|
Citation |
- Permanent Link:
- http://ufdc.ufl.edu/UF00028306/00369
Material Information
- Title:
- The Jasper news
- Uniform Title:
- Jasper news (Jasper, Fla.)
- Creator:
- Jasper news
- Place of Publication:
- Jasper, Fla.
Jasper, Fla
- Publisher:
- F.M. DeGraffenried
- Publication Date:
- March 18, 2010
- Copyright Date:
- 2010
- Frequency:
- Weekly
regular
- Language:
- English
Subjects
- Subjects / Keywords:
- Newspapers -- Jasper (Fla.) ( lcsh )
Newspapers -- Hamilton County (Fla.) ( lcsh )
- Genre:
- newspaper ( marcgt )
newspaper ( sobekcm )
- Spatial Coverage:
- United States of America -- Florida -- Hamilton -- Jasper
Notes
- Additional Physical Form:
- Also available on microfilm from the University of Florida.
- Dates or Sequential Designation:
- Vol. 1, no. 1 (Feb. 21, 1890)-
- General Note:
- Editor: Jno. M. Caldwell, <1890>.
- General Note:
- Publisher: W.L. Whitfield, <1904>.
Record Information
- Source Institution:
- University of Florida
- Holding Location:
- University of Florida
- Rights Management:
- Copyright The Jasper news. Permission granted to University of Florida to digitize and display this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
- Resource Identifier:
- 33315707 ( OCLC )
000579542 ( AlephBibNum ) sn 95047198 ( LCCN )
|
Downloads |
This item has the following downloads:
|
Full Text |
Tenth annual Wild Azalea Festival set for Saturday, Page2A
nflaonline.com
rua
Today's Weather
High
660 F
Precip: 20%
Considerable clouds early. Some
decrease in clouds later in the day.
Slight chance of a rain shower.
High 66F. Winds NW at 5 to 10 mph.
For up to the minute weather
go to www.nflaonline.com.
iI 9H ER, NUMBER 14|THURSDAYM gRCH[18 g, 2iiI ] SECTIONS 28 PAGES 50
Mudslingers
A new place to play in Hamilton
By Stephenie
* Livingston
S' , .- stephenie.livingston
- @gaflnews.com
. " Souped-up ATVs, Fords,
,. Chevys and GMC pick-ups
are lining up for Jasper's
S- newest fest - a Mud Fest.
f "So you want to get
- muddy, huh?" said Denise
Keith, spokeswoman of the
family owned mud bog in
Jasper, rightly named Mud
Fest.
"Oh, you think I can't
handle it?" I asked.
"You got a truck?" She
questioned.
"No, but I've got a Jeep,"
I said.
She laughed, "That'll
P OT and ABOVE: Having fun in the mud i
Jasper. - Courtesy photos
SEE MUDSLINGERS, PAGE 9A
Stories
to read
inside
* Gadsden
biofuel plant put
on hold
Page 11A
* Tenth annual
Wild Azalea
Festival set for
Saturday
Page 2A
New hospital
in the works
for Hamilton?
By Stephenie Livingston
stephenie.livingston@gaflnews.com
A new hospital may soon be a possibility for
Hamilton County, according to Economic
Development Director Milton Scott.
"For now, we are in the investigative
stages," said Scott.
A hospital committee was formed from the
ranks of county government three weeks ago
to investigate the county's need and to discuss
available options. Scott said the committee will
work toward applying for a Certificate of
Need, a first step in the regulatory process.
Obtaining a Certificate of Need requires
SEE NEW HOSPITAL, PAGE 2A
High-tech firm, truck stop, radio
station considering Hamilton
By Stephenie Livingston
stephenie.livingston@gaflnews.com
During Tuesday evening's County
Commission meeting, Executive Director
of Economic Development Milton Smith
presented three grant requests to the
board from businesses Smith said would
bring jobs to the community.
Council race
decided by
a single vote
By Stephenie Livingston
stephenie.livingston@gaflnews.com
The first request Smith presented was
by Scout Industries, LLC and its
subsidiary Scout Worldwide
Communications. Scout Industries is a
Service Disabled Veteran-Owned Small
Business in its fourth year of existence.
The company pursues government
SEE HIGH-TECH, PAGE 9A
Sto A new city councilman was elected in
Jasper by just one vote last Tuesday. The
city also passed a referendum on a
proposed tax abatement program by
eking fewer than 70 votes.
LaBarfield Bryant was sworn in as
councilman for District 1 last week after
Page 9A defeating his opponent Vanessa Smith
14 votes to 13. Furthermore, the council
now has the authority to prant
Grand jury
convened
in shooting
By Stephenie Livingston
The recent shooting death of
a Hamilton County woman
will be addressed Friday
during a grand jury probe,
according to Third Circuit
State Attorney Skip Jarvis.
Leonard Joeris is charged
with the murder of his wife
Lorrie Joeris, 42. He is
currently being held at the
Hamilton County Jail without
SEE GRAND, PAGE 2A
Funding
losses
threaten
libraries
Once again, legislature
zeroes out state budget
HOW TO BE HEARD
To make known your views
on library funding, visit
www.neflin.org/srrll where
pre-written email messages
can be submitted to
legislators. Phone numbers
and physical addresses are
also listed on the site.
By Jeff Waters
jeff.waters@gaflnews.com
Director of Libraries Danny
Hales said the elimination of
state funding for public
libraries will be devastating.
Legislatures cut all state
funding for public libraries last
Wednesday.
"It would be absolutely
catastrophic," Hales said. "The
handwriting is on the wall that
probably Jennings and the
White Springs branch will
have significant reduced hours
and may even be closed and
most employees will be
SEE FUNDING, PAGE 2A
* FROM OUR exemptions afl
READERS SEEI
Letter to the Editor
Page 11A North
Florida
Focus,
Page 2
Miss Marie's Kids,
Mercy Mountain
Boys
to take the stage
at the Spirit
6 9711311 0754164 1 11
ter an election that drew a
COUNCIL, PAGE 2A
S r r t r r t . rt t
A smiling LaBarfield Bryant is sworn in as a Jasper city councilman. - Courtesy photo
----------
!I
Publix /
For Kids 12 & Under
No Purchase Necessary
Must Present Coupon
Limit 1 Per Person -
L - -- - -- .- 1
COUNTY COMMISSION
* Workshop
aid local
veterans se
work
REDUCED
LI 2 Bedroom, 2 Bath
,� ' SBrick Home in Lynn
Lakes. Has potential
i to be converted to
I '~di 3 bedroom.
REALTY GROUP, INC. Now*75,000
106 HATLEY ST. SE
RatliffRealtyGroup.com 580774-F (386) 792-8484
as
er
PAGE2A HE ASPE NES. aspr. F THRSDY. MRCH18.201
New hospital in the
works for Hamilton?
Continued From Page 1A
certain health care
providers to obtain
state approval before
offering certain new or
expanded services. The
CON process is
intended to help ensure
that new services
proposed by health care
providers are needed
for quality patient care
within a particular
region or community,
and helps prevent
duplication of services.
"Through a
partnership between
the Development
Authority and the
hospital committee, we
will identify what our
needs are and what the
county can afford," said
County Coordinator
and hospital committee
member Danny
Johnson.
Scott said the
committee is currently
looking into a company
called Rural Health
Care Developers, as
well as larger
healthcare providers
such as Shands and
Columbia.
Grand jury convened
in shooting death
Continued From Page 1A
bond.
Lorrie Joeris died of a gunshot wound to the head
en route to Shands UF on Feb. 22. Leonard Joeris
was arrested nearly a week later after his wife's
death was ruled a homicide by the medical
examiner.
You
the latch
Subscription
1 7 2 Out of County
Mail or bring payment to:
1a$per ,Xu0s
105 2nd Ave., Jasper, FL 32052
386-792-2487
1-800-525-4182 ext. 152
Tenth annual Wild Azalea Festival set for Saturday
WHITE SPRINGS - The state Nature and Heritage
Tourism Center, Stephen Foster Folk Culture Center
State Park and the Special Events Committee for the
Town of White Springs will host the tenth Annual
White Springs Wild Azalea Festival on Saturday.
Join the town of White Springs and the State of
Florida's Nature and Heritage Tourism Center to
celebrate the spring bloom of wild azaleas. Festival
highlights include musical performances, arts and
crafts, trail hikes, the Little Miss Azalea Contest, the
Suwannee River Duck Race, a rock climbing wall
and other outdoor recreational opportunities.
Hundreds of visitors are expected to visit White
Springs to spend the day enjoying this street crafts
fair where expert artisans will display and sell their
handmade specialties. "Wild Azaleas" are a
highlight of this event and will be available for
purchase along with other native Florida plants.
SEE TENTH, PAGE 11A
Council race
decided by
a single vote
Continued From Page 1A
mere 91 voters. Sixty-seven voted
yes, while 24 voted against allowing
the City Council to grant
exemptions.
Kathy Avriett kept her District
Five seat as she was unopposed.
RIGHT: District 5 councilwoman Kathy
Avriett, seen here being sworn in for
another term, ran unopposed in last
Tuesday's Jasper city elections.
- Courtesy photo
Funding losses threaten libraries
Continued From Page 1A
furloughed."
Hamilton County has three
public libraries: Jasper, Jennings
and White Springs.
The House and Senate
Transportation and Economic
Development (TED)
Appropriations Committees cut
the funding during meetings
March 10.
"Until last year, we've never
had state funding to be zeroed
out," said Hales. "Hamilton
County will lose roughly half its
library funding with this cut."
A budget conference
committee cut the budget for
state public libraries to zero at
the end of last years' legislative
session. Legislators had
originally proposed a $21.2
million library budget, the
threshold in order to be eligible
for $8 million in federal
matching funds. At the last
minute, and after thousands of
emails and phone calls from
concerned citizens, legislators
restored the $21.2 million
funding.
Hales said what makes this
time different is the timing and
those involved. Legislators were
only two weeks into session
when TED proposed to
eliminate state aid to public
libraries in its entirety. Last year,
only the House committee
proposed the elimination and it
was near the end of the session.
Hales said that if the proposals
are approved for the budget and
it hits "the floor then usually
things don't get done after that."
"So now is the time to contact
your state legislators," Hales
said. "Tell them we want them to
restore the funding now."
To do that, folks can visit
http:/ /www.neflin.org/srrl/
where folks can submit pre-
written letters by email to their
legislators. There is also a phone,
address and email list available.
So far about 20,000 messages
have been sent electronically
and by hard copy. Governor
Charlie Crist has received about
5,000.
Both committees are expected
to release their proposed bills
within the next week.
Last year Hamilton County
received $160,462 in state aid. If
state funding is not restored,
Hamilton will lose $181,143
from its next budget.
571513-F
/mIIg@
6th Annual
Suwannee County
We need
your
support!
/eeed
Your
SUPport
I
April 9th * 5:30 p.m.
Entertainment by Jamie Ganote
Silent Auction & Dinner 5:30
Dinner Provided by Ms. Wilma
Cost is 18.50 per plate
Live Auction 6:30
Location:
Live Oak Church of God
Hwy. 129 South, Live Oak
For questions or donations contact the auction
chair Monja Slater at 386-208-4734
582227-F
Don't Let Florida Officials
Remove YOUR RIGHT TO KNOW
From The Newspaper.
Keep Public Notices
In Your Newspaper!
Proposed legislation would remove
your right to read public notices in
newspapers, restricting them to
government web sites only.
We're concerned.
You should be, too.
Public notices are an important tool
in ensuring an informed citizenry.
They have played a key role in
America's participatory democracy
where it counts most: how your tax
dollars are spent and how policy is
made.
When located in easy-to-find
sections of your newspaper, they are
fully accessible to everyone, unlike the
Internet. Large segments of the state's
population, including more than half
of Floridians over 65 and one-third
of minority populations, do not have
Internet access.
The public's right to know cannot
be abandoned in favor of cost savings
that are elusive.
Consider that less than 10% of U.S.
citizens view a government web site
daily, according to the U.S. Census
Bureau. This contrasts dramatically
with the 83% of adults who read a
community newspaper every week,
according to the National Newspaper
Association.
Furthermore, a public notice printed
in the newspaper produces a
permanent record. A newspaper is
archived for years, and is not subject
to computer crashes and hackers.
Newspapers are easily verifiable,
fully transparent and represent
an impartial third party. Giving
government singular responsibility
for distributing public notices is like
putting the fox in charge of the hen
house.
Newspapers are your watchdogs.
Keep it that way. Contact your local
representative today and voice your
opinion.
Search Florida's notices online at www.floridapublicnotices.com
tORi~j
jiasper
386-792-2487
SFLORIDA
U PUBLIC NOTICES
581460-F
I"'L"Zr T'" Z. /zJ
i ant tlie most in-deptl co erage.
est news and stories that touch home.
We want to give it to you.
I
PAGE 2A
THE JASPER NEWS, Jasper. FL
THURSDAY, MARCH 18, 2010
THRSA. ARH18 01 TEJAPR EW.Japr.FLPGE3
NFCC Public Safety Academy offers
free gang awareness training
Local law enforcement, criminal justice officers and NFCC Public Safety Academy students gather for informative Q&A on
Florida gangs. - Photo submitted
Submitted by: NFCC Office
of College Advancement
MADISON, FL - North Florida
Community College's Public Safe-
ty Academy held a free Gangs
and Security Awareness ques-
tions and answer training Feb. 24
and Feb. 25 at NFCC's Public
Safety Academy facility in Madi-
son, FL. All Florida Law Enforce-
ment and corrections officers
were encouraged to attend.
Guest speaker and Florida De-
partment of Corrections Crime In-
telligence Analyst, Carter Hick-
man spoke on gang related issues
that law enforcement and correc-
tions officers face on a daily basis.
Hickman covered topics such as,
Florida Legislature, gang identi-
fiers, gang myths, gang recruit-
ment and initiation, gang talk and
active gangs in Florida.
For more information about the
NFCC Public Safety Academy
please contact (850) 973-1617,
email hackleg@nfcc.edu or visit
www.nfcc.edu (Search: Public
Safety Academy).
Public meetings will address plans for
future water supply
By WalterM Cenzie
WHITE SPRING
lifeinwhitesprings@gmail.co
Life in White Springs will return next
week.
Healthy Start of N.
Central Florida's board
meets today
Submitted
Healthy Start of North Central Florida Board
meeting will be held today, Thursday, March
18th at 2:00 p.m. in the WellFlorida Council Con-
ference Room, Gainesville.
The public is invited. Please call Celia Paynter
at 352-313-6500, ext. 118 if you need additional
information.
Healthy Start of N. Central
Fl collecting for needy
families-diapers needed
Submitted
Healthy Start of North Central Florida is col-
lecting disposable diapers for needy families in
this region, May 9-June 20. Drop diapers off at
your local health department, or call Georgine
lanuale at 352-313-6500, ext. 120 for more infor-
mation.
Submitted
LIVE OAK, FL,
March 4, 2010 - The
Suwannee River and
St. Johns River water
Calvary
Baptist
Church
Homecoming
11:00am
This Sunday; March
21, 2010
Special Music with
Curtis Richards
and his Gospel Blue-
grass Band
Stay and have lunch
with us!
management districts
will hold several joint
meetings to address
plans for future water
supply.
Both districts are
each developing their
own water supply
plans for areas where
sources may be unable
to meet demands over
the next 20 years. The
Suwannee district is
currently developing a
plan for the Upper
Santa Fe River Basin,
which is scheduled for
adoption in December
2010.
The various meetings
will discuss the water
supply planning
process, alternative
water supply options
and minimum flows
and levels.
Anyone who may be
interested in the water
supply planning
process is invited to at-
tend. The following is
a schedule of meetings:
Northeast Florida
water supply planning
area workgroup:
March 18, 10 a.m.,
Alachua County
Health Department
Auditorium, 224 SE
24th Street,
Gainesville.
Northeast Florida
modeling subgroup:
March 25, 9 a.m., St.
Johns River Water
Management District
headquarters in Palat-
ka, 4049 Reid St. (Hwy.
100 West), Palatka.
Northeast Florida al-
ternative water supply
subgroup: April 8, 9
a.m., Green Cove
Springs City Hall, 321
Walnut St., Green
Cove Springs.
Northeast Florida
minimum flows and
levels (MFLs) sub-
group: April 23, 10
a.m., St. Johns River
Water Management
District headquarters
in Palatka, Governing
Board room, 4049 Reid
St. (Hwy. 100 West),
Palatka.
Northeast Florida al-
ternative water supply
subgroup: May 6, 9
a.m., Green Cove
Springs City Hall, 321
Walnut St., Green
Cove Springs.
Northeast Florida
water supply planning
area workgroup: June
17, 10 a.m., Andrews
Center, 201 E. Call St.,
Starke.
Northeast Florida
minimum flows and
levels (MFLs) sub-
group: July 9, 10 a.m.,
St. Johns River Water
Management District
headquarters in Palat-
ka, Governing Board
room, 4049 Reid St.
(Hwy. 100 West),
Palatka.
Meeting dates are
subject to change. To
verify meeting dates or
to learn more about
the water supply plan-
ning process, visit
www.mysuwanneeriv-
er.com. Information is
available under the
"Water Resources"
button and "Water
Supply Planning" link.
Norris
Notes U
By Lillian Norris
Norris Notes will
not be running dur-
ing the next few
weeks. Mrs. Lillian
Norris will be back as
soon as possible with
her column. Thank
you.
APPLY NOW
TO BE THE STAR OF YOUR OWN FINANCIAL FUTURE.
HURRY! Don't miss your chance to participate in the VyStar Money Makeover.
APPLICATIONS MUST BE POSTMARKED BY MARCH 22nd!
VyStar Credit Union and CBS 47/FOX 30 are teaming up to bring you the
VyStar Money Makeover, where contestants compete over the course
of the year to improve their household budgets and their financial
bottom line. And you can be a part of it.
www.vystarcu.org
JACKSONVILLE AND SURROUNDING AREA
904-777-6000 * 1-800-445-6289
GAINESVILLE BRANCH 352-372-1645
LAKE CITY BRANCH 386-719-6767
PALATKA BRANCH 386-328-3303
PALM COAST BRANCH 386-445-7079
Credit Union
We never forget that it's your money.
ACTION NEWS
Download your application TODAY
at www.vystarcu.org or ask a VyStar
representative for an application today.
THE VyStar
money
MakeLver
VYSTAR MEMBERSHIP IS OPEN TO ALL PEOPLE IN THE FOLLOWING COUNTIES:
Alachua * Baker * Bradford * Clay * Columbia * Duval * Flagler * Gilchrist * Hamilton * Levy * Putnam * Marion * Nassau * St. Johns * Suwannee * Union * Volusia
1 S FEIL NO PURCHASE NECESSARY TO ENTER OR WIN. Applicants must be Legal residents of the State of Florida. Primary applicants must be 18 or older. VyStar Credit Union employees
1NSI BY~NUA and their family members are not eligible for the VyStar Money Makeover'10 Contest. Limit one prize per family, household or address. Details are available at www.vystarcu.org
� 2010 VyStar Credit Union
583334-F
THURSDAY, MARCH 18, 2010
THE JASPER NEWS, Jasper. FL
PAGE 3A
IOTOA
PAGE4A HE ASPE NES. aspr. F THRSDY. MRCH18.201
The warmrs rerlkl bak
Copyrighted Material
Syndicated Content
Available from Commercial News Providers
er japerpr Wwi
ed weekly every Thursday. USPS #755-980
officee located at 105 NE 2nd Avenue,
Bank of America, Jasper, FL 32052
386) 792-2487 FAX (386) 792-3009
il address: jaspernewsl@windstream.net
an ............ .. Publisher
idges ............. Group Editor
................. Reporter
eddan ........... Administrative Assistant
'eriodicals postage paid at Jasper, FL.
nual subscription rate is $17 in county,
$25 out of county and out of state.
)STMASTER: Send address changes to:
ier News, 105 NE 2nd Ave., Jasper, FL 32052
A^^^ ^ ,4, , Hamilton County represented at recent legislative meeting
Submitted by Hamilton County Farm Bureau
The Hamilton County Farm Bureau was involved
with the Annual Multi-County District Legislative
Meeting held recently in Mayo, Florida. Rep. Debbie
Boyd and Rep. Leonard Bembry were both present
to discuss upcoming legislative issues wit the farm-
ers.
Jon and Ellen Deas represented Hamilton County,
and some of the key issues discusses were protection
of the Florida Greenbelt Law, the current General
Agriculture bill, and Amendment 4, which is the
"Home-Town Democracy" issue which will be on
the ballot for all Floridians to vote on during the next
election.
Deas is a farmer in Hamilton County, but also
serves on the State Board of Directors for Florida
Farm Bureau. According to Deas, the state organiza-
tion has a strong position on Amendment 4, and that
is it will be bad for all Floridians, and especially for
farmers and ranchers.
Nearly fifty Farm Bureau members from Suwan-
nee, Lafayette, Taylor, Madison, Jefferson and Co-
lumbia Counties heard the elected officials speak.
"Fortunately, we have some really great legislators
in Mr. Bembry and Ms. Boyd, and they think along
with Farm Bureau policy," said Deas.
Another speaker at the meeting was Farm Bureau
Chief lobbyist Ben Parks from Tallahassee. Parks in-
vited all the Farm Bureau Members to attend the
huge Farm Bureau Days at the state capitol on March
16th, beginning at 5:30 p.m. Over 800 Farm Bureau
members from all across the state will attend to meet
SEE HAMILTON, PAGE 8A
EQUAL HOUSING
OPPORTUNITY
HAMILTON COUNTY
COMMUNITY DEVELOPMENT
BLOCK GRANT HOUSING
REHABILITATION PROGRAM
CONTRACTOR REQUEST FOR
QUALIFICATIONS
ATTENTION GENERAL
CONTRACTORS
The Florida Department of Community Affairs has made
Community Development Block Grant funding available to
Hamilton County for the rehabilitation or replacement of
residential housing units located in the unincorporated areas of
Hamilton County.
Hamilton County has an ongoing Community Development Block
Grant in the Housing Rehabilitation category and is accepting
qualification packages from contractors who are state certified
and interested in participating in the Community Development
Block Grant Housing program. Minority and women owned
businesses are encouraged to submit a qualification package in the
program. Contractors that are currently qualified will remain
qualified and need not reply.
Request for qualification packages may be obtained from the
County Coordinators Office, 1153 US Hwy. 41, Suite 2, Jasper,
FL 32052, or from the Clerk of Courts Office, 207 NE 1st Street,
Room 106, Jasper Florida 32052.
Request for qualifications should be dropped off with or mailed to
Mr. Danny Johnson, Hamilton County Coordinator, 1153 US
Hwy. 41, Suite 2, Jasper FL, 32052. If you require additional
information, please do not hesitate to contact Spencer Nabors at
Fred Fox Enterprises Inc. (888) 223-9795.
Hamilton County is a Fair Housing/Equal
Opportunity/Handicap Access Jurisdiction 583326F
)hone (H) (C) (W)
Email:
Allergies:
582222-F
Publish
O
Phone (3
E-ma
Myra Reg
Robert Bri
Jo Ross..
Louise Sh
P
An
PC
The Jasp
T n-ttnri
LjLLeL LU 11t eJUlLUL_ CaIU .tL L1.1te I UlIIcy
Letters to the Editor and news articles can be mailed,
FAXed or dropped off at the news office located in the
Bank of America Building, Monday through Friday, 8 a.m.
till 5 p.m.
Letters to the Editor should be typed, double-spaced if
possible, brief and to the point, approximately 150 to 200
words or less. Not all letters are published. To be consid-
ered for publication Letters to the Editor must be signed,
include the writer's address and phone number, and in
the Jasper News' office on Friday before 5 p.m.
News Releases, 400 or less words, should be typed, dou-
ble-spaced if possible, brief and to the point. Not all articles
are published.
Letters and articles may be edited to fit available space.
Well written letters/articles require less editing.
To mail your letter/article, send it to: The Jasper News,
105 NE 2nd Ave., Jasper, FL 32052 or FAX it to: 792-3009.
PAGE 4A
THE JASPER NEWS, Jasper. FL
THURSDAY, MARCH 18, 2010
THRSA. ARH18 01 TEJAPR EW.Japr.FLPGE5
Delivering to Jasper, Jennings
& White Springs daily
'IImI Iw
Florist
Live Oak
362-2776
Lake City
755-8606
Mention this ad for free delivery
Revival at Friendship A special "fundraiser"
Baptist Church thank you
Submitted
Forever His Ministries will be at Friendship Bap-
tist Church, CR 137, Jasper, Florida from Sunday,
March 21st thru Wednesday, March 24th.
Sunday the services begin at 11:00 a.m. and 6:00
p.m. Services for Monday thru Wednesday begin at
7:30 p.m. each night
Forever His Ministries is a full-time, gospel music,
evangelistic team home based out of Countryside
Baptist Church in Mansfield, Texas. Formed in Jan-
uary 1985, they now travel and live full time in their
diesel bus, ministering and singing original songs
God has given them. Over the years, their ministry
has expanded into 200 to 250 churches, covering 30
states each year.
Phillip Crow and his wife, Diann Crow are the
owners and founders of Forever His Ministries.
They sing as a duet, and, Brother Crow plays the
guitar and the keyboard in their concerts. He has
written over 180 songs and also preaches as the Lord
allows. They invite you to join them in these services
of praise, worship & preaching; dedicated to win-
ning lost souls and to lifting up the LORD JESUS
CHRIST! Old fashion services! No contemporary or
modern music!
Don't miss these special services!
New Hope Baptist
Church will host annual
"Share Saturday"
Submitted
New Hope Baptist Church in Jennings, FL.,
will host its annual "Share Saturday" from 8:00
a.m. until noon on Saturday, March 27th at the
church. The address is 6592 NW 48th Street.
The public is invited to attend and select free
clothing from the donated "gently used" items
from baby clothes through adults.
Birth announcement
Submitted by Margaret A. McDonald,
committee vice-president
A very special "Thank you" goes to Sunoco Gas on
SR 6 and Burger King for hosting our first kick-off
campaign to raise funds for a new Crossroads Vol-
unteer Fire Station and Community Center.
As we embraced the presence of Judge Sonny
Scaff, we welcomed weekend travelers from Ten-
nessee, Arizona, Canada, Michigan, Alabama, Ohio,
Pennsylvania, Colorado, Kentucky, Texas, Indiana,
Florida, Georgia, North Carolina, Minnesota and
Utah.
Freddie the Clown entertained the little ones and
all the young at heart.
Thank
You
We, the family of He-
len K. Selph would like
to thank all who showed
their love and support as
well as being so kind and
generous during our
time of loss. All the
prayers, food, flowers,
calls, cards, donations,
hugs, and help are so
greatly appreciated.
We know God will
continue to comfort us in
the days to come because
of your prayers and sup-
port. We are blessed to
live in such a loving and
caring community, may
God bless each and
everyone.
Thank you again,
The Helen K. Selph
family
Present Yourself Untarnished
David H. Matier, Doctor of
Pastoral Counseling
This message is espe-
cially for our young peo-
ple. It asks the question,
"What is wrong with be-
ing able to approach the
marriage alter as a vir-
gin?" Imagine being
able to tell your love, "I
am presenting my body
to you; I've saved myself
for you because I love
you.
You can't replace
something you have giv-
en away. This is not to
judge those young peo-
ple that have given away
their virginity (I John
1:9) but for you that
haven't you need to turn
to Ephesians chapter 5
and absorb what the
Bible says about the hus-
band and wife relation-
ship. The Bible com-
pares the husband's rela-
tionship to his wife with
Christ's relationship to
the Church. It is inter-
esting that in verses 25
through 30 that there ap-
pears to be a lot of re-
sponsibility on the
"man" to help the
woman to remain
"pure" (a virgin) until
marriage!
Sex prior to marriage
is nothing short of "for-
nication" and "adultery"
and God will judge it but
in marriage the Bible
says, "Marriage is hon-
orable in all and the bed
undefiled:..." (Heb.
13:4). Every race/ethnic
group has had a mar-
riage ceremony of some
sort. In our nation/state
it is the law that we ap-
ply for a marriage li-
cense and Christians are
to be subject to the law
of the land (Romans
13:1-7). You are not
married just because you
started living together -
whether you had some
sort of little ceremony or
not; it is not legal (It is
amazing how many old-
er adults make judg-
REVIEW. RENEW. RETIRE.
There are many opportunities this year to help you renew your
efforts to save for retirement and stay focused on reaching your
retirement goals. These opportunities include:
I Opening or fully contributing to a traditional or Roth IRA
by April 15 to help maximize saving for retirement in a
tax-advantaged manner
I Consolidating retirement accounts to get a clearer picture
of your retirement
I Converting all or part of a tax-deferred IRA to a Roth IRA so
you can receive tax-free income* in retirement
Call today to schedule a review. We'll meet face to face to gain a
better understanding of your current situation and discuss your
opportunities to help move your retirement forward.
*Earnings distibutions from a Roth IRA may be subject to taxes and a 10% penalty if the account is less
than five years old and the owner is under age 59�.
E Josh Akers
Financial Advisor
521 Lakes Blvd Suite B
Lake Park, GA 31636
229-559-0127
www.edwardjones.com/renew
Member SIPC
ments about the young
people living together
unmarried while they
live together unmarried
so they can "beat the
government" out of tax-
es, etc.).
Save yourself until
your wedding day so
you can say to the one
you love, "I present my-
self to you on this, our
wedding day."
David H. Matier, DPC
dmatier@windstream.net
FIRST ADVENT CHRISTIAN
N.W. 15th Avenue Jasper
Rev. Wayne Sullivan
Sunday
Sunday School........ .........10:00 a.m.
Morning Worship...................11:00 a.m.
Wednesday
Prayer Fellowship....................6:30 p.m .
571612-F
NEW HOPE BAPTIST CHURCH
SR 6 West, 6592 NW 48th St.,
Jennings, FL 32053
938-5611
Pastor:Jeff Cordero
Sunday School................................10:00 a.m.
Morning W orship.............................11:00 a.m .
Sunday Evening Worship, Youth Happening,
RA's, G A 's........................................6:00 p.m .
Wednesday
Supper ..........................6:00 p.m.
Prayer Meeting, Discipleship class for adults,
Youth activities, Children's Choirs.....6:30 p.m.
Van pick-up upon request
571613-F
CALVARY BAPTIST CHURCH
1/2 mile East on Hwy 6, Jasper, Fl 32052
792-2275
Sunday
Sunday School .................. 10:00 a.m.
Morning W worship ................... 1 :00 a.m.
Children's Church................. 11:00 a.m.
Church Training ....................6:00 p.m.
Evening Worship ....................7:00 p.m.
Wednesday
Prayer Meeting....................... 7:00 p.m.
571614-F
Eternal Hope!
Church of
God to
celebrate
07th year!
Submitted
The Eternal Hope!
Church of God will
be celebrating its 97th
year on March 28,
2010. Our guest
speaker will be for-
mer Pastor Robert
Layne from Panama
City, Florida.
We invite you to be
a part of this time of
celebration. For more
information, call 386-
792-HOPE (4673).
clothes
closet
The Jasper First
Methodist Clothes Clos-
et, at 405 Central Avenue
in Jasper, will be open
Saturday, March 27th
from 1 - 5 p.m.
The Clothes Closet is
accepting clothing, clean
and in good repair only
please. There is a spe-
cial need for men's and
children's clothing. For
further information call
792-0904.
ST. THERESE CATHOLIC CHURCH
Three miles north of Jasper U.S. 41
P.O. Box 890, Jasper, FL 32052
Rectory U.S. 90 E., Live Oak, FL
(386) 364-1108
Sunday MASS 8:00 a.m.
571623-F
CHURCH OF CHRIST
CHURCH OF CHRIST
N.W. 3rd St., Jasper
Bldg.: 792-2277
Sunday
Sunday School.............................9:30 a.m.
Morning Worship.................10:30 a.m.
Evening Worship.................... 6:00 p.m.
Wednesday
E ve n ing ........................................6 :00 p.m .
571615-F
FIRST UNITED METHODIST
CHURCH
405 Central Ave., Jasper, FL
Pastor - Dale Ames
Phone- 386-792-1122
Sunday
Sunday School.............................. 9:45 a.m.
.1, ''.: ,: , : 11:00 a.m .
Wednesday
Bible Study..................................... 4:45 p.m.
Choir Practice................................ 6:00 p.m .
Family Night Dinner 3rd Wednesday
Clothes Closet 4th Saturday 1-5pm
571616-F
Braxton Lee Wynn
Sidney and Blake Wynn would like to an-
nounce the birth of their baby brother Braxton
Lee Wynn. Born December 27, 2009 at 4:29 a.m.
in Gainesville at the Women's Center, Braxton
weighed 7 lbs. 3 oz. and was 20 & 1/2 inches
long.
Proud parents are Doug & Kasey Wynn, Jr.
Maternal grandparents are Brenda & Walter
Amerson and Mike & Cindy Holton. Paternal
grandparents are Doug & Glenda Wynn, Sr.
Tfank You
The family of Lorrie Hinton Joeris would like to
thank everyone who have prayed and supported our
family in our time of need. God has given us
strength and courage to continue on each day and
the comfort to know that our daughter, mother, sis-
ter, aunt is in Heaven with our Lord.
All the prayers, food, phone calls, cards, flowers,
donations, and visits are greatly appreciated. A spe-
cial thanks to Calvary Baptist Church, our church
family, and the school corporation for their support
and meal in the fellowship hall.
Also, to all the churches and church families who
shared their pastors and their time with us; the
Hamilton County School system, principal, coun-
selors, and teachers who were so caring for Lorrie's
fourth grade class. What a wonderful and caring
community.
Thank you again,
Owen & Sybil Hinton
Elizabeth & Weston Joeris
Owen Hinton III
James (Ann) Hinton & Family
I NOWDENM I NATIONAL I^ S -
BURNHAM CHRISTIAN CHURCH
4520 NW CR 146, Jennings, FL 32053
938-1265
Pastor: Robert Carter
Sunday
Sunday School............................... 9:45 a.m.
W orship........................... ......... 11:00 a.m.
Evening Service.....................6:00 p.m.
Wednesday
Prayer Meeting............................... 7:00 p.m.
571617-F
PENTECOSTAL
PENTECOSTAL
DELIVERANCE CENTER
1394 McCall Street
Jennings, FL 32053
Pastor Edgar C. Wood
Sunday School..................... .......10:00 a.m.
Sunday Morning Worship............11:00 a.m.
Sunday Night Worship...................6:00 p.m.
Wednesday Night Worship............ 7:30 p.m.
575935-F
FIRST PRESBYTERIAN CHURCH
204 N.W 3rd Avenue, Jasper, 792-2258
Pastor: Rev. Parrish Jones, 792-8412
SUNDAY
Sunday School ...................... 10:00 a.m.
W worship Service........................... 11:00 a.m.
WEDNESDAY
Prayer in Fellowship Hall...............9:00 a.m.
Choir Practice...............................7:00 p.m.
571619-F
AfBI
To list your church on our
church directory, please call
Nancy at 1-800-525-4182
To place your ad inside
the Church Directory
please call Louise at
386-792-2487
I I I
THURSDAY, MARCH 18, 2010
THE JASPER NEWS, Jasper. FL
PAGE 5A
aYa of
(Jftywt tL 'w^ OY (ee
PAGE6A HE ASPE NES. aspr. F THRSDY. MRCH18.201
Heart Matters
By Angie Land
"Sorry, we already have other plans..." Ever used
that excuse to get out of something you really did-
n't want to do? The problem with well-worn ex-
cuses is that they are barely believable...even on
the rare occasion they might actually be true.
While occasionally our reason for using an excuse
can be to spare the feelings of another, often we just
aren't willing to be honest. Webster's dictionary
defines an excuse as "something offered as grounds
for being excused; an expression of regret for fail-
ure to do something." However, in our culture, ex-
cuses are much more likely to be a fabrication than
real regret. Excuses come in every variety and we
seem to have a never ending supply...but just in
case we have overused our favorites and need some
new material, there is now a host of websites
loaded with excuses cataloged for every occasion!
In Luke 14:15-24, the Bible records a parable Jesus
taught that has great insight concerning the futility
of our excuses:
"A certain man was preparing a great banquet
and invited many guests. At the time of the ban-
quet he sent his servant to tell those who had been
invited, 'Come, for everything is now ready.' But
Community Calendar
Mar. 19 - White Springs Neighborhood Watch
meeting in the Community Center
Mar. 20 - Wild Azalea Festival in White Springs
Mar. 20 - NHE's PTO presents 20th annual beau-
ty pageant at 6 p.m.
Mar. 21-24 - Forever His Ministries, full-time
gospel music & evangelistic team, presented at
Friendship Baptist Church. Sunday at 11 a.m. and 6
p.m., Mon-Wed services begin at 7:30 p.m.
Mar. 23 - Hamilton County Alcohol and Other
Drug Prevention Coalition sponsors a town meeting
in the Hamilton County Annex Auditorium at 6:30
p.m.
Mar. 24 - The Lady of the Lake Quilting Guild
will hold it's monthly meeting on Wednesday,
March 24, 2010 at 9:30 AM at the Teen Town 533 NW
Desoto St, Lake City, FL. (2 blocks north of Duval
(US 90) on Lake Jeffery Rd.
Mar. 27 - New Hope Baptist Church hosts their
annual "Share Saturday" from 8 a.m.-noon at the
church, 6592 NW 48th Street. Public invited.
they all alike began to make excuses..."
It is amazing that the Bible was written so long
ago, yet the excuses used in Jesus' parables are the
same ones we keep offering...the first excuse: Our
stuff...(vs.18) "I have just bought a field, and must
go and see it." Makes you wonder where he
thought it would go? The second excuse: our
jobs...(vs. 19) "I have just bought five yoke of
oxen, and I'm on my way to try them out..." Again,
if they are already paid for, did the new owner
think someone else would plow his field for him
before he could do it? The third excuse: our fami-
ly...(vs. 20) Still another said, "I just got married, so
I can't come." This one really puzzles me...what
newly wed married would want her husband to
turn down dinner out?
The real problem with relying on an excuse to
justify our behavior is that even a legitimate expla-
nation often "excuses" us from dealing with real is-
sues. Case-in-point: A family member offends
us, so instead of working toward forgiveness and
resolving the issue, we continually find an excuse
not to attend family gatherings where they will be
present. Often, the honest truth about the matter is
that we don't want to forgive the person and recon-
cile the situation. In reality, not one of us ever
Mar. 27 - Jasper First Methodist Church's Clothes
Closet will be open from 1-5 p.m. Accepting clean, in
good repair clothing. Special need for men's & chil-
dren's clothing. Call 792-0904.
Mar. 28 - Eternal Hope! Church of God celebrates
its 97th year! Guest speaker will be former Pastor
Robert Layne. Call 792-HOPE (4673) for more infor-
mation.
Apr. 3 - People United presents Annual Unity in
the Community Celebration. 11 a.m. until 5 p.m. in
Buddy Parker Park, Jasper. Contact Pastor Pamela
D. Johnson at 386-266-8387 for more information.
Apr. 4 - People United Sunrise Service at 7 a.m. in
Buddy Parker Park, Jasper. Contact Pastor Pamela
D. Johnson at 386-266-8387 for more information.
Apr. 4 - Jennings Missionary Baptist Church, lo-
cated on Oak Street in Jennings, will host Easter Sun-
rise Service at 7 a.m. Breakfast will be served. Watch
for signs.
Apr. 15 - Tax day TEA party outdoor rally from
7-9pm in the Sun Coast mall parking lot located at
exit 5 & 1-75 in Lake
Park, Ga. For more info,
contact John Burford:
386-938-1330 or
Irrp@mindspring.com
needs an excuse to do what we really want to do!
Another problem that occurs with using excuses
to justify our behavior is that we tend to blame oth-
ers. Problem at work? Blame the boss or a co-
worker. Problem with your children? Blame the
teacher or the coach. Problem with God? Blame
the church.
Continuing to blame others might temporarily
shift the responsibility from our lap, but the prob-
lems remain. The bottom line: blaming others is
a waste of precious time that could be spent figur-
ing out a solution. That being said, the next time
we are tempted to make up an excuse or blame oth-
ers for a problem, let's check first to see if we need
to be honest with ourselves and accept responsibili-
ty for our part of the problem...
Because Every Heart Matters...Angie
Heart Matters is a weekly column written by Angie
Land, Director of the Family Life Ministries of the
Lafayette Baptist Association, where she teaches bible
studies, leads marriage and family conferences and ..ff.
biblical counseling to individuals, couples and families.
Contact Angie with questions or comments at ang-
ieland3@windstream.net
Monthly Happenings:
The Jasper Revitalization Committee meets the 3rd
Thursday of each month at 6 p.m. in the Jasper City
Hall.
Bible Baptist Church opens their clothes closet on
the 2nd Saturday of each month from lp.m-3p.m.
Call 792-0720 for more information
The Town of White Springs presents "First Satur-
days". Community-wide events including free re-
freshments, yard sales, retail business-sponsored
sales and events.
Hamilton County
Pharmacy
Assistance Program
This is a reminder to all Hamilton County res-
idents of the Pharmacy Assistance Program. It is
currently located in the Hamilton County
Health Department. The program provides as-
sistance to residents who are low income and
who have no other types of resources to help
them in acquiring needed medications.
For more information contact Heather Bem-
bry at the Hamilton County Health Department
at 386-792-1414 ext. 239.
Pentecostal Deliverance Center
Located on McCall St., Jennings, FL
For more information call 386-590-6267 March 19th at 7 p.m.
Gordon Tractor OPEN HOUSE
See Kickin' Kevin from 98.1 Live from 10 a.m.- 12 p.m. March 27 * 9 a.m. - 1 p.m.
11J O I"'0F. L-SERIES Standard Tractor
L2800 , L34 WE KEEP YOU CUTTING
L3400 n Come in and visii
do CI L4400WANld
* ~t-/4n gear-arive transmission w 4WD
* Live continuous PTO * PTO 37.5 HP
To do the job right, you need the right * 8F/4R gear-drive transmission
tractor. The variety and versatility of * Full-flat deck
Kukota's standard L-Series lineup lets * Hydraulic independent PTO
you select what's perfect for you. * Hydrostatic power steering
It's about relentless power...brute strength...lightning quick reflexes...creature
comforts...add everything up and what you've got is a zero-turn that's design-engineered
to outwork and outlast practically any other machine out there...a zero-turn that's all
about generating the kind of productivity that builds up a bottom line...not tears one down
t
with the newest
Gravely dealer in
North Florida and
take a free test
drive! See the
entire lineup of
lawncare
products during
our Open House
on March 27th at
our Live Oak
location!
