Citation
Gainesville daily sun

Material Information

Title:
Gainesville daily sun
Uniform Title:
Gainesville Daily Sun
Gainesville daily sun (Gainesville, Fla. 1903)
Running title:
Daily sun
Alternate Title:
Sun
Creator:
Gainesville daily sun
Place of Publication:
Gainesville, Fla.
Gainesville Fla
Publisher:
H.H. McCreary
Publication Date:
Frequency:
Daily (except Saturday)[-1938]
Daily (except Monday)[ FORMER <1903>-]
daily
normalized irregular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Gainesville (Fla.) ( lcsh )
Newspapers -- Alachua County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Alachua -- Gainesville
Coordinates:
29.665245 x -82.336097

Notes

Abstract:
The Daily Sun was based in Gainesville, the seat of Alachua County and shipping center for Florida’s citrus region. The newspaper was formed through the merger in 1890 of the Gainesville Advocate and the Daily Morning Record. The Daily Sun described itself as a “democratic” paper. It was published daily, except Mondays, by Henry Hamilton McCreary, the scion of a prominent southern family. After completing a degree at the University of Kentucky, McCreary established himself as a newspaper editor at the age of twenty. McCreary also rose to prominence as a politician in the Democratic Party, first as a city councilman and later as a member of the state assembly, to which he was re-elected several times. McCreary considered himself a staunch patriot and fervently supported industrialization as a means of strengthening Florida and the nation. McCreary’s wife, born Irene Richardson, was well connected in the civic networks of Gainesville and northeast Florida and served both as vice-president of the Florida Federation of Women’s Clubs and president of the United Daughters of the Confederacy. The Daily Sun was continued, in 1903, by the Gainesville Daily Sun which briefly carried the title of the Gainesville Sun.
Additional Physical Form:
Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.
Dates or Sequential Designation:
-58th year (July 24, 1938).
General Note:
Description based on: Vol. 20, no. 48 (Apr. 5, 1903).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
32994415 ( OCLC )
002027051 ( ALEPHBIBNUM )
sn 95026977 ( LCCN )
sn 95026977 ( LCCN )

Related Items

Related Item:
Gainesville sun (Gainesville, Fla. : 1903)
Preceded by:
Daily sun (Gainesville, Fla.)
Succeeded by:
Alachua County news (Gainesville, Fla. : 1934)
Succeeded by:
Gainesville daily sun and the Alachua County news

Downloads

This item has the following downloads:


Full Text

PAGE 1

THEGAINESVILLESUNAUGUST51909aPASSENGERSTATIONISNOWBEINGBUILTSEABOARDCARPENTERSBEGINWORKONBUILDINGStateThatBuildingWillBeoirwpittedinAboutThirtyDaysAttheLatestFromTiieadayaDallySunWorkonlbenewSeaboatBjiasBQBgetstationhasatlastbeenstartedaadwillberushedtcomnkiloDaafastanthecarpenterscandotheworkTheworkIsundertheaujicrvjalonofMrWinterandheBaysJbohavethebuildingcompletedwJlbtheforcehonowhasInabortthirtydaysJtwillbeUemostcoainlonUyap-portioneddepotinthinpartoftheStateOBthenorthsidethesttingJwJaghornBOthatlafuturenotnwillbeackedInandouttoJaterferewithtravelandthepornCOBwWgosoarrangedtOtpartiesitsunderfheedgesMIdltspoutofedlMgWoableweatherla99toandfrostthetrainsOIltiltsouthflWethebaggagewillkehHdlRfromVtruckandplacedjitceevclcvtplacesforthetrainInfftejdofpaMIngtPtothebaggagerealsJvubeenthecustomandtheporticosextenjoverthecarewhichwillprefectwwscngersfromralayweatherLavatorfeaadtoiletwillbear-rangedallthroughthebuildingandHwillhetwicesireoftheroomsBOWreservedforpaswhichwilleasilymeettheVaMdThisnatterhasbeesunderadylseMcntandtalkedoftorthepastyearormoreandtheyhaveatlastrottentheIAMtosuitthecitizensandfurtherwillsotbeexperiencedwhichfegoodnewstothetravelingpublicDeafnessCannotBeCuredhylocalapplicationsastheycannotreachthediseasedportionofthecarThereIsonlyonewaytocuredeafnessandthatIsbyconstitutionalremediesDeafnessIscausedbyanInflamedconditionofthemucousliningoftheEuntachlanTubeWhenthistubeInInflamedyouhavearumblingsoundorimperfecthearingandwhenitIsentirelyclosedDeaf-nessIstheresultandunlesstheIn-flammationcanbetakenoutandthistuberestoredtoItsnormalconditionhearingwillbodestroyedforeverwinecasesoutoftenarecausedbycatarrhwhichisnothingbutanIn-flamedconditionofthemucoussurfacesWowillgiveOneHundredDollarsforanyease9fDeafnesscausedbycatarrhthatcannotbecuredbyHallsCatarrhCureSendforcircuIidiawayJJllageIztplIIfxIwill-tI1getipsthettersIlayIj¬¬¬lorefreeFJCHENEYCOToledoOSoldbydruggists75cTakeHallsFamilyPillsforconsti-pationCHARMINGHOOSEPARTYATKING8LEYLAKEISTARKEAug2AlargehousepartychaperonedbyRevandMrsTCEdwardsofStarkearenowenjoyingthemselvesatthecosybunga-lowofJFKicklitcratKIngsIeyThecharmingMissRubyLcltucrofBartowthelovelyMissFreddieWainwrightofStarkethegenialMissJuliaBunchofGainesvilleandtheverypleasantMissElizabethMat-thewsofTacomaandMessrsBinandFrankMatthewsofTacomaJEThrasherofMlcanopyJamesVIdayofGainesvilleCharleyLucienWainwrightofStarkeandMasterHenryEdwardsofStarkecomprisethepartyproperwhileotherfriendsdropInoccasionallytoaddenjoy-mentOurownMissFreddieWalnwrightbyhersprightlinessandlove-linessIstheleadingspiritofthepartyandallgoesmerryasthemar-riagebellVagariesofaColdYoucanneverboquitesurewhereacoldIsgoingtohityouInthefullandwinteritmaysettleInthebowelsproducingseverepainInsum-meritmayyoucolicwithdlnr-rhoenorsummercomplaintDonotbealarmednortormentoiirwlfwithfearsofappendicitisrmrtaiiinutlonofthebowelsAtllitirtitoftinpainorcrampIPakillerInwarmswreliefwillcompauonePainkillerPinputupinalargomilitregularCicthe1Iwlrtiezar1giveLaket¬¬¬¬¬¬¬>ICECREAMII1caDishIStirapackageofijEIXrO-VKECREAMPowderkiloaquartofmilkandfreezecanbedunefanaboutUsminutesThereisBcthingtoaddbawilltafttetwoquartsifeUckmatorroutforMteltwodiibia-HhMtetedHedpe3JookFretHIGHSPRINGSNEWSHIGHSPRINGSFallenofStPetersburglavisitingrtendtiintownTheWoodmanoftheWorldSantaFeCampWU1giveairtcnlcatWashingtonSwingsounextWednes-dayAbandfromJacksonvillehasbeenengagedandagrandtimeisMuchInterestitbeingtakcjiinthepianoawldiamondringcontestsAtpresenthissSusieBryantandMissWillieCubankxareintheleadThemayfriendsofRevJCRogerthebelovedpastoroftheBjtlstchurchwillbsorrytolearnbeisstUJverysickItishopedthathisrecoverywillbospeedyMiwMargaretMerchantapopularyoungladyoGainesvillehadreturnedafterapleasantvisittothefoullyofuncleHSRich-ardsonMrsMPSummersandlittledaughterVerahategonetoLa-GrangeGawheretbeywilltjendtherestofthesummerMrsEKAndersonIudchildrenandMissAnnieLairdMontgomeryAlahavegonetoPennsylvaniaforthesummerMissCorinneHodgesafterapleas-antvisitInAtlantahasreturnedhomeDrBCHodgesininBaltimorewherehewenttoaccompanyMrsTurnerMarkeywhowentfortreat-mentInasanitariumMrMarkey-IsalsowithhiswifeTheyoungpeopleofHlhSpringsenjoyedabirthdayjrartygivenlastbyMissKateRichardsonEveryteamIntownwasengagedfortheoccasionandallreportamostde-lightfulUnitMrsMGKnightandchildrenleftSaturdayforNowberrytovisitMrKnightsmotherMTHHoltwhoItcriticallyIllMissMaggieMorrUonofInvernessisvisitingherparentsMrandMrsMCMorrisonmuchtothepleasureofhermanyHighSpringsfriendsIIIIIladointhiswayforUtepowdercurthiefhereisnocookorelsetodoethnrWlAleJNYAugLeverettepromisedtoaUtbIhomeheryandhealsartlspslteeaeeweek¬>¬¬=CuredHayFeverandSummerColdASNuRbaumIlatesvllleIndianawritesLastyearIsufferedforthreemonthswithasummercoldsodistressingthatItinterferedwithmybuslnesHIhadmanyofthesymp-tomsofhayfeverandadoctorsdidnotreachmycaseand1tookseveralmedicineswhichseem-edonlytoaggravateItFortunately1insisteduponhavingFoleysHoneyandTarItquicklycuredmeMywifehassinceusedFoleysHoneyandTarwithsamesuccessJVMcCollumCoNoticeWethetrusteesofMtPleasantMEchurchdoherebyagreenottoberesponsibleforanydebtsexceptInci-dentalexpensescontractedormadeagainstsaidchurchuntilaftertheBroomedebtispaidInfullLDavisBenJChildsHRichardsonJonasWallaceMiltonStewartMBryantJADeBoseAIDeBosePeoplewithchronicbronchitisasth-maandlungtroublewillfindgreatreliefandcomfortInFoleysHoneyandTarandcanavoidsufferingbycommencingtotakeItatonceJWMcCollumCoMeettoHearComplaintsTheIkmrdofCountyCommissionorsnutinxiKJcliilsttsslonMondayforpurposeofhearingthecomplaintofptrtlwhohadIKHMInilfdbytheequalizingboardThnHithlilKKOxlforaPrThomasBlfttrlc011-tITtrowhoursamthethetaxes140asrnJjlHpre-scriptionbSresores-tratIttlltc¬¬¬¬>Lotsofmenandwomenwhoareagreeablewithothersgetcranky-athomeItsnotdispositionItstheliverIfyoufindinyourselfthatyoufocicrossaroundthehouselittlethingsworryyouJustbuyabottle-ofMallardsHerblneandputyourliv-erInshapeYouandeverybodyaroundyouwillfeelbetterforItPrice50centsperbottleSoldbyWMJohnsonReturnstotheCityFromTuesdaysDailySunPriestlyParkerthenegrodraymanwhojumpedhisbondandleftforotherpointreturnedtohishomehereSundayShortlyafterhisPolicemanArnowplacedhimunderarrestandhowillnowbeconfinedinthecountyjailuntilhiscaseIscalledattheregularternsofcourtBabyMorphineFiendsAremadebyallsoothingsyrupsandbabymedicinesthatcontainopiumandnarcoticsMcGeesBabyElixircontainsnoInjuriousornanotUdrugsofanykindAsureandsadearfordisorderedstomachsbowelsandfrtfulnessfpUmlldforurhtnKuiiintSoldbyWMJohnsonMrsAII0BI-IWhostillwomanwcallsrdaytouseourteltihotuVTheonewhooiupliitatliourchildrentakeashortruttileuherOHtheirwaytosvlnxjClevelandLenderForIndigestionandtroubletakeFlItVOrasItBiiiuulat1tlMnisandrvguJattstloVi-osltlvelytareluutulionJWMcCoiluiiiyonallIsCIJar-rivalturtttlIitr¬>ForInfantsandChildrenTheKindYouHaveAlwaysBoughtBearstheSignatureIForOverThirtyYearsTNI0MTMWMMMVHCWTMICI-TTmiGAINESVILLENATIONALBANKijUnitedStatesStateCountyandCityDepositoryCAPITALSTOCK10000000SURPLUS2000000DEPOSITSJune2351007856DIRECTORIrMHDePoiWmRttvkertGHenryDavisTShaniliJohnFJacksonJamwMedUnRobtDCrawfordClioAFairclotliNEWACCOUNTSAREINVITEDCOOKAUTOMOBILECOMPANY-FBMYERSMannerBUICKAGENCYbemisieilfornonearesoroodathisBUICKR-EPAIRWORKANDSUPPLIESMasonicStreetQainesviHein1881OLDSUARPEWILLIAMSOurLeaderDrthegallon3004bottles380ExpressprepaidGEORGEJCOLEMANWebandMellow575IbottlesExpressprepaidANVILAF1rClasFatutlrVhUberHvtfallon13M4bottJen380aurasprepaidOLDGEORGIADirectUorvlcOandOld1ythalonrjJS-KKNTfrKYnvPOINTERCLUBCORNnrthetralton4buttlesHJITWVU-lfrIi1CatalogueMailedFreeTheAltmayerFlatauLiquorCo720722724728WestBayStreetJACKSONVILLEItiiIt1i-IIJInUseACouSIc1IIDV-orwconwlsioMrcvmshfNEWYOBKCASTORIAfif1tWIlJMiiDontfflairt1IEstablishedgallon00theomIwatt711tIronWrtI11110ibIreXtFLORIDAaxwzWFPi1MNiMNIMMWNFiNNiMMtrMw1CASTORIAIIrTbHWCPtpi1811oBftwAS-Iyt1fIQNcIArNARCOTICtittreJS4IItJadonSoletttistILO5OVSLU-sTacSSittaircof4qtXAtTCOPY01NtBAlPKs1rrtflythea-rftFFWarehousesCe3-xpreeeptiflIlnrttttper1750ttelrrqttlitIts><>+



PAGE 1

THEDAILYSUNFLORIDAAUGUST5r3UAINEVILLEUJOliRNEWSOFCITYANDCOUNTYCONDENSEDMATTERSOFGENERALINTERESTSECUREDYSUNREPORTERSWhatHMHappenedandWhatlaGo-iitfHappenPrsalandSclalItemsoftheCityloboHarrisofWillistonwasInthecityyesterdayNFranciscohasreturnedfromashortvisittoJncksonvilleCaptChMcClennyofCadillachereyesterdayMrsJLBrowneofGroveParkwasshoppinglathocityyesterdayW1LWaitsofFairbaakswasauaoagthevisitorshereyesterdayOLFeasterandwifeofMlcanopywereaawagthovisitorshero8ecoMfeaBdbuggyandharnessforsaleatabargainEaqulroatthisfleeBarrelchoiceFloridasyrupfromptoetoadjustopenedSaundersHarteDrG8MeansofMcIntoshwasamongthevisitorstoGainesvilleyes-terdayFreshflneattheOperaHousoFruitStoreFreedeliveryMissLornaMcCredieofMlcauopywasamongthevisitorstothocityyesterdayLEMeansmadeashortvisittoJlaynesworthyesterdayreturningIn4heafternoon-JPEntenraofWaldowasheroyesterdaybeingoneofthemembersofthoballclubECJonesofLakelandarealtyaaanofthatplacewasavisitortoGalaesvllleyesterdayMrsBIIllopsonofHighSpringsarrivedInthecityyesterdayonaabortvisittorelativesMayorHoratioDavisleftyesterday-forashortvisittoJacksonvillelieexpectstoreturnaboutFridayStandardFertilizerCompanyIsjivingdoublevotesonallcashalesfromMWuntilcloseofplanecontestQeWsshippedwhenyouwantthemMrsCAMarksofWaldocameSownyesterdayonashortvisittobarpareatsaadtowitnessthoQOBtestbetweenMlcanopyandWattDoublevotesgivenfromnowuntili8thlathe1000contestnowbeingcodaGetbusyaaddoyourimrchaahigforfuturesuppliesSau-ntersitEarleWGEnglishofTacomawasvisitlagInthocityyesterday110saysthatthegroundsarctoowetforthetruckerstobegintheirfallprepara-tionsatthistimeARHarperleftyesterdayforOcalatolookafterhisIntereststhereforafewdaysHohasbranchstoresbothheroandatOcalabesidesthemainbusinessInJacksonvilleandIdoingasplendidbusinessTakeKodolatthotimeswhenyoufeelwhatyouhaveeatenIsnotdlBeatingKodoldigestswhatyoucatsoyoucaneatsufficientlyofanygoodwholesomefoodjfyouwillJustletKodoldigestitSoldbyalldruggistsStateSuperintendentWMHollowayofTallahasseearrivedinthecItyyesterdayandwillspendashorttimeheroonbusinessThishisformerhomehehasagreatmanyfriendsherewhoarealwaysde-lightedtoSMDAVISFANCYLIVERYExtraNiceStxktoWtrunPiivntllorsotiforImnilyImHarmni1XVaKmS-oIDAVISIYMXVrteavisitorkwatermelonsveryI140Cqgreatrhim-rUnitslV1IFIi4wastyester-dayyJThisIbase-ballLckibe-IngaiyIs¬¬¬>BTThomasofLaCrossewasamongthevisitorsheroyesterday-RLTurnercountysuperintendentofCitruscountywasamongthevisitorstoGainesvilleyesterdayMrsBTArnowandchildrenleftyesterdayforWorthingtonSpringstobeabsentforthenextweekortendaysThewomanwhoappreciatesdaintydeliciousdessertsshouldalwaysuseBlueRibbonVanillatheperfectflav-oringextractTheresnothingsogoodforasorethroatasDrThomasElectricOilCuresInatowhoursRelievesanypainInanypartDrJIICoffeeofWaldowasamongthevisitorstothecityyes-terdayHohasrecentlyreturnedfromatriptoAtlantaMissMaymeReddingofGreen-villeIsInthecityonavisittofriendsSheIsreturningfromapleasantoutingtoOrangeSpringsMrsJLKelleyleftyesterdayforBalsamNCtospendtheremainder-oftheheatedtermSheaccom-paniedasfarasJacksonvillebyDrKelleywhowillreturntodayXVIIwhohasbeenhereforthepastfewdaysattendingtheannualstockholdersmectlnioftheStandardFertilizerCompanytohishomentTampayesterdayWAMcLvnnuofXValdowhoIn0110ofthegreatadmirersofhisballteamcamedownyesterdaythepuriioseofboostinghismenontovictorybutItwastheirortdayJustarrivedfreshshipmentNa-tionalBiscuitCompanysgoodscon-sistingofGrahamwaitersnablscosroyallunchcracknelandotherva-rietiesforyourapprovalSaundersEarleTheregularbusinessmeetingOfthjJJFinleyChapterUDCwillbeheldthisafternoonattheresidence-ofMrsJohnMTaylorat4oclockMrsJUKelleyPresMissMllliuAdamsonfleeSecThereIsasharplinobetweenahotelandaboardinghousebothIntheirplaceareanecessityinagrow-ingcommunityThoseusedtofirstclasshotelservicewillfindtheirwishesanticipatedwhenstoppingntheBROXVNHOUSEEilSlnppyofMlcanopywonamongthofewbaseballfansthathisteamtothecityyesterdayTheclubhasgoodmakingsandIftheyhadamanagertodrillthemtornshortwhiletheywouldfcslngreatninnypeopleintheirDoWltfEarlyRiserthepleasantsafesureeasylittleliverpillsAsalveyoumayalwaysde-penduponinanycasewhereyouneedsalveIsDeWlttsCarbonizedWitchHazelSalveespeciallygoodfurPilesSoldbynildruggistSimeonKnlghtenwhohasbeenconllnedInthecountyJailforthepastseveralmouthsreleasedonbondyesterdayforhisappearancentthenextternsofISCourtHei-rhargcclwithhavingpausedcounter-feitmoneyandwasbroughtherefromNowberryWXVKingoftheLangLumberCompanyarrivedinthecityyester-dayforthepurposeoflookingaftertininterestshereonthelargeGov-ernmentbuildingwhichUnowa-HHiuIngtomeshapeandproinirtlont-HtstatesthathewillbehereatIn-tervalsofabutthirtydaysfromthitimeontolookaftertheworkRotrrtCalhounwhohasbeenmakRalncvlllehishomoforthepasttwoyearsreturnedtoNewYorkCityyesterdayhisoldhomeItiIntentiontoreturnhereearlyirtiltfallifmatterscanbesosprangdforhestatesilathhasrttorhealthIntMcitythananrevislcslintherasteightyearswasCoarseforlullwasIIIreturn-edaccompa-niedballplnyinghisfhap¬¬¬¬¬¬¬¬¬¬¬¬¬>>UNITEDSTATESDEPOSITORYFirstNationalGAINESVILLEFLORIDACapital10000000Surplus0000000CONSERVATIVEPROGRESSIVEWetakpleasureinplacingourfacilitiesatyour1icpoalantiwillItohaveyouwriteorcallonusifyoucontemplateopeningeItherBcheikinfTorpavingsaccountFOURPERCENTPAIDINOURSAYINGSDEPARTMENT-Jas31GrahamPnsFBairdViropnHETaylorCashierLetGrahamAsatCsfBankIJIItipicait



