|
Citation |
- Permanent Link:
- https://ufdc.ufl.edu/UF00028298/01470
Material Information
- Title:
- Gainesville daily sun
- Uniform Title:
- Gainesville Daily Sun
Gainesville daily sun (Gainesville, Fla. 1903)
- Running title:
- Daily sun
- Alternate Title:
- Sun
- Creator:
- Gainesville daily sun
- Place of Publication:
- Gainesville, Fla.
Gainesville Fla
- Publisher:
- H.H. McCreary
- Publication Date:
- July 30, 1909
- Frequency:
- Daily (except Saturday)[-1938]
Daily (except Monday)[ FORMER <1903>-] daily normalized irregular
- Language:
- English
Subjects
- Subjects / Keywords:
- Newspapers -- Gainesville (Fla.) ( lcsh )
Newspapers -- Alachua County (Fla.) ( lcsh )
- Genre:
- newspaper ( marcgt )
newspaper ( sobekcm )
- Spatial Coverage:
- United States -- Florida -- Alachua -- Gainesville
- Coordinates:
- 29.665245 x -82.336097
Notes
- Abstract:
- The Daily Sun was based in Gainesville, the seat of Alachua County and shipping center for Florida’s citrus region. The newspaper was formed through the merger in 1890 of the Gainesville Advocate and the Daily Morning Record. The Daily Sun described itself as a “democratic†paper. It was published daily, except Mondays, by Henry Hamilton McCreary, the scion of a prominent southern family. After completing a degree at the University of Kentucky, McCreary established himself as a newspaper editor at the age of twenty. McCreary also rose to prominence as a politician in the Democratic Party, first as a city councilman and later as a member of the state assembly, to which he was re-elected several times. McCreary considered himself a staunch patriot and fervently supported industrialization as a means of strengthening Florida and the nation. McCreary’s wife, born Irene Richardson, was well connected in the civic networks of Gainesville and northeast Florida and served both as vice-president of the Florida Federation of Women’s Clubs and president of the United Daughters of the Confederacy. The Daily Sun was continued, in 1903, by the Gainesville Daily Sun which briefly carried the title of the Gainesville Sun.
- Additional Physical Form:
- Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.
- Dates or Sequential Designation:
- -58th year (July 24, 1938).
- General Note:
- Description based on: Vol. 20, no. 48 (Apr. 5, 1903).
Record Information
- Source Institution:
- University of Florida
- Holding Location:
- University of Florida
- Rights Management:
- This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
- Resource Identifier:
- 32994415 ( OCLC )
002027051 ( ALEPHBIBNUM ) sn 95026977 ( LCCN ) sn 95026977 ( LCCN )
|
Downloads |
This item has the following downloads:
|
Full Text |
PAGE 1
THEDAILYSUNUAIMSVILLFFLOBIDiJULY30WOJi3NEWSOFOHANDCOUNTYCONDENSEDMATTERSOFGENERALINTERESTSECUREDYSUNREPORTERSWhatHMHappenedandWhatlC4HappenPerwnalandSocialItemsoftheCitycompanyAgoodbookWadeThomasofMonteochawasinthecftjjyesterdayMrsBBHoimonofHighSpringsIBvisitingInthecity-JGSmithofWillistonwasvisitlagInthecityyesterdayNewFloridacornmealforsaleJNBone798WestCourtstreetGeoLTaylorofPalmerwasamongthevisitorstoGainesvilleyesterdaybuggyaadharnessforsaleatabargalaEaqnlreatthisemceeRMcGregortheturpentinepro-ducerCSantaFewaslatkecityThursdayMraadMrsLTIzlarofOcalawerevisitorstoUteUniversityCityWednesdayWewillpayteacentsforacopyotTlwDallySetaofApril13thIne4CloslagotitallchinagoodsatactualcostwaattomakeroomlorfallateckMillersCaptWHeirofTrentonwasintowsyesterdayandmadeapleasantcallatThoSunoflflrEllFutcbwhohasbranabsentInGeorgiaforthopasttowmonthshillSreturnedtohishomohereMrsMosesEdclsteinhasreturnedabriefbutpleasantvisittoJacksonvilleandthebeachAlexandJohnAcreetworepre-sentativecitizensoftheArchersec-tionweretransactingbusinessInGainesvilleyesterday-MrJnoFurnitureBeaglehasre-celvcdbymistake30rollsoffang35and40cmattingwhichhoisotterlagfor20and23cyardbytherollforcashPBHowillfurnishtacksELECTRICTHEATRESituatedRearefMillersAllWeekTheHandCuffKingMdCESMatineeSaturJnyatJI5pm10ctoAlltoIGoodWetullUOfl0Efrom1AIRDOME10lall1fiecflyMI-lletsKfeeoatlltaadIaeILcIIHAYCOa¬¬ottheparkthisFrankScarboroofTlltonGavisitinghereyesterdayChasPlnltosonleftyesterdaytotashorttriptoJacksonvilleRCEvlnsofEvinstonwasavis-itortothecityyesterday-JAWilliamsofAlachuawasavisitortothecityyesterdayWCDevillethemerchantofArredondowasInthocityyesterdayMrsSPJacksonofArcherwasamongtheshoppersvisitingthecityyesterday-DrHLMontgomeryofMlcanopywashereyesterdayonashortbusi-nessvisit-JRColsonandJABellbothofTrentonwerevisitorstothecountycapitalyesterday-FBGodfreycashierofthoDankofAlachuawastransactingbusinessinthecityyesterday-TWShandshasgonetoJackson-villeHewillvisitDaytonaBeachbe-forehisreturntothecityWhylonelywhenyoucangetagoodbookatMillersfor50centsSeespecialsaleforthisweekSheltonPhillipsformerlysuperintendentofschoolsofLevycountywasvisitingheroyesterda-YYSmiththeyoungattorneyofAlachuawashereforashortwhileyesterdayonprofessionalbusinessTeachersWeekatMillersSpecialsaleonbooksfl50copyrightsforonlyGOcentsOverthreehundredtoselectfromBlueRibbonVanillaIstheRealFruitFlavormadefromthetinesvanillabeansofgreatstrengthandageduntiltheflavorIsperfectDSTaylorofArcherwashereyoulordayTillswashisfirstvisittothecityinquiteawhileandhisnumer-ousacquaintancesweregladtomeethimColECFSanchezleftyesterdayforStAugustineHoexpectstobeabsentIntheAncientCityforthenextseveraldaystakingamuchneededvacationJLConeofLakeButlerhaspur-chasedthebarbershopofJMRayoppositetheBrownhouseandwillcontinuethebualneasMrRayhasremovedtootherpointsJEFugatuofAlachuawasamongthevisitorstoGainesvilleyesterdaynohasbeensomewhatofastranger-tohisGainesvillefriendsduringthepastyearandtheyworepleasedtoseehimagainBystoppingwithusyouwillbosavedthoannoyanceofhavingtogotacquaintedwithanewmanagereverytimeyoucomeThesameproprietorforthepastnineyearsextendsthogladbaudtoyouatthoDrownHouseDrAAMurpbrcopresidentoftheUniversityofFloridaandfamilyarecomfortablylocatedattheWhiteHouseforthepresentwheretheywillforafewweeksprior-topermanentlysecuringasuitableresidencetrotGlennTerrellprincipaloftheCountyHighSchoolwifeandbabyleftyesterdayfortheirhomeatWebsterafterastayofnearlytwomonthsInGainesvilleProfTerrewasavaluablememberofthelastLegislatureandIsoneofthemostpopularmeninSumtercountynttrtnonat4WbeSumtorUaaclallut10obarltrrtthas1remain¬¬¬¬¬¬SomeofOurLatestArrivalsACOMPLETELINEOFUMBRELLACANOPIES-AFULLLINEOPHARNESS-ABEAUTIFULASSORTMENTOFLAPROBESAFEWTASTYRUNABOUISWhoaiuneedofanythinginoarlinecallonusDavisWeGiveVotesfortheandPianoContettBankAccountIsSolicitedWhetherLargeorSmallPhiferBrosBankerrtCrawfordRugYOURCJwkeemberc°GotothefallgamethisafternoonandrootforthehometeamDrJLCloudoneoftheleadingcitizensofAlachuawasavisitortothecityyesterday-RELRobinsonreturnedyester-dayfromavisittopointssouthHeflueaboutrecoveredfromhisrecentInjuriesPersonsdesiringacopyofthelawsenactedbythelastLegislaturecansecuresamebycallingatoraddress-ingthisofficeAGLamboneoftheprominentcitizensofMlcanopyandamostsuc-cessfultruckerwasavisitortothecityyesterday-JEThrasheroneoftheleadingmerchantsofMIcauopywasheremeetinghisfriendsandtransactingbusinessCorrieHesterofEvinstonandClaudeFontaneofMlcanopywerehereyesterdayforthepurposeofwit-nessingtheballgameAlbertDaughtreyofSouthFloridawhohasbeenspendingthepastfewdaysInHighSpringsarrivedhereyesterdayonashortvisitRSBradleyofWacahootawasavisitorheroyesterdayHesaystheyhaveplentyofrainfortheirsectiontolastthemforsometimeCWWellsandEStrlngfellowofAlachuawerehereyesterdayTheyareadmirersofbaseballandcamedowntowitnessthegamehereMVenableofArcherwasInthecityyesterdayHisbabyhasbeenquitesickforanumberofdaysandhewascompelledtobringhimherefortreatmentCEMctcalfofDunncllonhasarrivedinthecityHeholdstheposi-tionofshortKtopontintteamandejmeheretoholdtheParepositionWiththeOakHallteamMrandMrsJARosboroughofYYlMitiurwereheroyesterdayonashowingexpeditionTheywillleavenestfornvisittopointsitSouthCarolinaandueorgiaAttentionIsdirectedtothenewadvertisumentofSMDavisthelivery-manwhichappearselsewhereinthisIssueMrDavisrecentlypurchasedtheinterestofAItOliverInthisbusinessandisnowconductingthtsameMrsJRMerchanthasreturnedfromJacksonvillewhereshewascallcdtovisithermotherMrsJVfiurkoShefoundthopatientcoresidcrablyImprovedandbroughtherhomewithherforafewdaystore-cuperatefromherIllnesDelayincommencingtreatmentalighthavebeencuredquicklybyKidneymayresultInaseriouskidneydlscaseFolcysKidneyRemedybuildsupthowornouttissuesandstrength-enstheseorgansJWMcCollumCoJamesCaseanoldcitizenofWaldowhoIsnowinhis85thyearwasnvisitortoGainesvilleyesterdayHehasrecentlyreturnedfromapleasantvisittohisoldhomeinConnecticut-andreportsamostenjoyabletripbutwasgladtoreturntohisadoptedStateMrandMrsDMhealofAreavisitinginthecityTheyhavehadchargeoftheBaptistStateOr-phanageatthatplacefornnumberofyearsandthisIstheirfirstsinceassumingtheirdutiesTheyhaveJustreturnedfromatriphroufihAlabamaarconrvitetragaintakeuptheirdebarEveryonewouldbebenefitedbytak-ingFoleysOiinoLaxativeforatomachandlivertroubleantihabitualconstipationItsweetensthestom-achandbreathgentlystimulatesliverandregulatesthebowelsand1touchsuperiortopillsantiordinarl-axatlvwaWhynottryFoleysOrluyLaxativetodayJWMcCollsmiCoSGMatheUBfamiliarlyknovnrhisfriendsasGadwasintownyesterdayandfavoredTheSunwithacallGladtoyouoldboyrritduceourheartgoodtohaveorcountryfriendstheirresisttwhentheyareIntownWoarenev-ertoobusytoengageInafewmo-mentschatwithourfriendsandallarewelcome-TLBrownandsonHermanwereIntownyesterdayfromHighSpringsandmadeapleasantcallatthisofficeMrBrownsaystheyarenowhavingtoomuchraininhissectionforthbenefitofgrowingcottonandalsoreportstheappearanceoftheTIbugInsomefieldsHeIsoneofthemostIndustriousandsuccessfulfarm-ersInnorthernAlachuathebestfarmingsectioninallFloridaforadinorethe1IseeIIyes-terdayeelahugithandedFoleysRem-edymen-tionandlazy¬¬¬¬¬¬¬>¬¬¬IDA3DIIESDONTSENDTHECHILDRENBUTooavcEDowntoonrofficeandwewillgiveyouoneofourhandsomecalendarsANYDAYTHISWEEKTHEGAINESVILLENATIONALBANKOntheCornerIBurkhimsSaleIsaSuccessThegreatprosperitysaleofLJBurkhimIsprovingagreatsuccessandhefeelsthatitwillproveabigthingfortheInterestsofhismanycustomersTherehasbeennogreatbigjamattendantuponthesalebuthesaysthatcontinuousbusinesshasresultedallalongandheiswellpleasedwiththebusinessthatIsbe-ingdourEntertainmentforTeachersTheteachersandotherswillbeen-tertainedthiseveningattheHlgbSchoolAuditoriumbyaprojectingmi-croscopealsomusicandaltogctheianinterestingeveningsentertainmentisanticipatedWhilethisIsgivenforthebenefitoftheteachersitistreeandthecitizensanaskedtoattendReleasedonBondJackPricetheyoungwhitemanwhowasarrestedchargedwithhr-cenywasreleasedfromcustodyyeterdnyhavingfurnishedtherequiredboredHeloftImmediatelyforhitshomeinSouthFloridaDelayintakingFoleysKidneyRem-edyIfyouhavebackachekidneybladdertroublefastensthedictateuponyouandmakesacuremoredifficultCommencetakingsKidneyRemedytodayandyouwillsoonbewellWhyriskaseriousmaladyJWMcCollumandMrsEKCannonleftyes-terdayforBlackPointontheGulftospendsometimetherewithapartyoffriendsJRWillisofBransononeoftheattorneysofthatplacewasnbusi-nessvisitorhereyesterday5GentsPerLineBackInsertloabutnoadvertisetakenforlessthan20centsSUmakealineaofractionallinewordovereachsixcourtingatadditionallineCASHInadvanceaccompanyallordersforlaserIntllscolumnWANTEDHELPVTKDStenographerandApplyatExperimentSta-tionFORRENTFlRXISHEDROOMSforrentApplytoBFDawklnsLOvEastMagnoliastreetUiNTFiveroomcottaginextpublrsquawelectricIIghtrriathHMallniKlrncm-1aAJVVtVfVrtytratSunofficerCo-IrWANTSatodrZtype-writerfirsUlteta¬¬¬¬¬ContinentalRestaurantN-extDoortoPostofficeEquipmentSecondtoNoneREGULAR25cTICKETS21MEALSNointoxicatingordrinkssoldabouttheplacewhetherlawpermitsornotPlaceforLadlesGentlemenandChildrenElectricFansNoveltiesBooksStationerSouvenirsSheetPictorssandPithsFrames206EastLibertySlree-AIKESYILLSMIDIYOUCANSAVEMONEYTomliishoeMakrWillwwtintsInminuteswhilewaitfrtvofdiarceifnotsatfactoryoeAm-SJiopscatdoortoKJbflDubLibertySiGHUBOWCHINESELAUNDRYC-ollarsLcShirtlOcFirtelasnWorkatItcaymihlePrices225WESTMAINSTREETSOUTHDRGEOSWALDODENTISTT-heFinestMaterialsTheLatestMethodscfPracticeGuaranteedLiwestChargesinKeejiwiWithFirstClassWorkOFFICEINGRAHAMBUILDIMGPHONE51DEBTSCOLLECTEDANYWHERET-HIRDFLOORDUVALBUILDINGJACKSONVILLEFLJtIEALS4MissNNortonUyhavinglonIWgreatWyAllsemiintoxicatinprntrhrssllIIINfluaWorkFL1<>>=