1172 S.O ioA ve.,Live Oa ,*38 T8
583213-F
PUBLIC NOTICE OF
CITY ELECTION
NOTICE, is hereby given that the City of Jennings, Florida,
will hold a City Election to fill two (2) City Council seats
for full four (4) year term. The Qualifying Period will
commence at noon, April 12, 2010 and will end at noon on
April 16, 2010. Oaths may be secured at Jennings City
Hall. The City Election will be held on Tuesday, June 1,
2010, between the hours of 7:00 AM and 7:00 PM. All
voting will take place at Jennings Council Chambers. The
books for registration to vote in this election will close on
May 3, 2010.
Christy Smith
City Clerk
583261F
PAGE 6A
THE JASPER NEWS, Jasper. FL
THURSDAY, MARCH 18, 2010
THRSA. ARH18 01 TEJAPR EW.Japr.FLPGE7
Florida Department of Health
Be aware of circulating gastrointestinal
illness caused by Norovirus
Submitted
Tallahassee - The Florida Depart-
ment of Health (DOH) wants Florida's
residents and visitors to be aware of
the symptoms of and take precautions
to prevent contracting gastrointestinal
illness. The currently circulating gas-
trointestinal illness is attributed to a
virus called norovirus. Norovirus is
very contagious and can be transmit-
ted person to person, as well as
through contaminated water, food or
surfaces.
During January and February 2010,
61 clusters of gastrointestinal illness at-
tributable to norovirus have been iden-
tified, as compared to 47 clusters dur-
ing the same two months of 2009.
There have been recent reports of
norovirus and gastrointestinal illness
clusters in schools, assisted living facil-
ities, long-term care facilities, and cor-
rectional facilities.
"This is the time of year when
norovirus often spreads around our
communities," said Ana M. Viamonte
Ros, M.D., M.P.H., "Frequent hand-
washing, especially before preparing
food and after using the toilet or
changing a child's diaper, is the most
effective means of preventing the
spread of norovirus and other commu-
nicable diseases. Other important pre-
ventive measures include practicing
proper food handling and preparation
methods and disinfecting surfaces."
Norovirus may cause gastrointesti-
nal symptoms such as nausea, diar-
rhea, vomiting, and stomach cramp-
ing. Sometimes people may also have a
low-grade fever, chills, muscle aches,
headache, and an overall feeling of be-
ing tired. For most people, the symp-
toms only last for 24 to 48 hours.
While there is no treatment for
norovirus, it is recommended that in-
fected persons get plenty of rest and
consume extra liquids to avoid dehy-
dration. People with symptoms of
norovirus should stay home while ill
to avoid the spread of the virus. In ad-
dition, people who are infected with
norovirus should not prepare food for
others or work in sensitive environ-
ments like childcare, school, food ser-
vice, or health care facilities while they
have symptoms and for at least three
days after they have recovered.
Per Florida Administrative Code
64D-3, outbreaks or clusters of illness
are reportable to the local county
health department. For more informa-
tion about norovirus, visit
www.doh.state.fl.us/Disease
crtl/epi/diseases.htm#N or
www.cdc.gov or call your local county
health department. A complete list of
county health departments and con-
tact information can be found at
www.doh.state.fl.us/chdsitelist.htm.
DOH promotes, protects, and im-
proves the health of all people in Flori-
da.
Need Your High School Diploma?
Attend Hamilton County School
District's FREE ABE and GED
Prep Courses
Adults who have not received a high
school diploma may register and en-
roll at the class site in Jasper at the
JREL Complex, Building 1, Room 8.
This is your "Second Chance" to earn a
high school diploma.
Class Registration: Every Wednes-
day at 1:00 p.m.
1. Need a copy of your Social Secu-
rity card.
2. Students, ages 16-17, must pro-
vide a copy of their withdrawal form
from the last school attended.
3. Registration, including Locator
Test will take 1 hour.
TABE Class Entrance Test: Every
Thursday at 1:00 p.m.
1. Only for adults without a high
school diploma.
2. Must have completed registra-
tion.
3. Test takes approximately 3 hours
and will start promptly at 1:00 p.m.
Call Rex Mitchell (792-6571) or Eve-
lyn Davis (792-6529) for enrollment de-
tails.
a a
zib 2 saVe.corn
It's simple, choose your zip code or city and access
all your favorite advertising circulars, coupons, deals,
travel specials and more - online!
Come by our office at
* ADVERTISING CIRCULARS * COUPONS * DEALS
TRAVEL SPECIALS * ONLINE ANYTIME!
Featured Advertisers
'I'
Let Build Something Together
OVMN Emu
( Lottie's CORBETT'S MOBILE
Q o Laundry HOME CENTER
Contact Monja Slater at the Suwannee Democrat to
advertise on zip2save.com 386-362-1734 * 1-800-525-4182
* New retailers added weekly.573073
_________________________________________________'__________________573073-F
JCPenniey
KOHES
expect great things
0
TARGET
Quality Plus
Carpet Cleaning PJhn
Painting
IP NEW LIFE
D IRBIBLE
DIRECTBOOKSTORE
74e 9odet leedte
THURSDAY, MARCH 18, 2010
THE JASPER NEWS, Jasper. FL
PAGE 7A
THE JASPER NEWS. Jasper. FL
THURSDAY. MARCH 18. 2010
Jasper Legals
IN THE CIRCUIT COURT OF THE
3RD JUDICIAL CIRCUIT, IN AND FOR
HAMILTON COUNTY, FLORIDA
CIVIL DIVISION
CASE NO.: 24-2010-CA-000034
SUNTRUST MORTGAGE, INC.,
Plaintiff,
Vs.
JONATHAN A. MOODY, et al,
Defendants.
NOTICE OF ACTION
TO:
JONATHAN A. MOODY
Last Known Address: 5766 SW 61st Av-
enue, Jasper, FL 32052
Also Attempted At: 14555 98th PI., Live
Oak, FL 32060
Current Residence Unknown
YOU ARE NOTIFIED that an action for
foreclosure of Mortgage on the following
described property:
A piece or parcel of land in the North-
west 1/4 of the Southeast 1/4 of Sec-
tion 22, Township 1 North, Range 12
East, Hamilton County, Florida, de-
scribed as follows: Commence at the
approximate location of Southwest
corner of Northwest 1/4 of the South-
east 1/4 of said Section 22 run in an
Easterly direction along the centerline
of County Road a distance of 25 feet;
thence North a distance of 435 feet to
the Southwest corner of hereinafter
described tract to Point of Beginning;
thence continue North a distance of
210 feet; thence North 89025' East a
distance of 210 feet; thence South a
distance of 210 feet; thence South
89025' West a distance of 210 feet to
Point of Beginning; ALSO a 25 foot
easement from point 210 feet East of
the Southwest corner of the Northwest
1/4 of the Southeast 1/4 of Section 22,
Township 1 North, Range 12 East, on
the North edge of the county road
Right-of way; thence running North to
the Southeast corner of the above de-
scribed property.
Has been filed against you and you are
required to serve a copy of your written
defenses, if any, to it, on Marshall C. Wat-
son, PA., Attorney for Plaintiff, whose ad-
dress is 1800 NW 49th STREET, SUITE
120, FT LAUDERDALE, FL 33309 on or
before April 11, 2010, a date which is
within thirty (30) days after the first publi-
cation of this Notice in the Jasper News
and file the original with the Clerk of this
Court either before service on Plaintiff's
attorney or immediately thereafter; other-
wise a default will be entered against you
for the relief demanded in the complaint.
If you are a person with a disability who
needs any accommodation in order to
participate in this proceeding, you are en-
titled, at no cost to you, to the provision of
certain assistance. Please contact, Clerk
of Circuit Court, 207 N.E. First Street,
Room 106, Jasper, Florida 32052 (386)
792-1288, within 2 working days of your
receipt of this document; if you are hear-
ing or voice impaired, call 1-800-955-
8771.
WITNESS my hand and the seal of this
Court this 26th day of February, 2010.
(Court Seal)
Greg Godwin
As Clerk of the Court
03/11,03/18
By: /s/Cynthia Johnson
As Deputy Clerk
LEGAL NOTICE
The Suwannee River Economic Council,
Inc. Board of Directors will hold a meeting
of the Board of Directors on Monday,
March 29, 2010, 7:00 P.M. at the Suwan-
nee River Economic Council, Inc., Senior
Center in Live Oak, Florida.
3/18
IN THE CIRCUIT COURT OF THE
THIRD JUDICIAL CIRCUIT, IN AND
FOR HAMILTON COUNTY, FLORIDA
PROBATE DIVISION
CASE NO. 10-07-CP
IN RE:THE ESTATE OF:
PATRICK F. M. MARR
Deceased.
NOTICE TO CREDITORS
TO ALL PERSONS HAVING CLAIMS OR
DEMANDS AGAINST THE ABOVE ES-
TATE:
Within three months from the time of the
first publication of this notice, you are re-
quired to file with the Clerk of the Circuit
Court of Hamilton County, Florida, Pro-
bate Division, the address of which is
Hamilton County, Jasper, Florida a written
and verified statement of any claim or de-
mand you may have against the estate of
PATRICK F M. MARR.
Each claim must be in writing and must
indicate the basis for the claim, the name
and address of the creditor or his agent or
attorney, and the amount claimed. If the
claim is not yet due, the date when it will
become due shall be stated. If the claim is
contingent or unliquidated, the nature of
the uncertainty shall be stated. If the
claim is secured, the security shall be de-
scribed. The claimant shall deliver a copy
of the claim to the clerk who shall furnish
a copy to the personal representative.
ALL CLAIMS AND DEMANDS NOT SO
FILED WILL BE FOREVER BARRED.
Dated this 22nd day of February, 2010.
/s/Frank Marr
FRANK MARR
Personal Representative
/s/Ken Marr
KEN MARR
Personal Representative
/s/Donald K. Rudser
Donald K. Rudser
Fla. Bar No. 120735
P.O. Box 948
Jasper, Florida 32052
(386) 792-1933
Attorney for Personal Representative
03/11, 03/18
NOTICE UNDER FICTITIOUS
NAME LAW
PURSUANT TO SECTION 856.09,
FLORIDA STATUES
NOTICE IS HEREBY GIVEN that the un-
dersigned, desiring to engage in business
under the fictitious name of Mazie's Coin
Laundry & Car Wash located at: 1342
Oak Street, Jennings, FL in the County of
Hamilton in the City of Jennings, Florida
32053 intends to register the said name
with the Division of Corporations of the
Florida Department of State, Tallahassee,
Florida.
Name: Mazel Spencer
Address: 4764 NW CR 141
Jennings, FL 32053
Dated this 9th day of March, 2010.
03/18
NOTICE OF HEARING
The Hamilton County School Board will
conduct a public hearing on Monday, April
12, 2010. It will begin at 5:30 p.m. in the
Board Room of the school district admin-
istration building in Jasper, Florida. The
purpose of the hearing is to consider
changes to the following school board
policies:
2.05 Board Meetings
Revised
3.40 Animals on Campus
New
4.12 Instructional Materials Selection
Revised
5.30 Special Dietary Needs
New
6.78 Social Security Numbers
Revised
7.141 Selecting Professional Services
Revised
Reason for changes: various
Authority: 1001.41, 1001.42, FS.
Estimated economic impact: minimum
A complete copy of these rules are avail-
able for review at the office of the Super-
intendent of Schools; Jasper, Florida.
HAMILTON COUNTY SCHOOL BOARD
By: /s/Martha Butler
Martha Butler
Superintendent
If a person decides to appeal any decision
made by the Board, with respect to any
matter considered at this hearing, that
person will need a record of the proceed-
ings; and for such purpose that person
may need to ensure that a verbatim record
of the proceedings is made, which record
includes the testimony and evidence upon
which the appeal is to be based.
03/18
IN THE COUNTY COURT,
IN AND FOR HAMILTON
COUNTY, FLORIDA
CASE NO. 06-169-CC
JERRY R. MORGAN
Plaintiff,
Vs.
MILDRED S. BELLFLOWER,
Defendant.
NOTICE OF PUBLIC SALE
Notice is hereby given that the following
described property:
Lot 2, Block 16, according to Reneau's
Survey of the Town of White Springs,
Florida in Section 7,Township 2 South,
Range 16 East, HAMILTON County,
Florida
Shall be sold by the Clerk of this Court, at
public sale, pursuant to the Final Judg-
ment in the above styled action dated
March 10, 2010, at the Hamilton County
Courthouse in Jasper, Hamilton County,
Florida, at 11:00 A. M., on Thursday, April
15, 2010, to the best and highest bidder
for cash. Any person claiming an interest
in any surplus from the sale, other than
the property owner as of the date of the
notice of lis pendens, must file a claim
within 60 days after the sale.
WITNESS my hand and official seal in the
State and County aforesaid this 10th day
of March, 2010.
(Court Seal)
GREG GODWIN
Clerk of Court
03/18, 03/25
By /s/Cynthia Johnson
As Deputy Clerk
Arrest
Reports
Editor's note: The
Jasper News prints the en-
tire arrest record each
week. If your name ap-
pears here and you are lat-
er found not guilty or the
charges are dropped, we
will be happy to make note
of this in the newspaper
when judicial proof is pre-
sented to us by you or the
authorities.
The following abbre-
viations are used below:
DAC - Department of
Agriculture Commis-
sion
DOA - Department of
Agriculture
DOT - Department of
Transportation
FDLE - Florida De-
partment of Law En-
forcement
FHP - Florida High-
way Patrol
FWC - Florida Fish
and Wildlife Conserva-
tion Commission
HCDTF - Hamilton
County Drug Task Force
HCSO - Hamilton
County Sheriff's Office
ICE - Immigration and
Custom Enforcement
JAPD - Jasper Police
Department
JNPD - Jennings Po-
lice Department
OALE - Office of Agri-
cultural Law Enforce-
ment
P&P - Probation and
Parole
SCSO - Suwannee
County Sheriff's Office
WSPD - White Springs
Police Department
Mar. 8, Octavio Her-
nandez, 34; 1177 Mary
Street, Jennings; disor-
derly intoxication; JNPD
Mar. 9, Reather Mae
Bright, 38; 319 SW
Christmas Tree Drive,
Madison; violation of
probation; HCSO
Mar. 9, Bushons Del-
wyn Bell, 3261 E. Golf
Drive, Miami; child sup-
port; HCSO
Mar. 9, Michael
Thompkins, 47; transit;
hold for Orange County;
OCSO
Mar. 9, Maurice Lam-
ont Williams, 29; 3305
Avenue I, Ft. Pierce, FL;
hold for TCA; TCA
Mar. 9, Elliott C.
Kanubb, in transit, hold
for TCA; TCA
Mar. 9, Joshua Nieves,
in transit; hold for TCA;
TCA
Mar. 10, Bart Wesley,
42; 11143 NE 39th Drive,
Jasper; violation of pro-
bation; P&P
Mar. 10, Adam Cody
Atwood, 20; 3600 NW
104th Avenue, Jasper;
violation of probation;
P&P
Mar. 11, Willie Paul
Daniels, 35; 1077 Geor-
gia Street, Jennings; vio-
lation of probation, rob-
bery, aggravated battery
with a deadly weapon;
P&P
Mar. 12, Flor Nunez
Louise, 26; 2441 SW Bir-
ley Avenue, Lake City;
serving 4th weekend of
120 days; HCSO
Mar. 12, Jeremy Ryan
Crowley, 22; 131 SW Oa-
sis Glen Lot #10, Lake
City; battery (domestic
violence); HCSO
Mar. 12, Jennifer
Edgerley, 29; 315 Old
Airport Road, Aiken,
S.C.; violation of proba-
tion; JAPD
Mar. 12, Ray Maxie
Register, Jr., 51; 314 SW
5th Avenue, Jasper; dri-
ving under the influ-
ence; JAPD
Mar. 13, Nathan
William Carver, 35; 613
W 27th Street, Braden-
ton, FL; in to serve sen-
tence-15 days-felony
DUI; HCSO
Mar. 14, Charles
Jerome Speights, 25; PO
Box 922, Jasper; driving
while license suspend-
ed; JAPD
Mar. 14, Carolyn Lee,
46; PO Box 1717, Jasper;
driving under the influ-
ence with property dam-
age; FHP
Mar. 14, Lucas
Jimenez-Gomez, 20;
1261 Georgia Street, Jen-
nings; having no valid
drivers' license-death or
serious bodily injury;
FHP
Driver license and vehicle inspection checkpoints
The Hamilton County
Sheriff's Office will be
conducting driver li-
cense and vehicle in-
spection checkpoints
during the weeks of
April 1, 2010 until June
30, 2010, in Hamilton
County.
Recognizing the dan-
ger presented to the
public by defective vehi-
cle equipment, deputies
will concentrate their ef-
forts on vehicles being
operated with defects
Yl il ,`1
such as bad brakes,
worn tires, and defec-
tive lighting equipment.
In addition, attention
will be directed to dri-
vers who would violate
the driver license laws
of Florida.
The Sheriff's Office
has found these check-
points to be an effective
means of enforcing the
equipment and driver li-
cense laws of Florida
while ensuring the pro-
tection of all motorists.
The checkpoints will
be: US-41, CR-145, NW
16th Avenue, CR-751,
CR-25A, SR-6W, SR-6E,
CR-141, CR-143, CR-51,
CR-249 and SR-129.
Hamilton County
represented
Continued From Page 4A
with elected officials.
The event will be held at
the Leon County Civic
Center. Tickets can be
obtained from each local
county Farm Bureau of-
fice.
Farm Bureau is the
state's largest and most
influential organization
that represents all as-
pects of farming all
across Florida. Member-
ship in Hamilton Coun-
ty is almost 1,000 mem-
bers.
Enj: :
* rts &Trafts
* music & aly Flo
' w!i --
PAGE 8A
Jasper
Town Meeting
The Hamilton County Alcohol and Other Drug Prevention Coalition
is sponsoring a dynamic Town Meeting for your Community.
The meeting will include a panel discussion concerning the
alcohol and drug issues of Hamilton County.
The GRADE that BRINGS the
MOST PARENTS will receive a
PIZZA PARTY!!!
DOOR PRIZES!!!
Grand Prize - Wii Game System
Meeting will be held Tuesday,
March 23rd, 2010 at 6:30 p.m.
at the Hamilton Co. Annex Auditorium
Guest Speakers:
Marvin Page, HCSO
Illegal Drug Prevention/Enforcement
Special Agent Rick Damon, A.B.T.
Retail Compliance Checks/Enforcement
Deputy Jeramie Cheshire, HCSO
Community Policing Program/Enforcement
Mona Paine, RN, Hamilton County Health Department
Health Issues/Prevention/Treatment
Elizabeth Mitchell, Social Worker, Hamilton Co. High Education
Prevention in Schools
Pastor Jerry Thomason, Hamilton Co., Ministerial Alliance
Prevention/Education in the Faith Community
Honorable Sonny Scaff, Hamilton County Judge
Judicial Processes/Substance Abuse
If you are concerned about the alcohol and drug issues in
your community, now is the time to come, share your concerns, and
become better informed.
Opportunities to make positive changes will
be made available.
Presented by the Hamilton County Alcohol
and Other Drug Prevention Coalition
"Parents and Caring Community"
Refreshments served immediately following meeting. 583546F
I
THRSA. ARH18 01 TEJAPR EW.Japr.FLPGE9
COUNTY COMMISSION
High-tech firm, truck stop, radio
station considering Hamilton
Continued From Page 1A
contracts ranging from construction to
communications.
"My primary reason for
recommending this grant is the large
number of high-tech, high-paying jobs
it will facilitate," said Scott in a
written proposal to the board.
Smith recommended a grant of
$525,000 for Scout Industries.
"You don't typically see high-tech
business looking to come to this area,"
he told the board.
Smith also presented a grant request
of $500,000 from Love's Travel Stops
and Country Stores, Inc. Love's is a
truck-stop chain which would bring a
McDonald's and a Chester's Fried
Chicken as well as more than 50 jobs,
said Smith.
The final request was from
Smalltown Broadcasting, LLC, a
radio-media company owned and
operated by Scott James. James owns
three FM stations in Georgia and has
already received the license for an FM
talk-radio station in Hamilton County.
Smith asked the board to award a
grant of $125,000 to be paid out over
two years.
"Awarding this grant is an attempt
to create a sense of viability," said
Smith. "I cannot overemphasize the
importance of this concept of viability
and its psychological impact on both
employers and employees considering
relocating to our area.
After his presentation,
commissioners congratulated Smith
for "hitting the ground running" after
only eight weeks as Executive Director
of Economic Development. Some
expressed concern over the amount of
grant money requested, however.
"When the money runs out, where
do we go from there?" asked
Commissioner Buster Oxendine.
"The money is there to create jobs,"
said Smith. "We need them more than
ever."
"At worst this is a sincere effort, at
best an educated effort," he assured
the board.
After much discussion
Commissioner Mike Adams said, "I'm
not afraid to spend that money, that's
why they give it to us."
Still, the board decided to withhold
a final decision for now and agreed to
further discuss the requests at the next
board meeting in April.
Submitted
The U.S. Bureau of Labor
Statistics reported Friday the
unemployment rate for military
veterans who served in the
military since September 2001
(Gulf War-era II Veterans) was
10.2 percent in 2009. The jobless
rate for all Veterans of all eras
combined was 8.1 percent.
While not as high as the overall
unemployment rate, the Veteran
population faces its own
challenges. Nearly 21 percent of
Gulf War-era II Veterans
reported having a service-
connected disability in August
2009, compared with close to 13
percent of all Veterans.
Veterans in North Florida are
suffering from many of the
affects of the current economic
conditions that afflict the rest of
the nation. However, even in
this recessionary situation there
is opportunity to grow and
flourish.
Organizations are here to
assist Veterans in many
different facets of life, including
employment. An example is the
Local Veterans' Employment
Representative (LVER) and the
Disabled Veterans' Outreach
Program (DVOP) specialist, who
act as a focal point by assisting
Veterans in the region seeking
employment services and are
housed at Workforce. They help
connect employers and qualified
Veterans looking for work.
Additionally, they refer
qualifying Veterans to agencies
from the County Veteran
Service Officer to the US
Department of Veteran Affairs
Mudslingers
A new place to play in Hamilton
Continued From Page 1A
work."
Time to get dirty.
Located just off 1-75
on North US 129 a few
miles outside of Jasper,
Mud Fest is a place
where 16-year-olds run
their shiny new
birthday presents
through the pit, men
cake their classics with
inches of muck and
others take their ATVs
for a swim. The bog
will host its next
weekend of dirty deep-
South, down-home
entertainment April 2-
4. Admission is $10 a
day or $15 for the
weekend and kids
under 10 get in free.
Primitive camping and
restroom facilities are
also available. Trucks
are only allowed to
bog during the day.
However, ATVs can
ride day and night.
Denise's brother Jerry
Keith said he came up
with the idea after it
became difficult to find
good places to bog
legally in his native
Pasco County. Jerry
and his family have
always been
"mudslingers" and
were now in need of
fresh territory to slog
through.
"It's actually a pretty
popular and growing
sport," said Jerry. With
the dwindling
availability of good,
legal bogging, Jerry
said he decided to find
the ultimate new,
extreme bog spot, and
has since turned this
endeavor into a
business.
Since planting their
tires in Jasper, Jerry
and his family have
worked to spread the
word and create a local
attraction which Jerry
says could help boost
the local economy.
"This has the potential
to bring a lot of
revenue into Hamilton
County," said Jerry.
If all goes well, Jerry
said they may
eventually expand the
bog or even open
another.
"We just need the
help of the county and
the community to get
the word out," he said.
So, ready to get some
mud on your tires?
You've come to the
right place. Now let's
see if you can handle
our bog, says the Keith
family.
UPHOLSTERY I IY
Ur
NO
TRICKS
eU�
I*
Price includes fabric & labor.
More than 300 fabrics to select from!
Price also includes spring & frame repairs,
new padding added to entire piece.
New cushion foam is extra if needed.
NO Seconds * NO Close-Outs ALL First Quality Material.
"Ipersonally guarantee all work to suit you"
EARNHARDT & SONS UPHOLSTERY " ,
MADISON, FLORIDA
1-850-973-6006 OR 1-850-973-4667 NO
583733|rGIMMICKS
for services not available
through Workforce. These
employment services are
available to all qualifying
Veterans, including those who
are incarcerated and formerly
incarcerated.
On March 31, Workforce's
Veterans Services Department
will hold an Employment
Workshop for Veterans and
their dependants in Jasper at the
County Administrative
Complex (the old high school).
Here, Veterans will learn how to
plan, strategize, and energize
their job search to accentuate
their positive experiences. To
participate, call 866-367-4758 or
877-677-7573. Space is limited
for this event, so Veterans are
encouraged to call today to
ensure their seat.
APPLY NOW
TO BE THE STAR OF YOUR OWN FINANCIAL FUTURE.
HURRY! Don't miss your chance to participate in the VyStar Money Makeover.
APPLICATIONS MUST BE POSTMARKED BY MARCH 22nd!
VyStar Credit Union and CBS 47/FOX 30 are teaming up to bring you the
VyStar Money Makeover, where contestants compete over the course
of the year to improve their household budgets and their financial
bottom line. And you can be a part of it.
www.vystarcu.org
JACKSONVILLE AND SURROUNDING AREA
904-777-6000 * 1-800-445-6289
GAINESVILLE BRANCH 352-372-1645
LAKE CITY BRANCH 386-719-6767
PALATKA BRANCH 386-328-3303
PALM COAST BRANCH 386-445-7079
�VySta
Credit Union
We never forget that its your money.
ACTION NEW
Download your application TODAY
at www.vystarcu.org or ask a VyStar
representative for an application today.
THE VyStar
money.--
MakeLiver
VYSTAR MEMBERSHIP IS OPEN TO ALL PEOPLE IN THE FOLLOWING COUNTIES:
ALachua * Baker * Bradford * Clay * Columbia * Duval * Flagler * Gilchrist * Hamilton * Levy * Putnam * Marion * Nassau * St. Johns * Suwannee * Union * Volusia
FEMgA LY NO PURCHASE NECESSARY TO ENTER OR WIN. Applicants must be legal residents of the State of Florida. Primary applicants must be 18 or older. VyStar Credit Union employees
INSURED
SISh BYNCuA and their family members are not eligible for the VyStar Money Makeover '10 Contest. Limit one prize per family, household or address. Details are available at www.vystarcu.org
� 2010 VyStar Credit Union
584138-F
JASPER MARCH 31
Workshop to aid local veterans seeking work
MarchSpecial
Sofa & Chair
X Upholstered in
any
Fabric we stock!
$489oo
THURSDAY, MARCH 18, 2010
THE JASPER NEWS, Jasper. FL
PAGE 9A
IO'OA
NHE's PTO presents the 20th Annual Beauty Pageant March 20
Submitted
North Hamilton Ele-
mentary School's PTO
will present the 20th
Annual Beauty Pageant,
"Disco Dancing
Queens", on March 20,
2010 at 6 p.m. ($3.00).
If you want to catch
boogie fever, come get
down with us! Pictured
here are the contestants
in this year's pageant.
Little Miss Contestants:
first row- Elizabeth Smith,
Taylor Smith, Brayden
White, Mal'lesha Jones,
Jenna Tolle, Brooke Howell,
Maeghan White and Logan . .
McCulley (not in photo). Jr.
Miss Contestants: second "/i
row- Alyssa Culbreth, A
Mackenzie Prueter, Laura
Valdez. Miss Contestants:
back row- Madison Cox,
Chasity Arnold, Callie
Adams, Sabrina McClain,
Mary Prueter and Cassidy
Byrd (not in photo).
- Photo submitted
Congratulations to Alex Bowles!
Ivartna Butler ana Alex Bowies
Submitted
On February 10, Hamilton County
School Superintendent, Mrs. Martha
Butler, presented Alex Bowles with his
high school diploma. Alex was a 2001
Hamilton County graduate who re-
ceived a Certificate of Completion due
to missing a passing score on one of
the graduation tests. His graduating
class was the first class that could use
FCAT or HSCT scores for graduation
purposes. The FCAT was adminis-
tered to grade 10 students and if the
score in reading was 327 and the math
score was 315, the students did not
have to take the HSCT. These exemp-
tion scores were higher than the cur-
rent 300 scale score required to pass
FCAT reading and math. Alex was
successful in HSCT mathematics but
did not meet the criteria on HSCT
reading.
In January 2009, the Florida Depart-
ment of Education eliminated a rule
Jasper Town Meeting
Submitted
The Hamilton County Alcohol and
Other Drug Prevention Coalition is
sponsoring a dynamic Town Meeting
for your Community. The meeting will
include a panel discussion concerning
the alcohol and drug issues of Hamil-
ton County. A pizza party and door
prizes, including the grand prize of a
Wii game system, will be given away
during the event. Refreshments will be
served following the meeting.
The meeting will be held on Tues-
day, March 23rd in the Hamilton
County Annex Auditorium at 6:30
p.m. If you are concerned about the al-
cohol and drug issues in your commu-
nity come, share your concerns and be-
come better informed. Opportunities
to make positive changes will be made
available.
that required high school graduates to
pass both sections of the HSCT prior to
being awarded a standard high school
diploma. Under the new rule, students
could qualify for a diploma by earning
passing concordant scores on the re-
spective sections of the FCAT. Accord-
ing to state statute, eligible students
with a passing score equal to or greater
than 268 on the Grade 10 FCAT Read-
ing, or a 278 in FCAT math could use
those passing scores in place of failed
HSCT scores.
"Adults who have taken the HSCT
previously but who have not yet
earned passing scores in both sections
of the test must meet the remaining
testing requirements to qualify for a
high school diploma earning scores on
the respective sections of the FCAT,"
reads the relevant statute. Under the
second part of that rule, "when the stu-
dent earns a passing score on a section
of the FCAT, it shall be recorded in the
student's cumulative record. If this
student has previously been awarded
a Certificate of Completion in lieu of a
standard high school diploma by
virtue of failure to pass the HSCT,
such student shall be awarded a stan-
dard high school diploma."_
Alex never gave up his goal of
achieving a standard high school
diploma. Alex was attending Suwan-
nee-Hamilton Vocational Technical
school and was encouraged to take the
FCAT retake in October 2009. When
the results were returned, Alex had
achieved a passing score in reading.
The counselor advised him to contact
the Hamilton County school district
with results of the tests. With official
documentation of the passing scores,
Alex's high school diploma was or-
dered and presented to him on Febru-
ary 10.
A formal presentation from the
Hamilton County School Board was
made during the regularly scheduled
board meeting on March 8, 2010.
Alex's family and friends were present
to share in this momentous occasion.
If there are any adults who face a sit-
uation similar to Alex's and are inter-
ested in taking the FCAT, please con-
tact Karen Mitchell at 792-6522. There
will be an administration of the FCAT
reading and math at Hamilton County
High School on March 16 and 17.
The Hamilton County school district
would like to commend Alex for his
perseverance in achieving this goal.
30th Hamilton County Track &
Field Invitational sponsored
by First Federal Savings Bank
Submitted by Coach Ron Hall
On March 20th Hamilton County
High School will host the 30th Hamil-
ton County Track & Field Invitational.
Over 20 schools from North Florida
and South Georgia have been invited
to participate.
Prior to the running finals, a ceremo-
ny will be conducted to honor the for-
mer student athletes who were part of
the Boys State Championship Teams of
1978 & 1979, Girls State Championship
Team of 1979, Boys State Runner-up
team of 1976 and the Girls State Run-
ner-up teams of 1977 & 1978.
Also being recognized will be those
who were State Champions in an indi-
vidual event or part of a relay team.
Hamilton County High School has a
rich tradition of excellence in track &
field and anyone who has ever run
track at Hamilton County High School
is more than welcome to be part of
this special ceremony.
Field events will start at 9:30, cere-
mony at 11:30 and running finals at
12:00. Admission is $2.00. Come out
and support HCHS Track & Field.
UF researchers find cancer-fighting properties in papaya tea
Submitted
GAINESVILLE, FL. - The humble
papaya is gaining credibility in West-
ern medicine for anticancer powers
that folk cultures have recognized for
generations.
University of Florida researcher
Nam Dang, M.D., Ph.D., and col-
leagues in Japan have documented
papaya's dramatic anticancer effect
against a broad range of lab-grown tu-
mors, including cancers of the cervix,
breast, liver, lung and pancreas. The
researchers used an extract made from
dried papaya leaves, and the anti-
cancer effects were stronger when
cells received larger doses of the tea.
In a paper published in the Feb. 17
issue of the Journal of Ethnopharma-
cology, Dang and his colleagues also
documented for the first time that pa-
paya leaf extract boosts the produc-
tion of key signaling molecules called
Thl-type cytokines. This regulation of
the immune system, in addition to pa-
paya's direct anti-tumor effect on vari-
ous cancers, suggests possible thera-
peutic strategies that use the immune
system to fight cancers.
The papaya extract did not have any
toxic effects on normal cells, avoiding
a common and devastating conse-
quence of many cancer therapy regi-
mens. The success of the papaya ex-
tract in acting on cancer without toxic-
ity is consistent with reports from in-
digenous populations in Australia and
his native Vietnam, said Dang, a pro-
fessor of medicine and medical direc-
tor of the UF Shands Cancer Center
Clinical Trials Office.
"Based on what I have seen and
heard in a clinical setting, nobody
who takes this extract experiences
demonstrable toxicity; it seems like
you could take it for a long time - as
long as it is effective," he said.
Researchers exposed 10 different
types of cancer cell cultures to four
strengths of papaya leaf extract and
measured the effect after 24 hours. Pa-
paya slowed the growth of tumors in
all the cultures.
To identify the mechanism by
which papaya checked the growth of
the cultures, the team focused on a
cell line for T lymphoma. Their results
suggested that at least one of the
mechanisms employed by the papaya
extract is inducing cell death.
In a similar analysis, the team also
looked at the effect of papaya extract
on the production of anti-tumor mole-
cules known as cytokines. Papaya was
shown to promote the production of
Thl-type cytokines, important in the
regulation of the immune system. For
that reason, the study findings raise
the possibility of future use of papaya
extract components in immune-relat-
ed conditions such as inflammation,
autoimmune disease and some can-
cers.
Bharat B. Aggarwal, Ph.D., a re-
searcher at the University of Texas
M.D. Anderson Cancer Center in
Houston, already is so convinced of
papaya's restorative powers that he
has a serving of the fruit every day.
"We have always known that pa-
paya has a lot of interesting things in
there," said Aggarwal, a professor in
the center's department of experimen-
tal therapeutics who was not involved
in the UF research. Foremost among
papaya's health-promoting agents is
papain, papaya's signature enzyme,
which is found in both the fruit and
the leaves.
"This paper has not gone too much
into identifying the components re-
sponsible for the activity, which is just
fine. I think that is a good beginning,"
Aggarwal said.
Aggarwal also noted that papaya
extract's success in reducing cancer in
laboratory cell cultures must next be
replicated in animal and human stud-
ies.
"I hope Dr. Dang takes it further,
because I think we need enthusiastic
people like him to move it forward,"
Aggarwal said.
Dang and a colleague have applied
to patent the process to distill the pa-
paya extract through the University of
Tokyo; the next step in the research is
to identify the specific compounds in
the papaya extract active against the
cancer cell lines. For this stage, Dang
has partnered with Hendrick Luesch,
Ph.D., a fellow UF Shands Cancer
Center member and a professor of
medicinal chemistry. Luesch is an ex-
pert in the identification and synthesis
of natural products for medicinal pur-
poses, and recently discovered a coral
reef compound that inhibits cancer
cell growth in cell lines.
PAGE 10A
THE JASPER NEWS, Jasper. FL
THURSDAY, MARCH 18, 2010
THRSA. ARH18 01 TEJAPR EW.Japr.FLPGEh
Gadsden biofuel
plant put on hold
Project similar to the one
planned for Hamilton
By Stephenie Livingston
stephenie.livingston@gaflnews.com
Adage said Monday it would suspend work on
the proposed biofuel project in Gadsden County, a
plant similar to the one in the works for Hamilton
County.
A biofuel joint venture owned by affiliates of
Duke Energy and AREVA, ADAGE had proposed to
construct a 55 megawatt advanced biofuel facility in
Gretna, utilizing sustainable clean woody biomass.
The company said in a press release that it
respects the decision of the city of Gretna to
continue to study the project.
"We recognize that work still needs to be done in
the local community to fully implement the master
plan for economic development," the release said.
"However, Adage firmly believes that further study
will reinforce that the project would represent a safe,
sustainable renewable energy solution that meets all
local, State and National standards while delivering
new jobs and economic opportunity."
As was the case in Hamilton County, Adage was
attracted to the vibrant forest resources in Gadsden
County, according to the press release.
"We believe that Gadsden County represents a
good market for development of sustainable woody
biomass projects," the release said, "however in
light of the decision today by the City of Gretna to
delay consideration of the project, Adage will
suspend work on the Gadsden County project and
focus on continuing to develop a fleet of clean, safe,
reliable biopower projects throughout the U.S." said
a statement by Adage.
The Florida Department of Environmental
Protection will now be asked to suspend activity on
the Air Resource Permit Application for the
Gadsden County project. Adage said it would
continue to actively develop the project in Hamilton
County, which has already received full approval at
the state and local level.
Tenth annual Wild
Azalea Festival
set for Saturday
To the Editor:
Recently the City of Jasper held elections for two
seats on the city council. There were a total of 27
votes cast in one district and none in the other. For
the second term in a row no one ran against Ms.
Kathy Avriett in district 5. While Ms. Avriett is a
fine person and does her best on the council I find
it appalling that she has been unopposed since
being appointed to the seat over two terms ago.
Since I have heard criticism of her by people living
in her district I do not believe that she is
universally loved by all. Yet no one, it seems, has
either the will or the nerve to run against her.
In district 1 Mr. LaBarfield Bryant won the
election in a 14 to 13 vote. I guess there are only 27
people in his district that care who represent them.
Then immediately after being sworn in Mr. Bryant
was elected chairman of the city council. He made
the comment later that he wished he had been
given the opportunity to learn the job before being
elected chair. Am I naive to expect that someone
running for public office, especially city council,
would have some idea of what the job was and the
issues before the council? I have attended many of
the meetings over the last 6 years and do not
remember ever seeing any of the current council
members in the audience prior to their being
elected. Yet they all felt qualified to run for the
office. Of the five council members only one,
Elaine Rozier, has any prior government
experience. She has done, in my opinion, a good
job representing her district and trying to solve the
problems of the city. She has also been a champion
of the people's right to speak at the meetings in the
face of at least two members trying to stifle all
public input. While I sympathize with Mr. Bryant's
position, had he bothered to attend even a couple
of meetings before he was elected he would have
had an idea what was going on and possibly been
able to conduct the meeting with some order and
dignity.
One of the items brought up at the meeting was
people leaving their city mandated garbage cans
out too long. It seems that there are those in Jasper
who would like it to be like The Villages or Palm
Beach where every facet of life is regulated by
ordinance. The voice of reason, in the form of City
Manager Larry Cail, brought to light that the cans
were too large and cumbersome for many of the
senior citizens to bring in easily. Add to that the
fact that many of us work and cannot bring them
in until we get home and you can see how foolish
such an ordinance would be. Yet it was discussed,
even as the bigger problems of an aging
infrastructure and road repairs were ignored.
Aside from an apparent lack of knowledge of the
purpose of government under our Constitution
and inexperience in governmental affairs from
most of our council the biggest concern I have is
the lack of attendance by the public. Rarely have I
seen more then ten or fifteen people attend a
council meeting and at some meetings as few as
three or four have attended. When there is a highly
charged issue, such as the proposed sale of the
downtown park was, there is a turnout. But once
that issue is solved everyone goes home until the
next big issue. In the meantime the council passes
ordinances and taxes that affect every resident of
the town.
One cannot help but feel that the people of
Jasper, by their lack of concern and attendance, are
pleased with the workings of the council. This
either speaks well of the council or poorly of the
residents. Does anyone know which?
Robert I. Clark
Jasper
Continued From Page 2A
Visitors can listen to the
sounds of music as they
stroll through historic
downtown White
Springs. Kitty Tolson
Carroll will provide an
entertaining and
educational birds of prey
demonstration featuring
the ancient art of
falconry using free-
flying falcons, owls and
hawks.
The Nature and Heritage
Tourism Center is located
on CR 136 and US 41 in
downtown White Springs.
This event is free and
begins at 9 a.m. Admission
to the Stephen Foster Folk
Culture Center State Park
is $5 per vehicle with up to
eight passengers. For more
information please call Bob
Giarda at 386-397-4478 or
visit
www.floridastateparks.orgl
stephenfoster.
1uCI 1F
Attention
Area Churches
The Jasper News will publish
a full page, full color
in the March 25, edition.
Please call 386-792-2487
to place your Easter Services
information in the Directory.
Cost is only $15
for a 2 column x 3" space.
Room enough for additional
church info if you would
like to add that as well!
SDeadline is 5 p.m. on
Monday, March 22.
r "I
1I1
583461F
WIND-FM l
fqzs ss "iui0
~at1
SncGainevmiUe
UIM Outwannret~F democrat Lake City Reporter Blhilotaitaimes-Liott
Artists subject to change without notice. Show goes on rain or shine.
Taxes and processing are included in the ticket prices. Camping available. 582774 F
FROM OUR READERS
I-
[11
THURSDAY, MARCH 18, 2010
THE JASPER NEWS, Jasper. FL
PAGE 11A
OMNIAiw&wg
Our RoomiR k Drp
^T/ltfM
TAI 0W
PAGE12ATHE ASPR NWS. aspr. L THRSDY. ARCH18.201
EVERY WEEK @ LAKE CITY COMFORT SUITES ,.
3690 Hwy. 90 West - Just Off 1-75 Exit 427 0^4
Thursday 12noon - 7pm 4 Friday 9am - 7pm * Saturday 9am - 3pm_, -'..
& SILVER ARE
2i HISTORIC HIGHS! "B
PAYING UP TO THE MINUTE PRECIOUS METAL PRICES
ALWAYS A NO COST, NO OBLIGATION APPRAISAL
Coins & Currency
Watches
& Timepieces
Jewelry
Diamonds
WE BUY & ACCEPT CONSIGNMENTS OF SINGLE ITEMS,TO COLLECTIONS AND ESTATES
If You Decide To Sell, We Guarantee A Fair Reliable Transaction
If You Decide To Consign To Auction, We Offer Some Of The Best
Terms In The Industry
www.ManorAuctions.com
Modern & Antique Military Ites " Silver Historic Documents &
Firearms ; r:., A ..