PAGE 1

iiIVOLXXVINO154GAINESVILLEFLORIDATHVKSHAYAUGUST51909TENCENTSAWEEKryiai1jflflfrSTATEALIENISTSDECLARETHAWTOBEDANGEROUST-hreePhysiciansTestifyThatStanfordWhitesSlayer-IsStillInsaneThawonStand=WHITEPLAINSNYAug4ThreeofthosemedicalmenknownasalienistswhohavebecomesuchafamiliarpartofmoderncriminalcourtprocedureunitedIntheSu-premeCourtyesterdaytomakeItun-pleasantforHarryKThawwhokilledStanfordWhiteandwasadjudgedInsanebutnowdemandshisreleasefromtheMatteawanAsylumusamentallynormalmanAllthreetestifiedthathewasIn-aneandwhenThawtookthestandbrieflyaltersomedisconceillngtes-timonyhewasplainlyrustledfwdnervoushutMrJeromedismissedhimutterafewcomparativelyunim-portantquestionsOfthealienistswhotestifiedDrAustinFlintDrWilliamHirschandDrAmosTItuKerthelatgavetestimonyofthemostImportanceHeiactingsuperintendentofMatleawattandappearsasawitnesswith-outcompensationtheonlyalienistinthecasewiththisdistinctionJusticeMillscalledattentiontothisfactandtookahandInquestioning-himDrlinkersaidIhatinhisopinionThawwasnotonlyInsanenowbut-adangerouspersontoheatlargeShortlyafterthusMrJeromecalledThawtothestandHewaspaleandapparentlyshakenThedistrictattorneyputsomeratherIncoherentnoteswrittenbytheprisonerInevi-denceandaskedhimtoexplainthemAfterparriesbarkandforthendlaboriousexplanationsbyThawastothemeaningofcertainwritingshesaidAndIwantyoutoknowMrfJeromethatmanyofthesenotesyoucallsuggestionswerewrittenattherequestofmylawyers¬¬¬¬¬¬¬¬Doyoumeantotelluswhoob-servedyouinbothhomicidetrialsaskedMrJeromethatyoudidnotbelieveyoudidnotknowmoreaboutthecasethanyourlawyerdid-IdowasThawsquickreplyHoadmittedthathedidoffersomesuggestionstohislawyersThawwasexcusedafterabitmoreofthisordealandDrAustinFlintwascalledDrFlintdescribedaparanoiacasapersondominatedbycertaindelusionswhosementalandphysicalstatemightnototherwisebeaffectedexceptInKOfarasthesede-lusionsInfluencehimParanoiacsheconcludedImpres-sivelyneverrecoverDrHirschvariedthegeneralver-dictbydeclaringThawadegenerateparanoiacCharlesMonfcliuuterThawsattornewattackedthistestimonywithev-erylegalexpedientInDrFlintseaseheendeavoredtoshowthathehadgivencontradictorytestimonyIntwopreviouscaseswhereheappearedawanexpertHecausedDrKirschsomeunhappymomentsbyIn-quiringaboutubookheIswriting-DoyouInthishookclaimthatJesusChristwasaparanoiachenakedThealienistsreplywasthathewouldnotliketogiveanopinionThealienistsyesterdaydeliveredtheiropinionsofThawInanswertoJeromeshypotheticalquestiononly-asmallpartofwhichwasreadTheStatesalienistswillprobablyoccupythecenterofthestagefortwodaysmoreMrMorschauscrwillcontinuehisofDrFlintandDrHirschDrCarlosFMcDonaldhasyettotestifyHewillbecalledbyMrJoromoIcrossexaminatlon¬¬¬¬¬BrotherandSisterMetAsStrangersandMarriedCLEVELANDOhioAugstoryofaromancewhichendedinthemarriageofbrotherandsisterwasrevealedinPoliceJudgeMcGanheftsCourtyesterdayIthadtodowiththeearlyseparationandconse-quentreunionofAugustRcschkc-aswl2tandAugustaRuschkeaged0ThreechildrenthatresultedfromthemarriagearenowinthecareofHumaneSocietyThewomanweptasshetoldherthe4The¬storyonthestandWhenalittlegirlsheplayedwithherbrotherInGermanyShewasgiventoafamilyforadoptionThegirlsfosterparentsbroughthertoAmericaShewentunderthenameofLenaRobcckWhenshewas1CshemetInClevelandayoungmanthreeyearsherseniorTherewasacourtshipshefellInloveandwasmarriedHumaneofficerslatertoldthepairtheywerebrotherandsisItelManHeldCaptiveWhileWaterAroseAboutHimttHKESBARREPaAug4CaughtfastInapumpIntheNo14collierytfthePennsylvaniaRailroadComimatflninsvllleRobertTaylorthenlhtenglnourwasheldwhiletheslowlyroseabouthimIthadreachedhischinashestoodonIllstoeswhenrescuersfoundtutuAfewminuteslaterhewouldhavebeenTaylorwentIntotheworkingsearlytheirornlngtorepairthepumprIfutinsucvtIntttnWaterInflydrowndherd¬COACHTUMBLEDDOWNEMBANKMENT10HURTTrainLeavestheTrackontbeCentralofGeorgiaandManyHaveNarrowEscapeSTILLMOREGaAug4TenreceivedInjurieswhenaneast-boundmixedtrainontheBrewtontoPlneorabranchoftheCentralofGeorgiawasderailednearLexsyat1105oclockyesterdaymorningandtheonecoachonthetraitrrolleddownanembankmentPMPerkleofreceivedslightInjurieswhile1DVartlnwhoresidesat120JonesstreetwestwasaltohurtThelistofInjuredIncludesInadditionMrsLMWilliamsonVidaliaGaMrsVictoriaMurrayMrsAliceMurrayandchildallofSummitGaJFEtherldgeAdrianGa1MThlgpinNorrlstownGa-lIFlanDoverWBelcherconductorBrewtonJerrulnTheInjuriesofMrEtherldgeareGa-rper-SonsSa-vannah¬>>themostseriousHisbeadwashurtandhehasinternalinjuriesCrowdedCoachTurnsOverAlloftheinjuredwerebroughttothisplaceandarebeingcaredforhereTheaccidentoccurredonemilewestofLexsynearbridgeA103ThecoachwhichwasattachedtotherearofthetrainfollowedtheengineandfreightcarsfromtherailsranontotheedgeofthetillandtumbleddowntheembankmentturningoverAllofthosewhowerehurtwereinthisteachTheirInjurieschieflyarebadbruisesandcutsbutnoneofthemwiththepossibleexceptionofMrEtherldgeIsfatallyhurtThetrainwasInchargeofCon-ductorBelcherandthecoachwonwellcrowdedAnexaminationofthetrackatthesceneoftheaccidentleavesthecauseofthewreckamys-terybad-lys1¬¬WomanAsksforDivorceHusbandServingSentenceTAMPAAug4ThreedivorcesuitswereplacedonthodocketMon-dayoneofwhichisofmorethanpassinginterestWalterGeigerIsbeingsuedforabsolutedivorcehiswifeGeigerIsservingfiveyearsintheturpentinecampforsecuring280underfalsepretensesandItIsthoughthismisdoingandthedisgrace-ofhitssentenceIsthobasisofMrsJelwrxcomplaintGeigerwasaformerresidentofTampaanduponleavingsecuredfromtheAmericanNationalhankapaslilcrtscheckfor20whichhenotcashInLaterhereturned-toTampaandmadeclaimoflosingtheoriginalcheckThebankIssuedaduplicatecashierscheckfortheamountGeigerthenwenttoJack-sonvilleandcashedtheduplicateandblid¬¬laterpresentedthooriginalandre-ceivedthotacoofthecheckThotwochecksturnedupinduetlmattheDankbutGeigerhadflowsThematterwonplacedinthehandsofthesheriffofficeandChiefDeputyJLesterXgaveItIspersonalattentionGeigersoonafterwardswrotefromMontrealCanadatoafriendInthincityandtheletterfellSatotheRandsofthechiefHebadBOcityaddressbuthadwrittenonletterpa-perofarestaurantHewiredthepoliceofMontrealthesefactstheynabbcjlwhofoughtex-traditionforthreeTkoTampaauthoritieswonoutonthecaseandMrLesterwenttoCanadaandsecuredhismanwhowastriedandSentencedORabovestatedAmericanNatloaalLIIVCRant1tmonths1¬¬DidMrsRichmondKillMcTavishforHisMoneyCAMBRIDGEMassAug4InthedistrictcourtyesterdayMmElizabethRichmondwasgivennpreliminaryhearingonthechargeofhavingmur-deredStewartMeTavlshwhosebodywaxfoundonJuly2rdlyingonabedInherroomInEastCambridgewithabulletthroughhisrighteyeandtliewholeldeofhiheadbeatenInwithanaxeThewomanfoundinailoiulstuporfromliquorIntliroomnexttoMcTavlshsbatteredbodyMuchmysteryeurrowndsthemur-derThemotiverobberythepo-liceforMrTavlshhadaconsid-erablesumofmoneyonhispersonwasfwassay¬¬>MssJewelStandleyHague70730MittsAlconHollyArredondo57430MissAnnieUevllhArredondoEmnmWilliamTrenton35275MrsRBBakerHawthorn13400MrsJEParkorUCrosso11315MissKatiAkinAnvdondo8415MlsAdaPearceNowberry7050MissPirlMfLAlachua3515MissLJlaGarRMvinTi3rSrvVowberryM1Missfill1885117571<+whenhestartedforBostonfromGardnerMasswherehewasem-ployedasanattendantattheStateInsaneasylumMrsRichmondtheaccusedwomanhascomeundertheeyeofthepoliceonseveraloccasionsInthepastAboutayearagoshewasexamined-bythepoliceInconnectionwiththedeathoftinwifeofaBostonmerch-antwhomysteriouslyexpiredafterathreedayssojournIntheRichmondhomeLiteramanIssaidtohavemetdeathunderunusualclrcumstan-cesIntheRichmondhouseOnneitheroccasioncouldgroundbefoundonwhichtobaseachargeagainstthowomanr¬¬Thebestplacetobuyyourgoods-IsatthestorewhichInvitesyoutocomethroughanadinTheSunAsadvertisingfindsthobestmarksforeverythingelsewhynotforyourlrsonaservicesKeepyoureyeonthewantadsTheresaybesomethingadvertisetrhlchnofinteresttoyou



PAGE 1

OAlLYSUNttALMESVILLEFLORIDAAUGSTtPrLtI19U9>AGREATRESERVOIRBURSTSWITHROARANDWATERRUSHEDINTODISTRICT0CubicFeetofWateratOnceGreatDamageNoLivesLostFORTMORGANColoAug4TheIrrigationsectionnorthofhereistheofdevastationowingtotheburstingoftheretainingwallsofthegreatGovernmentreservoirMondayafternoonWitharoar1000000000cubicfeetofwaterrushedoutofthebreachcarryingeverythingbeforeItItweptacrossthevalleywitharoarandalthoughthegroundisalmostadeadlevelItcutagreatshallowditchhalfamileandmoretbaaamilelongSeveralfarmsweredestroyedbythegreatwashofwaterbutItsohappenedthatnoonenthefloodThedamagewillreachseveralbunthousanddollarsTheGovernswathadexpendedagreatsumofmoneylabuildingthereservewallLOCHLOOSANEWSLOCHLOOSAAug4JHUpthegroveMissDaisyBelleSimmonsRUpthegrovcandwifeJWUpthegroveandwifeandThomasMorrisonleftSundaynightforTampawheretheywillspendafewdayswithfriendsCVFowlerwasunexpectedlycalledtoGreenvilleFlalastSaturdayonaccountoftheseriousillnessofhisfatherGilesFowlerWeallhopeforhimaspeedyrecoveryandWTRichardsonwenttoGainesvilleonMondaytoattendtosomebusinessaffairsDPoseymadeabusinesstriptoGainesvilleMondayMissElsieHaymanreturnedhomeThursdayfromInvernesswhereshehasbeenforthepasttwoweekswithfriendsandrelativesMrsHVCasselsofIslandGrovespentafewdaysIntownlastweekJCHnynian3ALagenthasbeenquiteillforthepastfewdaysbutItImprovingnowWeallhopetoteehimoutagainsoonMissRoyFayandRobertCaldwellGainesvilleFurnitureCoWeCarryaFineLineofOakandMahoganySuitsOddDressersWashStandsChiffonniersandChifforobesRefrigeratorsIceCreamFreezersVudorPorchShadesandPorchRugsCompletelineofStovesandGainesvilleFurnitureCoIRRI-GATED1Leasedscenewiden-ingwascaughtdriedwPTompkinsRanges¬¬¬GAINESVILLEFLACAPITAL575000002500001OFFICERSWRThomasPresidentaKBroomeFirstCDTurnerCashierWBTaylorSecondDIRECTORSGKBreomeJBPadgettHFDuttonJAMaultsbyJQNicholsMVenableWRThomasWBTaylor4PerCentPaidinSavingsDepartmentspentlastSundaywithfriendsandrelativesatHawthornJohnHaymanspentlastSundayeveningwithaladyfriendofhisatIslandGroveThecitizensofHawthornandLochloosagatheredatthepicnicgroundsonthebanksofthebeautifulLochloosalakeThursdayforafishfryThedaywasbeautifulupuntiltimefordinnerwhenthedownpourofraindescendedThefishwerefriedandaftertheraindinnerwasservedTheremainderoftheeveningwasspentInlaunchridingonthelakeAboutCoclockalldepartedfortheirhomesafterhavingspentamosten-joyabledayTherewillbeanothersoonTheyoungfolksgatheredatthehomeofMrandMrsJDCaldwellSundaynightforthepurposeofaSingTheguestsarrivedat745-oclockandsanguntilabout10oclockwhentheyalldepartedwithratherweaklungs1WStewartmanageroftheLochloosabarbershopmadeobusinesstriptoHawthornMondayEADuprecandwifeofIslandGrovespentlastSundaywiththelattorsparentsMrandMrsJRMissJaneDealwhoIsvisitingMrandMrsJNherehasgonetoOrangeSpringstospendafewdayswithrelativesJNHaymausmadeabusinesstriptoGainesvilleMondayCarbitErglcofIslandGrovewasintownMondayshakinghandswithhisoldfriendsTheStoneHouseefIslandTheremarkablestonehouseoTEasterislandarebuiltagainstaterraceofearthorrockwhichinsomecasesformsthebackwallofthedwellingTheyarebuiltofsmall8lsbeofstratifiedbasalticrockpiledtogetherwithoutcementNoregularityofplanIsshowninthecoDstracUoaamajorityofthemTheaveragemeasurementisasfollowsHeightfromfloortoceiling4feet0tacticthicknessofwalls4feetto10incheswidthofrooms4feet6Incheslengthofrooms12feet0Inchesaveragesizeofdoorwaysheight20Incheswidth10InchesSkepticalIkindofagreewiththefolkswhosoythatstoryaboutGeorgeWashing-tonandthecherrytreeIsamythsaidFarmerCorntosselafterathought-fulsilenceForwhatreasonsinquiredhiswifeWellhumannatureispurtymuchthesameinallgenerationsandIfIhadaboywhopickedupanaxanvoluntarilywentouttochopwoodIwouldntchidehimIdhandhimamedalWashingtonStarTorturingeczemaspreadsItsburn-IngareaeverydayloansOintmentquicklystopsitsspreadingInnntlrelievestheItchingcuresitperma-nentlyAtanydrugstoreTheBoaofficeforcaninecardsnTneDUTTOMAHKiSLPLUSVicePresldentSVicePresidenttTomp-kinsliaymansEaster¬¬¬¬¬¬¬AncientGreekTrainingThemanmrInwhichtimeAtheniansbroughtuptheirchildrenInworthrememlwrlnjAtsevenyearsofagotheAthenianladenteredthepalestrawhichwasessentiallyaplaygroundAllthefirstandbettorhalfofthedaywasspentIngymnasticsdancinggnrnrsmidplayIntheafternoonthereweresingingsomewritingsonicreadingalllatheopenairandthencamealongperiodofplayagainSuchwastheschoolingoftheGreekladuptotheageoftenorelevenandItdidnotdifferessentiallyuptotheageofsixteenexceptintheseverityoftheexercisesAndyettheworldhasnotceasedtomarvelattheresultsoftheGreekeducationItproducedthehighesttypeofmanphysicallyandIntellectuallythattheworldhaseverseenwhichGastonsayswasasfarinadvanceofthemodemEnglishmanasthemodernEnglishmanIsInadvanceofthenativeAfricanInphysicalbeautycourageandpatriotismInphilosophyliteraturearchitectureandtheGreekshavebeentheunsur-passedmodelsoftheagesandarestilltheInspirationofourschoolstodayButtljeyplacedtheemphasisuponhygieneexercisegamesandplaywhicharetoomuchneglectedInthesedaysKansasCityStarGeographicalKnowledgeIn1492ButverywasknowninregardtotheextentoftheworldInAriatotlesdayinthefourthcenturyChristandbutverylittlemorewasknownaboutit1800yearslaterInthetimeofColumbusIn2000rearstheworldhadInrealityratherthanadvancedItwasthepopularbelieflathetimeofCoIambusthattheworldwasSatthoughmanycontemporaryscholarsthoughtdifferentlyThegreatcivilizationsoftheworldatthattimeweregroupedaroundtheMediterraneanseaalthoughEnglandwasaconsiderablepowerandtheScandinavianswereagreatmaritimepeopleBatEuropeansatthattimeknewbutlittleofAsiaandbutlittleofAfricaandAmericaofcoursewaxundreamedofEvenafterColumbushaddiscoveredthelattercontinentbewasperfectlyoblivi-ousofthetactHethoughtHaitiwasClpangoorJapanandforaCubaasupartofthemainlandofAsiaAFamousAllPotatoBanquetOneofthemustremarkablemenuseverilrawDupmusthavebeenthatofthefeastInTartstowhichBenjaminFranklinLavoisierthefounderofmodernchemistrystudotherdistin-guishedmensiltdownaguestsoflarmentlorEverydishatthisban-quetwitsmadeofpotatoesandeventheItramlyundIIiiiiursweretheproductofthesamevegetableThiswasPnrmentlerfinalprooftohisskep-ticalfellowcountrymenthatpotatoesworenutpoisonUKtheypersistedInbelievingLoutsXVIhimselfwasoneofPnrmwitlorsearliestconvertsgrantedlandonwhichtogrowlibplantsunddidnotdisdaintowearthepotatolowernsnbuttonholeThenPurmcntlercleverlypostedguardsroundbispotatofieldsbydayandwithdrewthembynightsothatpeo-pleweretemptedtocomethenstealeatandboconvincedTheallpotatobanquetwastheclimaxofthegreatcampaignChicagoNewsForHEADACHEHicksCAPUOINEWhetherfromcoldsheatstomachornervoustroublesCapudlnewinreliveyouItsliquidpleasanttotakeactsimmediatelyTryItlOcandMeatandrugsThehabitofansweringadsthatappealtoyouIsonethatwillkeepyouInterestedInthelifeyoareRvtagandprosperousIfItsprlatedstationeryyouwastTheBUBoncelatogetitGoodHealthFineDigestionStrongNervesandHeartyGoodHumorcomefromthemoderateuseofHARPERWhiskeyForsalebyallLeadingShippingHousessitlittlebe-foreretro-gradedlongtime-rliltsictotethenHARPERWiiISkTJ121-eiI¬¬¬¬¬¬¬¬¬OneefthemeetvaluablefeaturesefourserviceteoursubscribersandtethepublicgenerallyIstlonwiththeextensivelongdistancelineseftheAmericanTelephoneandTelegraphCompanyandtheotherassedatedSellTelephonecompaniesWeownthousandsefmileseflongdistancelinesInthesevenInwhichweoperateandInadditioncanconnectanytelephoneInoursystemwithlinesextendingtoanyethercityInwhichatellTelephonesystemIsoperatedTheselongdistantunfaareefthemostmodernandImprovedconstruc-tionandaremaintainedatahightateofefficiencyTheSellsystemsourconntcStatesoperatingInvariouseeetlenaefJMcountryareuniformInequip-mentandIntheirnttthedeeftingOnlybymattefthisflesetrailsarrangementbetweentheSellTele-phonecompaniesisItpossibletegettallTelephonealmostanywhereaskforLongDistanceandbeputtIPcommunicationwithalmeetanypoiseInthecountryThisvastnetworkefwiresradiat-ingthroughoutthenationIsweddallyIncommerceandforsocialpwposesbythebankerthefarmerandcitizensInallwalkseflifeandcarplanthereIsanImportantlinkInthtatreatchaintheirepeesaSouthernBellTelephoneandTelegraphCompanyEfficientServiceReasinaMesituTHEflATLYSUN10caWeA



PAGE 1

TILEIAlIASliNKKAlilTIMSfnHJIJit-o11aIiiiHoardofTradeSixdrugstaresFourshoeshopsStateUniversityTempleTwentylawyersTWOpaintshopsFourcontractorsOnebicycleshopBaseballdiamondTwoIcefactnrleSixmusicschoolsOnevarietystoreOnepubliclibraryTwowajoiiworksTwoplaningmillsTworacketstoresTwolumberyardsOnemarbleworksThreetllvrrmlthsThreewoodyardsFivedentalroomsOnxprcwofflcoFreemalldeliveryFourbeefmarketsBightbarberTwopublicjchoolaTwomusichousesAtelephonesystemTwoabstractoflicwFVuirprtingdebsTwomachineshopsTwobottlingworksSixOneCatholicchurchmilitarycompanystoresOnephosphateotllceOneOoeChristianhurcbTwostrainlaundriesTwoAdventchurchesOnedallynewspaperTwostoresOnefemalephysiciangrocerystoresThreefurniturestoresnewspaperoThreecoldstandsfiredepartmentrtUteUaunacti4tshopshousesIJiOnecoldstorageplantOneSevendrystoresOneelectriclightplantshopsThreerailwayssystemsEightordersEplsopnlchurcheslandOnelaboratorythirteenschoolsOnePresbyterianchurchTwomanufactoriesFourestateagenciesVolunteerThreemethodistchurchesbandphotographgallerIesTiroshowsWinterChautauQuaODesewnesveoffleeTirotIId-i=¬ToBeGivenAwaybytheMerchantsandTheSuntoCitizensofAlachuaCountyEachSectionGetsPrizesContesttoCloseAugust181909RealizingthatallshouldsharealikeinthedistributionleadingbusinesshousesjoinedinthecomlinationtogivenvnyTwoPianosandOneDiamondRingtoresidentsofAlachuninthreedifferentsectionsTheseprogressivefirmswillgiveOneVotoforeachpennyspentwiththemIntheeventofaticforanyprizeofferedaprizosimilarinallrespectsthere-towillbegiveneachofthosetieingTHEARHARPERPIANOCOofJacksonvillefromwhomthepianosforthipcontestwerepurchasedlaneagreedtoofferextraprizesasTothefirstfivecandidatesineachdfctrictexceptirgthewihiiuieofinthesaiddistrictsoneceitilicjitieachforICO00will1eredeemableincashasapaymentontinypianohandledbythemtleEverettHarvardDayton-orJohnChurchPianosJnadditiontothistheywillgiveacertificategoodforotherriuiUftiiitsintlt1racemalwillirnkertvialarrangementswithany-onetotakeofllrirjtronallpurchasesoflitthecashpriceQgntiflnWillembracethecityantisuburbsantibeconnnedtoaradiusoffourmilesineachdirectionThewinnerinthisdistrictwillbeawardedaHANDSOMEDIAMONDRINGViIIterritoryfromFairpointseastandfromRochelloallpointsjouthWaldoHawthornIslandGroveCampvilleLakeViewTacoumMidallpointsalonglineofTJONEPIANOWesternandNorthernSectionWanneeWilcoxBellJonesvifleArcherandallsettlementscoveredbvthisareaONEPIANOltOoOltziZDfl1WCOQit1TotalCashValue100000iSIIJmdon1ccountyiIiIIlichHIPlIGSIIaloeVIeEcompriseillcomprisenilstationsCromHtguetotlighSpringTrcntonJd1TWOPIANOSANDAII-JIAMONDRINCItfg4wtittohilliTheasternandSouthernSectionl¬>>>¬HowandWheretoGetThefollowingmerchantswillgiveonevcentpaidIntothili8taliHhnpnt3foro1vhlrhtheyhandleGainesvilleFurnitureCompanyFurniturePhiferMorrisCoClothingFurnishingsGainesvilleHardwareCoPlumbingandHardwareMrsFTMcCormickMiiuneryWMJohnsonDrugsandMedicines-LCSmithShoesandJewelryMrsRWilsonDryGoodsandNotionsSaundersEarleGroceriesandFeedStuffsCityBakeryBreadandPaltryPYSmithFreshMeatsCrawfordDAVISLiveryandSaleStablesTheSunPrintingandPublishingTheBrownHouseMealsandLodgingBananaHouseFruitsEtcEddinsMgfCoLumberandBuildingMaterialStandardFertilizerCoFertilizersVotesvote-rtrIndIIIINFranciscoI<<>>>>WhereVotesMayBeCastRnJlotboxeswillbofoundIntheestablishmintsofthomerchantsgivingvotesandatTheSunofficeVotessentbymallmustbedirected-totheVotingContestDepartmentofThoSunGainesville1ThocontestopentoanyonelivingInAlatbuacountywhoIsknownbytheconductorsofthecontestorvouoiicdforbysumoreputablepersontothemwellkncrn2Noemployeeattacheorrelativeofthepro-prietoroftheabovenamedarmsareeligibletoparticipateInthiscontestandwillparticipateInnoiqnunerIntheeventofantlaunaorainndingbetweencandMnteiiorothersInterestedinthlcontestsuchcontroversymayboreferredtothoconofcontestwhonlonnarethepersonstorenderdecisions4Intheeventacandidatedecidestowith-drawfromtheracesuchcandidatewillnotboallowedtotransfervotestothecreditofanothercandidateinthernoteatIFlorida-iRulesandRegulations10-fItCSIiIIqualified¬¬±OldSutjcHbr125Threemonthssubscription500votes250Sixmonthssubscription1200votes500Oneyearssubscription3500votesForacluboffiveoneyearsubscriptionsForacluboftensixmonthsrinscriptions30000votesstewSubscribers700votes1500votes4500votes35000votes30003votes35000votesThereisnolimittohenumlrofclubseachcontestantmaysecureTHESEMIWEEKLYSUN100Oneyearssubscription500votesForacluboffiveoneyear5000vowsForaclubof25oneyearsubTipions35000votesThereisnolimittotpnumWofcluKeachcontestantmaysecureSolicitingvotesbycandidatesorfriendswithinthestoresdribuMngVMBSisdesiredbytheoroorleto-rsIrrEmDAILYSUNfetterortkmortAcriptions0tlMloelaapt>



