health standards as approved by the city of Jacksonville. PBR is following all local and state health protocols, and along with VyStar Veterans Memorial Arena, is instituting a series of fan safety protocols. All fans as well as staff and competitors will be required to wear face masks inside VyStar Veterans Memorial Arena. In addition to Centers for Disease Control and Prevention-informed screening, all PBR personnel will undergo medical testing for COVID-19. PBR will only sell up to 41% of arena capacity to separate fans. All fans will be in pod seating to minimize fan crossover when entering and exiting their seats. VyStar Veterans Memorial Arena has gone cashless. All purchases, including parking, concessions and merchandise transactions, will require a debit or credit card. Mobile concessions ordering will be available on the YHQXH·VXSGDWHGDSS Hand sanitizer stations will be placed throughout the venue at high-volume areas to promote hand hygiene. Social distancing will be encouraged at the concession stands, rest-rooms and merchandise stands. Purchase tickets at www.ticketmaster.com. †n€€Senior league bowling is offered at 9:30 a.m. Wednesdays at the bowling alley off U.S. 17 in Yulee. The group also meets for Christian league at 6 p.m. ‡†nƒ Tickets for the 76th annual TaxSlayer Gator Bowl game are on sale to the public. The game will take place at noon on Jan. 2 and will be televised nationally on ESPN. The 2021 game will be the first in a sixyear deal which will feature a team from the Southeastern Conference that will serve as the anchor team and will face an opponent from the Atlantic Coast Conference, which also includes the University of Notre Dame. In compliance with city guidelines and following the precedent of the Jacksonville Jaguars and the Florida vs Georgia game, the TaxSlayer Gator Bowl will seat approximately RIWKHVWDGLXPFDSDFLW\IRUWKLV\HDU·Vgame. The health and safety of all guests is our number one priority, and as such, face cover-ings that completely cover your mouth and nose will be required at TIAA Bank Field. Ticket prices for the limited capacity game The Women’s Golf Association at the Amelia Island Club celebrated the holidays early with its annual Santa Derby on Dec. 3-4. Some holiday garb, includ-ing numerous Santa Claus hats, could be found among the partici-pants on the Long Point golf course. This two-day tournament featured an indi-vidual selective scoring format. Players had the option of play-ing either one or both days. If playing both days, participants had the opportunity to improve their hole-by-hole score. Players were divided into flights with 100% handicap. Six flight winners were determined after the tournament, with an overall winner. In the Rudolph flight, new member Fran Clinkscales won her division with a final score of 66, while Margaret Newton fin-ished with a score of 61 in the Prancer flight. Cherie Billings won the Comet flight with a score of 61, and Pam Vieser scored a 65 in the Dancer flight. Debbie Baechle was victorious in the Donner flight, turning in a final score of 67. In the nine-hole division, the winner was Dora Yelk, with a finishing score of 34. The overall winner of the Santa Derby was Penny Giles, finishing with an outstanding score of 56. ˆr The Men’s Golf Association at the Golf Club at North Hampton held a low net total score on odd holes format on Thursday. Players battled the cold. Ken Sekely took first place with a minus three; Harvey Manekofsky was second at plus 1; Paul Going and Walter Johnson tied for third at plus 3; and Charlie Angel was fifth at plus 5. The Women’s Golf Association played a 3, 2, 1 mixer, with three best ball on the par 3s, two best ball on par 4s, and best ball on par 5s. Deb Rasmussen, Donna Dandurand, Bertha Frazier and Sue Lopiano teamed up for first place at minus 11. Dana Hess, Kara O’Rourke and Rachael Hentigan were second at minus 9. Denise Buse, Michelle Vessey, Janie Ramsay and Carol Mizell placed third at minus 1. In fourth place were Jennifer Hawkins, Sue Simpson, Marsha Mongeon and Jayne Paige at plus 6. ‚„€n Giles ‡‰ˆ­ feraiaeaclfclcm & Easter Eg Ht YUC46441S UN DAYAPRIL 5 th 0am BRUNCH 2pm EG GHUNT RSVP in te Restarat r Call 9 Reseratis Reqested ADULTS | $CHILDREN2 &UNDER ‡%LOO0HOWRQ5G )HUQDQGLQD%HDFK)/ IHUQDQGLQDEHDFKJROIFOXEFRP Cabin Fever? GET OUT OF THE HOUSE AND 21727+(&2856( 7LPHWRJHWRXWLQWKHIUHVKDLU IHUQDQGLQDEHDFKJROIFOXEFRP IHUQDQGLQDEHDFKJROIFOXEFRP IHUQDQGLQDEHDFKJROIFOXEFRP IHUQDQGLQDEHDFKJROIFOXEFRP IHUQDQGLQDEHDFKJROIFOXEFRP IHUQDQGLQDEHDFKJROIFOXEFRP IHUQDQGLQDEHDFKJROIFOXEFRP Book Online! MONDAY FRIDAY Includes: 18 Holes and Cart Open – 1:001:00 – Close $ 45 $ 29 SHORTS Continued on 3B pionship game will be live. In addition, both semifinal games on Friday night at 6 p.m. and 8 p.m. will be heard on 92.5 FM and 1010AM. The champion-ship game will also be heard on radio. “Each year, the tournament gets better and this year is no exception,” said Alan Verlander, founder and CEO of High School 9:12. “Thanks to our sponsors and partners, we are able to provide an early season showcase that elevates high school basketball through-out our area. “We will be taking all safety measures as well to ensure and safe and exciting event.” All tickets are sold online through www.JaxHighSchool912.com, with general admission tickets start-ing at $10, VIP ticket packages that includes food and drinks for $75 and courtside seats for $120. ˆŠ Continued from 1B

PAGE 13

rr T he Nassau Sport Fishing Association held an awards dinner Sunday afternoon at Ten Acres. Member fisher-men were given points for fish weighed in throughout the year, and the lady angler and men’s angler with the most accumulated points at the end of the 2020 fishing season were awarded top honors. Trisha Glenn topped all lady anglers with a total of 25 points. During the tournament season, Glenn had several outstanding catches, including a second-place sea trout that weighed 2.2 pounds and top slam that included one sea trout, one flounder and one redfish for a winning weight of 8.61 pounds. Brad Reese had a colorful fishing season, including a big kingfish catch made while fishing with NSFA tournament director Mitch Fields. “I normally drive my boat and let the other fishermen fish,” Reese said. “However, on this particularly day, I was fishing on Mitch Fields’ fishing boat, and Mitch was driving. We were practicing fishing the day before the Jacksonville King of the Beach kingfish tournament. “Prior to the kingfish tournament, Mitch and I were slow trolling live menhaden on downriggers and on the sur-face. A large, silvery ribbonfish was rigged with several treble hooks down the side and with a wire leader. “We were also slow trolling our kingfish baits right in the middle of the St. Marys shipping channel when a large kingfish struck the barbed rib-bonfish. Luckily, I was standing by the deep bending kingfish rod and was able to reel in my new NSFA club record kingfish that weighed 37.12 pounds.” “I wish we would have caught that big kingfish during the next day of the tourna-ment,” Fields said. Reese also took secondplace flounder with a 2.68-pound flounder and reeled in a massive first-place redfish that weighed 8.4 pounds. And, with his new club record kingfish weighing 37.12 pounds, he took top men’s Angler of the Year honors. Other club winners included Audrey Schoen, with her first-place flounder weighing 3.4 pounds; Terry Kelly, who took third place with 2.54-pound flounder; Ed Frey, who took top honors in the sea trout category with a nice 3.36-pounder; Joe Wise, with third place in the sea trout category with a 2.05pound sea trout; Fields, second place with a 7.6-pound redfish; and Danny Leeper, who took third-place honors with a 6.74-pound redfish. Joe Giansante took second place in the slam category with 7.82 pounds. Other winners included Audrey Schoen, second-place lady angler; Brooke Kelly, third-place lady angler; Frey, second-place men’s Angler of the Year; and Fields, third place men’s angler. Angler of the Year in both the men’s and ladies division are determined by accumulat-ing points during the year for fish competitors weigh in dur-ing the each fishing seasons. Winter species include whit-ing, sheepshead and sea trout. Spring species are black drum, pompano and cobia. Summer species include kingfish, whit-ing and sea bass. Fall species are flounder, sea trout and redfish. There are also ladies, men’s and youth divisions along with an inshore slam category. Shawn Arnold is president, and Fields was tournament director for the 2020 fishing season. The NSFA was established in 1983 as a not-for-profit orga-nization authorized by the state of Florida. The club was com-prised of individuals who best represented the ideas defined in the cub’s mission statement. NSFA started out small in its early stages, holding club tournaments and social events. The club continues to grow and actively supports several fish-ing tournaments and the place-ment of offshore artificial reefs. Reef BA, located approximately 16.5 miles and 97 degrees east of the St. Marys entrance buoy, was created in 1995 and, in 2006, the club partnered with Fernandina Beach High School and the U.S. Coast Guard to create Captain Daddy (CD) Reef. CD Reef is located approximately 10 miles southeast of the St. Marys jet-ties at coordinates N30 35.928, W81 15.952. NSFA also holds the annual the Fernandina Beach Fishing Rodeo. There are also other public tournaments and outings that occur during the year. The club also provides its members and the general pubrn F ERNANDINA B EACH T IDES T ides, Sun & Moo n : December 9 December 16, 2020 Sat. 12/12 Sun. 12/13 Mon. 12/14 Tues. 12/15Fri.12/11Thur.12/10Wed.12/16 Moonrise 1:27ASunrise 7:12AMoonset 1:58PSunset 5:24PWed.12/9 High 3:21A 7.64’ Low 9:26A 2.06’ High 3:40P 7.87’ Low 9:53P 1.52’ Moonrise 2:32ASunrise 7:12AMoonset 2:33PSunset 5:25P Moonrise 3:39ASunrise 7:13AMoonset 3:11PSunset 5:25P High 4:26A 8.04’ Low 10:30A 1.84’ High 4:43P 7.88’Low 10:49P 1.27’ High 5:29A 8.49’ Low 11:31A 1.59’ High 5:44P 7.94’Low 11:44P 1.05’ Low -A -’ High 6:28A 8.91’ Low 12:31P 1.34’High 6:41P 8.00’ Moonrise 5:59ASunrise 7:14AMoonset 4:40PSunset 5:25P Low 12:39A 0.88’ High 7:24A 9.21’ Low 1:27P 1.14’High 7:36P 8.04’ Moonrise 7:10ASunrise 7:15ANew Moon 11:18A Sunset 5:26PMoonset 5:34P Low 1:31A 0.78’ High 8:17A 9.36’ Low 2:19P 1.06’High 8:29P 8.01’ Sunrise 7:16AMoonrise 8:17ASunset 5:26PMoonset 6:33PTide calculations are for Amelia River, Fernandina Beach. No corrections are necessary. Sun & Moon events are also calculated for Fernandina Beach, although actual times may vary because of land masses.Low 3:11A 0.93’ High 10:02A 9.17’Low 3:57P 1.27’High 10:13P 7.80’ Low 2:22A 0.79’ High 9:10A 9.34’ Low 3:09P 1.10’High 9:21P 7.93’ Sunrise 7:16AMoonrise 9:17ASunset 5:26PMoonset 7:36P Moonrise 4:48ASunrise 7:14AMoonset 3:52PSunset 5:25P Paying too much money for your business insurance? Simpler, smarter business insurance. We come to your business for personalized service to save you both time and money. We make insurance easy. 904-388-6446 PHOTOS BY TERRY LACOSS/SPECIAL The Nassau Sport Fishing Association holds monthly meetings at Ten Acres with occasional covered dish dinners. Pictured are, from left, Trisha Glenn, Audrey Schoen and Patty Rucker. Mitch Fields, tournament director; Trisha Glenn, first place lady angler; Brad Reese, first-place men’s angler; and NSFA President Shawn Arnold are pictured, above from left, during the recent NSFA awards dinner. Trisha Glenn, below left, was named top lady Angler of the Year for her big catches made in 2020. Reese, below right, caught this big king the day before last summer’s King of the Beach kingfish tournament while fishing with Fields. Reese did get to weigh his 37.12-pound king in during the annual NSFA fish of the month tournament. His big king helped Reese win men’s Angler of the Year honors. lic with education on fishing techniques with seminars and outings. Becoming a member of NSFA provides a great way to network with others interested in fishing. The club meets the second and fourth Wednesday of every month, except November and December. Generally the first meeting of each month will be a business meeting and the second meeting will be a social meeting with a covered dish meal. For information on the NSFA, visit www.nsfafish.net. are $135 for club seats, $70 for lower level sideline seats and $40 for endzone seats. Limited premium seating packages are also available. To purchase tickets, visit www.taxslayergatorbowl.com or call 904-633-2000.rn The Nassau Sport Fishing Association holds its monthly business meetings on the second Wednesday of each month. The monthly social get-together is held on the fourth Wednesday of each month. The location for both meetings is Kraft Ten Acres, 961023 Buccaneer Trail, Fernandina Beach, Florida 32034. The Nassau Sport Fishing Association, founded in 1983, is a 501(c)(3) nonprofit orga-nization, created to develop and promote salt-water fishing in the Nassau County area while adhering to state, federal and local regulations, to encourage compliance with the rules of water safety and to promote youth-related com-munity and other civic-minded activities. Call 556-5531 or email info@nsfafish.net for information. Continued from 2B

PAGE 14

r n r A note came to my email’s inbox: Would I like to be part of a project being explored by the Plantation Artists’ Guild & Gallery (PAGG) and their volunteer corps, Art Lovers? Karen Bowden, a photographer and exhibiting member of the gallery, had proposed the proj ect. Her idea? To ask photographers to submit their photos taken during 2020. A hundred photos would be selected. From the first meeting, everyone wanted to be part of it and we dubbed it “2020 – A Look Back.” Next stop, a meeting with Gil Langley and the Amelia Island Tourist Development Council, who agreed it was just what our community needed as we head into 2021. We continued to brainstorm and found many willing partners and sup porters. The new Marriott properties near Main Beach – Courtyard and SpringHill Suites – are title spon sors and we are pleased to announce the News-Leader and the Nassau County Record are our media partner. There are plans to work with Fernandina Beach Main Street to coordinate a “Photo Walk” in the Historic District. So, we are off and running. A call for photos is now underway. What happens to the pho tos collected? Art Lovers members will select the top 100 photographs. An opening reception – live or vir tual – will be held at PAGG and will display large reproductions of the winning photographs. A video will be produced that will be available online. Throughout the year, the exhibition will be made available to other gal leries, banks, retail outlets or public buildings. A book is in the works. We are looking for photos that reveal emotion, display adaption, humor or resilience. It is not just about the pandemic; our lives contin ued through elections, storms, comets, birthdays, a football season and much more. Each submission will be accompanied by a short narrative about why the photo is special. A pic ture can speak a thousand words, and the goal is to capture the emotional roller coaster of 2020 in just 100 pho tos – the best, the worst and the won der of 2020. Any net revenue associated with this project will be donated to Arts Alive Nassau, a nonprofit whose mis sion is to promote the arts and provide free or low-cost arts opportunities and educational experiences to children who would otherwise have little or no access to the arts. So, look through your photos taken this last year that reveal some special moment and send it in. More informa tion, complete rules and entry forms are available at https://bit.ly/39Qdk6f. You may be a part of collected photos that capture an incredible year, a year like no other. The deadline to enter is Jan. 15. For questions, contact me at dickie.ander son@gmail.com and Karen Bowden at karenphotolady@yahoo.com. To receive her weekly newsletter or information about her books, including her four From the Porch books, contact Dickie at dickie.anderson@gmail.com. This year’s seventh annual Barnabas Center Empty Bowls, held Nov. 19 as an outdoor drive-thru due to the coronavirus pandemic, was a tremendous success, thanks to the hundreds of event sponsors, donors, attendees, volunteers and participants, according to a news release. Barnabas was focused on keeping its Empty Bowls attendees safe along the driv ing route as they enjoyed entertainment, a meal of soup from presenting sponsor The Ritz-Carlton, Amelia Island and a unique hand-painted bowl to take home. “The Empty Bowls fundraiser is a sym bolic reminder of the many ‘bowls’ in our community that still need to be filled for people who struggle with hunger or food insecurity,” the release says. In addition to The Ritz-Carlton’s involve ment, Barnabas “is especially appreciative” of the support of event legacy sponsor Baptist Medical Center Nassau and a grant from the Delores Barr Weaver Forever Event Fund. More than 140 additional sponsors also made contributions to the event. Barnabas supporters Jack and Charlotte Roberts created an event Challenge Fund grant that gave attendees the opportunity to match their $10,000 gift, with donations surpassing that amount. “We are so grateful to our generous spon sors and awesome community members who participated in our Empty Bowls event,” said Liza Cotter, Empty Bowls Committee chairwoman. “We all had a great day out doors enjoying delicious soup, entertaining musicians and a parade of happy Barnabas volunteers! Everyone felt so good support ing the dynamic work of Barnabas in Nassau County.” To learn more about Barnabas Center and its services in Nassau County, and/or to make a donation, visit BarnabasNassau.org or call 904-261-7000. Find out why Nassau County needs Empty Bowls by watching a special video highlighting Barnabas’ services during the COVID-19 pandemic at https://youtu.be/9zVsSyM-HEQ. rr rn PHOTOS BY CAROLINE BLOCHLINGER/SPECIAL Left, a volunteer helps prepare the drive-thru area for a modified seventh annual Empty Bowls event. Right, Barnabas Center President and CEO Wanda Lanier, right, greets one of the participants as they enter the drive-thru. Presenting sponsor The Ritz-Carlton, Amelia Island pre-pared the soup for the event. Volunteers lined up the soup and bowls for distribution and musicians performed for par-ticipants as they made their way through the drive-thru. Above, volunteers helped distribute bowls and soup to donors as they drove along the event’s route. Below, some of the volunteers at this year’s Empty Bowls event give a thumbs up regarding its success.