We Have S5,000 Availhb BYo
General Antiques: Timepieces: Coins & Bullion: Jew
- Ivory & Jade - Pocketwatches - Gold Coins
- Pottery & Glassware - Wristwatches - Silver Coins
- Fine Art - Mantle Clocks - Certified Coins
- Statuary & Figurines - Wall Clocks - Circulated / Unc
- Sterling Silver Names Such As: - Silver Clad Coins
Names Such As: - Rolex - Gold Bars
- Lladro - Waltham - Silver Bars / Rounds
- Lalique - Cartier - Proof Coins
- Steuben - Patek Philippe - Key / Better Dates
- Daum - Longines - Silver Dollars
- Roseville - Jaeger LeCoultre - Art Bars
In The Last 12 Months We sincerely thank the hundreds of
W E PAID! Lake City area residents whose trust
OVER $580,000 and loyalty make our business
TO LAKE CITY a joy and privilege every week.
AREA RESIDENTS Paul, Bill, Joe & Malcolm
elry & Diamonds:
- Gold Jewelry
- Silver Jewelry
- Broken Jewelry
- All Diamonds
Military Items:
- Helmets
- Medals & Awards
- Edged Weapons
- Uniforms
- Ephemera
LIVE
LAKE CITY
APPRAISER
850-567-4653
THI EVNT S COPEATIELYBROGHTTO OU ACHWEE BY
CITH OVER 70 YEARS OF COMBINED EXPERIENCE
FlriaU e m i&*C f o a
Stt Lcns B25, nurdAawEfocmetCopiat5855
PAGE 12A
THE JASPER NEWS, Jasper. FL
THURSDAY, MARCH 18, 2010
Spirt of the Suwannee Music Park: Miss Marie's Kids, Mercy Mountain Boys to take the stage, Page 2
News * Entertainment * Classifieds
North Florida Focus
Mac 1 8,2 1 w . fI nIi e c r erig aitoLaaetead uane oute
-FOR RENT-
The NFCC Quilt Show is an annual event at the
Wardlaw-Smith-Goza Conference Center.
- Courtesy photo
Calling all
quilters
NFCC seeks entries for annual show
MADISON - Attention, quilters and quilt owners. North Florida
Community College is seeking entries for its annual quilt show.
Quilts will be displayed at the Wardlaw-Smith-Goza Conference
Center in Madison, Florida in conjunction with Madison County's
"Down Home Days" celebration April 17. The exhibit will be
open to the public with free admission Saturday, April 17 from 10
a.m.-3 p.m.; Sunday, April 18 from 1-5 p.m.; and Monday, April
19 from 10 a.m.-3 p.m.
Show organizers are calling on area quilt owners to display
handmade quilts whether new or old, a treasured heirloom or a re-
cent gift. Quilts will be displayed on the first and second floors of
the historic WSG Conference Center, known locally as The Man-
sion.
The Madison County Garden Club will also host a National
Garden Club level flower show entitled "Around the World with
Quilts and Flowers" at The Mansion to compliment the quilt show
April 17-19.
Don't miss this opportunity to show off your quilted treasures.
Applications to enter a quilt or multiple quilts in NFCC's ANNU-
AL QUILT SHOW are available by (.,11...0* Maria Greene, WSG
Conference Center Coordinator, at (850) 973-9432 or email
GreeneM@nfcc. edu.
GREAT RATES FOR NICE LOOKING
RENTALS - STARTING AT $300 PER MONTH
FOR SINGLEWIDES AND $450 PER MONTH
FOR DOUBLEWIDES. WATER, SEWER,
AND GARBAGE INCLUDED. NO PETS.
386-330-2567 569597-F
LOCATED ON HWY 53- 5 acres. Approx two miles from the Suwannee
River and public boat ramp. This property is cleared and fenced with a
pond that was started but not finished. Asking $35,000. Call Anita Handy,
386-208-5877 MLS#73024
$85,000- 3/2, 1344 sq.ft. concrete block home located near the Advent
Christian Village with screened back porch. Call Ronnie Poole, 386-208-
3175 for more information MLS#73216
NOW IS THE TIME TO BUY...This 2br, 2 bath home just minutes from
town. Owners have not finished the master bedroom addition, so you can
design it around your needs. Home is landscaped, workshop, & 2 car
carport on 1.5 acres. $119,000. Call Kellie Shirah, 386-208-3847
MLS#73604
PRICE REDUCED! RIVERFRONT lot on the Suwannee River Approx
5 miles from I-10 close to the Spirit of Suwannee Music Park. Now
$39,000. Call Sylvia Newell, 590-2498 MLS#58514
VERY PRETTY 5 acres nestled amongst large & small oaks with private
pond. Property has well, septic, & power pole. Just needs a little clean-up
from the previous mobile home. Asking $35,000. Call Ric Donovan, 590-
1298 MLS#73690
COUNTRY LIVING at it's best close to Live Oak. This 3/2 home is
constructed well. The floor plan is very open with 22ft ceilings, kitchen,
dining room, great room. A plus is the 14x24 workshop, 12x14 storage, and
16x22 shelter. A must see! $259,000. Call Sherrel McCall, 386-688-7563
MLS#73721
TURN-KEY HORSE FARM: Make an offer before prices go up again.
30 Acres or more with creek, barn, improved pasture with separate
paddocks, 4BR/2BA Brick home with solar powered entrance gate!
$350,000. Call Cathy Collins 386-208-4150 MLS#72659
FIELDS OF McAlpin..10 ac. (Lot 21, Phase 5), 176th St., flag lot, great
country location MF homes allowed, $34,900. Call Glenda McCall, 386-
208-544 MLS#69827
GOOD INVESTMENT PROPERTY, hard wood floors could be
beautiful with some attention, close to schools, great neighborhood. Lot
has several mature grape vines and a pecan tree. Bring all offers. $45,000.
Call David Mincey, 590-0157 MLS#70709
$69,000...will buy this 4/2 home on .77 acres. Spacious kitchen, living &
dining room have hardwood flooring, family room & 2 baths. Has attached
carport, laundry room & storage area. Call Kellie Shirah, 386-208-3847
MLS#74046
5 ACRES of planted pines at a great price with lots of privacy for you.
Only $19,500. Call Sylvia Newell, 590-2498 MLS#73635
PERFECT LOCATION TO GET AWAY FROM
EVERYTHING...Holly Point, 100 ft. on Withlacoochee River, owner will
finance after $20,000. down, 15 yrs, 6% int., 5 yr. balloon, $47,000. Call
Glenda McCall, 386-208-5244 MLS#68322
160 ACRES- 1/2 mile of paved road frontage, 10" irrigation well. Priced at
$2,750 per acre. Call Ronnie Poole, 386-208-3175. MLS#71567
A handmade birdhouse, complete with steeple. - courtesy photo
THE STAR OF - 39lf
THE SPRING
FLOWER ,
SHOW IS
AZALEAS!
Spring in all its glory wouldn't -L
be complete with out azaleas!
They're the perfect low
maintenance blooming shrub for
shady areas. Plant some today and
you'll be rewarded with masses
of spring flowers year after year! i
#1 pot azaleas only M
$4.99
From cooking, to aroma therapy, to insect
DISCOVER THE control herbs have lots of great uses! They can
JOY OF HERBS! be planted almost anywhere and are beautiful
J FI* Fgrowing right along side your flowering plants!
9248 129th Road * Live Oak HWY 90
(386) 362-2333
Mon.-Fri. 8:30 a.m.-6:00 p.m. 11TH STREET
Saturday 8:30 a.m.-5:00 p.m.
Sunday 12:30 p.m.-4:30 p.m. ,ESI
"For over 30 Years" N |
WWW.NOBLESGREENHOUSE.COM
570600-F F
Ready to
spruce up
your yard
for Spring?
Calico Arts and
Crafts Show
coming to Moultrie
this weekend
The 2010 Calico Spring
Arts and Crafts Show is set
for Saturday and Sunday.
Hours are Saturday 9 a.m.
to 5 p.m. and 10 a.m. to
4 p.m. on Sunday. Adult
admission is $5. There is
free parking for all and
free admission for children
12 and under. For more
information, visit
www.calicocrafts.com.
If you've caught Spring
fever, it's likely you're
looking for just the thing to
spruce up your garden,
your home or yourself. You
can find it all at the Calico
Arts and Crafts Show in
Moultrie, Ga. Make your
backyard a main attraction
with an unforgettable,
handmade birdhouse or
birdfeeder salvaged from
old barn wood and pine
furniture by Charles Bush,
Damascus, Ga. You can
compliment it with a sea-
sonal wreath or floral
arrangement from Jeannie
and Frances Routh of
Moultrie, GA who will
have a variety of vivid col-
ored wreaths in store for
you. Bring nature indoors
with a handpainted window
by Stathia Hammond of
Southport, N.C. and see
charming scenery through
her eyes.
Ladies can add a twist to
their wardrobe with any of
SEE READY, PAGE 3
A 0
Dial's Inspection
Services
For All Your Home
Inspection Needs!
386-364-4434 or
386-590-6534
Please visit our website:
www.suwanneevalleyinspections.com
P CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
Miss Marie's Kids,
Mercy Mountain Boys
to take the stage at the Spirit
Miss Marie's Kids:
It's an exciting weekend coming up at
the Spirit of the Suwannee Music Park
with Miss Marie's Kids from Jacksonville
featuring some of the most talented kids
in North Florida Friday night and Satur-
day night the ever popular Mercy Moun-
tain Boys.
Make plans now to be there both
nights, March 19 -20, to enjoy these tal-
ented performers. It's a weekend not to be
missed.
On March 19 Miss Marie, a former
singer and recording artist who had her
own band and TV show at age 13 and
toured for more than 20 years, brings her
array of talented kids to the SOSMP
stage. Miss Marie has been polishing tal-
ented kids' performances for years. Tak-
ing the stage Friday night could possibly
be The Frosted Flakes, a threesome of
Courtney Loftus, Hayley Moran and Jes-
sica Warner who will thrill you with their
talent. Other Miss Marie's Kids who
could perform are Cortnie Frazier, Connor
Blackley, Heather Dockery and Kelcie
McClary. Don't miss these talented kids
who will entertain you with their talent
and vibrant performances.
Saturday night, March 20, the Mercy
Mountain Boys are back with their won-
derful bluegrass and gospel music. This
group has traveled all over the South per-
forming, won many awards and has be-
come one of the favorites of the SOSMP
Music Hall guests.
Doors to the Music Hall open at 5 p.m.
for dinner, shows begin at 7 p.m.
Admission Friday night is $5. However,
on Friday nights your $5 admission cost
can be deducted from your food and bev-
erage ticket. Admission Saturday night is
$10.
FLi :0 4lo
Kelcie McClary
uonnor tiacKley
When: Thursday, March 18th
thru Sunday, March 21
Time: Thursday - Saturday
9 am to 6 pm
Sunday 9 am to 4 pm
Location:
Hwy. 90 West
Office Max Parking Lot
Across from Lake City Mall
Rates as low as 5.99%
Zero Down
N Payment
No payments until
Summer
I
I
,If
e
i
I
E
(
- -
e 5n
I art
service
Contract"
O
*YAMAHA A
/O<
... W � *dI . 00 O
529 S. Ohio Ave., Live Oak, FL
Bus. 386-362-1389 Fax: (386) 362-6131
S.C. Sullivan (386) 362-1389,
Evening 362-2990
(1) Horse Farm: 55 acres with a 5
bedroom, 3 bath CH&AC home
with fireplace cont. approx. 5000
sq. feet under roof with an 18 stall
horse barn with office and bath
cont. approx. 5000 sq. ft. under
roof. The property has 4 fenced
paddocks with room for
expansion. Approx. 3 miles from I-
75. Call for more information. Just
listed $599,999.
(2) Off CR 49 5 acres in grass with
scattered trees, fenced on 3 sides
with survey. Only $4,900 per acre.
(3) 161st Rd: 9.82 acres partially
wooded with a 4BR/3-1/2 bath
CH&AC home with fireplace cont.
approx 2400 sq. ft. heated area,
10'x30' storage. REDUCED TO
$260,000.
(4) Off CR136: 5 acre partially
wooded some grass. Will work for
land home package. Reduced to
$39,900.
(5) CR 51 & Pinewood St.: 2.29
Acres, city water and sewer, zoned
office. Good location $192,500.
(6) Off CR 349: 10 acre wooded
tract with a two bedroom CH/AC
log home in excellent condition
cont. approx. 1200 sq. ft. under
roof, 30'x40' pole barn.
REDUCED TO $145,900.
(7) 410 Dexter: Corner lot with
CH/AC brick home in good
condition. Approx. 2,000 sq. ft.
under roof with 2 car garage,
kitchen furnished, large pool with
privacy fence. Good location.
Good Buy @ $135,000..
(8) Industrial Park: 1.13 acre
corner tract good exposure.
Reduced to $34,500.
(9) 40 acres with 835 ft. on paved
road in 13 year old planted pines.
Priced to sell at REDUCED TO
$179,600.
(10) Near City: 2 ac. with 3/2 home
cont. approx. 1280 sq. ft. under
roof, kitchen furnished, carport.
REDUCED TO $49,000.
(11) Luraville Area: Fly-in
Community 15 acre wooded large
trees, good county road. Priced to
sell reduced to $74,900.
(12) Suwannee River: Two acres
wooded river lot off CR 349 near
Royal Springs and Boat Ramp.
100 sq. ft. on the water. (Buildable)
good buy @ $55,000.
(13) Off Mitchell Rd.: 20 acres
wooded with survey on 199th Rd.
$89,900.
(14) Hamilton Co.: 10 acres on
CR751 and the river approx. 1300
ft. on the water and approx. 1300
ft. on paved road. Priced to sell at
REDUCED TO $72,000.
(15) Madison Co.: 40 acres in 16
year old slash planted pines off CR
255 good elevation. Good buy at
$175,000.
(16) Suwannee River home: nice
two bedroom two story CH&AC
home South of Branford, kitchen
furnished, beautiful view of river
from rear, screen porch. Good area.
REDUCED TO $168,000.
(17) Farms of 10 Mill Hollow: 4
acres in grass/cropland with
scattered trees. $32,500.
(18) Near City: Off US 90 East 5
acres wooded near golf course.
Good buy @ $44,900.
(19) 190th St.: 10 acres in planted
pines approx. 15 years old, with a
3/1 CH/AC SWMH, 2 car
carport/shop. Priced to sell @
$49,000.
(20) 208 Houston: 3/5 BR, 1-1/2 BA
frame home cont. approx. 2,000 sq.
ft. under roof. Zoned R/O, has
potential. Priced to sell @ $59,500.
(21) Keaton Beach: Deep Water
Canal lot near public boat ramp,
sewer & water. Good buy @
$125,000.
(22) 169th Rd.: 5 ac. in grass with a
3/2 CH/AC DWMH cont. approx.
1,850 sq. ft. under roof in excellent
cond. 2 car detached garage. Good
area. REDUCED TO
$119,500.
(23) Off 16th St.: 2 100x530 river
lots with MH (needs some R&R),
well, septic and storage building.
Lot has large hickory white oak
magnolia. Well above the flood
elevation. $79,900 for the pair.
(24) 193rd Rd.: 6.59 acres wooded
on paved road. Good area. Good
buy @ $37,500.
(25) Hamilton County: 40 acre
wooded on county road. Good
hunting area that adjoins
SRWMD. $149,500.
(26) New 3 bedroom, 2 bath
CH/AC home. City sewer & water,
privacy fence. Good Buy @
$95,000.
(27) Off CR 249: 3 wooded lots, will
work for mobile homes, on county
road. Good buy @ $12,600 for all
three.
F�9647-F
Cortnie Frazier
r
MARINE-SPORTING GOODS, INC. "olef .
386-752-2500
BOAT & ATV SALE
March 18, 19, 20, 21 2010
Office Max Parking Lot, West US Hwy. 90
SLake City, FL I_ _
1st
"'4*Ie
New Polaris RZR ,..uWi we
$11,500 soo MSRP
$8,995 Sale Price
he S.uppiMes .Lat RCebl
New Polaris 330 ATV
84699 Retail Price
$3195 Sale Price
PAGE 2, MARCH 17 & 18, 2010
S
II
* CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
NFCC seeks entries for its
new Flash Fiction Contest
MADISON - The North
Florida Community College
English Department announces
its new Flash Fiction Contest
and invites the community to
submit entries to the writing
contest by April 19. Stories
must be based on one of the
following titles: "Grit"; "The
Bi.i-.-.. iili or "Sunday Morn-
ing"; and should be no longer
than 600 words. Stories should
be completely original and free
of spelling and grammatical er-
rors. Text should be typed in
12-point Times New Roman
font and double-spaced. Email
submissions to NFCC English
instructor Tolu Jegede at
tjegede@go.nfcc.edu by the
April 19 deadline with "Flash
Fiction" in the e-mail's subject
heading.
Winners of the "Flash Fiction
Contest will receive: 1st place:
$40 gift certificate from Bor-
ders and story published in The
Trailblazer, NFCC's student
newspaper; 2nd place: $30 gift
certificate from Borders; 3rd
place: $20 gift certificate from
Borders. Winning entries will
also have their stories pub-
lished on the NFCC website in
The Sentinel Review, NFCC's
online literary publication.
The contest is open to the
public. For more information,
contact Tolu .1 .*.. . at
850-973-1635 or email
:/. .. . . @ ... , 1.. .. .. 1,,
O
C
0
0
m
0
m
m-
Ready to
spruce up
your yard
for Spring?
Continued From Page 1
the accessories available
from Hollywood, S.C.
crafter Caroline Sandlin.
The Carolina native makes
rustic, casual style jewelry
by combining her own
handcrafted pottery beads,
with a variety of other
items that include stone
beads, African recycled
glass beads, ethnic wood
and bone beads, shells,
and coral. She finishes
each piece with her own
bench fabricated sterling
accents and clasps.
From ornamental iron
home and garden decor, to
painted glass and antiques,
to whimsical painted chil-
dren's furniture and acces-
sories ... it's all together in
one location. Don't forget
all the wonderfully deli-
cious gourmet delights to
savor and so much more.
These items are lovingly
made by local artisans and
crafts people so you'll feel
really good supporting the
local economy while ac-
quiring unique gifts for
your friends and family.
Clogging teams from
around the South will en-
tertain the crowds on both
days.
All-star lineup of speakers planned for Origins '10 series at FSU
World-famous anthropologist Richard
Leakey will be the opening act as The
Florida State University presents "Origins
'10: Celebrating the Birth & Life of Be-
ginnings," a reprise of last year's popular
series of public outreach events sponsored
by the university's Office of Research.
Unlike Origins '09, which featured 12
events in 12 days during the month of
March at venues around Tallahassee, Ori-
gins '10 will feature five April lectures,
all held in the Richard G. Fallon Theatre,
located in the Fine Arts Building on the
Florida State campus.
Leakey's April 1 presentation is "Why
Our Origins Matter." Named by Time
magazine as one of the "100 Greatest
Minds of the 20th Century," the son of the
legendary husband-and-wife team of an-
thropologists Louis B. and Mary Leakey
is recognized as one of the world's most
powerful voices in wildlife conservation.
Other speakers visiting Florida State to
take part in Origins '10 are as follows:
* April 8: Brian Greene, one of the
world's leading theoretical physicists and
author of popular books on the origins of
matter and the universe, will discuss "The
Fabric of the Cosmos." Greene's 2000
book "The Elegant Universe" has sold
more than 1 million copies worldwide and
was adapted into a Peabody Award-win-
ning "Nova" special that Greene hosted.
* April 16: World-famous oceanograph-
er - and Florida State alumna - Sylvia
Earle will deliver a talk. In 1979, Earle set
a world record by diving with a special
suit to an astonishing depth of 1,250 feet.
Author of many books on ocean explo-
ration, she has been called a "living leg-
end" by the Library of Congress.
* April 23: Science writer and social
critic Steven Berlin Johnson will present
"The Origin of Air." Johnson is the best-
selling author of six books on the inter-
section of science, tclin i, ,l- . and person-
al experience. His writings have influ-
enced everything from the way political
campaigns use the Internet to urban plan-
ning and the battle against terrorism.
SEE ALL-STAR, PAGE 11
with s
THE VALDOSTA DAILY TIMES
Spring Community Yard Sale
Saturday, April 10; 7:00 am - 1:00 pm
Lowndes County Civic Center
Hwy 84 East Valdosta
Call today to reserve your booth space!
Limited number of spaces available.
Inside Spaces - $35.00 each
Outside Spaces (Covered) - $25 each
)6 .6.6 ;
6~( .~b~~CZ!Ir . - -
IlHusqvarna STIHL*
Tough Name.Tough Equipment.
SNMAPER-
ISNAPPER GRASSHOPPER"
s . 7TB STOP BY AND
Ss SEE PRO ARMS
#IN THEIR
Liv NEW FACILITY!
OPEN HOUSE - SATURDAY, MARCH 27, 9 a.m. - 3 p.m.
1701 N. Ohio Ave. (US 129) Live Oak 362-5020 or 800-648-2856
Reg. Hours: Mon.-Fri. 7 a.m.-5:30 p.m.; Sat. 7 a.m.-12 p.m.243
MARCH 17 & 18, 2010, PAGE 3
I t~�'86
PAGE 4, MARCH 17 & 18, 2010
U CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
ao o oA �[w iD
Pink Ladies Needed!
Are you looking for a place to share
your talents? Do you enjoy meaningful
conversation with a good friend? How
'bout a good book?
Then We Want You!! Suwannee
Health Care and Rehab Center is looking
for volunteers to start a Ladies Auxiliary.
Call Lynn Brannon, Activities Director
at 386-362-7860 or 386-590-2961.
Talent Search
Do you sing or play and instrument?
Do you act or dance? Do you like to read
or spend time with a friend in wonderful
conversation?
WE WANT YOU! Suwannee Health
Care & Rehab Center is looking for your
talent for our residents. Dinner for two -
$45; One night at the Beach - $125; One
hour volunteering to make memories that
last forever - PRICELESS!
Call: Lynn Brannon, Activities Direc-
tor 386-362-7860 or 386-590-2961.
Head Start/Early
Head Start early
enrollment
Suwannee Valley 4Cs Head Start/Early
Head Start is accepting applications for
children from birth to age 5. Head
Start/Early Head Start is a FREE compre-
hensive early childhood education pro-
gram that includes health, dental, nutrition
and VPK services to eligible
children/families.
Centers are located in Suwannee,
Hamilton, Lafayette and Columbia coun-
ties. Parents bring proof of income and
child's age to register.
For more information call 386-754-
2222.
Customers needed!
Dairy Queen of Live Oak will host
Dairy Queen Benefit Night the second
Tuesday of every month from 6-8 p.m. to
help buy books for Suwannee Middle
School.
Donations needed!
Suwannee County Environmental
Watchdogs, a non-profit organization,
seeks donations for yard sale merchan-
dise. Info: Sandy, 386-364-8020.
Register now!
Descendants of Calhoun
family plan reunion in 2009
Descendants of the late Sarah Calhoun,
Eva Calhoun and Thomas Calhoun are in-
vited to a family reunion to be held in
2009. Info:
misstheresamartin@yahoo.com or pre-
dop@aol.com.
Coffee with your
councilman
City Councilman for District 4 Mark
Stewart invites his constituents to "Cof-
fee with your Councilman" at JAVA JAX
located in the Publix shopping center.
Come and meet with him on the sec-
ond Tuesday of each month from 7 a.m.
till 8:30 a.m. This will be a time to get to
know each other and discuss current is-
sues and citizen concerns.
CJBAT tests
Monday - Thursday
Monday - Thursday at 5 p.m. (by ap-
pointment): CJBAT (Criminal Justice Ba-
sic Abilities Test) at NFCC Testing Center
(Bldg. #16), Madison. CJBAT is required
for acceptance into Corrections & Law
Enforcement programs. Photo ID re-
quired. Pre-registration & scheduling time
and date are required. To register please
call 850-973-9451.
College Placement
Tests
Monday - Thursday
Monday - Thursday at 5 p.m. (by ap-
pointment): College Placement Test
(CPT), NFCC Testing Center (Bldg. #16),
5 p.m., Madison. Register in NFCC Stu-
dent Services 24 hours before test. For in-
formation please call 850-973-9451.
TABE tests
Monday - Thursday
Monday - Thursday at 5 p.m. (by ap-
pointment): TABE (Test of Adult Basic
Education) at NFCC Testing Center
(Bldg. #16), Madison. TABE is required
for acceptance into vocational/technical
programs. Photo ID required. Pre-registra-
tion & scheduling time & date are re-
quired. To register please call 850-973-
9451.
Greater Visions
Support Group
Addiction Support Group: Greater Vi-
sions faith-based addictions support
group meets at the Grace Manor Restau-
rant. Meetings are held on Thursday
mornings at 9:30 a.m. This group pro-
vides spiritual and emotional support in
a non-judgmental setting. Come experi-
ence the freedom from addictions that is
found in Christ.
Greater Visions is an outreach of
Christ Central-Live Oak. For more infor-
mation contact 208-1345.
Suwannee County Re-
publican Executive
Committee to meet
The Suwannee County Republican
Executive Committee meets in the coun-
cil chambers of Live Oak City Hall at 7
p.m. on the first Thursday of the month.
If the first Thursday is the first day of
the month, the meeting will be held on
the following Thursday.
Each meeting has a guest speaker or
current issues will be discussed. All are
welcome to attend. For more informa-
tion call Chairman Carl Meece at 386-
776-1444.
Legislative candidate
to speak at Republican
meeting
The Suwannee County Republican Ex-
ecutive Committee meets at Live Oak
City Hall, in the Council Chambers, at 7
p.m. on the first Thursday of the month. If
the first Thursday is the first day of the
month, then the meeting will be on the
following Thursday. Each meeting has a
guest speaker or there will be current is-
sues brought up for discussion. All are
welcome to attend.
For more information, call Chairman
Carl Meece, 386-776-1444.
Branford TOPS
meeting changes
locations
We now meet every Tuesday at L & M
Scrapbooking located at 105 SW Suwan-
nee Ave. in Branford.
Weigh-in begins at 4:30 p.m. Meeting
starts at 5.
For more information please contact
Donna Hardin at 386-590-2333.
"Take Off Pounds Sensibly."
SREC seeking
location in Branford
Suwannee River Economic Council,
Inc., a non-profit organization is seeking a
location in the Branford area that could be
used to serve meals to persons 60 years of
age or older.
Any business, organization or church
that has space available and would be in-
CONTINUED ON PAGE 6
A/ LEBUT Y R HEALT
ABOUT YOUR HEALTH
Physical Therapy
Heartland'
REHABILITATION SERVICES
Sandy Laxton, PTA
Mandy McCray, PTA
Carolyn McCook, Office Manager,
Patient Care Coordinator
AQUATIC THERAPY
Workers Compensation, Industrial
Rehabilitation, Ergonomic Consultation,
Job/Workers Site Analysis Orthopedic/Sports
Medicine, Pediatrics Providers
Medicare, Medicaid, AvMed & BCBS Providers
405 11th St., Live Oak, FL 32060
(386) 364-5051 570640-F
North Florida
Pharmacy
* Medical
Equipment
* Oxygen
"Everything For Your
Home Recovery"
Locally Owned & Operated
101 SW U.S. Hwy. 27, Branford, FL 32008
(386) 935-6905
229 W. Main St., Mayo, FL 32066
(386) 294-3777 570643-F
Ophthalmology
GREGORY D. SNODGRASS, M.D.
522 South Ohio Avenue
Snr-, 330-6260 or 1-800-435-3937
IN MHUMUAKII
for your loved one
TEMPORARY or LONG TERM
COMPANIONSHIP
Private Duty Live-in * Live-out
Sleep Over * Weekends or Holidays
* Personal & Daily Needs
We're here to help you enjoy living in your own
home with complete assistance & safety as if
we were your own family
When a nursing home is NOT the right
answerfor you.
We're Here To Help!
388-963-5256
License 299418
SUNRISE
Serving seniors in Suwannee and Columbia counties
since 1996 579877-F
Get the Facts About
Glaucoma
As people age, many expect their health to begin
to deteriorate at least a little bit. While science has
made many advancements and people are now
living longer and healthier lives, there are still
some signs people recognize as signs of aging.
And these signs can begin as early as a person's
20s, growing more noticeable as time goes on.
One side effect many inappropriately associate
strictly with aging is glaucoma. Though
commonly considered a disease of the elderly,
glaucoma is not strictly limited to baby boomers
and seniors citizens. While the Glaucoma
Research Foundation notes that the elderly are at
a higher risk for glaucoma, they are also quick to
point out that 1 out of every 10,000 babies born in
the United States is born with glaucoma,
illustrating the broad expanse of this potentially
harmful disease.
With that in mind, consider the following quick
facts about glaucoma:
* Roughly half of the 4 million Americans who
Ophthalmology
Eduardo M. Bedoya, M.D.
Now at Shands in Live Oak
386-755-7595
Toll Free 866-755-0040
Se habla espafiol 570641, F
Family Dentistry
HERBERT C. [
MANTOOTH,
D.D.S, P.A.
602 Railroad Ave., Live Oak, FL
(386) 362-6556
1-800-829-6506
(Out of Suwannee County) 570639-F
COPELAND
MEDICAL
CENTER
ADVENT CHRISTIAN VILLAGE
AT DOWLING PARK
Clinic: Family Practice, Urgent Care,
Geriatric Consultations, Women's Health, School Physicals
Rehab: Physical Therapy, Speech Therapy, Occupational Therapy
Pharmacy
10820 Marvin Jones Blvd., Dowling Park, FL
386-658-5300
Hours: Mon.-Fri. 8 a.m. - 4:30 p.m.
Nasseer Masoodi, M.D.
Rich Corley, PA-C
Accepting Medicare and Most Insurance,
Sliding Scale Also Available 580883-F
have glaucoma are unaware they have it.
* Glaucoma is a leading cause of blindness. It's
important to get routine eye examinations, as
even those who do and receive adequate
treatment for glaucoma will not necessarily avoid
blindness. In fact, roughly 10 percent of people
with glaucoma who receive proper treatment still
experience loss of vision. For those who never get
treatment, the likelihood of blindness is even
greater.
* There are not necessarily symptoms of
glaucoma. The importance of eye examinations is
further emphasized by the very real likelihood
there will be no discernible symptoms of
glaucoma, as doctors often diagnose the disease
before patients know they even have a vision
problem. When vision loss begins, it does so with
diminished peripheral vision. Many people
subconsciously compensate by turning their head
to the side.
* According to the Glaucoma Research
Foundation, African-Americans are particularly
susceptible to glaucoma at a young age.
Physical Therapy
"^-9 iiiilicj Sa d-ii/loo i aii, _Ai1".
* Physical Therapy * Occupational Therapy * Speech Therapy
* Specializing In Arthritis * Fibromyalgia * Geriatrics * Spinal &
Joint Pain * Sports Injuries * Work Injuries * Pediatrics
* Manual Therapy * Lymphedema
Locally Owned & Operated
Live Oak 208-1414 Medicare, Protegrity
Lake City 755-8680 � Blue Cross, Av Med
Jasper 792-2426 Medicaid-pediatrics
Branford 935-1449 Workers Comp
Mayo 294-1407 *Most Other Insurance Plans
A Medicare Certified Rehabilitation Agency
Email: info@healthcorerehab.com
Website: www.isgroup.net/healthcore i
Christian Village offers full
prescription services to the
community."
To place an ad on this page, please call Nancy at 386-362-1734 Ext. 103
At the W.B. Copeland Medical Center at Advent
Christian Village, modem facilities provide a
comfortable setting for our experienced staff to
deliver quality, full-service medical care.
Following your medical appointment, have your
prescription filled on the spot and purchase over
the counter medications at Village Pharmacy. Our
experienced Pharmacist gives professional
consultations and personalized service. Village
Pharmacy also offers free prescription delivery
service within Dowling Park, as an additional
convenience. Most forms of insurance accepted.
ADVENT CHRISTIAN VILLAGE
AT DOWLING PARK
PO Box 4345 * Dowling Park, FL 32064
386-658-5860 * 1-800-955-8771 TTY
1-800-647-3353
www.acvillage.net 580882-F
* CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
North Florida
Reaching 14,100 households each week
ss
ifie
Place a classified: Call 386-362-1734 or toll free 1-800-525-4182
or fax 386-364-5578 Hours are M-F 8 am - 5 pm * closed Sat. & Sun.
View the Classifieds Online at: www.classifiedmarketplaceonline.com
We accept C I |.-j
I
Announcements
Help Wanted
FirstDay
CASE MANAGER
POSITION
For Dixie/Lafayette/Levy
Counties
Responsible for client case
records, home visits, client
assessments, case plans, and
case management. Must have a
4 year college degree with
course work in Social Work,
Sociology, Psychology, Nursing,
Gerontology, and/or related
fields. Two years experience in
Gerontology and/or related
fields. Experience may be
substituted for the college
required. Submit Resume to
SREC, Inc. P.O. Box 70, Live
Oak, FL 32064. Call 386-362-
4115
Deadline: March 24, 2010 no
later than 12:00pm Voice/TDD
Affirmative Action Employer.
CDL DRIVERS NEEDED for
over the road flatbed positions.
Minimum of 2 years experience,
clean CDL, flatbed experience
preferred. Driver's home every
weekend during seasonal freight,
every 10-15 days during off
season. Late model Preterbilts
and Freightliners. Average
salary $50K to $60K. Call 386-
590-1980 or 386-776-1857.
FirstDay
DENTAL ASSISTANT
General Dentist in Live Oak has
an opening for a dependable,
outgoing, friendly dental
assistant. Preference will be
given to the assistant that has
experience in: lab duties,
charting, sterilization
procedures, radiology certified,
and fabricating temporary
crowns. Salary will be based on
verifiable experience. Please
e-mail your resume, cover letter,
and salary requirements to :
dentalassistant266@ hotmail.co
m
FirstDay
MATH TEACHER
Lighthouse Christian Academy in
Mayo is seeking a certified, high
school math teacher for the 2010
- 1011 school year. Please fax
resumes to 386-294-3449. For
more information, please call
386-294-2994.
NURSING
INSTRUCTOR
POSITION
at North Florida Community
College. For Details Visit
www.nfcc.edu
FirstDay
OTR DRIVER wanted, must
have clean MVR. Reefer exp.,
LTL, physical work, references
req. Call 386-963-3153.
SENIOR OPPORTUNITIES
Are you unemployed? Over 55?
We can help! The Older Worker
Program is an "earn while you
learn" job training program
operated by FIWI through the FL
Department of Elder Affairs. The
Older Worker program provides
you with part time paid job
training positions in your area. If
you are unemployed, over 55
and looking for a job contact
FIWI today at 352.244.5193 to
find out about how the Older
Worker Program can help.
SENO POTNTE
Ar*yu nepoydOvr- 5
Weca el! h Ode ore
Prgami a ernwilS o
TEMPORARY
MAINTENANCE
POSITION
Full Time.
Carpentry, Renovation, &
Flooring Exp. Required. Must
have good work history. Apply in
person at Suwannee Health &
Rehab,
1620 East Helvenston St.
Live Oak Fl. 32064
EOE/V/D/M/F
Jobs Wanted
HANDYMAN: Roofing, decks,
small additions, flooring,
painting, yard work, odd jobs.
Please contact Eddie 386-364-
5664 for mor information.
NEED HELP MOVING OR
CLEANING UP YOUR AREA?
CALL 386-249-2701
Lost & Found
FOUND ORANGE Male Cat.
Very Friendly. Found in Boys
Ranch Area. 386-842-5026
Special Notices
Yard Services
IT'S TIME to Resod your Lawn
with All types of Sod, Free
Estimates and Friendly Service.
Let us help you order online at
www.OBGarden.com (813)
936-5081
Business
Opportunities
ALL CASH VENDING!! Do You
Earn $800 in a Day? 25 Local
Machines and Candy All For
$9,995. Call 1-888-753-3430
AIN#BO2000033 Call Us: We
Will Not Be Undersold!
Miscellaneous
KING SIZE BED $75; Chairs $5;
Tables $10; Refrigerator $40;
Bread Maker $20; Crackpot $10;
Call Tondra at 386-590-7909.
Located @ Live Oak Motel Rm
#22.
Vocational
HEATING/AIR TECH TRAINING.
3 week accelerated program.
Hands on environment. State of
Art Lab. Nationwide
certifications and Local Job
Placement Assistance! Call
Now: 1-877-994-9904
Want to be a CNA?
Don't want to wait?
Express Training is now
offering our quality Exam Prep
Classes in Lake City, Fl.
Class sizes limited. Next
Class
Feb. 1st - 5th, 8am to 4pm
Call 386-755-4401
expresstrainingservices.co
m
You can Reach
Over 4 Million
Potential Buyers
for your product
through our Internet
and Newspaper
Network in Florida
and throughout
the Nation.
Call Nancy at
386-362-1734
569568-F
AIRLINES ARE HIRING - Train
for high paying Aviation
Maintenance Career. FAA
approved program. Financial
aid if qualified. Housing
available. Call Aviation Institute
of Maintenance (888) 349-5387
AVIATION MAINTENANCE /
AVIONICS Graduate in 14
Months. FAA Approved;
financial aid if qualified. Job
placement assistance. Call
National Aviation Academy
Today! 1-800-659-2080 or
NAA.edu
HIGH SCHOOL DIPLOMA!
Graduate in just 4 weeks!!!!
Free Brochure. Call Now! 1-
800-532-6546 ext. 16
www.continentalacademy.com
NEED YOUR HIGH SCHOOL
DIPLOMA? Finish from home
fast for $399! Nationally
accredited. EZ pay. Free
brochure.
www.diplomaathome.com Call
800-470-4723
ATTEND COLLEGE ONLINE
*Teaching, *Business, *Court
Reporting, *Accounting,
*Criminal Justice, *Other Fast
Track Courses. Financial Aid if
Qualified. Train for a High
Paying Job. Call 1-800-930-
9796 www.onthenetdegree.com
LOST AN ANIMAL? WANT TO
ADOPT? Call Suwannee County
Animal Control at 386-208-0072.
M-F from 9 a.m.- 5 p.m.
Pets for Sale
LYNN'S MOBILE PET
GROOMING Van comes to your
home, now in Live Oak. 36 yrs
experience, small dogs only.
386-288-5966
Building Materials
LUMBER LIQUIDATORS
Hardwood Flooring, from $
.99/Sq.Ft. Exotics, Oak,
Bamboo, Prefinished &
Unfinished. Bellawood w/50
year prefinish, plus A Lot More!
We Deliver Anywhere, Many
Florida Locations, 1-800-
FLOORING (1-800-356-6746)
METAL ROOFING & STEEL
BUILDINGS. Save $$$ buy
direct from manufacturer. 20
colors in stock with trim & access.
4 profiles in 26 ga. panels.
Carports, horse barns, shop
ports. Completely turn key jobs.
All Steel Buildings, Gibsonton,
Florida. 1-800-331-8341.
www.allsteel-buildings.com
METAL ROOFING TAX
CREDIT! 40 yr Warranty.
Direct from manufacturer. 30
colors in stock Quick
turnaround. Delivery available.
Gulf Coast Supply &
Manufacturing, 1-888-393-0335
www.gulfcoastsupply.com
Furniture
ASHLEY FURNITURE up to
70% Off. No Credit Check.
$10,000 Credit Line. Huge
Showroom Delivery
Everywhere Tampa Discount
Furniture And Mattress
Outlet.com 813-978-3900
FirstDay
LIFT CHAIR Solid Good
Condition $250. NEW Portable
Dish Washer $175, Jazzy
Scooter Great $750. 386-776-
2527
Office Equipment
FOR SALE
Casio Cash Register-
Great for small business
works great asking $50.00 Call
386-208-4734
Miscellaneous
CUSTOM BUILT
ENTERTAINMENT
CENTERS, BOOKCASES,
CABINETS, & MORE!!
I can build it the way you want!
Place your orders today.
V & K Cabinets 229-242-
3295
If no answer please Iv. msg.
CASH PAID for your unused,
unexpired & sealed Diabetic Test
Strips. Most brands considered.
Call Linda 888-973-3729 for
details! Or
www.cash4diabeticsupplies.com
DIRECT: FREE
INSTALLATION/ZERO
DEPOSIT* Packages as Low
as $29.99/mo. Free HD/DVR
Receiver and Movies Free for 3
Months Call Now PG Global 1-
866-745-2846 or 1-877-216-
0514
DISH NETWORK. $19.99/mo,
Why Pay More For TV? 100+
Channels. FREE 4-Room Install.
FREE HD-DVR. Plus $650 Sign-
up BONUS. Call Now! 1-866-
573-3640
EVERY BABY DESERVES A
HEALTHY START. Join more
than a million people walking
and raising money to support the
March of Dimes. The walk starts
at marchforbabies.org.
Today. 1-877-212-9978
INTERNET GROCERY
SHOPPING! 30% savings!
Free shipping! 10,000 plus
name brand middle aisle items!
Save time, money and gas!
www.discountongroceries.com
or Call 813-598-1153/813-453-
5667
PROFLOWERS - Christmas
Decor and Holiday Flowers &
Other Gifts starting at $19.99.
Go To www.proflowers.com/Elf to
get an EXTRA 15% OFF Or Call
1-877-697-7697!
SWIM SPA Loaded, new. List
$18,000, sacrifice $8,995.
Hottub, Manufactured by Vita, 24
jets, 5 HP $1,695. Call 727-
851-3217
VONAGE UNLIMITED CALLS
Around The World! Call the
U.S. AND 60+ Countries for
ONLY $24.99/Month 30-Day
Money Back Guarantee. Why
Pay More? 1-877-872-0079
Wanted to Buy
CASH FOR YOUR COINS!
Private collector seeking U.S.
coins and currency. Older
varieties, all denominations. I
travel to you ! I pay more than
dealers and pawn! Questions?
Call 352-949-1450.
Garage/Yard Sales
ESTATE SALE: 3/20 8-2
10123 92nd Trail, Live Oak.
Household items, tools,
Furniture, EVERYTHING MUST
GO.
FREE GPS! FREE PRINTER!
FREE MP3! With Purchase of
New computer. Payments
Starting at Only $29.99/week.
No Credit Check! Call GCF
sense
SEARCH TECHNOLOGY
IT MAKES OTHER SEARCH
TECHNOLOGY A WASTE OF TIME.
LITERALLY.
Introducing 6Sense'" Search Technology from Monster
Now Available for Employers on northofboston.com/monster
We've changed the recruiting game, yet again. Our new 6Sense search technology finds people, not keywords.
Not just any people, the ones you actually need. It is quickly becoming the cornerstone of innovative new
products like Power Resume Search" which delivers the best-qualified candidates - sorted, ranked and
compared side-by-side - so you get better matches to your job opportunities with unprecedented efficiency.
So stop wasting time and find the candidate you've been looking for.
Get a Monster� advantage at classifiedmarketplaceonline.com/monster
classifiedmarketplaceonline.com m o t r
w-
classifiedmarketplaceonline.com/monster
www.northofboston.com/monster
581352jrv
GET A TmlnSter ADVANTAGE
aP ( pf �d Cars, Trucks, SUV's, Motorcycles
Draneinn I-Ianial Pr:D nlan iJhnh
EXCELLENT CREDIT - NO CREDIT - BAD CREDIT - COME SEE US!!