PAGE 1

THEDAILYSUNttAlNKSViLLBFLUHI1IAAUtUST51KOUn2aaa><><>¬>T6JRAILWAYISREPORTEDTOBESOLDNOTHINGDEFINITECOULDBELEARNEDOFTRANSACTIONOfficialsandStockholdersofCompa-nyWereAllHereYesterday-forSomething-ItwasrumoredhereyesterdaythattheTJrailwaybadagainchangedhandsthistimethepurchasersbe-ingtheGCPRailwayCompany-ofGeorgiaThisroadIsasmallonerunningfromCollinsthroughamostfertilesectionandIssaidtobeaboutsev-entymilesInlengthbutwithagreatfuturebeforeItisbranchingoutandmakingfortheGulfTheSunreportertriedtoverifythereportlastnightandevendayafternoonaskedMrStuckywileIspresidentoftheTJCompany-Iftherewasanythinginthemeeting-oftheprincipalstockholdersofthecompanybutreceivednodefiniteanswerItIsknownrhoweverthatthepri-vatecaroftheofficialsoftheGCIIsnowinthecityandwasherenearlyallofyesterdaypresumablyforthispurposeandsomethingdefinitewillverylikelybegivenforpublica-tionwithinitshortwhileOathJlwitrxStuckyandSlmontonwhoarelendingstockholdersintheTJwerehereyesterdaybutnothingcouldbegainedfromInreferencetothedealFORSILVERSERVICEBoardofTradeTakesActiontoSecureFundsAtthe8timotionofMayortliCRinotfvilleHoardofTradehau-iikinuptitmatteroftalkingfiiil-sfrtinpurposeofisilverservicefrthebandhIluriiia-IartletidesiringtocontributeinthefundcannotifyIIHamiltonIerretnryamidtheamountItftDotjhoillIntlnII1yeathemFr¬¬¬llitofcontributionuptnlHtnlishi-IIFHampton1inDisagreeableatHomeLotsofmenmidwomenwhoarKreeublewithothersSetcrankyathomeIt1notitstheRicerIfyoufindInvourelfthatyoufeelcrossaroundtheboutlistthingsworryyouJUKIbuyahottltofRallurJsHerbinuandputyourHveInshapeYousuitivrybodaroundyonwillfeelbetterforItJrlceSOcentsperbottleSoldbyV-MChickenAcountryministerinthecoiifeiIllsiiyiliurnIfrcircnltvaluen-IKWSVwhereuroutchickenwasserv-edfurdinnerMelUllpreviouslyeticountered11rleofribeuriUHlIxeldinnernmlthtchickenlookedtohitsVtllliofacetiouslyremarkedwinreliMItchickenentersthministryiileItiesbettertherellwtiinvrMnedtinsmallboyofthefondlyIxttiItecnnlCASTORSForlafsiaUantiChildrenEyeFarBusinessWhiteWhyareyousoInnstlendthatfriendndollarvlieiieerlienkItHespendshismoneyIndrinkcienrsllluckMiheHIwayspaysitiftekWhiteHuttheremustbesomeotherrensonforyourreadycenvrnMtyItlnckWellthreIsspciulshalfthemoneyonmeJutlguForFeverishnessandAchingVhctlMfromMalariousconditionscoldsorovereatingtryHicksCapudineItreducesthefovrawlHevestheactingItsHijuiJiv2and0centsatdrugstoresTheawakopersonreadsthewaneverydayandanswerssomeal-mostasoftenJuhnnnHcmiltictIttIirjYJAi1FlilitshtoIIandlIlttlwaJrInnuntOWSItrnlrYknIodrUrsrtillttnrH-trfrwlh1ldIfitsgoodheresirktitfka-attreionly1eetrJrhimil>>><<>++REMOVESBLOODporeandglandoftheskinIsemployedInthonaovpreservingitssmoothoventexturecleansingitandriieachtinyoutletwhichgoesoncontinuallydayandWhentheS5becomesinfectedwithhumorsandacidsacertainDorcentnmlotionittoitsnormalstrengthandthicknessnr-BSSthegreatestofbloodpurifiersexpelsallforeignmattercuresAcneTetterSaltRheumandotherBookokinDiseaseandanymedicalfreetoESTHER8JORDANWWHAMPTOHJORDANCOMPANYINSURANCEPORTERBiOCKGAINESVILLEFLORIDAFireLifeandAccidentUNIVERSITYOFFLORIDAGainesvilleFloridaAnInstitutionoftheFirstRanksup-portedbyStateandFederalFundsforFloridaYoungMenThoroughCouwsLendingtoDegreesofBABScMAMLL8InArtsandScienceAgricultureChemicalCivilElectricalandMe-chanicalEngineeringLawNormalSchoolGraduateSchoolKxpcneesExceedinglyLowForCataloguewritetoAAMURPHREEAMLLDPresidentFLORIDASTATECOLLEGEFORWOMENTallahasseeFloridaACollegewithoutapnrattjIntheSouthofferingtooldiplomasInthefollovidvpartnieiUIACollegoflllnialArtIIASchoolofIndustrialArtsIIIASchoolofFineArtsIVASchoolofKxpretiHion-VASchoolforTeachersNoTuitionOtheroxporiPegvirylowFurfurtherinririjiattonEDWARDCONRADIMAPh0PresidentCOOKAUTOMOBILECOMPANYBUICKFBMYERSAGENCYlefornoneareyooilacthisBUICKREPAIRWORKAXPSUPPLIESMasonicGainesvilleFloridaTHESUNANDMERCHANTSCOOPERATIVECONTESTVOTINGCOUPONG-OODFURHPaeMf-crfZfttfftttugthetemperatureofourbodiesThisisdoneanthtofImpuritiesalsopassoffwiththenaturalandtheirSOurnAtureirritatesandinflamestheskinanddriesupItsnaturalorbRdpimplesboilspustulesorsomeItchingroshorscalyskinecSSScuresskinofkindbytheacidsremovingthehumorsfromthebloodSSScoolsthenutritiousredcorpusclesandenrichesitIneveryThentheinsteadofbeingirritatedanddiseasedbytheexudingacridmatternourishedsoothedandsoftenedbythiscoolingofandHMsaffectionsofthekinItremovespimplesblackheadsblemishesfromtheskinandassistsinrestoringagoodTHESWIFTSPECIFICCOATLfTjOLlrrQrtMunatavr1ontlithltIIIIcHIIottifirtIIJJIttitITlliII-JrnotssstlteecaacldcnatdiseasescompwdegreespSc-andnddleStreetaesrFor-tLidrt-Tti11NpmiryistFtstrKnnateitwrnlwrfl-nItetNIittt1alTli>>><+tillhavebeenyourutlrruin0iwillVhavinganinsurancepol-icytlatwillinilonmifyroutitwhatisleftwlniitittirefiendvisitsyourhomoNothingBewieintimeamiinure-inasolidcompanyliketitsoiifwereireent-KfAGUSKMANAgentGainesvilfcFlorida7IrYi1SAVEDFROMTHEWRECKlithyouforyourlossMIhiltjyrI4Wut1IrwcavqA¬>==



PAGE 1

rflfcDAILYSUNGAINESVILLEFLORIDAAUGUSr51909ccJI1t<>>¬¬¬+SPEEDYRELIEFIMPROVEMENTATAIRDOMEMoreRaisedSeatsHaveJustBeenPlacedinCommissionManagerWellingtonhashadcar-pentersbusyforthopasttwodaysplacingmoreraisedseatsIntheAirDomewhichwillgivealloftheoc-cupantsoftimeplaceabetterviewOwingtoallseatshavingbeenplacedonalevelitwasnecessary-fornearlyallpartiessittingIntheBILIOUSFORfro¬¬THEMATTHFrJDUOKIDSAtElectricTheatreAirDonerearoftheplacetostandinorder10theperformancebutunderhenewplantheseatsartsarrangedfurtheconvenienceandcomfortolillTheshowIsdrawinglargecrowdseachnightandthefamouslittleactnowbeinggivenisexcitingconsider-ableinterestamongthepeoplegenrallyOcalaandGainesvilleAspecialtoTheTampaTimesdatOcalaJulyIrdsaysTheOcalabaseballteamisplay-ingatPalatkatodayandtomorrowindthentheygotoDaytonawhereheyarescheduledforThursdaysurdFridayTheboysreturnhomoSat-urdayandwillmeetotherlocalteamsnthelocaldiamondNineteengamesarescheduledhereduringAugustandfiveawayfromhomeOfthesethegametoboplayedInGainesvilleonthe26thwillnodoubtprovethemostInterest-ingowingtotherivalrybetweenthetwotennisThehonorssofarthisseasoitareeveneachteamwinningmegameanditIsexpectedthatfrom100tofiOOfunsofthiscitywilljourneytoGainesvilletowitnessthedecidinggameRevWarrensExplanation-TheOcalaStarofTuesdayLaysAletterfromRevIIIWarrenwhoisnowvisitinghismotherInMaconGasaysregardingvisitroOralsfromOnlnosviHeabouttIndaysagowhichtheGainesvillecorre-pondtntofTheTlniesliiloncons-ultdsuchadarksomenitsiferyMynosingtoOcalawasnotmysteriousnorwasmyleavingGainesvillenminusintimeleastdexreeHairyShowdroppedinatthemornInsserv-icerniifentedtotaketitvnlimInrInviewoftwolettersnbyWillDalemillingmetoOcalathetripworepossibleSoIleftfulexplanationsviththawanilflabandtiledmethence-AWeakling-IstheonlywaytodescribethepoorchildthatIsaIIIIctodwithwormsNomatterhowmuchorhowofteniteatsthewormsgetallthenourish-mentfromthefoodthechildgetspracticallynoneWhitesVermifugesetsridofthewormsquicklytasllyandwithnoaftrfleetsPrice25centsabottleSoldyWJohnsondIhisreamladsihumidi¬¬>>WALDOANDMiCANOPYPLAYEDATIEGAMEgameWasFullofAmusementandLastedTenInningsWaldoandMlcanopyjourneyedhereyesterdayforthepurposeofcleanshgupeachotherbutaftertheInningthegamewascalledthetotestanding7to7WaldoeasilyhadtheMlcanopyoutclassedtramageneraltandpointofballplayersfortheircamhasbeenplayinggoodamateurmulluptothecontesthereyesterday-utIIIthisgametheywenttopiecesmlthebatterywhichdidgoodworkecelvedpoorsupportLocalinterestwasinfavoroftheMlcaiiopyltesfrontthefirstowingtoWaldohavingmadefourrunsbeforeheyhadmanagedtoscoreevenoneandinthelasthalfoftheeighthintingthesmallcrowdpresentwentwildovertheerrorsofWaldowhichletInfiverunnersallowingthemtotiethescoreThisremindedoneoftlflgameofafewdaysagowhentheOlympicstalliedtimesontheOakUnlitinoneinning-InthetenthInningWillieJollypre-ventedMlcanopyfromscoringwhentwoworeoutnndsecondandthirdtccuplvdbymakingabeautifulonelandedcatchInleftafterrhardrunIhemanwhohelddownsecondbaseuulCurryMerchantshortforMlcanopydidthebest1rtheircamThescorebyinningsWallo0i1010200f7-Micauepy000000i007ThebatterieswereMicanopy-SparknianamiHesterWaldoIrewittmilHarveyMELROSENEWSNOTESMKLKOSKAuglitevhairunitutiiilyhivereturnedfromtheirvaealeuandtheirmanyfriendsarepleadtoMetillinhackTheSantaIVtookoutnfullUKofLucoiitepearsinbarrelsoniucMlaDuringthemonthofJulythetotaljnlallasmeasuredbyUSStandinlgungewas1123InchesProfLooueysschoolInhigherarithmeticIsprogressingnicely20scholarstakingthocourseThobirthdaysofMissClaraHelloMackandHerbertCliuinljirlainwereekbnitfdonThursdaylyaJollyMiihlrtspartyatMrsChumherlalnttTrlponthelakeintinDixieaoneofenjoyablefeaturesofthenfernoonThestoreofAAMcllaeIsbeingmuchunprovedbytherepaintingoftimeInteriorandthefixturesYourcorrespondenthadoccasiontotakeadrivethroughtimesocalletiPricesettlementnearMelroteItwasagreatpleasuretoseethefinefieldsofcornaveraging-over20bushelsperacrethelargepeanutpatchessugarcanenUllbeanfieldsandtoseethecottonpickersatworkalreadyToshowwhatcanbedonebyourfarmersItmightbomentionedthatthefivePricebrothersputupthisseason20iicansoftomatoesmostlythreepoundcansandthereareothersThefailureofthepeachcroppreventedthemfrothputtingupanythisyearFornilthosegoodsthereIsnreadysaleastheyorefarsuperiortotheNorthernarticleBabyMorphineFiendsAremadebynilsoothingsyrupsandbabymedicinesthatcontainopiumandnarcoticsMcOeoaIlabyKllxlr-fontnijjwnoInjuriousornarcoticdrugsfanykindAsureandsafecurefordisorderedstomachsbowelsandfretfulnesKsplendlilforteemingInfantsSoulbyWMJohnsonGEOSWALDODENTISTW-illRemoveAboutAugust20thtoEastSideCourtHouseSquareTheFinestMaterialsTheMethodsofPracticeAllWoikGuaranteedTheLowestChargesinKeepingWithWorkPresentLocatioiGrahamBuildingslayerssixeLl25uDRiLatestnthwar1yes-terdayvel-vetFirstClass¬>>>SurprisingWhatKodolWillDoF-oryouwhenyouneeditButlongeryoulectIndigestionthemorewillsufferbeforeKodolcanrestoreGoodDigestiontthe¬AndofcourseIndigestionIfBOBlectcdlongenoughbringsonseriousdiseasesInwhichKodolcannotbenefityouSomeofthesethereIsnohelpforatallThereareInfactveryfewmentswhichcannotbetraceddi-rectlytoImpurebloodAndImpurebloodIsalwaysduotoadisorderedrftDmncnUsoKodolandpreventNervousDyspepsiaKodolwilleffectuallyassistNaturotosecureacompleterestora-tionofgooddigestionItdoesthisbyatoncedigestingallfoodInthestomachandkeepingItdi-gesteduntilthestomachIsrestedandcanresumeItsownworkKodolremovesthetheeffectquicklyremovesItselfWhenItIsrecalledthatHeartDiseaseCancerandevenConsumptionarcduetopoordigestionandpoisonsthustransmittedtothobloodandthroughoutthesystemtheImportanceofmaintaininggooddiges-tionIBatoncerealizedcauseandApo-plexy¬¬¬¬¬¬¬¬WoknewwhatKodolwoulddebeforeeverthefirstbottlewassoldIfwedidnotknowjustwhatItwilldowewouldnotguaranteeItthewaywedoItiseasyforyoutoproveKodolthenextorthefirsttimeyohaveanattackofIndigestionladyouwillcertainlybesurprisedattheresultsItIsperfectlykaralessTherecaabenoharmlatryingsomethingthatmaydoyouagreatdealofgoodwhenitcoteyo-nothingifItdoesntOurGuaranteeOototodaysadgndelUrbottleThenentirecontentofthebottleIfyoucaahonestlyMytbatItBMsetdoneyeaatrr-drojrgUtknowthatearguaranteeIappliesbottleonlyandtobutonelaafaultyThelargoliestiecontainZtfasuckaatheIftyteatbottleKodolIspreparedatthetorieaofRCDeWlttareturnUtebottlethe1althewillyaeetilionorWotheglutthebottleDuDIILotrrtolan11CoCklatganeedthetotrfnndourmoneywltbeutdelaybaydruglabors¬FORSighSchoolandGrammarSchoolGraduatesAmbitiousyoungmenandwomenwillbeInterestedInread-ingSchoolfaxnbookIssuedbyTheTribunecontainingthemostcompleteinformationaboutalltholeadingprofessionstogetherwithdetailsregardingsonicofthemostprominentschoolsinthuUnitedSlnUsItwillaidyouInchoosingyourvocationandstartyouonthoroadtosuccessSchoolfaxIsofespecialInteresttoparentscontemplatingsendingtheirboysandgirlstoschoolsofanynaturewhateverWewillmallthisbookabsolutelyfreeFilloutcouponandmailtoSchoofaxroom628TribuneBuildingTRIBUNEBUREAUOFSCHOOLINFORMATION521irriHMCWtnvMjfwMC9ffIMfMtSNameAgeAddressSchoolGrammarorHighSchoolWhenGraduatedBIGCLEARANCESALEMensSummerClothingUPWARDSOF1000BlueBlackandFancySuitsNOWOFFEREDATDiscountsofFrom25to50PerCtLOT1LOT2LOT3LOT4750100015002000tp-onrequestwewillsendtwoortlrepsuitsoffitlylotforyourselectionBHLEVYBROSAVANNAHUEOHWASALEJBYALTDEUGGJfTSrbe-lowiITOFIIICOrWakteJitNETNETNETNET¬



PAGE 1

TriKMiMvnjKSPSAUGUST51909rniI1-it4GAINESVILLEtieredDecemberatGaines-villeFlaassecondclassfonderActofCongressofMarch3It7-PfcMhhMlEveryMondayandThursdayatGalnMvllleFiendsHHMCREARYEdlterandMgtrTermsfSutoerlptlsn-TteSir1ayearrstkaBOcsinglecopiesIc-AtfvcrtUJniRataLocaladvertisements15teatsaMfortkeAntaad10centseachMttloaaliBsertloaDisplayadvertisementsforthreeetasadtwelvemoatasatspecialratesPriceuponapplicationMarriageandDeathnoticesInsertedtreeObituaries6centsalineOurClubbingListBunandTheNYWorldoneyear9165TheSunandTheAtlantaGaWeeklyConstitutiononeyear175fffcaSunandTheAtlantaGaJournaloneyear150theSunandTheSemiWeeklyTiaaeaUalonyear150Wewillsotacceptstampsofalargerdenominationthan2centsNOTICETOSUBSCRIBERSSubscriberstoTheSunwhonrcInarrearsareurgentlyrequestedtomakesettlementwithoutfurtherdolayUnderthepostalregulationswearcprohibitedfromextendingcredittosubscribersformorethanandthosewhohavenotpaiduptoAugust100SwillbudroppedfromthelistofsubBcrihorsduringthenexttwoweeksTheprivilegeofmailingthepapertosubscriberswhoareInarrearsforoverayearIsdeniedbythepostallawsandwehavebeennotifiedtocomplywiththisprovisionatonceItyoufalltoreceiveTheBunafterthomiddleofJulyyouwillthereforeknowthereasonthornDonotwatttocometotowntopayyoursubscriptionbutsuedtheamountbymailatonceDOITNOWTeddyscaughtadlngallngashotadlgdlginthoeyeohwhatulotoffunnythingsforaSmithsonianpieAnenquirerwanttttoknowwheretheliarsgotobutuptodatethere-inribevidencethattheyhavegoneanywhereAdischargedAuburnNYcon-victwillbeada30000SyracusebroomfactoryhavinglearnedthatbusinessInThemanwhocanturnmisfortuneIntoalikethatdeservestosucceedRangecattleInFloridaneverap-pearedtobeInbetterconditionthantheydoatpresentTheywillbewellpreparedtoundergoaseverewinterastborainshavekepttherangeswellcoveredwithgrassduringthepastseasonThePerryHeraldsaysInaheadlinetoacountryletterListweekBearkilledbyaman9feetlongThatwassomewhatofamansure-lyandheoughttojoinsometravellogcircusandreapafortuneasalivinggiantHutwhatwedliketoknowisbowlongwasthebearsaysTheMadisonEnterpriseRecorderfr31lOmatterLforIIIIIIIfortprlonhegtints1uTwtceaWeekaftttEtrlateTknlteaWeek1temlWeeklyoneeoneyeurtCYstepping-stonetr¬¬<=ThegoodroadsquestionwillnotdownButtheautosgodownwhentheystriketheclayedroadsduringthiswetweatherThefactistheonlytimethiseditorwaseverstuckonclayedroadswaswhenhehadtotraversethemduringwetweatherThenhewasstuckgoodandfastuntilheleadhisboneIntothewoodTheJaxMetheadsanarticleFavoredSpotsInFloridaThereisbutonefavoredspotinFloridaIntheeloquentlanguageofGovernorBloxhaminhisspeechesoffortyyearsagoisfromthePerdldoontbowesttotheboundingbillowsofthebroadAtlanticontheoustandfromthelarkwatersoftheStMarysontlwnorthtothebrightkeyoftboGulfwheretheloseexile5ltinconscioussecurityunderthebroadaegisofAmeritnfromFloridaisalltotiltftrNVwrrt0ATTENDTHEINSTITUTESOurobservationconvincesusthatthefailureofthefarmersin-stitutetosometimesaccomplish-thatgoodwhichmightreasonablybeexpectedIsmorefre-quentlyduetothefarmersthemselvesthantoanyfaultoftheInstitutebutItisnotdeniedthatInstitutelecturershavenotalwaysfullymeasureduptotheiropportunitiesandresponsibili-tiesasteachersofpracticalagricul-tureThechiefcauseforthefailureoftheinstitutesystemtodothefullamountofgoodpossiblesaysTheRaleighNCProgressiveFarmerIsthewellknownconservatismofthetillersofthesoilortheirdislikeandreluctancetochangetheirmethodsofdoingthingsItIsverymucheasierforallofustodoourworktheoldwayinwhichlongpracticehasmadeusperfectandanewwaywhichIsmuchbetterandwhichafterpracticeIsalsomucheasiermayatfirstbeverymuchmoredifficultthantheoldwaywithwhichwearefamiliarThisaccountsforthetendencytogetIntorutsandstaythereIftheinstitutesaregoingtoma-teriallyaiduswemustavoidthecommonerrorofconcludingthatmethodswhichhavebeendemon-stratedaspracticableandeffectivebyothersontheirtaroswillnotalsolepracticalandhelpfulonoursWehaverepeatedlyheardmenstatethatsuchandsuchcropswouldnotgrowontheirfarmsandlatertheverysameperuoimmakingthosestate-mentshungrowntheeverysamecropssuccessfullyandprofitablyWehavealsofrequentlyknownnntotryjcropMIIImplementoramethodofcultivatingorthelandandafterouttrialcnHiidetintItwasnotpracticalundertheircondi-tionsbutlaterfrontfurtlurtrialtheylearnedthatthenthinswereHOpracticableandhelpfulthattheyadoptedthemWhatothersaredoingIrandoIKagoodmutoInsuchmattersifImplementsormeth-odshaveprovedgenerallyprofitableonotherfarmstheyartlikelytobvofvaluetoanymangrowingsimilartrotsifgivenapropertrialNoInstitutelecturerinlikelytoad-vocateanythinghenotdoranythingwhichliundrrdHhaveotfoundvnluihlemvliningtlmllnrconditiontoyoursthereforeifyourexHrienroliftersgreatlyfromthatofothersthchancesarethatfaultIstotInthecroptheImiKtinmitinmethodhutInyournuimigomntotItIfitisofgreatvaluetootherswoshouldtryhardtorankitofvaluetousNineoutofeverytenwhohaveattendedtheInstitutesartreadytoadmitthattheyhaverceivcdmucnbenefitfromthemandtheycontinuetoattendthemregularlyeveryyearIfttheinstitutesarefnltothosewhoattendthemtheywouldbeequallyhelpfultothegreat-ernumberwhodonotattendIfItpaysagoodfirmertoattendtheInsti-tutesandthisIsthekindthatgenerallygotothemitwillpayallfarm-erstoattendthemAdvocatesofprohibitionandlocaloptionlawsassortthattheenact-mentofsuchlawsdecreasesthesaleandconsumptionofliquorandtheopponentsofsuchlawsjustasstrong-lyassecttheydonotAlldoubtuponthequestionwillprobablybesetatrestbyieMetalstatementoftittreasurydepartmentThefiguresshowadecreaseofbetweenfourandfivemillionbarrelsofbeerInliSThatmeansabillionpintslessliquordrunkIn190Sthanin1907ThatIsnotsoasunderthehelltpremrWKnewtinstrial-readyantde-crease¬¬¬¬¬¬¬¬¬¬¬>temperancereformersexpectedbutitisaverydecideddecreaseallthesameandonethatisallthemoresuggestivebecauseofthepersistentattemptsatillegalsellingandthefa-cilitiesforsecuringliquorIndryter-ritorythroughtheoperationsoftheexpresscompaniesItallindicatesthatthetemperancemovementIsa-veryrealthing-AFloridaRepublicanexplainsthatthehighcostofchickensIsnotbe-causeoftheprotectivetariffonbeefbutbecausethenegroesstealtomanychickensIfthenegropoliticalfriendsloftinthiscountry-weshouldliketoknowwheretheyPeopleworrymotoomuchsaysMrJohnDRockefHrAndMrRockefellersIdeaofrelievingthem-istoraisethepriceofkeroseneoilnoandarethinhasany¬¬¬Atanelevationof9000feetnearthesummitofMountSanJacintoCalSupervisorMarshalloftheCleve-landnationalforestreservehasdis-coveredanextensivelakeItisex-tremelyhazardousofaccesstothenorthandsouthofIttherebeingunscalablespurswithnotrailsAtoneplaceinclimbingthecanyontothesummitthewatertinybeseenthrough-acleftIntherocksThelakeliesmuchhigherthanLakeTahoeStrugglingovertheledgewhichhidesItMar-shalldiscoveredmagnificentviewsThereartindicationsofagreatdepthFromthepeakcanbeseenMexicoNevadaArizonatheMajovedesertSaltonSenandtheIslandsnearSantatartarsASouthernStatehistradeitmisdemeanortotradingstampsAjailsentencewasaboutonlythinsleftonecouldnotgetwiththetradingChapletMtitthestamps¬¬¬¬¬FRANKCLARK-AfeweditorsdelightIncriticisingCongressmanFrankClarksposition-onthetariffnndnevermissanoi-portunltytorepublishmatterwhichtheyconsiderdetrimentaltohisinterestsMrClarkspositiononthetariffwaswellknownbeforehewaselectedtoCongressforthefirsttermasheproclaimeditfromthestumpineverycountyinthedistrictuswellasInprintedmattermailedtoeveryvoterHeIsforatariffforrevenueonlybutaslongasrevenuehastoberaisedbyadutyonforeignproductsImportedintothiscountryhebelievesandjustlysothatFloridagrowncottonfruitsvegetablestobaccoetcshouldreceivethebene-fitofaprotectivetariffonsuchar-ticleImportedIntothiscountryAtariffoncottonImportedIntotheUnitedStateswouldbeworthmillionstothegrowersofSeaIslandcotton-InGeorgiaandFloridaInthesameproportionasithasbeenbeneficial-toothersectionsofthecountryonotherproductsThomanufacturerofcottongoodsInthiscountryIspro-tectedagainstcompetitionfromthesamegoodsmanufacturedInEnglandbuttheproducerofthostaplefromwhichthesegoodsaremanufacturedhastogrowthecottonincompetition-withthepauperlaborofEgyptIn-diaandotherforeigncountriesIsthereanyjusticeInthiswhenIronoreetcIsgiventhebenefitofagainstforeigncompetitionThecornwheatbarleyoatswoolanimalsandeverythingproducedintheWestisprotectedbythetariffbutthepiutlucerofcottonhistola-borIncompetitionwiththepeonsofIndiaandEgyptThereisnojusticeinsuchadiscriminatingtariffandMrClarnUtobocommendedforhiseffortsinbehalfofhisconstitu-entliehenslaboredfaithfullytobettertintconditionsofhispeopleespeciallythefarmersandtitopposi-tiontohimemanatesfrompersonalasveiluspoliticalenomiurfButFrankClarkisequaltothepresentemergencyandthemanwhoopposeshimforreelectionIntheprimariesoflilrtwillfindtintClarkhasthepeoplehackofhimNottoreturnFrankClarktoConKrestinderthepresentcircum-stanceswouldbeanacknowledge-mentontitpartofthepeoplethattheydonotappreciatetheetfortsofafaithfulpublicservanttobettertheirconditionMELROSENEWSNOTESMKLIIOSKAugIRevparrandfamilyhavereturnedfromtheirvaca-tionandtheirmanyfriendsarepleas-edtoseethemTheSantaFetookoutafullloadofLecontopearsInbarrelsonDuringthemonthofJulythetotalbackTuesdaypo-liticalpro-tection>¬¬¬¬¬¬¬¬¬¬¬¬¬¬rnfallasmeasuredbyUSStand-ardtwingewas1123InchesThebirthdaysofMissClaraBelleMackandHerbertChamberlainwerecelebratedonThursdaybynJollychildrenspartyatMrsChamberlainsAtriponthelakeintheDixiewasoneofenjoyablefeaturesoftheaf-ternoonThestoreofAAMcRaeisbeingmuchImprovedbytherepaintingoftheInteriorandthefixturesYourcorrespondenthadoccasiontotakeadrivethroughthesocalledPricesettlementnearMelroseyes-terdayItwasagreatpleasuretoseethefiitecornaveragingover20bushelsperacrethelaruepeanutpatchessugarcaneandvel-vetbeanfieldsandtoseethecottonpickersatworkalreadytTostowwhatcanbedonebyourfarmersitmlshtbementionedthatthefivePricebrothersputupthisseasonIT-2iicnnoftomatnoTnnstlytbrepcundcansandthereartcinrThefailureofpeachcroppreventedthetafrontputtingupanythisyearForallthesegoodsthereisarendssaleasthyorefarsuperiortotheNVrlernarticleSomeonewhoperhapswaspakIngoutofabitterexperienceonsaidthatGodsendslootaiidevilsendscooksmanyjiiwillacceptthelatterinmoffnt-MomentbutItIsttartenlnHvtvotingwomennnrrrhadnotrainingIntheewmhvofurresfiiihoinetttaklncantinIvfwMHisanossemtalHecauseofthisdeficiencyninnyhomesaremadeunhappyLoveinnecessityofahappyweddedbutloveuaptfntmillipIhIfieldstheethetr¬¬¬¬>>NOTARIFFFORENGLANDReportsfromEnglandIndicatethatcountryissowellsatisfiedwithfreetradethatthereIslittleprospect-ofJosephChamberlainwinningoutInhistighttoreestablishprotectivetariffwhichwasabolishedIn1846TheEnglishLiberalleadersofParliamentaresettinguptheandGermantarifftroublesashorribleexampleswhichshouldwarnEnglandagainstfollowingIntheirfootstepsForatimeItappearedasIttheprotectionistsundertheleadofMrChamberlainweregaininggroundbutitnowseemsthesenti-mentofthenationisagainswingingaroundIndefenseoffreetradesaditisextremelydoubtfulIfEnglandwillevercountenanceprotectionagainThoBritishpeoplehavebeenenlightenedastothebenefitsoffreetradebyextensiveeducationalworkcarriedonbytheLiberalsForInstanceithasbeenpointedoutandthecontentionsustainedbyfactsthatwhilewagesarehigherinunderfreetradethanInhighprotectionFranceGermanyandotherEuropeannationsthecostoflivingisconsiderablycheaperinEnglandthaninthehighprotectioncountriesalsothattheAmericanconsumerhasbeenplacedatthecompletemercyoftrustsbyhighprotectionantiispay-Ingunreasonablehighpricesforwearingapparelfoodstuffsandmanu-facturesAddressingameetingofcitynunInLondonrecentlyPremierAstndeclaredthattheLiberalswouldnotlookatanysuggestionforatariffsayingTwogreatcountriesogreatestcommorinlriilw-IntheworldhaveUtryinghirhandsattarifffabricationsfortiltlasttwoorthreeyearsGermany-fortwoveiirshnshadinoperationafullblownscientifictariffandGe-rmanysdeficitismuchgreaterthanourIVHAndIfwelookontheothersideoftheAtlantictheyhaveJustcom-pletedarevisionoftheDlngleytariffItisnotforlittospeakdisrespectfvl-Ivorfindpleasureandcomplacency-inthetroublesofourfriendsntIneighborshutwhenwearetoldthatsovereignremedyforourfinan-cialtroublesistocreateinIrotBritainwhatlingbeencreatedinGermanyandwhatIsjustbeingre-createdinAmerirnageneralweareentitledtolooktotheex-perienceofthosewhohaveadoptd-tliejwjmethodsAndwhatIstheenofthenewAmericantariffWhyasfarasIcanmakeoutitisuniversallycondemnedbythewholeAmericanpressnndregardedbytheAmericanpeopleasatriumphofparticularinterestsovergeneralInterestsfortheyseethetrustsmonopoliesrelntrenchodandrein-forcedIntheirInnsnailtoovictoriouscampaignagainsttheconsumer1JI11JI1tlJittntthe1isAmeri-canEngla-ndtarItor¬¬¬>¬¬¬¬°+ThatsanastonishingnightCaMnotofficersactuallycuttingdownthGovernmentexpensesYouNeedEyeGlassesIfyourheathachesafterreadingorafteranyurtifcualuaoftheryesTheAchetsCuetatheStrain-ontheOpticalNerveOurEycGlasewillrelievetrailandcorrectthevieonjermaneatlyComeinandletusmakeascien-tificexaminationofyoureyesCHCOLESSONJewelersandOpticiansGAINESVILLEa3-JfiIiianailaft111totfkeYaal1kalalatala1itunaaGaftaila3I1MIi-llo¬=>>