PAGE 15

The Nassau Humane 6RFLHW\·VDQQXDO3DUDGHRI3DZVZLOOWDNHSODFHYLUWXDOO\WKLV\HDU so that pets and their owners can once again bring costumes and cheer to the community. Submit pictures or video of your costumed pet. “Floats” with pets and their owners are welcome too. ,QFOXGH\RXUDQG\RXUSHWV·names and contact informa tion. Still photos are fine, but taking a video of you and your animals “parading” from left to right would be even better so that they can be put “together to make our parade come to life.” Submit your pictures or video via email to volun teer@nassauhumane.org by WRGD\VRWKDW1+6·VSDUDGHgrand marshal can edit them together by Saturday, Dec. 12, when the physical ver sion of the parade had been planned to occur. For informa tion, contact info@nassauhu mane.org or 904-321-1647. Updates will be posted on the Nassau Humane Society Facebook page and website at NassauHumane.org. $PHOLD&RPPXQLW\ 7KHDWUHZLOOSUHVHQW Erma %RPEHFN$W:LW·V(QG , a comedy about the life and work of the popular humorist who asked, “If life is a bowl of cherries, what am I doing in the pits?” In-person and livestreamed performances will be at 8 p.m. Thursday, Friday, Saturday and Dec. 17-19 and at 2 p.m. Sunday in the Main Stage theater at 207 Cedar St. in Fernandina Beach. In-person tickets, with socially distanced seating, are $25 for adults and $10 for students. Livestream tickets are $15 for an individual, $30 for a house hold of up to four, and $90 for a group of up to 10. Visit AmeliaCommunityTheatre.org or call 904-261-6749 for tickets and information. 6FURRJH7KH0XVLFDO KDVEHFRPHDQDQQXDOWUDGLWLRQDW$PHOLD0XVLFDO3OD\KRXVH and this year ZRQ·WEHDQ\GLIIHUHQW7KLVtimeless musical follows the SORWRI&KDUOHV'LFNHQV·$Christmas Carol, in which the miserly Ebenezer Scrooge undergoes a profound experi ence of redemption over the course of a Christmas Eve night after being visited by the ghost of his former partner, Jacob Marley, and the ghosts of Christmas past, present and future. Performances are set for 7:30 p.m. Friday and Saturday and 5 p.m. Sunday. For tickets, visit https://bit.ly/2HWJS2k. Audience mem bers should bring a chair or blanket. If the weather looks as if it may be inclement, call 904-277-3455. to find out if the show will be canceled. 0RUHWKDQDGR]HQORFDO DUWLVDQVFUDIWHUVDQGRWKHUV will take part in the Buy Local Holiday Extravaganza from 10 a.m. to 4 p.m. Saturday that will benefit The Salvation Army Hope House. Some of the arts and crafts that will be available include handmade leather items such as purses and belts, jewelry, handmade chocolates, lamps and other items made from driftwood, shells and sand, metal art, ceramic tile coasters, shell art, microgreens, pepper oils and more. Organizers are still accepting vendors. The craft fair will take place in the park ing lot of the 8 Flags Shopping Center at South 14th and Lime streets in Fernandina Beach. For information, contact Kim Murray at k.copeland.murray@gmail.com. 7KH)URQW3RUFK%HDGHUV PDNHDQGVHOOMHZHOU\WRUDLVHIXQGVIRUGRQDWLRQVWRORFDOFKDULWLHV and will hold a trunk show 10 a.m. to 5 p.m. Saturday at Story & Song Bookstore Bistro, 1430 Park Ave. in Fernandina Beach. Most recently, the group was able to donate $2,000 to the Interfaith Dinner Network, which serves meals several days a week to the DUHD·VKRPHOHVVDQGIRRGinsecure. Since their first donation of $1,000 in March WR0LFDK·V3ODFHWKHFRXQW\·VUHVRXUFHIRUYLFWLPVof domestic abuse, the group has donated a total of $8,000 to organizations that include Take Stock in Children, Arts Alive, Nassau County Council on Aging, Starting Point Behavioral Healthcare and *UDFLH·V.LWFKHQ &HOHEUDWHGFKHI:KLWQH\ 2WDZNDZLOOEHDW7KH%RRN/RIWIURPSP6DWXUGD\to sign her cookbook, The Saltwater Table: Recipes from the Coastal South . Otawka is an author and award-winning chef at the Greyfield Inn on Cumberland Island in Georgia. She briefly left to be on season nine of Top Chef. Offering a modern perspective on southern flavors with a strong emphasis on vegetables and fresh ingredients, the book contains 125 recipes such as summer tomatoes topped with crispy okra, flakey buttermilk biscuits with ginger-spiked jam and sweet Atlantic shrimp poached with beer, citrus and bay leaves. The Book Loft is located at 214 Centre St. in Fernandina Beach. $&KULVWPDV0HPRU\ , DVWDJHGUHDGLQJE\5RQ.XUW]$UOHQH)LONRIIDQG$YHU\+LOOLNHU will take place at 2 p.m. Sunday at Story & Song Bookstore Bistro. Originally published in Mademoiselle magazine in December 1956, this auto biographical short story by Truman Capote follows a young boy and his older friend as they make fruitcakes for Christmas and have other adventures. Tickets are $21 per person and include lunch with a beverage of your choice. For information, call 904-601-2118. The store is located at 1430 Park Ave. in Fernandina Beach. 3ODQWDWLRQ$UWLVWV·*XLOG *DOOHU\RU3$**ZLOOIHD WXUHWKHDUWZRUNRIH[KLELW LQJPHPEHU'HS\$GDPV as its “Corner” show artist for the month of December. Adams works in oil, transparent water color, gouache, pastel and egg tempera. Subjects vary from figurative, landscape and still life, and are done in a realistic style. Her subjects involve places, things and people from her personal experiences. She says she determines the medium that best conveys the mood she wants to impart to each painting. You can view her art at depyadams.com and paggart.com. Located at 94 Amelia Village Circle in the Omni Amelia Island Plantation Shops, PAGG is a not-for-profit artist coop erative. Gallery hours are 11 a.m.-5 p.m. Monday, 9 a.m.-1 p.m. Tuesday, 11 a.m.-5 p.m. Wednesday through Saturday and 1-5 p.m. Sunday. For information, call 904-432-1750 RUYLVLW3ODQWDWLRQ$UWLVWV·*XLOG& Gallery on Facebook. 7KHQH[WPHHWLQJRI $PHOLD,VODQG:ULWHUVZLOOEHSP7XHVGD\'HF at Story & Song Bookstore Bistro. Every December, participants talk about a special book (or two) that has been enjoyable and personally impactful dur ing the year. Attendance, and listening only for some book tips, is optional since there is no membership requirement DQG\RXGRQ·WKDYHWRDFWLYHO\participate in the meeting. With safety precautions in place, an RSVP is required for space planning but the meet ing is open to the public. Send questions and reservations to Lee Ann at jimlee.shobe@gmail.com by Sunday, Dec. 13. Amelia Island Writers is a chapter of the Florida Writers Association. Visit ameliaisland writers.org for information. $PHOLD,VODQG0XVHXP RI+LVWRU\ZLOOZHOFRPH0RUULV´0DUW\µ+\OWRQ from WKH8QLYHUVLW\RI)ORULGD·VHistoric Preservation Program in the College of Design, Construction and Planning for its next 3rd on 3rd lecture at 6 p.m. Friday, Dec. 18. The city of Fernandina Beach recently received a grant to update guidelines for the Old Town Historic District in partnership with the university, and Hylton will discuss how digital technol ogy is helping to understand WKHDUHD·VLQFUHGLEOHKHULWDJHincluding a demonstration of terrestrial laser scanning that can create a digital model of a community. Attendance is free for museum members with a suggested donation of $5 for nonmembers. Masks are man datory. Seating is limited to a maximum of 30 people and is wheelchair accessible. This program also will viewable via a livestream at https://bit.ly/2E6Sp8g. $PHOLD0XVLFDO3OD\ KRXVHZLOOKRVWDIDPLO\IULHQGO\KROLGD\UHYXH featuring a number of favorite Christmas songs and some comedy skits at 7:30 p.m. Friday and Saturday, Dec. 18-19, on its outdoor stage. You should bring your own chair and pay what you can at the door. AMP is located at 1955 Island Walkway in Fernandina Beach. 7KH'\QDPLF/HV 'H0HUOH7ULRIHDWXULQJ%RQQLH(LVHOHDQGVSHFLDOguests, will perform “The Jazz Spirit of Christmas” at 2 and 7:30 p.m. Saturday, Dec. 19, at Story & Song Bookstore Bistro. Tickets are $25 per person. Then, the Dynamic Les DeMerle Band will perform ´1HZo^\ahb\^3;knm or Demi-____ 2'@^m&hnm&h_&cZbefhg^r*,'gmanlbZlf,2'`rim-)'P^gm[rahkl^-*'nB]hlihm-,'#XXXXLZg]e^kln>b`am e^iaZgmihZ\a^klpZk^/1'@bo^g^p`ngl/2'#Ma^gb`am[^_hk^g]h_Zih^f.0'?hkmng^&m^ee^klk^lb]n^.1'BkZgbZg\hbg.2'Ln``^lmbo^h_ma^lni^k gZmnkZe 60. Was aware of/*'?ZeeZle^^i%pbmahnm/+'?hhmiZkm/,'IbkZm^lZ__bkfZmbo^l/-'?k^g\aobg^rZk]//'?^fZe^`Zf^m^l H APPY H OLIDAYS © StatePoint Media nn n r r The YMCA at Wildlight will host a free community drive-in movie night featur-ing Jim Carrey playing the title role in the live-action film How the Grinch Stole Christmas at 6 p.m. Friday. Food trucks will be onsite for dinner and the winner of a raffle drawing that night will win a three-month YMCA membership. You must register to attend. To do so and pur-chase $5 raffle tickets, text WILDLIGHT to 41444 or visit https://igfn.us/f/32kf/n. The Wildlight YMCA is located at 251 Breezeway St. in Yulee. You should arrive early to reserve your spot.IMAGINE ENTERTAINMENT