Fiacn -0 CHEU Si ,'08 HONDA CVICe '09 HEAVY 08 07 MINI COOPER
Financing Available ER MALIBUUSTAN E
)j1 6- 1r s 'l ow 15,67S
W/ 9,998 015995 6.990 194,998 55. ij
- u '05 NISSAN 350 Z '00 BMW 14011 L 05 CHEVY 05 NISSAN ALTIMIA '04 DODGE STRATUS
" j CONVT. I 1V--ERADR. BG.1A
AUTO SALES _ - - 4-
1518 W. US 90, LAKE CITY
386-758-6171 oI,,0 ,99e 8o 012,995 r ,o* 7,995o o ss,995 oL s6,9
yes, we're Back!!! Better Than Ever!!!
I a Iiu vn ivniualIc, i yan vvaFro u,
Lonnie Higginbotham Gene Guerrero
I
MARCH 17 & 18, 2010, PAGE 5
*64"
fVg"g
)L
�7�a
P CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
Classifieds
SEVEN SALES ONE
LOCATION Fri & Sat 19/20th
8til? 131st Loop-Follow signs at
51 & Demetree - 1 mile.
Rototiller, Treadmill, Furniture,
Misc Tools, Electric Impact
Wrench, Clothes, Shoes, Books,
Fabric, Glassware, Lots of
Household Stuff. Treasures of all
Kinds! Don't Miss!
SPRING
COMMUNITY
YARD SALE
Saturday, April 10th
7 am -1 pm
Lowndes Co.
Civic Center
(Fairgrounds, Hwy. 84 E.)
Clean out your closets!
Empty your cabinets!
Reclaim your garage!
Join us for a great day
of yard sale fun!
VENDOR SPACES
AVAILABLE!
Inside spaces - $35 ea.
Outside spaces - $25 ea.
Spaces are limited,
so act quickly!
Call the
Classified Marketplace
229-244-1880
229-244-3400
1-800-600-4838
or come by
VALDOSTA
DAILY
TIMES
201 N. Troup St.
Valdosta, GA
Boats/Supplies
BOATS; 1000's of boats for sale
www.floridamariner.com
reaching 6 million homes weekly
throughout Florida. 800-388-
9307, tide charts, broker profiles,
fishing captains, dockside dining
and more.
Apartments for Rent
FirstDay
APARTMENTS FOR RENT:
Equal Opportunity, Rental
assistance may be available.
Branford Villa Apartments. 396-
935-2319
I
PUBLISHER'S
NOTICE
All real estate advertising in thi,
newspaper is subject to the Fai
Housing Act which makes it illegal
to advertise "any preference, limi
station or discrimination based or
race, color, religion, sex, disabili
ty, familial status or national ori
gin, or an intention, to make an'
such preference, limitation an(
discrimination." Familial status in
cludes children under the age o
18 living with parents or legal cus
todians, pregnant women ani
people securing custody of chil
dren under 18.
This newspaper will not know
ingly accept any advertising fo
real estate which is in violation o
the law. Our readers are hereb'
informed that all dwellings adver
tised in this newspaper are availa
ble on an equal opportunity basis
To complain of discrimination cal
HUD toll-free 1-800-669-9777
The toll-free number for the hear
ing impaired is 1-800-927-9275.
Houses for Rent
HOUSE 2Bd/1Ba CHA, Fridge,
Stove, Seperate storage bldg.
new paint & hardwood floors
$600 + Utlities $500 Sec Dep.
Ref's, No Smokers, No Pets
downtown Live Oak. Call for app
362-1837 days or after 6pm 362-
6156 Cell 590-0204 Ask for Ellen
FirstDay
HOUSE 2Bd/2Ba Lots of
closets 1 mile from Live Oak. NO
PETS $650/mo, 1st, Last & $300
Dep. Includes Water/Sewerage
386-362-3002 or 318-840-4802
Mobile Homes for Rent
FirstDay
DWMH 3Bd/2Ba on 6 Acres. 3
miles from Mayo Correctional.
2000 model, totally refurbished
inside. $500 mo plus Dep. 386-
294-2135
FOR RENT NEAR MAYO
Over 3 acres. Single Wide
mobile home, 3/2.
New floorings! $600/month.
Contact: 386-935 2256
FirstDay
RENT WITH OPTION TO BUY
1984 Double wide mobile home
24X60. 1440sf, 3bd/2ba, on 10
acres. Large 3 car garage. Horse
stalls, RV carport. Fenced in
pastures. Washer & Dryer
included. Large back porch.
Gated entrance. $1,000mo. 772-
318-8831
FirstDay
SWMH 2Bd/2Ba $500/mo in
town, large Yard. 1st & $500
Security to move in.
386-590-1930
FirstDay
VERY NICE 28X76 DWMH
4Bd/2.5Ba on 3 acres. X-
Fenced, Large Deck, Horse
Ready, McAlpin Area. $950/mo
386-867-1833
Office Space for Rent
OFFICE SPACE 2-UNITS: 310 &
314 N. Ohio. 1000-1800 sq ft
available. Utilities included. PIs
Call 386-466-5876
Vacation Property
LAND SALE NOTICE:
VIRGINIA MOUNTAINS
Closeout Sale! 5 acres, great
fishing! Near stocked trout
stream, near state park,
$29,500, must sell. Bank
financing. 1-866-275-0442
NC MOUNTAINS Top of the
mountain! 10acres with great
view, very private, creek,
waterfalls & large public lake
nearby, $99,500. Bank
financing. Call 1-866-789-8535
S.E. TENNESSEE PARADISE
Custom built cypress log home
with barn, pond, creek, 60 acres.
Will sell smaller parcels. See
Forsalebyowner.com listing
#21221919,
mayangus@aol.com, 423-608-
1950
SOUTHEAST TENNESSEE
Variety of homes & land;
mountain, valley, farms, wooded
tracts, gated community. 800-
516-8387, George Hamilton
Land & Auction, TAL1557
www.hamiltonauction.com
www.timber-wood.com
TENN MTN PROPERTY
5ACRES Private wooded
parcel, perfect for cabin. Near
Cookeville $14,900. Owner
Financing 931-839-6141
TURN YOUR UNWANTED
TIMESHARE INTO CASH! No
Commissions/Brokers Fees.
Buyer pays All closing costs.
Timeshare Clearinghouse 888-
595-3547
BYOWNERRESORTS.COM
Lots
FirstDay
ONE ACRE RIVER RD.
Beautifully wooded, paved rd.
Owner Financing NO DOWN.
$14,900 $153/mo 352-215-
1018
Acreage
CENTRAL GEORGIA - 49AC -
$1,325/ACRE Gently rolling,
planted pine, some hardwood,
near Flint River, great hunting.
478-987-9700 St. Regis Paper
Co.
FirstDay
FIVE ACRES DOWLING PARK,
Well, Septic, Power, Paved Rd
frontage. Owner Financing, NO
DOWN $64,900 $570/mo 352-
215-1018
FOR SALE BY OWNER:
Paved Rd Frontage, near
Orange Baptist Church. 25+
Acre parcel, 24+ acre parcel,
5+ acre parcel. Owner
Finance Avail. 386-362-5259
or 386-984-9532 Before 9:00
PM
FirstDay
FOUR ACRES
O'BRIEN/MCALPIN AREA
Beautiful Secluded Country
Setting. High & Dry. Owner
Financing NO DOWN $34,900
$359/mo 352-215-1018
PRICE REDUCED
Lafayette County
10ac, North of MAYO, $64,900
1 ac RV/MOBILE HOME lots,
Branford area, $9,500
Suwannee County
5 ac, Near airport, $39,900
Easy Financing
1-941-778/7980 /7565
www.landcallnow.com
Trucks for Sale
FORD 1986 RANGER and 1988
BRONCO COMBINED DEAL:
Both run, minimal work needed
on both, Call for details. $1100
OBO. 386-963-2916
Aircraft
SKYLANE 182 RG. 1979, Low
time, always hangared.
Professionally maintained. A
50K avionic Garmin upgrade in
2008. Must sell NOW. See at:
http://tinyURL.com/Nicel82RG.
No reasonable offer refused.
Motorcycles
ARCTIC CAT 2005 ATV: 650cc
V-2 Extra Mud Tires, Cabin,
Storage Bag, & Ramps. $4500
OBO 386-792-3106
Contact
us at the 1
paper
Classified
Advertising
386-362-1734 ext, 102
fx 386-364-5578
e-mail:
www.suwanneedemocrat.com
Mon. Fri.:
8 a.m.- p.m.
We'd love to hear from you.
Classified
Marketplace
RO. Box 370
Live Oak, FL 32064
r 7
SStump Grinding
Jim Sellers 386-776-2522
Cell 386-647-5978
affordable Seamless Gutters E-UMB-INATORS,INC.
"Satisfaction Guaranteed" Complete Tree Service
Specializing In: Licensed & Insured
* Seamless Gutters Carl Kirk
* Soffit & Fasia 386-776-1835 Owners:
* Gutter Guard Cell Keith & Glenda Hudson
SScres and Repair 386-209-27n 40 9351 220th Street
Enclosures and Repair �386-209-2740 O'Brien, FL, 32071
Residential & Commercial * Licensed & Insured Phone 386-935-1993
FREE ESTIMATES * FAMILY OWNED & OPERATED Fax 386-935-3321
W LIVE OAK
MINI STO0RA!GE
* 5x15 * 5x20 * 10x15 * 10x20
CLIMATE CONTROLLED STORAGE
5x5 *5x10*10x10 10x20
Units located on Gold Kist Road
Rental Office: 121 Van Buren St., Live Oak 364-6626
TO PLACE AN AD, CALL 386-362-1734
DEADLINE IS FRIDAY AT 2:00 P.M.
571377-F
Continued From Page 4
terested in assisting in this much needed service to the el-
derly population of Branford, should contact Bruce
Evans, Senior Center Director, at 362-1164 or Janis
Owen, Director of Client Services, at 362-4115, ext. 240.
Love a mystery?
Try locating your ancestors by working on your family
tree. The Suwannee Valley Gcnic.ihi-;: Society invites
you to join and learn how to find your ancestors.
Membership is $30 for a single member or $35 for a
family. Corporate membership is also available for
donations of $100 or more (tax deductible). Meetings are
held on the first Thursday of each month at 7:00 PM at
the Gcic.ilh .-', Center at 215 Wilbur Street SW in Live
Oak. The library is open on Tuesday and Thursday from
9 a.m. until 5 p.m. and the talented folks there will be
glad to help. For more information call Jinnie or Alice at
386-330-0110.
Take Off Pounds Sensibly
We know everyone has different hopes and dreams,
different health conditions and weight loss goals. TOPS
helps people meet their individual needs through group
support.
However you measure success and whatever you have
to lose, TOPS is here for you.
Change take time. Take Off Pounds Sensibly supports
you, no matter how long, even after you've reached your
goal.
There is no quick fixes at TOPS and no phony guaran-
tees about weight loss. It's up to you and it's a total com-
mitment on your part, but if you bring the desire, we can
help.
We meet every Wednesday morning at 9 at the Com-
munity Church of God, 10639 US 129 South, Live Oak.
For more information contact Barbara at 362-5933.
AARP tax filing service
suspended
Due to volunteer leadership staffing difficulties, AARP
Tax-Aide has found it necessary to temporarily suspend
its free volunteer tax preparation service in Suwannee,
Hamilton and Columbia counties this tax filing season
that would have begun Feb. 1. AARP Tax-Aide wants all
citizens to know that they are deeply committed to assist-
ing the taxpayers in these areas, and they are working to
rectify this situation for next year.
In the interim, to locate an alternate site near them, tax-
payers may visit the AARP Tax-Aide Web site at
www.aarp.org/taxaide, or call toll-free 1-888-227-7669.
AARP Tax-Aide is a program of the AARP Foundation,
offered in conjunction with the IRS.
Caladium bulbs
Live Oak Garden Club
#1 Quality Caladium
Bulb Sale
Order Now!
Price still 10 bulbs for $6.
To place your order, call:
Ella Carter - 386-362-1326
Andrea Miller - 386-963-3172.
Rocky Sink Baptist
Rocky Sink Baptist would like to invite all to come
meet their pastor Robert Carter.
8422 169th RD. Live Oak, FL.
Live Oak Partnership
meeting schedule changes
The Live Oak Partnership Revitalization Board will
meet on the first and third Tuesdays of each month at 3:30
p.m. The meetings will be held at the Live Oak City Hall
complex. Unless otherwise noted, these meetings will be
held in the City Hall Annex building, east of the main City
Hall office.
MOAA meets fourth Tuesdays
MOAA (Military Officers Association of America,
Suwannee River Valley Chapter) meets fourth Thursday,
6:30 p.m., Elks Club, Lake City for dinner and program.
Info: Steve Casto 386-497-2986.
CONTINUED ON PAGE 7
SSuwannee
S graphics
SPRINTING * COPY SERVICE
Color Copies * Blueprints
621 Ohio Ave. North * Live Oak, FL 32064
(386) 362-1848 * Fax (386) 364-4661 * 1-800-457-6082
Go to suwanneedemocrat.com and
look under Local Happenings for:
* Calendar of Events
PAGE 6, MARCH 17 & 18, 2010
* CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
tOnoA3~~ �o e
MARCH 17 & 18, 2010, PAGE 7
Continued From Page 6
Seasonal flu vaccine still
available at health department
Seasonal influenza vaccine for adults is still available at
the Suwannee County Health Department for adults and
children age 36 months and older. This vaccine is
recommended in addition to any H1N1 (Swine Flu)
vaccine that may become available later this fall.
Seasonal flu vaccine is recommended for those who
are:
* All children age 6 months and older
* 50 years of age and older
* Persons at risk for complications from influenza,
including:
women who will be pregnant during flu season
persons with chronic health problems
persons with a weakened immune system
persons with muscle or nerve disorders that can lead
to breathing or swallowing problems
residents of nursing homes and other long term care
facilities
* Healthcare providers
* Caregivers of children from birth up to 5 years of age
* Household contacts and caregivers of people 50 years
and older
* Anyone with chronic medical problems
The vaccine will be given by appointment. Call 386-
362-2708 for an appointment at the Live Oak clinic or
386-935-1133 for an appointment at the Branford clinic.
There is no charge for the children's seasonal flu vaccine.
Adult seasonal flu vaccine is $30 and is covered by
Medicare.
Free English-speaking
and literacy classes
Provided by Columbia County School District's Career
and Adult Education Program
Where: Wellborn, Florida
Unity of God Ministries, Inc.
12270 County Road 137
When: Every Thursday
5:30 p.m.-8 p.m.
Activities for children will be provided.
Please contact 386-755-8190 for additional information.
Wellborn Neighborhood Watch
to meet
Each month on the last Thursday the Wellborn
Neighborhood Watch has its regular meeting and at that
time we have scheduled speakers.
This month our guest speaker will be Michael Ingram,
Manager of Retail Operations for the Hospice Attic in
Lake City and Gainesville. He will explain to us exactly
how the Attic helps with funds for Haven Hospice and the
families that come there in need. He will also explain how
the Attic helps families after Medicare and other sources
of help are no longer available to them.
Please come and join us at the Blake Lowe building
next to Wellborn Playground at 7 p.m. We have
refreshments before the meeting and hope many of you
can join us.
For information call Jane Campbell at 208-8818.
New master gardener
volunteer training
Suwannee County UF/IFAS Extension will be offering
training for new Master Gardener Volunteers.
CLASSES: Wednesdays, February 17-June 2, 2010
from 8:30 am-4:00 pm
COST: $100 which includes manuals, lawn handbook
and field trips
The classes will be held at the Suwannee County Exten-
sion Office which is located at 1302 llth Street SW, Live
Oak (next to the coliseum).
Coast 0to Cost.
Around the Corner
The training is for individuals who can donate 75 hours
of their time to help Extension Agents improve landscape
and gardening practices.
For more information, contact Carolyn Saft or Pamela
Burke at the Suwannee County Extension Office at 386/-
362-2771 or csaft318@ufl.edu.
Educational program for
adults with Type 2 diabetes
Through March 25
Suwannee County Extension is now offering an
educational program to help adults with type 2 diabetes
control their blood sugar to feel better and reduce risk of
health complications. The program will include nine
classes taught by a team of qualified educators and health
professionals, and a personal consultation with a
registered dietitian. Health assessments (height, weight,
and blood pressure measurements) are included. Classes
will run from Jan. 28 to March 25 and will be held on
Thursday from 4 to 6 p.m.
We are now recruiting participants for this program. If
you have been diagnosed with type 2 diabetes, are at least
21 years old, and are interested in being a part of this
program, please call the Extension office at 386-362-
2771 by Jan. 25. The $75 program fee includes the
educational classes, nutrition consultation, program
materials and health assessments.
Class size is limited!
Spring-Friendly Landscaping
& Gardening series
March 17
Suwannee County UF/IFAS Master Gardener
volunteers are continuing their Spring-Friendly
Landscaping & Gardening series. January's topic was
"Alternative Vegetable Gardening With an Organic
Twist" at the Suwannee River Regional Library-Live
Oak. This topic will be offered again on March 17 at the
Wellborn Community Center. This series is offered on
the third Wednesday of
every month at 10 a.m.
Discussion will include
raised beds, vertical
growing and other
containers, plant selection
and insect management.
Other topics to be
discussed throughout the
series include: "Native and
Drought Tolerant Plants",
"So What's Bugging You?",
and "How and When to
Prune".
The classes will be held at three different locations
throughout the year.
*Suwannee River Regional Library-Live Oak, 1848
South Ohio Avenue
*Suwannee River Regional Library-Branford, 703 NW
Suwannee Avenue
*Wellborn Community Center, 1340 8th Avenue
For more information contact Carolyn Saft at
. ,,ji' 18@ufl.edu or Pam Burke atpeburke@ufl.edu or
386-362-2771.
It's Camp Meeting time again!
March 14-19
Peace Baptist Church
7794 S. E. US Hwy. 27
Branford, FL 32008
T. L. Holton, Sr. - Pastor; Vernon Welkner - Assoc.
Pastor
Mark your calendars for these special meetings and
don't miss out on some great preaching and music.
DATES:
Sunday, March 14, 2010 through Friday, March 19,
2010
DAILY SCHEDULE
9:30 AM - Men's Prayer
10:00 AM - Morning Service
(3 Preachers)
12:00 - Noon meal
5:00 PM - Evening meal
6:00 PM - Men's Prayer
6:30 PM - Evening Service
(2 Preachers)
Special music each service.
For more information call the church office, 386-935-
CONTINUED ON PAGE 8
SMetal Roofing
metal Rooing & Acessoe At Discount Pces!
Quality Metal Roofing & Accessories At Discount Prices!!
3'wide galvalume
3'wide painted
2' wide 5-v
Cut to your desired lengths!
*Delivery Service Available*
Ask about steel buildings
Gulf Coast Supply & Mfg. Inc.
CALL TOLL FREE 1-888-393-0335
BUSINESSES b% SERVICES
Village Oaks I Apartments LAKE WOOD Village Oaks II
1, 2, 3 & 4 bedroom units. Apartments
Hurry in for an application. APARTMENTS IN 1, 2, & 3 bedroom units.
Rental assistance available to LIVE OAK HUD vouchers accepted.
qualified applicants. iHuy in for an application.
Call 386-364-7936, Quiet country living Call386-364-7936,
TDD/TTY 711. TDD/TTY 711.
705 NW Drive, Live Oak 2 bedroom duplex. 705 NW Drive, Live Oak
"This institution is an equal "This institution is an equal
opportunity provider and Call 362-3 110. opportunity provider, and S
employer" 570121F employer."
'A or or owSfI
DfwlM
n^ o -Q
D n ~ ri~ n \ D ^\ ~\ O
WE ARE THE MANUFACTURER
METAL ROOFING
STATE OF FLORIDA APPROVED
Residential* Commercial* Agricultural
AGRI.METAL SUPPLY, INC.
Phone: 38-294-1720 Fax: 386-294-1724
232 SE Industrial Park Cir. Mayo, FL
:0::s
I TO PLACE AN AD, CALL 386-362-1734
DEADLINE IS FRIDAY AT 2:00 P.M.
tall Junk Joe
For Junk Vehicles
Will Remove any kind
of scrap metal
Free Pickup
Call 386-867-1396
LAKEWOOD
APARTMENTS
IN LIVE OAK
Quiet country living 2 bedroom duplex
Call 362-3110
800
P CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
---- Copyrighe Ma
w - � Syndicated Cor
S*Available from Commercial
m -
MOM-44
trial
tent
PAGE 8, MARCH 17 & 18, 2010
News Providers
- - -
t~Oswoi �(?fa
Continued From Page 7
4681.
Victory Baptist Church
"Gospel Sing"
"Forever His" The Crows
March 17
Gospel sing March 17, at 7 p.m. located at 10475 SR
51 (3 mi. from Rotary on #51).
Everyone is invited for a night of praise, worship and
preaching.
There will be a free will offering taken.
For more information contact Pastor Owens at 386-
362-5313.
St. Francis Xavier Catholic
Church Fish Fry
March 19
St. Francis Xaiver Catholic Church, located at 928 E.
Howard Street, US 90 East will hold a fish fry on Friday
night, March 19, beginning at 5 p.m.
Included in the fish dinners are hush puppies, cole
slaw, baked beans and macaroni and cheese, The price is
$6 adults, $3 for children 6-12 and under 6 are free. Fish
fry sponsored by Knights of Columbus #9720.
Announcements
Advertising that Works. Put your
ad in Over 100 Papers throughout
Florida for one LOW RATE! Call
(866)742-1373 or visit:
www.florida-classifieds.com
Auctions
LUXURY WATERFRONT
HOME AT AUCTION. 5732 East
Bay Boulevard, Gulf Breeze. 3
bedrooms, 3.5 baths, 3000 SF
Selling Onsite 3/24 @ 10:00 AM.
HUDSON & MARSHALL
(866)509-4473. Lic#
SCQ1035357, AB110
Business Opportunities
ALL CASH VENDING! Do you
earn $800 in a day? 25 Local
Machines and Candy $9,995.
(888)629-9968 BO2000033 CALL
US: We will not be undersold!
Condos For Sale
HOME AUCTION Over 60
Luxury Condos Little Havana,
Miami up to 2Br/2Ba 874sqft
Starting Bids as low as: $29K
Previously Valued at $323k
Auction: April 10 FREE
BROCHURE: (800)603-4954
www.Auction.com REDC I Lic#.
CQ1031187
Financial Services
$$$ ACCESS LAWSUIT CASH
NOW!!! $$$ As seen on TV.$$$
Injury Lawsuit Dragging? Need
$500-$500,000++within 48/hrs?
Low rates APPLY NOW BY
PHONE! Call Today! Toll-Free:
(800)568-8321
For Sale / Pools
Backyard Fun! Pools create
generations of memories everyday,
vacations never end! Simple DIY
pool kits and pool accessories on
sale. Visit FamilyPoolFun.com or
call (800)950-2210
Help Wanted
OTR DRIVERS- New Trucks!
Average 2,500-3,000 miles! Up to
41 cpm. 12 months experience
required. No felony or DUI past 5
Railroad Historical Society
meeting will focus on LOP&G
March 19-20
The Georgia Southern & Florida Railroad Historical Soci-
ety will hold its 10th annual meeting at the Historic Perry
Station on March 19-20.
Kickoff for the meeting will be at 6:30 p.m., Friday,
March 19, with two presentations scheduled for the evening.
The meeting will resume at 7:30 a.m., Saturday morning,
March 20 with a get acquainted time. Coffee, juice and
doughnuts will be served until 8:15 when the meeting offi-
cially begins.
All meetings will be held in the city council room directly
across from the Historic Perry Station. A substantial number
of out of town attendees have already registered.
The meeting will focus on history of The South Georgia
Railway and the Live Oak, Perry & Gulf Railroad Company,
which became subsidiaries of the Georgia Southern & Flori-
da Railway in 1954.
Presentations will be made by Dr. Revis Butler of Atlanta,
grandson of Thomas Dowling, founder of the LOP&G and
Dowling Park and L. A. Bailey of Clearwater, retired after a
long career as a telegraph operator and agent for the Atlantic
Coast Line Railroad and later a banking company executive.
Russell Tedder, retired after 46 years in the shortline rail-
road industry, will conduct the meeting and also make pre-
years. (877)740-6262. www.ptl- Creek basin, great hunting.
inc.com (478)987-9700 St. Regis Paper Co.
Drivers - FOOD TANKER
DRIVERS NEEDED OTR
positions available NOW! CDL-A
w/Tanker REQ'D. Outstanding
pay & Benefits! TEAMS
WELCOME!! Call a recruiter
TODAY! (877)484-3042
www.oakleytransport.com
Heating/Air Tech Training. 3 week
accelerated program. Hands on
environment. State of Art Lab.
Nationwide certifications and
Local Job Placement Assistance!
CALL NOW: (877)994-9904.
Homes For Sale
Delray Beach, FL-Paradise! 6
New Homes, Name your own
price! Accepting Sealed Bids, No
Minimum! For March 17th sale,
www.defalco.com (561)922-7424
Misc. Items for Sale
FREE 6-Room DISH Network
Satellite System! FREE HD-DVR!
$19.99/mo, 120+ Digital Channels
(for 1 year.) Call Now - $400
Signup BONUS! (888)593-7040.
FREE 6-Room DISH Network
Satellite System! FREE HD-DVR!
$19.99/mo, 120+ Digital Channels
(for 1 year.) Call Now - $400
Signup BONUS! (888)318-5581
DIRECT Save $29/mo FOR A
YEAR! NO Equipment/Start-Up
Costs! FREE HD/DVR Upgrade!
Other Packages Start $29.99/mo!
Ends 7/14/10. New cust. only,
qual. pkgs. Call DirectStarTV
(877)688-6563
Miscellaneous
AIRLINES ARE HIRING - Train
for high paying Aviation
Maintenance Career. FAA
approved program. Financial aid if
qualified - Housing available.
CALL Aviation Institute of
Maintenance (888)349-5387.
LAKE LOT SALE! 5 acres only
$24,900 includes FREE BOAT
SLIPS! (was $59,900) Sale March
20th! Beautiful mix of woods/
meadows- walk to private fishing
lake. Quiet country road, utilities,
warranty deed. Low financing. Call
now (888)792-5253, x.3427
BANK-ORDERED
LIQUIDATION SALE! 3/ 20 & 21
Direct Ocean Access with FREE
Boat Slips Now $29,900 (was
$124,900) All amenities complete!
Paved roads, underground utilities,
club house, pool. Excellent
financing. Call Now (877)888-
1406, x 1554
LAND OR DEVELOPMENTS
WANTED. We buy or market
development lots. Mountain or
Waterfront Communities in NC,
SC, VA, TN, AL, GA, FL. Call
(800)455-1981, Ext.1034
COASTAL GEORGIA RARE
OPPORTUNITY! Golf course,
restaurant, deep water docks,
fitness center, more! Starting at
$29.9K Special Pricing Limited
Supply Buy Now Build Later
(877)266-7376
CENTRAL GA 49 AC -
$1,325/AC Gently rolling, planted
pine, some hardwood, near Flint
River, great hunting. (478)987-
9700 St. Regis Paper Co.
.: .',
AN F
ADVERTISING NETWORKS OF FLORIDA
Classified I Display Meyo Daily
" i .
CENTRAL GA 120 AC -
$1,350/AC Hardwoods, planted
pine, borders Little Muckaloochee
Week of Mar. 14,2010
569559-F A
sentations. He worked at the Historic Perry Station as clerk,
agent and train dispatcher for the LOP&G and South Geor-
gia from 1951 to 1966.
At 2 p.m., following the presentations, a tour will be con-
ducted to some of the old railroad sites west of Perry, includ-
ing a view of the Gulf of Mexico. Although the LOP&G
did not reach its originally intended destination of St. Marks,
it did come within two miles of the Gulf at Mandalay.
Spring
Yard Sale
March 20
Mrs. Vickers' class is taking donations for their Spring
Yard Sale to be held March 20. Pick up available.
Please call (386) 344-2993 for more information.
Rec Dept. public meeting
notice
March 25
Suwannee County is applying for a Recreational Trails
Program Grant.
A public meeting will be held at the William Guy Lem-
mon Memorial Park, located at the intersection of US 129
South and 296th Street at 5:30 pm on Thursday, March 25.
The sole purpose of this meeting is to discuss a Recre-
ational Trails Program Grant Application for the Sandy
Point Trail.
Anyone interested is invited to attend the meeting.
Please call 386-362-3004 if you have any questions.
'Fishingfor the Kids' set
March 27
The third annual Children's Miracle Network "Fishing
for the Kids" fishing tournament is set for March 27. Reg-
istration is in the sporting goods department at Wal-Mart
in Live Oak, or on the morning of March 27 in front of the
store from 6-8 a.m. No registrations after 8 a.m.
Weigh-in will be in the lot beside Big Daddy's BBQ.
There will be fishing games, a silent auction, and lots of
fun for everyone.
United Way annual meeting,
awards banquet set
March 30
United Way of Suwannee Valley will celebrate its
awards banquet and annual meeting on Tuesday, March
30, at Lake City Community College Howard Confer-
ence Center. The event will begin with a social time from
5:30 to 6. Dinner will be served at 6 p.m., and the meet-
ing will be conducted from 6 to 7:30 p.m.
All individual contributors as well as organizational
contributors are invited to attend this annual membership
meeting. Call the United Way office at 752-5604 by
March 23 to make reservations at $25 per person. Tables
may be reserved for groups of eight.
The event will highlight the youth from the area
schools, including Columbia High School, Suwannee
High School, Hamilton High School and Fort White High
School, who visited United Way affiliated agencies and
spoke about their experiences and community volun-
teerism during the campaign season events. The event
will include the recognition of outstanding community
volunteers and local company giving campaigns as well
as the election of the 2009-2010 executive committee and
board of directors.
Again the 2009-2010 United Way community fundrais-
ing campaign season events have featured a "heads or
tails" drawing. Guests are invited to bring $5 to partici-
pate.
United Way of Suwannee Valley is a community im-
pact and fundraising organization which, utilizing volun-
teers on all levels, advances the common good by identi-
fying unmet community needs and seeking to alleviate
those needs through United Way of Suwannee Valley ini-
tiatives and the funding of affiliated health and human
service agencies.
Web challenge could benefit
animal shelter
Through mid-April
The Suwannee County Animal Control Shelter is en-
tered into a shelter challenge sponsored by Petfinders and
the animal rescue site. In order to win we need everyone
CONTINUED ON PAGE 9
Out of Area Real Estate
w o
- , -
- -.- b
__
%�- -Io
4w,4wnopD
* CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
Shc ()ul of
M\ Ic auc
it �III '
11I1)
Copyrighted Material
Syndicated Content
Available from Commercial News Providers
(to -[? @@a(N@
Continued From Page 8
to log onto www.theanimalrescuesite.com and vote for
Suwannee County Animal Control Shelter. You can do
this once a day. The contest runs through mid-April.
Please, we need your help and it only takes a few min-
utes a day. Not only can we possibly win the grand prize
of $100,000 but there are weekly prizes also.
Suwannee High Class of 1980
The Suwannee High Class of 1980 is planning their 30
year class reunion. If you were a member, had a child,
sibling or relative as part of the graduating class, please
email your name (maiden and married), address, phone
number and email address to shsclassl980@yahoo.com.
Or call 386-362-6309 to leave a message.
We look forward to hearing from you and seeing you
at the reunion.
Senior Citizen Club
Madison Travel & Tours
June 9-17
New York City - "The Big Apple," 9 days, 8 nights
June 9-17, 2010. Total Cost $949. Final payment due by
4/3/2010. For more information contact Charlene and
Walter Howell (386) 842-2241.
Senior Citizen Club
Madison Travel & Tours
Oct. 14-26
Las Vegas and the Grand Canyon - 13 days, 12 nights
Oct. 14-26, 2010. Total Cost $1220. Final payment due
by 8/8/2010. For more information contact Charlene and
Walter Howell (386) 842-2241.
Senior Citizen Club
Madison Travel & Tours
Dec. 6-10
Smoky Mountains "Show Trip" 5 days, 4 nights Dec.
6-10, 2010. Total Cost $490. Final payment due by
9/30/10. For more information contact Charlene and
Walter Howell (386) 842-2241.
Roving 'Sonic hedgehog' gene may
change scientists' understanding
of limb growth, Page 10
DiG'E &BUlDWEISERW SELO'3
JAL FLORIDA GATIWAy PRO
Classifieds As Individual AsYo.
CLASSIFIED
571322-F
It's fast, easy, convenient, and always available!
To create your customized classified ad visit
www.nflaonline.com
And click on "Buy a Classified"
0I Yo Ad]
~C~r~R~r~a~PP
MARCH 17 & 18, 2010, PAGE 9
Q
,m,
l*
'P~ ~~~"
�r :�-, ;i','
L:::
P CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
Roving 'Sonic hedgehog'
gene may change scientists'
understanding of limb growth
By John Pastor
Sonic hedgehog, a gene that plays a
crucial rule in the positioning and growth
of limbs, fingers and toes, has been con-
firmed in an unexpected place in the em-
bryos of developing mice - the layer of
cells that creates the skin.
Named for a video game character,
Sonic hedgehog describes both a gene and
the protein it produces in the body. Its
study is important to increase understand-
ing of human birth defects.
It was thought to be exclusively present
in the cell layer that builds bone and mus-
cle, called the mesoderm. But University
of Florida Genetics Institute researchers
have discovered that Sonic hedgehog is
also at work in mice limb buds in what is
known as the ectoderm, the cell layer that
gives rise to the skin in vertebrates.
Finding Sonic hedgehog in this layer of
cells is loosely akin to discovering that
yeast has crept from the batter to the
frosting, where it has the surprising effect
of limiting how much the cake will rise.
More literally, instead of causing ap-
pendages to grow, Sonic hedgehog seems
to act as a failsafe mechanism to keep ad-
ditional digits from developing.
"Sonic hedgehog protein determines
how your limbs form, and why your
pinky is at the bottom of your hand and
your thumb is at the top," said Brian D.
Harfe, an associate professor of molecular
genetics and microbiology at the UF Col-
lege of Medicine. "But what's been previ-
ously published is only part of the picture.
We determined that Sonic hedgehog sig-
naling is required in the ectoderm to have
normal digit formation. Get rid of it, and
an extra digit forms."
In this case, when scientists disrupted
Sonic hedgehog signaling in a small re-
gion of the limb buds of embryonic mice,
an additional digit began to arise in what
would be the mouse paw.
The discovery, to appear online in this
week's Proceedings of the National Acad-
emy of Sciences, suggests that Sonic
hedgehog's role in the growth of ap-
pendages is far more complex than origi-
nally thought. Developmental biologists
may have to rethink established theories
about how limbs are patterned in verte-
brates - an effort that could provide in-
sight into human birth defects.
"We used tcciliin ,l-l, where a viral pro-
tein seeks out specific sequences of
DNA," said Cortney M. Bouldin, a gradu-
ate student in the Interdisciplinary Pro-
gram in Biomedical Sciences in the de-
partment of molecular genetics and micro-
biology. "We concentrated on disabling a
protein essential for Sonic hedgehog sig-
naling. Although it has been removed
from the limb before, we wanted to
specifically remove it from the ectoderm.
When we did that, in the latter stages of
development, we saw extra cartilage and
the early beginnings of another digit."
Sonic hedgehog signaling in the ecto-
derm of limb buds may act as a buffering
system that prevents unneeded growth,
Bouldin said.
The UF research was sparked by stud-
ies of gene activity in the limb buds of
mice by William J. Scott, a professor of
pediatrics at the University of Cincinnati.
Scott used a microarray experiment to ex-
amine gene expression levels in the ecto-
derm of mice limb buds, finding activity
that could not be possible without the
presence of Sonic hedgehog.
UF researchers were able to advance
this investigation from cell studies to de-
veloping mice embryos by knocking out
gene expression in a small region of the
ectodermal layer. It allowed them to ob-
serve early limb development in the ab-
sence of Sonic hedgehog signaling.
"The view had been if you reduce sig-
naling, if anything you would get fewer
fingers," said Scott, who did not partici-
pate in the UF research. "We now know
we can't disregard Sonic hedgehog signal-
ing in the ectoderm. It still has its pre-
dominant effect in the tissue where it is
made, but it does something more than we
thought it did previously. When we try to
understand problems that arise with limb
growth in humans, we will be able to ex-
amine those possibilities."
Harfe said the next phase of the work
will be to observe what happens when
Sonic hedgehog signaling is disrupted
through larger segments of the ectodermal
Sell Your Car for "Top Dollar"
SI
AO Sl
~- ~
-----i.. : --_ -.. ~ ----
2---- :--= I -
ES I
-
Each Kit Includes:
* 2 All-Weather Fluorescent "For Sale" Signs
* Successful Tips
"Get Top Dollar for Your Used Car"
* Pre-Sale Checklist
* Vehicle Options Window Display
* E-Z Closing Forms
including Deposit Form & Bill of Sale
Run your Car For Sale classified in the Wednesday
North Florida Focus & Friday Suwannee Democrat
Classifieds and get the Car Kit for FREE.*
Deadline for placing your ad is Friday at 11:00 a.m.
*Not valid with the $18.95 special 569562-F
And Make Your Event a Success!
YA
S A L E-:
Each Kit includes:
* 3 Bright 11" x 14" All-weather Signs
* Over 275 Pre-Priced Labels
* Successful Tips for a "No Hassle" Sale
* Pre-Sale Checklist
* Sales Record Form
Run your Yard Sale in the
Wednesday North Florida Focus &
Friday Suwannee Democrat Classifieds
and get the Yard Sale Kit for FREE.
Deadline for placing your yard sale is Friday at 11:00 a.m.
569561-F
Brian D. Harfe, an associate professor of molecular genetics and micro-
biology at the UF College of Medicine. - Courtesy photo
layer. Ultimately, researchers hope the
work will lead to quality of life improve-
ments for people.
"We would like to repair limb defects in
humans and enhance regeneration of
limbs, helping people who might cut off
fingers in an accident, for example,"
Harfe said.
The work was funded by the UF Col-
lege of Medicine.
UF performing arts
calendar of events
March 18 - April 17, 2010
Curtis M. Phillips Center for the Performing Arts
University Auditorium
Alan & Carol Squitieri Studio Theatre
UFPA presents
Buffalo Philharmonic Orchestra
JoAnn Faletta, Music Director
with Fabio Bidini, Piano
Thursday, March 18, 7:30 p.m.
Reserved Seating: $34.00 - $55.25
For more information, call 352-392-2787
or visit www.performingarts.ufl.edu
UFPA presents
Menahem Pressler & the New York
Chamber Soloists, Winds
Sunday, March 21, 2 p.m. University Au-
ditorium
Reserved Seating: $28.50 - $39.25
For more information, call 352-392-2787
or visit www.performingarts.ufl.edu
UFPA presents
Abraham Inc.
Tuesday, March 23, 7:30 p.m.
Reserved Seating: $23.25 - $39.25
For more information, call 352-392-2787
or visit www.performingarts.ufl.edu
UFPA presents
No Southern Accent
Thursday, March 25, 7:30 p.m.
Sunday, March 28, 2 p.m. Squitieri Studio
Theatre
Reserved Seating: $15.75
For more information, call 352-392-2787
or visit www.performingarts.ufl.edu
UFPA presents
One Night of Queen Performed by Gary
Mullen & The Works
Tuesday, March 30, 7:30 p.m.
Reserved Seating: $28.50 - $39.25
For more information, call 352-392-2787
SEE UF, PAGE 15
I Livestock Show*ansaI
PAGE 10, MARCH 17 & 18, 2010
* CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
SUWANNEE VALLEY HUMANE SOCIETY
CRITTER CORNER
Suwannee Valley Humane Society
1156 SE Bisbee Loop
Madison, Florida 32340
Two ,rnl. . south of Lee offC.R. 255
From - 10 Exit 262. Take C.R.255 north .8 of a mile
We are a Limited Space Shelter (no kill). You must
check with us prior to bringing a drop-off animal to the
shelter. Hours: Tues. to Sat. 10:00 to 2:00, or by appoint-
ment. We are closed on Sunday and Mondays. Visit our
website and see the animals that need a really good home
at www.suwanneevalleyhumanesociety.org or at our e-mail
address suwanneevalley @ embarqmail.com.
We service the surrounding counties of Madison,
Suwannee, Hamilton, Lafayette, Columbia and Taylor. We
do not pick up animals.
Lost and Found Pets:
If you have lost a pet or found one, the humane society
will help you find your pet. Call us at (850) 971- 9904 or
toll free at 1-866-236-7812. Leave a message if we are
closed, we will return your call. Remember to always call
your local animal controls or shelters if you have found an
animal or lost a pet.
THRIFT STORE:
You must come see our thrift stores, if you have not
been here before. We have three stores, a boutique, cloth-
ing and furniture. We are always looking for donations for
the stores. Please keep us in mind if you have items in
good condition you would like to donate to us.
RECYCLING:
We have a recycling bin on our property newspapers,
magazines, and catalogs. The bin will take all kinds of pa-
per. We also have a bin in Live Oak at 305 Pinewood Dri-
ve, next to Johnson's Appliance/Radio Shack. We also col-
lect aluminum cans to recycle. Just bring them to the shel-
ter. All the money goes to help the homeless animals.
Our adoption is $65.00, which INCLUDES, spay/neuter,
wormed, boost- shots, heartworm/feline leukemia tested,
micro chips, and rabies shot (if old enough). We also a Di-
amond in the Ruff program, ask about it. Please come
visit us, our animals would love to meet you.
We are always looking for volunteers. We need help
cleaning cages, dishes etc, as well as the thrift store could
use more help. We would love any time you could give us.
FEATURED ANIMALS FOR ADOPTIONS
DOGS:
# 3783 - Squiggles - is a female, Boxer/ Mix. She is 4
1/2 months old. She is brown with black and white trim.
She weighs 23.2 lbs.
# 3774 - Gage - is an 11 month old, Lab mix. He is a
cream color male, who weighs 53.2 lbs.
# 3772 - Sonja - is a female, Lab mix. She is 9 months
old and is all tan. She weighs 42.4 lbs.
# 3748 - Crissy - is a female, Lab mix. She is 5 months
old. She is black and has white on her back and neck.
# 3746 - Carol - is a 5 month old, lab mix. She is black
with a white streak on her nose.