PAGE 1

rALNKSVlLLftAto1XH7HEt1GIST==PRETTYRECEPTIONFORFACULTYANDSTUDENTSDRANDMRSJLKELLEYENTERTAINMONDAYNIGHTTheNormalIsNowNearingItsCloseButInterestHasNotFlaggedFromWednesdaysDallyFriendshipandheartygreetingsJiavubeenextendedtothefacultyandstudentsoftheSummerTrainingSchoolninnytimestoldInvariousmodesofentertainmentbutMondaynightwhenDrandMrsJLKelleythrewopenthedoorsoftheirnewhomeinhonoroftheteachersofSouthernFloridatheclimaxofhospi-talitywasreachedAteightoclockthereceivinglineconsistingofMesdamesKelleyMurpureeFloydLynchandMissesandShannonbegantogreettheguestsandinanhourthespaciousandbeautifulparlorswenfilledwithmanyofthebrightestandmosttaleit-dteachersoftimeStateNothingthatperfectforethoughtcouldanticipatewaslackingMrnVYIIburnthecharm-ingdaughterofDrandMnKelleypresidedatthepunchbowlFromthediningroomdaintyanddeliciousrefreshmentswereservedconsistingofsherbetcreamcakeHeTimehoursspedbywithlightningwingsasthemerryandsparklingconvergeoffriendsmadegladandlighttheheartoffriendTheGiines-vlllfOrchestradiscoursedsweetmu-sicduringtineveningtotheperksilllightofthemusiclovingAutmosthighlyappreciatedincidentoftheeveningtherecitationbyhutqueenamongtheyoungteacherMissJessieMillerofEdenMissMillerisanartistSheibtonlypos-sessestalentoftillhighestorderbuthhtinstheginlnstodevelopthattalentOneoftinmustpromi-nentschoolsofFloridaistryingtosecureherAtelevenoclocktheguestsllpersedvotingDrandMrsKelleytheirsincerethanksforoneoftinmostdelightfuleveningsspentandcarryingwiththematenderfeel-ingforDrKelleyandhischarmingfamilyNormalNotesThoughthisIsthelastweekoftheNormaltheInteresthasnotflag-gedThecommonregretIsthatItcannotlasttilltheSeptemberexami-nationMissLucilleRichardsreturnedtoSanfordlastMondayMissHellaCoxtheaccomplisheddaughterofRepresentativeCoxofPolkcountyleftforKathleeni1ijoesterStev-enswasserfIever¬>¬<¬¬¬ProfWendellGilbertoftheSouthFloridaNormalInstitutehasbeenchosenprincipaloftheLaCrossoschoolTwootherteachersfromProfCorrsschoolwhohavebeensecuredbyAlachuacountyinthelastfewlaysareMissHattieHaw-thornandMssCarolinaJenny-AtthechapelexercisesyesterdaymorningMissesElsieSmithandEVaPooleandMrDeckwerechosenaCommitteeonresolutionsNomatterhowlongyouhavesuffervdFoloysKidneyRemedywillhelpyouMrsSLHowenofWayneWVawritesIwasastiffenfromkidneydiseasehothatattimesIouldnotgetoutofbedandwhenIdidIcouldnotstandstraightItookFoleyHKidneyOnelunarbottleandpartofthesecondredmeentirelyItwillcureyouXVMcCollumCoOcalaBallClubFromWednesdaysDallySunTheOcalabaseballcluhthroughheroTuesdaymortisingforPalwtkawheretheywerescheduledforttt0KainspromtheytillgotoSanfordforthreegameswiththeSanfordnineInalltheOcalaclubhastwentysixgamerscheduledforthemouthWhileatthedepotseveralofthelocalplayerstookadvantageofmeetlogthemandageneralhandshakingtookplaceTheOcalaboysleftovertheSeaboardwiththebestwishestheOakHallsTorturingeczemaspreadsitsburnareaeverydayDoansOintmentQuicklystopsItsspreadingInstantlrelievestheItchingcuresItpermaAtanydrugstoreIittentedMassedthatplaceofIlirIi1IVent<¬BrokeOutonHipsandSoreIrritatingandPainfulthatSuffererCouldNotSleepScratchedConstantlyandGrowingWorseCUTICURASEFFECTQUICKANDPERMANENT-Whentwoandnhaltyearsolddaughterbrokeoutens-andtheofherlegswitha-veryirritatingundpainfultruttiinItinOctobertInoticewaxalittleredHtirfutvandaconstantdesireonhertoscratchherlimbsShecouldnotslapandtheeruptionssoreandwaterlameoutthemIhadtwodoctorstreatbutworseundertheirtreatmentThenItheCutlcuraCuticumOintmentandCuticuraResolventandusedthemtwoweekswhennhowasentirelywellThlflwasInFebru-aryShenanneverhadanotherroughonherkinandsheInnowbottleofCuticuraandlessthanaboxofCuticuraOintmentRRWhitakerWinchesterTennSept22103WOMENEverywhereUseCuticuraSoapandCuticuraOintment-Forpurifyingandtheskinofsnapsscalesanddan-AdnifffordrythinVVandfallingforrVanilsoothingredwinVforannoyingirrita-liwnkneandfr-jrlmanysanativepurposensforalltheUMSofCJunrantlandrosybuwedthehourofbirthrcmplftermrmlandIntfnlTrmtmrntfortttofIlitlrttnSK-IrutmtnomimmtiSOrnuniltutt-cnriHmolvrnlInnlCtHnitil-MthrmwtimitlienrMluilrrlnChantorrvImwlvioti-jMUlrtriteMlkurahaltonSUnDltnunACUTEWATERFAMINEDUETOEARTHQUAKE-IMEXICOCITYlugyAftertauIdaysofoneoftitmostacutewaterfaminesthattheCityofMexicoevEexperiencedowingtothebucklingofwatermainsatthetimeoftheearthquakeonFridayoflastweekGuiller-moHeltranyPugndirectorofpulpworksIssuedastatementyesterdaythattodaythescarcitywouldberelievedandthemainsrepairedFiverspicetheInitialhockat514FridaymorningthewatersupplyofthecapitalhasheroseriouslyIm-pairedEachsucceedingquiverottheearthIntensifiedthesituationandABSOLUTECUREOfSKINERUPTIONlegsWas-SoabouthIherbouhtonlCfteenoldIusedonlyhalttheMrstLUIITIrrcInhlnlultIifromInfantrodmhoUfn111111titklnocIiIIUIfLdfrllltnItkMtIatfwarIIbtreaterbuckllnsofthershebeautify-ingi1anti-septicnaurhudrrnAdumltMtotiranrrklRIncsitformCoact2rIwlfrthrtIcausedmain¬<><<>¬++IneverypartofthecitywaterapremiumandthefewfaucetsdrippingaresurroundedycarryingthetluldbucketstohomesLETTERTOJMRIVERSGainesvilleFloridaDearSirTherearethousandsofpeoplesayingThaiswhatIcallagoodjotofpaintIthaswornthreeyearsImgoingtorepaintbeforeitneedsitthreeyearsIsenoughThosepeoplearealongwaybehindthetimesTherearetworeasonstarpaintingthosepeopleknowonlyonetheyarethinkingonlyofwearofkeepingoutwaterThreeyearsmay-betoolongforthelooksofpaintItisnthalflongenoughforthewearIfallyouwantofpaintistokeepoutwaterDevoeisgoodforadozenyearsinaverageplacesAndthath-atinnillgII1>ThecostoftheJobIHthething-tothinkofandifyouthinkofitrightyouneedntbotherwithwearThepaintthattakesleastgallonsmakestheleastbillforbothpaintandmintingpeopleforgetthelaborbillitsthebiggesthillillthejobAgallonisaboutFivegalIonsravedIsThepaintthatsavesthepainttowearCeoVDrownUnionSCpaint-edIIFArthurshousetheretwelveyearsagowithMgallonsrepaintedliveyearsagoleadandollwithlastyearDevoewith14galTheresISOsavedonpaintanddontknowwhathepaidforyogallonstuffnomatterGobythegallonsYourstrulyFWDEXOECOPSTheGainesvilleHardwareCoourpaintfirstjoinndigallonsthats25allons3¬¬¬AJEALOUSMANCOMMITSMURDERT-HENTURNSGUNONHIMSELFANDBLEWOUTHISBRAINSHadMadeTwoPreviousUnsuccessfulAttemptstoKillWomanofWhomHeWasEnamoredDANVILLEValugAsarsuitofspurnedlutelienllussellAfarmeraboutGOyearsoldoftitscountyuKterdayafternoonshutindinstantlykilledMrsTankersUyngul-oOyearsandthouemptiedtlvcre-mutningbarrelofthewithwhichthedeedwascommittallusthisownheadThedoubletragedywasexactedonthefarmofMrsTankersntLucktwentymilesfromChathamMrsTankersleyhasforsometimehvenlivingapartfromherhusbandwhosewhereaboutsIsnotkownDenHUHsellwasatenantontheplantationandwasknowntohavebeenviolent-lyInlovewithJcOnWedncsdtxythetwobadaquar-relandMrsTankersleyorderedofftheplaceOnSaturdayhewenttoherhouseandfiredattwicewithashotgunbothshotsbe-ingineffectiveHemn1anotherunsuccessinlattempttoIllheryester-daymorningTimecriiiuailsdonwhiletwosmallchildrenoftheslainwomanwereplayinginthehouseRussellhashadacheckeredcareerSeveralyearsagohewasinlovewithayoungwomanofthecountyandInajealousrapeflreilatForthiscrimehesortedayearintitprisonBOUNDOVERTOCOURTSusieWrightTakesChildtoLizzieRochelleFromSaturdaysDallySunSusieWrightwasboundovertotincircuitonFridayonachargefhavingstolenthegirlbabyofLizzieRochellesometimeduringlastOctobiiAftertakingthechildSusieleftthissectionofthecountrynodonlyreturnedafewdayssincewhenshewasimmediatelyplacedunderarrestThechildwasreturnedtoitsmotherLizzieRochellewhiletheWrightwo-manwillhavetolayinJailuntiltluconveningofcourtlaxNoticeInpursuanceofChapterNo4115Section3ftawofFloridaIgivebelowastatementshowingtheamount-oftaxescollectedbyWDDickinsontaxcollectorofAlachuacountyFlor-idaforpledendingJune30lOPaushownbycountytreasurershut101TankIlhercountttRus-sellbethet>¬><¬TAXKOIIK8-llcneir77T16ftRoadFundRoadFundSpecJjJI627fSSchoolFundR6175SchoolFundSixRialDistrict200066SchoolIolU190811000Total1168245SflWlCMlEflIerkCircuitCourt-AWeaklingIstheonlywaytodescribethepoorchildthatIsnfilletedwithwormsXomatterhowmuchorhowoften-itoatsthewormsgetallthenourish-mentfromthefoodthechildgetspracticallynoneWhitesCreamVermifugegetsridofthewormquicklyeasilyandwithnobudafter-effectsPrice2centsabottleSoldbyWMJohnsononmy3210crJI2nies¬>WillLayCornerStoneFrontTuesdaysDallySunC1GraceofKvlnstonwasIntiltcityyesterdayHewiystheyaremakinggreatIlvjtarationsforfugofthecurlierstoneofthenewchurchthereunAugustIthAstrandpicnicdinnerwillbeservedrefreshmentswillbesoldforthebene-fitofthechurchandfinespeakershavebeenaskedtobepresentTheMasonicbodyhasalsobeenaskedtoparticulateandtheywillarrangeaprogramwhichIHtobepublishedatalaterdateActiveat87ThiswouldbeunusualnewsIfmenandwomenwouldkeepthemselves-freefromrheumatismandallachesandpainsaswellankeepingtheirmusclesandJointslimberwithBallardsSnowLinimentSoldbyWMthelaForPermanentReliefTakePVAflK-INttHERBSFiftyCentsaBottleTrybuttetodaAvoidAllSufouBallardSnowLinimentC-oWSTLOUISMOUAandkJJWHOLESALEandRETAILLIQU211WestliarSt0Ilex401JACKSOSViLLEWILLIAMSPAYSTHEEXPRESSCASEDeSotoRye4fullquartsCfullquartsPAID5oo70012fullquartsfreightpaid1300WilliamsNo10Rye4fullquarts3205fullquarts15012fullquarts900OldHalifaxRye4fullquarts420Cfullquarts600fullquarts1200gunnySouthRye4fullquarts275ifullquarts40012fullquarts80025fullpints1200YellowstoneBourbonLcnniitrjnervspaidOldBooneExpressPaidOldHomesteadCornWhalJAWjugexpresspaidSpecialOfferDottllngExpressI-WOpintaIndrumtOOhaltplotsIndrumSoldonlybydrumwillndrumCornWhiskeyExpressIRockyForkperbottleexpaRockyForkpercaseexpal1gnlcornexpaid1galcornexpaid1galINcornexpaidRyeVvhiskeyExprcMIPCQueenCityexpaidSunnySouthexpaidRyeMaltexpaidorRlcnHUtexpaidPlanterexpaid4fullquartsexpresspaid50012fullquartsexpresspaid127JAlcohol24fullpintsexpresspaw1375OnegradeonlyandJugexpal48fullhalfpintsexpresspall1500Ginexpaid2f0325iSendUsaTrialOrdeGEORGIASCHOOLOFTECHNOLOGYATLANTAGEORGIATECHNICALINSTITUTEoftilehighestrankwheeIRratluateHoccupyprominentnndlucrativepositioninengineeringandcommerciallifeIncaINinthemostprotvelvrlvoftheSouthwiththeaboundingopportunititsntfrrrtlitsgraduatesinthefouthspresentremarkabledevelopmentAdvancdcourvsinMechanicalElectricalTextileandCiulEngileeringEngineeringCliPtiiiitryChemistryandArchitectureExtensiveandnewequipmntofShopMillLaborato-riesetcNewJiraryaminewChemicalLabCostreaonaleStudentsnnfivetlanytimednrinuthesessionNextsessionopensSept221909ForillntratdcatalogadlnuKGMATHESONAMLLDPregAtlantaGeorgiaYOURSavingsAccounServesyouinmorothanonewayItreservefortimesofwantandmisfor-tuneItiscapitaltousewhenyouseeagoodbusinessopportunityAllthetimeyourmoneyisinthisbankitearnsyouFOURPERCENTWeinviteyouraccountsmallorlargeTheFirstNationalBankofAiaehuaALACHUAFLORIDAITlONIt-CUfDYSdirectlyonItwillcureCONSMALAIttAANQCisotttlrtfreefromandIspostssolelyofItistfwstrengthensweakenedglandsItchecksallottheaS-oldRecommendedMJOaSOILLIAMS1GOODSEXPRESSfIdlbrookWhiskeyladrumfullllurarta12751HurdlePaidOverholtexIBidUSOldtlaoneexpaidMottledInWIlliamsPrivateexpaIIJrotorHOOiid-a1e-INMDZactstheLivernilpnIsonousmineralwandorderanit113cryERyeaCtehumidbytheGuvmtSeal1INTER-ESTe<<