PAGE 16

As one of only a few orchestras in American performing for a live audience, the Jacksonville Symphony continues creating live music through December. Although the concerts may look a little different, the Jacksonville Symphony will continue to be a soundtrack for the holiday season. The month will bring the Symphony’s First Coast Nutcracker Suite, Handel’s Messiah, Holiday Pops, and a special New Year’s Eve concert featuring the music of The Rat Pack.W First Coast Nutcracker Suite 8 p.m. Friday2 and 8 p.m. Saturday2 p.m. SundayMoran Theater Deanna Tham, conductor. Enter the magical world of childlike imagination and experience Tchaikovsky’s ballet in the First Coast Nutcracker Suite. A family tradition in Northeast Florida for more than 40 years, this timeless masterpiece comes to life with the only performance in Jacksonville with a full, live symphony orchestra. This year’s production has been redesigned to make sure dancers, musi-cians and the audience are all able to safely enjoy Tchaikovsky’s holiday classic.W Handel’s Messiah7:30 p.m. Saturday, Dec. 123 p.m. Sunday, Dec. 13Jacoby Symphony Hall Gonzalo Farias, conductor; Emily Birsan, soprano; Amanda Crider, mezzo-soprano; Eric Ferring, tenor; David Kravitz, baritone. In a season of social distancing and a pause on choral singing, the Jacksonville Symphony proudly main-tains the heart of one of the great holiday traditions: Handel’s Messiah. World-class soloists and the Symphony perform every-one’s favorite arias, including “Ev’ry val-ley shall be exalted,” “O thou that tellest good tidings to Zion,” “The trumpet shall sound,” and many more. This abridged performance of “The Greatest Story Ever Told” concludes with the uplifting sounds of the “Hallelujah” chorus.W Holiday Pops 7:30 p.m. Thursday, Dec. 1711 a.m. and 7:30 p.m. Friday, Dec. 183 and 7:30 p.m. Saturday, Dec. 193 p.m. Sunday, Dec. 20Moran Theater Gonzalo Farias, conductor. Jacksonville’s favorite musical holiday tradition has been reimagined! Join the Jacksonville Symphony, guest singers and Douglas Anderson dancers for a festive celebration that is sure to put you in the holiday spirit. So ‘let it snow’ at the most wonderful concert of the year!W New Year’s Eve: The Rat Pack 7:30 p.m. Thursday, Dec. 31Jacoby Symphony Hall Gonzalo Farias, conductor; Sal Viviano, vocalist; Nat Chandler, vocalist; Eric Jordan Young, vocalist. The Jacksonville Symphony and guest vocalists straight from Broadway step into the roles of Davis, Sinatra and Martin to celebrate the best of “the Rat Pack” for a very special New Year’s Eve concert. Spend an hour with the music that defined an era and hear the music they made famous. Safety Protocols and tickets: Based on Centers for Disease Control and Prevention guidelines and the results of a survey sent to patrons in June, the Symphony has developed a compre-hensive list of safety protocols that are in place for the 2020-21 season. These protocols include, but are not limited to, a mask requirement while in the Times-Union Center for the Performing Arts, abbreviated programming that lasts 60-75 minutes and physically distanced seating throughout Jacoby Symphony Hall and the Moran Theater. Tickets can be purchased by visiting JaxSymphony.org or contacting the ticket office at 904-354-5547. Nassau County Animal Services will hold a special adoption event 10 a.m. to 3 p.m. Saturday at Pet Supplies Plus, 6500 GA Highway 40 E, Saint Marys, Ga. Aww, Byson would live in a real home. He was picked up as a stray by our officers but not claimed, so Byson is looking for a new home. He is shy and rather frightened here at the shelter. We think Byson is about two years old, and he needs an owner who will give him some TLC and time to adapt to a new home. This handsome man is Tractor. He gets along well with other dogs, is housetrained and knows how to sit on command and catch treats when tossed to him. We took Tractor into the cattery, and he didn’t pay any attention to those nasty, old cats! Tractor has a beautiful gray and white coat. He is going to make some lucky person or family a wonderful pet. Please take a moment to let all your social media friends know about him. Nassau County Animal Services is showing adoptable dogs and cats by appointment only. If you wish to visit a pet, call the shelter at 904-530-6150 to schedule an appointment. To see photos and descriptions of our available pets, visit our Facebook page. Nassau County Animal Services is located at 86078 License Road in Yulee, across State Road 200 from Target, Home Depot and Petco. Shelter hours are 11 a.m.-4 p.m. Tuesday, Thursday and Friday, 1-6 p.m. Wednesday and 11 a.m.-3 p.m. Saturday. r A bottle baby, Jaguar was raised by a wonderful foster family with his best friend, Jeeps, and is a lovable kitten who likes a lot of attention. He has a loud purr and is a pretty mellow guy. Jaguar and Jeeps are bonded and would like to go to a home together. If you are interested in meeting or adopt-ing Jaguar and Jeeps, stop by the Cats Angels Adoption Center or call 904-321-2267 to make an appointment. Volunteers will be wearing masks at the Adoption Center and Thrift Store, and we are asking our shoppers to also wear masks and stay three cat lengths away from other customers. The Adoption Center will be restricted to three visitors or one family at a time. Adoptions will be by appointment and we ask that you submit an application before your appointment is made. Our cats are waiting for their forever homes and you can see them all online at our website. Do you have four hours a week to volunteer at the Cats Angels Thrift Store? Our volunteers have a lot of fun and enjoy helping all the custom-ers. If you interested in finding out more, call 904-321-2267 and leave a message. Cats Angels is a volunteer-based organization helping since 2001 with low cost spay/neuter ser-vices and TNVR (Trap-Neuter-Vaccinate-Return to Caregiver). We receive no local or federal government funding and operate solely on private donations, fund raising, grants and sales from our Thrift Store and your support is appreciated. If you want to know more about how to support or donate to Cats Angels, visit catsangels.com and click on “How To Help,” where you will find many ways to lend a hand. Recycle your alumi-num and cat food cans at the bins in our parking lot at 709 S. Eighth St. We graciously accept donations for cat care and resale items for our Thrift Store. Information about our spay/neuter, TNVR and adoption programs is on our website. Cats Angels welcomes volunteers to help us care for the cats and as retail clerks in our Thrift Store. Our Volunteer Application is online or you can call. Flint is a super-sweet dog who has been good with children he’s met, and he’s ready to be your Santa every day of the year! He’s very affection-ate and would love to cuddle with you. He’s housetrained and walks well on his leash. He has a soft white coat that’s great for petting and freckles on his ears. He’s selective about other dogs and guards things he believes are his, so bring your pet over for a meet and greet to see how they do. He’s about 6 years old and a true rescue dog. He’s already neutered, micro-chipped and up to date on his shots. While Flint waits for a human with whom to snuggle, he’s making do with a stuffed bear – but all he really wants for Christmas is you! Please come see friendly Flint. Meet Skittles! This sweet kitty is looking for a place to call home. She’s a domestic short-hair mix and about 5 years old. She’s a black and tan tabby who loves gentle pets. We love her striking markings and beautiful eyes. Skittles is spayed, micro-chipped and up to date on all vaccines. She’d love to see you today! If you’re interested in seeing her, call us at 904-321-1647 or visit NassauHumane.org to see if she’s at our cattery or one of our remote adoption locations. Our Adoption Center at 639 Airport Road in Fernandina Beach is open from 11 a.m. to 5 p.m. Tuesday through Thursday, 11 a.m. to 6 p.m. Friday, and 11 a.m. to 4 p.m. Saturday and Sunday; the center is closed Monday. That’s an extra half-hour on weekday mornings (except Monday) and an extra hour on Sunday afternoon. We are abiding by social distance guidelines, and facemasks must be worn in the shelter. If you don’t have one, we will be glad to provide you a disposable mask for free at the door. We are abid-ing by social distance guidelines, and facemasks must be worn in the shelter. If you don’t have one, we will be glad to provide you a disposable mask for free at the door. To maintain social distancing, we are limiting the number of clients in the shelter at any one time. Please consider making an appointment to secure your place in case the shelter is busy. You can call us at 904-321-1647 or email us at info@nassauhumane.org. You can check out our adoptable pets anytime at NassauHumane.org, and follow us on Facebook. Come meet your new best friend! nnnnn Nassau Humane Society Second Chance Re-Sale Store and The Closet always need volun-teers and donors! Make new friends and choose from front of store or behind the scenes. We are the primary source of funding for the Nassau Humane Society and 100% of sales go directly to the animals. For more information, call 310-9627. nnn Bring gently used items to donate to Second Chance resale store, 1002 S. 14th St., to benefit the Nassau Humane Society’s programs. Free pickup is available by calling 321-0022. nnnn Cats Angels is in need of volunteers for our Thrift Store and for cat care. If you like work-ing in a retail setting, we have shifts available Monday through Saturday from 11 a.m. to 2 p.m. and from 2 to 5 p.m. If those hours don’t fit in your schedule but you would still like to help in the Thrift Store, let us know. The kitties need your help too. We have two cleaning shifts (morn-ing and evening) every day and the cats and our volunteers are always happy to meet new people. Our volunteer application is available online at our website at bit.ly/2ijwWGf or at the Cats Angels Thrift Store, 709 S. Eighth St. We’re open 11 a.m. to 5 p.m. Monday through Friday and 10 a.m. to 5 p.m. Saturday. For more information, call us 321-2267. nnn n Cats Angels provides low-cost spay and neuter and TNVR (Trap-Neuter-Vaccinate-Return to Caregiver) services through First Coast No More Homeless Pets. Call 321-2267. You can show your support for rescue animals and help with their medical care at the same time by participating in two holiday fundraiser benefiting the Nassau Humane Society, accord-ing to a news release. NHS is offering T-shirts that can be ordered online, and proceeds will benefit the Milo’s Fund for medical expenses at the organization. Many of the animals NHS takes in each year need medical attention, including heartworm treatment. The shirts come in five different colors, and sizes range from XS to 4XL. Prices start at $24.99, plus shipping. Hoodies and sweatshirts are also avail-able. The shirts are only available for a short time and will begin shipping Dec. 22. To order, visit nassauhumane.org. NHS also is sponsoring an Ugly Christmas Sweater Contest to raise funds for the shelter. Take a picture of your pet in his or her best ugly sweater and NHS staff will judge the best photo. The winner will take home a prize. Entries are $20 each and will give back to shelter animals in need. Entry fees can be paid by visiting the shelter at 639 Airport Road in Fernandina Beach, calling 904-321-1647 or going online to nassauhumane.org/donate. Entries can be emailed to media@nassauhumane.org. The contest ends Dec. 22. SUBMITTED Ferst Readers of Nassau County will host Storytime with Santa at 11 a.m. Saturday, Dec. 19, via Zoom. The cost is $36 per household and the price for this interactive journey with Santa and Mrs. Claus reading winter stories, “snack time” with Santa and a magical rendition of “’Twas the Night Before Christmas” includes both your Zoom “ticket” and a donation to adopt a reader to receive books for one year. Visit https://bit.ly/FerstReadersSanta. Author Jane R. Wood will present “Reinventing Myself After Losing My Dream Job” at the January meeting of the Eight Flags Charter Chapter of the America Business Women’s Association, according to a news release. Wood will share her journey to becoming an award-winning author after being downsized from a corporate position she loved. “Because of COVID-19, some of our members are currently finding themselves at similar crossroads. If you are contemplating a career change or are facing a forced fur-lough causing you to reconsider your chosen profession, Jane’s enthusiasm, creativity, and her amazing story of re-invention will inspire you,” Marie Fenn, the local chapter’s profes-sional development chairwoman, said in the release. The in-person meeting is open to members and guests. Check-in and networking will begin at 5:30 p.m. Tuesday, Jan. 12, at the Fernandina Beach Golf Club, 2800 Bill Melton Road, with the busi-ness meeting set for 6 p.m. A simultaneous livestream via Zoom will be available with registration. Contact Lillie Rogers at 904-233-8810 to register or for information. Wood is a former teacher, newspaper reporter and television producer who has used her previous jobs and experiences to become a successful author. She has written five award-winning juvenile fiction books in which she weaves history and science into stories filled with mystery, adventure and humor for young readers ages 8-14. Wood earned a Bachelor of Arts from the University of Florida and a M.Ed. from the University of North Florida. She has served in leadership positions with numerous non-profit organizations and is the Florida Authors and Publishers Association’s past-president. The Amelia Island Book Festival has chosen Wood numerous times as one of its Authors in Schools presenters. She is also a past recipi-ent of the AIBF’s Literacy Champion Award. The author lives in Jacksonville with her husband, Terry, and is the mother of two grown sons and five grandchildren. Her web-site is janewoodbooks.com. The Eight Flags Charter Chapter has been serving businesswomen in Nassau County for more than 51 years. They meet monthly on the second Tuesday of every month and now offer a hybrid of Zoom and in-person options. ­­ rrrnrr Wood €nn‚ƒn SUBMITTED„…† nn  n JACKSONVILLE SYMPHONY The Jacksonville Symphony will continue its 40-year tradition with a produc-tion of First Coast Nutcracker Suite this weekend. Print Edition PLUS FREE E-EDITION Contact us Today! 261-3696 fbnewsleader.com SAVE UP TO 62%