CATS:
# 3777 - Meko - is a white light color calico. She is 11
All-star lineup of
speakers planned for
Origins '10 series at FSU
Continued From Page 3
* April 28: The series
concludes with a presenta-
tion by John D. Hofmeis-
ter, former president of
Shell Oil and now a fiery
advocate for overhauling
the federal government's
energy policies. Hofmeis-
ter is the founder of the
nonprofit Citizens for Af-
fordable Energy; he warns
of dire consequences if the
federal government contin-
ues on its current path,
which in his words repre-
sents "40 years of failure."
Tickets are now on sale
at the Fine Arts Ticket Of-
fice or online at www.ori-
ginsl0.fsu.edu.
For more information,
contact Frank Stephenson,
O, ;..0*., '10 coordinator, at
850-644-8634 orfstephen-
son@fsu. edu.
months old and weighs 5 lbs.
# 3775 - Gator - is an orange and white kitty. He is 11
months old and weighs 6.11 1/2 lbs.
# 3731 - Unique - is a 9 month old, white tabby. She
weighs 6.15 lbs.
# 3726 - October - is a black tabby. She is 1 year 4
months old. She weighs 8.4 lbs.
# 3711 - Honey - is a tan tabby. She is 10 months old.
She weighs 8.8 1/2 lbs.
Outgrow Your
Wheels?
LOST and FOUND
FOUND:
Was found 6 miles west of 1-75 off of Rte.6. A male,
Lab mix, he is more blond color than yellow. He has large
big feet and is real friendly. He has a hurt leg. Show up
around March 5th. If this is your dog, please call Opal
Workman @ 386-938 - 5142.
Our Web site has chanlQed to www.suwanneevalleyhu-
manesociety.org plus you can view the animals ;i,. ...i,
wIl.l':'t'ftllI '.cL .'lii or you can find us on
wwIlQ'rfidhlt'CI. 'C 'i.
Time to Upgrade.
If youe srdng for that pOrt iset of whelds,
loIk no further than www.nflaonline.com
2 save.com
'1 �
ADVERTISING CIRCULARS * COUPONS * DEALS * TRAVEL SPECIALS * ONLINE ANYTIME!
Contact Monja Slater at the Su wannee Democrat to
advertise on zip2sare.com 386-362-1734 * 1-800-525-4182
57106- CO*toC s, A fo� htC~c
I YU DN'THAV TOTRDE OURTOYTA ..JUST OW ONE!
MARCH 17 & 18, 2010, PAGE 11
~7~7~
I I I jK �
P CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
THE
iat an rw on"I k mmame or nowL~
(d fwatb. too -rawvi %hidme
moO- bd 0
ps kw see. apo
Copyrighted Material
" Syndicated Content
Available from Commercial News Providers
ri----- - --- --------I
I I
Quality Plus
Carpet Cleaning
I carpetcleaninglakecity.com
100% SATISFACTION GUARANTEED
I I
I 386-965-7188
I I
2 ROOMS -I Tile & Grout
1 50 Addtonalcharge for hey sol remo .l .50W /sf _
i Deluxe Package Ii Deluxe Package Ii Deluxe Package I
I 3 Room* 601 4 Room*10 I6 Room* S90
Carpet Steam Cleaned Includes: Chemical Pre-Spray, Chemical Injected Steam Extraction
| Deodorizer *Over 250sf considered 2 rooms
"Anytime is Donut Time"
)rb gDaily Lunch
Specials
Now serving
(Across from Town & Country Tire)
300 East Howard St. (US90), Live Oak
Hours: Mon.-Fri. 5 a.m. - 5 p.m.; Sat. 7 a.m. - 2 p.m.
386-330-2950 098
I John'sI
I
386-688-3000
Licensed * Insured
I 581106-F
SFullervice Repairs benching
I * Backhoe Services * New ConstructionI
I-I
* Remodeling * Drain Cleaning & Sewer
Repair * Hi-Velocity Water Jetting
EpoxyAll Work Guaranteed I
I 15 OFF Service Calf|
I Reg. 90 for 1st Hour. Parts not Included j
I
386-752-8656 Serving
Family Lake City,
Owned Mark & Cody Barrs, Owner Live Oak &
& State Certified & Insured Surrounding
Operated CFC05219 ---------------------
Operated CFC 05219Service Calli
L III5--------------81108-F
-i- - - - -
00-
I; off
S any cake
817 S. Ohio, Live Oak
I I
362-7009 581100-
I I
DIRECTVo
150 Channels for *34.99
No Credit Card Required
S386-344-2957
LI 581109-F
Lottie's
Laundry
(386) 362-4085
Specializing in: Cleaning,
Press Only, Alternations
I and all your other cleaning needs.
I Monday-Friday
1435 North Ohio Avenue ny-_6PM ay
Live Oak, FL 32064 Saturday
Located in Badcock's Plaza 8AM_12" NI
Always giving you the right look!5811
L . _ _ _ j
I' BIBL mOKSORE
BI --------- ----ORE
!BIBLE BOOKSTORE!
NEW LIFE BIBLE $5 off I
BOOKSTORE purhae of
I1102 Ohio Ave. South (Next to Advance Auto) $25 or more
386-362-4851
Better Parking, Better Hours, More Inventory
Hours: Mon.-Fri. 9 a.m.-6 p.m.; Saturday 9 a.m.-5 p.m.
r--------------------------- n
7�e 57� VUffe eea
I I
7i e ~ , c1 H~e, eiaSe
&6e ta ajywtrateie yq
I o lie t iveqw 40%
I PePas zat wsatu p
581110-F
S e Full Service Department
to take care of all your Mobile Home Needs.
SReceive a Free Estimate with coupon
L - - - - - - 581105-F|
NeedYou Batroo Reodeld! eed Dor IsSalSeJ
oupeow-
PAGE 12, MARCH 17 & 18, 2010
r - - - - - - - - -
* CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
a"po
Show5
MARCH 17 & 18, 2010, PAGE 13
dassi
SCopyrighted Material
SSyndicated Content
Available from Commercial News Providers
Swamp Hunt to benefit
American Diabetes Association
GAINESVILLE - The Swamp
Hunt, a large-scale scavenger hunt at
the University of Florida and the sur-
rounding Gainesville area, is set for
Saturday, March 27.
The event is sponsored by Health
Troupe, a student organization at UF.
All proceeds will be donated to the
American Diabetes Association.
Teams consisting of 6-8 individu-
als will compete for top prizes. The
Hunt will kickoff at 11 a.m. Teams
are to pick up their hunt list anytime
from 11 a.m. - noon on the North
Terrace of the Reitz Union at the
University of Florida.
Teams must return to Sharab
Lounge by 9 p.m. for the after party,
which will end an evening of musi-
cal entertainment and prizes. Non
participating individuals are wel-
come to join in on the party at
Sharab for a $5 cover fee to be do-
nated to the American Diabetes As-
sociation.
Individuals must register on the
event's Web site. The cost per indi-
vidual is $10. This fee includes reg-
istration, food, and after party en-
trance.
To ,* .;i. ir and collect further
information, visit
www. theswamphunt. com.
Businesses from A to Z
UTO & TRUCK
SPECIALIST
B&B
920 E. Main, Mayo
Sammy Buchanan
Mon-Fri. 8 a.m.-6 p.m.
386-294-2761
574103-F
CERAMIC
TILE
& LAMINATE
WOOD FLOORS
Installations
30+ years experience
Free Estimates!!
386-647-6924
immigration
Green Card;
Spouse/Family K Visa;
Student F Visa; Worker
HB Visa; Investor E Visa;
Change of Status
386-362-2030
www.fjslawcenter.com
574101-F
Printing Copying
lueprints
Suwannee
Graphics
621 Ohio Ave. North
Live Oak
386-362-1848
574099-F
[Daddy's
Gun Shop
Buy - Sell - Trade
Come To Daddy's,
We'll Take Care of You!
386-294-1532
,574104-F
ANNIE'S
VARIETY
* Clothing
*Shoes * Books
* Alterations
And Much More!
163W. Mail St., Suite 100
Mayo, FL
386-965-7704
LUMBER
Live Oak
Plumbing, Inc.
Repairs/Remodel
New Construction
State Lic. #CFC1427438
386-362-1767
574102-F
CHOOSE YOUR LETTER!
PUBLISHES EVERY WEDNESDAY!
$5.00 PER WEEK
CALL JANICE GANOTE 386-362-1734
Buy this
space *5.00
per week
*fURNITURE,
POWER TOOLS,
HAND TOOLS &
MISC.
By Appointment
386-330-6621
andclearing
BILL'S BACKHOE
4%4SERVICE
Bushogging, Stump
Removal, Discing, Fencing
12150 196th Terrace
O'Brien, FL 32071
386-364-1418 or
386-590-2882
rRecycling
CASH PAID
Junk Cars, Trucks,
Tractors & Scrap Metal
Trailers, No MH
386-965-1423
386-365-4879 -
Marks
V The Spot!
Place Your
Ad Here!!
Gilbert's
Lawn Service
* Full Lawn Service
* Brush Hogging
* Pressure Washing
* Leaf Vaccuming
386-776-2342
580595-F
NOISES
ETAL
ROOFING
AGRI-METAL
SUPPLY
232 SE Ind. Park Circle
Mayo, FL 32066
386-688-7397574098-F
SHORT TERM
RENTAL
New 2BR/2BA fully
furnished.
Bring your own food,
beverages & toothbrush
3 day Minimum
386-842-2006
574761-F
OU CAN
SUCCEED
WITH THIS AD!
CALL TODAY!
$5.00 PER
WEEK
HELP
YOUR
BUSINESS!
ADVERTISE
HERE! ONLY
$5.00 A WEEK
TAX
PREPARATION
Reasonable Fees
Paper Returns Only
Retired Accountant
386-362-1326
575247-F
7ZOWIE
*5.00 a
week
CALL
TODAY!
c;7zinf1Q-F
Time to Upgrade.
--o - b - .
ponm
O
P CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
On Select 2010 Toyota Models!
2008 528i
_ k-s-.
L ,UUU T9 LU3U4 4IIooRB..LuEi iu ONLY9KMILES L
I RXIL' II L
m 2009 C300 2008XB 2006 Gr. Cherokee 2008 Accord LX
I MIt 1 I 0 a I An I
S 2008 Mustang
T9346 _ i__
r_-
C
H
E
V
Y
2009 Corvette
ROUNTREEMOORETOYOTA.COM
WSigwa9 akYA
B
M
W
46��,'
w
w
I II Iree II oore 1ovo1 I mI
I0 ROUTRE OOE
PAGE 14, MARCH 17 & 18, 2010
\^
* CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
Oren Moverman, Ben Foster. - Courtesy photo
SARASOTA - Ringling College of Art and Design has
announced that it will host visiting director and writer
Oren Moverman and actor Ben Foster this month as part
of the College's Digital Filmmaking Studio Lab program.
Moverman and Foster will work with Ringling College
Digital Filmmaking students as part of the Lab's collabo-
rative orientation toward driving direct creative interac-
tion between students and film industry luminaries.
Moverman and Foster recently worked together on
"The Messenger," which received two Academy Award
nominations - Best Original Screenplay (Moverman co-
wrote the film) and Best Supporting Actor (Woody Har-
relson.) The duo will work with students on campus on
Thursday, March 24th, with a press briefing planned for
2 p.m. at the Ann and Alfred Goldstein Center.
At 7:30 pm that evening, the Sarasota Film Society
will offer a free showing of Mr. Moverman's Bob Dylan
biopic 'I'm Not There' as part of the ongoing 'Ringling
Reels and Retrospectives' series at Bums Court Cinema.
On Friday, March 25th at 10pm the Film Society will
screen Ben Foster's "Pandorum." The screenings are co-
sponsored by the Sarasota County Film Commission and
are free and open to the general public.
Moverman's expertise as a writer and director aligns
well with the foundation of the Digital Filmmaking Stu-
dio Lab's focus on 'Story' as the cornerstone of filmmak-
ing. Story drives everything in film - the script, produc-
tion design, directing, cinematography, editing, market-
ing, etc.
"Story goes to the heart of what our industry will al-
ways need - no matter how the tci'linl ,1-, changes and
advances," said Ringling College Digital Filmmaking
Department Head Bradley Battersby "Just as it is today
with current industry leaders like Jim Cameron, Steven
Spielberg and Brad Bird, the best storytellers are destined
to be the future leaders of our art and industry. At Rin-
UF performing arts
calendar of events
March 18 - April 17, 2010
Curtis M. Phillips Center for the Performing Arts
University Auditorium
Alan & Carol Squitieri Studio Theatre
Continued From Page 10
or visit www.performingarts.ufl.edu
UFPA presents
The Kin Saturday, April 3, 7:30 p.m.
Squitieri Studio Theatre
Reserved Seating: $34.00
For more information, call 352-392-2787 or visit
www.performingarts.ufl.edu
UFPA presents
Pat Metheny - The Orchestrion Tour
Sunday, April 11, 7:30 p.m.
Reserved Seating: $28.50 - $44.50
For more information, call 352-392-2787 or visit
www.performingarts.ufl.edu
UFPA presents
University of Florida Symphony Orchestra
Raymond Chobaz, Conductor
Saturday, April 17, 7:30 p.m.
Reserved Seating: $15.00 - $25.00
For more information, call 352-392-2787 or visit
www.performingarts.ufl.edu
Events, dates, times and p.. .*.,*i,,,. are subject to change.
For updates, please visit the University of Florida Per-
f iiiiiir . Arts web site at I n n i,. #C'i# iiii., i,..ufl.edu and
click on the "Events" link.
Oscar-nominated writer/director
Oren Moverman, acclaimed actor
Ben Foster coming to Ringling
gling our focus is on teaching to create great story and
then reinforcing it with the best production tools, tech-
niques and technologies available to bring these stories
to life."
The Ringling College Digital Filmmaking Studio Lab,
launched this past January in association with Future
Films, LLC, brings some of the world's most renowned
filmmakers, producers and film industry leaders to Sara-
sota to work collaboratively with Ringling students on
learning the process of motion picture and television de-
velopment. Industry luminaries that have lectured as part
of the Digital Filmmaking Studio Lab include director
Werner Herzog, who inaugurated the Lab in January, and
producer Paul Schiff, who screened his new film star-
ring Michael Douglas, 'Solitary Man,' for students and
donors. Ringling College President Larry Thompson and
Producer Paul Schiff recently discussed the Digital Film-
making Lab on air with SW Florida National Public Ra-
dio News Manager Amy Tardif. The interview is accessi-
ble at http://wgcu.org/audioplayer/6665.aspx.
For more information on the 1.... ,... ;,, i,/.1;/... sign-
ing up for p. . i,,,, updates, go to www.;, i. l;,. .. .I
RMCHEVY.COM
RMCH EVY.COM
NEW 2009 CHEVY SILVERADOj
S 1500,LT SK108P002 2 STK10P0004
33,980 $16,495
S * - 1 * * - ."a
STK210N0046A V6, LOWMILES STK#110H9097A
16,387 $12,945
p~-Z
S---
,'- ST $ A7102656
$13,885
$2,612
V^ft
1500 CLSC, WIT SIK07P0005 ~ 0021
15,780 10,723
1500, SLT-1 STK909C9240B 1500, S S STK09C9240B
$28,950 $9,755
Photos for illustration purposes onlv
_ I .... --� ---------------
MARCH 17 & 18, 2010, PAGE 15
P CLASSIFIED MARKETPLACE - WWW.NFLAONLINE.COM - SERVING NORTH FLORIDA AND SOUTH GEORGIA
2010 MOTOR TREND "TRUCK OF THE YEAR"
g g MAGAZINE'S ____
NOV U-U & - m . ii
CUMMINS DIESEL
~Lc Nc-�.
2010 RAM 3500 CREW
CUMMINS DIESEL
S Plus
1,000
REBATE
a case of honey!
C
rl*
�-" *
2010 GRAND CHEROKEI
,la^ff ,
Plus a case of honey! REBATE
'lw w Q10000uiu
$8,000
Plus a case of honey!
2010 LIBERTY
__,aUm,
,111P v
30 AVAILABLE
South Georgia/North Florida #1 Volume Jeep Dealer! -
According to Chrysler Sales History Data
CASS
I RY
*- -WT Plus
BURC
SJeep I
SQo100126
$5,000
a case of honey! REBATE
H _
QUITMAN
888-304-2277
VALDOSTA
229-242-1540i
SHOP IN YOUR PAJAMAS 24 HOURS A DAY!
DRIVE IT LIKE YOU STOLE IT.COM
PAGE 16, MARCH 17 & 18, 2010
'000Ie
'-- ��~L'I.E~
�~�:~c~~i~
|
Full Text |
xml version 1.0 encoding UTF-8
REPORT xmlns http:www.fcla.edudlsmddaitss xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.fcla.edudlsmddaitssdaitssReport.xsd
INGEST IEID ED3VCUUBK_N5VOF9 INGEST_TIME 2011-05-10T17:03:59Z PACKAGE UF00028306_00369
AGREEMENT_INFO ACCOUNT UF PROJECT UFDC
FILES
PAGE 1
By Stephenie Livingstonstephenie.livingston@gaflnews.comA new city councilman was elected in Jasper by just one vote last Tuesday. The city also passed a referendum on a proposed tax abatement program by fewer than 70 votes. LaBarfield Bryant was sworn in as councilman for District 1 last week after defeating his opponent Vanessa Smith 14 votes to 13. Furthermore, the council now has the authority to grant exemptions after an election that drew a CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida 139TH YEAR,NUMBER 14 THURSDAY,MARCH 18,2010 2 SECTIONS 28 PAGES 50¢ n f l a o n l i n e . c o mTheJasper NewsToday's Weather Considerable clouds early.Some decrease in clouds later in the day. Slight chance of a rain shower. High 66F.Winds NW at 5 to 10 mph. For up to the minute weather go to www.nflaonline.com.High 66¡FPrecip:20% NoPurcha s eNece ss ary Mu s tPre s entCoupon Limit1PerPer s on575903gav ForKids12&Under 580774-F REALTY GROUP, INC. 106 HATLEY ST. SE RatliffRealtyGroup.comREDUCED2 Bedroom, 2 Bath Brick Home in Lynn Lakes. Has potential to be converted to 3 bedroom.$75,000(386) 792-8484Now By Stephenie Livingstonstephenie.livingston@gaflnews.comA new hospital may soon be a possibility for Hamilton County, according to Economic Development Director Milton Scott. ÂFor now, we are in the investigative stages,ÂŽ said Scott. A hospital committee was formed from the ranks of county government three weeks ago to investigate the countyÂs need and to discuss available options. Scott said the committee will work toward applying for a Certificate of Need, a first step in the regulatory process. Obtaining a Certificate of Need requires By Stephenie Livingston The recent shooting death of a Hamilton County woman will be addressed Friday during a grand jury probe, according to Third Circuit State Attorney Skip Jarvis. Leonard Joeris is charged with the murder of his wife Lorrie Joeris, 42. He is currently being held at the Hamilton County Jail without By Jeff Watersjeff.waters@gaflnews.comDirector of Libraries Danny Hales said the elimination of state funding for public libraries will be devastating. Legislatures cut all state funding for public libraries last Wednesday. "It would be absolutely catastrophic," Hales said. "The handwriting is on the wall that probably Jennings and the White Springs branch will have significant reduced hours and may even be closed and most employees will beBy Stephenie Livingstonstephenie.livingston@gaflnews.comDuring Tuesday eveningÂs County Commission meeting, Executive Director of Economic Development Milton Smith presented three grant requests to the board from businesses Smith said would bring jobs to the community. The first request Smith presented was by Scout Industries, LLC and its subsidiary Scout Worldwide Communications. Scout Industries is a Service Disabled Veteran-Owned Small Business in its fourth year of existence. The company pursues governmentCouncil race decided by a single voteCOUNTY COMMISSIONHigh-tech firm, truck stop, radio station considering HamiltonHOW TO BE HEARDTo make known your views on library funding, visit www.neflin.org/srrl/ where pre-written email messages can be submitted to legislators. Phone numbers and physical addresses are also listed on the site.Funding losses threaten librariesOnce again, legislature zeroes out state budgetGrand jury convened in shootingNew hospital in the works for Hamilton? By Stephenie Livingstonstephenie.livingston @gaflnews.comSouped-up ATVs, Fords, Chevys and GMC pick-ups are lining up for JasperÂs newest fest „ a Mud Fest. ÂSo you want to get muddy, huh?ÂŽ said Denise Keith, spokeswoman of the family owned mud bog in Jasper, rightly named Mud Fest. ÂOh, you think I canÂt handle it?ÂŽ I asked. ÂYou got a truck?ÂŽ She questioned. ÂNo, but IÂve got a Jeep,ÂŽ I said. She laughed, ÂThatÂll MudslingersA new place to play in Hamilton A smiling LaBarfield Bryant is sworn in as a Jasper city councilman. Courtesy photo• Gadsden biofuel plant put on holdPage 11A• Tenth annual Wild Azalea Festival set for SaturdayPage 2A• Workshop to aid local veterans seeking workPage 9A• FROM OUR READERSLetter to the EditorPage 11ATenth annual Wild Azalea Festival set for Saturday,Page 2A TOP and ABOVE: Having fun in the mud in Jasper. Courtesy photosMiss Marie's Kids, Mercy Mountain Boysto take the stage at the Spirit North Florida Focus, Page 2 SEENEW HOSPITAL,PAGE2A SEEGRAND,PAGE2A SEEMUDSLINGERS,PAGE9A SEECOUNCIL,PAGE2A SEEHIGH-TECH,PAGE9A SEEFUNDING,PAGE2A 4 Stories to read inside}
PAGE 2
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 2A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FL 581460-FJasper News386-792-2487 For questions or donations contact the auction chair Monja Slater at 386-208-4734April 9th • 5:30 p.m.We need your support!Entertainment by Jamie Ganote Silent Auction & Dinner 5:30 Dinner Provided by Ms. Wilma Cost is $8.50 per plateLive Auction 6:30 Location: Live Oak Church of God Hwy. 129 South, Live Oak582227-F 6th Annual Suwannee CountyAUCTIONWe need your support! 1 Year In County Subscription$17$251 Year Out of CountyJasper News105 2nd Ave., Jasper, FL 32052 386-792-2487 1-800-525-4182 ext. 152Mail or bring payment to:You want the most in-depth coverage, the latest news and stories that touch home. We want to give it to you.571513-F furloughed." Hamilton County has three public libraries: Jasper, Jennings and White Springs. The House and Senate Transportation and Economic Development (TED) Appropriations Committees cut the funding during meetings March 10. "Until last year, we've never had state funding to be zeroed out," said Hales. "Hamilton County will lose roughly half its library funding with this cut." A budget conference committee cut the budget for state public libraries to zero at the end of last years' legislative session. Legislators had originally proposed a $21.2 million library budget, the threshold in order to be eligible for $8 million in federal matching funds. At the last minute, and after thousands of emails and phone calls from concerned citizens, legislators restored the $21.2 million funding. Hales said what makes this time different is the timing and those involved. Legislators were only two weeks into session when TED proposed to eliminate state aid to public libraries in its entirety. Last year, only the House committee proposed the elimination and it was near the end of the session. Hales said that if the proposals are approved for the budget and it hits "the floor then usually things don't get done after that." "So now is the time to contact your state legislators," Hales said. "Tell them we want them to restore the funding now." To do that, folks can visit http://www.neflin.org/srrl/ where folks can submit prewritten letters by email to their legislators. There is also a phone, address and email list available. So far about 20,000 messages have been sent electronically and by hard copy. Governor Charlie Crist has received about 5,000. Both committees are expected to release their proposed bills within the next week. Last year Hamilton County received $160,462 in state aid. If state funding is not restored, Hamilton will lose $181,143 from its next budget.Continued From Page 1AFunding losses threaten librariesmere 91 voters. Sixty-seven voted yes, while 24 voted against allowing the City Council to grant exemptions. Kathy Avriett kept her District Five seat as she was unopposed.Continued From Page 1ACouncil race decided by a single votecertain health care providers to obtain state approval before offering certain new or expanded services. The CON process is intended to help ensure that new services proposed by health care providers are needed for quality patient care within a particular region or community, and helps prevent duplication of services. ÂThrough a partnership between the Development Authority and the hospital committee, we will identify what our needs are and what the county can afford,ÂŽ said County Coordinator and hospital committee member Danny Johnson. Scott said the committee is currently looking into a company called Rural Health Care Developers, as well as larger healthcare providers such as Shands and Columbia.Continued From Page 1ANew hospital in the works for Hamilton?bond. Lorrie Joeris died of a gunshot wound to the head en route to Shands UF on Feb. 22. Leonard Joeris was arrested nearly a week later after his wifeÂs death was ruled a homicide by the medical examiner.Continued From Page 1AGrand jury convened in shooting death RIGHT: District 5 councilwoman Kathy Avriett, seen here being sworn in for another term, ran unopposed in last Tuesday's Jasper city elections. Courtesy photo WHITE SPRINGS The state Nature and Heritage Tourism Center, Stephen Foster Folk Culture Center State Park and the Special Events Committee for the Town of White Springs will host the tenth Annual White Springs Wild Azalea Festival on Saturday. Join the town of White Springs and the State of FloridaÂs Nature and Heritage Tourism Center to celebrate the spring bloom of wild azaleas. Festival highlights include musical performances, arts and crafts, trail hikes, the Little Miss Azalea Contest, the Suwannee River Duck Race, a rock climbing wall and other outdoor recreational opportunities. Hundreds of visitors are expected to visit White Springs to spend the day enjoying this street crafts fair where expert artisans will display and sell their handmade specialties. ÂWild AzaleasÂŽ are a highlight of this event and will be available for purchase along with other native Florida plants.Tenth annual Wild Azalea Festival set for Saturday SEETENTH,PAGE11A
PAGE 3
Public meetings will address plans for future water supply !"# $%$## &&"&'" $%#"## ()") #((&* +"## &"(% "#((&* ()"# #"#$*,,& "$$#" -*# ## &*&"(% (&)".(( +# ##&)" "("/$, "#$%# &## #((&*(&% ("##& #((&*"("# $$$)&"# & *""$*, # #((&*(&% ("###"0 )"&&"%# #&")$%#1 2"#&" #((&*(&% "%"(1 4 $ &5"* 6&/($ "$ 7#&& 2"#&" $"&%#,%"(1 89 $ !"#: %$/# ;#<&0 39 =6* :#><&3 2"#&"&0 #((&* #,%"(1(&49 $ 75" (%#5*6&&? :& 7 5"(%# 2"#&" $$$)&"# &=#>#,0 %"(1(&? $ !"# :%$ /#;# <&37"% +"""$9 =6* :#> <&3 2"#&"&0 #((&* #,%"(1*@9 $ 75" (%#5*6&&? :& 7 5"(%# 2"#&" #((&*(&% "%"(1! A $ # 5 5&& 2"#&" $$$)&"# &=#>#,0 %"(1!&*9 $ !"#: %$/# ;#<&0 37"%+" ""$9 =6* :#> <&3 %# #,'"% " )*$%#" "&$"," #((&*(&0 %("### $*#0 "$ )"$"# &,& B:#"#C ,"B: ((&*<&%C&3 CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 3A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FL 583334-F ):(%#&&3 6&*")2"5&&"#"&0 &%#("#,&(#)"*)$ #%"*90! /"((#")) *"&"&&($"&&7"% &?80??0@8)"$")" $" 6&*")2"5&&"+" $%&&,&"*#* 41( $ :&&&"5"&5"0 )""$7#&& (, <&&5&<* ?80??0@84)*""& )"$" 2"#2"#&& ",% %-) 3# # && 2"#&&,,3# #""#("##,& "&$ 3 *" Norris NotesBy Lillian Norris Healthy Start of N. Central Florida's board meets todayHealthy Start of N. Central Fl collecting for needy families-diapers needed1$ #*D ( 5## #7"#(&+&0 %##+ *& #E Calvary Baptist Church Homecoming /22"&" 5"$$*5"&&%F#<,&)0 *$*&)7%# *##;#0 "##%, , 82F#<,& )*$*)&*0 #" &&&")"0 $""#"))# "%" 7##(3&"/0 ($")5""#5$0 &&%&*#5630 $#("3"%%## &)"$"0 "#"))#)"&*,## 63$""(### &"%#&%%0 )#%%$*#%%0 $"%%&3 %%#&" "$")"$"," 2<,&)*$* ("=48>9A?0@A $&3&%G) "# ) =1<,& )*$*> NFCC Public Safety Academy offers free gang awareness trainingLocal law enforcement, criminal justice officers and NFCC Public Safety Academy students gather for informative Q&A on Florida gangs.Photo submitted
PAGE 4
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 4A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FLOPINION ! "" #$%%# &%'(') &%#'" * +,%'"' '%"#% $%%" #***-"' "".% &%&$% .*"%" %(-&/ ")#%#' %"& &% $%# $"$) "&%%$' #''%""&* -"$) #0) &%) '1& "/2"" 3"&) ( "& '" #%&) '$) & &*/( -"-&/$( %($4 4"2""#(* /$%'% 567# -%% #"%&'(* 0 58$%$&% "*2&%%"" (% "') #%&$*-& '$*/) %%) #& $&%(# ##'* 0 565*/ $%0) &"'0"0 $#0 $&%() '/%$ 4' * %/) $ 6$%&%) 57"% -.9' $%,%) '" $%* 2*% ((% $) *0 575 () .($ -"%%( ""&') "%%% "'%$' (*/"&%%$ ##$#") "(%#* %* $%":%+ &% 55%( %#$&* /("'"#$ $$#% "' %('* /((% (#%%$*0+ %";&' 58!+% $%***"$ &$%%&) $'&"$) %%'"%* 0&**" %3. $% 5< #&% &$#) (%* =%$"&%" %29) &$ &"#% &*0")%$ %(#%) &&%*2.% -'(:('" %("-) "$$ '")%" $%%9) :*) 0) *%$$%% %(&) %'(') #&%(% #&% %%%) $) '%"" $%( %%% %#(&&* &'",) *;*0"9)3* %;&) ($ $(')"&%) %(""%%*2 %"% 8')&%) $(#>' #$'* ! The warmers strike back A MINORITY VIEWBY WALTER WILLIAMS© 2009 Creators Syndicate~ ~ The Jasper News-%$'('&%'*:-?8)57 3""% +/%,(& ",;@A -A76!85)<78,BA76!85)A5 /)%%C>$ D$%*'9***************- 9#%*************=&/% ;9********************9 @&%%************,%(,-%%;@* ,&E 8&' E&"&'%&"* -3,/9C%%%C ;+$ +/%,(*;@ALetter to the Editor and Article Policy@/%%$#% ,B%%%""$""% ",&%%'&%'7** ** @/%&%#'%%)%" ##"%4' $%*+%* % "# $ ""%'#"** +$9<$%&%#'%%&) #)%"##"%*+ %* @%'#%%"(#* $F1&%* '&F%C;+$ +/%,(*;@A,BC85)A5* 582222-F The Florida Department of Community Affairs has made Community Development Block Grant funding available to Hamilton County for the rehabilitation or replacement of residential housing units located in the unincorporated areas of Hamilton County . Hamilton County has an ongoing Community Development Block Grant in the Housing Rehabilitation category and is accepting qualification packages from contractors who are state certified and interested in participating in the Community Development Block Grant Housing program. Minority and women owned businesses are encouraged to submit a qualification package in the program. Contractors that are currently qualified will remain qualified and need not reply. Request for qualification packages may be obtained from the County Coordinators Office, 1153 US Hwy. 41, Suite 2, Jasper, FL 32052, or from the Clerk of Courts Office, 207 NE 1st Street, Room 106, Jasper Florida 32052. Request for qualifications should be dropped off with or mailed to Mr. Danny Johnson, Hamilton County Coordinator, 1153 US Hwy. 41, Suite 2, Jasper FL, 32052. If you require additional information, please do not hesitate to contact Spencer Nabors at Fred Fox Enterprises Inc. (888) 223-9795. Hamilton County is a Fair Housing/Equal Opportunity/Handicap Access Jurisdiction583326FHAMILTON COUNTY COMMUNITY DEVELOPMENT BLOCK GRANT HOUSING REHABILITATION PROGRAM CONTRACTOR REQUEST FOR QUALIFICATIONSATTENTION GENERAL CONTRACTORS OPPORTUNITYEQUAL HOUSING %#'2&'&& 2&'&&$((% $,&&)&'@( %''%*9*## '%%9*@%#'$# %&&(&$") * ;%/%2&' %"'&%&$ "%=#@$&= ,&%,%<$ G2)$'H&$$# #"%(%&4 * "2&'#& (%""% &&*,%.) ,%<% $##%"%%'" "%* +'""'&"&$) @"''%;""%) &%%""* G&'$(' *#'%*'%%' $&&'H%* ,$&& "##'-"*-) (%&% &&&' 6#CA**3(7&& #"$%Hamilton County represented at recent legislative meeting SEEHAMILTON,PAGE8A
PAGE 5
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 5A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FL Suzie's FloristDelivering to Jasper, Jennings & White Springs daily 800-477-6370Mention this ad for free deliveryLive Oak 362-2776 Lake City 755-8606Since 1980580908-F 571609-F ADVENT CHRISTIAN BAPTIST (Southern) CHURCH OF CHRIST FIRST ADVENT CHRISTIANN.W. 15th Avenue Jasper Rev. Wayne Sullivan Sunday Sunday School.......................10:00 a.m. Morning Worship....................11:00 a.m. Wednesday Prayer Fellowship....................6:30 p.m.571612-F CALVARY BAPTIST CHURCH 792-2275 Sunday SundaySchool.....................10:00 a.m. Morning Worship...................11:00 a.m. Children's Church.................11:00 a.m. Church Training......................6:00 p.m. Evening Worship....................7:00 p.m. Wednesday Prayer Meeting.......................7:00 p.m.1/2 mile East on Hwy. 6, Jasper,Fl 32052571614-F NEW HOPE BAPTIST CHURCHSR 6 West, 6592 NW 48th St., Jennings, FL 32053 938-5611 Pastor:Jeff Cordero Sunday School................................10:00 a.m. Morning Worship.............................11:00 a.m. Sunday Evening Worship, Y outh Happening, RA's, GA's.........................................6:00 p.m. Wednesday Supper..............................................6:00 p.m. Prayer Meeting, Discipleship class for adults, Youth actvities, Children's Choirs.....6:30 p.m. Van pick-up upon request571613-F CHURCH OF CHRISTN.W. 3rd St., Jasper Bldg.: 792-2277 Sunday Sunday School.............................9:30 a.m. Morning Worship........................10:30 a.m. Evening Worship..........................6:00 p.m. Wednesday Evening........................................6:00 p.m.571615-F NON-DENOMINATIONAL BURNHAM CHRISTIAN CHURCH4520 NW CR 146, Jennings, FL 32053 938-1265 Pastor: Robert Carter Sunday Sunday School...............................9:45 a.m. Worship........................................11:00 a.m. Evening Service.............................6:00 p.m. Wednesday Prayer Meeting...............................7:00 p.m.571617-F To list your church on our church directory, please call Nancy at 1-800-525-4182To place your ad inside the Church Directory please call Louise at 386-792-2487 CATHOLIC CHURCH ST. THERESE CATHOLIC CHURCH Three miles north of Jasper U.S. 41 P.O. Box 890, Jasper, FL 32052 Rectory U.S. 90 E., Live Oak, FL (386) 364-1108 Sunday MASS 8:00 a.m.571623-F PRESBYTERIAN FIRST PRESBYTERIAN CHURCH204 N.W. 3rd Avenue, Jasper, 792-2258 Pastor: Rev. Parrish Jones, 792-8412 SUNDAY Sunday School ............................10:00 a.m. Worship Service...........................11:00 a.m. WEDNESDAY Prayer in Fellowship Hall...............9:00 a.m. Choir Practice................................7:00 p.m.571619-F PENTECOSTAL DELIVERANCE CENTER1394 McCall Street Jennings, FL 32053 Pastor Edgar C. Wood Sunday School............................10:00 a.m. Sunday Morning Worship............11:00 a.m. Sunday Night Worship...................6:00 p.m. Wednesday Night Worship............7:30 p.m.575935-F PENTECOSTAL FIRST UNITED METHODIST CHURCH405 Central Ave., Jasper, FL Pastor Dale Ames Phone 386-792-1122 Sunday Sunday School..............................9:45 a.m. Morning Worship.........................11:00 a.m. Wednesday Bible Study....................................4:45 p.m. Choir Practice................................6:00 p.m. Family Night Dinner 3rd Wednesday Clothes Closet 4th Saturday 1-5pm571616-F METHODIST !" #$"#%& "'())&&*()) &&!"$"' ()&&' !' '!" !+,& "-./"! ''''' 0'&1"" ,#))#/)') "& 2!3 !!& +"'" '4"& .)'5 &+""6 !7'8 '!'513 9: ;+<1!<=" < 3>< ?"@+4"A'0 *'B'!'!44!! '!!C "& ?! '" !!4!+ ?D'?1 2"B4"+,; 0'= :& "'& "4$"4 !", 5$"&3##))-%(#-&& 0$>, '&D)7E# '& 23'7B"$" & '7$ ?47"&2 '3'70$"& +!"!5 4 4"" !"!&0' ''" !4' 5& ?"!! '"&? 4" !"! !& ?! 8 "" '!5> !'&$!' "& +4"' 17" 9D7$ 1;;; F?G7" $!"! B&4 4 '4 '' !&? "!! ' '"& $40 ! " !"" &$ ' '"" 0 "& +4"' +B& !" = '& H"H!.()) &&"# &+*/-#=$%.& +! '!H'"H !"'& +' "!"' &;4I @$' ' ' 'JA;'' "@; '"" "8;K"! !"; "& LK '"' "&+ 6'"' '" '"F; (-G!" K" 9/ " ! &+ K ! K &; '#/ ') ! " @A @AF'G '< ,' '!@! A@"A 06' ' "@' !(&&&AF& (%G&9"E ' '"! &;E "!' 6 !F (G&L 6" ''M " !" 8'F; D'" 46' "' '' " ' "@ 'A!, &G& "! "'" "" "@;" !" '"&A +9< !0 '"#. #))&1' 4! 2 5"!2 "& $" !! & !.* -#129F%*G& + %)/? "# !/&& + '' '" &+ !K K'& !! -#)-)%&Thank YouBirth announcementBraxton Lee Wynn Re vi v al a t F r iendship Ba ptist Chur c h Present Yourself UntarnishedNew Hope Baptist Church will host annual "Share Saturday"clothes closetA special "fundraiser" thank youEternal Hope! Church of God to celebrate 97th year!Thank You
PAGE 6
!" #$%&'( ) *!"#+, -"+ !.) +"/01 1#( 2&"3 #)01 *'5,5678 3%+ *+01''3911 2+56+!5:6,2" :;<56=,,> /#. ?@,A +)9*A&" /=!% 3,9+ ,%%/* A$#B,8 /B863,& >5/#(&$:*)/1<,, 1&;; 9 .&6&6+=&& 2=1A)))A1A/,, *&;"/ .&6&6+=&& 2=1A)))A1A/,, *=.+ (6=+3$ "/.6,3" , 9'4'$, /6 9-C/956 &6+8!,+ =.,0 1A)1A11 D #0 '=>" 1 ',)= # .. ,,1 //,, ''3,?! @3", ,++ "CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 6A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FL 583213-FSee Kickin' Kevin from 98.1 Live from 10 a.m. 12 p.m. March 27 • 9 a.m. 1 p.m. 1722 S. Ohio Ave., Live Oak, FL • 362-1887 L-SERIES Standard TractorTo do the job right, you need the right tractor. The variety and versatility of Kukota's standard L-Series lineup lets you select what's perfect for you.L2800 L3400 L44002WD/4WD • PTO 25.0 HP • 8F/4R gear-drive transmission 2WD/4WD • PTO 30.0 HP • 8F/4R gear-drive transmission • Live continuous PTO 4WD • PTO 37.5 HP • 8F/4R gear-drive transmission • Full-flat deck • Hydraulic independent PTO • Hydrostatic power steering It's about relentless power...brute strength...lightning quick reflexes...creature comforts...add everthing up and what you've got is a zero-turn that's design-engineered to outwork and outlast practically any other machine out there...a zero-turn that's all about generating the kind of productivity that builds up a bottom line...not tears one down.Come in and visit with the newest Gravely dealer in North Florida and take a free test drive! See the entire lineup of lawncare products during our Open House on March 27th at our Live Oak location!260H XDZWE KEEP YOU CUTTING¨ NOTICE, is hereby given that the City of Jennings, Florida, will hold a City Election to fill two (2) City Council seats for full four (4) year term. The Qualifying Period will commence at noon, April 12, 2010 and will end at noon on April 16, 2010. Oaths may be secured at Jennings City Hall. The City Election will be held on Tuesday, June 1, 2010, between the hours of 7:00 AM and 7:00 PM. All voting will take place at Jennings Council Chambers. The books for registration to vote in this election will close on May 3, 2010. Christy Smith City Clerk583261FPUBLIC NOTICE OF CITY ELECTION Pentecostal Deliverance CenterLocated on McCall St. , Jennings, FL For more information call 386-590-6267March 19th at 7 p.m. ?+3"E@$" , %3F'333 "E" , ,,+,3G %3% ,?,, ,H,,, @#3"++ 6, $4""3 ""EG 3""," +3,3 3,"B C56*09*+.= , ,0 ?3I ", I"3 "+J+,"3%. 66E@ C .33 +=% 36,,E,( ,,E:"A
PAGE 7
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 7A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FL 573073-FContact Monja Slater at the Suwannee Democrat to advertise on zip2save.com 386-362-1734 • 1-800-525-4182 John's Painting Lottie's LaundryLottie's Laundry The Golden Needle Jasper News579396-F Pick a& save10%, 15% or 25%OFF any new subscriptionCome by our office at 105 2nd Ave., Jasper, pick a clover & save up to 25% off the regular price of a new subscription.New subscribers only386-792-248726 Weeks $9 in county; $13 out of county 52 Weeks $17 in county; $24 out of county !! " !! "# ! $ !$ " !% &'('$ )( ! $*+ !&''," ! $! $!$ " $./0"1 2$0""$0"3""$-4 !$! ! !!$ ! " ! ! ! ". # ! $ $!$ !"5 !$$ $ $! !"$ &**6 " 7 $ ! 84 "3 "9 $ $$ $ " 3/: )*;$ " $ """" < <<"=# ""! "/ """" <"" $$ "Be aware of circulating gastrointestinal illness caused by NorovirusFlorida Department of Health/ ! ! % %2>?:8$@ !($26" -5:. !" : : 2 2 ! ! A A >7 (A''"" ("# 55 " &"5 $!()(+$ " ;"2!$ !? ( " / / @ @ > > : : > > A A > (A''"" (" ! " &"0 ! " ;"; (A''"" :280+,&)B+(> +,&)B&, "Need Your High School Diploma?Attend Hamilton County School District's FREE ABE and GED Prep Courses
PAGE 8