PAGE 1

SHEJbAllYSNGAIKESV1LLFFLORIDAAUGUST5liMHtir7-i11riIIThuRepastBeganWithGreenTeeServedInGlassesFOODEATENWITHFINGERSTaMMannersInaMeerithGentlenunsHtuwAParticularMarkof-FavarbytheteHisQuattiThatIINetAlwaysAppreciatedDuringmytayInFez1tookeveryopportunityofgainingacloserInsighttatothedoaaestlcIIfooftheInhabitmataa4forthatreasonwritesLaw-renceIlarrllatheLondonGraphicalIteartllyAcceptedanwttkAbdaUahclPasttheministerforforelgaaffairsOaarrivingathomo1wasUSBIntoalargeroomInwbtcbwereseatedfiveorsixguestsofhighrankjUriBllahtookmebythebandandgravelyiBtrodaccdawtothecompanyAallkeaenableswasplacedOBthe4irBapoawhichIseatedmyselfTilerepastcommencedwithgreentellservedlasmallglassesTbedisteatefpreparingthistopeculiartotheceeatryTotheprincipalnativeguesttogivesthehonorofmakingtheteaIBIbiscaseItwasRateullwhobeingaaderBrittenprotectionbadbeentedtaaerInmyhonorHeacceptedtheInvitationtodothohonorsoftheeveninganrlorderedthenotoplacethenativebrasstrayInfrontofwherehosatcrossleggedonThemethodsofproceedingsuchnswouldrecommendthemselvestoanEnglishteapartyMeasuringouttheteaInhishandtiedroppedItInthepotThenervesblarethenpouredboilingwateroverItThiswasswilledaroundandthewaterpouredoffTherIOtwasthenfilledwithtingelumpsofloafsugarbrokenroughlyfromasugarloafandallttlomintwasaddedAsmallquan-tityoftheconcoctionWONpouredIntoaglasssippedandpouredbackagaintinneduntiltherequireddelicacyofsavorwasreachedThecompanythendrankthecustom-arythreeglassesofthisslnipymixtaredrawingItthroughtheirtetbwitaBoundlikeahorsedrinkingAeachglassfinishedandreplacedinthetrayItwattrefilledandluuuUdbackbythekeeperofthepotwhowassupposedtoremembertowhomeachglassbelongedAtnsignfromtbehostthetraywarumoredandanotherslaveapproachedeachpersonwithabrassbowlsoapsadtowelandnbronzekettleofwarmwaterTheguestswashedtheirrightluandapre-paratorytothedinnerWenilsataroundasmalltablenlwutsirIncheshighuponwhichwasplacedthedlsbThecoursesweremanyandvariedAssaystheIladltbTheblessingofGodrestsonthefoodtakenwiththefingerssoallgoodMohauisedansfollowthewordsoftheirprophetNoknifemustbousedonbreadaadthesmallroundloavesareStrokesupandhandedaroundThetailsorslewIsnotdifficulttomn-alpulatcalthoughtheolivesfloatingiuargonoilslipthroughyourlingersMiniaturetugsofwaroccurwithyourvtoavUIntheefforttodismembernfowlordividetoupibmeatAsaparticularmarkoffavortbeItoKtwillfromtimetotimeplaceKPureyounlittletitbitwhichheliastornoffwithlifegreasyfingersHow-everstomachrebelsualustItyouhavetontvnllnxrthemorselDur-ingthemealtiltnationaldishofcous-cousIsInvariablyservedTillsdlsbIsandfrombrokennfwheatspeciallyiirojniriJLywomenIt-IsservedplrduplikeahugeconewiththemeatontopEachpersonscoopsouthitownlittlebohIntitaideandmustnottresjiasnonhisneighborsPortionTotheluexikTittimlItIsdifficulttoinnuagetheCOUKCUIIMwithoutmakinganawfulmessofItThesmallgrainmustbeJudiciouslycompressedIntotiloosehallnodthenslotIntothemouthANIEALWITHAMOORHiltgrosstltedivanarenotIntotheThsIIrOCNl8wasswasgrainsHitIhiseyedIn-vitedSaIpottonfiyour¬¬¬¬>¬¬withthebuckofthethumbTheMoorstakeextremedelightInwatch-ingtheIneffectualeffortsofEuro-peanswhoareIndifficultieswiththeircouscousMoorsnflverygreatentersandlittlectnvrIcarriedonduringthe11111AbowlcfwaterIspassedfromhandtobandfurthosewhorequiredrinkThelastcoursefinishedthehowlandwaterareoncesnorerequisitionedandthehandsantimouthwashedALibelontheOriginalWhyIsMaudesoangrywiththephotographersShefoundalabelonthelatchofherpictureHayingTheoriginalofibisphotographIscarefullypreserv-edBostonTranscriptAPessimistLittleVIlllcSavpawhatIsnaflmistPaApessimistmysouIsnmollderivesmustof1Upleasurefromtilsefforttospoililisuriofotli-erChicagoNewsIonItIrvritpegVIIthe¬¬¬<>IDLYWANDERING-WhenOverwroughtWorkerCutsLootFromCaroWhennbunlucssmanfromoverstrainornstudentfromover-worksometimesInsteadoflikingtobedhodisappearSuddenlybeismissingalltraceofhimlostIllsfamilynudfrleudsInvariablyfeartheworstTheyImaginehemetwithaccidentandIslyingunconsciousInabospltalorbuspartedwithhiswitsandisconflnwlInmiasylumorluaeventakenhisownlifeThesethingsarenilpossiblebuttheprobablethingIsnoneofthemTheprobablethingIsthattheoverwroughtmanLasyieldedtonnaturalImpulseandInstinctivelyhassoughtacurebybecomingnwanderertimeliehasputthecaresoftheoldlifebe-hindhimandwiththemthepeoplethatrecalltheoldlifeandhasSirenblraeelfuptothehealingoftheroadTodriftwithnowelldefinedobject-toseestrangeplacesandfacesevertoanswertbecallofthebeyonddiefernsastheGermanscallItIsmoretttaaAdreamlyingsomewhereInthebackofeverymansmindwhereItwaslodgedbysomeancestorofthenomadperioditIsoneofnaturesownremediesfortheworriesoflifeForthemanwithagreatsorrowforthemanwithatroubledforthemanwhosenervesaresettreatinghimrighttravelchangeofsceneIsoneofthethingsthewisephysicianwillprescribeIfItbeaveritabletrampafootthecurewillbespeedierandmorecompleteandmayworkphysicalregenerationIntothebargainNewYorkMullAFLOWERANDAWISHTheRomanticMarriageofDaofSuezCanalFameSirHenryRrackenbiirytellsInDIackvroodHMagazinethestoryoftheromanticmarriageofSIdcLossopsAFrenchmanlivingInReunionwascompelledbytbeIHneHSofhiswifetotakehertoFranceHesailedwithhiswifeandtwoyoungdaugh-tersbutthewifediedotithevoyageSometimeafterwardtheFrenchmancalledonMdetoldhimofbillmisfortunesofhisBufferingsonthelongseavoyageandexpressedthewishtodedicatetheremainderofhislifetothefurtheranceofthecon-structionoftheSuezcanalDeIssepsgavehimanappointmentatItumtillaandemploymentwasfoundInoneoftheworkshopstherefordaughtersOnedayDeLOHSVPHattentionwasattractedbythesetwogirlswithtowbeenteredIntoconversationHocameagainnextdayandgavetoeachofthemaflowersayingthattheyshouldtramsawishthelastthingatnightandthatIfInthemorn-ingtheyfoundthattheflowersbadopenedthewishwouldbegrantedOnthefollowingmorningbewenttotbelrhouseandfoundoneofthegirlssmilingtheotherIntearslieaskedthemustcfthInttrrsrndnpssMyflowerhisnutopenedshere-pliedTellmeyourwishnothatIfpossi-bleItmaygroutedresondcdM-dcLrssvpsAhtoyouleastofnilmenIrontellItwaheranswerThegreatengineermarriedherChinesaDrsrietleCruditiesHereisUlimpeofriteofthenaivebitsofhimmaginifthuntLIUKlendingIrngnliaiipnvlngthepartoftheiTsuitriitirsasolowhichmenusthatthewidowamiorphanoregoingtothetocelebnitcfuneralrilesThepropertynowonthestagnlittleboxfurmialtarundthrowsoverthewidowsheadnwhiteveilsymbolofmourningThenElamLineUKtinventurerwinwavesitsliaiidstiiidklLshertikeamanpuntingnfoottiallthattheeftitwillIsoutnfIdspherofmlliiiTIllweiutinsofficiallyfbiinxilfromatoutempleHowhiletherestifticfatu-lyLatchlMforetinaltirIlomLingKtmllsoveraidurIConenftumusicianswhutobethefortheLess1hislitout111111IlltHISrotl1ntitresthlllll1suffershascon-scienceandhisbunroittrestingEteryINnlysiagiziue¬¬¬¬¬¬>><>++WhatFsrVPclrsMakeAFoultorvIilitnthutnfertnlnprofessornlnMlulllwustotor-turetoaminiliorifstudentsonstirvivlngIxirlnoinlitlvtnrtheirofesMirxtldtlitilInhisnlluiiIolewasuflluleinovalntTtheIitstoiilsliiiwMitofthis1nrtliligentlemanrHinlfartafiiigtii-profesxorofinsultinghisruuntryimMi-OeinaiuKilanttMilorvTinjirffefSii1liiiivupoii1iplilnoithattheHIItouhKltlientVmilwasuienyafiiieasiirementTheIullshgentlesevliitfhisiiiltnken-skiHlhitiirofcsMirtoforgivehUaptreatrutUtTnthistaeprutVursmartlyrepllidYoueeultlnotlxrunicsirevenifyoutriedfurIttakesfortyKOJtouiaUeotuMtLondonMnilDormsKogulotscureconstipationthestomachtlmtilatthePierpromoteIlsfntandeasypassageoftheuaboxInillitIIIIIntqsIiIreseateotruntonesqtuut1>¬<>>>><<>ImimnwirwrIM-SfaifBimj-iflcTcodardUcduIa-ieliteStoaachsondDovcbnessandftstconlalrtsneitherNARCOTICforlionSourStOHachDiarrtoea-WonnsjConvulsionsJcvcrishnessandLossOFSLEEPifacsimileSignatureofANEWYORKEXACTCOPYOFnitNTaueaMtTnewcmACASTORIAForInfantsandChildrenodf-iIIslmi1atBearstheSignatureIPromotessUoncteetrulofnor1inu1NOTlIIoflIsInAFor0VerIThirtyYears1WRAPDirlftrrTheKindYOUHavoAlwaysBoughtAirclablePrarationfcrAs1itpttdS11iitUsetGASTilflrot==THECOOPERATIVECONTESTBusinessHousesThatAreinthePlanWhichWillIssueVotesThehandsomepianosanddiamondringtobogivenawayintheCo-OperativeContestwillbethegrandsidistributionofprizeseveroffereduiAlachuacountyPartiestradingwithanyofthefol-lowingstoreswillbegivenvoteeverypennyspentGainesvilleFurnitureCompanyfurniturePhlfcrMorrisCocloth-IngandfurnishingsGainesvilleHard-wareCoplumbingandhardwareSirsFTMcCorniioicmillineryWMJohnsondrugsandmedicinesLCSmithshoesandJewelryMrsRWilsondrygoodsandnotionsSaun-dersEarlegroceriesandfeed-stuffsCityBakerybreadandpastryPYSmithfreshmeatsCrawfordDavisliveryandsalestablesTheStunprintingandpublishingThethrownHousemealsandlodgingNFranciscoIlannnalousefruitsetcFldlnsMfgColumberandbuildingnaterialStandardFertilizerCofertilizerVoteswillbegivenonallordersforjobprintingatTheSunofficeandonsubscriptionsasfollowsTheDailySun1125threemonthssubscriptionsubscribersGOOvotesnow700votes250sixmonthssubscriptionoldsubscribers1200votesnewlfOOvotesonoyearssubscriptionold3500votesnewsubscrib-ers4500votesForacluboffivesubscrip-tionsbefore12oclocknoonAugH1909oldsubscribers30000votesnewsubscribers35000votesForacluboftensixmonthsBuf-orrlptlonsbefore12oclocknoonAugIS190Doldsubscribers30000votesnewsubscribers35000votesThereIsnolimittothenumberofclubseachcontestantmayserumTheSemiWeeklySun1oneyearssubscription500votesoneforIoldsub-scriberssub-scriberssub-scribersoneyenr¬>¬¬¬ForaclubofOveoneyearsubscrip-tions5000votesForacluboftwentyfivesubscriptions35000votesThereisnolimittothenumbsofclubseachcontestantmaysecureNOTICEOFRECEIVINGBIOSFORSEWERWORKTIltHoardofPublicWorkoftbeCityofGainesvilleFloridawillre-ceivesealedbidsuntilnoononThursdayAugustthetwentysixthforthefurnishingofmaterialundcon-structionofapproximatelylGOOfeetof8InchSanitarySewerTheHoardreservestherighttore-jectanyorallbidsPlansandspecificationsonaleintheofficeoftheSecretaryWWHAMPTONSecretaryBoardPublicWorksJuly27thIWantadvertisingisaforcewhichyoucanharnessandwithwhichyoucandriveyourplansandpurposetoanydesireddestlnatlnIfyouhavefoundanythingseeUitadvertisedIftheWantcolumnTFTHOMASUNDERTAKINGCOPULLLINEOFNUWHOODSVSTOJfMHT-IHOXFENCESMitttrirtihrnwlMitrOeOtoloHda1909totiKSrsFORcJilltatatIIoneyen2-1ttdtYrourNEPe-ItttNiiiuntwHlcars¬¬¬fGSMerchantCotctalleraandJobbersInStapleandFancyGroceriesGrainGardenSeedlSdFertilizersSOUTHSIDESQUAREGAINESVILLEFLORIDAHflheatmarketpricepaidforChskcnsEgosandothcProduce-ACompletestorkofHayCornOatsFlourBraniCAlCottoaseedMealandRyeWeonlytheVeryBestgoodsatLowestPricesandcuannteeatlfetlonoIbaneiaIerare1owuBUSINESSCAIDRGEOSWALDO-DENT1KTGrahamBuildingEastMelnstreetHIIPhone51AlecLongDlctancREDWARDCLARKDENTISTOfficesInGrahamUuildiogSaundersCarlesstorePhotNo356DRDsVERhBOfficeoveiGainesvilleNattoaaiAiiPhoae280JHDEKTlrfiOfficeDuitosftCoftPhea280GaiBeJvUleFU-BEKAKtRINCHANCERYGAINESVILLEAiacbuaOo-OttloHinllflymnihFERDINANDHAYEKATTORNEYATLAV-IGAIHXBTILLICantellyourcitypropertyprovedandtruaklngandfarminglandsSendkillaHitofwhatyouoverfortale2U20JACARLISLEATTORNEYATLAWAndSolicitorinEquityReaEstateandUMralPracticeAllbusinessattendedtoOfficenextofficefAiNKvirLKFLOMOAFitANKCLAUIvTI1OSXVFIKLOIN-OQLAUKFIELDINGLAWYERSPracticeInallCourtsStateFederalOniceaOverGainesvilleNatlouflankGalncavilloFloridaTheabstractbeforeyouInvestitsabsolutelynecessaryifyouwishtoavoidbuyingalotofexpensiveliti-gationandprobablylossoftheiHaveusdrawupanabstractandbethoroughlypostedonwhatyouarepurchasingGuaranteedaccuracyandpromptworkALACHUACOUNTYABSTRACTVOYLEVOYLEREALESTATEISAINKSVILIFFarmsDwellingsLotsForSaleYOriPROPERTYWITHVSAbstractsofTitleMade-TonilLandsinAlailinaCountjonshortnotitvFireInsuranceWritteninRCminirDiIJEDBALDttnjuIjWATTORNEYATLAWS-OLIOITORIrLiDAdoorStillCFloridaFlL1Toveraltarrlioverpietosal10in-vestmentGainesville¬¬>



PAGE 1

THEDAILYSUNGAINESVILLEFLORIDAAUGUST51909itrrcCIriYwtyyt>°+9MM4atIAPoetOmenatwllJeMMCoadaltMminmatterEditormadPbUbe-rntrsucwmvOfficelaHaymaaiBlockHateStreetaTncrBomistyMastDAKTSowytbHthedfieryteralag-MptMalaydltar4bylathecityryetiftlxMtfc4i3tuneileeteauitoceaUaMaemitkaowawi-VtaTwkemTMatSwiaaciktfortyHBpagerpaMbkedeveryMeayftanteydcaatitaalltheauraoftheMfctealtet4ccaeralaa4winOMBtMtacf4earofthecaWrCaaadafarftMaycaria4faac-Mbtaiaiwtovayfarlaad-AMfMtTKHDAILYBUNGAntctmtsPtattatintyeadomtswccfeedflywincetmoretogetalittleUptcMoffteaoaROWThepathefnotorietylafromthejailtthevanievlllestageTheSmtkIsgettingBOaolKIthatevesaurrtcaaecaatevenblowItawayThereabsolutely80differeacebetweettheCvaualMviewaadthatofTrfeaTaftitSHJthinksaMtUetarllrevisingThataaajurtaslshlngalghfrCablseteffteeraactuallycuttingdowntheGovermmefltexpeaaeo-ScaatorRootacematoholdapostikequivalenttothatofadvisoryeouBseltotheadministration-ItlooksasIfthetariffdisputemightenableMrTafttobuildupanearlyrecordasapeacemakerThebiteralsogetsbitBarneyOldfleldthefamousnutodriverhasbeenrundownbyanautomobileTeddyscaughtadlngallngashotadlgdlgIBohwhatalotoffsnaythingsforaSnrlthsonlanpieviLabatedMlzrathenewrulerof-tcriedwhenhewastakenawayfronthitnetherPoorlittlekidMrkTaftknowsmoreoverthatinthebrightItixiconofRolfologytherearenosuchwordsasthathazardtetoomuchformeItIsunderstoodthatnotwlthstandtagthedefeatofhisproposalforadutyenteaSenatorTlllmanwllcontlaaetotakoalittlesugarInPeopleworrymetoomuchsaysMrJohnDRockefellerAndMrRockefellersideaofrelievingthemistoraisethepriceofkeroseneoilBOWandthenASouthernStatehasmadeitamisdemeanortogivetradingstampsAjailsentencewasabouttheonlythingleftonecouldnotgetwiththetradingstampsAColoradomansayshehasthatonlyuglywomenvoteEvi-dentlytheriseofthesuffragettemovementIstobecounteractedbysubtlediplomacy-ItwouldseemthatPresidentTaftbadsucceededingettingwellundertheepidermisofsomeofthosewhofanciedtheirhideswerethoroughlyprotectedThesteeltrustispleasedwiththertnewtariffbillTheothertrustshavenotbeenheardfromIs-FreasontobelievetheyareequallylgratifiedTheywroteItallrightMrFWanEnglishmanpracticedInthoartofastronomyVthinkshewouldhavemoreucsignalingVenusthanMarIrseemmorelikelythatiaiItalkbacksoulIthenft1IYIerUtefarIfsiLI111t1MedkJwput1JWIllthtailnotIIIfI1l1JlteUtoerwIMPanessettolyUterrLon-ttheeyenIiIbutthererJJIWIltHonlitjlIwIIIIroA-LrHtwratViafilitMcc1tSavtCorn4Raeasamowex-denteraaiMeisianypertVafielMetespelagetimer4eMhseryeetsatafetveIiUkak1M1-1aMWRaeteegreedtadAkieul-ielellellw1msriytidipsjaidwCbe-drtaaMealVisieveaetMpleuktdkaewaueadreWagegaeRtiMIL-kpaAhe-ymayblefirsFrrdIPeraaebisrh1robserv-edtiSen-atorsrCe-raletn>>¬¬<<><>+°°+FIREHURTSTHEFIELDS-OfcoursethegreatestloasustainidthroughtheburningofvegetablematterwhichshouldbemixedwiththesoilsaysTheRaleighXCProgressiveFarmeristhelossofthehumusformingmaterialsbuttheactuallossInplantfoodIsalsoworthy-ofseriousconsiderationTheandpotassiumcontainedInthevegetablematterarenotdestroy-edbyburningforthesemineralplantfoodsremainintheashesbutthenitrogenwhichoursoilsneedmostisdrivenoffintotheairandlostWerepeatthatthegreatestlossIsthedestructionofthematerialsbutletusseeJustwhattholossofaltrogenamountstowhenatonofcrabgrassbroomsedgeorcornstalksIsburnedIfthematerialburnedbeJapancloverorotherle-gumesthelossofnitrogenIsmuchgreaterAtonofcrabgrasshaycon-tainsabout22poundsofnitrogenandthisIsworth20centsapoundwhichgivesitavalueof440AtonofcrabgrassandothermaterialsequallyrichInnitrogenisoftenburnedoCeachacreThatIsforeachacrebumoverwomayeasilydestroyworthoftheveryplantfoodoursoilsneedmostWeareslowtoacceptsuchstatemeatsasfactsbecausetheplowingunderofthesematerialsdocsnotgiveimmediateevidenceofanysuchbeobtainedfromtheplowingunderofsuchaquantityofcornstoverorcrabgrassThatIsmorebenefittothefirstsucceedingcropwouldbeobtainedfromtheapplicaUOBof4worthofcottonseedmealthanfromplowingunderatonofcornstalksThisIsundoubtedlysobuttheeffectsofplowingunderhumusformingmaterialsarenotalonemeasuredbythenitrogentheycon-tainandarenotlimitedtothefirstyearItIsthisworkingforimmediateresultsalonethathasbroughtoursoilstothatDegreeofInfertilityrepsresentedbyanaverageyieldof200poundsoflintcottonand15bushels-ofcornperacreNorichlandeverbecamesuddenlyunproductivenorcanadepletedsoilbeeconomically-builtuptoahighdegreeoffertility-InoneortwoyearsFromthesefactsweshouldlearnthatfarminglandsforthisyearsresultsexclusive-lywhilesometimesnecessaryIfper-sistedInIscertaintoleadtosoilandfinallytoagriculturalandfinancialbankruptcyAnewministrywasformedInFrancewithfarlessdifficultythanwasexpectedbutnoonecantellhowlongItwilllastThefactthatmembersoftheFrenchLegislature-aresplitupIntoanumberofgroupsInsteadofformingtwostrongandcompactopposingpartiesaccountsforthemanyparliamentarycrisesthatoccuraadtheprecariousenceofministriesFortunatelytherepublicanformofgovernmentissoentrenchedIntheconvictionsofthepeoplethatnofearofupsettingItnowexistsIfacorporationvoluntarilycon-fessestohavingputItshandsinotherpeoplespocketsandabstractedhundredsofthousandsofdollarsItsmembersareletoffwithaminimumfineDutIfanordinarypersononbeingarrestedvoluntarilypleadsguiltytotakingafewdollarsheIssenttoprisonWhythisdiffer-encewhentheinbothInstancesisthesameIncharacterDeafnessCannotBeCuredbylocalapplicationsastheycannotreachthediseasedportionoftheearThereIsonlyonewaytocuredeafnessandthatlabyconstitutionalremediesDeafliesaUcausedbyaninflamedconditionofthemucousliningoftheEustnchlanTubeWhenthistubeIsInflamedyouhavearumblingsoundorimperfecthearingandwhenitIsentirelyclosedistheresultandunlesstheIn-flammationcanbetakenoutandthistuberestoredtoItsnonnalconditionhearingwillbedestroyedforevernineeasesoutofarecausedbycatarrhwhichisnothingbutaninnamedconditionofthemucoussur-facesWewillgiveOmHundredHollarsforanyruseofDfHsscausedbycatarrhthateuwjiotIKcuredbyHallsCatarrhCureSendforclrcu-UmfreeFJCHENEYCO-TolnloOTiikHullsFamilyPillsforconstiIwe440value-totenSaidnphos-phorushumustormingde-pletionoffenceDeaf-nessbydrutgits7x¬¬¬¬¬¬¬¬¬¬¬¬SomeonewhoperhapswasoutofabitterexperienceoncesaidthatGodsendsfoodandthedevilsendscooksNotmanypeoplewillacceptthelatterpartofthatstatementbutItIsundeniablethatmanyyoungwomenmarrywhohavehadnotrainingIntheessentialsofsuccessfulhomemakingandsurelycookingIsanessentialBecauseofthisdeficiencymanyhomesaremadeunhappyLoveIsanecessityofahappyweddedlifebutloveIsapttogetkilledbypoorhousekeepingThesuccessfulflightofLouisOleriotacrosstheEnglishChannelfromCalaistoDoerInhismonoplane-Isadistincttriumphinaeronautics-TobesurelongerflightshavebeenrecordedoverlandbuttheremarkablethingaboutBlfirlotssuccessIsthatheperfectlyachievedhisaimwhichwastocross23milesofopenwaterandlandataspothebadpreviouslydecideduponafeatappealsvividlytotheImaginationandpoints-tostillgreaterachievementsInaerialnavigationArichmoneylenderatabanquetheldtodevisemeanstohelpthepoorwassoaffectedbythestoriestoldoftheheroicpatienceandstruggledisplayedhemovedthatthreecheersbegivenpoorSuchuselesssentimentalismIsaboutthelimitoftheInterestofsomepeoplewhentheyarecalledupontohelpthoseInneedManhashisdutiesaswellaainthehoselifeMarriagewillcertainlybeafailurehoweverdevotedandcapablethewifeifthehus-bandisindolentaimlessdrunkenorbrutalThemanshouldtakeIntothehomelifesoundnessofcharacterachivalrousspiritindustryandaffec-tionAFloridaRepublicanexplainsthatthehighcostofchickensIsnotoftheprotectivetariffonbeefbutbecausethenegroesstealBOmanychickensIfthenegrohasanypoliticalfriendsleftinthiscountrywoshouldliketoknowwheretheyEverymanIsIndutyboundtocon-siderhimselfapartandparcelofthecommunityInwhichhelivesHeowestoItthefulfilmentofthedutiesofcitizenshipacleanhonorablelifeandaconHtautandIntelligentefforttoadvanceitsInterestsIfEnglandreallywantstoabateUKsuffragettemobwhyduesnotthegovernmentinnthepolicewithmiceYoumayfindwhatyouarelooking-forthroughawantadInTheSunGOTHISHAIRRACKWaPerfectlyBaldtubeHeStartedteleKmbre0llcrpteldeFrederickManuelMarylandblockButteMontanaboughtabottloofNewbrosHerplcldeApril6WBAdbegantouseItforentirebaldnessThehairfol-liclesInhisscalpworenotdeadandIndayshebadhairalloverhisheadwritesandtodayraylairUasthickandluxuriantaaanyonecouldwiibNewbroaHerpicldoworksonanoldprincipleandwithanewda-coverydettrojrtheandyouremovethoeffectHerpUldedestroysthegermthatcausesSaadnifffalllaghairandfinallyBOthatwiththecausetonetheerectcannotremainStopsfalllnchairatonceandanewgrowthstartsSoldbyleadingWeIBforstapletoHerplcldeCoDetroitMickJ8BodifordACoSpecialAgentsA-SOLBIYMUGGISTSEVERYWHERECMDipUrcrnoatnn-MttuutrtIrriutlootorolrfriloi-ofmaconmfmbro-ftnfitnotMintorpionoobriprrprepaidfr-IICOQrcoJmrMatoftwucPROCUREDrt4naarjttTiprrtKMJfrrnrtr-fnvVTVtwtounikr-vpyrvturtcALLCOUNTRIESBiulifsiJirSHIIJJAitJdtii-PiUntandInfrlnjMurtPracticeEwmiuiyWrtrrtjut023ltrtrapUnlMIMtNUttCfiWASHINGTONDCsuchfortJJebe-causeare0On2hecauseImldndruggistBend8tamTheCHICHESTERSPILLSIarBrauteUMwu-uoAItElUimJANDf1IracINItECTtrff-li-Iyetspeak-ingwo-menJulyLalfotetonoeateJLet01aRAAPILLaketir-antaeetaeqSi1tAlworsReuLleMENANDWOMER-CNEitaleOaaraatarrnrtalaYsand0oniEntsCswcttcepentElepatltl0sots4rIragslala-G1aoraCICpIIICraneofItiO19axntairaldrartatslat¬¬¬¬¬¬><<+BallardSnowLinimentPositivelyCuresRheumatismNeuralgiaLamevSprainBruwctetcGhritaTrialandbeConvincesMALLARDSNOWLINIMENTCOFTIOWMISSOUMSoldfooommknelTYPEWRITERSMEasyMctiMKitsALLKIllSOfSUPPLIESMachinesfarRentTMKayStMfMMarbleWriteforPricesTermsEtcRCDAVISCO204WestBayStJACKSONVILLEFLAWLDENHAMAgentEFFECTIVEDEO191808LeaveGainesvilleforMicanopyFairfieldandlo-calpointsSouth1010amReturningarriveGainesville425praLeaveGainesvilleforSampsonCityPalatkaLakeCityValdostaandallpointsNorth600pmReturningarriveGainesville930pmALGlassGinSuptLEBarkerTrafficMgrNEWYORKCITYandRETURNTicketsonsalefromJacksonvilleeveryMon-dayandThursdaybeginningwithJune17thuptoAug30thwithfinalreturnlimitSept30thStopoversallowedontheseticketsatRichmondWashingtonBaltimoreandPhiladelphiaReducedratestoothersummerresortsForinformationratesreservationsetcorwritetoAWFRITOTDivisionPassen-gerAgent138WestBayStJacksonvilleFlaSEABOARDAirLineRailway1AVANNAHCOLUMBIACAMDENSOUTHERNPINESRALEIGHRICHMONDWASHINGTONBALTIMOREPHILADELPHIANEWYORKTwoElegantTrainsDailySEABOARDEXPRESSSEABOARDMALLMODERNPULLMANEQUIPMENTONLYLINKDailyThroughSleepersgJacksonvilletoNewOrleans-ForfullInformationandsleepingcarreservationscallonanyAgentSeaboardorwrite3CBOVLSTONAssistantGeneralPassengerAgentJacksonvilleFlriafsOldPrice25SOcand100PreandVfMJOEJNSONTampaJacksonvilleoo3500IATlAnllCOASTLIMERAILROADcan-onaeoaa-000000fiIgIigrf-ir-Iglagg0iaJrOofeERflLesrt311IIlanSirsTaritsttALWSdHalEyiU<<¬¬