PAGE 17

LEGAL NOTICES LEGAL NOTICE ADVERTISING DEADLINE IS NOON THE FRIDAY BEFORE THE NEXT WEDNESDAY PUBLICATION. CALL 261-3696 FOR EARLY HOLIDAY WEEK DEADLINES. LEGAL NOTICES ARE ALSO PUBLISHED AT www.fbnewsleader.com LEGAL NOTICE ADVERTISING DEADLINE IS NOON THE FRIDAY BEFORE THE NEXT PUBLICATION NO TI CE UN DE R FIC TI TIOUS NAME LA W PURSUA NT TO SECTION 865.09, FLORID A S TAT UT ES NO TI CE I S HE RE BY G IV EN th at t he u nder si gn ed , de si ri ng to e ng ag e in b us ines s un de r th e fi ct itio us n am e of Fly2H op e lo ca te d at 1507 T om lin so n Rd , i n th e Co un ty of Na ss au , in t he Cit y of Hilli ar d, 32046 i ntend s to r eg is te r th e sa id n am e wi th t he Div is io n of Co rp or at io ns o f th e Flo ri da De pa rt m ent o f St at e, Tallaha ss ee, Flo ri da . Da te d at J ac ks on ville t hi s 3r d da y of D ec em be r, 2020. Mich ael A . L afay et te Fly 2H op e F NL 1 T 12-09-202 0 #613161 NO TI CE UN DE R FIC TI TIOUS NAME LA W PURSUA NT TO SECTION 865.09, FLORID A S TAT UT ES NO TI CE I S HE RE BY G IV EN th at t he u nder si gn ed , de si ri ng to e ng ag e in b us ines s un de r th e fi ct itio us n am e of T he P al et te S ho p lo ca te d at 494 2 Fi rs t Coas t Hw y, S ui te 4 , in t he Co un ty o f Na ss au , in t he City of F er na ndin a Be ach, Flo ri da 32034 i ntend s to r eg is te r th e sa id n am e wi th t he Div is io n of Co rp or at io ns o f th e Fl or id a De pa rt m ent o f St at e, Tallaha ss ee, Flo ri da . Da te d at F er na ndin a Be ac h th is 1 st day o f De ce mbe r , 2020. Em ma Collin s, S ol e Me mb er of E mm a Co llin s Ar t , L LC Em ma Collin s Ar t , L LC FN L 1T 12-09-202 0 #612835 NO TI CE UN DE R FIC TI TIOUS NAME LA W PURSUA NT TO SECTION 865.09, FLORID A S TAT UT ES NO TI CE I S HE RE BY G IV EN th at t he u nder si gn ed , de si ri ng to e ng ag e in b us ines s un de r th e fi ct itio us n am e of Vill a So leil A mel ia l oc at ed a t 124 4 Har ri so n Po in t Tr ail , in t he Co un ty o f Na ss au , in t he City of F erna nd in a Be ac h , 32034 in te nd s to r eg is te r th e sa id na me wit h th e Di vi si on o f Co rpo ra ti on s of t he Fl or id a De pa rt m ent o f St at e, T allahas s ee, Fl or ida. Da te d at J ac ks on vill e th is 2n d da y of D ecembe r, 2020. Jo se ph Q ua tt l eb au m Hu rr ican e Sh oa l s Re al ty Pa rt ne rs , L LC FN L 1T 12-09-202 0 #613070 BO ARD OF COUN TY CO MM ISSIONERS NA SSAU COUN TY , FLORIDA IN VI TA TIO N TO B ID ( IT B) NO TI CE I S HE RE BY G IV EN th at t he B oa rd o f Co un ty Co mm issio ner s o f Na ss au Co un ty , Flor id a invi te s s ea le d bids f or : PA VE ME NT R EH AB F OR CR 108 F RO M MI DD LE R D. T O US -1 7 BI D NO . N C2 0-025 Fo r de ta ile d info rm at ion re ga rd in g th e bi d du e da te an d bi d re qu ir ement s f or t hi s IT B , p leas e visit t he N as s au Co un ty s w ebs it e at h ttp :/ /w ww .n as s auco un ty fl.co m or c on ta ct t he P ro cu re m ent D ep ar tm en t at 904-5306040. Bi d info rm at io n an d do cu me nts c an b e ob ta in ed fr om h tt ps ://www .d em an ds ta r. co m/ . AT TE ST : JO HN A . C RA WF OR D EX -O FFI CI O CL ER K TH OM AS R . FO RD CH AI RM AN BO AR D OF C OU NT Y CO MMI SS IO NE RS NA SS AU C OU NT Y, F LO RI DA FN L 4T 1125 & 1202-09-16-2020 #611082 EAST NA SSAU ST EW AR DSHIP DIST RI CT BO ARD OF SUPE RV ISORS FISC AL YE AR 2020/2021 MEETING DATE S Th e Bo ar d of S uper vi so rs (B oa rd ) of t he E as t Na ss au St ew ar ds hi p Di st ri ct ( Di st ri ct ) will h ol d t hei r re gu la r m eet in gs f or Fis ca l Ye ar 2 020/2 02 1 at F er nandin a Be ac h Mu nici pa l Ai rp or t, 700 Air po rt R oa d, Fe rn an dina B each , Fl or id a 32034 o n th e th ir d Th ur sd ay at 10:00 a .m ., u nl es s ot her wise in dica te d, a s fo llo ws : De ce mb er 17, 202 0 Ja nu ar y 21, 202 1 Fe br ua ry 18, 202 1 Ma rc h 18, 202 1 Ap r il 15, 202 1 Ma y 20, 202 1 Ju ne 17, 202 1 July 15, 202 1 Au gu st 19, 202 1 Se pt embe r 16, 202 1 Th e pu rp os e of t he m eet in gs is fo r th e Bo ar d to c on si der a ny b us ines s wh ic h ma y pr op er ly c om e befo re it . T he m eet ings a re o pe n to t he public a nd w ill be c onduct ed in acco rd an ce wit h th e pr ov isi on o f Flor id a La w. Th e m eet ings m ay b e cont inue d to a d at e, time , a nd p lace to be spe ci fi ed o n th e re co rd at th e m eet ing. A co py o f th e ag en da f or t he se m eetin gs ma y be o bt ai ne d by c on ta ct in g th e o ffi ce s of t he Dis tr ic t Ma na ge r , W ra t hell , H un t & As so ci at es , L LC , 2 30 0 Gl ades R oa d , S ui te 410W , Bo ca R at on , Flor id a 33431 , (5 61) 571-0010, d ur in g no rm al bu si nes s ho ur s or b y visi ti ng th e Di st ri ct s we bs it e, h ttp s ://e as tn as sa usd.net /. T her e ma y be o cca si on s wh en o ne or m or e Su pe rv is or s or s ta ff will p ar ti cipa te b y te le ph on e. P ur su an t to p ro vi si on s of t he A me ri cans wit h Di sa bilitie s Ac t, a ny p er so n re quir in g sp ec ia l ac co mm od ati on s at t he m ee ti ng s be caus e of a d is abilit y or p hy si ca l im pair me nt s ho ul d co nta ct t he Dis tr ic t O ffi ce a t (561) 571001 0 at l ea st 4 8 ho ur s pr ior t o th e me et in gs . I f yo u ar e he ar in g or s peec h im pair ed , pl ea se c on ta ct t he Flo ri da Re la y Se rv ic e by dialin g 711, or 1800-955-8771 ( TT Y) / 1 800955 8770 ( Vo ice) , fo r ai d in c on ta ct in g th e Di st ri ct O ffi ce . A pe rs on w ho d ecides t o appe al a ny d ec isio n ma de a t th e m eet ings wit h re sp ec t to an y ma tt er c on si de re d at t he m eet ings i s advi se d th at p er so n will n ee d a re co rd o f th e pr oc ee ding s an d th at a cco rd in gly , t he p er so n ma y n eed t o ens ur e th at a v er ba ti m re co rd o f th e pr oc eed in gs i s ma de , includin g th e te st im on y an d ev id en ce up on w hich s uc h appeal i s to be bas ed . Di st ri ct Man ager FN L 1T 1209-202 0 #613080 NO TI CE OF PUBLIC HEA RI NG NO TI CE I S HE RE BY G IV EN t ha t on T hu rs da y, t he 17t h da y of D ec embe r 2 020 , a t 6:30 P .M . t he Co ndit io na l Us e an d Va ri anc e Bo ar d of N as sa u Co un ty will h ol d a public he ar in g at t he C om mi ss io n Ch am be rs , J am es S . P ag e Go ve rn me nt al C om pl ex , 96135 N as sa u Pl ac e , Y ulee, Fl or ida, 32097 t o c on si de r an applicat io n fo r a Co ndit io na l Us e , C U 2020-032 . T he Pu blic i s in vi te d to a tt end t he me et in g c on c er ning t he follo wi ng d esc ri be d pr op er ty i n Na ss au Co un ty : Su bjec t Pr op er ty L oc at io n: 86109 Ca rd in al Rd, Yu le e, F L 320 97 . Pa rc el I D# 042N 27-4290-0031-0000 Ac ti on R eque st ed : CU 2020-36 i s a re ques t fo r a c on di ti on al u se p er mi t pu rsu an t to S ec ti on 28.14( J) o f th e Na ss au C ount y La nd D eve lo pm en t Co de t o allo w fo r a mo t her -i nla w dw ellin g in th e Op en R ur al Z on in g Di str ic t. Th is a pplicat io n is file d by : Ma rr ia n Ja me s (O wner /A pplic an t) , 86109 Ca rd in al Rd, Yu le e, F L 320 97 Th e public i s invi te d to be p re se nt a nd b e he ar d. Co pies o f th e applicat io n an d c op ie s of t he c ri te ri a th at ar e ap p licable t o th e appl icat io n ar e availabl e at t he De pa rt m ent o f Pl an ni ng & Ec on om ic O ppo rt un it y lo cat ed a t 96161 N as sa u Pl ace, Yu lee , F L 32097, o r (904 ) 53 06300. I nd ividuals w ho c an no t at te nd t he p ublic h ea ri ng ma y pr ov id e writ te n c om m ent s to t hi s a ddr es s or b y ema il to : p la nni ng in fo @n as sa ucou nt yf l.c om . W ri tt en c om m ent s bec om e a pa rt o f th e re cor d an d ar e su bjec t to Fl or ida' s Pu blic R ec or ds l aw , Ch ap te r 119. 07 (1 )( a), F.S . Th is hea ri ng m us t be c on duc te d as a q ua si -j udicia l he ar in g . A ny q ue st io ns a s to pr oc ed ur es m ay b e ob ta in ed fr om t he D epar tm ent o f Pl an ni ng & E c on om ic O ppo rt unity . I nt eres te d pa rt ie s sh ou ld lim it c on ta c t wi th C ondi ti on al Us e an d Va ri anc e Bo ar d Me mb er s an d wi th C ou nt y Co mm is si o ner s on t hi s to pi c to p ro pe rl y no ti c ed p ublic he ar in g or t o wr it te n co mmu ni cat io n in car e of t he N as sa u Co un ty D epar tm ent o f Pl an ni ng & E c on om ic O ppo rt unity , 9 6161 N as sa u Pl ace, Yu le e, F L 320 97 . Pe rs on s wi th dis abilit ie s re quir in g ac c om mo da ti on s in or de r to p ar ti c ipat e in t hi s pr og ra m or ac ti vi ty s ho ul d c on ta c t th e As sist an t Co un ty Ma na ge rs O ff ic e (9 04 ) 5306010 , o r Fl or id a Rela y Se rv ic e (1 800-955-8771) a t leas t tw ent yfo ur ( 24 ) ho ur s in a dva nc e to r eque st s uc h ac c om mo da ti on . IF A P ER SO N WI SH ES T O AP PE AL A NY D EC ISIO N MA DE BY T HE B OA RD , AG EN CY O R CO MMI SS IO N WI TH R ES PE CT TO A NY M AT TE R CO NS ID ERED AT S UC H ME ET IN G OR H EARIN G , H E WI LL NE ED A R EC OR D OF T HE P RO C EED IN GS A ND FO R TH AT P UR PO SE , MA Y NE ED T O EN SU RE T HA T A VE RBA TI M RE CO RD O F TH E PR OC EED IN GS I S MA DE , W HI CH RE CO RD I NC LU DE S TH E TE ST IMO NY A ND E VI DE NC E UP ON WH IC H TH E AP PE AL I S TO B E BA SE D. Th e Co nd itio na l Us e an d Va ri an c e Bo ar d ma y c on ti nu e he ar in g on t hi s ma tte r. CO ND ITIO NA L US E AN D VA RI AN CE B OA RD OF NA SS AU C OU NT Y, F LO RI DA /s/ O rl ando Avila It s : C ha ir ma n FN L 2T 12-02-09-2020 #612025 IN THE CI RC UIT COUR T OF TH E FOUR TH JUDICIAL CI RC UIT, IN AND FOR NA SSAU COUN TY FLORIDA CAS E NO.: 45-2019 -DP-2 9 IN T HE I NT ER ES T OF : K.M. B. DO B : 07/ 10 /1 3 A MI NO R CH IL D SU MMO NS AND N OT IC E OF AC TI ON B Y PU BL IC AT IO N FO R TE RM IN AT IO N OF PA RE NTAL R IG HT S TH E ST AT E OF F LO RI DA TO : Jam e s Ed wa rd B ro dg en A dd re ss u nkno wn YO U AR E HE RE BY N OT IF IE D th at a p e ti ti on h as b ee n file d in t he a bo ve -s ty le d Co ur t by th e S TATE O F FL OR ID A DE PA RT ME NT O F CH IL DR EN A ND FA MI LI ES f or te rm inat io n of pa re nt al r ight s an d pe rm ane nt c om mi tm e nt f or s ub se que nt a dopt io n of t he ab ov e -n am e d fe ma le c hild J. E. B. b or n on J ul y 10, 2013 i n Mo nt go me ry C ou nt y, A laba ma . Y ou a re he re by c om ma nde d to a ppe ar be fo re th e Cir cuit J ud ge Le ste r B. Ba ss a t the R ob e rt M . F os te r Ju st ice Ce nt e r, T hi rd Fl oor Co ur tr oo m A, 76347 Ve te ra ns Way , Y ulee Flo ri da 32 097 a t th e h ou r of 9 :0 0 a.m . o n Janua ry 8 , 2021. Y ou m us t ap pe ar a t th e h ear in g on t he da te a nd time s pe ci fi e d. P ur su an t to t he N as sa u Co un ty Ad mi ni st ra ti ve O rd e r 2 0201, th is he ar in g sh all be c on duct e d e it he r by te leph on ic me an s or vide o co nf e re nc e ut ilizin g th e Z oom A pplicat io n. Th e re i s no c os t to u se t he Zo om a pplicat io n. F or i ns tr uc ti on s on h ow t o si gn u p fo r Zo om , p leas e vis it h ttp s ://z oom .u s/ re so ur ce s. Ple as e n am e y ou r Zo om p ro file a cco rd ingl y so y ou c an be e as ily i de nt if ie d by J ud ge Ba ss . T o appear be fo re Ju dg e B as s vi a th e Z oom A pplicat ion , t he p ar ti e s ar e re sp on si ble f or d ow nl oa di ng th e Z oom A pplic at io n an d th e n us in g the follo wi ng i nv ita ti on i nf or ma ti on : h ttp s ://z oom .u s/ j/9 1662 5 179 3 4?pw d=RF Uy Zn JT NG lQ SE lxZG1M RF Yx Nz Zk dz 09 Me eti ng ID : 916 6251 7934 Pa ss wo rd : 254640 Th os e wit ho ut a cce ss t o th e i nte rn e t ma y call eit he r of th e fo llo wi ng n umbe rs : Di al b y yo ur l oc at ion +1 312 626 6799 US ( Ch icag o) +1 9 29 205 6099 U S (N e w Yo rk ) +1 3 01 715 8592 U S (G e rm an to wn ) +1 346 248 7799 US ( Ho us to n) +1 669 900 6833 US ( Sa n Jo se ) +1 253 215 8782 US ( Ta co ma ) 877 853 5247 US Tollfr ee 888 788 0099 US Tollfr ee YO UR F AI LU RE T O PE RS ON AL LY A PP EA R FO R TH IS A DV ISO RY H EARI NG C ON ST IT UT ES CO NS EN T TO T HE T ER MI NA TI ON O F PA RE NTAL R IG HT S TO TH IS C HI LD . I F YO U FA IL T O AP PE AR O N TH E DA TE A ND TI ME S PE CI FI ED Y OU M AY LO SE A LL L EG AL R IG HT S TO TH E CH IL D NA ME D IN T HE P ET ITI ON P UR SU AN T TO S EC TI ON 39.801( 3)(d), F LO RI DA ST AT UT ES . Pu rs uant t o se ct io ns 39.802 (4 )(d ) an d 63.082( 6)(g), Flo ri da S ta tu te s yo u ar e he re by in fo rm e d of t he a vailabilit y of privat e p lace me nt wit h an ad op ti on e nt ity , a s de fi ne d in se ct io n 63 .032(3) , F lo ri da St at ut es . Y ou h ave t he r ight to be re pr e se nte d by a n at to rn e y in t hi s ma tte r an d by co ur tappo in te d co un se l if yo u ar e i ndig ent . I nd ividuals wi th dis abilit ie s ne edi ng a re as on ab le a cco mm od at io n to par ti cipa te i n th is p ro cee din g sh ou ld c on ta ct t he A DA C oor dina to r as s oon a s po ssi ble , t e leph on e (9 04) 5484600; o r if h ear in g or v oi ce im pair e d call 711 . WI TN ES S my h an d as cle rk of s ai d Co ur t an d th e S eal th e re of , t hi s 20t h da y of No ve mb er , 2020. Jo hn C ra wf or d as Cle rk o f Sa id C ou rt By : I vy C ar te r As D epu ty Cle rk L . A nn H end ri ck s , E sq ui re Se ni or A tt or ne y/ Child re n' s Le gal Se rv ice s Fl or ida Ba r No .: 0834394 ST AT E OF F LO RI DA DE PA RT ME NT OF CH IL DR EN A ND F AM ILIE S 96026 Lo ft on S quar e C ou rt Yu lee , F L 320 97 (9 04)557-910 2 FN L 4T 12-02-09-16-23-2020 #611823 IN THE CI RC UIT COUR T OF TH E FOUR TH JUDICIAL CI RC UIT, IN AND FOR NA SSAU COUN TY FLORID A. CAS E NO.: 45-2019 -DP-2 6 IN T HE I NT ER ES T OF : D. P. R ., I II DO B : 0 8/ 23/2013 D. P. R. DO B : 0 9/ 19/2016 D. P. R. DO B : 1 0/ 22/2018 MI NO R CH IL DR EN SU MM ON S AN D NO TI CE OF A CT IO N BY P UB LI CA TI ON FO R TE RM IN AT IO N OF PA RE NTAL R IG HT S TH E ST AT E OF F LO RI DA TO : J enni fe r An n Wylie Da ry l Pr es to n Robe rt s , J r. A ddr es ses un kn ow n YO U AR E HE RE BY N OT IF IE D th at a p et itio n ha s been file d in t he a bo ve -s ty le d Co ur t by th e ST AT E OF F LO RI DA D EPA RT ME NT O F CH IL DR EN A ND FA MI LI ES f or t er mi na ti on o f pa re nt al r ight s an d pe rm an ent c om mi tm en t fo r su bs equ en t ad op ti on o f th e ab ov e-na me d ma le child re n D. P. R. , I II , b or n on A ugus t 23, 2013 i n Or ange C ou nt y, Flo ri da ; D .P.R. , b or n Se pt em be r 19, 201 6 in O ra ng e Co un ty , Fl or ida; a nd D .P .R ., b or n on Oc to be r 22 , 2 01 8 in D uv al Co un ty , Fl or ida. Yo u ar e he re by c om ma nd ed t o ap pe ar b ef or e th e Ci rc ui t Judge Le st er B . Ba ss a t th e Ro be rt M . Fo st er J us ti ce C enter ,76347 Ve te ra ns W ay , Y ul ee Flo ri da 32097 a t th e ho ur o f 9: 00 a.m . on D ec em be r 18 , 2 020 . Y ou mu st a ppear a t th e he ar in g on t he d at e an d ti me s pe ci fi ed . P ur su an t to t he N as sa u Co un ty A dm inis tr at iv e Or de r 20201 , t hi s hea ri ng s hall b e co nduc te d ei th er b y te le ph on ic m eans o r vi de o co nfe re nce ut ili zi ng t he Z oo m Ap plicat ion . T her e is n o co st t o us e th e Zo om a pp li ca ti on . Fo r in st ru ct io ns o n ho w to sig n up fo r Zo om , p leas e vi si t h ttp s ://z oom .u s/ re so ur ce s. Pl ea se n am e yo ur Z oo m pr ofile a cco rd ingl y so y ou c an be e as ily id ent if ie d by J ud ge Ba ss . T o appear b ef or e Jud ge B as s vi a th e Z oom A pplicat ion , t he p ar ti es a re r esp on si bl e fo r do wn lo adin g th e Z oom A pplic at io n an d t hen u si ng t he follo wi ng i nv ita ti on i nf or ma ti on : Th os e wi th ou t acce ss t o th e in te rn et m ay call eith er o f th e fo llo wi ng n umbe rs : Di al b y yo ur l oc at ion +1 312 626 6799 US ( Ch icag o) +1 929 205 6099 US ( Ne w Yo rk ) +1 301 715 8592 US ( Ge rm an to wn ) +1 346 248 7799 US ( Ho us to n) +1 669 900 6833 US ( Sa n J os e) +1 253 215 8782 US ( Ta co ma ) 877 853 5247 US Tollfr ee 888 788 0099 US Tollfr ee YO UR F AI LU RE T O PE RS ON AL LY A PP EA R FO R TH IS A DV ISO RY H EARI NG C ON ST IT UT ES CO NS EN T TO T HE T ER MI NA TI ON O F PA RE NTAL R IG HT S TO TH ES E CH IL DR EN . I F YO U FA IL TO A PP EA R ON T HE D AT E AN D TI ME S PE CI FI ED Y OU M AY LO SE A LL L EG AL R IG HT S TO TH E CH IL DR EN NAM ED I N TH E PE TITI ON P UR SU AN T TO S EC TI ON 39.801( 3) (d), F LO RI DA ST AT UT ES . Pu rs uant t o se ct io ns 39.802 (4 )(d ) an d 63.082( 6)(g), Flo ri da S ta tu te s yo u ar e hereb y in fo rm ed o f th e availabilit y of pr ivat e placem en t wi th a n ad op ti on e nt ity , a s de fi ned i n se ct io n 63 .032(3) , F lo ri da St at ut es . Y ou h av e th e ri gh t to b e re pr es en te d by a n at to r ney i n th is ma tte r an d by co ur tappo in te d co un se l if yo u ar e indigent . I nd ividuals wi th dis abilit ie s n eedin g a re as on ab le a cco mm od at io n to par ti cipa te i n th is p ro ce ed in g sh ou ld c on ta ct t he A DA C oor dina to r as s oon a s po ssi ble , t el ephone (9 04) 5484600; o r if hea ri ng o r vo ic e im pair ed call 711 . WI TN ES S my h an d as cle rk of s ai d Co ur t an d th e Se al t her eo f, t hi s No ve mb er 12, 2020 da y of No ve mb er , 2020. J oh n Cr aw fo rd as Cle rk o f Sa id C ou rt By : I vy C ar te r As D eput y Cl er k L . A nn H end ri ck s , E sq ui re S eni or A tt or ne y/ Child re ns L egal Se rv ices Fl or ida Ba r No .: 0834394 ST AT E OF F LO RI DA DE PA RT ME NT O F CH IL DR EN AN D FA MI LI ES 96026 Lo ft on S quar e Co ur t Yu le e, F L 320 97 (9 04)557-910 2 FN L 4T 1118-25 & 1202-09-202 0 #609887 IN THE CI RC UI T COUR T FOR NA SSAU COUN TY , FLORIDA PRO BAT E DI VISION FILE NO. 20CP -000423 DI VISION: IN RE: E ST AT E OF JO HN D . H EG AR TY , JR., De ceas ed . NO TIC E TO C RE DI TO RS (Sum ma ry A dm inist ra tio n) TO A LL P ER SO NS H AV IN G CL AI MS O R DE MA ND S AG AINS T TH E AB OV E ES TATE : Yo u ar e hereb y no tifie d t hat a n Or de r of S um ma ry Ad mi ni st ra tio n ha s be en ent er ed i n t he e st at e of JOH N D. HE GA RT Y , J R. , d ecea se d , F ile Nu mb er 20CP 000423 ; b y the Ci rc uit C ou rt f or N as sa u Co unt y, Flo ri da , P ro bat e Di vi si on , t he a ddr es s of w hich i s 76347 V et er an s Wa y, Yu lee, Fl or id a 32097 ; t ha t t he d ec ede nt s dat e of d eat h wa s July 18 , 2020 ; t hat t he t ot al v alue of t he e st at e is p er so na l pr op er t y le ss t ha n $ 75,000 , a nd t hat t he n am es a nd a ddr es ses o f t ho se t o wh om it h as be en a ss igned b y su ch o rd er ar e: Be ne fi ci ar ies : A ddr es s SU ZA NN E A . P ER EG RI NE , JOH N D . H EG AR TY , I II , H OL LY A. JE HL E , C OTR US TE ES O F TH E JO HN D . H EG AR TY , JR. T RU ST DA TE D JU NE 9, 1982, AS A ME ND ED 934 Cr ys tal D ri ve Fr an kf or t , M I 4963 5 SU ZA NN E A . P ER EG RI NE 934 Cr ys tal D ri ve Fr an kf or t , M I 4963 5 JO HN D . H EG AR TY , I II 443 Be achs id e Pl ac e Am e lia I sl and, F L 3203 4 HO LL Y A . J EH LE 1109 Te rr ac e La ne Gl en vi ew , IL 600 25 AL L INTE RE ST ED P ER SO NS AR E NO TI FI ED T HA T: Al l cr ed it or s of t he e st at e of t he d ec ed ent a nd p er so ns ha vi ng claim s or d em ands agains t t he e st at e of t he de cede nt ot he r t ha n t ho se fo r wh om p ro visi on f or f ul l pa ym en t w as m ad e in t he Or de r of S um ma ry A dm inist ra t io n mu st file t hei r clai ms with t hi s cour t W ITHIN T HE T IM E PE RI OD S SE T FO RT H IN F LO RI DA ST AT UT ES S EC TI ON 733 .7 02 . AL L CL AI MS AND D EM AN DS NO T SO F IL ED W IL L BE F OR EV ER BA RRE D. N OT WI TH ST AN DIN G ANY O TH ER A PP LI CA BL E TI ME P ER IO D , A NY C LA IM FI LE D TW O (2 ) YE AR S OR MORE A FT ER T HE D ECEDEN TS DA TE OF DE AT H IS BA RRE D. Th e dat e of fir st p ub lic at io n of t hi s No tic e is : D ecem be r 9t h, 2020. At t or ney f or P er so ns Givin g No t ice: Ro be rt H. T ru de au At t or ney f or P et itio ne rs Em ail: rtru deau @p fh glaw.co mS econ da ry E ma il: k ba ca @p fh glaw.c om Fl or ida Ba r No . 