!"# #$ %#!"# #! & '( )! ! ! )& *! +& ) + &CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 8A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FL 583546FIf you are concerned about the alcohol and drug issues in your community, now is the time to come, share your concerns, and become better informed. Opportunities to make positive changes will be made available. Presented by the Hamilton County Alcohol and Other Drug Prevention Coalition "Parents and Caring Community" Refreshments served immediately following meeting.Guest Speakers: Marvin Page, HCSO Illegal Drug Prevention/Enforcement Special Agent Rick Damon, A.B.T. Retail Compliance Checks/Enforcement Deputy Jeramie Cheshire, HCSO Community Policing Program/Enforcement Mona Paine, RN, Hamilton County Health Department Health Issues/Prevention/Treatment Elizabeth Mitchell, Social Worker, Hamilton Co. High Education Prevention in Schools Pastor Jerry Thomason, Hamilton Co., Ministerial Alliance Prevention/Education in the Faith Community Honorable Sonny Scaff, Hamilton County Judge Judicial Processes/Substance Abuse Grand Prize Wii Game System Meeting will be held Tuesday, March 23rd, 2010 at 6:30 p.m. at the Hamilton Co. Annex AuditoriumThe GRADE that BRINGS the MOST PARENTS will receive aPIZZA PARTY!!!DOOR PRIZES!!!The Hamilton County Alcohol and Other Drug Prevention Coalition is sponsoring a dynamic Town Meeting for your Community. The meeting will include a panel discussion concerning the alcohol and drug issues of Hamilton County.JasperTown Meeting NOW HAMILTON, SUWANNEE & LAFAYETTE COUNTIES Enjoy: * Arts & Crafts * Music & Dance by Florida Artists * Wagon Rides * Children's Activities * Great Food * Antique Cars * Little Miss Azalea * Wild Azalea Sale * Nature Hike * Suwannee River Duck RaceSaturday, March 20th 9 a.m. 4 p.m. In beautiful Downtown White Springs, FloridaPresented by The Town of White Springs and The State of Florida's Nature & Heritage Tourism CenterLocated on US 41, three miles east from I-75 and nine miles north from I-10For more information call: (386) 397-4461 ! , ---+-./+./ +0+ 0 +1++ 1 -+ -+ 2 */* / $0-$0 $30-$0 ./ ./ 0400 0 2 10-1 05&6! (!%78 995 !$8 :8$305&;!'5 -!58 5&;!5 !798 8 5&;!5. 1!";8%%#? *!+&0!+.8 8 5&;!/& @!! 8 5&;!$3! 8 5& #!<1! 7"8 7%3/%;-! $8 8040 5& #! !"#8%=##31 #7!$8 8 040 5& !10 -!%?8 #99> !$8 ! ! 8 040 5& "!+3( .!"=8"77 1< !.8 7 "#8 5& "!$' !""8 % 1 >.A #!. 8B C8 5& "!$ /!";8% ? '!! &&8 8$05& "!'5: '!$&!? 8% 71 ?!$8 8$05& %!3 1!%?8= % 1"9!< !+.8 ? -D*8 5& 7! $!"?80 <:;""!$8 8$05& 7!.! 7=80<: 9 9!$8 8+0 5& 7!. $(>(!"#8 "= >!$ 8 E8 +0Arrest Reports Jasper LegalsIN THE CIRCUIT COURT OF THE 3RD JUDICIAL CIRCUIT,IN AND FOR HAMILTON COUNTY,FLORIDA CIVIL DIVISION CASE NO.:24-2010-CA-000034 SUNTRUST MORTGAGE,INC., Plaintiff, Vs. JONATHAN A.MOODY,et al, Defendants. NOTICE OF ACTION TO: JONATHAN A.MOODY Last Known Address:5766 SW 61st Avenue, Jasper, FL 32052 Also Attempted At:14555 98th Pl., Live Oak, FL 32060 Current Residence Unknown YOU ARE NOTIFIED that an action for foreclosure of Mortgage on the following described property: A piece or parcel of land in the Northwest 1/4 of the Southeast 1/4 of Section 22,Township 1 North,Range 12 East,Hamilton County,Florida,described as follows:Commence at the approximate location of Southwest corner of Northwest 1/4 of the Southeast 1/4 of said Section 22 run in an Easterly direction along the centerline of County Road a distance of 25 feet; thence North a distance of 435 feet to the Southwest corner of hereinafter described tract to Point of Beginning; thence continue North a distance of 210 feet;thence North 89¡25'East a distance of 210 feet;thence South a distance of 210 feet;thence South 89¡25'West a distance of 210 feet to Point of Beginning;ALSO a 25 foot easement from point 210 feet East of the Southwest corner of the Northwest 1/4 of the Southeast 1/4 of Section 22, Township 1 North,Range 12 East,on the North edge of the county road Right-of way;thence running North to the Southeast corner of the above described property. Has been filed against you and you are required to serve a copy of your written defenses, if any, to it, on Marshall C.Watson, P.A., Attorney for Plaintiff, whose address is 1800 NW 49th STREET, SUITE 120, FT, LAUDERDALE, FL 33309 on or before April 11, 2010, a date which is within thirty (30) days after the first publication of this Notice in the Jasper News and file the original with the Clerk of this Court either before service on Plaintiff's attorney or immediately thereafter;otherwise a default will be entered against you for the relief demanded in the complaint. If you are a person with a disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance.Please contact, Clerk of Circuit Court, 207 N.E.First Street, Room 106, Jasper, Florida 32052 (386) 792-1288, within 2 working days of your receipt of this document;if you are hearing or voice impaired, call 1-800-9558771. WITNESS my hand and the seal of this Court this 26th day of February, 2010. (Court Seal) Greg Godwin As Clerk of the Court By:/s/Cynthia Johnson As Deputy Clerk 03/11, 03/18 IN THE CIRCUIT COURT OF THE THIRD JUDICIAL CIRCUIT,IN AND FOR HAMILTON COUNTY,FLORIDA PROBATE DIVISION CASE NO.10-07-CP IN RE:THE ESTATE OF: PATRICK F.M.MARR Deceased. NOTICE TO CREDITORS TO ALL PERSONS HAVING CLAIMS OR DEMANDS AGAINST THE ABOVE ESTATE: Within three months from the time of the first publication of this notice, you are required to file with the Clerk of the Circuit Court of Hamilton County, Florida, Probate Division, the address of which is Hamilton County, Jasper, Florida a written and verified statement of any claim or demand you may have against the estate of PATRICK F.M.MARR. Each claim must be in writing and must indicate the basis for the claim, the name and address of the creditor or his agent or attorney, and the amount claimed.If the claim is not yet due, the date when it will become due shall be stated.If the claim is contingent or unliquidated, the nature of the uncertainty shall be stated.If the claim is secured, the security shall be described.The claimant shall deliver a copy of the claim to the clerk who shall furnish a copy to the personal representative. ALL CLAIMS AND DEMANDS NOT SO FILED WILL BE FOREVER BARRED. Dated this 22nd day of February, 2010. /s/Frank Marr FRANK MARR Personal Representative /s/Ken Marr KEN MARR Personal Representative /s/Donald K.Rudser Donald K.Rudser Fla.Bar No.120735 P.O.Box 948 Jasper, Florida 32052 (386) 792-1933 Attorney for Personal Representative 03/11, 03/18 LEGAL NOTICE The Suwannee River Economic Council, Inc.Board of Directors will hold a meeting of the Board of Directors on Monday, March 29,2010,7:00 P.M. at the Suwannee River Economic Council, Inc., Senior Center in Live Oak, Florida. 3/18 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 856.09, FLORIDA STATUES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under the fictitious name of Mazie's Coin Laundry & Car Wash located at:1342 Oak Street, Jennings, FL in the County of Hamilton in the City of Jennings, Florida 32053 intends to register the said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Name:Mazel Spencer Address:4764 NW CR 141 Jennings, FL 32053 Dated this 9th day of March, 2010. 03/18 NOTICE OF HEARING The Hamilton County School Board will conduct a public hearing on Monday, April 12, 2010.It will begin at 5:30 p.m.in the Board Room of the school district administration building in Jasper, Florida.The purpose of the hearing is to consider changes to the following school board policies: 2.05 Board Meetings Revised 3.40 Animals on Campus New 4.12 Instructional Materials Selection Revised 5.30 Special Dietary Needs New 6.78 Social Security Numbers Revised 7.141 Selecting Professional Services Revised Reason for changes:various Authority:1001.41, 1001.42, F.S. Estimated economic impact:minimum A complete copy of these rules are available for review at the office of the Superintendent of Schools;Jasper, Florida. HAMILTON COUNTY SCHOOL BOARD By:/s/Martha Butler Martha Butler Superintendent If a person decides to appeal any decision made by the Board, with respect to any matter considered at this hearing, that person will need a record of the proceedings;and for such purpose that person may need to ensure that a verbatim record of the proceedings is made, which record includes the testimony and evidence upon which the appeal is to be based. 03/18 IN THE COUNTY COURT, IN AND FOR HAMILTON COUNTY,FLORIDA CASE NO.06-169-CC JERRY R.MORGAN Plaintiff, Vs. MILDRED S.BELLFLOWER, Defendant. NOTICE OF PUBLIC SALE Notice is hereby given that the following described property: Lot 2,Block 16,according to Reneau's Survey of the Town of White Springs, Florida in Section 7,Township 2 South, Range 16 East,HAMILTON County, Florida Shall be sold by the Clerk of this Court, at public sale, pursuant to the Final Judgment in the above styled action dated March 10, 2010, at the Hamilton County Courthouse in Jasper, Hamilton County, Florida, at 11:00 A.M., on Thursday, April 15, 2010, to the best and highest bidder for cash.Any person claiming an interest in any surplus from the sale, other than the property owner as of the date of the notice of lis pendens, must file a claim within 60 days after the sale. WITNESS my hand and official seal in the State and County aforesaid this 10th day of March, 2010. (Court Seal) GREG GODWIN Clerk of Court By /s/ Cynthia Johnson As Deputy Clerk 03/18, 03/25Driver license and vehicle inspection checkpoints& . & +< & +< ( +&5 !### &+07 ,D7 !' 7?!31 =!'9? ! '"?!'=1!'=/! ' 7 !' 7%!'? ! '"7;' ";&Hamilton County represented
PAGE 9
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 9A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FL 584138-F EARNHARDT&SONS UPHOLSTERYPriceincludesfabric&labor. Morethan300fabricstoselectfrom!Pricealsoincludesspring&framerepairs, newpaddingaddedtoentirepiece. Newcushionfoamisextraifneeded. NOSeconds€ NOClose-OutsALLFirstQualityMaterial.EARNHARDT&SONSUPHOLSTERY MADISON,FLORIDA1-850-973-6006OR1-850-973-4667 Sofa&Chair Upholsteredin any fabricwestock!$48900 MarchSpecial583733jrv NOGIMMICKSÂIpersonallyguaranteeallworktosuityouÂŽNOTRICKS work.ÂŽ Time to get dirty. Located just off I-75 on North US 129 a few miles outside of Jasper, Mud Fest is a place where 16-year-olds run their shiny new birthday presents through the pit, men cake their classics with inches of muck and others take their ATVs for a swim. The bog will host its next weekend of dirty deepSouth, down-home entertainment April 24. Admission is $10 a day or $15 for the weekend and kids under 10 get in free. Primitive camping and restroom facilities are also available. Trucks are only allowed to bog during the day. However, ATVs can ride day and night.Continued From Page 1AMudslingersA new place to play in HamiltonWorkshop to aid local veterans seeking workSubmitted The U.S. Bureau of Labor Statistics reported Friday the unemployment rate for military veterans who served in the military since September 2001 (Gulf War-era II Veterans) was 10.2 percent in 2009. The jobless rate for all Veterans of all eras combined was 8.1 percent. While not as high as the overall unemployment rate, the Veteran population faces its own challenges. Nearly 21 percent of Gulf War-era II Veterans reported having a serviceconnected disability in August 2009, compared with close to 13 percent of all Veterans. Veterans in North Florida are suffering from many of the affects of the current economic conditions that afflict the rest of the nation. However, even in this recessionary situation there is opportunity to grow and flourish. Organizations are here to assist Veterans in many different facets of life, including employment. An example is the Local Veterans Employment Representative (LVER) and the Disabled Veterans Outreach Program (DVOP) specialist, who act as a focal point by assisting Veterans in the region seeking employment services and are housed at Workforce. They help connect employers and qualified Veterans looking for work. Additionally, they refer qualifying Veterans to agencies from the County Veteran Service Officer to the US Department of Veteran Affairs for services not available through Workforce. These employment services are available to all qualifying Veterans, including those who are incarcerated and formerly incarcerated. On March 31, WorkforceÂs Veterans Services Department will hold an Employment Workshop for Veterans and their dependants in Jasper at the County Administrative Complex (the old high school). Here, Veterans will learn how to plan, strategize, and energize their job search to accentuate their positive experiences. To participate, call 866-367-4758 or 877-677-7573. Space is limited for this event, so Veterans are encouraged to call today to ensure their seat. contracts ranging from construction to communications. ÂMy primary reason for recommending this grant is the large number of high-tech, high-paying jobs it will facilitate,ÂŽ said Scott in a written proposal to the board. Smith recommended a grant of $525,000 for Scout Industries. ÂYou donÂt typically see high-tech business looking to come to this area,ÂŽ he told the board. Smith also presented a grant request of $500,000 from LoveÂs Travel Stops and Country Stores, Inc. LoveÂs is a truck-stop chain which would bring a McDonaldÂs and a ChesterÂs Fried Chicken as well as more than 50 jobs, said Smith. The final request was from Smalltown Broadcasting, LLC, a radio-media company owned and operated by Scott James. James owns three FM stations in Georgia and has already received the license for an FM talk-radio station in Hamilton County. Smith asked the board to award a grant of $125,000 to be paid out over two years. ÂAwarding this grant is an attempt to create a sense of viability,ÂŽ said Smith. ÂI cannot overemphasize the importance of this concept of viability and its psychological impact on both employers and employees considering relocating to our area. After his presentation, commissioners congratulated Smith for Âhitting the ground runningÂŽ after only eight weeks as Executive Director of Economic Development. Some expressed concern over the amount of grant money requested, however. ÂWhen the money runs out, where do we go from there?ÂŽ asked Commissioner Buster Oxendine. ÂThe money is there to create jobs,ÂŽ said Smith. ÂWe need them more than ever.ÂŽ ÂAt worst this is a sincere effort, at best an educated effort,ÂŽ he assured the board. After much discussion Commissioner Mike Adams said, ÂIÂm not afraid to spend that money, thatÂs why they give it to us.ÂŽ Still, the board decided to withhold a final decision for now and agreed to further discuss the requests at the next board meeting in April.Continued From Page 1ACOUNTY COMMISSIONHigh-tech firm, truck stop, radio station considering HamiltonDeniseÂs brother Jerry Keith said he came up with the idea after it became difficult to find good places to bog legally in his native Pasco County. Jerry and his family have always been ÂmudslingersÂŽ and were now in need of fresh territory to slog through. ÂItÂs actually a pretty popular and growing sport,ÂŽ said Jerry. With the dwindling availability of good, legal bogging, Jerry said he decided to find the ultimate new, extreme bog spot, and has since turned this endeavor into a business. Since planting their tires in Jasper, Jerry and his family have worked to spread the word and create a local attraction which Jerry says could help boost the local economy. ÂThis has the potential to bring a lot of revenue into Hamilton County,ÂŽ said Jerry. If all goes well, Jerry said they may eventually expand the bog or even open another. ÂWe just need the help of the county and the community to get the word out,ÂŽ he said. So, ready to get some mud on your tires? YouÂve come to the right place. Now letÂs see if you can handle our bog, says the Keith family. JASPER MARCH 31
PAGE 10
! " ! # $%% !!% !!! % &&%! && # !% ! '"( ') $*& !# '+ &! %& & ! ,-"./# %0 +!! %& ! ! 1 +%%! !# $% !! !+! "234&5# !"(3& !%% & 6 $*& $ $ ! %! !++%% !! $%& $1 %6 # ! %& 7$,% $ %%% ! $%%& # !68 $!$!% $!! ! # #9& !* &*".: $!! &$ %:%% %! ;! # # %% !! !3" ;%% ,% %# ;# *! <(."#2)""& %& ! !2( & *% $$!!CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 10A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FL Little Miss Contestants: first rowElizabeth Smith, Taylor Smith, Brayden White, Mal'lesha Jones, Jenna Tolle, Brooke Howell, Maeghan White and Logan McCulley (not in photo). Jr. Miss Contestants: second rowAlyssa Culbreth, Mackenzie Prueter, Laura Valdez. Miss Contestants: back rowMadison Cox, Chasity Arnold, Callie Adams, Sabrina McClain, Mary Prueter and Cassidy Byrd (not in photo). Photo submitted " ! '# &*=,$ $"%> 4!$$ ?!%# %# % &% .(3=.(.4 &%.(.5# %.(245# #%.((=.(3 !!@ # $$% ! %*= % $ *! % $ .A'# A'!% "AB" &*= 4,>09,CC0CD& !!:# % %*$!@% ! 1$% >/!/?/# !-$ ;%% !!%#! # !%$ $!& % $# %% ! $!% ,( %-%0# !/!! %%# %# %*!! *&!% # ;#%%$# !!# ! %! &$ %%$! $!# +%!# &%# ! # %# ! $9/!# %%# %1 &%% E ,$ ! * F* *%!D !%%$G 5%% %% !%% %%%"H?# ! % &% *! % % %&& !!% ! , *%%% %## * *? % * !% %! %%% ## % # !! ?/# 1$%& / $% ;$ $!%%$ E:$ * # %!! G!! % ;%# $$ 1! ;#!! ;!@ %% $ E&! %!# %$ I %,*!!!G !! !! ;! # E,//!*% ,* *$% G !! /!!$ # !1$% &*F %% $! !/! *C ?/% 1 %% C# % %%# $ % ! UF researchers find cancer-fighting properties in papaya tea30th Hamilton County Track & Field Invitational sponsored by First Federal Savings BankNHE's PTO presents the 20th Annual Beauty Pageant March 20 >0# ;?& " ?! E//! JG" "2KB'L ,% !%$! M? ;! Congratulations to Alex Bowles! & /!?$ !& ! %&! ! !%# @@ @!!@% :! !$ !$5% $% !! &! "' 2A' ,%# !# # % *$! $Jasper Town Meeting Martha Butler and Alex Bowles
PAGE 11
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 11A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FL 583461FThe Jasper News will publish a full page, full colorEaster Services Directoryin the March 25, edition. Please call 386-792-2487 to place your Easter Services information in the Directory. Cost is only $15 for a 2 column x 3" space. Room enough for additional church info if you would like to add that as well! Deadline is 5 p.m. on Monday, March 22.Attention Area Churches 582774-F JasperCLASSIFIEDS570761-FAdvertise your YARD SALE, VEHICLES OR UNWANTED ITEMS IN THE CLASSIFIEDS. Call 386-792-2487 to place your ad today. FROM OUR READERSTo the Editor: Recently the City of Jasper held elections for two seats on the city council. There were a total of 27 votes cast in one district and none in the other. For the second term in a row no one ran against Ms. Kathy Avriett in district 5. While Ms. Avriett is a fine person and does her best on the council I find it appalling that she has been unopposed since being appointed to the seat over two terms ago. Since I have heard criticism of her by people living in her district I do not believe that she is universally loved by all. Yet no one, it seems, has either the will or the nerve to run against her. In district 1 Mr. LaBarfield Bryant won the election in a 14 to 13 vote. I guess there are only 27 people in his district that care who represent them. Then immediately after being sworn in Mr. Bryant was elected chairman of the city council. He made the comment later that he wished he had been given the opportunity to learn the job before being elected chair. Am I naïve to expect that someone running for public office, especially city council, would have some idea of what the job was and the issues before the council? I have attended many of the meetings over the last 6 years and do not remember ever seeing any of the current council members in the audience prior to their being elected. Yet they all felt qualified to run for the office. Of the five council members only one, Elaine Rozier, has any prior government experience. She has done, in my opinion, a good job representing her district and trying to solve the problems of the city. She has also been a champion of the peopleÂs right to speak at the meetings in the face of at least two members trying to stifle all public input. While I sympathize with Mr. BryantÂs position, had he bothered to attend even a couple of meetings before he was elected he would have had an idea what was going on and possibly been able to conduct the meeting with some order and dignity. One of the items brought up at the meeting was people leaving their city mandated garbage cans out too long. It seems that there are those in Jasper who would like it to be like The Villages or Palm Beach where every facet of life is regulated by ordinance. The voice of reason, in the form of City Manager Larry Cail, brought to light that the cans were too large and cumbersome for many of the senior citizens to bring in easily. Add to that the fact that many of us work and cannot bring them in until we get home and you can see how foolish such an ordinance would be. Yet it was discussed, even as the bigger problems of an aging infrastructure and road repairs were ignored. Aside from an apparent lack of knowledge of the purpose of government under our Constitution and inexperience in governmental affairs from most of our council the biggest concern I have is the lack of attendance by the public. Rarely have I seen more then ten or fifteen people attend a council meeting and at some meetings as few as three or four have attended. When there is a highly charged issue, such as the proposed sale of the downtown park was, there is a turnout. But once that issue is solved everyone goes home until the next big issue. In the meantime the council passes ordinances and taxes that affect every resident of the town. One cannot help but feel that the people of Jasper, by their lack of concern and attendance, are pleased with the workings of the council. This either speaks well of the council or poorly of the residents. Does anyone know which? Robert I. Clark JasperBy Stephenie Livingstonstephenie.livingston@gaflnews.comAdage said Monday it would suspend work on the proposed biofuel project in Gadsden County, a plant similar to the one in the works for Hamilton County. A biofuel joint venture owned by affiliates of Duke Energy and AREVA, ADAGE had proposed to construct a 55 megawatt advanced biofuel facility in Gretna, utilizing sustainable clean woody biomass. The company said in a press release that it respects the decision of the city of Gretna to continue to study the project. ÂWe recognize that work still needs to be done in the local community to fully implement the master plan for economic development,ÂŽ the release said. ÂHowever, Adage firmly believes that further study will reinforce that the project would represent a safe, sustainable renewable energy solution that meets all local, State and National standards while delivering new jobs and economic opportunity.ÂŽ As was the case in Hamilton County, Adage was attracted to the vibrant forest resources in Gadsden County, according to the press release. ÂWe believe that Gadsden County represents a good market for development of sustainable woody biomass projects,ÂŽ the release said, Âhowever in light of the decision today by the City of Gretna to delay consideration of the project, Adage will suspend work on the Gadsden County project and focus on continuing to develop a fleet of clean, safe, reliable biopower projects throughout the U.S.ÂŽ said a statement by Adage. The Florida Department of Environmental Protection will now be asked to suspend activity on the Air Resource Permit Application for the Gadsden County project. Adage said it would continue to actively develop the project in Hamilton County, which has already received full approval at the state and local level.Gadsden biofuel plant put on holdProject similar to the one planned for Hamilton Visitors can listen to the sounds of music as they stroll through historic downtown White Springs. Kitty Tolson Carroll will provide an entertaining and educational birds of prey demonstration featuring the ancient art of falconry using freeflying falcons, owls and hawks. The Nature and Heritage Tourism Center is located on CR 136 and US 41 in downtown White Springs. This event is free and begins at 9 a.m. Admission to the Stephen Foster Folk Culture Center State Park is $5 per vehicle with up to eight passengers. For more information please call Bob Giarda at 386-397-4478 or visit www.floridastateparks.org/ stephenfoster.Continued From Page 2ATenth annual Wild Azalea Festival set for Saturday
PAGE 12
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 12A THURSDAY, MARCH 18, 2010 THE JASPER NEWS , Jasper, FL 584545F
PAGE 13
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North FloridaNorth Florida FocusSpirt of the Suwannee Music Park:Miss Marie's Kids, Mercy Mountain Boys to take the stage, Page 2 News • Entertainment • Classifieds March 17 & 18, 2010Serving Hamilton, Lafayette and Suwannee Counties www.nflonline.com WWW.NOBLESGREENHOUSE.COM 570600-F 9248 129th Road • Live Oak (386) 362-2333 Mon.-Fri. 8:30 a.m.-6:00 p.m. Saturday 8:30 a.m.-5:00 p.m. Sunday 12:30 p.m.-4:30 p.m. "For over 30 Years"THE STAR OF THE SPRING FLOWER SHOW IS AZALEAS!From cooking, to aroma therapy, to insect control herbs have lots of great uses! They can be planted almost anywhere and are beautiful growing right along side your flowering plants! DISCOVER THE JOY OF HERBS!Spring in all its glory wouldn't be complete with out azaleas! They're the perfect low maintenance blooming shrub for shady areas. Plant some today and you'll be rewarded with masses of spring flowers year after year!#1 pot azaleas only $4.99 570742-F ATTENTION!Dial's Inspection ServicesFor All Your Home Inspection Needs! 386-364-4434 or 386-590-6534Please visit our website: www.suwanneevalleyinspections.com 127 Howard Street E., Live Oak, FL Phone: 386-362-4539 Toll Free: 1-800-557-7478 Se Habla Espanol EMAIL: info@poolerealty.comHours: Mon. Fri. 8 a.m. 5:30 p.m.; Saturday 9:00 a.m. 3:00 p.m.; Sunday by appointment PRICE REDUCEDhome with 2,700 sq.ft and 3 bedroom, 2 bath. Home is near town in Mayo, very nice. $185,900. Call for more information today, 386-362-4539. MLS#73375 GREAT Starter Home. 3/2 brick home on just over an acre, paved road, large oaks, fenced area for horse. Needs TLC. Super deal at $67,500. Call Vicki Prickitt, 386-590-1402 MLS#70947569603-FLOCATED ON HWY 535 acres. Approx two miles from the Suwannee River and public boat ramp. This property is cleared and fenced with a pond that was started but not finished. Asking $35,000. Call Anita Handy, 386-208-5877 MLS#73024 $85,0003/2, 1344 sq.ft. concrete block home located near the Advent Christian Village with screened back porch. Call Ronnie Poole, 386-2083175 for more information MLS#73216 NOW IS THE TIME TO BUYÉ This 2br, 2 bath home just minutes from town. Owners have not finished the master bedroom addition, so you can design it around your needs. Home is landscaped, workshop, & 2 car carport on 1.5 acres. $119,000. Call Kellie Shirah, 386-208-3847 MLS#73604 PRICE REDUCED! RIVERFRONT lot on the Suwannee River. Approx 5 miles from I-10 close to the Spirit of Suwannee Music Park. Now $39,000. Call Sylvia Newell, 590-2498 MLS#58514 VERY PRETTY 5 acres nestled amongst large & small oaks with private pond. Property has well, septic, & power pole. Just needs a little clean-up from the previous mobile home. Asking $35,000. Call Ric Donovan, 5901298 MLS#73690 COUNTRY LIVING at it's best close to Live Oak. This 3/2 home is constructed well. The floor plan is very open with 22ft ceilings, kitchen, dining room, great room. A plus is the 14x24 workshop, 12x14 storage, and 16x22 shelter. A must see! $259,000. Call Sherrel McCall, 386-688-7563 MLS#73721 TURN-KEY HORSE FARM: Make an offer before prices go up again. 30 Acres or more with creek, barn, improved pasture with seperate paddocks, 4BR/2BA Brick home with solar powered enterance gate! $350,000. Call Cathy Collins 386-208-4150 MLS#72659 FIELDS OF McAlpin.. 10 ac. (Lot 21, Phase 5), 176th St., flag lot, great country location MF homes allowed, $34,900. Call Glenda McCall, 386208-544 MLS#69827 GOOD INVESTMENT PR OPERTY, hard wood floors could be beautiful with some attention. close to schools, great neighborhodd. Lot has several mature grape vines and a pecan tree. Bring all offers. $45,000. Call David Mincey, 590-0157 MLS#70709 $69,000É will buy this 4/2 home on .77 acres. Spacious kitchen, living & dining room have hardwood flooring, family room & 2 baths. Has attached carport, laundry room & storage area. Call Kellie Shirah, 386-208-3847 MLS#74046 5 ACRES of planted pines at a great price with lots of privacy for you. Only $19,500. Call Sylvia Newell, 590-2498 MLS#73635 PERFECT LOCATION TO GET AWAY FROM EVERYTHING... Holly Point, 100 ft. on Withlacoochee River, owner will finance after $20,000. down, 15 yrs, 6% int., 5 yr. balloon, $47,000. Call Glenda McCall, 386-208-5244 MLS#68322 160 ACRES1/2 mile of paved road frontage, 10" irrigation well. Priced at $2,750 per acre. Call Ronnie Poole, 386-208-3175. MLS#71567 BANK OWNED MADISON Attention, quilters and quilt owners. North Florida Community College is seeking entries for its annual quilt show. Quilts will be displayed at the Wardlaw-Smith-Goza Conference Center in Madison, Florida in conjunction with Madison County's "Down Home Days" celebration April 17. The exhibit will be open to the public with free admission Saturday, April 17 from 10 a.m.-3 p.m.; Sunday, April 18 from 1-5 p.m.; and Monday, April 19 from 10 a.m.-3 p.m. Show organizers are calling on area quilt owners to display handmade quilts whether new or old, a treasured heirloom or a recent gift. Quilts will be displayed on the first and second floors of the historic WSG Conference Center, known locally as The Mansion. The Madison County Garden Club will also host a National Garden Club level flower show entitled "Around the World with Quilts and Flowers" at The Mansion to compliment the quilt show April 17-19. Don't miss this opportunity to show off your quilted treasures. Applications to enter a quilt or multiple quilts in NFCC's ANNUALQUILTSHOW are available by calling Maria Greene, WSG Conference Center Coordinator, at (850) 973-9432 or email GreeneM@nfcc.edu. If you've caught Spring fever, it's likely you're looking for just the thing to spruce up your garden, your home or yourself. You can find it all at the Calico Arts and Crafts Show in Moultrie, Ga. Make your backyard a main attraction with an unforgettable, handmade birdhouse or birdfeeder salvaged from old barn wood and pine furniture by Charles Bush, Damascus, Ga. You can compliment it with a seasonal wreath or floral arrangement from Jeannie and Frances Routh of Moultrie, GAwho will have a variety of vivid colored wreaths in store for you. Bring nature indoors with a handpainted window by Stathia Hammond of Southport, N.C. and see charming scenery through her eyes. Ladies can add a twist to their wardrobe with any of Calico Arts and Crafts Show coming to Moultrie this weekendA handmade birdhouse, complete with steeple. Courtesy photoCalling all quiltersNFCC seeks entries for annual show The NFCC Quilt Show is an annual event at the Wardlaw-Smith-Goza Conference Center. Courtesy photo The 2010 Calico Spring Arts and Crafts Show is set for Saturday and Sunday. Hours are Saturday 9 a.m. to 5 p.m. and 10 a.m. to 4 p.m. on Sunday. Adult admission is $5. There is free parking for all and free admission for children 12 and under. For more information, visit www.calicocrafts.com. GREAT RATES FOR NICE LOOKING RENTALS STARTING AT $300 PER MONTH FOR SINGLEWIDES AND $450 PER MONTH FOR DOUBLEWIDES. WATER, SEWER, AND GARBAGE INCLUDED. NO PETS. 386-330-2567-FOR RENT-569597-F SEEREADY,PAGE3
PAGE 14
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 2,MARCH 17 & 18,2010 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA S.C. Sullivan Agency 529 S. Ohio Ave., Live Oak, FL Bus. 386-362-1389 Fax: (386) 362-6131 S.C. Sullivan (386) 362-1389, Evening 362-2990 582647-F (1) Horse Farm: 55 acres with a 5 bedroom, 3 bath CH&AC home with fireplace cont. approx. 5000 sq. feet under roof with an 18 stall horse barn with office and bath cont. approx. 5000 sq. ft. under roof. The property has 4 fenced paddocks with room for expansion. Approx. 3 miles from I75. Call for more information. Just listed $599,999. (2) Off CR 49 5 acres in grass with scattered tr ees, fenced on 3 sides with survey. Only $4,900 per acre. (3) 161st Rd: 9.82 acres partially wooded with a 4BR/3-1/2 bath CH&AC home with fireplace cont. approx 2400 sq. ft. heated area, 10'x30' storage. REDUCED TO $260,000 . (4) Off CR136: 5 acre partially wooded some grass. Will work for land home package. Reduced to $39,900. (5) CR 51 & Pinewood St.: 2.29 Acres, city water and sewer, zoned office. Good location $192,500. (6)Off CR 349: 10 acre wooded tract with a two bedroom CH/AC log home in excellent condition cont. approx. 1200 sq. ft. under roof, 30'x40' pole barn. REDUCED TO $145,900 . (7) 410 Dexter: Corner lot with CH/AC brick home in good condition. Approx. 2,000 sq. ft. under roof with 2 car garage, kitchen furnished, large pool with privacy fence. Good location. Good Buy @ $135,000.. (8) Industrial Park: 1.13 acre corner tract good exposure. Reduced to $34,500. (9) 40 acres with 835 ft. on paved road in 13 year old planted pines. Priced to sell at REDUCED TO $179,600 . (10) Near City: 2 ac. with 3/2 home cont. approx. 1280 sq. ft. under roof, kitchen furnished, car port. REDUCED TO $49,000 . (11) Lura ville Ar ea: Fly-in Community 15 acre wooded large trees, good county road. Priced to sell reduced to $74,900. (12) Suwannee River: Two acres wooded river lot off CR 349 near Royal Springs and Boat Ramp. 100 sq. ft. on the water. (Buildable) good buy @ $55,000. (13) Off Mitchell Rd.: 20 acres wooded with survey on 199th Rd.$89,900. (14) Hamilton Co.: 10 acres on CR751 and the river approx. 1300 ft. on the water and approx. 1300 ft. on paved road. Priced to sell at REDUCED TO $72,000 . (15) Madison Co.: 40 acres in 16 year old slash planted pines off CR 255 good elevation. Good buy at $175,000. (16) Suwannee River home: nice two bedroom two story CH&AC home South of Branford, kitchen furnished, beautiful view of river from rear, screen porch. Good area. REDUCED TO $168,000 . (17) Farms of 10 Mill Hollow: 4 acres in grass/cr opland with scattered trees. $32,500. (18) Near City: Off US 90 East 5 acres wooded near golf course. Good buy @ $44,900. (19) 190th St.: 10 acres in planted pines approx. 15 years old, with a 3/1 CH/AC SWMH, 2 car carport/shop. Priced to sell @ $49,000. (20) 208 Houston: 3/5 BR, 1-1/2 BA frame home cont. approx. 2,000 sq. ft. under roof. Zoned R/O, has potential. Priced to sell @ $59,500. (21) Keaton Beach: Deep W ater Canal lot near public boat ramp, sewer & water. Good buy @ $125,000. (22) 169th Rd.: 5 ac. in grass with a 3/2 CH/AC DWMH cont. approx. 1,850 sq. ft. under roof in excellent cond. 2 car detached garage. Good area. REDUCED TO $119,500 . (23) Off 16th St.: 2 100x530 river lots with MH (needs some R&R), well, septic and storage b uilding. Lot has large hickory white oak magnolia. Well above the flood elevation. $79,900 for the pair. (24) 193rd Rd.: 6.59 acres wooded on paved road. Good area. Good buy @ $37,500. (25) Hamilton County: 40 acre wooded on county road. Good hunting area that adjoins SRWMD. $149,500. (26) New 3 bedroom, 2 bath CH/AC home. City sewer & water, privacy fence. Good Buy @ $95,000. (27) Off CR 249: 3 wooded lots, will work for mobile homes, on county road. Good buy @ $12,600 for all three. 582444-F It's an exciting weekend coming up at the Spirit of the Suwannee Music Park with Miss Marie's Kids from Jacksonville featuring some of the most talented kids in North Florida Friday night and Saturday night the ever popular Mercy Mountain Boys. Make plans now to be there both nights, March 19 -20, to enjoy these talented performers. It's a weekend not to be missed. On March 19 Miss Marie, a former singer and recording artist who had her own band and TVshow at age 13 and toured for more than 20 years, brings her array of talented kids to the SOSMP stage. Miss Marie has been polishing talented kids'performances for years. Taking the stage Friday night could possibly be The Frosted Flakes, a threesome of Courtney Loftus, Hayley Moran and Jessica Warner who will thrill you with their talent. Other Miss Marie's Kids who could perform are Cortnie Frazier, Connor Blackley, Heather Dockery and Kelcie McClary. Don't miss these talented kids who will entertain you with their talent and vibrant performances. Saturday night, March 20, the Mercy Mountain Boys are back with their wonderful bluegrass and gospel music. This group has traveled all over the South performing, won many awards and has become one of the favorites of the SOSMP Music Hall guests. Doors to the Music Hall open at 5 p.m. for dinner, shows begin at 7 p.m. Admission Friday night is $5. However, on Friday nights your $5 admission cost can be deducted from your food and beverage ticket. Admission Saturday night is $10.Miss Marie's Kids, Mercy Mountain Boysto take the stage at the Spirit Miss Marie's Kids:Cortnie Frazier Kelcie McClary Connor Blackley Heather Dockery The Mercy Mountain Boys. Courtesy photos
PAGE 15
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida MARCH 17 & 18,2010,PAGE 3 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA Saturday,April10;7:00am-1:00pm LowndesCountyCivicCenter Hwy84EastValdostaCalltodaytoreserveyourboothspace! Limitednumberofspacesavailable.InsideSpaces–$35.00each OutsideSpaces(Covered)–$25each CalltheClassifiedMarketplacetofindoutmore!229-244-1880229-244-34001-800-600-4838 201N.TroupStreet,Valdosta578953cpv SATURDAY, MARCH 27 We Stand BehindEVER Y LA WN MOWERWe Sell! * Quic k and Easy FINANCE At Johns, you get "MOW" for your money! THE LOWEST PRICESON BRAND NEW 2010 LAWN & GARDEN MACHINERY IN NORTH FLORIDA! PRICED HUNDREDS BELOW MSRP!OPEN HOUSE SATURDAY, MARCH 27, 9 a.m. 3 p.m.1701 N. Ohio Ave. (US 129) Live Oak 362-5020 or 800-648-2856 Reg. Hours: Mon.-Fri. 7 a.m.-5:30 p.m.; Sat. 7 a.m.-12 p.m. FACTORY REPS ON SITE ALL DAY LONG! 582435-F STOP BY AND SEE PRO ARMS IN THEIR NEW FACILITY! SATURDAY, MARCH 27Terms up to 36 months!FINANCING! 0% the accessories available from Hollywood, S.C. crafter Caroline Sandlin. The Carolina native makes rustic, casual style jewelry by combining her own handcrafted pottery beads, with a variety of other items that include stone beads, African recycled glass beads, ethnic wood and bone beads, shells, and coral. She finishes each piece with her own bench fabricated sterling accents and clasps. From ornamental iron home and garden dŽcor, to painted glass and antiques, to whimsical painted children's furniture and accessories ... it's all together in one location. Don't forget all the wonderfully delicious gourmet delights to savor and so much more. These items are lovingly made by local artisans and crafts people so you'll feel really good supporting the local economy while acquiring unique gifts for your friends and family. Clogging teams from around the South will entertain the crowds on both days. Continued From Page 1 MADISON The North Florida Community College English Department announces its new Flash Fiction Contest and invites the community to submit entries to the writing contest by April 19. Stories must be based on one of the following titles: "Grit"; "The Braggart"; or "Sunday Morning"; and should be no longer than 600 words. Stories should be completely original and free of spelling and grammatical errors. Text should be typed in 12-point Times New Roman font and double-spaced. Email submissions to NFCC English instructor Tolu Jegede at tjegede@go.nfcc.edu by the April 19 deadline with "Flash Fiction" in the e-mail's subject heading. Winners of the "Flash Fiction Contest will receive: 1st place: $40 gift certificate from Borders and story published in The Trailblazer, NFCC's student newspaper; 2nd place: $30 gift certificate from Borders; 3rd place: $20 gift certificate from Borders. Winning entries will also have their stories published on the NFCC website in The Sentinel Review, NFCC's online literary publication. The contest is open to the public. For more information, contact Tolu Jegede at 850-973-1635 or email tjegede@go.nfcc.edu.NFCC seeks entries for its new Flash Fiction Contest World-famous anthropologist Richard Leakey will be the opening act as The Florida State University presents "Origins Ô10: Celebrating the Birth & Life of Beginnings," a reprise of last year's popular series of public outreach events sponsored by the university's Office of Research. Unlike Origins Ô09, which featured 12 events in 12 days during the month of March at venues around Tallahassee, Origins Ô10 will feature five April lectures, all held in the Richard G. Fallon Theatre, located in the Fine Arts Building on the Florida State campus. Leakey's April 1 presentation is "Why Our Origins Matter." Named by Time magazine as one of the "100 Greatest Minds of the 20th Century," the son of the legendary husband-and-wife team of anthropologists Louis B. and Mary Leakey is recognized as one of the world's most powerful voices in wildlife conservation. Other speakers visiting Florida State to take part in Origins Ô10 are as follows: * April 8: Brian Greene, one of the world's leading theoretical physicists and author of popular books on the origins of matter and the universe, will discuss "The Fabric of the Cosmos." Greene's 2000 book "The Elegant Universe" has sold more than 1 million copies worldwide and was adapted into a Peabody Award-winning "Nova" special that Greene hosted. * April 16: World-famous oceanographer and Florida State alumna Sylvia Earle will deliver a talk. In 1979, Earle set a world record by diving with a special suit to an astonishing depth of 1,250 feet.All-star lineup of speakers planned for Origins Ô10 series at FSUAuthor of many books on ocean exploration, she has been called a "living legend" by the Library of Congress. * April 23: Science writer and social critic Steven Berlin Johnson will present "The Origin of Air." Johnson is the bestselling author of six books on the intersection of science, technology and personal experience. His writings have influenced everything from the way political campaigns use the Internet to urban planning and the battle against terrorism. SEEALL-STAR,PAGE11
PAGE 16