PAGE 1

VOLXXIXNOPublishedTwiceaandThursdayGAINESVILLEFLORIDATHURSDAYAUGUST51909ONEDOLLARAItlitntntWeekMondaynYAiYi1ttjunQbCITYOFOSAKAJAPANISREDUCEDTOASHESConflagrationEatsOutHeartofGreatManufacturingCityandDestroysTwentyThousandNoosesaOSAKAJapanAug2ConfusionstillprevailshereastheresultofSaturdaysdisastrousfireThousandsofpeoplearehomelessandhungerIsstaringmanyofthemInthotacoAsystemofreliefhasbeenorganizedbythemunicipalauthoritiesbutitisInadequatetosupplyallneedsOutsidecitiesandtUWIIaregener-ouslysendingincontributionstoInalleviatingthesufferingsofthehomelessanddestituteThenumberofcasualtieshasnotyetbeendeterminedbuthundredsofIKrsonsarecrowdingthehospitalsThelatestestimateisthatUOOO-OInilldlngtiaredestroyedtheseInclud-ingbanksthestockexchangethemuseumgovernmentedificesandfactoriesWhileatitIsim-possibletoapproximatethtlodgestheyaregivenataroundseveralmill-ionyenItisfearedthatsomeoftheinsurancecompanionwillfullresultoftheheavylossestheywillhavetopayTheconflagrationlaUdmorethan44ttb-usedireslitras-a¬¬>¬twentyfivehoursandtheburnedsec-tionspresentadeplorablesightThebtreetsofthecityareverynar-rowandthehousesweremostlyofwoodconstructionUnderastrongbreezethereforethebuildingswereeasypreyfortheflameswhichjump-edfromonetoanotherwithgreatrapidityOncehopewasalmostabandonedthattheconflagrationcouldbearrestedThefiremenfoughtvaliantlyagainsttheoddsoflackofwaterandthehighwindandmanyofthemfellunconsciouswhileworknbravelyattheirpostsHadnotthewatersupplybeencurtailedbytheexistingdroughtItisbelievedthefirewouldhavebeenquenchedwithoutgreatimageDuringthefirethegreatestconfu-sionprevailedamongthespinninggirlsinthefactoryquarterbutforinnatelynoseriouslossoflifeoccur-redthereThebelongingsofthepeoplewhoworeabletosaveanythingfroththeirburningtomesarepiledIngreat¬¬¬ImportantItemOmittedFromAppropriationBillTALLAHASSEEFlaAss2ThegeneralappropriationbillwhichpasstilbothhousesoftheLegislatureofKODcontainedanitemof7000fortherepairoftheroofofthecapitol1TcertainminoralterationsintheinteriorofthebuildingandforimprovementofthecapitolgroundsItwasostfmatedandunderstoodthatabout3000ofthisamountwouldleneededtoputtheroofIngoodre-pairItlimerecentlybeenInbadchapeUnfortunatelythegeneralappropr-iationbillwasleftbytheLegislature-tothelastdayofthesessionandafterthebillcontainingthesaiditemof7000forcapitolrepairandimprovementWASpassedbybothhousestheonelinecarryingthispar-ticularItemwasleftoutoftheen-rolledbillduewithoutdoubttothegreathasteInwhichtheenrollingsec-retaryoftheSenatehadtodohisworkonthelastnightofthesessionThebillgottoGovernorinapile120measureswhichwerepenttotimonthelastdayoftinsessionPadtherewasnochancetodetecttomissionMeantimeduringtherecentcon-tinuedrainyweathertheconditionffthecnpltolroofhasboongettingvrsoandworseandgivingporeandIlJ1rthe-ytdtfttfriIIeJrfirIf14Ithe¬¬¬¬¬storetroubleonaccountofleaksThedangerofseriousdamagetothecapltolbuildingandtothemanyvaluablerecordstherefiledhasbecomeandItwasnecessarytodosome-thingtoprotecttieStatespropertyUnderthesecircumstancestheHoardofCommissionersofStateIn-stitutionswhichconsistsofthoandhisentirecabinetrecentlydiscussedthematterandrequested-theSecretaryofStateascustodianofthecapltoltoseewhattermshecouldnukeforgettingtheroofthor-oughlyrepairedAtameetingofthehoardSaturdayafternoontheSecre-taryofStatereportedanofferfromaresponsiblecontractortofurnishandputinplaceC4Gfeetoflfiozcoppercavegutter20squares12x12slateand1boxconklinsoldstyletinforflashingandworkaroundthetowerfor1752whichis1218cheaperthanthelegislativeestimateandthantheamountwhichtheLegislaturereal-lyappropriatedbutwhichwasleftoutoftheAppropriationactinthehasteofenrollingTheboardresolvedtoauthorizetheSecretaryofStatetohavethisworkdoneundersaidofferandtosubmittothenextLegislatureastatementofthefactswithrequestthatanap-propriationbemadetotakeupthemostoftheworkIjappar-entGov-ernor¬¬¬¬ProhibitionistsAgainWin-aVictoryinSantaRosariPKNSACOLAAUK2Willivttiin-fiuinotherprecinctrenrlihitdurlinthetinyadvicestrotsMiltonnurdayaretothepfiVotthattinprohibitionistshavetcoredevenalargermidmoredecisivevlrturythouthugdidtwoHKOhnSmtROMfouutyslatdrTi1fSanniavontlirtillrooarsdftItKlIIaII11tIrt1111fchltdtl4ytitnaNtILrlrhr>inajiiritforthenthrprtrlnrtIntitutlrtcountswncurrlidlvthewiandtwofthniHjuriclfjofonlytwtvPhllotinotherhadonlyflvnvotehancastbythprohibitlonlslKSaneofthfprHurtartlocatedfarintotlfintrloratdwillprnbnUvnotirfrJinuitlltxlivhilttftariclrvnilIslamth011diCIItilttIftrlL1rgatemorebe-tritrvtsitI>>>FUNERALOFMRNEWBERNRemainsWillArriveTodayOverACLfromLeroyThefuneralservicesoverthere-mainsofthelateWCNewbernwillbeheldtodayntEvergreenCemeterywherethoIntermentwillbemadeandallfriendsofthefamilyareIn-vitedtobepresentThefollowinggentlemenhavebeenaskedtoactaspallbearersEJHalrdJPBunchIICRothSMMixsonMBSaundersWD¬Dickinsonandtheyarerequestedtomeetthetrainat330atAtlanticCoastLineMrNewbernwasforanumberofyearssectionforemanhereandhasmadeGainesvillehishomeoffandonforthepasttwelveyearsonlyre-centlyremovingtoLeroywherehehasaandotherrelativesInbusinessheapsalongtherailroadtaclcsfromOsakatoKobewheretheywerere-movedearlySaturdaymorningwhenthefirebrokeoutInthegrayofthedawnofSaturdaythousandsolpersonsheavilyladenwithhouse-holdeffectsweretobeseenfleeingacrossthenumerouscanalbridgesandawayfromthofirezoneWhentheyhudreachedplacesofsafetytheburdenswerelaiddownandtheablebodiedmembersoffamiliesreturnedtothecitytoassistInfightingtheflamesleavingtheoldpeopletoguardtheireffectsfromthievesAlldaylungSaturdayandfarIntothenightthepeopleassistedthefiremenandthetroopsinquenchingthecon-flagrationAnareaofoverfourmilessquarecontainingsomeofthecityshand-someststructuresIncludingtheRuddhistTempletinelargestintheworldaentirelyburnedTheStockEx-changeoneofthemoatimportantinthiscountrywasentirelydestroy-edThislossitIsbelievedwilltenaconsiderablytodislocatethebusinessofOsakawhichwithitsmanufac-turingconcernsisoneofthechiefcommercialcitiesofJapanManytouchingsightsweretoboseenduringthelireThewomenwereandliedhitherantithitherwiththeirchildrensomeofwhomlatercriedpltunuslyforfoodthatcouldnotbeobtainedforthemTheemperorIsdeeplyconcernedoverthedisasteranditIsbelievedthathewillmakeageuerousdona-tiontotherelieffundandthatluluactionwillbequicklyfollowedbygiftsfromcharitablepeopleandJONESVILLENEWSAug4MrsCOGreeneanddaughterMissMarionandMissClemPickettleftMonday-forLakeCitywheretheywillvisitfriendsforafewlaysafterwhichtheywillvisittheirslaterMrsJItFowleratGreenvilleMissMayKirbyofGainesvillevis-itedntthehomeofMrandMrs-JIGriffinlastweekCenaHamiltonIsatSanfordvisitinghersisterMrsJCKortsonwhohaslatelymovedtherefromNewdepotJOSILLsoninlnwterrorstrickeninsti-tutionsMiss¬¬RevGriffindeliveredtwointerest-IngycrmoiiHtoattentiveonlastSundaymorningandeveningTheseweretinfiatscoswohavehadInournewbuildingThechurchIKnottlnlMhrdyetbutwohopetohaveitcompletedbynextSundaywhinwewillbeginourproOnThursdaynightAug12tliwewillaboxsupperatJoaesvlllo-MhuolhouseAlltherowontedtoprojHtroaboxwithmipperfortwoThereboxeswillhesoldstudtheproceedswillKOtowardbuyingnorganforourchurchAIreaderarecordiallyInvited1JJoneswinowasinfmedhfroP1hilionfiiiufw-lfirrur3iladiesarekItflJlrtIcongrega-tionstratadtnectinghavefinkagiIiuirmttrw1-ItFtgltrulathsrtI>STATEALIENISTSDECLARTHAWTOBEDANGERIsStillInsaneThawonStandThreePhysiciansTestilyThatStanfordWhitesWHITEPLAINSNYAug4ThreeofthosemedicalmenknownialienistswhohavebecomesuchafamiliarpartofmoderncriminalcourtprocedureunitedIntheSu-premeCourtyesterdaytomakeitun-pleasantforHarryKThawwhokill-edStanfordWhiteandwasadjudgedinsanebutnowdemandshisreleaseromtheMatteawanAsylumasmentallyuonnnlmanAllthreetestifiedthathewasInsaneandwhenThawtookthestandbrieflyaftersomedisconcertingtes-timonybuwasplainlyruffledandnervousbutMrJeromedismissedhimafterafewcomparativelyunim-portantquestionsOfthealienistswhotestifiedDrUhtlnFlintLrWilliamHirschandirAIUPHTlinkerthelastgavetestimonyofthemostImportanceHeisactingsuperintendentofMattcawanandappearsasawitnesswith-outcompensationtheonlyalienistnthecasewiththisdistinctionJusticeMillscalledattentiontothisfactandtookahandInquestioninghimDrtakersaidthatInhisopinionThawwasnotonlyInsanenowbut-idangerouspersontoboatlargeShortlyafterthisJeromecall-dThawtothostandliewaspaletadapparentlyshakenThodistrictattorneyputsootrntfcorIncoherentnoteswrjttenbytheprisonerInevi-denceandaskedhimtoexplainthemAfterparriesbackandforthandlaboriousexplanationsbyThawastothemeaningofcertainwritingshoiW-AndIwantyoutoknowMrJeromethatmanyofthesenotesyoucallsuggestionswerewrittenattherequestofmylawyersaIrIII¬¬¬>¬¬¬¬¬BrotherandSisterMetAsStrangersandMaCLEVELANDOhioAug4ThestoryofaromancowhichendedInthemarriageofbrotherandsisterwasrevealedInPoliceJudgeMcGaununsCourtyesterdayIthadtodowiththeearlyseparationandwiseliioirtreunionofAugustRoschkoaged29andAugustaReschkeagedrtThreechildrenthatresultedfromthemarriagearenowInthecareoftin1InmainSocietyThowomanweptaFbtoldherDoyoumeantotellusservedyouinbothhomicideaskedMrJeromethatyoubelieveyoudidnotknowtoothecasethanyourlawyerdIdowasThawsquickHeadmittedthathedidoffsuggestionstohislawyersThawwasexcusedaftera1ofthisordealandDrAustwascalledDrFlintdesparanoiacasapersondomincertaindelusionswhosemetphysicalniatcmightnototheiaffectedoxccitlurofarastlusionsInfluencehimParanoiacshelivelyneverrecoverDrHirschvariedthegendietbydeclaringThawadeparanoiacCharlesMorschauserThawnewattackedthistestimonycrylegalexpedientlaDrcaseheendeavoredtoSHOWhadgivencontradictoryteatlitwopreviouscaseswherehe-edasanexpertHoIllrtjcbsomeunhappymomeaquiringaboutabookhoIswDoyouInthisbooketaJesusChristwasaThealienistsreplywaswouldnotliketogiveanopThealienistsyesterdaytheiropinionsofThawlaaJeromeshypotheticalquestlasmallpartofwhichwasTheStatesalienistswilloccupythecenteroftheattwodaysmoreMrMorschauserwilleewtlofDrThatHirschDrCarlosFMcDcyettotestifyHowillbeMrJemmyiconcludedIcarparetske4bcrossexaminatton


PAGE 1

itTilLholt11JibItALlTlUHrJIS1VirginiaRepublicanstoRunKentforGovernorNEWPORTVnJuly30IlacingthemselvessquarelyonrecordashavinglocaloptionwithcouutiesandcitiesastheunitInsteadofmagisterialdistrictsasunderthepresentlawtheVirginiaRepublicansyesterdayacceptedtheliquorques-tionasanIssueIntheapproachinggubernatorialcampaignThenafteradoptingaplatformofwhichtheliquorplunkwaxtheprincipalfea-tureandelectingaStatetickethead-edbyWilliamIKentofWythepresentAmericanconsulgeneraltoGuatemalatheyadjournedtheirStateconventionsinedieThediscussionofprohibitionwasprecipitatedsoonaftertheconventionmetbythereadingofthefollowingplankasdraftedbytheresolutioncommitteeWefavorthegeneralprincipleoflocaloptionhighlicenserigidpoliceprotectionandastrictenforcement-ofthelawObjectiontothisresolutioncameandemphaticallyfromVirginiaTheplankasreportedwasdeclaredtobomeaninglessandIndicativeofacquiescenceIntheex-istinglawAHasubstituteStateSenatorATLincolnofferedthefollowingWefavorthegeneralprincipleoflocaloptionandthattheenmitiesandcltlcHLnaunitInallelectionsontheliquorquestionwithrigidenforcementofthelawMrLincolnledthefightforadoptionandwassoconspicuouslyKennatloiinlinurginghiscausethatnfterthesubstitutehadbeenIncorpo-ratedIntheplatformbyavoteof70to310hewasImmediatelyputforwardanacandidateforLieuten-antGovernorAlthoughaslateal-readyhadTeenpreparedtheleadersthoughtIttonominatehimforthosecondplaceontheticketandnooneopposedhimTheTicketTheticketnominatedwasasfolIn-stantlywisexPalsdYrSouth-westaIts¬¬¬¬ForGovernorWilliamPKentofWytheForLieutenantGovernorATLincolnofSmytheForAttorneyGeneralGeorgeARevercombofCovington-ForSecretaryoftheCommon-wealthJohnIILockeNewportNewsForStateTreasurerJosephPKruppnerofAlexandriaForCommissionerofAgricultureJamesTRobinsonofRocklnghamForSuperintendentofPublicInsti-tutionFrankPUrentofNelsonStateChairmanCliascomSlempspentthegreaterpartofWednesdayinheadingoffwhatappearedtobeamovementtonumbnatehimforGovernorliefinallyaccomplishedthisbyappealingtotheheadsofthetendistrictdolegallonsnottoallowanyonetoplacehisnamebeforetheconventionActiveCampaign-InacceptingthenominationforGovernorSirKenttoldthethathewaspreparedtowageanactivelightandwoulddohisbesttowinMrLincolnsaidthathewouldacceptthenoniiiutionforLleutenanGovernorinordertogivestrengthtotheprohibitionmovementTheAblngdondispensaryinWash-ingtoncountyinSouthwestVirginia-issaidtohavebeenluruclyrenKtisihitforfightwhichthePruhlbi-tlonlctswagedwithsuchsuccessYesterdayDelegatesfromtinsouthwestdodaredthattheyImdwonabigvUloryastiltsaleofliquorwastgreatmenaceInthatsectionowlnjtopourpoliceprotectionKenttiltnomineeforIsavonofnformerDemocraticLieutenantGovernorofVirginiaHewaxagoldDemocratuntilHryanwasnomlnatrdthefirsttlmoHoissaidtobeamanoflargomentisngoodxtiimpspeakerandonequalifiedtoWHRanHellsllchtIrlowswellorgnnizedconven-tiontheGover-nor><+GenuineNaturalWhiskeyatonicthemedicinalwhicharcfullyrecognized-bythehighestIIsystemuporifyournervesareonedgetrySunnyBrookmeWhiskeyI-twillrestoreoldtimevigorinalmostnousingBrookmoderatelyyouaretobenefitingeneraLthattheHOniteUtortesbottlebearstheGovernmentGreenStampcertifyingtotheexactAgeProofandMeasuretowithoutIf-KUVEREIKftECTTOYWEXNESSPREPAIDYANYOFTHEFOUOWIIMW8TH11UTERSCIliumCotackoiuMFlaCCIJutlerCoJack-sonvilleFlaLLobWhiskeyCoJacksonvilleFluAltmanWhiskeyCoJacksonvilleFlaDFACPLongJacksonvilleFlaGreilTradingCoPensacolaFlaBirminghamLiquorCoPensacolaFlaReidWhiskeyCoPensacolaFlaEDominguezTampaFlaBottlesl3tbOtHea-ftyaerBottlesSMppedtaptataboxesSeemrctalttincawltbJeeronlerNoMnc4CaDGruesomeFindofWomanWhoDiedFromHungerqualitiesofouroS4445gapBeerRyer116YYCtseoeLucenMutesnm4omr41aOnCIsFOODg11SQwartKtttestbasgoods¬°MEMPHISTwinAMRThewomanlyingonapulletontheHourdeadhermouthfilledwithbitsofcrackerinalatefforttosustainlifeandherthreechildrenranginginagefrom2to9yearsasleepbesidethebodyoneunconsciouswasthegruesomepicturepresentedwhenneighborsforcedtheirwayintothetenementapartmentofMrsDeliaChrystle3yearsoldhereAirsChrystlchadbeen111dwellersInthetenementstateandforseveraltheyhareministeredtoHerwasteMondaynightwhentheir3weeksrtiiitforadmissiontotitroomwasunansweredthiiyforcedanenmuteThconditionofthebodyindi-catedthatthewomanhadbeendeadforseveralhoursThntdeathresultfromlackofnourishmentwastitiplnionoftheponcesurgeonsum-monedMrsChrystlecametoMemphisabouttwelveyearsagofromStLouistierhusbanddiedseveralsearsagoThatshewasawomanofrefinementneighborsdeclarewasaprenttdi<¬¬FLORIDAPEOPLEsaaATTHESEPRICESAndconsiderthequalityEverycttairillustratedmodeetbestwhitemapfetockendtfnlslMdnalouldocrvarniahbestdoubtsrattannetcheeppithWiohundrJtofClawtthM4-hyrtallrtollthMOMcharniijlrarevofowpatternItyu-fSORTiufomURGEILLUSTRATEDCATALOGWW9fillJBcsWrTHESUNANDMERCHANTSCOOPERATIVECONTESTVOTINGCOUPONiGOODFORAddressThismayatTillSotherorateithrofterntlwiththeconutSOTOODAFTERAlOISIW9LOOKIWINteRtenatOUttombrua1225UlanlortIJackwllrlcridActi1iJu1ItiII5VOTESIForiCoupontitchitIlOnJcnLttarahenntfieseatsaresledOthtstaar114spasthlisp6aau4orrtarksaoethtrdspostihIopadalteeha1AMYliatqlkiYROCIERSy01YNliE3ECANEHOINREDCfEEHGRCAHARYFOR15CTSEXTRArFLORIDACFAIRFACTORYaIthetI<<=====LEGALPETITIONFORTotheHonorablehoardofIiihtriiitloiiJuliiisvllliAlarhuaotyFloridaWetheiinderHlivotersandtaxpayersInrodondoSpecialDistrictpetityourhonorablebodytoallanwtlonfortheofththeSpecialDistrictboundariesofMUdistrictsoastoembodytheheretoafterdescribedterritorymdelMtrusteesforthesamemlmlllagetobeleviedonfalltetifctorti-HeginnlngattheXEcornerofSeeITTpHiIt1runniiiKKuthtullesthencewestthnTrodatullesthencenorthtliiethinrowestiininorthonemilethenceeastfourtobtKiniilntpointallSelionsIfi17IS201228iiiMandtheElyoffcit-lonsllSOand110K19i-IJFJohn11HollywCHevllleJHevllleTMViNoteTheabovepetitionwillfegactedIIIKJIIbytheHoardofInstructionofAlachuacountyIdaatthemeetingtobeheldSeptember6th1909GainesvilleJuly301300BUSINESSDRGEO6WALDODENTISTJranimBuildingEastStrcttfcPhone51AlsoLongDistaffsJeANieCLANKT11OSIVFIRLOWIaFIELDINGLAWYERSPracticeInallCourtstitaUHiFederalOfticesOverGainesvilleNatloiiltankiiilnexvilieFlorida1UIA1TONCivilEngineerandSurveyirI-IEALEUINHEALESTATEPrtnptmttenliontohuueDillonduetdoorberthofTlirnfheriPOKniwaOfmMTturTFTHOMASUNDERTAKINGPULLLINEOFINEWUOUDSI-AORSTSFORieSCSfcUTMTOMHMTOftUIROFENCESSerMaplePonetuukuecttootoallccuertlaMallasJtelegraphordo-ntlalnesvllleFlarldaVOILEVOILEREALESTATGAINESVILLEFLAFarmsDwellingsWForSaleLISTYOfliIKOPEHTYWI2HKAbstractsofTitleIfe-TJaiIjujIinCountMiortnoticeFireInsuranceWritteninRUalifCcininlJlleierIfoftTAltUSTRICTLYCOHriOfNTIALIriaAUriitDSWIFT1DVERIiSEMEtdTSELECTION1rlpurposeih61t1cmbrarill1ITpGfPuFleaIIItiiCARDSlIMollolliCLARK0ttJJ-iI-ftttillCOtftittfatrirIpresvptlpRIbIi1-f4wiJb101jIIAtfIGIAlaHUc-onrlitIrtartdeadtjflIItIInccw1ttljPItA1r04tertiGsnfOgtxmuttonehalfawygelMasseyt-ablettIfii1tsotherIbislinesiLesdedserI-lloallIDt11A-Y1-pmmMettuuMeaoehtttorNOtTA5YAaaasrauaILDirttRteMr1b-twTiiwaTtak8P-53I1911<><>>>><>


xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0002829801476datestamp 2009-04-08setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title Gainesville daily sunGainesville Daily SunDaily sunSunGainesville daily sun (Gainesville, Fla. 1903)dc:creator Gainesville daily sundc:subject Newspapers -- Gainesville (Fla.) ( lcsh )Newspapers -- Alachua County (Fla.) ( lcsh )dc:description b Additional Physical Form Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.Dates or Sequential Designation -58th year (July 24, 1938).Description based on: Vol. 20, no. 48 (Apr. 5, 1903).dc:publisher H.H. McCrearydc:date August 5, 1909dc:type Newspaperdc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00028298&v=0147632994415 (OCLC)002027051 (ALEPHBIBNUM)sn 95026977 (LCCN)sn 95026977 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Alachua -- Gainesville