0889091 Pu rc ell, Fla na ga n, Hay & Gr eene, P.A . 1548 La ncas t er T er ra ce Jack so nv ille , Flor ida 322 04 Te le ph on e: ( 904) 355-0355 Pe rs on s Gi vi ng N ot ic e: SU ZA NN E A . P ER EG RI NE 934 Cr ys tal D ri ve Fr an kf or t , M I 4963 5 JO HN D . H EG AR TY , I II 443 Be ac hs id e Pl ac e Am e lia I sl and, F L 3203 4 HO LL Y A . J EH LE 1109 Te rr ac e La ne Gl en vi ew , IL 600 25 FN L 2T 12-9-16-2020 #613129 IN THE CI RC UIT COUR T OF TH E FOUR TH JUDICIAL CI RC UIT IN AND FOR NA SSAU COUN TY , FLORIDA CA SE NO.18CA000475AXYX U. S . B AN K NA TI ON AL A SS OC IAT IO N , A S TR US TE E FO R ST RU CTU RE D AS SE T SE CU RI TI ES C OR PO RA TI ON M OR TG AG E PA SS TH RO UG H CE RT IF IC AT ES , SE RI ES 2007BC 3, Pl aint iff, VS . JA NI CE C . SC OT T A/ K/ A JA NIC E C . J ON ES A /K /A J ANI CE SC OT T A/ K/ A JA NI CE ; e t al. , De fend an t (s ). NO TIC E OF F OR EC LO SU RE SA LE P UR SU AN T TO C HA PT ER 45 NO TI CE I S HE RE BY G IV EN t hat s al e will b e ma de p ur su ant t o an O rd er o r Fina l Ju dg m ent . F in al J ud gm en t wa s awar de d on N ov em be r 19 , 2 020 i n Ci vi l Ca se N o. 1 8CA 000475A XYX, o f t he Cir cuit Co ur t o f t he F OU RT H Judicial Ci rc uit i n an d fo r Na ss au Co unt y, Flo ri da , w he re in , U. S. BA NK NAT IO NA L AS SO CI ATI ON , AS T RU ST EE F OR S TR UC TU RE D AS SE T SE CU RI TI ES C OR PO RA TI ON M OR TG AG E PA SS TH RO UG H CE RT IF IC AT ES , S ERI ES 2007BC 3 is t he Plaint if f, an d JA NI CE C . SC OT T A/ K/ A JA NI CE C . JO NE S A/ K/ A JA NIC E SC OT T A/ K/ A JA NI CE ; U NKN OW N HE IR S , B ENEF ICIA RI ES , DE VI SE ES , S URVI VI NG S PO US E, GR AN TE ES , AS ; E RN ES T HA DL EY S CO TT ; D EN NI S LE E SC OT T ; G EO RG E MI TC HE LL SC OT T; A NY AND A LL U NKN OW N PA RT IE S CL AI MI NG BY , TH RO UG H, U ND ER AND AG AINS T TH E HE RE IN N AM ED IN DI VI DU AL D EF EN DA NT (S ) WH O AR E NO T KN OW N TO BE DE AD O R AL IV E , W HE TH ER SA ID U NK NO WN P AR TIE S MA Y CL AI M AN IN TE RE ST A S SP OU SES , HE IR S DE VI S EES , GR AN TE ES , OR O TH ER CL AI MA NT S ar e De fe ndant s. Th e Cl er k of t he C ou rt , Jo hn A . C ra wf or d will s el l to t he hig he st b idde r fo r ca sh a t www. na ssa ucle rk .r ealf or ecl os e. co m o n Ja nu ar y 7, 2021 a t 11:30:00 A M ES T t he fo llo wi ng d es cr ibed r ea l pr op er ty as s et f or th in said Fi na l Judg me nt , t o wit : A PO RT IO N OF S EC TI ON 8 & SE CT IO N 17 , TO WN SH IP 2 NO RT H, R AN GE 2 7 EA ST , NA SSA U CO UN TY , F LO RI DA . SA ID PO RT IO N BE IN G MO RE P AR TI CU LA RL Y DE SC RI BE D AS FOL LO WS : FO R A PO IN T OF R EF ER EN CE CO MME NC E AT T HE SO UT HE AS T CO RN ER O F SE CTI ON 8 , TH EN CE N OR TH 89'-55'-00” W ES T , A D ISTA NC E OF 8 6. 31' F EE T TO T HE P OI NT OF B EG IN NING . FR OM T HE P OI NT O F BE GI NN IN G, T HE NC E NO RT H 03'22'-26” E AS T, A D ISTA NC E OF 219. 02 ' FE ET T O A PO IN T; TH EN CE S OU TH 83' -1 9' 03” EA ST , A D IS TA NC E OF 140 .17' FE ET T O TH E SO UT HE RL Y ED GE OF A G RA DE D RO AD ( PO ST ED CL YD E HI GGE NB OT HA M RO AD ) ; T HE NC E NO RT H 60'10'-43” W ES T , A D ISTA NC E OF 37. 38 ' FE ET T O A PO IN T; TH EN CE A LO NG S AI D SO UT HE RL Y ED GE O F RO AD , NO RT H 48 '20' -3 4” W ES T A DI STA NC E OF 33.72' F EET T O A PO INT; T HE NC E NO RT H 31'22'-35” W ES T , A D ISTA NC E OF 41. 14 ' FE ET T O A PO IN T; TH EN CE N OR TH 30' -0 3'18” WE ST , A D ISTA NC E OF 2 9. 01' FE ET T O A PO INT ; T HE NC E NO RT H 22' 03'01” W ES T , A D IS TA NC E OF 43.39' F EET T O A PO INT; T HE NC E NO RT H 28'37'-33” W ES T , A D ISTA NC E OF 69. 71 ' FE ET T O A PO IN T; TH EN CE N OR TH 38' -0 1'23” WE ST , A D ISTA NC E OF 2 9. 66' FE ET T O A PO INT ; T HE NC E NO RT H 50' 59'22” W ES T , A D IS TA NC E OF 53.09' F EET T O A PO INT; T HE NC E NO RT H 66'11'-43” W ES T , A D ISTA NC E OF 66. 05 ' FE ET T O A PO IN T; TH EN CE S OU TH 47' -3 4' 38” WE ST , A D ISTA NC E 141.57 ' FE ET TO A P OI NT ; T HE NC E DE PA RT IN G FR OM S AI D SO UT HE RL Y ED GE , SO UT H 00' -1 9' 05” W ES T, A DI ST AN CE O F 390.50' F EE T TO A P OI NT ; TH EN CE S OU TH 00'24'-44” E AS T, A D ISTA NC E OF 77. 84 ' FE ET T O A PO IN T; TH EN CE S OU TH 89' -5 5' 05” EA ST , A D IS TA NC E OF 212 .75' FE ET T O A PO INT ; T HE NC E NO RT H 03'-22'-26” E AS T, A D IS TA NC E OF 75.86 ' FE ET T O TH E PO INT OF B EG IN NING . TH E FO RE GO NE D ES CR IB ED LA ND S CO NTAINS + /2 .9 2 AC RE S MORE OR LE SS . An y pe rs on cla im in g an i nt er es t i n the s ur pl us f ro m the sa le , i f an y , o t her t ha n t he pr op er t y ow ner a s of t he dat e of t he l is p en de ns m us t file a c laim b ef or e t he cle rk re po rt s the s ur plus a s un clai me d. WI TN ES S my h an d and t he se al o f t he c ourt o n No ve mbe r 23 rd , 202 0. CL ER K OF T HE C OU RT Jo hn A . C ra wf or d De put y Cl er k AL DR ID GE P IT E , L LP At t or ney f or Plain tiff 1615 So ut h Co ng re ss Av en ue Su it e 200 De lr ay B each , F L 33445 Te le ph on e: 561 392-6391 Facs imile : 561 392-6965 Pr im ar y EMail: S er vi ce Mail@ aldr idge pit e. co m IM PO RT AN T AM ER IC AN S WI TH D IS AB IL ITIE S AC T : I f yo u ar e a pe rs on wit h a di sa bilit y wh o need s an y acco mm odat io n in o rd er t o pa rt icipat e in t hi s pr oc ee ding , yo u ar e en title d at n o co st t o yo u , t o t he p ro vi si on o f ce rt ai n as si st ance . Pl ea se c on t ac t t he AD A Co or dinat or at ( 904 ) 548460 0 (t hen p re ss 0 ) at le as t 7 d ay s befo re y ou r sc hed uled c ou rt a ppear an ce , or i mm ediat el y upon re ceiv in g t hi s not ificat io n if t he tim e befo re t he s ch ed ul ed a ppe aran ce i s le ss t ha n 7 da ys ; if y ou a re h ea ri ng o r vo ice im pair ed , call 711. FN L 2T 12-02-09-2020 #612094 IN THE CI RC UIT COUR T OF TH E 4TH JUD IC IAL CI RC UIT, IN A ND FOR NA SSAU COUN TY , FLORID A CI VIL DI VISION CA SE NO. 19CA000513AXYX LE ND IN GH OM E FU ND IN G CO RP , Plain ti ff , vs . HO ME LA ND C ON ST RU CT IO N OF A ME RI CA , L LC ; Z HA N BE NNE TT ; T RA CE Y BR IM AG E , A S TR US T EE OF T HE 1 748 L EW IS S T. TR US T ; U NKNO WN P ER SO N( S) IN P OS SE SS IO N OF T HE S UB JE CT PRO PE RT Y, D ef endan t( s) NO TI CE O F FO RE CL OS UR E SA LE NO TI CE I S HE RE BY G IV EN pu rs ua nt t o a Fina l Judg me nt of F or ec lo su re file d No ve mbe r 9, 202 0 an d entered i n Ca se N o. 1 9C A 000513A XY X, of t he Cir cuit C ou rt o f th e 4t h Judicial C ir cuit i n an d fo r NA SSA U Co un ty , Fl or ida, w he re in LE ND IN GH OM E FU ND IN G CO RP i s Pl ai nt if f an d ZH AN BE NN ET T ; T RA CE Y BR IM AG E, AS T RU ST EE OF T HE 1748 L EW IS ST . TR US T ; U NK NO WN P ER SO N (S ) IN PO SSESS IO N OF T HE S UB JE CT P RO PE RT Y; H OM EL AN D CO NS TR UC TI ON O F AM ER IC A, LL C; a re d ef en dant s. JO HN A . C RA WF OR D , t he Cle rk o f th e Ci rc ui t Co ur t , w ill s el l to th e hi gh es t an d be st b idde r fo r ca sh B Y ELEC TR ON IC S AL E AT : WW W. NAS SA UC LE RK .R EAL FO RE CL OS E. CO M , a t 11:30 a. m. , on J an ua ry 7 , 2021, t he fo llo wi ng d es cr ibed p ro pe rt y as s et f or th i n sa id F inal J ud gm ent , t o wi t: LO T 3 , B LO CK 5 , U NI T TW O OF A ME RI CA N BE AC H S EC TI ON T HR EE, A S UB DI VI SI ON A CCO RD IN G TO T HE P LA T TH ER EO F RECO RD ED I N PL AT BO OK 4 , PA GE 1 , O F TH E PU BLI C RE CO RD S OF N AS SA U CO UN TY , F LO RI DA . An y pe rs on cla im in g an i nte re st i n th e su rp lu s fr om t he sa le , i f an y , o t her t ha n th e pr op er ty o wner a s of t he da te o f th e li s pe nden s mu st file a claim b ef or e th e Cl er k re po rt s th e su rp lu s as u nclai me d. Da te d th is 10t h da y of No ve mb er , 2020. JO HN A . C RA WF OR D As Cle rk o f sa id C ou rt As D eput y Cl er k T hi s No ti ce i s pr ov id ed i n acco rd an ce wit h th e Am er ica ns wit h Di sa bilitie s Ac t, i f yo u ar e a pe rs on wit h a di sabilit y wh o n eed s an y ac co mm od at io n in o rd er t o pa rti cipa te i n th is p ro ce ed ing, yo u ar e ent itle d, a t no c os t to yo u, t o th e pr ov isio n of c er ta in a ss is ta nce. P leas e conta ct t he A DA C oo rd inat or a t (9 04)548-460 0 pr e ss 0 , a t leas t 7 da ys b ef or e yo ur sch ed ul ed co ur t appear ance , o r im me diat el y up on r ecei vi ng t hi s no ti fi ca ti on i f th e ti me b ef or e th e sc hed ul ed appe aran ce i s le ss t ha n 7 da ys ; i f yo u ar e he ar in g or v oi ce i mp ai re d, call 711. Su bm it te d by : Ka hane & A ss oc ia te s , P.A . 8201 Pe te rs R oa d, S te . 300 0 Pl an ta ti on , FL 33324 Te le ph on e: ( 954) 382-3486 Te le fa cs im ile: (954) 382538 0 De si gn at ed s er vi ce e ma il : n oti ce @k ah anea nd as so ciat es .co m FN L 2T 12-09-16-2020 #613307 TH REE RI VE RS CO MM UNITY DE VELOPMEN T DIST RI CT NO TI CE OF MEETING Th e Bo ar d of S uper vi so rs (B oa rd ) of t he T hr ee R iver s Co mm unit y De ve lo pm en t Di st ri ct ( Di st ri ct ) will h ol d a Re gu la r Me et in g on D ecem b er 17, 2020 a t 3:00 p .m., a t th e Am elia W al k Am eni ty C enter , 8528 7 Maje st ic W al k Ci rc le , F ernand in a Be ac h, Fl or id a 32034 . T he p ur po se o f th e m eet in g is f or t he B oa rd to c on si de r an y bus in es s wh ic h ma y pr op er ly c om e b ef or e it. T he me et in g is o p en to t he public a nd w ill b e conduc te d in acco rd an ce wit h th e pr ov isi on o f Flor id a La w fo r Co mmu ni ty D evel op me nt Dis tr ic ts . Th e me et in g ma y b e co ntin ue d to a d at e, tim e, a nd plac e to b e sp ecif ie d on t he re co rd a t th e me et in g. A co py o f th e agend a fo r th e m eet in g ma y b e ob ta ined b y co nt ac ti ng t he D is tr ic t Ma nager , W ra th ell , H un t & As so ciat es , LLC , 2300 G lade s Ro ad , Su it e 410W , Bo ca R ato n, Flo ri da 3 3431 , ( 561) 5 710010, d ur in g no rm al b us in es s ho ur s or b y vi si ti ng t he Di st ri ct s we b si te , ht tp s ://t hr ee ri ve rs cd d.co m/ . On e or m or e Su pe rv is or s, or s ta ff o r ot her i ndiv id uals ma y pa rt ic ip at e b y sp ea ke r te le ph on e. P ur su an t to p ro vi si on s of t he A me ri cans wit h Di sa bilitie s Ac t, a ny p er so n re quir in g sp ec ia l ac co mm od ati on s at t he m eet in g or t o ob ta in acce ss to t he te leph on ic , vi de o co nferenc ing, o r ot he r co mm unicat io ns m edia t echno lo gy u se d to c on duct t hi s m eet in g is a sk ed t o advi se th e Di st ri ct O ffi ce a t leas t fo rt yei gh t (48) h ou rs p ri or t o th e m eet in g b y co nt ac ti ng th e Di st ri ct M an ager a t (5 61 ) 571-0010. If y ou a re h ea ri ng or s peec h im pair ed , plea se co nt ac t t he Flor ida Re la y Se rvi ce b y dialin g 7-11, o r 18 00955-877 1 (T TY ) / 1800-95 58770 ( Vo ice) , f or aid i n conta ct in g th e Di st ri ct Man ager . Ea ch p er so n wh o decide s to a pp eal an y de ci si on m ad e at t he m ee ti ng wit h re sp ec t to a ny m at te r co ns id er ed a t th e m eet in g is a dv is ed t ha t pe rs on will n ee d a re co rd o f th e pr oc ee ding s and th at a cco rd in gly , t he p er so n ma y n eed t o ens ur e th at a v er bati m re co rd o f th e pr oc eed in gs i s ma de , includin g th e te st im on y an d ev id en ce up on w hich s uc h appeal i s to b e bas ed . Di st ri ct Man ager FN L 1T 12-09-202 0 #613321 NO TI CE OF PUBLIC HEA RI NG NO TI CE I S HE RE BY G IV EN th at o n Th ur sd ay , th e 17t h da y of D ec embe r 2 020 , a t 6:30 P .M . t he Co ndit io na l Us e an d Va ri ance B oa rd o f Na ssa u Co un ty will h ol d a public he ar in g at t he C omm is si on Ch am be rs , J am es S . P ag e Go ve rn m en ta l Co m pl ex , 96135 N as sa u Pl ac e , Y ulee, Fl or ida, 32097 t o co ns ider a n applicat io n fo r a Zo ni ng V ar ian ce , V2 0 20-008. T he P ublic i s in vi te d to a tt end t he m ee ti ng co nc er ning t he follo wi ng d esc ri be d pr op er ty i n Na ss au Co un ty : Th e lo ca ti on o f su bj ec t pr op er ty o f zo ning v ar ia nc e applicat io n V2 020008: 851030 A va nt Rd , Y ulee , FL 32097 P ar ce l ID # 43-2N 274640-0054 0000 Th e applican t is s eek ing: Re lie f fr om S ec ti on 9.0 5 of t he Na ss au C ou nt y La nd D ev el op m en t Code t o allo w fo r a re duct io n in f ro nt s et back s fr om 30f t to 1 5ft a nd sid e se tback s fr om 10f t to 6ft f or a n acce ss or y st ru ct ur e. Th is r equ es t is b ei ng m ad e pu rs uant to S ec . 5 .0 5 of t he N as sa u Co un ty L an d De ve lo pm en t Co de . Th is a pplicat io n is file d by : Ma ri esha S te ve ns on (o wner /applican t) 851030 Av an t Rd, Y ulee, F L 32097 Th e public i s invi te d to b e pr esent a nd t o be a bl e to sp ea k fo r or a gain st o r to a sk qu es ti on s. C op ie s of t he a pplicat io n an d co pies o f th e cr it er ia t ha t ar e applicable t o th e applicat io n ar e availabl e at t he D epar tm ent o f Pl an ni ng & E co nom ic O ppo rt un it y lo ca te d at 96 161 N as sa u Pl ac e, Y ulee , FL 32097 , o r (9 04) 530-6300. I ndiv id ua ls wh o canno t at te nd t he p ub lic h ea ri ng m ay p ro vi de w ri tte n co mm ent s to t hi s a ddr es s or b y em ai l to : p lanni ng in fo @n as sa ucou nt yf l. co m . W ri tte n com men ts b ec om e a pa rt o f th e re co rd a nd a re su bjec t to Flo ri da's P ublic Re co rd s law, C hapt er 119.07 (1 )(a) , F .S . Th is hea ri ng m us t be c on duct ed a s a quas ijudicial he ar in g . A ny q ue st io ns a s to pr oc ed ur es m ay b e ob ta in ed fr om t he D epar tm ent o f Pl an ni ng & E co nom ic O ppo rt unity . I nt eres te d pa rt ie s sh ou ld lim it c on ta ct wit h Co ndit io na l Us e an d Va ri ance B oa rd Me m be rs a nd wit h Coun ty Co mm is si o ner s on t hi s to pi c to p ro pe rl y no ti ce d public he ar in g or t o wr it te n co mmuni ca ti on i n ca re o f th e Na ss au Co un ty D epar tm ent o f Pl an ni ng & E co nom ic O ppo rt unity , 9 6161 N as sa u Pl ace, Yu le e, F L 320 97 . Pe rs on s wi th dis ab ili ti es r equir in g ac co mm od at io ns i n or de r to p ar ti ci pa te i n th is pr og ra m o r ac ti vi ty s ho ul d co nt ac t th e De pa rt m ent o f Pl an ni ng & E co nom ic O ppo rtu ni ty ( 904) 5 30-6300, o r Fl or ida R elay S er vi ce ( 1-80 09558771) a t leas t tw ent yfo ur ( 24 ) ho ur s in a dv an ce t o re ques t su ch acco mm od at io n. TH E PU BL IC I S IN VI TE D TO B E PR ESEN T AN D BE H EA RD . IF A PE RS ON W IS HE S TO A PP EA L AN Y DE CI SI ON M AD E BY T HE BO AR D, A GE NC Y OR C OM MI SS IO N WI TH R ES PE CT T O AN Y MA TTE R CO NS ID ER ED A T SU CH M EE TI NG O R HE AR IN G, HE W IL L NE ED A R EC OR D OF TH E PR OC EE DI NG S AN D FO R TH AT P UR PO SE , MA Y NE ED T O EN SU RE T HA T A VE RB AT IM RE CO RD O F TH E PR OC EED IN GS I S MA DE , WH IC H RE CO RD I NC LU DE S TH E TE ST IMO NY A ND E VI DE NC E UP ON WH IC H TH E AP PE AL I S TO B E BA SE D. T he Co nd itio nal Us e an d Va ri an ce B oa rd m ay c on ti nue hea ri ng o n th is m at te r. CO ND ITIO NA L US E AN D VA RI AN CE B OA RD OF NA SS AU C OU NT Y, F LO RI DA Or la nd o Av ila It s : C ha irm an FN L 2T 12-02-09-2020 #612055 NO TI CE OF PUBLIC SALE BI LL S TO WI NG Giv es N ot ic e of F or eclo su re o f Li en a nd i nt ent t o se ll t hes e ve hicles o n 12/23/2020 , 08:30 AM a t 42 5 S. 8t h St . Fe rn andina B each , Fl or id a 32 034-3609 , p ur su an t to s ub se ct io n 713.78 o f th e Fl or id a St at ut es . B I LLS T OW IN G Re se rv es t he r ight t o accept or r ej ec t an y an d /o r all bids . T1B 11HK5KU 2 24664 2019 To yo ta FN L 1T 12-09-20 20 #613232 NO TI CE OF PUBLIC SALE FI RS T CO AS T PA IN T & BO DY TO WI NG L LC giv es N ot ic e of Fo re cl os ur e of Lie n a nd I nt ent to s el l th es e vehicl es o n De ce mb er 23 , 2 0 20 , 11:00a m a t 474379 E S TATE R OA D 20 0 FE RNA ND IN A BE AC H, F L 3203 40801 , p ur su ant t o su bs ec ti on 713.78 o f th e Fl or ida S ta tu es . FR ST C OA ST P AINT & B OD Y TO WI NG L LC r eser ve s th e ri gh t to a ccept o r re je ct a ny a nd /o r all bids . 2011 K NA FU 4A2X B 5368596 KI A 2014 JF 1G PA C6 XE 82 3340 1 SU BA RU 2017 5 NP D 84L F2 HH087237 HY UN DA I 2019 3 N1 AB 7A PX KY284669 NI SS AN FN L 1T 12-9-2020 #613348 NO TI CE OF PUBLIC MEETING Th e So ut h Ame lia I sl an d Sh or e St abiliz at io n As so ci ati on , In c . w ill h ol d a Fina nc e Co mm it te e M eetin g on D ece mb er 9 , 2020 , a t 2:00p.m ., vi a ZO OM . T o at t end t hi s m eet ing, ple as e call ( 904 ) 277512 3 fo r th e lin k to t he m eet ing. FN L 2T 12 -0 2-09-202 0 #611834 1 SUBMITTED The Coalition for the Homeless of Nassau County sponsored a sit-down Thanksgiving Day dinner last month for those it serves. The organization fed about 30 people but could have fed 40 more, according to a news release that added, “Thanks to all of you who brought food – it was all so yummy.” The Coalition also thanked several businesses that donated food, including Southern Sisters and Merlot Momma Food Services, as well as Fernandina Beach Church of Christ, where the meal was served. The release says that residents at Nassau Sober Living recovery home helped serve the food and that numerous volunteers, including “Caroline, Judy, Carol, Bonnie, Peg, Lynnette, Mike, Tommy, Bryan, Kathi, Kim, Zen, (and) John,” helped organize and participated in the event.