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 4,MARCH 17 & 18,2010 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA To place an ad on this page, please call Nancy at 386-362-1734 Ext. 103As people age, many expect their health to begin to deteriorate at least a little bit. While science has made many advancements and people are now living longer and healthier lives, there are still some signs people recognize as signs of aging. And these signs can begin as early as a person's 20s, growing more noticeable as time goes on. One side effect many inappropriately associate strictly with aging is glaucoma. Though commonly considered a disease of the elderly, glaucoma is not strictly limited to baby boomers and seniors citizens. While the Glaucoma Research Foundation notes that the elderly are at a higher risk for glaucoma, they are also quick to point out that 1 out of every 10,000 babies born in the United States is born with glaucoma, illustrating the broad expanse of this potentially harmful disease. With that in mind, consider the following quick facts about glaucoma: * Roughly half of the 4 million Americans who have glaucoma are unaware they have it. * Glaucoma is a leading cause of blindness. It's important to get routine eye examinations, as even those who do and receive adequate treatment for glaucoma will not necessarily avoid blindness. In fact, roughly 10 percent of people with glaucoma who receive proper treatment still experience loss of vision. For those who never get treatment, the likelihood of blindness is even greater. * There are not necessarily symptoms of glaucoma. The importance of eye examinations is further emphasized by the very real likelihood there will be no discernible symptoms of glaucoma, as doctors often diagnose the disease before patients know they even have a vision problem. When vision loss begins, it does so with diminished peripheral vision. Many people subconsciously compensate by turning their head to the side. * According to the Glaucoma Research Foundation, African-Americans are particularly susceptible to glaucoma at a young age.Get the Facts About Glaucoma "Everything For Your Home Recovery"• Medical Equipment • OxygenLocally Owned & Operated101 SW U.S. Hwy. 27, Branford, FL 32008(386) 935-6905229 W. Main St., Mayo, FL 32066(386) 294-3777570643-FNorth Florida Pharmacy Locally Owned & OperatedLive Oak208-1414 Lake City 755-8680 Jasper 792-2426 Branford 935-1449 Mayo 294-1407• Medicare, Protegrity • Blue Cross, Av Med • Medicaid-pediatrics • Workers Comp • Most Other Insurance PlansEmail: info@healthcorerehab.com Website: www.isgroup.net/healthcoreHCHealthcore, Inc."Meeting All Your Rehabilitative Needs"HCHealthcore, Inc.Physical TherapyA Medicare Certified Rehabilitation Agency570644-F• Physical Therapy • Occupational Therapy • Speech Therapy • Specializing In Arthritis • Fibromyalgia • Geriatrics • Spinal & Joint Pain • Sports Injuries • Work Injuries • Pediatrics • Manual Therapy • Lymphedema HERBERT C. MANTOOTH, D.D.S, P.A. Family Dentistry602 Railroad Ave., Live Oak, FL(386) 362-6556 1-800-829-6506(Out of Suwannee County)570639-F 580882-F ACV"The Village Pharmacy at Advent Christian Village offers full prescription services to the community."At the W.B. Copeland Medical Center at Advent Christian Village, modern facilities provide a comfortable setting for our experienced staff to deliver quality, full-service medical care. Following your medical appointment, have your prescription filled on the spot and purchase over the counter medications at Village Pharmacy. Our experienced Pharmacist gives professional consultations and personalized service. Village Pharmacy also offers free prescription delivery service within Dowling Park, as an additional convenience. Most forms of insurance accepted. ADVENT CHRISTIAN VILLAGEAT DOWLING PARK POBox 4345 • Dowling Park, FL32064 386-658-5860 • 1-800-955-8771 TTY1-800-647-3353 www.acvillage.net COPELAND MEDICAL CENTER ACVADVENT CHRISTIAN VILLAGEAT DOWLING PARK 10820 Marvin Jones Blvd., Dowling Park, FL 386-658-5300 Hours: Mon.-Fri. 8 a.m. 4:30 p.m.Nasseer Masoodi, M.D. Rich Corley, PA-CAccepting Medicare and Most Insurance, Sliding Scale Also Available Clinic: Rehab: Pharmacy OPEN TO THE PUBLIC580883-F 570641-F OphthalmologyGREGORY D. SNODGRASS, M.D.522 South Ohio Avenue (386) 330-6260 or 1-800-435-3937570646-F REHABILITATION SERVICESPhysical TherapyAQUATIC THERAPYWorkers Compensation, Industrial Rehabilitation, Ergonomic Consultation, Job/Workers Site Analysis Orthopedic/Sports Medicine, Pediatrics Providers Medicare, Medicaid, AvMed & BCBS Providers 405 11th St., Live Oak, FL 32060 (386) 364-5051Sandy Laxton, PTA Mandy McCray, PTA Carolyn McCook, Office Manager, Patient Care Coordinator570640-F for your loved oneIN HOME CARE TEMPORARY or LONG TERM COMPANIONSHIPPrivate Duty Live-in • Live-out • Sleep Over • Weekends or Holidays • Personal & Daily NeedsLicense 299418When a nursing home is NOT the right answer for you.386-963-5256Serving seniors in Suwannee and Columbia counties since 1996We're Here To Help!We're here to help you enjoy living in your own home with complete assistance & safety as if we were your own family579877-F C C a a l l e e n n d d a a r r o o f f E E v v e e n n t t s sPink Ladies Needed!Are you looking for a place to share your talents? Do you enjoy meaningful conversation with a good friend? How Ôbout a good book? Then We Want You!! Suwannee Health Care and Rehab Center is looking for volunteers to start a Ladies Auxiliary. Call Lynn Brannon, Activities Director at 386-362-7860 or 386-590-2961.Talent SearchDo you sing or play and instrument? Do you act or dance? Do you like to read or spend time with a friend in wonderful conversation? WE WANTYOU! Suwannee Health Care & Rehab Center is looking for your talent for our residents. Dinner for two $45; One night at the Beach $125; One hour volunteering to make memories that last forever PRICELESS! Call: Lynn Brannon, Activities Director 386-362-7860 or 386-590-2961.Head Start/Early Head Start early enrollmentSuwannee Valley 4Cs Head Start/Early Head Start is accepting applications for children from birth to age 5. Head Start/Early Head Start is a FREE comprehensive early childhood education program that includes health, dental, nutrition and VPK services to eligible children/families. Centers are located in Suwannee, Hamilton, Lafayette and Columbia counties. Parents bring proof of income and child's age to register. For more information call 386-7542222.Customers needed!Dairy Queen of Live Oak will host Dairy Queen Benefit Night the second Tuesday of every month from 6-8 p.m. to help buy books for Suwannee Middle School.Donations needed!Suwannee County Environmental Watchdogs, a non-profit organization, seeks donations for yard sale merchandise. Info: Sandy, 386-364-8020.Register now!Descendants of Calhoun family plan reunion in 2009Descendants of the late Sarah Calhoun, Eva Calhoun and Thomas Calhoun are invited to a family reunion to be held in 2009. Info: misstheresamartin@yahoo.com or predop@aol.com.Coffee with your councilmanCity Councilman for District 4 Mark Stewart invites his constituents to "Coffee with your Councilman" at JAVAJAX located in the Publix shopping center. Come and meet with him on the second Tuesday of each month from 7 a.m. till 8:30 a.m. This will be a time to get to know each other and discuss current issues and citizen concerns.CJBAT testsMonday à Thursday Monday à Thursday at 5 p.m. (by appointment): CJBAT(Criminal Justice Basic Abilities Test) at NFCC Testing Center (Bldg. #16), Madison. CJBATis required for acceptance into Corrections & Law Enforcement programs. Photo ID required. Pre-registration & scheduling time and date are required. To register please call 850-973-9451.College Placement TestsMonday à Thursday Monday à Thursday at 5 p.m. (by appointment): College Placement Test (CPT), NFCC Testing Center (Bldg. #16), 5 p.m., Madison. Register in NFCC Student Services 24 hours before test. For information please call 850-973-9451.TABE testsMonday à Thursday Monday à Thursday at 5 p.m. (by appointment): TABE (Test of Adult Basic Education) at NFCC Testing Center (Bldg. #16), Madison. TABE is required for acceptance into vocational/technical programs. Photo ID required. Pre-registration & scheduling time & date are required. To register please call 850-9739451.Greater Visions Support GroupAddiction Support Group: Greater Visions faith-based addictions support group meets at the Grace Manor Restaurant. Meetings are held on Thursday mornings at 9:30 a.m. This group provides spiritual and emotional support in a non-judgmental setting. Come experience the freedom from addictions that is found in Christ. Greater Visions is an outreach of Christ Central-Live Oak. For more information contact 208-1345.Suwannee County Republican Executive Committee to meetThe Suwannee County Republican Executive Committee meets in the council chambers of Live Oak City Hall at 7 p.m. on the first Thursday of the month. If the first Thursday is the first day of the month, the meeting will be held on the following Thursday. Each meeting has a guest speaker or current issues will be discussed. All are welcome to attend. For more information call Chairman Carl Meece at 386776-1444.Legislative candidate to speak at Republican meetingThe Suwannee County Republican Executive Committee meets at Live Oak City Hall, in the Council Chambers, at 7 p.m. on the first Thursday of the month. If the first Thursday is the first day of the month, then the meeting will be on the following Thursday. Each meeting has a guest speaker or there will be current issues brought up for discussion. All are welcome to attend. For more information, call Chairman Carl Meece, 386-776-1444.Branford TOPS meeting changes locationsWe now meet every Tuesday at L& M Scrapbooking located at 105 SWSuwannee Ave. in Branford. Weigh-in begins at 4:30 p.m. Meeting starts at 5. For more information please contact Donna Hardin at 386-590-2333. "Take Off Pounds Sensibly."SREC seeking location in BranfordSuwannee River Economic Council, Inc., a non-profit organization is seeking a location in the Branford area that could be used to serve meals to persons 60 years of age or older. Any business, organization or church that has space available and would be inCONTINUED ON PAGE6
PAGE 17
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida MARCH 17 & 18,2010,PAGE 5 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA North Florida Call or toll free or fax Hours are M-F 8 am 5 pm • closed Sat. & Sun.Reaching 14,100 households each week You can Reach Over 4 Million Potential Buyers for your product through our Internet and Newspaper Network in Florida and throughout the Nation. Call Nancy at REAL ESTATE386-362-1734569568-F GetaMonster®advantageatclassifiedmarketplaceonline.com/monster classifiedmarketplaceonline.com/monster 581352jrv Announcements ATTENTION ADVERTISERS*PROOF READ YOUR ADAny error must be reported the first day of publication. Should the error inhibit response,credit will apply only to the first run date. The South Georgia Media Group is not liable for any loss or expense that results from publication or omission. Help Wanted FirstDayCASE MANAGER POSITIONFor Dixie/Lafayette/Levy Counties Responsible for client case records, home visits, client assessments, case plans, and case management.Must have a 4 year college degree with course work in Social Work, Sociology, Psychology, Nursing, Gerontology, and/or related fields.Two years experience in Gerontology and/or related fields.Experience may be substituted for the college required.Submit Resume to SREC, Inc.P.O.Box 70, Live Oak, FL 32064.Call 386-3624115 Deadline:March 24, 2010 no later than 12:00pm Voice/TDD Affirmative Action Employer. CDL DRIVERS NEEDED for over the road flatbed positions. Minimum of 2 years experience, clean CDL, flatbed experience preferred.Driver's home every weekend during seasonal freight, every 10-15 days during off season.Late model Preterbilts and Freightliners.Average salary $50K to $60K.Call 386590-1980 or 386-776-1857. FirstDayDENTAL ASSISTANT General Dentist in Live Oak has an opening for a dependable, outgoing, friendly dental assistant.Preference will be given to the assistant that has experience in:lab duties, charting, sterilization procedures, radiology certified, and fabricating temporary crowns.Salary will be based on verifiable experience.Please email your resume, cover letter, and salary requirements to : dentalassistant266@hotmail.co m FirstDayMATH TEACHERLighthouse Christian Academy in Mayo is seeking a certified, high school math teacher for the 2010 1011 school year.Please fax resumes to 386-294-3449.For more information, please call 386-294-2994.NURSING INSTRUCTOR POSITIONat North Florida Community College.For Details Visit www.nfcc.edu FirstDayOTR DRIVER wanted, must have clean MVR.Reefer exp., LTL, physical work, references req.Call 386-963-3153. SENIOR OPPORTUNITIESAre you unemployed? Over 55? We can help! The Older Worker Program is an "earn while you learn" job training program operated by FIWI through the FL Department of Elder Affairs.The Older Worker program provides you with part time paid job training positions in your area.If you are unemployed, over 55 and looking for a job contact FIWI today at 352.244.5193 to find out about how the Older Worker Program can help.TEMPORARY MAINTENANCE POSITIONFull Time. Carpentry, Renovation, & Flooring Exp.Required.Must have good work history.Apply in person at Suwannee Health & Rehab, 1620 East Helvenston St. Live Oak Fl.32064 EOE/V/D/M/F Jobs WantedHANDYMAN: Roofing, decks, small additions, flooring, painting, yard work, odd jobs. Please contact Eddie 386-3645664 for mor information. NEED HELP MOVING OR CLEANING UP YOUR AREA? CALL 386-249-2701 Lost & FoundFOUND ORANGE Male Cat. Very Friendly.Found in Boys Ranch Area.386-842-5026 Special Notices ATTENTION READERSYou should be cautious of calls from interested buyers of your advertised merchandise.If the caller is offering you MOREmoney than what you are asking or suggest sending you a check for more than the amount and requesting you to cash it and just send them back the remaining amount DON'T! THIS IS A SCAM! BE CAUTIOUS,IF IT SOUNDS TOO GOOD TO BE TRUE,IT USUALLY IS. Yard ServicesIT'S TIME to Resod your Lawn with All types of Sod, Free Estimates and Friendly Service. Let us help you order online at www.OBGarden.com (813) 936-5081 Business OpportunitiesALL CASH VENDING!! Do You Earn $800 in a Day? 25 Local Machines and Candy All For $9,995.Call 1-888-753-3430 AIN#BO2000033 Call Us:We Will Not Be Undersold! MiscellaneousKING SIZE BED $75; Chairs $5; Tables $10;Refrigerator $40; Bread Maker $20;Crackpot $10; Call Tondra at 386-590-7909. Located @ Live Oak Motel Rm #22. VocationalHEATING/AIR TECH TRAINING. 3 week accelerated program. Hands on environment.State of Art Lab.Nationwide certifications and Local Job Placement Assistance! Call Now:1-877-994-9904 Want to be a CNA? Don't want to wait? Express Training is now offering our quality Exam Prep Classes in Lake City,Fl. Class sizes limited. Next Class Feb.1st 5th,8am to 4pm Call 386-755-4401 expresstrainingservices.co m AIRLINES ARE HIRING Train for high paying Aviation Maintenance Career.FAA approved program.Financial aid if qualified.Housing available.Call Aviation Institute of Maintenance (888) 349-5387 AVIATION MAINTENANCE / AVIONICS Graduate in 14 Months.FAA Approved; financial aid if qualified.Job placement assistance.Call National Aviation Academy Today! 1-800-659-2080 or NAA.edu HIGH SCHOOL DIPLOMA ! Graduate in just 4 weeks!!!! Free Brochure.Call Now! 1800-532-6546 ext.16 www.continentalacademy.com NEED YOUR HIGH SCHOOL DIPLOMA? Finish from home fast for $399! Nationally accredited.EZ pay.Free brochure. www.diplomaathome.com Call 800-470-4723 ATTEND COLLEGE ONLINE *Teaching, *Business, *Court Reporting, *Accounting, *Criminal Justice, *Other Fast Track Courses.Financial Aid if Qualified.Train for a High Paying Job.Call 1-800-9309796 www.onthenetdegree.com LOST AN ANIMAL? WANT TO ADOPT? Call Suwannee County Animal Control at 386-208-0072. M-F from 9 a.m.5 p.m. Pets for SaleLYNN'S MOBILE PET GROOMING Van comes to your home, now in Live Oak.36 yrs experience, small dogs only. 386-288-5966 Building MaterialsLUMBER LIQUIDATORS Hardwood Flooring, from $ .99/Sq.Ft.Exotics, Oak, Bamboo, Prefinished & Unfinished.Bellawood w/50 year prefinish, plus A Lot More! We Deliver Anywhere, Many Florida Locations, 1-800FLOORING (1-800-356-6746) METAL ROOFING & STEEL BUILDINGS .Save $$$ buy direct from manufacturer.20 colors in stock with trim & acces. 4 profiles in 26 ga.panels. Carports, horse barns, shop ports.Completely turn key jobs. All Steel Buildings, Gibsonton, Florida.1-800-331-8341. www.allsteel-buildings.com METAL ROOFING TAX CREDIT! 40 yr Warranty. Direct from manufacturer.30 colors in stock Quick turnaround.Delivery available. Gulf Coast Supply & Manufacturing, 1-888-393-0335 www.gulfcoastsupply.com FurnitureASHLEY FURNITURE up to 70% Off.No Credit Check. $10,000 Credit Line.Huge Showroom Delivery Everywhere Tampa Discount Furniture And Mattress Outlet.com 813-978-3900 FirstDayLIFT CHAIR Solid Good Condition $250. NEW Portable Dish Washer $175, Jazzy Scooter Great $750.386-7762527 Office EquipmentFOR SALE Casio Cash RegisterGreat for small business works great asking $50.00 Call 386-208-4734 MiscellaneousCUSTOM BUILT ENTERTAINMENT CENTERS,BOOKCASES, CABINETS,& MORE!! I can build it the way you want! Place your orders today. V & K Cabinets 229-2423295 If no answer please lv.msg. CASH PAID for your unused, unexpired & sealed Diabetic Test Strips.Most brands considered. Call Linda 888-973-3729 for details! Or www.cash4diabeticsupplies.com DIRECTV:FREE INSTALLATION/ZERO DEPOSIT* Packages as Low as $29.99/mo.Free HD/DVR Receiver and Movies Free for 3 Months Call Now PG Global 1866-745-2846 or 1-877-2160514 DISH NETWORK .$19.99/mo, Why Pay More For TV? 100+ Channels.FREE 4-Room Install. FREE HD-DVR.Plus $650 Signup BONUS.Call Now! 1-866573-3640 EVERY BABY DESERVES A HEALTHY START. Join more than a million people walking and raising money to support the March of Dimes.The walk starts at marchforbabies.org. FREE GPS! FREE PRINTER! FREE MP3 ! With Purchase of New computer.Payments Starting at Only $29.99/week. No Credit Check! Call GCF Today.1-877-212-9978 INTERNET GROCERY SHOPPING! 30% savings! Free shipping! 10,000 plus name brand middle aisle items! Save time, money and gas! www.discountongroceries.com or Call 813-598-1153/813-4535667 PROFLOWERS Christmas Decor and Holiday Flowers & Other Gifts starting at $19.99. Go To www.proflowers.com/Elf to get an EXTRA 15% OFF Or Call 1-877-697-7697! SWIM SPA Loaded, new.List $18,000, sacrifice $8,995. Hottub, Manufactured by Vita, 24 jets, 5 HP $1,695.Call 727851-3217 VONAGE UNLIMITED CALLS Around The World! Call the U.S.AND 60+ Countries for ONLY $24.99/Month 30-Day Money Back Guarantee.Why Pay More? 1-877-872-0079 Wanted to BuyCASH FOR YOUR COINS! Private collector seeking U.S. coins and currency.Older varieties, all denominations.I travel to you ! I pay more than dealers and pawn! Questions? Call 352-949-1450. Garage/Yard SalesESTATE SALE: 3/20 8-2 10123 92nd Trail, Live Oak. Household items, tools, Furniture, EVERYTHING MUST GO. Classified Bargain Basement Classified Bargain Basement$0 $100 FREE$100 $150$5800-525-4182 800-525-4182Call today
PAGE 18
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 6,MARCH 17 & 18,2010 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA TO PLACE AN AD, CALL 386-362-1734 DEADLINE IS FRIDAY AT 2:00 P.M. 575778-FLIVE OAK MINI STORAGEUnits located on Gold Kist Road Rental Office: 121 Van Buren St., Live Oak 364-6626• 5x15 • 5x20 • 10x15 • 10x20 CLIMATE CONTROLLED STORAGE 5x5 • 5x10 • 10x10 • 10x20 582611-F Affordable Seamless GuttersResidential & Commercial • Licensed & InsuredFREE ESTIMATES • FAMILY OWNED & OPERATEDSpecializing In: • Seamless Gutters • Soffit & Fasia • Gutter Guard • Screen Enclosures and RepairCarl Kirk 386-776-1835 Cell 386-209-2740"Satisfaction Guaranteed" 571377-FNorth Florida North FloridaBusiness Business Bulletin Board Bulletin Board E-LIMB-INATORS, INC.569573-FOwners: Keith & Glenda Hudson 9351 220th Street O'Brien, FL. 32071 Phone 386-935-1993 Fax 386-935-3321Complete Tree Service Licensed & Insured 570794-F Jim Sellers 386-776-2522 Cell 386-647-5978 Stump Grinding TAX REFUND SPECIAL • TAX REFUND SPECIAL TAX REFUND SPECIAL • TAX REFUND SPECIALTAX REFUND SPECIALTAX REFUND SPECIAL AUTOMOTIVE386-362-4012500 West Howard Street (US 90), Live Oak See Dealer for details Includes Taxes & tag transferRemainder of 100,000 Factory WarrantyNOW ONLY570730-FPER MO. W.A.C. 34 MPG 621 Ohio Ave. North • Live Oak, FL 32064 (386) 362-1848 • Fax (386) 364-4661 • 1-800-457-6082 PRINTING • COPY SERVICE Color Copies • Blueprints570686-F SEVEN SALES ONE LOCATION Fri & Sat 19/20th 8til? 131st Loop-Follow signs at 51 & Demetree 1 mile. Rototiller, Treadmill, Furniture, Misc Tools, Electric Impact Wrench, Clothes, Shoes, Books, Fabric, Glassware, Lots of Household Stuff.Treasures of all Kinds! Don't Miss! SPRING COMMUNITY YARD SALESaturday, April 10th 7 am 1 pmLowndes Co. Civic Center(Fairgrounds, Hwy. 84 E.) Clean out your closets! Empty your cabinets! Reclaim your garage! Join us for a great day of yard sale fun!VENDOR SPACES AVAILABLE!Inside spaces $35 ea. Outside spaces $25 ea. Spaces are limited, so act quickly! Call the Classified Marketplace 229-244-1880 229-244-3400 1-800-600-4838 or come by 201 N. Troup St. Valdosta, GA Boats/SuppliesBOATS; 1000's of boats for sale www.floridamariner.com reaching 6 million homes weekly throughout Florida.800-3889307, tide charts, broker profiles, fishing captains, dockside dining and more. Apartments for Rent FirstDayAPARTMENTS FOR RENT: Equal Opportunity, Rental assistance may be available. Branford Villa Apartments.396935-2319 PUBLISHER ' S NOTICE All real estate advertising in this newspaper is subject to the Fai Housing Act which makes it illega to advertise " any preference, limi tation or discrimination based on race, color, religion, sex, disabili ty, familial status or national ori gin, or an intention, to make any such preference, limitation and discrimination. " Familial status in cludes children under the age o 18 living with parents or legal cus todians, pregnant women and people securing custody of chil dren under 18. This newspaper will not know ingly accept any advertising fo real estate which is in violation o the law. Our readers are hereby informed that all dwellings adver tised in this newspaper are availa ble on an equal opportunity basis To complain of discrimination cal HUD toll-free 1-800-669-9777 The toll-free number for the hear ing impaired is 1-800-927-9275. Houses for RentHOUSE 2Bd/1Ba CHA, Fridge, Stove, Seperate storage bldg. new paint & hardwood floors $600 + Utlities $500 Sec Dep. Ref ' s, No Smokers, No Pets downtown Live Oak.Call for app 362-1837 days or after 6pm 3626156 Cell 590-0204 Ask for Ellen FirstDayHOUSE 2Bd/2Ba Lots of closets 1 mile from Live Oak.NO PETS $650/mo, 1st, Last & $300 Dep.Includes Water /Sewerage 386-362-3002 or 318-840-4802 Mobile Homes for Rent FirstDayDWMH 3Bd/2Ba on 6 Acres. 3 miles from Mayo Correctional. 2000 model, totally referbished inside.$500 mo plus Dep.386294-2135FOR RENT NEAR MAYO Over 3 acres.Single Wide mobile home, 3/2. New floorings! $600/month. Contact:386-935 2256 FirstDayRENT WITH OPTION TO BUY 1984 Double wide mobile home 24X60.1440sf, 3bd/2ba, on 10 acres.Large 3 car garage.Horse stalls, RV carport.Fenced in pastures.Washer & Dryer included.Large back porch. Gated entrance.$1,000mo.772318-8831 FirstDaySWMH 2Bd/2Ba $500/mo in town, large Yard.1st & $500 Security to move in. 386-590-1930 FirstDayVERY NICE 28X76 DWMH 4Bd/2.5Ba on 3 acres. XFenced, Large Deck, Horse Ready, McAlpin Area.$950/mo 386-867-1833 Office Space for RentOFFICE SPACE 2-UNITS: 310 & 314 N.Ohio.1000-1800 sq ft available.Utilities included.Pls Call 386-466-5876 Vacation PropertyLAND SALE NOTICE: VIRGINIA MOUNTAINS Closeout Sale! 5 acres, great fishing! Near stocked trout stream, near state park, $29,500, must sell.Bank financing.1-866-275-0442 NC MOUNTAINS Top of the mountain! 10acres with great view, very private, creek, waterfalls & large public lake nearby, $99,500.Bank financing.Call 1-866-789-8535 S.E.TENNESSEE PARADISE Custom built cypress log home with barn, pond, creek, 60 acres. Will sell smaller parcels.See Forsalebyowner.com listing #21221919, mayangus@aol.com, 423-6081950 SOUTHEAST TENNESSEE Variety of homes & land; mountain, valley, farms, wooded tracts, gated community.800516-8387, George Hamilton Land & Auction, TAL1557 www.hamiltonauction.com www.timber-wood.com TENN MTN PROPERTY 5ACRES Private wooded parcel, perfect for cabin.Near Cookeville $14,900.Owner Financing 931-839-6141 TURN YOUR UNWANTED TIMESHARE INTO CASH! No Commissions/Brokers Fees. Buyer pays All closing costs. Timeshare Clearinghouse 888595-3547 BYOWNERRESORTS.COM Lots FirstDayONE ACRE RIVER RD. Beautifully wooded, paved rd. Owner Financing NO DOWN. $14,900 $153/mo 352-2151018 AcreageCENTRAL GEORGIA 49AC $1,325/ACRE Gently rolling, planted pine, some hardwood, near Flint River, great hunting. 478-987-9700 St.Regis Paper Co.FirstDayFIVE ACRES DOWLING PARK, Well, Septic, Power, Paved Rd frontage.Owner Financing, NO DOWN $64,900 $570/mo 352215-1018 FOR SALE BY OWNER: Paved Rd Frontage, near Orange Baptist Church.25+ Acre parcel, 24+ acre parcel, 5+ acre parcel.Owner Finance Avail.386-362-5259 or 386-984-9532 Before 9:00 PM FirstDayFOUR ACRES O ' BRIEN/MCALPIN AREA Beautiful Secluded Country Setting.High & Dry.Owner Financing NO DOWN $34,900 $359/mo 352-215-1018PRICE REDUCEDLafayette County 10ac, North of MAYO, $64,900 1 ac RV/MOBILE HOMElots, Branford area, $9,500 Suwannee County 5 ac, Near airport, $39,900 Easy Financing 1-941-778/7980 / 7565 www.landcallnow.com Trucks for SaleFORD 1986 RANGERand 1988 BRONCO COMBINED DEAL: Both run, minimal work needed on both, Call for details.$1100 OBO.386-963-2916 AircraftSKYLANE 182 RG.1979, Low time, always hangared. Professionally maintained.A 50K avionic Garmin upgrade in 2008.Must sell NOW.See at: http://tinyURL.com/Nice182RG. No reasonable offer refused. MotorcyclesARCTIC CAT 2005 ATV:650cc V-2 Extra Mud Tires, Cabin, Storage Bag, & Ramps.$4500 OBO 386-792-3106 C C a a l l e e n n d d a a r r o o f f E E v v e e n n t t s sterested in assisting in this much needed service to the elderly population of Branford, should contact Bruce Evans, Senior Center Director, at 362-1164 or Janis Owen, Director of Client Services, at 362-4115, ext. 240.Love a mystery?Try locating your ancestors by working on your family tree. The Suwannee Valley Genealogy Society invites you to join and learn how to find your ancestors. Membership is $30 for a single member or $35 for a family. Corporate membership is also available for donations of $100 or more (tax deductible). Meetings are held on the first Thursday of each month at 7:00 PM at the Genealogy Center at 215 Wilbur Street SWin Live Oak. The library is open on Tuesday and Thursday from 9 a.m. until 5 p.m. and the talented folks there will be glad to help. For more information call Jinnie or Alice at 386-330-0110.Take Off Pounds SensiblyWe know everyone has different hopes and dreams, different health conditions and weight loss goals. TOPS helps people meet their individual needs through group support. However you measure success and whatever you have to lose, TOPS is here for you. Change take time. Take Off Pounds Sensibly supports you, no matter how long, even after you've reached your goal. There is no quick fixes at TOPS and no phony guarantees about weight loss. It's up to you and it's a total commitment on your part, but if you bring the desire, we can help. We meet every Wednesday morning at 9 at the Community Church of God, 10639 US 129 South, Live Oak. For more information contact Barbara at 362-5933.AARPtax filing service suspendedDue to volunteer leadership staffing difficulties, AARP Tax-Aide has found it necessary to temporarily suspend its free volunteer tax preparation service in Suwannee, Hamilton and Columbia counties this tax filing season that would have begun Feb. 1. AARPTax-Aide wants all citizens to know that they are deeply committed to assisting the taxpayers in these areas, and they are working to rectify this situation for next year. In the interim, to locate an alternate site near them, taxpayers may visit the AARPTax-Aide Web site at www.aarp.org/taxaide, or call toll-free 1-888-227-7669. AARPTax-Aide is a program of the AARPFoundation, offered in conjunction with the IRS.Caladium bulbsLive Oak Garden Club #1 Quality Caladium Bulb Sale Order Now! Price still 10 bulbs for $6. To place yourorder, call: Ella Carter 386-362-1326 Andrea Miller 386-963-3172.Rocky Sink BaptistRocky Sink Baptist would like to invite all to come meet their pastor Robert Carter. 8422 169th RD. Live Oak, FL.Live Oak Partnership meeting schedule changesThe Live Oak Partnership Revitalization Board will meet on the first and third Tuesdays of each month at 3:30 p.m. The meetings will be held at the Live Oak City Hall complex. Unless otherwise noted, these meetings will be held in the City Hall Annex building, east of the main City Hall office.MOAAmeets fourth TuesdaysMOAA(Military Officers Association of America, Suwannee River Valley Chapter) meets fourth Thursday, 6:30 p.m., Elks Club, Lake City for dinner and program. Info: Steve Casto 386-497-2986. CONTINUED ON PAGE7 Go to suwanneedemocrat.com and look under Local Happenings for:• Calendar of Events
PAGE 19
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida MARCH 17 & 18,2010,PAGE 7 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA TO PLACE AN AD, CALL 386-362-1734 DEADLINE IS FRIDAY AT 2:00 P.M. LAKEWOOD APARTMENTS IN LIVE OAK569601-FQuiet country living 2 bedroom duplexCall 362-3110 580884-F CALLTOLLFREE 1-888-393-0335Gulf Coast Supply & Mfg.Inc. Quality Metal Roofing & Accessories At Discount Prices!!Metal Roofing$ $ $ $ $ SAVE $ $ $ $ $3' wide galvalume 3' wide painted 2' wide 5-vAsk about steel buildings North Florida North Florida571380-F 582328-F Call Junk Joe $150 & Up CashFor Junk Vehicles Will Remove any kind of scrap metal Free PickupCall 386-867-1396 580885-FWE ARE THE MANUFACTURERPhone: 38-294-1720 Fax: 386-294-1724232 SE Industrial Park Cir. Mayo, FL STATE OF FLORIDA APPROVEDResidential • Commercial • Agricultural METAL ROOFINGAGRI-METAL SUPPLY, INC. 30 Years Paint Finish Limited Warranty Deliver y Available Business Business Bulletin Board Bulletin Board 571389-Fwww.nflaonline.com C C a a l l e e n n d d a a r r o o f f E E v v e e n n t t s sSeasonal flu vaccine still available at health deparmentSeasonal influenza vaccine for adults is still available at the Suwannee County Health Department for adults and children age 36 months and older. This vaccine is recommended in addition to any H1N1 (Swine Flu) vaccine that may become available later this fall. Seasonal flu vaccine is recommended for those who are: á All children age 6 months and older á 50 years of age and older á Persons at risk for complications from influenza, including: women who will be pregnant during flu season persons with chronic health problems persons with a weakened immune system persons with muscle or nerve disorders that can lead to breathing or swallowing problems residents of nursing homes and other long term care facilities á Healthcare providers á Caregivers of children from birth up to 5 years of age á Household contacts and caregivers of people 50 years and older á Anyone with chronic medical problems The vaccine will be given by appointment. Call 386362-2708 for an appointment at the Live Oak clinic or 386-935-1133 for an appointment at the Branford clinic. There is no charge for the children's seasonal flu vaccine. Adult seasonal flu vaccine is $30 and is covered by Medicare.Free English-speaking and literacy classesProvided by Columbia County School District's Career and Adult Education Program Where: Wellborn, Florida Unity of God Ministries, Inc. 12270 County Road 137 When: Every Thursday 5:30 p.m.-8 p.m. Activities for children will be provided. Please contact 386-755-8190 for additional information.Wellborn Neighborhood Watch to meetEach month on the last Thursday the Wellborn Neighborhood Watch has its regular meeting and at that time we have scheduled speakers. This month our guest speaker will be Michael Ingram, Manager of Retail Operations for the Hospice Attic in Lake City and Gainesville. He will explain to us exactly how the Attic helps with funds for Haven Hospice and the families that come there in need. He will also explain how the Attic helps families after Medicare and other sources of help are no longer available to them. Please come and join us at the Blake Lowe building next to Wellborn Playground at 7 p.m. We have refreshments before the meeting and hope many of you can join us. For information call Jane Campbell at 208-8818.New master gardener volunteer trainingSuwannee County UF/IFAS Extension will be offering training for new Master Gardener Volunteers. CLASSES: Wednesdays, February 17-June 2, 2010 from 8:30 am-4:00 pm COST: $100 which includes manuals, lawn handbook and field trips The classes will be held at the Suwannee County Extension Office which is located at 1302 11th Street SW, Live Oak (next to the coliseum). The training is for individuals who can donate 75 hours of their time to help Extension Agents improve landscape and gardening practices. For more information, contact Carolyn Saft or Pamela Burke at the Suwannee County Extension Office at 386/362-2771 or csaft318@ufl.edu.Educational program for adults with Type 2 diabetesThrough March 25 Suwannee County Extension is now offering an educational program to help adults with type 2 diabetes control their blood sugar to feel better and reduce risk of health complications. The program will include nine classes taught by a team of qualified educators and health professionals, and a personal consultation with a registered dietitian. Health assessments (height, weight, and blood pressure measurements) are included. Classes will run from Jan. 28 to March 25 and will be held on Thursdays from 4 to 6 p.m. We are now recruiting participants for this program. If you have been diagnosed with type 2 diabetes, are at least 21 years old, and are interested in being a part of this program, please call the Extension office at 386-3622771 by Jan. 25. The $75 program fee includes the educational classes, nutrition consultation, program materials and health assessments. Class size is limited!Spring-Friendly Landscaping & Gardening seriesMarch 17 Suwannee County UF/IFAS Master Gardener volunteers are continuing their Spring-Friendly Landscaping & Gardening series. January's topic was "Alternative Vegetable Gardening With an Organic Twist" at the Suwannee River Regional Library-Live Oak. This topic will be offered again on March 17 at the Wellborn Community Center. This series is offered on the third Wednesday of every month at 10 a.m. Discussion will include raised beds, vertical growing and other containers, plant selection and insect management. Other topics to be discussed throughout the series include: "Native and Drought Tolerant Plants", "So What's Bugging You?", and "How and When to Prune". The classes will be held at three different locations throughout the year. áSuwannee River Regional Library-Live Oak, 1848 South Ohio Avenue áSuwannee River Regional Library-Branford, 703 NW Suwannee Avenue áWellborn Community Center, 1340 8th Avenue For more information contact Carolyn Saft at csaft318@ufl.edu or Pam Burke at peburke@ufl.edu or 386-362-2771.It's Camp Meeting time again!March 14-19 Peace Baptist Church 7794 S. E. US Hwy. 27 Branford, FL32008 T. L. Holton, Sr. Pastor; Vernon Welkner Assoc. Pastor Mark your calendars for these special meetings and don't miss out on some great preaching and music. DATES: Sunday, March 14, 2010 through Friday, March 19, 2010 DAILYSCHEDULE 9:30 AM Men's Prayer 10:00 AM Morning Service (3 Preachers) 12:00 Noon meal 5:00 PM Evening meal 6:00 PM Men's Prayer 6:30 PM Evening Service (2 Preachers) Special music each service. For more information call the church office, 386-935570096-FVillage Oaks I Apartments1, 2, 3 & 4 bedroom units. Hurry in for an application. Rental assistance available to qualified applicants. Call 386-364-7936, TDD/TTY 711. 705 NW Drive, Live Oak "This insitution is an equal oportunity provider, and employer." LAKE WOOD APARTMENTS IN LIVE OAK Quiet country living 2 bedroom duplex. Call 362-3110.570121-F 569608-FVillage Oaks II Apartments1, 2, & 3 bedroom units. HUD vouchers accepted. Hurry in for an application. Call 386-364-7936, TDD/TTY 711. 705 NW Drive, Live Oak "This insitution is an equal oportunity provider, and employer." BUSINESSES SERVICES& CONTINUED ON PAGE8
PAGE 20
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 8,MARCH 17 & 18,2010 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA !"#$%& '())*! +,-!-.%%/ #,#.# ! "#" '"0+ 1(0*23.4. 5562%7'(*-)),5!(-%"))5# $%&$'(%$ )*+,( 4%. .%#+%9%&, #:9%#4## '-"+* 5(,!!('(((*-5-,--"+ # #;$%#.# $$$ ))(",-# (6 <-2&=$5=55"# '(((*)+5,55)(>?+--#$@@A/ %4 "*.$' 3.,4>, ?%%%&B, 7B#),!7.B%%#C% 2@2#$C'(((*(! ,5# %/(0$ ,$12$2$$ C4# 7#B+6&"!D7 >%?#;%8.7 .%#'())*!-, 5+A#E# "%3& %$%)$4 %, %&.7.%8%4. %%27#@63%&, E#&%%47%&%4%% 7%%#B%%/ .%)#.'5 *!-!, )"=8"# 25$6758&+8$ 5 .%&.&.#84 7#C7E#, %# #D(#.# $01,9:#((-# = ;3$.$@ %7-9#2%4+#3$@< %.4.%$#'())*5!,+!!(# &$0&;<6=>?$@?? 7 7#3.97%&9 9>$6>&?8, E#3@CFB '(* , 5"#&%8#.# ));%3.$&%. 7,?>G>%-), -.6#+. @6.C$-.% ?E$%/'(!!*+"(,(!(+# . %@739# B"-H7%#+ ?;7, E#0&7% %#B27'(*+! ,5!)# "* ! @ *%@6!?? ?+562 "0+1(0#>=)6>5562 %7'(*-)),5!(-%"!5(# "#"(! @ @? )6>, 556.%%7"0=+1 (0@%7'(*-)),5!(-%"("-# "*(% ! @ *% +)=-?+562 "0+1(0#>=)6>5562 %7'(*-)),5!(-%"!)# $%% +)+,("++, ,&7&7 %2%$# 7.#E,I4.% %#$@@%%%%2%, '(((*5,"-(!# ,)),)+, .&.#2, =4=7=.%=.J, %#I4.%%# .%E#$'())*("(, ++= #?%.# ,3+) ) +!B??$I?># (,+63#C?FBC$#BC, C;#>C#K$?C#$@@ '(*5,55 ?L@!# % ,3"(,+))6( ?, 7# #!"0%#6"06.+9,+"9# ..%?#$'(((*()+,-"!+ #%&.#.# ,$@ %&7%= %=47%=%G749 4=)5="#$'())*!(5,("-"# !5!;%$6 7%&%%7#(= #$C>&%1'++5*(5,()# ;???A8$%7 # %9=9=&=%., %%&%=;#;%%$ C>&%1'++5*(5,()# $%,$5 >=>79= >9#@%%&8%%2B% %&%%%#'(+(*+)+,")"" #.%4#.# 348?6@??= Announcements Advertising that Works. Put your ad in Over 100 Papers throughout Florida for one LOW RATE! Call (866)742-1373 or visit: www.florida-classifieds.com Auctions LUXURY WATERFRONT HOME AT AUCTION. 5732 East Bay Boulevard, Gulf Breeze. 3 bedrooms, 3.5 baths, 3000 SF Selling Onsite 3/24 @ 10:00 AM. HUDSON & MARSHALL (866)509-4473. Lic# SCQ1035357, AB110 Business Opportunities ALL CASH VENDING! Do you earn $800 in a day? 25 Local Machines and Candy $9,995. (888)629-9968 BO2000033 CALL US: We will not be undersold! Condos For Sale HOME AUCTION Over 60 Luxury Condos Little Havana, Miami up to 2Br/2Ba 874sqft Starting Bids as low as: $29K Previously V alued at $323k Auction: April 10 FREE BROCHURE: (800)603-4954 www.Auction.com REDC | Lic#. CQ1031187 Financial Services $$$ ACCESS LA WSUIT CASH NOW!!! $$$ As seen on TV .$$$ Injury Lawsuit Dragging? Need $500-$500,000++within 48/hrs? Low rates APPLY NOW BY PHONE! Call Today! To ll-Free: (800)568-8321 For Sale / Pools Backyard Fun! Pools create generations of memories everyday, vacations never end! Simple DIY pool kits and pool accessories on sale. Visit FamilyPoolFun.com or call (800)950-2210 Help Wanted OTR DRIVERSNew T rucks! Average 2,500-3,000 miles! Up to 41 cpm. 12 months experience required. No felony or DUI past 5 years. (877)740-6262. www .ptlinc.com Drivers FOOD T ANKER DRIVERS NEEDED OTR positions available NOW! CDL-A w/Tanker REQ'D. Outstanding pay & Benefits! TEAMS WELCOME!! Call a recruiter TODAY! (877)484-3042 www.oakleytransport.com Heating/Air Tech Training. 3 week accelerated program. Hands on environment. State of Art Lab. Nationwide certifications and Local Job Placement Assistance! CALL NOW: (877)994-9904. Homes For Sale Delray Beach, FL-Paradise! 6 New Homes, Name your own price! Accepting Sealed Bids, No Minimum! For March 17th sale, www.defalco.com (561)922-7424 Misc. Items for Sale FREE 6-Room DISH Network Satellite System! FREE HD-DVR! $19.99/mo, 120+ Digital Channels (for 1 year.) Call Now $400 Signup BONUS! (888)593-7040. FREE 6-Room DISH Network Satellite System! FREE HD-DVR! $19.99/mo, 120+ Digital Channels (for 1 year.) Call Now $400 Signup BONUS! (888)318-5581 DIRECTV Save $29/mo FOR A YEAR! NO Equipment/Start-Up Costs! FREE HD/DVR Upgrade! Other Packages Start $29.99/mo! Ends 7/14/10. New cust. only, qual. pkgs. Call DirectStarTV (877)688-6563 Miscellaneous AIRLINES ARE HIRING T rain for high paying A viation Maintenance Career. FAA approved program. Financial aid if qualified Housing available. CALL A viation Institute of Maintenance (888)349-5387. Out of Area Real Estate CENTRAL GA 120 AC $1,350/AC Hardwoods, planted pine, borders Little Muckaloochee Creek basin, great hunting. (478)987-9700 St. Regis Paper Co. LAKE LOT SALE! 5 acres only $24,900 includes FREE BOAT SLIPS! (was $59,900) Sale March 20th! Beautiful mix of woods/ meadowswalk to private fishing lake. Quiet country road, utilities, warranty deed. Low financing. Call now (888)792-5253, x.3427 BANK-ORDERED LIQUIDATION SALE! 3/ 20 & 21 Direct Ocean Access with FREE Boat Slips Now $29,900 (was $124,900) All amenities complete! Paved roads, underground utilities, club house, pool. Excellent financing. Call Now (877)8881406, x 1554 LAND OR DEVELOPMENTS WANTED. We buy or market development lots. Mountain or Waterfront Communities in NC, SC, VA, TN, AL, GA, FL. Call (800)455-1981, Ext.1034 COASTAL GEORGIA RARE OPPOR TUNITY! Golf course, restaurant, deep water docks, fitness center, more! Starting at $29.9K Special Pricing Limited Supply Buy Now Build Later (877)266-7376 CENTRAL GA 49 AC $1,325/AC Gently rolling, planted pine, some hardwood, near Flint River, great hunting. (478)9879700 St. Regis Paper Co. Week of Mar. 14, 2010569559-F 4681.Victory Baptist Church"Gospel Sing" "ForeverHis" The CrowsMarch 17 Gospel sing March 17, at 7 p.m. located at 10475 SR 51 (3 mi. from Rotary on #51). Everyone is invited for a night of praise, worship and preaching. There will be a free will offering taken. For more information contact Pastor Owens at 386362-5313.St. Francis Xavier Catholic Church Fish FryMarch 19 St. Francis Xaiver Catholic Church, located at 928 E. Howard Street, US 90 East will hold a fish fry on Friday night, March 19, beginning at 5 p.m. Included in the fish dinners are hush puppies, cole slaw, baked beans and macaroni and cheese, The price is $6 adults, $3 for children 6-12 and under 6 are free. Fish fry sponsored by Knights of Columbus #9720.Railroad Historical Society meeting will focus on LOP&GMarch 19-20 The Georgia Southern & Florida Railroad Historical Society will hold its 10th annual meeting at the Historic Perry Station on March 19-20. Kickoff for the meeting will be at 6:30 p.m., Friday, March 19, with two presentations scheduled for the evening. The meeting will resume at 7:30 a.m., Saturday morning, March 20 with a get acquainted time. Coffee, juice and doughnuts will be served until 8:15 when the meeting officially begins. All meetings will be held in the city council room directly across from the Historic Perry Station. Asubstantial number of out of town attendees have already registered. The meeting will focus on history of The South Georgia Railway and the Live Oak, Perry & Gulf Railroad Company, which became subsidiaries of the Georgia Southern & Florida Railway in 1954. Presentations will be made by Dr. Revis Butler of Atlanta, grandson of Thomas Dowling, founder of the LOP&G and Dowling Park and L. A. Bailey of Clearwater, retired after a long career as a telegraph operator and agent for the Atlantic Coast Line Railroad and later a banking company executive. Russell Tedder, retired after 46 years in the shortline railroad industry, will conduct the meeting and also make presentations. He worked at the Historic Perry Station as clerk, agent and train dispatcher for the LOP&G and South Georgia from 1951 to 1966. At 2 p.m., following the presentations, a tour will be conducted to some of the old railroad sites west of Perry, including a view of the Gulf of Mexico. Although the LOP&G did not reach its originally intended destination of St. Marks, it did come within two miles of the Gulf at Mandalay.Spring Yard SaleMarch 20 Mrs. Vickers'class is taking donations for their Spring Yard Sale to be held March 20. Pick up available. Please call (386) 344-2993 for more information.Rec Dept. public meeting noticeMarch 25 Suwannee County is applying for a Recreational Trails Program Grant. Apublic meeting will be held at the William Guy Lemmon Memorial Park, located at the intersection of US 129 South and 296th Street at 5:30 pm on Thursday, March 25. The sole purpose of this meeting is to discuss a Recreational Trails Program Grant Application for the Sandy Point Trail. Anyone interested is invited to attend the meeting. Please call 386-362-3004 if you have any questions.'Fishing for the Kids' setMarch 27 The third annual Children's Miracle Network "Fishing for the Kids" fishing tournament is set for March 27. Registration is in the sporting goods department at Wal-Mart in Live Oak, or on the morning of March 27 in front of the store from 6-8 a.m. No registrations after 8 a.m. Weigh-in will be in the lot beside Big Daddy's BBQ. There will be fishing games, a silent auction, and lots of fun for everyone.United Way annual meeting, awards banquet setMarch 30 United Way of Suwannee Valley will celebrate its awards banquet and annual meeting on Tuesday, March 30, at Lake City Community College Howard Conference Center. The event will begin with a social time from 5:30 to 6. Dinner will be served at 6 p.m., and the meeting will be conducted from 6 to 7:30 p.m. All individual contributors as well as organizational contributors are invited to attend this annual membership meeting. Call the United Way office at 752-5604 by March 23 to make reservations at $25 per person. Tables may be reserved for groups of eight. The event will highlight the youth from the area schools, including Columbia High School, Suwannee High School, Hamilton High School and Fort White High School, who visited United Way affiliated agencies and spoke about their experiences and community volunteerism during the campaign season events. The event will include the recognition of outstanding community volunteers and local company giving campaigns as well as the election of the 2009-2010 executive committee and board of directors. Again the 2009-2010 United Way community fundraising campaign season events have featured a "heads or tails" drawing. Guests are invited to bring $5 to participate. United Way of Suwannee Valley is a community impact and fundraising organization which, utilizing volunteers on all levels, advances the common good by identifying unmet community needs and seeking to alleviate those needs through United Way of Suwannee Valley initiatives and the funding of affiliated health and human service agencies.Web challenge could benefit animal shelterThrough mid-April The Suwannee County Animal Control Shelter is entered into a shelter challenge sponsored by Petfinders and the animal rescue site. In order to win we need everyone C C a a l l e e n n d d a a r r o o f f E E v v e e n n t t s s CONTINUED ON PAGE9