PAGE 1

THEttAlMSVlLLiSUN5HeT-fAUGUST1<<=+peakerCannonsFighttoIncreaseTaxonGlovesIWASHINGTONDCAug2OneofthemostedifyingspectaclesofthetariffsessionhasbeenthatpresentedlySpeakerCannonalmostattemptingtoboldupthepassageofthebillactgailysendingthreatstotheWhitegeusebecausethePresidentwouldsetapprovethedealwhichMrCanseamadewithformerRepresentativeJttauerforextortionatedutiesongloveswhichMrLlttauerwhoIsoneofthelargestglovemanuftctarcrsInthecountrywishestosakewithoutforeigncompetitionatUsplantatGloversvllleNYWhentthebeginningofthesessiontheretitsathreattodefeatUncleJoeCannonIntheracefortheSpeakerWpandwhenalargenumberofvbllcansJoinedforceswiththeDem-ocratstopreventthereadoptionoftieReedruleswhichmaketheSpeak-ernothingshortofadespotCannonseatforLittauerandmadeahardfastagreementwithhimthattimidhaveprohibitivedutiesonTO-MBSglovesifhewouldsaveCannontemdefeatLlttauerwhoisaliber-alentertainerachievedthetaskassiltedtohimwithaswillberememWedthehelpofafewTammanyDemocratswhoturnedtraitortotheirpartyInconsiderationofspecialfcverswhichtheSpeakerwasInaletittontograntTheWaysandMentalCommitteemetandthePayneKtlcontainedtheglovedutiesde-mandedbyLittauerasthepriceofftteassistancetotheSpeakerTheMoueobjectedbutwaspowerlessMdertherulestopreventtheglovebeingadoptedwithoutdefeatlietimeentirebillIntluentialmemlienoftheHouseImmediatelybeganvertIntheSenatehowevertopre-venttheadoptionoftheglovedutiesthereandweresuccessfulTheDtofileyrateswereadoptedIntheSenateandthebillwenttoconferaceMeanwhilehoweverthePresi-dentlearnedoftimeCannonLlttauertradeanddeterminedtodefeatitWhenthetariffbillwenttoconferfftRe-tlhe-riIifIHUesittwIwensiftiL1wetaf¬¬¬¬¬¬tterCannonpickedthecommitteeagainstRepresentativePayneInordertoinsuretheretentionoftheglovedutiesHuttheyPresi-dentinfcrniedtheconferetsthathewouldneveragreetoanyovertinDingleyratesonglovesCannonwenttotheWhitehouseaftertvlegraphlngtoLlttaiurtocometoWashingtonandmakethefightTheSpeakertoldthePresi-dentwasanoldmanthathehadJustonerequesttomakeandthatwasthathebepermittedtokeephispromisetoLittauerThePresi-dentwasthoroughlydisgustedthatsuchatradeshouldhavebeenmadethatthepeopleofthecountryweretobecompelledtributetoLittauerforthefarfrommeritoriousprivilegeofhavingCannonSpeaker-oftheHouselietoldCannonsoveryplainlyThatdidnotsilencetheSpeakerhoweverHehasbeenmak-ingpoliticaldealsallhislifeandwasabsolutelyunabletoseeanythingIm-properInhisconductortograspthePresidentsmeaningHeneverceasedhistightTheconfereespromised-thePresidenttoreporttheDingleydutiesbutCannonkeptupthecon-testFinallywhentheconfereeshadagreedtothePresidentsdemandforfreehidesCannongotthem-todemandthePresidentsapprovalofacompromiseonthegloveThecompromisewasrejectedbutevenafterthatastillfurthercompromisewasproposedTheRepublicanconfereeshavecomeverynearwreckingthetariffbillaltogetherTheirInsistenceonthegloveratesdemandedbyCannonandLittauerandthedutyonlumberdemandedbycertainWesternSenatorsplacedthebillinseriousandIncidentallydemonstrated-totheleadersoftheSenateandtheHousethatalthoughhewasbigandgoodnaturedandapparentlyeasygoIngWilliamIITaftpossessedade-terminationmoredangeroustoen-counteronceItwasarousedeventhanthatofTheodoreRooseveltmeteasefirtthathetopayIeasched-uleJeop-ardy¬¬¬¬¬¬¬¬¬¬¬¬¬¬+WrongedWomanSlaysHusbandandAffinityJrJCANTONOhioAugelopescentterminatedinthemurderofTonyPanlllaandMrsClaraPlsaanlPanlllawireofthesaileAftershootingherhusband-rsRanillaattackedMrsPlazaniabutterknifeAstrugglefirsPizzanlbeingsubbedktytimesDuringthePtxzanlsucceededinreachingaWepfcoaeandheldherantagonistLilywhileshecalledthepolicetaMrsPanlllaoverpoweredeverBeforethetelephoneconfercompletedandMrsPlzzanideadwhenthepolicelearnedoftroubletoiltadesertedhiswifeInDeans3AnOfblurstwithfoll-owedIruowastfFmanstruggle-rsMLht151tie>GainesvilleFloridalHtltutlonoftheFirstRanksupbyStateandFederalFundsYoungMenCoursesLeadingtoDegreesABMAMScandLLBandScienceAgricultureCivilElectricalandMSchoolPeaiesExceedinglyLowForwritetoISITYOFFLORIDAJAIfinedofScInArttcalLawNormalGraduateMURPHREEAMLL0-PrelldentrtkrdoughI1EngineeringmilAANJandMrsPlzzauileftherhusbaudPeterandchildinNewYorkCityanddopedtoCantonlastFebruarythepolicesayMrsPanlllalatercametoCantonandfoundthecoupletogetherHerhusbandagreedtolivewithheragainifsitewouldpermitMrsPizzanitooccupypartoftheirresidenceThewoniMiagreinltothisandtarthelastmonththethreehavebeenoccu-pyingthehousetogetherMrsPanlllasaidshesawherHusbandinMrsPIzzanisroomTatterdayandthesightcrazedherYoumayfluflwhatyouarelooking-forthroughawantadinTheSunPizzani¬FLORIDASTATECOLLEGEF-ORWOMENTallahasseeFlorida-ACollegewithoutaparallelintheSouthofferingdegreesanddiplomasInthefollowingdepartmentsIACollegeofLiberalArtsIIASchoolofIndustrialArtsIIIASchoolofFineArtsIVASchoolofExpressionVASchoolforTeachersNoTuitionOtherexpensesverylowForfurtherInformationaddrEDWARDCONRADIMAPhDPresidentII1BStetsonUniversityLINCOLNIFULLEYLiltDLUDPresidentTHEBESTSCHOOLFORYOURCHILDREN-BENDTHEMTOSTETSONnPrfColltfueofLiberalArtsCollegeofCollegeofTechnologyStudentsLastYearColiceofUuinuuiMOOEndowmentPreparatoryAcademyNormalModelSchooluSchoolofMethanlcArtsSMraoLaboratoriesforScienceSclolofM1crPhDISNOSETOOGUO17InstructorsBuildingsLa-IncreJiInlibrary0001U5edGeneralEllulpmciltofArtsletTJounnr1JlIlhn1IIIlotOrtnlCLrntnfJohntandUniversity3gdAilchoolFundormilcrifiTautgMalarlliaIUprlUonv-rrffruranaailcrlira19YSTrTt>°>+GUAVAJELLYByJohnBellingFloridaAgriculturalExperimentStationUndilutedguavajuiceconsistsoloverlopercentofwateraboutpercentofsugarsandasmallpercentagoofpectinandacidItalsocontainssubstanceswhichgivethecolorandflavortothejelleymadefromitPureguavajellyusuallycontainsabout20percentofwaterabout75percentofsugarsandtherestispectinacidetcDuringtheboilingofthemixtureofJuiceandcanesugartheacidactsonthesu-garandchangespartofitIntoInvertsugarsothatItformsasirupandIfthereIsenoughacidthesugarwillnotcrystallzeoutThisstrongsirupcausesthepectintosetasajellyThepinkcolorisdeepenedbylongerboilingorbymoreacidAmountsofJuiceandSugarSupposealargeamountofwater-IsaddedwhencookingtheguavasNowifequalamountsofthisdilutedjuiceandcanesugararetakentomakethejelleytheremaynotbeenoughpectininwhichcasethejel-lywillnotsetproperlyorwillbestickyIfItdoessetortheremaynotbeenoughacidandthejellywillsugarortheremaynotbeenoughoftheguavaflavorIfalargeamountofwaterhasbeenusedIncookingthefruitmorejuiceandlesssugarshouldbetakentomakethejellyIftheguavashavebeencookedInadoubleboilerwithoutwaterequalamountsofjuiceandsugarwillyieldagoodjellyItwasfoundthatthejuicefromtwopoundsofripeguavaswithonepoundofsugaryieldedlessthanoneandahalfpoundsofjelleyHowFartoRoilWhenboilingthejelleythetemper-aturerisesasmoreandmorewaterevaporatesTosecureauniformjel-lyititdesirablealwaystostopatthesamepointThiscanbestbedonebytheuseofaglassthermome-terSuchaninstrumentreadingto300degreesFcanusuallybeboughtfromadrugstoreorIfnotprocur-abletherecanhepurchasedforGOcentsfromtheArthurHThomasCompanyPhiladelphiaInaseries-oftestsitwasfoundthatthebestjellywasmadewhentheboilingwassolve¬¬¬¬¬¬stoppedatIIHtdegreesFItIHusual-lynecessarytostoptheboilingforumomentwhenusingthethermome-terbecauseofthebubblingITtheHumeamountofwaterIsalwaysusedIncookingtlhripeguavasandthehnnieproportionsofjuiceandsugararetakenandifthetemHrnturwhichIsfoundtogivethebestjelly-IsmeasuredwithathermometeritwillhepossibletoturnoutuuniformproductyearafterNoIronorsteelshouldcomeIncontactwiththefruitorJuiceTheguavasmaybeheatedtinsoftInanenamfdoraluminumvesselwith-asmallamountofwateratthebot-tomorinadoublehollerTheJuiceshouldhesqueezedoutthroughclothinastrongpressmeasuredandtheproperamountofgranulatedsugarndffpfAdeepaluminumvesselIsusefulfnrboilingdownthejuiceWhenthesugardissolvedthesolutioncanhefilteredthroughcloth-ItishnlltildowntillthethermometermarksthepropertemperatureandthenrunintoglassesormoldsSTATEPAPERSPLEASECOPYhasyear><>¬+TakeNoticeAllpersonsarerecommendedtotakeFoleysKidneyRemedyforrheumatismandkidneyandbladdertroubleItwillquicklycorrecturinaryIrregularitieswhichIfneglectedmaydevelopintonseriousIllnessItwillrestorehealthandstrengthDonotneglectsignsofkidnrorbladdertroubleandriskrightsdiseaseordiabetesJWMcCollumCoMarriedatBurnettsLakeMritTterryandMissMariahTurnertwopulnryouthpeopleofAlncliiKiwerequietlyaLakeonSundayHInoonImviiuloftfromtheirhornfollowlullrhurchserviceThhappyiftfurStIHUrsbiirieulnnMHIMafewdayslwforrMirnhiDonrfKgukcurentlon-tothngtoNMchstimulatetheIhirinniillfnfliixtlt-1fKlhIxlVUN2-KftpyourcjeonthewantadshinnvbecnetlingadvertisedIIIhumtltr1back-achemuttrriedBurnttstintthr-ulimesillulsr¬¬>==+JULYRAINFALL1645INCHESHeaviestPrecipitationRecordedforAnyOneMonthinTenYearsWeatherObserverJIHHell1M1inchesrainfallforthemonthofJulytheheaviestformonthintenyearsFollowingIstheprecipitationasre-cordedbyMrBellfromJanuary11JOOtodatePrecipitationatGainesvilleFlaMonthlyfromJan11900toJuly311909Inclusive1900190119021903January3982C927515February185920343529March78569741566SApril7S316017037May405203114505Juno1012866821571July415776485572August233954277963September2664081042412October23933033070November692742725December434297731149TotalInches6224590751824916January11799430081February2S332917387March13526415732April18315456308May88427667391Juno6088821055435July7338301028678August4291490449555September495599229950October277295183257November2634611238December23256335454TotalInches4905597343434555JanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberTotal431219061908190938315539171161881661021781838876285319622386510re-portsany-one190519074421643¬=APPROACHINGPICNICWillBeHeldatWorthingtonSprings-onWednesdayAugust18thTherewillbeagrandrallyandun-ionilcnlcntWoithingtonSpringsontieofAugustundertheauspicesoftheFarmerEducationalandCo-OperativeUnionofAmericaEveryoneInvitedtoconicandbrlngbasketsTheFloridaStatepresident-MSKnightofLakeCityandStateOrganizerJWDoruianofHoustonalsoVVWebbchairmanoftheUnionSeaIslandCottonCowillad-dressthepeopleAlllocalunionsarerequestedtotakepartinthispicnicNIISTOKES-JLDROWNWILYWILLIAMSNOTICENoticeisherebygiventhatfourafterthefirstpublicationhere-ofItheundersignedasGuardianofJamesRhodesandArchieRhodesminorswillapplytotheCountyJudge-ofAlachuacountyFloridaforrfnordertosellalltherighttitleandInterestofthesaidminorsInandtothefollowingrealestatetowltBlock1ofIngramflAdditiontotheCityofGainesvilleFloridaThisJuly15th1909CHARLESMRHODESGuardianCASTORForInfantaandChildrenTillKindYcuHaveAlwaysboughtBearsthaTCJKICW51JCURE1IIJtMi-ooct25IKIlathWweeksleRt1ltorN7u-jiUiIlIWlCoNDITIOHDE-STRt-A111rICCO-ftfbrLmIAtItlLtHANJIUTAFOODcc11uDJutJ11c1jJRDIh-fACIERHAHSTEWARTrvr91CttnerSOWybi-Gtrq1taiLRMI11ALre4CENTS¬¬StatementofConditionofCuttonRankGainesvilleFlaasReport-edtotheStateComptrolleratCloseofBusineuTusdayJuly27th1909ResourcesLoansOverdraftsDondsandCertificatesBankingHouseFurniture-andFixturesOtherResourcesCashonhandandwithbanksLiabilitiesCapitalSurplusandProfitsDepositsCashiersChecksCertifiedChecksNotesandDillsRedlscounted1341496861693219319223648519136500118907051509266537500000253401938860884292682500200000050926653StateofFloildaAlacbuaCountyIEDTurnerCashierofTheDuttonBankdosolemnlyswearthattooabovestatementistruetothebestofmyknowledgeandbelief-EDTURNERCashierSworntoandsubscribedbeforemethis27thdayofJuly1909CPGOODMANNotaryPublicGKBroomeWBTaylorWRTfeowas-NetletfDsMlutlNoticeisherebygivesthatthefirmheretoforedoingbusinessatGroveParkFloridaasPalterftWaltshasbeendissolvedbynmtaalconsentPHIFERftWAITSSEEDSRVEOtTABLBDYWewillWnanyRlzmlwerHTftrereiveTR4TBnOXLYrcfalla-ItttlnBUHIZeaTbeSeedsThatGrowWALTOVSouthOceinStJftoktoariUeFlaPoultrySuppliesKetcedlenInsecticideWriteforcatalogTheCorrectAttestNAILORDERREDSSIBDRCEOSWALDOVIFJDCO-T<<==+DENTISTWMRemiveAleutAugust20thtoEastSiRCwrtHwscSyareT-fccFiesMaterialsTheLatestMetfcrfsifPracticeAWTheLawestCtarfesmKeepingWithWarkPrescatLacatiaGratamBtttiMiHOTWEATHERSPECIALSEVERYTHINGFORTHEHOMECOMFORTI-CEPICKSICESHAVERSSicICECHIPPERS35cICENXESR-EFRIfiERATSXSWHITEMOUNTAINFREEZERSARCTICFREEZERSQUICKMEALGasolineRangesTheBestonEarthPERFECTIONOILSTOVESBAiRDHARDWARECOkSsaraitem11t25cFirstCkss=



PAGE 1

THEA1MSVILLHSUNAUGUST51909unoIFITMISSELLAJOLLYISFIRSTINSOUTHERNDEVELOPSGREATSTRENGTHIN-CLOSINGDAYSOFCONTESTOnlyTwoWeeksMoreandRaceWillBeOverandPrizesAwardedtotheWinnersMissEllaJollyofOrangeHeightstakesfirstplaceIntheEasternandSouthernsectionwithMisslabelMcCrtfdlesecondMissRealholdsfirstplaceinGainesvilleandMissLucindaBryantofHellIsfirstIntheNorthernandWesternsectionMissJollyhasdevelopedremarkablestrengthduringthepastthreeweeksandhasgonefromabouttenthplacetofirstwhichshowshowrapidshehasbeenadvancingOnlytwomoreweepsremainforthefinalwindupwhenthegrandprizeswillbeawardedalsoallofthecertificatesmailedtotheonesen-titledtothemantitheworkthatwillboputforthbythecandidatesfromthistimeonwillluInterestingSomeofthecandidatesarenowcenteringonandeitherisitlnghereregularlyorcom-ingeachweektoworkforIntertstandItisrumoredthatninnyoftheloweroneshavegreatprisestospringduringtheluxtfvdaysTheprizeareallhandsomeandex-pensivesadarewellworththehardworkhathasbeendonetosicurethemFollowingIstheresultofthecanvansGainesvilleCentralSectionMissEUlleHealLXiiVMissAddleGoode2t5j77-JllssMargaretLedheUeiliisMissNoraStalls1S71SJ-MUaHtssleCarver107140MissMaryFernandez01005MissGertrudeHarrodrllMissMyraSwtiaringen40113MissHbnchThompson35973-MlAliceSchaftr313JOMissAuraMLewis23750MissMabelWllllunw1121MrsXXVTaylor117nsMissEvaHauknlpht1011SMissAnnieHellTaylorSOG5MissGraceHullaru6175MissEllaHailoyIiIMssCurtisPutts342SFannieWhiting14SOtiifrlI1ItlHtheirurI°IIIiIssjsttoutottowncityr3¬¬¬>EasternandSouthernDistrictMissEllaJollyOrangelliss72vjoMissMabelMcCredleMcuopy8D123SMissLornaMcCndleMcnopy77JliMissHattieEnglishTacoma7217111MissMartleChainberlinMicafollyS32slitslUssleXXaftsHawthorn223450MissXXilmaSlamsMonteochajnSMissMyrtleHammondHawthornSSSOOMissCordeliaCrownRockPoint72420MissAnnieLewisHawthorn71300MissPattleZetrouerRochelleMissLulaPerryRochelle33645HobblttMcnopy32555MissVandallaStafXXaldo3244-MisEtlleTlsonEarleton2J345MissJewelGodwinHawthorn24510MissMaryHallOrangeHts13475-MbsGertrudeSmithFairbanks14770MlisGeorgiaSnowdcnHatchetCreek12030-MUsMaryLouiseAtwaterWaldo7235MissXellleReevesMIcanopy4800MissEmmaEntenzaWaldo3340MamieDalleyWaldo200WesternandNorthernSectionMissLucindaBryantBell943220MissHattieLudwigTloga856563-MlsGertrudeGulnnHague7143tt5MissVidaBarronHell710610MissAnnieKirklandAlachua600570MissEvaPowellAlachuaMs54tiMissEllenllevllleArredondo24191mMissRosaLeeRivesHighSprings157270Mrsivartfsprings10759-MisJewelStandleyHague7073MissHollyArredondo5743MissAnnieBevllleArredoudo47575MIsEmma3527MrsRnBakerHawthorn1340-rjParkerLacrosse11315MsKatieAkinArredondo84r-sAdaPearceXewberry705ftMISSPennMcLoodAlnchua3515M8LulaGayHelllSS-SlsLlzzloSmithXewberry63uSenatorRootseemstoholdapoltlonfpiitMintothatofadvloncounseltilU-illMissLaverneMissHigh111lam11EteltiAlecTrenton>¬¬JRAILWAYISREPORTEDTOBESOLD-iNOTHINGDEFINITECOULDBELEARNEDOFTRANSACTIONOfficialsandStockholderofCompa-nyWereAllHereYesterdayforSomething-ItwasrumoredhereyesterdaythattheT1railwayhadagainchangedhandsthistimethepurchasersbe-IngtheGCHallwayCompanyotCeciliaThisroadIBasmallonerunningfromCollinsthroughamostfertilefuturebeforeitIsbranchingoutandmakingfortheGulfTheSunreportertriedtoverifythereportlastnightandevenyester-dayafternoonaskedMrStuckywhoIspresidentoftheTJCompany-IftherewasanythingInthemeeting-oftheprincipalstockholdersofthecompanybutreceivednodefiniteanswerItIsknownhoweverthatthepri-vatecaroftheofficialsoftheGCPIsnowinthecityandwasherenearlyallofyesterdaypresumablyforthispurposeandsomethingtieflnlto-willverylikelybegivenforpublica-tionwithinnshortwhileBothStuckyandSlmontonwhoartlendingstockholdersintheJwereyesterdaybutnothingcouldbegaiiudfromthemInreferencetotinfilWALDOANDMICANOPYPLAYEDATIEGAMEXXaldoandMIcanopyJourneyedhereyesterdayforthepurKtieofclean-ingupeachotherbutafterthetenthinningthegamewascalledthescorestanding7to7XXaldoeasilyhadtheMIcanopyplayersoutclassedfromageneralstandpointofhallplayersfortheirteamhasbeenplayinggoodamateurhulluptothecontrahereyesterday-butinthisgametluywenttopiecessadthebatterywhichdidgoodworkreceivedpoorsupportLocalInterestwasinfavoroftheMicanotyitefromthefirstowingtoXValdohavingmadefourrunsbeforeTPIILwseventyMesonTthere¬¬¬¬¬>theyhadmanagedtoscoreevenoneandInthelasthalfeighthIn-ningthesmallcrowdpresentwentwildovertheerrorsofXXaldowhichletInflueallowingthemtotiethescoreThisremindedoneofthegameofafewdaysagowhentheOlympicstalliedsixtimesotitheOakHallsinoneinning-InthetenthinningWillieJollypre-ventedMIcanopyfrothscoringwhentwowereoutandsecondandthirdoccupiedbymakingabeautifulousthandedcatchInleftniternhardrunTheUlAnwhohelddownsecondbaseandCurryMerchantonshortforMIcanopydidtheboatworkfortheirteamThescorebyInningsXValilo0l10200Micanopy07ThebatterieswereMIcanopySparkmanandNesterWaldoPrewittrindHarveyDEATHOFMRATWATERiPostmasterofWaldoDiedVerySuddenlyYesterdayMorningPostmasterHCAtwaterofXXaldodroppeddeadathishomeatthatplaceatanearlyhouryesterdaymorningsupposedlyfromheartfail-ureHewasagentlemanratheradvanc-edInyearsandhadbeenpostmaster-ofWaldoforthepasttwelveyearswhichmadehimnmanwhowasoftenmetandgenerallyknownthroughout-thissectionHearofoathisusualearlyhourandprMrdhisbrHkfatawasliliusualcustombeforegoingtotheofficebutafterfinishinghismealhentnrudforthedoorandfellneverretaininghimselfanddeathresultedaphysiciancouldbesum-monedIllswifehadnoticedthathewasffflliiRofwhenhefirstgotandwhenaskedwhatWitsthematterrepliedhehadaslighthadacheandwouldsoonIMallrightThlhlonlyconversationa-hnvrilcaftTseatedInarhirrunners0I000000hisIllofuse07023beforeBendwas5being¬¬¬¬>¬>>AGREATRESERVOIRBURSTSWITHROAR-ANDWATERRUSHEDINTOIRRIGATEDDISTRICT1000000000CubicFeetofWaterLoosedatDamage-NoLivesLostFORTMORGANColoAug4TheIrrigationsectionnorthofhereIsthesceneofdevastationowingtotheburstingoftheretainingwallsofthegreatGovernmentreservoirMondayafternoonWitharoar1000000000cubicfeetofwaterrushedoutofthewiden-ingbreachcarryingeverythingbe-foreitItsweptacrossthevalleywitharoarandalthoughtheground-IsalmostadeadlevelItcutagreatshallowditchhalfamileandmorethanamilelongSeveralfarmsweredestroyedbythegreatwashofwa-tersbutItBOhappenedthatnoonewascaughtInthefloodThedamagewillreachseveralhun-dredthousanddollarsTheGovernexpendedagreatsumofmoneyinbuildingthereservewallLOCHLOOSANEWSLOCHLOOSAAug4JII1pthegroveMissDaisyHelloSimmonsIttpthegroveandwife1WUpthegroveandThomasMorrisonleftSundaynightforTampawheretheywillspendafewdayswithfriendsCVFowlerwasunexpectedlycall-edtoGrecnvllleFlalastSaturday-onaccountoftheseriousIllnessofhisfatherGilesFowlerWeallhopeforhintuspeedyrecoveryXXITompkinsandXVTRichard-sonwenttoGainesvilleonMonday-toattendtosonicbusinessaffairsDPoseymadeabuslHOKStriptoGainevUoMondayMissEpeeHaynmnreturnedhomeThursdayfromInvernesswhereshehasforthepattwoweekswithfriendsandrelativesIIXCaselsofislandGrovespentafewdaysIntownlustweekJCHaymnnSALagenthasbeenquiteillfortinjMistfewdaybutItimprovingnowXXenilhope-toseehimoutagainsoonMhxRoyFaymidRobertCaldwellOnceGreatbeenIntSundaewithfriendsandntenthadandwifeMrsIlust¬¬¬¬relativesatHawthornJohnlaymanspentlastSundayeveningwithaladyfriendofhisatIslandGroveThecitizensofHawthornandLochloosagatheredatthepicnicgroundsonthebanksofthebeautifulLochloorialakeThursdayforafishfryTimdaywasbeautifulupuntiltimefordinnerwhenthedownpourofraindescendedThefishwerefriedandaftertheraindinnerwasservedTheremainderoftheeveningwasspentInlaunchridingonthelnleAboutlurkalldepartedfortheirhcaicsaiurhavingspentamosten-joyabledayTherewillbeanothersootTheyoungfolksgatheredatthehomeofMrandMrsJDCaldwellSundaynightforthepurposeofaSingTheguestsarrivedat74oclockandsanguntilabout10oclockwhentheyalldepartwithratherweaklungs-IWStewartmanageroftheLochloosabarbershopmadeabusinesstriptoHawthornMondayKADupreeandwifeofIslandGrovespentlastSundaywiththehi-ttersparentsMrandJIIMissJaneDealwhoIsvisitingMrandMrsJXHaymansherehasgonetoOrangeSpringstospendafewdayswithrelativesJXHaymansmadeabusinesstriptoGainesvilleMondayCarbltErgleofIslandGrovewasIntownMondayshakinghandswithhisoldfriendslPalatkaShutsOcalaOutPalatkadefeatedOcalaInthegamejthereTuesdayAtooandItwasanInterestingcontestWalkernotallow-ingahittotheOcalanineInsecondgumatPaintkayes-terdaybetweenOcalaandthatcityOcnlawayflifentdbynscoreof4to0resultofthesetwogumocanbettershowthpeoplewlwttoexpectinthtwoKHinesbetweenCalnHHvlllHmidIalntkaIHIVHonlocalliltfurtrmttwodMrsIiTomp-kinstheThethe¬¬GLANDERSINHORSESCURABLEBYMALLEIGovernorGilcnristGivesValuableInformationOb-tainedFromExperimentsByUSAOfficers¬TALLAHASSEEAugsup-plementtheinformationrelativetothetreatmentofglandersInhorseswhichheobtainedfromColHugh-IScottSuperintendentoftheUnitedStatesMilitaryAcademyatWestPointXYandembodiedInaninterviewuponhisreturntoFloridaGovernorGllchrlstwrotetotheQuartermasterGeneraloftheUnitedStatesArmyforcopiesofreportswhichhadbeenmadetothedepartmentonthissubjectandhascopiesofseveralsuchreportsfromwhichthefollowingextractsarepublishedfortheInformationofInterestedpersonsInFloridaDrThomasPShanahanveterinarysurgeonoftheQuartermastersUSAreportsasfol-lowsGlandershavingbrokenoutamongthehorsesofthe3rdsquadron14thCavalrystationedatJoloPIcom-prisingtroopsIKLandtocontrolandweedouttheIn-fectedcasesthecommandingofficerorderedthatthemalleintestbendmlnltenItothesefourtroopsbytinordersandunderthedirectionsolMajorHughLScottlltliCavalrycommandingthepostofJoloPIThemnlleinwasadministered-totheanimalsonetroopatntimeandanyanimalthatnxictedtothetestwastobeIsolatedfromthehealthyanimnlsmidgivenrepentedofmalleinuntiltheanltralceasedtoreacttothemalleinandwhentheanimaldevelopednoofglandersandgavenofurtherunctiontothemallointesthowasrelumedtodutyInthetroopThethatreceivedthenmllelndevelopedsymptomsofglandersOutof215horsestestedwithmal72reactedatthefirsttostThesehorseswerequarantinedandputstableandpromptlyrofromtheeffectsofthefirstmalMntestcontinuedtodowellattheexpirationoffourweeksretestedwithmalleinOnehorse3ToItestInjectionstIphmpornrhcIreceiv-edDe-partmentl-andsymp-tomstestrevtroycti¬¬¬¬¬dvelopHglanderxtendaysafterthefirstinjectionthreeafterthesecondInjectionandweredestroyedTheremaining68horseswerereturn-edtodutyintheirrespectivetroopsandhaveremainedhealthyuptothisdatesixmonthsafterthefirstmul-leintestwasmadeXonewcaseshaveappearedamongthefourtroopsuptodateTilesummaryresultofthefirstmalleintestAugust1904wasasXuiiiborofcavalryhorsesatthispost215provenhealthybyfirstmalleinInjection145provenInfectedbyfirstmalleininjection72provenhealthybysecondmalleinin-jection36provenInfectedbysec-ondmalleininjection35provenhealthybythirdmalleinInjection24provenInfectedbythirdmalleinInjection11provenhealthybyfourthmalleininjectionSFourhorsesweredestroyedsuffer-ingwithglanders-ColHLScottreportingtotheWarDepartmentfromJoloPhilippineIslandswroteasfollowsThedifficultywasIndetectingglandersandIsolatingtheInfectedhorsesintheearlierstagesofthediseasebeforeItprogressesfarenough-tobecommunicatedtoothersInordertoaccomplishthisnlargehorsesfol-lowsi¬¬¬¬¬¬¬ToTeachProhibition-InthePublicSchoolsMONTGOMERYAlaAug3ThefirstprotestagainstthenumerousprobillvoicedIntinHousfterdavnftinottwhenRrwmtntineStollenwrecktwnewromcountyspokeiantPHMMWofthPootebillroitnfrvtentofeducationnthpnbllrrhmUannlsttineofiThbillprovidelfrrtvtniixhtthatImemlHrIlitinK111robitwasMontgomerytheRarmi>+quantityofmalleinwasprocuredaaiallthecavaltyhouseswereInoculatedwiththeresultsmentionedwithinItisbelievedfromthisandotherlafornationthtthemallelaIsacureforglandersinitsIncipientstagesbe-foreithasbecomesufficientlyadvancedtobeIndicatedbytheulcersinthemembraneswellingoftilelandsetcandalltheoldsymptomsusuallyrelieduponforthediagnosis-ofglandersandthatbyitsuseasshownwithinthecavalrymountatthisposthogbeensavedfromlossThemulleinseemedtoactasaverystrongtonicandthoseanimalsthatwereweakandthinbe-gantoImprovealmostimmediately-untilwhenreturnedtodutytheywerefatandstrongArmyVeterinarianRichardOBCorcoranmadeareportofhisworkonglandersamongthehorsesattheResidlcofSanFranciscofromwhichthefollowingextractsaretaken-IthenInjected1CCofmallcihintoeachanimalatIntervalsoftentofourteendaysuntilallceasedtoreactboththermallyandlocallywiletheywerereturnedtodutyBe-forethesecondInjectionofmalleinwasgiventheIsolatedhorsesofHtroopIUncoveredthatonehadacuteandcutaneousglandersXo39andlateranotherdevelopedacuteglandersXo35Rothhorseswerede-stroyedonFebruary3rdand5threapelivelyAtaboutthesametimeXo21ofthesametroopHshowedindi-cationsofchronicglandersInduratedIntermaxillaryglandsslightnasaldischargeandsmallcharacteristiculceronSchnelderlanmembranesThisanimalhoweverrecoveredbutUKtreatmentwasmoreprotractedthanmostofJhcothersMonthsafterthisInstupingthematterovercalmlyanddeliberatelyIpersonallycametotheconclusionthatglandersdidexisttotheextentclaimedbytauStateau-thoritiesbutthatbytheperiodictestIngoftheheardwithmalicInbycom-pleteenorm-ous¬¬¬¬¬¬¬¬veterinariansprecedingusItrrknowinglyactednnncurativeagentTakingIntoconsiderationtherepu-tationsofmydifferentpredecessorsandtheperiodicInjectionsofmallelnbythemintothisoriginallyIn-fectedlardandtheirImmunityfromthediseaseatourinvestigationIhadcometotheundoubtedconclu-sionnodassertedsothoughtscoffedatbysomeofmycolleaguesthatmalleinwasacurativeagentforglanderswhennotacuteortoofaradvancedThiscasenowsubmittedofgeneralizedIncipientglandersamongthepublicanimalsattilePresi-dioofMonteroyIsthefirstopportunityIhavehadofprovingmyasrertloniFromnilofthesedeductionsfromextensiveexperienceandob-servationIhavenohesitationinstronglyrecommendingthatallourpublicanimalsbeInjectedannuallyorwithmalleinespe-ciallyInthetropicsorwhereglandersIssuspectedtoexistNotonly-asadetectorbutasanImmunlreraswellasatreatmentforthedis-easewhenreactionsarediscoveredTheintervalsbetweeninjectionsshouldbenotlessthantendaysasIfoundInmanyofthecasesquotedlocalreactionexistingforfullyoneweekafterInculatlonsemlannually¬¬¬¬¬¬¬¬mottoesshallbedisplayIntheschoolsThebillwaspassedbyawidemarginTheFullerbilltoprohibitnews-papersfrompublishingthenameotwomenonwhomassaultshavebracommittedpiwdaswasabillhlbltbBthedUplaefnudeFullerbillprohibitswsJeilerfromwilingpublishedoutsldqStatethatviolateprovisionprotheitstpicturesThepapers