PAGE 18

C LASSIFIEDS r rnn rn  ANNOUNCEMENTS Lost & Found Personals Public Notice MiscellaneousEMPLOYMENT Help Wanted Business Opportunity Work Wanted ServicesEDUCATION Schools & Instruction Tutoring Lessons/ClassesFARM & ANIMAL Equipment Livestock & Supplies Pets/Supplies ServicesMERCHANDISE Garage Sales Articles for Sale Antiques-Collectibles Produce Appliances Home Furnishings Muscial Instruments Auctions Wanted to Buy Free Items Miscellaneous RECREATION Boats/Watercraft RVs/Campers/TrailersREAL ESTATE Homes for Sale Condominiums Mobile Homes Ocean/Waterfront Lots & Land Farms & Acreage Commercial/Retail Investment Property Other Areas Wanted to BuyRENTALS Apartments Condominiums Homes Rooms Mobile Homes Vacation Rentals Office Commercial/Retail Roommate Wanted Wanted to RentTRANSPORTATION Automobiles SUVs Trucks Vans Motorcycles/ATV’s 1303 Jasmine St., Suite 101 Fernandina Beach, FL NLPSA The food pantry needs donations of non-perishable food items all year round. For more information, C all: 261 7000 We’ve Moved Local News Sports Classifieds Advertising Local Events Schools COVID News Come by our new location to place a classified or retail ad, drop off news items, purchase a subscription or say HI! 1235 South 10th Street (Corner of 10th and Lime Streets) 9042613696 online at fbnewsleader.com Proudly serving the citizens and businesses of Nassau County since 1854! NEED HELP? HIRE ME! THIS SPACE AVAILABLEAdvertise In The News-Leader Service Directory! Call 261-3696 and find out how to put your advertising dollars to work for you! Call the News-Leader at 261-3696 to put the SERVICE DIRECTORY to work for you! Do you need an affordable way to let the community know about the services you offer? THIS SPACE AVAILABLEAdvertise In The News-Leader Service Directory! Call 261-3696 and find out how to put your advertising dollars to work for you! ADVERTISING r rn nr nr n nr n n ­€‚ ƒƒr„… LAWN MAINTENANCE CONSTRUCTION rrnnnn PAINTING ROOFING rnr rnr Providing Quality Work and Professional Service Since 1993 “Re-Roong Is Our Specialty”Roong Siding Soft 261-2233 coastalroofs.comFree Estimates PRESSURE WASHING LAWN MAINTENANCE CONSTRUCTION 6”Seamless Aluminum GuttersFINANCING AVAILABLE (904) 261-1940LICENSED & INSURED Lowell Duster AMELIA GUTTERS When It Rains Be Prepared. rn nn n r rrn r nn r nn $ 20,750 Amelia Handy ManElectrical Plumbing Deck Repairs Any Electrical or Plumbing NO JOB TOO SMALL 904-903-1175terry.layman500@yahoo.com Insured & Bonded HANDY MAN SERVICES This Holiday Season, please SHOP LOCAL Support Local Business! In addition to nding out the latest news, sports and events happening in Nassau County you can also:Visit www.fbnewsleader.com today! Renew your subscription online! Browse back issues....and more! Place classi ed ads online! DO YOU KNOW? SELL IT! Place an ad call 261-3696The average American family has about $7,000 worth of unused items in their homes ...

PAGE 19

December 2020 | A Special Supplement to Holiday Happenings Volunteer Opportunities Christmas colors Shopping Tips Visit from Santa Holiday Song Book

PAGE 20

Tidings of Comfort & Peace As we usher in the holiday season, we are moved to remember all of the loved ones past and present who have brought so much joy and light to our lives. We cherish their presence and their memories, and all of the blessings that touch our hearts and spirits. We hope that this Christmas and the New Year deliver much happiness, goodwill and good fortune to you and yours. Thank you for your trust in us and your friendship. 1890 S. 14th St. Suite 302 Fernandina Beach, FL 32034 (904) 261-2700www.eternityfuneralhome.com www.eternityfuneralhome.com www.eternityfuneralhome.com WeÂ’ve Moved! 2 | Holiday Essentials, News-Leader, 2020

PAGE 21

3 Holiday Essentials, News-Leader, 2020 Holiday Happenings Holiday Home Tour The 14th annual Holiday Home Tour, which benefits the Amelia Island Museum of History, will run from 10 a.m. to 4 p.m. Friday and Saturday, Dec. 4-5, in the downtown Historic District in Fernandina Beach, with each home on the tour decorated for the holidays by a local florist or decorator. Tickets are a la carte at $7 per home and must be purchased in advance at ameliamuseum.org . Raffle tickets will be available both days in the sunroom at the Myers House, 28 S. 10th St. Tickets are $5 each, three for $10 and seven for $20. Both cash and credit/debit will be accepted. ‘Scrooge!’ Amelia Musical Playhouse will present its annual production of Scrooge!, written by Leslie Bricusse and directed by Jill Dillingham, in December. This timeless musical follows the plot of Charles Dickens’ A Christmas Carol , in which the miserly Ebenezer Scrooge undergoes a profound experi-ence of redemption over the course of a Christmas Eve night after being visited by the ghost of his former partner, Jacob Marley, and the ghosts of Christmas past, present and future. Shows will be at 7:30 p.m. Dec. 11-12 and at 5 p.m. Dec. 13. Tickets prices and availability were not available prior to press time, but you can visit https://bit.ly/2HWJS2k for updated information. ELIZABETH WILKES PHOTOGRAPHY Owned by Mike Myers and Christie Walsh-Myers, the Steamboat House, 8 S. 10th St. in Fernandina Beach, is one of the five homes that will be part of this year’s Holiday Home Tour, the primary annual fundraiser for the Amelia Island Museum of History. 16th Anual Yulee Holiday Festival Prade The parade will take place on Saturday, Dec. 12, at 10 a.m. All float entries should report to the staging area promptly at 8:30 a.m. Initial staging will begin at The Ark of Nassau, 86051 Hamilton St. The parade route will move east along Hamilton Street, then take a right onto Goodbread Road. The first viewing area will be a quiet zone and sensory-friendly area in front of Yulee Primary School on the east side of Goodbread Road. The parade route will continue south toward the Yulee Sports Complex, passing the judges who will be staged in front of the Nassau County Transportation Building. The announcer will be set up in front of the main entrance of the ballpark. The parade will finish its final stretch by turning right onto Pages Dairy Road. All parade floats and vehicles will continue back to the staging area via U.S. 17. There will not be a viewing area on U.S. 17 due to safety pre-cautions. Road closures in the area will occur from 10 a.m. until an estimated 11:30 a.m. All viewing areas will be on the east side of Goodbread Road. Please be respectful while parking and mindful of the time when deciding on your parking spots. For more information, visit yhfestival.wix.com/yulee or facebook.com/yhfestival.