PAGE 21
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida MARCH 17 & 18,2010,PAGE 9 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA 581451-FLAW OFFICE OF TRACY PHILLIPS, PA. 571322-F C C a a l l e e n n d d a a r r o o f f E E v v e e n n t t s sto log onto www.theanimalrescuesite.com and vote for Suwannee County Animal Control Shelter. You can do this once a day. The contest runs through mid-April. Please, we need your help and it only takes a few minutes a day. Not only can we possibly win the grand prize of $100,000 but there are weekly prizes also.Suwannee High Class of 1980The Suwannee High Class of 1980 is planning their 30 year class reunion. If you were a member, had a child, sibling or relative as part of the graduating class, please email your name (maiden and married), address, phone number and email address to shsclass1980@yahoo.com. Or call 386-362-6309 to leave a message. We look forward to hearing from you and seeing you at the reunion.Senior Citizen ClubMadison Travel & ToursJune 9-17 New York City "The Big Apple," 9 days, 8 nights June 9-17, 2010. Total Cost $949. Final payment due by 4/3/2010. For more information contact Charlene and Walter Howell (386) 842-2241.Senior Citizen ClubMadison Travel & ToursOct. 14-26 Las Vegas and the Grand Canyon 13 days, 12 nights Oct. 14-26, 2010. Total Cost $1220. Final payment due by 8/8/2010. For more information contact Charlene and Walter Howell (386) 842-2241.Senior Citizen ClubMadison Travel & ToursDec. 6-10 Smoky Mountains "Show Trip" 5 days, 4 nights Dec. 6-10, 2010. Total Cost $490. Final payment due by 9/30/10. For more information contact Charlene and Walter Howell (386) 842-2241. By Steve Woodhouse CNHI News Service The cynics and critics can all say we've seen this movie 1,000 times before. Ageeky guy lands a beautiful girl despite all odds. To them I say, so what? It made me laugh and what else is a comedy supposed to do? Kirk (Jay Baruchel) comes to the screen as a cross between French Stewart and a nerdy James Dean. Completely skinny and devoid of muscle tone, his job with the TSAbrings him in contact with hot party planner, Molly (Alice Eve). Molly, sick of dating hunky dudes who cheat on her, likes Kirk and gives him a chance. They start going out and the story, somewhat formulaic, proceeds. However, it proceeds with a great deal of laughter. Supporting Kirk throughout his courtship of Molly are his three friends, Stainer (TJ Miller), Jack (Mike Vogel) and Devon (Nate Torrence). Each one represents an aspect of Kirk's personality. It's as though he's having a conversation with himself each time he talks with them. His internal struggle of wondering if he is truly worthy of being with someone as gorgeous as Molly is played out through his conversations with them. Stainer is the typical foul-mouthed, boastful buddy who moonlights as a Daryl Hall impersonator. He represents Kirk's jaded feeling after being dumped by former girlfriend Marnie (Lindsay Sloane). Director Jim Field Smith does not even try to hide this very well, as we learn Stainer has gone through the same inferiority complex with another girl that Kirk is facing with Molly. Jack is the good-looking, quiet guy we don't hear much from. Probably because Kirk is neither good-looking nor confident enough to carry a presence just by being in a room. Then there's Devon, the chubby, married guy obsessed with Disney cartoon depictions of romance. Obviously, Devon is Kirk's sentimental side, which Kirk keeps guarded throughout the movie. We see Kirk as he would probably make himself if he had the ability in Molly's ex, Cam (Geoff Stults Ñ even that guy's name sounds cool). Cam is a pilot, which Kirk aspires to be, as well as confident and ridiculously good-looking. Who wouldn't want to be this guy? Maybe I read too much into characters. I don't know. This is just what I saw while I was laughing myself silly. The performances in this film were pretty good. Kyle Bornheimer is brilliant as Kirk's idiotic older brother and Sloane does well in the witchy ex-girlfriend role. This film will make you uncomfortable and probably gross you out. That is, unless you've seen enough of these films that you have become slightly desensitized to it. However, the gross scenes are brief and do not take away from the overall enjoyment. They are not overdone and they are integral to the storyline. This film is meant to make you laugh and I, as well as the rest of the crowd in the theater, did just that. Enjoy it for what it is worth and remember that in this world, people like you for who you are. You should like yourself as well. This film is rated R. Steve Woodhouse writes for the Knoxville (Iowa) Journal.ÔShe's Out of My League':Ahome run
PAGE 22
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 10,MARCH 17 & 18,2010 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA Each Kit includes: 3 Bright 11”x 14”All-weather Signs Over 275 Pre-Priced Labels Successful Tips for a “No Hassle”Sale Pre-Sale Checklist Sales Record FormGet Your Yard Sale KitAnd Make Your Event a Success! ! FreeRun your Yard Sale in the Wednesday North Florida Focus & Friday Suwannee Democrat Classifieds and get the Yard Sale Kit for FREE.Deadline for placing your yard sale is Friday at 11:00 a.m.569561-F Each Kit Includes: ! "#$% &'( ()*Sell Your Car for “Top Dollar” FreeRun your Car For Sale classified in the Wednesday North Florida Focus & Friday Suwannee Democrat Classifieds and get the Car Kit for FREE.Deadline for placing your ad is Friday at 11:00 a.m.*Not valid with the $18.95 specialGet your Car For Sale Kit*569562-F 11am til 1pm Senior Citizens Day Free Admission & Lunch April 6 5K Walk/Run April 3 8 am Talent Show 6 pm nightly April 5, 6 and 9, 2010 Youth Dair y Show, Heifer, Steer & Hog Show, and Goat Show Demolition Derby April 10, 7pmCelebrating 95 years of traditionApril 2 April 10, 2010Suwannee County Fairgrounds (Newburn Rd.) Live OakSuwannee County Fair Livestock Show and Sale For more information call (386) 362-FAIRCheck us out on Facebook... Suwannee County Fair April 9; 7:30 p.m. Lawn Mower derby, mini van derby and pickup derby April 10; 1 p.m. Flat drags quadrunners and motorcycle Suwannee County Fair and Suwannee County Riding Club present: Barrel Race and Team Roping4-D Barrell Racing: April 2nd 7 p.m. Team Roping: Draw-Pot Team Roping starts at 12 Noon, April 3 Open Mic Night April 2, 3, 10; 7 p.m.584139-F By John Pastor Sonic hedgehog, a gene that plays a crucial rule in the positioning and growth of limbs, fingers and toes, has been confirmed in an unexpected place in the embryos of developing mice Ñ the layer of cells that creates the skin. Named for a video game character, Sonic hedgehog describes both a gene and the protein it produces in the body. Its study is important to increase understanding of human birth defects. It was thought to be exclusively present in the cell layer that builds bone and muscle, called the mesoderm. But University of Florida Genetics Institute researchers have discovered that Sonic hedgehog is also at work in mice limb buds in what is known as the ectoderm, the cell layer that gives rise to the skin in vertebrates. Finding Sonic hedgehog in this layer of cells is loosely akin to discovering that yeast has crept from the batter to the frosting, where it has the surprising effect of limiting how much the cake will rise. More literally, instead of causing appendages to grow, Sonic hedgehog seems to act as a failsafe mechanism to keep additional digits from developing. "Sonic hedgehog protein determines how your limbs form, and why your pinky is at the bottom of your hand and your thumb is at the top," said Brian D. Harfe, an associate professor of molecular genetics and microbiology at the UF College of Medicine. "But what's been previously published is only part of the picture. We determined that Sonic hedgehog signaling is required in the ectoderm to have normal digit formation. Get rid of it, and an extra digit forms." In this case, when scientists disrupted Sonic hedgehog signaling in a small region of the limb buds of embryonic mice, an additional digit began to arise in what would be the mouse paw. The discovery, to appear online in this week's Proceedings of the National Academy of Sciences, suggests that Sonic hedgehog's role in the growth of appendages is far more complex than originally thought. Developmental biologists may have to rethink established theories about how limbs are patterned in vertebrates Ñ an effort that could provide insight into human birth defects. "We used technology where a viral protein seeks out specific sequences of DNA," said Cortney M. Bouldin, a graduate student in the Interdisciplinary Program in Biomedical Sciences in the department of molecular genetics and microbiology. "We concentrated on disabling a protein essential for Sonic hedgehog signaling. Although it has been removed from the limb before, we wanted to specifically remove it from the ectoderm. When we did that, in the latter stages of development, we saw extra cartilage and the early beginnings of another digit." Sonic hedgehog signaling in the ectoderm of limb buds may act as a buffering system that prevents unneeded growth, Bouldin said. The UF research was sparked by studies of gene activity in the limb buds of mice by William J. Scott, a professor of pediatrics at the University of Cincinnati. Scott used a microarray experiment to examine gene expression levels in the ectoderm of mice limb buds, finding activity that could not be possible without the presence of Sonic hedgehog. UF researchers were able to advance this investigation from cell studies to developing mice embryos by knocking out gene expression in a small region of the ectodermal layer. It allowed them to observe early limb development in the absence of Sonic hedgehog signaling. "The view had been if you reduce signaling, if anything you would get fewer fingers," said Scott, who did not participate in the UF research. "We now know we can't disregard Sonic hedgehog signaling in the ectoderm. It still has its predominant effect in the tissue where it is made, but it does something more than we thought it did previously. When we try to understand problems that arise with limb growth in humans, we will be able to examine those possibilities." Harfe said the next phase of the work will be to observe what happens when Sonic hedgehog signaling is disrupted through larger segments of the ectodermal ! " " #$ Brian D. Harfe, an associate professor of molecular genetics and microbiology at the UF College of Medicine. Courtesy photolayer. Ultimately, researchers hope the work will lead to quality of life improvements for people. "We would like to repair limb defects in humans and enhance regeneration of limbs, helping people who might cut off fingers in an accident, for example," Harfe said. The work was funded by the UF College of Medicine. UFPApresents Buffalo Philharmonic Orchestra JoAnn Faletta, Music Director with Fabio Bidini, Piano Thursday, March 18, 7:30 p.m. Reserved Seating: $34.00 $55.25 For more information, call 352-392-2787 or visit www.performingarts.ufl.edu UFPApresents Menahem Pressler & the New York Chamber Soloists, Winds Sunday, March 21, 2 p.m. University Auditorium Reserved Seating: $28.50 $39.25 For more information, call 352-392-2787 or visit www.performingarts.ufl.edu UFPApresents Abraham Inc. Tuesday, March 23, 7:30 p.m. Reserved Seating: $23.25 $39.25 For more information, call 352-392-2787 or visit www.performingarts.ufl.edu UFPApresents No Southern Accent Thursday, March 25, 7:30 p.m. Sunday, March 28, 2 p.m. Squitieri Studio Theatre Reserved Seating: $15.75 For more information, call 352-392-2787 or visit www.performingarts.ufl.edu UFPApresents One Night of Queen Performed by Gary Mullen & The Works Tuesday, March 30, 7:30 p.m. Reserved Seating: $28.50 $39.25 For more information, call 352-392-2787UF performing arts calendar of eventsMarch 18 April 17, 2010 Curtis M. Phillips Center for the Performing Arts University Auditorium Alan & Carol Squitieri Studio Theatre SEEUF,PAGE15
PAGE 23
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida MARCH 17 & 18,2010,PAGE 11 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA Contact Monja Slater at the Suwannee Democrat to advertise on zip2save.com 386-362-1734 • 1-800-525-4182573075-F 571106-Fwww.nflaonline.com $ 15,812 $ 19,500 $ 21,450 $ 13,880 WOW! $ 149 Only WhatÂs at the end of your Rainbow? w/ $1,000 Toyota Ownership Discount w/ $1,000 Toyota Ownership Discount Buy It for $ 19,910 $ 14,156 $ 28,440 $ 12 945 $ 14,845 $ 10,650 $ 22,135 $ 19,100 $ 209 Only w/ $1,000 Toyota Ownership Discount $ 12,900 $ 14,988 $ 3,927 Suwannee Valley Humane Society 1156 SE Bisbee Loop Madison, Florida 32340 Two miles south of Lee off C.R. 255 From 10 Exit 262. Take C.R.255 north .8 of a mile We are a Limited Space Shelter (no kill). You must check with us prior to bringing a drop-off animal to the shelter. Hours: Tues. to Sat. 10:00 to 2:00, or by appointment. We are closed on Sunday and Mondays. Visit our website and see the animals that need a really good home at www.suwanneevalleyhumanesociety.org or at our e-mail address suwanneevalley@embarqmail.com. We service the surrounding counties of Madison, Suwannee, Hamilton, Lafayette, Columbia and Taylor. We do not pick up animals. Lost and Found Pets: If you have lost a pet or found one, the humane society will help you find your pet. Call us at (850) 9719904 or toll free at 1-866-236-7812. Leave a message if we are closed, we will return your call. Remember to always call your local animal controls or shelters if you have found an animal or lost a pet. THRIFTSTORE: You must come see our thrift stores, if you have not been here before. We have three stores, a boutique, clothing and furniture. We are always looking for donations for the stores. Please keep us in mind if you have items in good condition you would like to donate to us. RECYCLING: We have a recycling bin on our property newspapers, magazines, and catalogs. The bin will take all kinds of paper. We also have a bin in Live Oak at 305 Pinewood Drive, next to Johnson's Appliance/Radio Shack. We also collect aluminum cans to recycle. Just bring them to the shelter. All the money goes to help the homeless animals. Our adoption is $65.00, which INCLUDES, spay/neuter, wormed, boostshots, heartworm/feline leukemia tested, micro chips, and rabies shot (if old enough). We also a Diamond in the Ruff program, ask about it. Please come visit us, our animals would love to meet you. We are always looking for volunteers. We need help cleaning cages, dishes etc, as well as the thrift store could use more help. We would love any time you could give us. FEATURED ANIMALS FOR ADOPTIONS DOGS: # 3783 Squiggles is a female, Boxer/ Mix. She is 4 1/2 months old. She is brown with black and white trim. She weighs 23.2 lbs. # 3774 Gage is an 11 month old, Lab mix. He is a cream color male, who weighs 53.2 lbs. # 3772 Sonja is a female, Lab mix. She is 9 months old and is all tan. She weighs 42.4 lbs. # 3748 Crissy is a female, Lab mix. She is 5 months old. She is black and has white on her back and neck. # 3746 Carol is a 5 month old, lab mix. She is black with a white streak on her nose. CATS: # 3777 Meko is a white light color calico. She is 11SUWANNEE VALLEYHUMANE SOCIETYCRITTER CORNERmonths old and weighs 5 lbs. # 3775 Gator is an orange and white kitty. He is 11 months old and weighs 6.11 1/2 lbs. # 3731 Unique is a 9 month old, white tabby. She weighs 6.15 lbs. # 3726 October is a black tabby. She is 1 year 4 months old. She weighs 8.4 lbs. # 3711 Honey is a tan tabby. She is 10 months old. She weighs 8.8 1/2 lbs. LOSTand FOUND FOUND: Was found 6 miles west of I-75 off of Rte.6. Amale, Lab mix, he is more blond color than yellow. He has large big feet and is real friendly. He has a hurt leg. Show up around March 5th. If this is your dog, please call Opal Workman @ 386-938 5142. Our Web site has changed to www.suwanneevalleyhumanesociety.org plus you can view the animals through www.petango.com or you can find us on www.petfinder.com. * April 28: The series concludes with a presentation by John D. Hofmeister, former president of Shell Oil and now a fiery advocate for overhauling the federal government's energy policies. Hofmeister is the founder of the nonprofit Citizens for Affordable Energy; he warns of dire consequences if the federal government continues on its current path, which in his words represents "40 years of failure." Tickets are now on sale at the Fine Arts Ticket Office or online at www.origins10.fsu.edu. For more information, contact Frank Stephenson, Origins Ô10 coordinator, at 850-644-8634 or fstephenson@fsu.edu. Continued From Page 3All-star lineup of speakers planned for Origins Ô10 series at FSU
PAGE 24
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 12,MARCH 17 & 18,2010 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA THESometimes complaints land in my inbox. Last week, I answered a note from a reader about couponing and processed foods. Here's a letter from a reader who wonders about the environmental impact of coupon shopping. Q: "Saving money isn't the only consideration in making choices. What about all the energy that goes into making those plastic, glass and metal containers products are packaged in? Excess packaging is just one of the many things to think about when buying a product. Frugality is a good value, but so is making conservative use of our Earth's natural resources so there will be some left long after we're gone." A: It dismays me that some people blame coupon shoppers for excess packaging so often seen on products at the grocery store. This is not the first time I've heard this argument, either. I'm no fan of packaging overload. My household recycles as much as possible. But packaging is a reality of our modern world. It's difficult to buy a gallon of milk if it doesn't come in a carton or a jug. And it would nearly be impossible à not to mention messy à to bring home a jar of pasta sauce without the jar! Unless you grow all of your household's food in a very large garden and then can and store all the produce for use during the winter months, at some point you need to purchase products at a store. And the products you purchase will be covered in cardboard, plastic, glass or metal packaging. Products are packaged in various ways, for various reasons: to protect the nutritional content of a product, to maintain product integrity and even, unfortunately, to deter theft. I've often noted that the large, clear bubble clamshell around a razor is many times larger than the razor itself. Wasteful packaging? Possibly. But in the real world, the packaging also deters theft. Not long ago, a couple made news in my area when they were arrested for trying to shoplift razors from a supermarket. They had emptied a box of cereal, removed $510 worth of razors from large, plastic packages and then put the razors in the cereal box. They tried to purchase the overloaded box of "cereal" in the self-checkout lane. The checkout register's scale notified the store's staff that the weight of the item being scanned was much heavier than a normal box of cereal. The pair was arrested. Razors are typically packaged in a large plastic bubble because they are expensive and the bulky package deters theft. Sometimes, the plastic bubble also may contain a radio-frequency identification (RFID) chip to trigger an anti-theft alert if the product is taken out of the store before being disabled. Incidentally, had the razor shoplifters been good coupon shoppers, they could have had just about as many razors as they wanted, free of charge. Those "expensive" razors frequently are free with coupons during good sales! Here's an eco issue all good coupon shoppers face. Do we invest in a reusable razor and buy replacement blades (which come in a cardboard package but are rarely on sale) or do we rely on the throwaway razors we generally can receive for free (in giant plastic packages) using coupons? I can't, in good conscience, purchase razor blades when I can get razors for free on a regular basis. Buying more razors in "big plastic bubbles" may not be the environmental thing to do, but with coupons, it is the economical thing to do. And, as this is a coupon savings column, it's no secret on which side of that issue I sit. While I'm always mindful of not wanting to deplete the earth's resources, I also can't in good conscience waste my household's financial resources, either. As with all things, you must decide for yourself which choice makes more sense. Next week, we'll hear from another reader who asks a "quality versus price" question regarding meats. Jill Cataldo Jill Cataldo, a coupon workshop instructor, writer and mother of three, never passes up a good deal. Learn more about couponing at her Web site, www.supercouponing.com. E-mail your own couponing victories and questions to jill@ctwfeatures.com. Copyright © CTW FeaturesJill Cataldo saves hundreds on groceries by making the most of the common coupon. You can, too. Here's how. Reader Gripe: Couponers Court Eco DisasterBy Jill Cataldo John's Painting Free Estimate with couponPressure Washing • Epoxy Garage Floor Coating386-688-3000Licensed • Insured581106-F Receive a Free Estimate with coupon581105-F COUPON Lottie's Laundry(386) 362-4085Specializing in: Cleaning, Press Only, Alternations and all your other cleaning needs.1435 North Ohio Avenue Live Oak, FL 32064 Located in Badcock's PlazaAlways giving you the right look!Monday-Friday 8AM-6PMSaturday 8AM-12NoonLottie's Laundry 10% OFF with this coupon581102-F Free Installation with coupon 150 Channels for $34.99No Credit Card Required386-344-2957581109-F $300offany cake 817 S. Ohio, Live Oak 362-7009581100-F A Deal You Can't Refuse!386-965-7188carpetcleaninglakecity.com100% SATISFACTION GUARANTEED Carpet Steam Cleaned Includes: Chemical Pre-Spray, Chemical Injected Steam Extraction Deodorizer *Over 250sf considered 2 rooms !"#$ %&'(!"#$ )&'*!"#$ (&'+*Additional charge for heavy soil removal581104-F The Golden Needle would like to congratulate you on your engagement. To honor this special occasion, we would like to give you 40% off any bridal gown in stock. Please call to set up a reservation or stop by and we will help you find the gown of your dreams. The Golden NeedleHoliday Proms581110-F Better Parking, Better Hours, More Inventory 1102 Ohio Ave. South (Next to Advance Auto)386-362-4851,-./01-202/23-581099-FHours: Mon.-Fri. 9 a.m.-6 p.m.; Saturday 9 a.m.-5 p.m. $5 offany purchase of$25 or more 581108-F$15 OFF Service CallReg. $90 for 1st Hour. Parts not Included • Full Service & Repairs • Trenching • Backhoe Services • New Construction • Remodeling • Drain Cleaning & Sewer Repair • Hi-Velocity Water Jetting • All Work Guaranteed386-752-8656Mark & Cody Barrs, Owner State Certified & Insured CFC 05219Family Owned & Operated Serving Lake City, Live Oak & Surrounding AreasCommercial • Residential "Anytime is Donut Time"Hours: Mon.-Fri. 5 a.m. 5 p.m.; Sat. 7 a.m. 2 p.m.Daily Lunch SpecialsNow serving Breakfast & Lunch Sandwiches Call ahead for no waiting386-330-2950 Free Coffee w/Dozen Donuts581098-F 300 East Howard St. (US90), Live Oak(Across from Town & Country Tire)
PAGE 25
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida MARCH 17 & 18,2010,PAGE 13 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA 571306-Fwww.nflaonline.com Businesses from A to Z CHOOSE YOUR LETTER! PUBLISHES EVERY WEDNESDAY! $5.00 PER WEEK CALL JANICE GANOTE 386-362-1734AB EF IKLN O P Q T UWXZ574099-FAPAAuto Parts 209 Duval St. NW 386-362-2329574100-F Place Your Ad Here!!Marks The Spot!nique Giftsuick SaleBuy this space $5.00 per weekeen Deal$5.00 a weekandclearingmmigrationLive Oak Plumbing, Inc.UTBACK SERVICESDlueprintsPrinting Copying 621 Ohio Ave. North Live Oak 386-362-1848XCELLENT386-294-2761574103-FRecyclingDEAL ONLY $5.00 A WEEKURNITURE,VERYGOOD PRICE $5.00 PER WEEK574101-Fwww.fjslawcenter.comLUMBERRepairs/Remodel New ConstructionState Lic. #CFC1427438386-362-1767574102-FSGreen Card; Spouse/Family K Visa; Student F Visa; Worker HB Visa; Investor E Visa; Change of Status 386-362-2030UTO & TRUCK920 E. Main, Mayo Sammy Buchanan Mon-Fri. 8 a.m.-6 p.m.SPECIALISTG JMAGRI-METAL SUPPLY232 SE Ind. Park Circle Mayo, FL 32066 386-688-7397574098-FOWThis space$5.00 CALL TODAYAXPREPARATIONOWIE$5.00 a week CALL TODAY!574104-Faddy'sGun ShopBuy Sell Trade Come To Daddy's, We'll Take Care of You!386-294-1532574105-Fchestsandboxes.com Quality items for unique giftsCASH PAIDJunk Cars, Trucks, Tractors & Scrap Metal Trailers, No MH 386-965-1423 386-365-4879574760-FHELPYOUR BUSINESS!ADVERTISE HERE! ONLY$5.00 A WEEKYOU CAN SUCCEEDWITH THIS AD! CALL TODAY! $5.00 PER WEEKAuto/Truck Repairs Beat Any Price Guaranteed I Pick-Up Free, If I Do Repairs Free Estimates All Work Fully Warranted Lic. # 3054904-422-7733574107-FCReasonable Fees Paper Returns Only Retired Accountant 386-362-1326575247-FHORT TERM RENTALNew 2BR/2BA fully furnished. Bring your own food, beverages & toothbrush 3 day Minimum 386-842-2006574761-F 574049-FANNIE'S VARIETY575420-F• Clothing • Shoes • Books • Alterations And Much More!163 W. Mail St., Suite 100 Mayo, FL 386-965-7704578141-F 578144-FERAMIC TILE& LAMINATE WOOD FLOORS Installations 30+ years experience Free Estimates!!386-647-6924 BILL'S BACKHOE SERVICE12150 196th Terrace O'Brien, FL 32071 386-364-1418 or 386-590-2882Bushogging, Stump Removal, Discing, FencingPOWER TOOLS, HAND TOOLS & MISC.By Appointment 386-330-6621578636-F386-776-2342580595-Filbert'sLawn Service• Full Lawn Service • Brush Hogging • Pressure Washing • Leaf Vaccuming GAINESVILLE The Swamp Hunt, a large-scale scavenger hunt at the University of Florida and the surrounding Gainesville area, is set for Saturday, March 27. The event is sponsored by Health Troupe, a student organization at UF. All proceeds will be donated to the American Diabetes Association. Teams consisting of 6-8 individuals will compete for top prizes. The Hunt will kickoff at 11 a.m. Teams are to pick up their hunt list anytime from 11 a.m. noon on the North Terrace of the Reitz Union at the University of Florida. Teams must return to Sharab Lounge by 9 p.m. for the after party, which will end an evening of musical entertainment and prizes. Non participating individuals are welcome to join in on the party at Sharab for a $5 cover fee to be donated to the American Diabetes Association. Individuals must register on the event's Web site. The cost per individual is $10. This fee includes registration, food, and after party entrance. To register and collect further information, visit www.theswamphunt.com. Shoes: "Black Vinyl Shoes" Grade: A By Jeremiah Tucker CNHI News Service Shoes was one of the first bands to have its music videos appear on MTV in the early Ô80s. "Tomorrow Night," you remember that one? How about "Too Late"? Both songs are from its major label debut "Present Tense," but it's not surprising if you've never heard them because even if it could be argued that Shoes indeed achieved mainstream popularity, it was certainly short-lived. The band released three albums between 1979 and 1982 on Elektra, and then retreated home to Illinois, sporadically releasing music on its own label. Shoes'made melodic guitar pop with warm, ample harmonies, a style that was momentarily in fashion in the late Ô70s and early Ô80s, perhaps because it seemed like a less fraught iteration of the punk and emerging new wave scenes. "Black Vinyl Shoes," the band's first nationwide release and its best album, earned Shoes its deal with Elektra, but all of the band's noblest attributes were crystallized in these 15 songs. I recently listened to "Black Vinyl Shoes" after having not played it in more than five years, and I was struck not only by how great it is but how contemporary it sounds. With bands like the San Francisco group Girls garnering acclaim for pop songs recorded with intentionally low sonic fidelity, "Black Vinyl Shoes," recorded on 4-track in a living room in 1977, sounds absolutely au courant. Whereas today garage bands have access to cheap software that can give their recordings a professional sheen, Shoes were limited by circumstance, not by choice. They were, however, more ardent students of pop history than most. Part of "Black Vinyl Shoes" charm is that the songs exhibit the ambition of The Beatles and the budget of recent high school graduates, which is what the Shoes were. There's something affecting about such careful, lovingly-crafted pop songs presented so plainly. But thank God when the record finally got noticed for the power pop classic that it was, it wasn't ever rerecorded. Sometimes limits enhance. No one wishes Picasso's blue period featured more color. Luckily, "Black Vinyl Shoes" has entered the digital age and is now available on iTunes. Download "Tragedy," "Running Start," "Someone Finer," "Not Me" and "Fire For Awhile." Song of the week Ryan Bingham: "The Weary Kind"Shoes' album remains a pop power classic"The Weary Kind" won the Oscar Sunday for Best Original Song, and it was deserved. Written by producer T. Bone Burnett and alt-country singer-songwriter Ryan Bingham, "The Weary Kind" goes some way to making the movie "Crazy Heart" believable. In the film, when the washed-up, alcoholic protagonist Bad Blake played by Jeff Bridges, who won the Oscar for Best Actor Sunday for his performance writes the song, it redeems his reputation as a country legend. And "The Weary Kind" is exactly the kind of scaledback, classicist country song that someone who played outlaw country in the Ô70s would write late in their career in a bid for a critical revival. But as performed by Bingham who began his music career after washing out as a bull rider and played in the same kind of dive bars Blake plays in the move it sounds more like the spare, beaten-down reflections that populate Bruce Springsteen's "Nebraska" than, say, something off Johnny Cash's "American Recordings" series. New release Pavement: "Quarantine the Past: The Best of Pavement" Grade: A The best indie rock band of the Ô90s finally gets a greatest-hits compilation just in time for its reunion tour this summer. Stephen Malkmus, the band's lead singer and songwriter, in many ways seemed to epitomize the Ô90s slacker phenomenon while simultaneously seeming above trends. Perhaps that's why these 23 songs sound both fresh and incredibly tied to a now faraway decade. Regardless, there isn't a dud here. It's a must buy. Jeremiah Tucker writes for The Joplin (Mo.) Globe. CNHI News Service distributes his column.
PAGE 26
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida PAGE 14,MARCH 17 & 18,2010 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA
PAGE 27
CYAN MAGENTA YELLOW BLACK CYAN MAGENTA YELLOW BLACK Odd Even U U new new Odd EvenU U new new North Florida MARCH 17 & 18,2010,PAGE 15 CLASSIFIED MARKETPLACE WWW.NFLAONLINE.COM SERVING NORTH FLORIDA AND SOUTH GEORGIA RMCHEVY.COM CONTACT JESSE 24/7 See Dealer for Details NOW MSRP 2010 CADILLAC SRX 2010 CHEVY CAMARO LS 2010 CHEVY AVEO10G0007 10C0017/MO* NEW 2009 CHEVY SILVERADO 4X4 EXT. CAB STK#10C0034B V6, LOW MILES STK#110N9097A 1500, SLT-1 STK#09C9240B 1500, SL STK#09C9240B 2008 Chevy Silverado 1500, LT STK#08P0022 STK#10N0046A LT STK#A7102656 STK#10P0004 1500 CLSC, W/T STK#07P0005 STK#08P0021A SAVE $ 8,543 YouÂll be at Lease Payment NEED CREDIT RESCUE? WE CAN HELP YOU! 10C0029 Oscar-nominated writer/director Oren Moverman, acclaimed actor Ben Foster coming to RinglingSARASOTARingling College of Art and Design has announced that it will host visiting director and writer Oren Moverman and actor Ben Foster this month as part of the College's Digital Filmmaking Studio Lab program. Moverman and Foster will work with Ringling College Digital Filmmaking students as part of the Lab's collaborative orientation toward driving direct creative interaction between students and film industry luminaries. Moverman and Foster recently worked together on "The Messenger," which received two Academy Award nominations Best Original Screenplay (Moverman cowrote the film) and Best Supporting Actor (Woody Harrelson.) The duo will work with students on campus on Thursday, March 24th, with a press briefing planned for 2 p.m. at the Ann and Alfred Goldstein Center. At 7:30 pm that evening, the Sarasota Film Society will offer a free showing of Mr. Moverman's Bob Dylan biopic ÔI'm Not There'as part of the ongoing ÔRingling Reels and Retrospectives'series at Burns Court Cinema. On Friday, March 25th at 10pm the Film Society will screen Ben Foster's "Pandorum." The screenings are cosponsored by the Sarasota County Film Commission and are free and open to the general public. Moverman's expertise as a writer and director aligns well with the foundation of the Digital Filmmaking Studio Lab's focus on ÔStory'as the cornerstone of filmmaking. Story drives everything in film the script, production design, directing, cinematography, editing, marketing, etc. "Story goes to the heart of what our industry will always need Ñ no matter how the technology changes and advances," said Ringling College Digital Filmmaking Department Head Bradley Battersby "Just as it is today with current industry leaders like Jim Cameron, Steven Spielberg and Brad Bird, the best storytellers are destined to be the future leaders of our art and industry. At RinOren Moverman, Ben Foster. Courtesy photo gling our focus is on teaching to create great story and then reinforcing it with the best production tools, techniques and technologies available to bring these stories to life." The Ringling College Digital Filmmaking Studio Lab, launched this past January in association with Future Films, LLC, brings some of the world's most renowned filmmakers, producers and film industry leaders to Sarasota to work collaboratively with Ringling students on learning the process of motion picture and television development. Industry luminaries that have lectured as part of the Digital Filmmaking Studio Lab include director Werner Herzog, who inaugurated the Lab in January, and producer Paul Schiff, who screened his new film starring Michael Douglas, ÔSolitary Man,'for students and donors. Ringling College President Larry Thompson and Producer Paul Schiff recently discussed the Digital Filmmaking Lab on air with SWFlorida National Public Radio News Manager Amy Tardif. The interview is accessible at http://wgcu.org/audioplayer/6665.aspx. For more information on the program, including signing up for program updates, go to www.ringling.edu. or visit www.performingarts.ufl.edu UFPApresents The Kin Saturday, April 3, 7:30 p.m. Squitieri Studio Theatre Reserved Seating: $34.00 For more information, call 352-392-2787 or visit www.performingarts.ufl.edu UFPApresents Pat Metheny The Orchestrion Tour Sunday, April 11, 7:30 p.m. Reserved Seating: $28.50 $44.50 For more information, call 352-392-2787 or visit www.performingarts.ufl.edu UFPApresents University of Florida Symphony Orchestra Raymond Chobaz, Conductor Saturday, April 17, 7:30 p.m. Reserved Seating: $15.00 $25.00 For more information, call 352-392-2787 or visit www.performingarts.ufl.edu Events, dates, times and programs are subject to change. For updates, please visit the University of Florida Performing Arts web site at www.performingarts.ufl.edu and click on the "Events" link. Continued From Page 10UF performing arts calendar of eventsMarch 18 April 17, 2010 Curtis M. Phillips Center for the Performing Arts University Auditorium Alan & Carol Squitieri Studio Theatre
PAGE 28
qY se gs moe^ s Yohhd [ rhs qi qY se gs moe^ s Yohhd [ rhs qi dSS o9 RE ] ] ER8 ER8 dSS o9 RE ] ] ER8 ER8 eD? R n?DG [d[. =C(C hkro` ^Y / " , CCC `ors ^o b(CC(=& =C(C m`sep qlo`dioo / x , CCC `ors ^o b(CCC(( b(CCCC# =C(C qdggsepo` / x , CCC `ors ^o cH;> V TV>R DQ ODER6. cH;> V TV>R DQ ODER6. cH;> V TV>R DQ ODER6. cH;> V TV>R DQ ODER6. cH;> V TV>R DQ ODER6. cH;> V TV>R DQ ODER6. k^0_ jooc _os_de. _]e k_ _lkekem rk`p_ s`o _kemkem roo_ s`o s r]XXke0 [o0`o _[oo^oekem ^lo poshmo^ s qs_o dn ldeoY [k^l o\o` Y \olkqho c]`qls_op. ro_^ chsqo ^d r]Y s eo[ ^`]qi = C ( C = C ( C ro_^ chsqo ^d r]Y s eo[ ^`]qi = C ( C = C ( C =C(C `sg ("CC q`o[ [M EER? DQ =C(C \V HSD> rR>< DQ _D;u ^OVEJ 6D; QD? 6D;? TDEQMSRETRu =C( C gd^ d` ^`o ep ^` ]qi dn ^lo Yos gs`ql k_ gs`ql k_ gs`ql k_ ^`]qi gde^l ^`]qi gde^l ^`]qi gde^l sep ^lo posh_ s`o sep ^lo posh_ s`o sep ^lo posh_ s`o _[oooo ooo^.. ... _[oooo ooo^.. ... _[ooooooo^..... _D;HR? _VHR> lM> o7u =C(C _RU?ME P '\(CCC (* g_`c /=C,x& C 4 SM>TD; E< /( F /=C,(x ) W&C F /*%xWG QRRu C C C A A A s9 VMHVUHR ^D D. *C s \s khsrho =C(C [`semh o` qs __ r] `q l "xC= %%S8 9 ^OVEJ YD ; QD? \D _D; rR>< cHVTR M5R ;TJu _[ooooooo^. _[ooooooo^. _[ooooooo^. gs msXkeo0_
|
|