PAGE 1

TinsttAlSESVJLLlSOAUGUST51909tji1i-NEWSOFCITYANDCOUNTYCONDENSEDMATTERSOFGENERALINTERESTSECUREDBYSUNREPORTERSWhatHatHappenedandWhatlaGoIngtoHappenPersonalandSocialItemsoftheCitypromlucDailySunJRofWilcoxwasavisitorhereyesterdayCaptJSDuplusofAlachuawasinthecityyesterdayJusticeJARobertsofRochellowasheroyesterdayMmGWMcCallofAlachuawasavisitorheroyesterdayMrsOMFutchofAlacbuawasshoppinginthecityyesterdayWDTillmanofCarnpvtflewasvisitingInthecityyesterdayJHLawofArcherwasinthecityMondayandmadeacallatthisofficeFBGodfreycashieroftheBankofAlacbuawasinthocityyesterdayHCCatoandWaShcheeofHighSpringswerevisitorsheroyes-terdayJesseIGriffinofJonesvilleandSOGayofTrentonwerevisitorshereyesterday-JFRileyofWadewasInthecityyesterdayandrenewedhissubscrlitlontoTheSunWJWilliamsofTrentonwasheroyesterdayandmadeapleasantcallatthisoffice-TJRiversofAlachuawasavis-itorheroyesterdayHemadeapleas-antcallatthisofficeFredRileyofWadeandHenryTuckerofNewberrywerevisitorstoGainesvilleyesterdayMrandMrsTKGodbeyofWaldoaccompaniedbytheirdaughterwerevisitorsheroyesterdayMissHattleDennisleftyesterdayforNorthCarolinatobeabsentfortheremainderoftheheatedterm-JAJonesofJonesvillewasavis-itortothecityyesterdayWhileherehemadeacallatthisofficeSamRogersWilliamGrayandBenjaminWilliamsallcitizensofTrentonhereyesterdayISFutchaformercitizenofHighSpringsbutwhoIsnowlocatedatStPetersburgwasAvisitorheruyester-dayMrsDTArnowwhohasbeenabsentforthepastfewweeksvisitingrelativesatBrunswickhasreturnedhomeDrRACaswellofAlachuaandIIAPIckettofJonosvllluwerehereyesterdayattendingthedelinquenttaxsaleCaptVTRichardsonofkochlootawasIntownMondaytheguestofhissistersMesdamesGSMerch-antandIIHMcCrearyJCWltherapoonwhoIsconductIngasingingschoolatFortWhitearrivedInthecityyesterdayonashortvisittohisfamilyFMRamseyofWacahootawasItithecityyesterdayHehasjustre-turnedfromnbiflreBvisittothenorthernpartoftinecountyTheStandardFertiliserCompanyitgivingdcublevotesonallcishalesfromnowuntilcloseofpianocontestGoodsshippedwhenyouwantthemTPAllendeputysheriffofIn-vernesswanhereyesterdayhavingcomefortwoprisonerswantedtherewhoworecaughtnearNewberrylastMartiniI1fIIjtrItIIYawerevisitorstq1Akrft4tsa¬¬¬¬¬FJHammondoneofthemostuxttinaivemerchantsoftheEasternportoftuecountywithheadquartersntHawthornwannvisitorhereyes-terdayTGHaganandlucksonFloydofTrentonamongthoowhospoutMondayinGainesvilleandwhilehereiiMuleTinSunnnHgruo-UcullMissAliasIlMtlwrwhounitedtoAtlantatovisithrntotkoronalokmtehatsreturnedandrvmuch1WStarkctmrfltkjiiofeMHiiMloftyesterdaywhereMwillrthepractlroofhitIIIlloo-1IiluiUctrdwartaccount-ulUorltheJrqrutwIlocateIrtcuredcLII4wasithrpatientd-Irtresntc1t91Itiwl-trt¬>>+Theformerownsacanneryandputsupalargequantityoftoma-toesandpeacheseachyearColandMrsWWwillleavetodaytheirannualKiiimeroutingTheyexporttobegonefurthenextseveralweekssadwillvisittheCatskillmountainswindinguptheirtripatSaratogaNVJEThrasherofMlcanopywasheroyesterdayHestatesthatbusi-nesshasbeengoodthepoetftatothephenomenalsuccessoftheplantersandhewillleavethisweekforlialtlmoreandotherpointstobuyhissupplyofgoodsItPLumpklnofOrangeHiIgniswasavisitorhereyesterdayliesaysthattheheavyrainshavefilledthelowplaceswithwaterbutnodamagehasresultedtothecropsfromthedownpourandthingsneverlookedmorepromisingforthefarmeraInageneralwayRevThosPHaychairmanoftheMinisterialAssociationhasaskedElderJTJohnsontofillhisappoint-mentsattheNorthGainesvilleHalluntilhisreturnfromhisvacationNextFridaynightwillbethefirstappointmentPreachingFridaynightAugustGat745oclockMrandMrsGeorgeWBrumleyandMasterFranksailtodayfromJacksonvilleonthesteamshipCretanforBaltimorewheretheyexpecttobejoinedbyMrandMrsEMClarkewholeftheremorethanamouthagoTogethertheywillspendsixweeksgreetingoldfriendsandrelativesontheEasternshoreofMarylandFromtdncndftj1DallySunHenryIolkofNewberrywasavis-itortothecityyesterday-JIHolderandEGSpencerbothofAlachuuwereInthecityyester-dayAlexParrishoftheGordonsettle-mentwasvisitingInGainesvilleyes-terdayJusticeJTStokesoftaCrossowasamongthevisitorstotlfecountycapitalyesterdayItTlieckhamofCampvilleandVAStringerofArcherwerevisitorstoGainesvilleyesterday-T11LinkandFrankItennuttbothinfluentialplantersofCauipvlllewerevisitinghereTuesdayKSGatildenofEugenewasavis-itortothecityyesterdayWhileherehemadeapeatnntcullatthUofficeMissBarrenofHellarrivedInthecitylastnightandwillvisitheruncle1IICohonforthenextseveraldaysHCSealeyoneoftheleadingciti-zensofAlachunwastransactingbusinesshereyesterdayandattendingthedelinquenttaxsaleJAKosboroughonooftheclerksintheExpressofficeleftyesterdayforpointsInGeorgialiewillbeabsentaboutfourweeksJKSherouseofCampvilleoneoftheenterprisingcitlztuisoftheeastornsectionvusgreetinghisac-quaintanceshereyesterday11AFisherhasreturnedtramMeantiPrairieCreekwhorehehasbeenemployedonabrickAntractforthepastseveraldaysCaptCIThlKpInofWaldowasavisitortoGainesvilleyesterdayWhllointhecityhimadenploatianlallattieidlerenewinghisulscrlptlon-WWGeigerofMlcanopywasnvisitorheroyesterdayliethegroundsarenowwetinhissectionandthatItwillInterferewiththefallvegetablegrowingCVMcQueenofwasinthecityyesterdayHecameforHamiltonfurIdaIntobslatestendsc-owingewberry¬¬¬¬¬¬¬>¬¬>thepurposeofattendingthetaxsalewhichisnowbeingconducubyIVCollectorDickinsonWIIGayoneofthetiersofTrentontitiiioneoftheiKt-intliuiitlftlsettktrcofWstrMuckwnhereyesterdayslinkingkmiilwithhithostsoffriendsMrandMrJMHalleandtooHttUfchlMronleftyeaterlayhitJacksonvillewhoretheywillHialHfurtininxtdaysvlslugrelativesandfriendsGrnctHallsofGalHwvlllowhomulhertomeInOcalafursomeInnluugonetoBalsamNCntpendtimeutiJofiMgtherirOcallawartVIKntrhirolnrilfd-HIrSNwatcinntlrhutseveralsetaestaint1rIsFICLltrfoldtltnesetMissInIwarnaatntMt1tr1wcrsas-pgtoIif-t>+DaytoilaBenchHegoesfortheofmakingarrangementstocar-ryhisfamilythereforashortwhiletotakeInthepleasuresoftheuceauasaMrsLMBrinkleyneeMissKatiecarterarrivedInthecityyesterdayfromNewOrleansandwillspendsometimeherevisitinghernetherandsistersShehasalargecircleofacquaintanceswhowillbepleasedtoagainmeetherJohnYoungGovernmentarchitect-ofOcalaarrivedinthecityyester-dayHeIsnowmakingpreparationstoremovehisfamilyhereInorderthathewillbenearerhisdutiesandhassecuredtheSeaglecottageonWestMainstreetforthispurposeFnnnThursdaysDallyTThomasofLaCrossewasamongthevisitorshereyesterdayMrsJLBrowneofGroveParkwasshoppinginthecityyesterdayWHWaltsofFairbankswasamongthevisitorshereyesterday0LFeasterandwifeofMlcanopywereamongthevisitorshereyester-dayMissLornaMcCredleofMlcanopy-wasamongthevisitorstothecityyesterdayMrsBBHopsonofHighSpringsarrivedinthecityyesterdayonashortvisittorelativesKLTurnercountysuperintendentofCitruscountywasamongthevisitorstoGainesvilleyesterdayMrsBTArnowandchildrenloftyesterdayforWorthingtonSpringsabsentforthenextweekortenSendfurspecialannouncementofcoursesInMusictheFineArtsandtheMechanicArtsatStetsonUniver-sityHcLandFloridaDrJHCoffeeofWaldowasamongthevisitorstothecityyes-terdaylielainrecentlyreturnedfromatriptoAtlantaWGEnglishofTacomawasvisitnsInthecityyesterdayHesayshatthegroundsaretoowetforthenitkolatoLegittheirfallpreparanunsatthintimeMrsJLKelleyleftyesterdayforlialsamNCtospendtheromalndoroftheheatedtermShewasaccuia-iianiodastarasJacksonvillebylrKelleywhowillreturntodayWAMcLunnuofWaldowhoh-oneofthegroutadmirersofhishullteamcamedownyesterdayfurthopurposeofboominghitmenontovictorybutitwaatheiroffdayMssTillieCookofOcalaaccompniedbyhersisterMrsBerthaClinesassedthroughGainesvillelastnightonroutetoOcalawherethelatterwillvisitwithhersisterswhoarelivingthereStateSuperintendentWMHolloayofTallahasseearrivedIntheityyesterdayandwillspendahorttimehereonbusinessThisbei-nghisformerhomehehasagreatmanyfriendsherewhoarealwaysdo-tghttdtogreetSlappvofMcanopywasamongthefewbaseballfansthataccompa-niedhisteamtothecityyesterdayTheclubhasgoodmakingsandIftheyhadamanagertodrillthemshortwhiletheywouldfowlngreatpeopleIntheirballplayingSimeonKnlghtenwhohasLeononfinulInthecountyjailfortteslatseveralmonthwasroltnodonHindyesterdayforhisappearanceathotermtit1SCurtIiIbartdUUsvdcounterlItmoneyandwasbroughthereNowbony-WWKingoftheKingLumbervomponyarrivedInthecitylayfurpuriKMoofkwkinxafterto-efurnnuntexttrotspur-posehealthbullderbun-SJayshint-Edesterfifea¬¬¬¬¬¬¬¬><>>ilutorwuhrethelargeGovriimotitIwiildinicwhichisnowH-iiilngrumsshapeandproportiontatsthathwillIMhenatInnalsufalruttiilrtyivfromthontolookaftertheworkRobertCnthuutiwhohasbctimaltUKaHiwctllkhoaxforthei-AOyearsrvturnHltoXwYorktyeaUrdayoldhonItiltoreturnhrtarlinfullifmattereauHrrni-IforttrhlthInthUcitethannilacevisltwllathepaeightyearsMr4MrSDoryudMi-iinltLowIkMttrksillkathirnmfurIxHiUvtllKhrHillhjHmltinOftIIihishatolloftIIlltHathallritIII111rntr-rburISISaeahunts-ItVni>>><>>>>>>+FewittandEIloothbyofWaldoac-companiedthebaseballbuysofthatowntoGainesvilleycMerdayOfallthegamesplayedbyWaldothisseasontheouugladlessayyester-dayswastheworstandtheytirenotveryloudInpraisefortheboyswhoallowedtheMlcanopyltestosnoreCaptRobertFredericktheaccom-modatingconductorontheOcalaJacksonvillerunwhohasbeenoffforpastfewweekstakjnghisannualacatlonhasagainresumedhisrunmuchtothedelightofanumberofitsmanyfriendsDuringhisabsencethepositionwasablyfilledbyCon-ductorMillerwhoIsalsoprovinghimselfverypopularamongthetrav-elingpublicDoingsofCourtFromWednesdaysDallySunWalterHicksthenegrowhocon-ductsnsmallstandintheneighbor-hoodofthedepotwasarrestedcharg-edwithgivingaworthlesscheckonthePilfertankfor93250ItwasmadepayabletotheHartsfleldGro-ceryCompanyandwillcomeupforhearingtodaybeforeJusticeGeorgeHallbothfatherandsonwerearrestedandbroughtherebySheriffRamseyTuesdayonacharge-ofhavingkilledahogbelongingtoanothernegroTheircasewaspost-poneduntilThursdayNedRobinsonanegrowhohaditolenacowfromFMRamseyatWacahootawasbroughtInbyDeputyCurlandhiscasewaspostponedDeputySheriffHarrisofLaCrosseiiroughtintwoprisonerseachchargdwithcarryingconcealedweaponstenacHyniiincoloredvasgivenfouraumthswhileSusieMcQueenanaxednegreswasgiventhreemonthsbothcaseshavingbeetsheardbeforeJusticeStokesofInCrostWillRemoveCentalOfficeDrGeoSWaldoIrasleasedtiltMooraboveHroomesdrygoadsstoreonEasteastsideofthesquareundafterextensivealterationsantilitwillmovetututineoftilloustcotivtiilontanddentaljfficcsanywhereincountryTiltoperatingroomwillbolnlhd-utwhitefimiULlTIllIatotimpruvdelectricandhydraulicdentaloutlitwillbeiiiMahedincludingfurthesterilizingofallwateriiitriuiiontsandmaterialsfureachiperationinfullviewgivingthepa-tientafeelingofsecurityfromanychanceofInfectionandmakingacompletesanitaryofficeAprivateloungingroomforweakpatientsisprovidedaswellasprivatelavatoryanddressingroomforlaItlDrWaldosaimtomakehisnowofficestrictlymodernanduptodatefurnishingeverythingforthecomfortsafetyandconvenienceofhispatientsRevWarrensExplanationTheOcalaStarofTuesdaysaysAletterfromRevLIIWarrenwhoIsnowvisitinghismotherInMaconGasaysregardinghisvisittoOcalafromGainesvilleabouttendaysagowhichtheGainesvillecorrepoudintofTIllTimesUnionconsldsuchadarksomemysteryMy-ronilngtoOcalawasnotmysteriousnurnmyGainovlllonoMiensintheleastdegreeHarryShowdroppedinatthemorningsereIcetotaketIllvonlnpIlHirInMOWoftwoletNr1indcd-nabyWillDalernllliigtntoOcainifthetrippossibleSnIloftflfNilJiiatloiivithFhtiwulDalelilfdtinthoncithepratthBredingwereandCar-lisleententemothruap-paratustireslenetnittitd¬¬¬¬¬¬¬¬¬¬¬+BaseballThursdayandFridayPromWwlMfjdnv8DullySunIakikrfuilliiuHifurGnlnivlllliballandfortinpariKiMttrliumJittnnirruamirriditvirylimiWiikiIttwostmlichfftIfHthat1MrKarrtdacciiiniMiitthiiithGtmCltPAMALA-IunlikeotheruifdKiueeverUHforCHILLSandFEVER-MrTJMKvioftUNwOrluwnitII11IIkruffrlffvinrMkHUjjf1MALAuIrA1ItittntItransr1111IiI1rJttIntotrUitlrtrItttIwillt-heretitn1fisthttasitifoulany11>>>><+DIGCROWDATWORTHINGTON1PlentytoEatandMerryPartyWatHGatheredThereMTheWoodmenpicnicandbarbecsefMatWorthingtonSpringsyesterdaylargenumberofcitizensfromGallvlllentteunedandreportapleaiattimejPartiesfromthiscitywhopresentstatethatitwasoneoftkehlargestgatheringsthathadever4assembledinthosepartsandIpastedofforderlyandTherewasagreatdentmorepreparetocatthancouldhavebeenresiftsedbyabouttwicethenumberWANTSSITUATIONWANTEDWANTEDByyoungladyposltloaiiteacherforsmallchildrenyearsexperiencegoodreferonctttAddressBox8S2WadeFloridaFORSALE100x121feetcoreWestMainandBoundarystreetaHalfcashbalanceonownterawwitheightpercentinterestH4-McCrearyIWANTEDHELPONEORTWODESIRABLEpartiescansecuregoodpayingpotltiaHwithusIftheycanshowgoodoncesandaremenofenergyA4rdressBiiKinessPOBoxIiiWANTEDIFYOUWANTtogetthehighestpriceandquickestreturnssilteggschickenscantspeacbeimelonstomatoesIrishetcetctoMohrSonshinMerchantsStPetersburgFkfFORRENTFORRENTFlvoroomcottagenepublicsquaroelectriclightssevenagebathandallmodernleucosApplytLibertystreetr-atSunofficeNICEfrontroomforonblocknexttosquarehotaaicoldbathelectriclightsandatconveniencesApplyJUKIEIA-ortystreetorSunofficeiGainesvilleFurnitureftWeCarryLineofOakenMahoganySuitsOddDressersWashStandChiffonniersandChiffoflRefrigerators-IceCreamFreezesShadesandPorchRugsofStovesandRangesGainesvilleFurnitureagrandsuccessIneverw1bellquietfnifIfIl-OUSALELotreferiJ-ourlOtaComroartPSTAIitSA4nraFinejitJIJIJ1VudorPorchSaCompletelineIf1fttclantryayHadatryever-ythingi4thrwtiaIrbtrlLei1><