PAGE 22

4 Holiday Essentials, News-Leader, 2020 News-Leader he Christmas holiday can be a difficult time for many of us. Holiday hype to create the “perfect” family celebration may leave some us feeling more stressed than joyful. For those struggling with grief or depression, the date on the calendar often heightens loss or sadness. For those who are lonely, homeless, chronically unemployed, or chronically ill, the glitter of the holiday can deepen despair. The magic in giving is that it brings joy to the giver as well as the recipient. Some of us already make volunteering or charitable giving part of our holiday traditions. Why not extends the season of giving throughout the year and experience firsthand what social psychologists call the “helper’s high?” Charitable organizations need your financial support at Christmas time and year-round. Moreover, volunteers are needed to stretch manpower in lots of community organizations from char-ities to schools to civic groups. Volunteering is the perfect antidote to the holiday blues and beyond. In truth, volunteering is good for whatever ails you. Make volunteering in your community a New Year’s resolution. Local churches offer opportunities to bring more meaning into your own holiday while spreading the joy of Christmas to others. Below, we offer some additional suggestions, beginning with annual holiday projects with which we’re familiar followed by year-round opportunities for volunteers. This is but a partial list. Please let us know if you would like your group added to next year’s list. Joy to the Children is an all-volunteer, nonprofit organization established in 1995 with the primary purpose of hosting a Christmas Day celebration for chil-dren of economi-cally disadvantaged families in Nassau County. Families are chosen for participation through referrals from area schools, including the Families in Transition program and service organizations such as the Boys & Girls Clubs. A Christmas Day party includes a holiday feast donated by local restau-rants and entertainment including music and crafts. Children receive clothing, a backpack, school supplies, toiletries, books, bedding, and toys. While Joy to the Children will still need volunteers, it is cutting back on the number needed this year. Children will receive presents, but they will not be wrapped. Volunteers are needed for toy and clothing shopping, gift transport and on Christmas Eve. Volunteers for preparatory activities can be of any age. However, because of confidentiality concerns, only those age 18 or older can volunteer at the Christmas party. To volunteer, sign up at joytoth-echildren.org/volunteers. For those unavailable to volunteer, cash donations are always welcome. All donations go directly to benefit children since the organization has no paid staff or overhead. For information, email info@joyto-thechildren.org, or visit joytothechildren.org or their Facebook page. Barnabas Center coordinates an annual Christmas Adopt-A-Family project that matches donors with recipient families referred by agencies such as Head Start and Family Support Services (foster children). While much of the matching process takes place well before Christmas, Barnabas provides volunteer opportunities and accepts charitable donations toward its year-round mission. With program sites in Fernandina Beach and Callahan, Barnabas provides crisis assistance such as rent and utility payments, a resale shop for furniture and clothing, a food pantry, and a walk-in medical clinic. Most funding for Barnabas comes from private donations. For information, call 904-261-7000 or visit barnabasnassau.org. Micah’s Place is a nonprofit agency serving victims of domestic violence and their children. Services include a 24-hour crisis hotline – 904-225-9979 – a 16-bed emergency shelter, two thrift stores, coun-seling, outreach and other related services. The organization hosts a holiday gift card drive called the Spirit of Empowerment. Parents leaving an abusive Make volunteering your New Year’s resolution T Continued on page 6

PAGE 23

5 Holiday Essentials, News-Leader, 2020 HAPPY HOLIDAYS Dewar’sTito’s VodkaWheatley Vodka Maker’s Mark $ 22 99 1.75L HOURS: MON-THURS 8AM-11PMFRI-SAT 8AM-MIDNIGHTSUNDAY 12:00-8:00PM 2112 S. 8TH ST. FERNANDINA BEACH, FL 904261-3640 1 Mile Across Intracoastal On The RightDRIVE-THRU SERVICEBEST OF THE BEST FOR 25 YEARS $ 21 99 1.75L Fireball $ 2 9 99 1.75L $ 30 99 1.75L $ 24 99 750mL $ 2 0 99 1.75L Captain Morgan 5 5 POINTS LIQUORS Guided Ecotours Kayak, bike, SUP rentals in Talbot Islands State Park 904-251-0016 organic cotton clothing Fair Trade items Recycled gifts Dog Is Good gifts Unique, earth-friendly gifts May the magic and wonder of the holiday season stay with you throughout the coming year the entire Kayak Amelia crew For that ‘hard to buy for’ person on your list.... Gift Cards available KayakAmelia.com “You deserve a good paddling!” Oh Yay, it’s time for the silly hat photo again A SALES AND SERVICE DEALERSHIP 321-1422OceanOutboardMarine.com OCEAN OUTBOARD MARINE1619 North 14th St. Fernandina Beach, FLAuthorized Key West Dealer

PAGE 24

6 Holiday Essentials, News-Leader, 2020 relationship often do not have the financial means to buy gifts for their children. Donors are needed to provide gift cards before Dec. 16 for clothing or department stores so parents can select just the right gift for their own child. In lieu of gift cards, donors may also make donations by cash or check. For information, call 904-491-6364, ext. 100, or visit micahsplace.org. The Salvation Army offers multiple holiday volunteer opportunities. Iconic symbols of the Christmas holiday are their Red Kettle bell ring-ers stationed at local businesses to collect holiday donations. All bell ringers are volunteers and their services are needed from the day after Thanksgiving through Dec. 24. Volunteers can commit to as little as two hours of service. Volunteering with friends, family, or neigh-bors can make it a fun social experience. To vol-unteer as a kettle ringer, call Mary Moore at 904-402-7054. All local kettle donations stay in Nassau County and go directly to the support services at Hope House. Hope House is The Salvation Army branch serving Nassau County. Located at 410 S. Ninth St. in Fernandina Beach, Hope House provides year-round crisis services to people in need. Services include emergency shelter, clothing, food, transportation assistance, financial assistance, disaster relief and the Interfaith Dinner Network soup kitchen. Donations of clothing, packaged food, linens, etc., to support the year-round mission of Hope House can be dropped off at 410 S. Ninth St. A spe-cial Hope House Christmas program is the Senior Angel Tree. Low-income seniors 60 and older in Nassau County, many referred by the Nassau County Council on Aging, provide wish lists for the Angel Tree. Community groups or individuals can adopt one or more seniors, purchasing gifts or gift cards for seniors to do their own shopping. Gifts and gift cards must be received the first week of December. For information on the Senior Angel Tree program, call 904-321-0435. The Salvation Army is an evangelical part of the universal Christian church established in 1865 and has been serving those in need for 150 years. Nearly 35 million Americans receive assistance from The Salvation Army in 5,000 communities across the country. The Nassau County Council on Aging, which administers the Meals on Wheels program, is requesting donations to provide a needy senior with a generous turkey dinner for Christmas with plenty of left-overs. Donations can be made through gift cards at Publix, Winn-Dixie or Harris Teeter or with cash or checks to NCCOA at 1901 Island Way in Fernandina Beach. The Council provides many other programs including home health, adult day care, transportation, help with small home repairs, support groups and a lifelong learning program. Volunteer opportunities abound throughout the year. Call 904-261-0701 or visit nassaucountycoun-cilonaging.org for information. The Day Drop-In Center located at the Fernandina Beach Church of Christ, 1005 S. 14th St., is a year-round resource for the home-less. The site is open Monday through Saturday from 9-11 a.m. for the home-less to pick up mail, pick up breakfast and lunch, shower and do their laundry. Referrals to other community resources are also available. Volunteers are needed to keep the centerÂ’s doors open, and donations of backpacks and other personal items are appreciat-ed. Call Patricia De Jesus at 904-277-2517 during hours of operation. The Fernandina Beach Police Auxiliary Corps is a group of community volunteers working in concert with the police department in a variety of special events and activities throughout the year. Among these are visitation of seniors living alone, traffic control for local schools and events like the Shrimp Festival, Sounds on Centre, parades, races and charitable events. Training is provided. PAC is a part of the Fernandina Beach Police Foundation, a nonprofit corporation supporting the department in charitable and educational activities. All activities are supported by volunteers and donations. For infor-mation, call 904-310-3254 or visit fbpolicefounda-tion@gmail.com. W Volunteering Continued on page 7

PAGE 25

7 Holiday Essentials, News-Leader, 2020 Join us for live online Worship each Sunday @11:00AM at Facebook.com/601CentreStreet To learn about our safe, weekly on-campus Sunday Worship, and our activities for adults, youth, and tweens visit: mumconline.com/CONNECT Connect through online & in-person groups & classes: mumconline.com/STUDY r(nz¡Mýep(Ú(¡ez©(!áà(¶¡ýp©@z¡n(! . 601 Centre Street, Fernandina Beach mumconline.com | 904-261-5769 2UMRLQXVRQFDPSXVIRURQHRI RXUVL[ZRUVKLSRSSRUWXQLWLHV 302SHQDLUIDPLO\ZRUVKLSRQWKHJUDVV EULQJFKDLUVRUEODQNHWVWRVLWRQ 30:RUVKLSLQVLGHWKH6DQFWXDU\ 30:RUVKLSLQVLGH0D[ZHOO+DOO 30:RUVKLSLQVLGHWKH6DQFWXDU\ 30:RUVKLSLQVLGH0D[ZHOO+DOO 302SHQDLUZRUVKLSRQWKHJUDVV EULQJFKDLUVRUEODQNHWVWRVLWRQ 'HFHPEHUWK :RUVKLSZLWKXVIURPKRPHOLYHDW )DFHERRNFRP&HQWUH6WUHHW 3030/HVVRQV&DUROVZRUVKLS 30&KULVWPDV7DL]«ZRUVKLS 2Q&KULVWPDV(YH:RUVKLSZLWK 0HPRULDO8QLWHG0HWKRGLVW&KXUFK LQWKHZD\PRVWFRPIRUWDEOHIRU\RX\RXUIDPLO\ PXPFRQOLQHFRP&KULVWPDV RUFDOOWKHFKXUFKRIILFHDW &29,'SUHFDXWLRQVZLOOEHREVHUYHGRQFDPSXVLQFOXG LQJ PDVNVUHTXLUHGDWDOOVHUYLFHVVRFLDOO\GLVWDQWVH DWLQJDQG UHVHUYDWLRQVQHHGHGIRULQGRRUVHUYLFHV )LQGPRUHGHWDLOVDQGWKH5693OLQNRQOLQHDW Opportunities to volunteer with school children include Arts Alive Nassau, a nonprofit bringing music, drama and visual arts instruction to chil-dren who might otherwise have little or no access to arts. Programs for kindergarteners through fifth-graders are held on school campuses after hours. Teachers are paid an honorarium. Adult volunteers (no artistic talent needed) are needed to assist during courses. Donations are needed for supplies and for instru-ments for children who cannot afford to rent them: dulcimers, violins, guitars, drums or band instru-ments. Call 904-310-9243 or visit ArtsAliveNassau.org. Take Stock in Children is a mentoring program for at-risk middle and high school students to help them complete graduate and obtain scholar-ships to continue their education. In this program affiliated with Florida State College and the FSCJ Foundation, students agree to maintain a 2.5 GPA, stay drug-free and crime-free, exhibit good behav-ior in school, and have good attendance in order to earn a scholarship. Each student is assigned a vol-unteer mentor and they meet once a week during school hours. How many children can be helped each year depends on local fund-raising. For information, call 904-548-4464 or visit takestocknassau.org. For animal lovers, the Nassau County Humane Society, Nassau County Animal Control and Cats Angels have opportunities throughout the year for dog walkers and foster parenting. All also offer opportunities to take a pet out of a kennel for a home visit or a day of fun. Julia Roberts contributed to this article. W Volunteering

PAGE 26

8 Holiday Essentials, News-Leader, 2020 any people may not get in the holiday spirit without decorations and all the trimmings. Chances are strong that if you have containers full of items just waiting to see the light of day again this holiday season, those items are red or green or some combination thereof. Red and green have become the traditional colors of Christmas, just as blue and white symbolizes Chanukah. But how did this color palette come to evolve? Just like many traditions of Christmas, the red and green scheme has origins that pre-date the Christian celebration. Christmas has borrowed from many of the customs of winter solstice celebrations of ancient peoples, including the Celts. Ancient Celtic people revered holly plants, believing they brought beauty and good fortune in the middle of winter — a time when the landscape is normally bleak and holly plants thrive and stand out. Celts would regularly bring in sprigs of holly and decorate their homes with the plants, which feature shiny, serrated leaves and bright, red berries, as a way to guarantee a pros-perous new year. Holly also came to be associated with the crown of thorns Jesus Christ was forced to wear during his crucifixion. The custom of using red and green continued into the 14th century. Dr. Spike Bucklow, a research scientist at the University of Cambridge, says red and green also were used to paint medieval rood screens, which were partitions installed in churches to separate the congregation from the priest and altar. Dr. Bucklow notes that Victorians also extended the association of these colors as a physical bound-ary to another boundary: the marking of the end of the old year and the beginning of a new one at Christmastime. While red and green had associations with Christmas in early times through holly and other sources, the connection was perhaps best solidi-fied thanks to a man named Haddon Sundblom. Sundblom was an artist commissioned in 1931 by the Coca-Cola company to create an image of Santa Claus for the company’s upcoming holiday ads. Until this point, versions of Santa were rarely consistent, with his clothing vacillating between green, blue and red. He also wasn’t the plump, jolly fellow asso-ciated with Christmas as we know him today, but rather thin and elf-like. Sundblom portrayed him as a chubby man wearing red robes, likely as a nod to Coca-Cola’s own red logo, even though the company denies the connection. Santa was featured in front of a green background. The ads proved popular and Sundblom’s Santa became the preferred depiction. Santa’s red robes perfectly complemented the green background and other green components of the hol-iday, such as Christmas trees and holly, that already had been solidified as Christmas imagery. Color plays a strong role in creating Christmas nostalgia. Red and green are put on vivid display throughout the season. Metro Creative Connection Why are Christmas colors red and greeen? M

PAGE 27

9 Holiday Essentials, News-Leader, 2020 Designer and Stock fabric Re-Upholstery Slip Covers Custom-Built Upholstered Furniture Upholstered Antique Restoration Boat Interiors Carpets HunterDouglas Certified Showcase Dealer Custom Bedding Designs Draperies, Valances & Cornices Come visit our showroom and “ ON-SITE” workroom rowlandsuph@gmail.com www.RowlandsUpholstery ofAmelia .com Decorators Welcome Owned and operated in Fernandina Beach by the Rowland family for 6 7 years . 1120 S. 8th Street Fernandina Beach (904) 261-5842 For the News-Leader Santa Claus is coming to town. From 10:30 a.m.-5:30 p.m. Saturday, Dec. 5, children and adults alike can share in the St. Nick Experience on Amelia Island at the Amelia Island Welcome Center, 102 Centre St. in Fernandina Beach. St. Nick – or his elves, more than likely – will trans-form the Welcome Center into his workshop so he can greet all of the area’s good boys and girls. According to a Facebook post, “St. Nick thought this would be the perfect location with the mag-ical windows in the back of the room where he can remain socially distanced but still hear all of the Christmas wishes! He will only see one family group at a time inside the workshop while others remain socially distanced, with facemasks worn on the train platform. In between family groups, workshop helpers will jump into action to remarkably clean surfaces until they sparkle!” A photographer will be on site and portraits will be available for purchase. Because of the large crowd expected, Santa is only accepting reserva-tions for the event at bit.ly/StNickPortraits. Santa Claus is coming to town

PAGE 28

10 Holiday Essentials, News-Leader, 2020 hen in doubt while holiday shopping, go with a gift card. Gift cards provide a convenient way to ensure people of all ages ultimately get something special. According to a 2016 survey by the gift card sales tool CardCash, gift cards are a $127 billion market that keeps growing. Physical gift cards have been growing at an annual rate of 6 percent, but digital gift cards are growing at an annual rate of 200 percent. The financial resource The Motley Fool indicates that, during the 2018 holiday shopping season, people buying gift cards purchased roughly four cards each, with an average value of $45 per card. Many people enjoy the convenience of storing digital gift card information on their phones. Even though gift cards are any easy option, like giving cash, they may seem like impersonal gifts. However, gift givers can explore these ways to add a personal touch to the gift card. Make your own gift card. Companies including Visa and Mastercard enable gift-givers to person-alize cards with their own photos. Shoppers also can choose from predesign galleries to present a card that has a little more flair. The gift cards can then be tied to specific occasions or holidays. Choose a popular store. Rather than buying the first gift card you see, select a card for a specific store your loved one likes. For example, if the person is an outdoors enthusiast, a gift card to an outdoors business may be perfect. If he or she wants to be the next top chef, money toward a kitchen supply store is fitting. Wrap it in a unique way. DonÂ’t just give the gift card in an envelope; find a unique way to wrap it. After all, that will make the gift card a gift within a gift. Find a small gift box and wrap the gift card as you would any other gift. Or make it even more exciting by designing a scavenger hunt with clues on where to find the hidden gift card. Assemble a gift basket. Add a few extra treats to a basket with the gift card that ties into a theme. If the gift card is for a boating or fishing retailer, place tackle, a floating key ring or a dry storage bag in the gift basket. Add a sweet message. Attach a greeting card and share a few sentiments about why the gift card was chosen. This will help make the gift more personal and show that time was taken to select the item. The National Retail Federation and Prosper Insights & Analytics reassures that gift cards are one of the most popular entries on holiday wish lists each year. Making the gift a bit more personal can increase the enjoyment factor even further. Metro Creative Connection 5 ways to make gift cards more personal W

PAGE 29

11 Holiday Essentials, News-Leader, 2020 ingerbread cookies and houses are one of the many symbols of the holiday season, alongside Christmas trees and twinkling lights. In fact, few confections symbolize the holidays more so than gingerbread. Many a child (or a child at heart) has spent hours carefully trying to create decorative gingerbread houses. Although gingerbread recipes span various cultures, gingerbread houses originated in 16th century Germany. The fairy tale “Hansel and Gretel” helped solidify the popularity of gingerbread, which became part of Christmas traditions. Even though gingerbread houses can be fun to make, there’s no denying it can be exacting work — especially for those who strive for perfection. Prepackaged kits attempt to take some of the guess-work out of the equation, but those who are crafting from scratch can employ these tips as they build their gingerbread houses. Go for form and not flavor. Few gingerbread houses ever get eaten, so focus on finding a dough that will bake up rock hard as opposed to one that tastes good. Get the right icing texture. Pastry artist Catherine Beddall says royal icing is the preferred “glue” to adhere gingerbread pieces. Beddall says icing should be thick like peanut butter and not runny. Mind the dough. Do not roll out the gingerbread dough too thin or it may become brittle after being cooked. Always cut out shapes before the gin-gerbread is baked. Let the baked pieces sit overnight to cool completely before using them to build. Patience is key. Allow the icing to dry for at least a couple of hours after adhering each piece and before moving and handling the house, says Beddall. Work in stages so that individual items can be deco-rated and allowed to dry. Then the walls can be put together, followed by the roof pieces. Kids likely will need help. Children may not have the patience or steadiness to handle complete gingerbread construction. They can decorate the separate pieces of the house while the components are laying flat, which is easier for kids. Adults can do the main assembly later on. Utilize a template. Free-handing may not be easy. Cut out templates using cardboard or poster-board for various gingerbread pieces. One of the most important tips is to have fun. Don’t take gingerbread house making too seriously as a novice. Rather, enjoy the experience and the centuries-old tradition. Metro Creative Connection 218 Ash Street Fine Gifts HomeFurnishings LadiesAccessories 904-277-6626 (Ash & 3rd St. one block from the Boat House Restaurant) A Christmas Wonderland How to create a durable gingerbread house G

PAGE 30

12 Holiday Essentials, News-Leader, 2020 2020 has been year unlike any other. A global pandemic affected communities in every corner of the globe, and many people found they had much more time on their hands due to stay-at-home restrictions. That extra free time may have opened up the oppor-tunity to re-engage with old hobbies or start entirely new ones. Such endeavors may have resulted in items that can make ideal handmade holiday gifts. Crafting or engaging in other creative pursuits is a great way to pass the time and alleviate anxiety related to self-quarantining. Katie Carey Levisay, a clinical neuropsychologist in Denver, said that crafting requires focused attention and forces a person to be completely immersed in the moment. For those who prefer to continue to avoid crowds until COVID-19 is in the worldÂ’s collective rearview mirror, producing handmade gifts also cuts down on trips to shopping malls and other retailers. Those interested in making handmade gifts this holiday season can consider these ideas. Jewelry: Most craft stores now have entire aisles dedicated to making jewelry. From earring posts and loops to necklace brackets and all the essentials in between, jewelry crafters can create something fitting for the special people on their lists. Candles: Candles add light, warmth and aroma to help a home feel cozy. With some basic compo-nents, such as a wax source, wick, tint, and scent oils, itÂ’s easy to make candles. Pour the wax into a favorite vessel, such as a mason jar or delicate teacup. Handmade soaps: Those who dabble in candles may want to parlay those skills into soapmaking as well. Soaps can be crafted relatively easy and pack-aged as part of the ultimate homemade spa package. Oven mitts or skillet handle covers: Gift that special home chef with custom oven mitts and a coor-dinating skillet holder for popular cast-iron cookery. An easy pattern, some durable fabric and some basic sewing skills are all thatÂ’s needed. Handmade blanket: Those who love to knit or crochet know the bounty that can be made with nee-dle, hook and yarn. From homemade afghans to cozy slippers to scarf and hat sets, the options are endless. Food: Those whose talents lean more toward culinary than crafty can pour their holiday love into delicious desserts or tasty tidbits. Handmade gifts provide an opportunity to offer personal and meaningful gifts that can make the holi-days that much more special. Metro Creative Connection Handmade gifts are special Tips to simplify shopping and wrapping The holiday season is a busy time of year. People devote many hours to generating gift lists and plan-ning their shopping excursions. Shopping can be all-encompassing during the holiday season, but it is only half of the gift-giving equation. After all of those toys, articles of clothing and other goodies are purchased, those items will need to be wrapped and hidden away. Gift-givers may be looking for ways to make these tasks just a little easier. Shop early: The sooner you begin shopping, the more time you will have to purchase everything you need and then get it prepared for giving. While Black Friday and Cyber Monday sales feature great deals, there are discounts to be had all year long if Continued on page 13

PAGE 31

13 Holiday Essentials, News-Leader, 2020 you keep your eyes open. Grab an item here and there when there is something that catches your eye and fits the needs of a gift recipient. Shopping early also affords shoppers a greater buffer if they plan to do some of their shopping online. Shipping times have changed due to COVID-19, which has disrupted some supply chains and put added pressure on shipping companies. The U.S. Postal Service says products and packages may require more time to be delivered due to limited transportation availability, so shopping early can help ensure everything arrives on time. Tackle the kids’ gifts first: Watching children’s bright grins and all their excitement opening presents can make all the hard work worth it. Be sure that you shop for all of the gifts for children in your household first, especially if you play Santa’s helper. Use opportunities when the kids are in school or at daycare to bring gifts into the house and then wrap them. Wrapping as you go can help to ensure there are no “spoiler alerts” prior to the holidays. Create a wrapping station: A dedicated area for wrapping can streamline the process. Gift wrapping supplies can be tough to keep organized because they’re usually awkward sizes and can eat up a lot of space. That’s where a wrapping station can come into play. It can be custom-made or you can use items already around the house. A laundry room or a large closet can be the ideal location for a wrapping station. Because wrapping paper rolls are the most cumbersome wrapping supplies, find a way to corral them. A tall laundry hamper works, or consider hanging wrapping paper rolls horizontally on thin curtain rods attached to a wall or the back of a door. Simply pull off the amount of paper you need and cut. Organize other supplies in a nearby drawer or organizational caddy. Store gift bags and tissue paper in a fabric tote bag. Having everything within arm’s reach cuts down on time spent searching for supplies. It’s that time of year for shopping and wrapping. Ensure it is a low-stress experience with some time-saving tips. Metro Creative Connection W Shopping and wrapping The holiday season is an important one for small businesses every year, and it figures to take on heightened importance in 2020. The outbreak of the novel coronavirus COVID-19 in late 2019 and early 2020 hit small businesses especially hard, with many being forced to close their facilities to custom-ers in an effort to prevent the virus from spreading. Estimates regarding the effects of the COVID19 outbreak on small businesses varied, but many small business owners were forced to let go employ-ees as they confronted steep declines in revenue. A ZenBusiness survey of more than 1,000 small busi-ness founders, senior managers and decision mak-ers found that 37 percent of small businesses that employ between 11 and 25 people were considering laying off more than one-fifth of their workforce. As small businesses face difficult challenges, it’s no surprise that many consumers want to support locally owned small businesses this holiday season. Such support not only can help small businesses, but also can help to revitalize local communities. Shop online. Online shopping has traditionally been dominated by big box retailers. However, many small businesses increased their e-commerce capa-bilities to generate revenue. Shoppers concerned about shopping in person this holiday season should explore the delivery and curbside pickup options available at locally owned small businesses. Even businesses that have not traditionally been allowed to deliver, such as breweries and wineries, have been able to do so during the outbreak, giving consumers unlimited online shopping options. Purchase gift cards. Gift cards take the guesswork out of holiday shopping, and such cards are easily shipped or even emailed to loved ones. That’s a significant benefit during the 2020 holiday season, when delivery times are expected to be lengthy. Gift cards to local businesses simplify holiday shopping, support small businesses and help shoppers avoid potential delivery delays. Share your experience. Word-of-mouth is vital to small businesses at any time, and can be espe-cially valuable as these companies try to overcome the challenges posed by the COVID-19 outbreak. Holiday shoppers can share their experiences with local businesses via social media. Share information about the lengths local small businesses have gone to in regard to safety measures, order fulfillment and their delivery and pickup efforts. Such sharing may compel neighbors and friends to follow your lead and provide vital support to local businesses in need this holiday season. Small businesses are the backbone of many communities, and the holiday season provides a great opportunity to support such firms as they look to recover from a difficult year. Metro Creative Connection How to support small businesses

PAGE 32

14 Holiday Essentials, News-Leader, 2020 iving gifts during the holiday season may be rewarding, but certain people on your shopping list may leave you scratching your head wondering what to buy. Teenagers often fall into that confusing category. As trends and interests change at a moment’s notice, adults may not know what to get the teenag-ers on their list. These suggestions can set you on the right course. Gadgets: Teens like staying abreast of the latest technology, and what better way to do so than with hot-off-the-assembly-line products? Moderns teens use multiple mobile devices — from tablets to smartphones to notebook computers — so an outlet multiplier with surge protection could be the way to go. A charging caddy that keeps all of their devices organized and within reach while replenishing the batteries can make for another go-to gift. While shopping for gadgets, think about investing in Bluetooth-enabled earbuds or over-the-ear headphones. This way teens can enjoy their favorite streaming music stations or binge Netflix series without disturbing others. Gym equipment: Adolescents are conscious of their personal health and body image. To fos-ter positive experiences, gift givers can encourage healthy physical activity. A gym membership or per-sonal fitness equipment can help teens get on track with a weekly regimen. Luggage/travel gear: A thirst for exploration may inspire teens to travel the country or the world. A high-quality piece of luggage can be a building block for teens’ travel gear. Other travel items to consider are RFID blocker ID and credit card hold-ers, money toward a passport or an overnight toilet-ries bag. Gaming: Many teens immerse themselves in gameplay, whether solo or online multiplayer. Games can be enjoyed while using various con-soles, computers and even smartphones. Find out which platform teens are using and then pur-chase gift cards, points or e-codes so that they can get new games or enjoy in-app purchases and upgrades. School funding: Some gifts can focus on the future, including teens’ education. Consider donating to or opening up an account to help fund college costs. Different plans have different annu-al contribution limits and tax deferments, so it’s a good idea to speak with a financial professional to figure out which avenue is right for you and your gift recipient. Retailer gift cards: Teenagers always enjoy some extra purchasing power, so gift cards to their favorite retailers are likely to be a hit. If you’re not sure where the teen on your list shops, consider a gift card good for any store in a local mall. Shopping for gifts for teens can be a little easier if shoppers get a nudge in the right direction. Metro Creative Connection Tips for gifting teens G

PAGE 33

15 Holiday Essentials, News-Leader, 2020 Published by the News-Leader Fernandina Beach, Florida 904-261-3696 fbnewsleader.com he 2020 holiday sea-son figures to be vastly different than seasons past. The novel coro-navirus COVID-19 has transformed daily life in many ways. The public has become accustomed to wearing masks while shopping, limiting the num-ber of people in public venues and keeping their distance from friends and loved ones. Many events have been reimagined as virtual celebrations because of social distancing protocols. For those with large families or peo-ple with inherent risk factors that make them more susceptible to illness, sharing the holidays over video conferencing apps may be the safest way to go in 2020. The following tips can help holiday hosts make the most of a vir-tual holiday experience. Pick a bright, festive spot: Set up your tablet, smartphone or computer in a bright area with a festive backdrop. You’ll want oth-ers who join the virtual hangout to be able to see you clearly. A Christmas tree or a decorated fire-place in the background can set the scene. Choose the right conferencing app: Certain programs may work better than others depending on your needs. For example, if everyone has the same operating system platform (iOS or Android), you may be able to use an app inherent to that system, which won’t require a separate download or login. Apps also may be chosen depending on how many people can be invited in, as some set limits. Do your homework and conduct a test run prior to the holidays. Keep props nearby: If the goal is to open gifts virtually, be sure to have everyone gathered and gifts nearby so no one is scrambling in and out of view. Position the camera at eye level: Try to set up the camera so you’re not looking up or down. Practice looking straight into the camera instead of at yourself in the minimized window or even others on the screen. This way you’ll appear engaged. Use mute when not speaking: Muting yourself (and encouraging others to do the same) when you are not speaking will limit the amount of background noise. As the host, serve as the moderator and encourage everyone to speak one at a time. Choose a visual cue to signal when someone has the floor to speak, such as raising a hand or even showing a festive picture. Tune into virtual worship: While some places of worship have reopened to some capacity, others may still be offering hybrid services. If your place of worship offers services via YouTube or another video platform, gather around and watch together and participate just as if you were there in person. Better yet, share the link with other family and friends so they can tune in as well. Share dinner ‘together:’ Set up your camera source so it captures the holiday table. All par-ties gathering virtually can then sit down to the holiday meal as one and enjoy one of the season’s more endearing traditions. Virtual celebrations may continue through the holiday season. Adapting with some video confer-encing tips can ensure everyone enjoys the festivities. Metro Creative Connection How to host virtual holiday celebrations T

PAGE 34

16 Holiday Essentials, News-Leader, 2020 ADVENT “MIDWEEK EVENING” WORSHIP P^]g^l]Zrl%=^\^f[^k+g]%2ma%*/ma+,k] L^kob\^Zm.3))IF !Hnmlb]^hgeZpg%[kbg`Z\aZbk" CHRISTMAS “EVE” WORSHIP Mankl]Zr%=^\^f[^k+-ma!hnmbl]^l^kob\^"!##Fnlm\Zeemhl\a^]ne^pab\al^kob\^rhnpblamhZmm^g]"*+3))IF>Zker