PAGE 1
THEDAILYSUNGAINESVILLEfLOttlDAJULY30190J1jtrawrr-a2>ISDRAWINGFEATUREATAIRDOME-CANRELEASEHIMSELFFROMHANDCUFFSORSHACKLESMMHMRefutationttralghtJacketThatHeCarriesOutofInStartWhiteHaycowhotonowplayingawetksattheAirDometecreatingagreatamoralofinterestbythemanmerlawkkhkefreeshimselffromiMBfevCstftWHfecutschainsandlafactanynaaaerewaythatheBightheliedtipfeythecommitteewhoBlghUyvisitthestageforthisHealsohMaregulationstraightwhkhhetaeaabledtogetoutfUt4statesthatiewillforfeit25yeJMUitahleiaatitfiUoaforanydAYto81rr4JIstaidplitrposs-sjaitoHyeetheHandcuffKingregulationstralghtJacketthathocanSKHcomooutofafterIthasbeenstrappedaroundhimHaycohasnumerousclippings-ofhisvariousfeatsamongthembeIngalongaccountofhowheUKtapedfromtheMoscowRussiaAsBjlumbesidesnumerousaccountsofgettngoutofJailandguardhouseshasnotvisitedthecountyjellhaIswiltingtomaketheefforttogetoutafterhavingmadenexaminationandstatesthatheiwllltrytoperformthenetIfitIsagreeabletothesherifftTomorrownighthewillexplaininIpartsomeofthefeatsperformedbyhimingettingofftheaftertheyaresecurelylockedabouthimandshowtheaudiencetheeasewithwhichherelieveshimselfoftheACleanHeadMeansCoolHeadCdThingUKnewInWarmWeatherBettertoknowwhatwillmakotheheadcleanandcoolOnlyoneanswerParisianSageYouveheardofitofYouknewItwastheonlyrealdan-druffgermkillerworthwhileYouknowWMJohnsonguaranteesittostopdandrufffallinghairandItchfngscalpintwoweeksormoneybackThatthiswonderfulhairrejuvena-torParisianSageturnsharshfadedlusterlesshairintosilkybeautifullustroushairInafewdaysYouknowthatitIsextensivelyusedbywomenofrefinementButyoudidntknowthatitwouldkeepthescalpniceandcoolInsummerWellnowyouknowitsogetalargebottleandifyouarentsatis-fiedgetyourmoneybackGOcentsatWMJohnsonsLeadingdruggistseverywhereinAmericanowsellParisianSagoandforyourowngoodalwaysrememberthatthegirlwiththeauburnhairIsoneverypackageMadeInAmericabyGIrouxMfgCoBuffaloNYKeepyoureyeonthewantadsTherejnaybesonthingadvertisedwhichisofimerfftnvonIsntthereccirnonlyawantadcandofryoutodayeAtrpressy11thor-oughrJshacklesnuts4course-sttI1¬¬¬>>HOTWEATHERSPECIALSEVERYTHINGFORTHEHOMECOMFORTI-CEPICKSICESHAVERSSicGHffPttS35cICEAXESWHITEMMNTAINFREEZERSARCTICFREEZERSSICKHtwLB89MMCRimesMEwlhMLSTOVESUiDHUDWARECOAdventistsCenvsntienTheSeventhDayAdventistswillholdaSabbathSchoolandYoungPeoplesconventionattheirchurchinNorthGainesvillebeginningFridaynightat730andcontinuingoverSaturdayandSundayProgramasfollowsFridaynight730preachingbyElderRWParmeloSaturday930amSabbathschool11ampreaching330pmconventionworkSunday930amand3pmconventionwork730-pmpreachingWParmelethepresident-ofthoconferenceandMrsRGStringertheStateSabbathSchoolsecretarywillbepresentotherworkersfromsurroundingchurchesAllarecordiallyinvitedtoattend-AGoldenWeddingMeansthatmanandwifehaveliv-edtoagoodoldageandconsequentlyhavtikepthealthyThebestwaytokeephealthyistoseethatyourliverdocsitsduty305daysoutofTheonlywaytodothisistokeepUallardsHerbinointhehouseandtakeItwheneveryourliverIn-active50centsperbottleSoldbyWMJohnsonAnEpitaph-InthechurchyardofLeighnearBoltouwillIKsoundntombstonebearingthefollowingamazingsen-tenceAvirtuouswomanIsSBtoherhusbandTheexplanationseemstobethatspacepreventedcrownbeingcutInfullandthestonemasonarguedthatacrownequalsshillingsLondonNotesandQueriesCAPUOINEforTHATHEADACHE-OutlastsightHeadacheandnerv-ousthismorningHicksCapudlnejustthethingtofityouforbusinessdearstheheadbracetheservesTryItAtdrugstoresI1125cREfillEDTInPERFECTElderRifsgetstIatoiCEIThCttalso5¬¬¬¬¬ElevenFloridaCountiesGrowSeaIslandCottonTheSeaIslandcottongrowingcountiesofFloridaareelevenandthefollowingtableshowsthenumberofbalesofSeaIslandcottonginnedin190Sand1905inthecountiesnamed19081905-Alachoa7749S79tJIlakerS451153Bradford33353959Columbia80513SS9Hamilton4jtULSOJacksongut726Jefferson1851C1Lafayette021055Madison7S711143SuwanneeRh35921-TcilrJToo-AIchor121tttrrdng1pisacr¬>=HETARIFFCONFEREESCOMETOAGREEMENTContinuedfromPageOneconsiderablyinadvanceofthedutiesfixedbytheSenatebillwhichforthemostpartwerethesameastheDingleyratesUnquestionablythesessionwasthebusiestofthethreeweeksthebillhasbeenInconfer-enceDozensofSenatorssoughtaudienceandwerereceivedbytheSenatemembersofthecommitteeandtherecalledalsomanymembersoftheHouseincludingthecommitteereproseatingtheantifreerawmaterialinsurgentsInthecorridorsswarmedagentsofspecialInterestswhoseemedtorealizethatthocrucialperiod-oftheconferencehasarrivedSenatorsElkinsandScottofVestVirginiaandClarkofWyomingendeavoredtogettheconfereestomaketherateof45centsatouuucoalapplytotheshorttonwhichitIssaidwouldmakeadifferenceotabout5centsatonandwouldoperate-toadvancetheratetotheequivalent-of50centsTheSenatorsinterested-ingettingalltheprotectionpossible-forcoalwerenotsuccessfulintheirmissionJustbeforethecloseofthesessiontherateonprintpaperwasfixedat375atonThisisonly25centslessthantheSenaterateand175morethantheHouserateTherewassomediscussionyesterdayoftheironorequestionSenatorBurrowsmadeanefforttogettheratefixedat20centsinsteador15centsatonHideswereleftonthefreelistcontingentupontheadoptionoftheruleinthoHousemakingtheaction-oftheconfereesingoingbelowtheHouserateinfixingtherateonleatherIfthereportislaidbeforetheHouseonFridayaccordingtothepresentprogramItwillbeprintedandtakenupSaturdayItisnotbelievedthattheHousewilldiscussItmorethanonedayInthiscasetheSenatemaybeginwiththereport-onMondayItisbelieveditcanbedisposedOfnextweek-Ifpeoplewithsymptomsofkidney-orbladdertroublecouldrealizetheirdangertheywouldwithoutlossoftimecommencetakingFoleyeKidneyRemedyThisgreatremedystopsthepainandtheIrregularitiesstrength-ensandbuildsuptheseorgansandthereisnodangerofDrlghtsdisease-orotherseriousdisorderDonotdis-regardtheearlysymptomsJWMeCollumCoLightningChangoThetlitvvwruldboyunthesideItitinMttvitcarturnedJuJdetiljtolookoutofthewindowtherebywipinghismuddyshoesonthecoloredtrousersofthemiddleoedmansittingtohimMadamexplodedthemanIsthisyournastylittleHerethebuysprettymotherturnedherheadandlookedathimangelhefinishedwithagaspChicagoTribuneFoleysHoneyandTarnotonlystopschroniccoughsthatweakentheconstitutionanddevelopintocon-sumptionbuthealsandstrengthenstbolungsItaffordscomfortandre-liefintheworstcasesofchronicbronchitisasthmahayfeverandlungtroubleJWMcCollumCoyester-dayonseatlightnexttIboy¬¬¬¬¬¬¬¬<¬ThepriceofSeaIslandcottondur-ing1908wasforstrictmiddlingFlorida11A2centsGeorgia1792centsSouthCarolina2339centsEgyptian1725centsThevalueofthecropfor190SFlorida2322352Georgia31669S6SouthCarolinall161S2tfDuringtheyearendingAugust31InnStheUnitedStatesImported122170balesofEgyptiancottonforthreadandthefinerofgoodsandfi917balesofPeruviancottontobeInmillstobomixedwithwoolTheEgyptiancropin10samountedtol27Vnbaleraisedon19Xiacresoranaverageof327-ltonnlitperacrenorgahasslxnSouthOir-ofc11vigrovayclassand1SfatOIlrtusedrI¬>+CURESSKINDISEASEScauseofallskindiseasescanbetracedtosomehumororacidinthebloodthecuticleisalwayshealthywherethecirculationisfreefromimpuritiesWhentheiswithacridorunhealthymatteritcannotperformitsnaturalworkofnourishingtheskinitstemandpreservingitsnormalsoftnesspliabilityandhealthfulnessInsteaditthedelicatetissuesaroundthporesandandproducessomeofthemanyformsofskindiseaseTheitchingandstingingsoaccompanyingskinaffectionsareproduced-byfromtkobloodofthewithwhichitisfilledIntothesensitivemembranousfleshlyingJustbeneaththeoutercoveringandsurroundingthecountlessnervesporesThisexplainswhyscratchingtheouterskinaffordsnofromtheitchingandburningS8curesSkinDiseasesofeverycharacterbypurifyingthebloodItdownCatothecirculationsadremovesthehumorsorwhicharcausingthetroublebuildstheweakacridbloodandpermanentlyeveryvarietyofskinaffectionLocalapplicationscantheysevercurebecausetheydosotreach8goesrightintothecirculationreachestroubleandcuresitbyremovingthecaaseHook-sSiloDiMsesandanymedicaladvicefreetoallwhowriteTImSWATSPECIFICCOATLAWTA01COOKAUTOMOBILECOMPANYfrBAGENCYDontbemixedfornoneareeogoodasthisREPAIRWORKANDSUPPLIESMIMCStrutBafcesrifcESTHER8JORDANWWJORDANCOMPANYINSURANCEPOR-TERB10CKGAINESVILLEFLORIDAFireLifeandAccident55Stinflamesjcuriat1IYEnsBUICKBUICKFloridajIDheoldeana10mpaleLi-TheupTart51anetrerqIIAMTTOY¬=UNIVERSITYOFFLORIDAGainesvilleFloridaAnInstitutionoftheFirstRanksup-portedbyStateandFederalFundsforFloridaYoungMenThoroughCoursesLeadingtoDegreesofBABScMAMScandLLArtsandScienceAgricultureChemicalCivilElectricalandMe-chanicalEngineeringLawNormalSchoolGraduateSchoolExpensesExceedinglyLowForCataloguewritetoAAMURPHREEAMLLDPresidenta-Inj¬¬FLORIDASTATECOLLEGEF-ORWOMENTallahasseeFlorida-ACollegewithoutaparallelIntheSouthofferingdegreesanddiplomasInthefollowingdepartmentsIACollegeofLiberalArtsIIASchoolofIndustrialArtsIIIASchoolofFineArtsIVASchoolofExpression-VASchoolforTeachers-NoTuitionOtherexpensesverylowForfurtherInformationaddressEDWARDCONRADIMAPhDfPresidentTHESUNANDMERCHANTSCOOPERATIVECONTESTVOTINGCOUPONG-OODFORAddreMThiaCouponmaybecastatTheSunofficeorateitherofthestorecon-nectedwiththecontestNOTGOODAFTERAUG101909SAVEDFROMTHEWRECKT-hatwouldhavebeenyourutterruinyouwillbebyhavinganinsurancepol-icythatwillindemnifyyouforyourlossWiththefirefiendvisitsyourhomeNothingBewiseintimeandinsureinjisolidcompanyliketheOIKwerepresent-AMCUSHMANAgentGainesvilleFloridaftit5VOTESfJ1j-IoutitwhatisleftwhenIrIjjj-I7AFor2riiceryrstiYre¬
PAGE 1
TIEtAlLYSUNttAINtiHVJLLEFLORIDAJULY19090w-cIIrr-rlHUtM3=SANFORDTAKESTHEFIRSTOFTHESERIESWILLDOTHEINPITCHINGI-NTODAYSGAMETheVisitorsWillHavetheLefthandedSmithFromGeorgia-OntheMoundTodayGainesville0Sanford1witheleventuningstodecideitThatwasthewayitstoodattheballparkonThursdayafternoonwhenthelargestandmostenthusiasticcrowdoftheseasonvisitedtheparktoseethegreatcontestbetweenthesetwofastclubsWhiletheboysoutclassedthevisitorsIntheirplayingtheystillhavethehoodooonthemthatcausedthelossofthegameInthoeleventhbytwoerrorsbutthiswasunavoidableandnokicksarecomingfromtheGainesvillerootersTheSanfordsetareacleverlotofboysandknowjusthowtoplaythegameaswasfullyevidencedinthecontestThursdaywhichwasoneoftheverybestgamesthatwillbeseenonthehomediamondtheentiresea-sonAllyourootershadbetterfallinlinetodayforSanfordwillhaveSmithofAtlantaheretodothefiringforthemwhileGainesvillewillhavethemoundfilledwithHineswhohasonseveraloccasionsdemonstratedthathecandeliverthegoodsSeveraltimesduringthegameGainesvillehadmenonbasesbutthenecessaryhitwasnotforthcomingtobringthemhomeInthetenthInningtwoOakHallswereonbasesandoneontwhenGrahamtriedtopilferthirdbutwascaughtandHendrickswastaggedouttryingtoswipesecnodThisspoiledthebestchanceoftheOakHallswinningWatsonprovedhimselfsuperiorlBeefTrustridgesintheboxtillvisitorsonehitThelo-calstouchedBridgettupforsixsafeInglesoneabyMillerTheGameExplainedFIRSTINNINGMillerstruckoutAllenoutshorttofirstGrahamoutthirdtofirstVlbbertwalkedandswipedsecondJonesfannedWhitepoppedouttoMakesTwosolidcarsoftheHWETTERSTOVESandRANGESjustreceivedWithourfiveyearsexperienceandconstantuseandsaleofthesegoodswedonothesitateingivingyouaFiveYearsGuaranteewitheachRangeyoupurchasefromusWearslongercookseasierlooksnicerthananyothermakemanufacturedGAINESVILLEHARDWARECOHINES1homeII011h-allowingCook-ingEasyttwobngger¬¬>¬¬¬NATURESWARNINGG-ainesvillePeopleMustRecognize-andHeedItKldnerIllsconicfjufetlytnyste-rlouslylintnaturealwayswarnsyouNoticethekidneysecretions-IftherearesettlingsandsedimentPassagesfrequentscantypainfulItstimethentouseDoanKidneyPillsTowardoffUrightsdiseaseordia-betesDoanshavedonegreatworkInthislocalityMrsJLWarrenofStarkeKlasaysForsometimeIuvictimokidneytroubleThekidneysecretionweretoofrequentInpassagecausing-methegreatestannoyanceand1qul-fcredconstantlyfrombackachesandlullpainsthroughthekidneysIcouldnotrestwellandInthemorningarosefeelingtiredandwornoutMybackbecameverylameandIoftenfounditdifficulttogetaroundIatlengthreadaboutDonsKidneyPillsandprocuredaboxSinceusingthemIhavebeenfreefromback-achesandthesorenessandlamenesshasdisappearedTheannoyancefromthekidneysecretionsalsoceasedandIamabletosleepwellDoansKid-neyPillsbenefitedmewonderfullyandIcanrecommendthemasthebestkidneyremedyIeverusedForsalebyalldealersPriceCOcentsCoBuffaloNewYorksoleagentsfortheUnitedStatesRememberthonameDoansandtakenootherleftVibbertstolethirdHudsonoutAllentoMillerSECONDINNINGBullockoutshorttofirstllendrickssaneDen-tonfouledoutMorrisfannedSwanhittothirdoutatfirstFoxfannedTHIRDINNINGTaylorbuntedandwasthrownoutatfirstSpottswoodsingledtoleftNVatsonlanmdMillirsingledtoleftAllenoutpitchertoIlibLSpoltsttoudandMillerdiedonbasesIturItyonfouledoutBridgesfailedVlbbertskiedouttorightFOURTHINNINGGrahamoutonuflytocenterBullockskiedouttoleftHendricksfollowedsuitfouledoutWhitefannedHudhongothisbaseonfourwideThusandstolesecondnmomentlaternvlpliiKthirdMorrisskiedouttoenterFIFTHINNINGDentonoutthirdtoTaylorfannedSpottawoodsingledtocenterandstolesecondWnitonrangSwanbeatouthittoHendricksFoxfannedBurlesonfouledoutBridgesHewoutSIXTHINNINGMillerskiedouttocenterAllenHewouttoleftGrahamgothisbaseonfourwideonesBul-lockoutonahighonetocenterVlbbertflewouttocenterJonesoutshorttofirstWhitewalkedbutwascaughttryingtostealsecondSEVENTHINNINGHendricksoutonaflytocenterDentonoutshorttofirstTaylorsingledtocenterSpottswoodwalkedWatsonfannedHudsonpoppedouttoHendricksMorriswalkedSwanhitbypitchedballtookfirstMorriscaughtoffsec-ondandhadblocksputtohimFoxpoppedouttoSandyEIGHTHINNINGMillerfouledouttoleftAllenoutonflytorightGra-hamskiedouttoleftBurlesonfouledouttoMillerBridgesfannedvlhbertfouledoutNINTHINNINGBullockHewoutHendricksflewouttoleftDentonreachedfirstonerrorbycenterfielderwhodroppedtheballTaylorfannedJoneshitoverSpottswoodttheadIncenterfortwobasesWhitefannedHudsonoutsecondtofirstJonestak-ingthirdMorristoppedouttoSandyTENTHINNINGklcdouttoleftWatsontruckoutMillerhittoleftfieldfencefortwobusesAllenoutondrivetofirstSwanfouledoutFoxfannedBurlesonoutshorttofirstELEVENTHLVsINGGrahamflewontoleftBullocksingledtolullnendrickshittocenterwhodroppeditGrahamrunningforRullocktriedtostealthirdandwasputoutHendrinksouttryingtoswipesecondBridgesoutonaflytocenterVibbertflewouttocenterJonehitonetoDentonwhodroppedItWhitehittoTaylorwhofumbledtheballJonesscoringwiththewinningrunWhiteouttryingtoreachthirdScorebyInningsOakHalls0000000000Sanford0000000000HitsGainesville6Sanford1errorsGainesville4Sanford2baseonballsoffWatson4Bridges2wildpitchBridges1twobasehitsFosterMilburnloutfirstwas¬¬¬>¬¬¬¬=ANOTHERNEWGARAGEWILLSOONBEERECTEDDAVISHILLWILLHAVELARGESTOREROOMBUILDINGHaveAgencyforTwoMachinesAl-readySecureRightsforSevenCountiesintheStateDavisHillaresoontoopenaurgeandcommodiousgarageerect-edfortheaccommodationoftheirautomobilebusinessThelocationofthenewsitehasnotbeenselectedasyetbutdisinter-estedpartieshaveofferedtoerectthetaahandsomebuildingespecially-fortheiruseIfasufficientleaseistakenuponsameAlthoughtheyaretheyoungestintheautomobilebusinessheretheyhavecontractedforalargenumberofcarsandarcmeetingwithgreatsuccessinthesaleofthemwhichassuresthemofagoodbusinessInstoreforthenOneofthebestandeasiestcarsIsthelittleBrushrunaboutandtheyfigurethattheywillplaceunumberofthesecarswiththephysiciansthroughoutthecountryfortheyhavecontractedforfifteenanLavesoldaboutfiveofthecontratalreadyAnothercarhandledthemIstheKMPandwhiletoehaveJUKIreceivedthefirstcarloadtheyhaveureallysoldthreeofthemachinesTheyarenowpreparingtheiran-nouncementwhichwillappearwithinthenextfewlaysandstatethattheywillbeheretoInterestthegeneralpublicInautomobileshavingsecurertherightsforsevencountiesJonesandMillerstruckoutbyWatonbyfridges5hitbypitcherSwimNOTESOFTHEGAMEByBelgibubKnockaballPrettygameehiAnotheronotodayBesureandbeoutItsPopnowGamecalledat330todayHineswillpickleemtodayBullocksarmwasworkingniceHendrickskeepsafterthemalltimeNowonderSnnfordIsproudoftheirteamWatsonsstockwentupabout90pointsMillercoveredfirstInhisusualgoodstyleRaindidnothurtanythingBridgesheldupwellSpottswoodwasthestarInthefieldandatthebatSanfordsoutfieldhadplentytodoyesterdayanddidIttooDentonserrorwascausedbyamightyharddrivetojudgeLeteverybodycomeouttodayandwhoopemupfortilehoneteamIttakesBMTenchtogottherooterslinedupBoouttodayBenBettergetBridgesashoveltodigouttherocsfromthpitchersIlexSorryyoucouldntgetawaywiththatstealPatYouhavetotakeyourchancesWonderhowBridgesmanagestoholdhismealticketHesnotsomuchforaleaguerWaldo7WllllstonTheWIllistonbaseballteamwenttoWaldoyesterdaywherearatheronesidedgamewasplayedIntheaf-ternoonthescorebeing7to1favorofWaldoPrewittandHarveywerethebatteryforWaldoThismakesthefifthstraightgamethatthisteamhasBOAoncetotcaUlagcardOooooooooooooooooOooonay9o-OooooooooooooooooOOneFlit00S000the0000won-T¬¬¬
PAGE 1
VOLXXVINO149GAINESVILLEFLORIDAFKIDAYJULY301909TENCENTSAWEEK4-Jraineb1kai1+HARRYTHAWANSWEREDMRJEROMESQUERIESO-ldTimeEnemiesBroughtFacetoFaceIntheCourtRoomatWhitePlainsWHITEPLAINSNYJuly29HarryThawHfatelayinhisownhandsyesterdayForsixhoursheocciupledthewitnessstandwhileDistrictAttorneyJeromethemanwhotwicetriedtosendhimtoprisonundwhooncealreadyhasthwartedanefforttoreleasehimfromacriminalinsaneasylumdelvedintolifehistoryThawemergedcreditablyfromtheordealWhateverJeromeandhitalienistsmaymakeoftheexaminationtotheeyeandoarofthelaymanStanfordWhitesslayershowednosignsofInsanityonthestandyittcrdayLastnightThawthemembersofhisfamilyandhisretinueofat-torneysandexpertswereunanimous-intheiropinionthathuhasprovedfitnesstoboallargeIllsintendsbelievethatIfhuacquitbimtiIinthefutureawelltutodayJustivMillswillhavenochoicebuttogruitIllsnppllrallonforreleasefromxctteawannutThawsordeallanotoverHewillretrainonthewitnessstandto-dayandperhapsadaylongerTheStatesalleulstHbelievethatIfheInsanehewillbomorelikelytobe-trayhimselftowardtheendwhenweariedbyJeromescontinuedham-meringeltherThawnortheNewYorkdistrictattorneydisplayedanythingbuttheutmostgoodnatureyesterdayFrequentlythedialogueresembledHiechatoffriendsatnnafternoonteaSometimesThawthoughthehadscorefdapointandmulledwiththeenjoymentThesmilewasalwaysreflectedonthefaceofhiswhitehairedmotherwhosatincourtthroughoutthedaywithothermem-bersoftheThawfamilyJeromeyesterdaystrovetoThawsInsanitymainlyonhisalIMhisYhiskeen-estestab-lish¬¬¬¬¬¬JudgeBullockDecidesLawUnconstitutionalITheOcalaBannerofJuly2SthsaysJudgeWSBullockmadeadecis-ioninchambersyesterdaywhichthevariouscountiesoftheStatemanyhundredsofdollarsThecasewasoneinwhichDavisWhitewassuingLakecouutyfortheusualfiftydollarspaidfortestimonyuponwhichconvictionsaresecuredAgainstblindtigeroperatorsunderactoftheLegislatureof1907AttorneyGeorgeWScofleldofInAornefcsrepresentedWhitewhilekakecountwasrepresentedbyJudge-JBGainesofLeosburgJudgeBullockafterhearingthergurrftitfsofthentiorntVHdecidedwill-S1egun11p¬legedhallucinationsregardingStanfordWhitestreatmentofyounggirlsTimeandtimeagainheaskedthewit-nessownopinionofhismentalstateThawsrepliesinsubstancewereIhavealwaysbeensanemedi-callyWhenIkilledWhiteImayhavebeenlegallyInsaneforafewminutesIamsanenowThreeyearsconfinementdonotseemtohaveembitteredThawsYes-terdayheexpressedregretforcertatsofthemoreunspeakablechargeswhichbemadeInhiswillagainstthemanhekilledAttimesthewitnessscoredonthedistrictattorneytopalpablythatthewholecourtroomjoinedinhissmileoftriumphOnecharacteristicepisodeoccurredwhenJeromeaskedThawtoexplainhostilitytoDrAllanMcLaneHamiltononeoftheStatesformeralienistsThawsaidhedidnotknowexactlywhyhedislikedHamiltonItwaslikethecaseofDrFellheaddedWhoisFellinquiredJeromeIn-nocentlyWhydontyouknowexclaimedthewitnessInrealorfeignedsurpriseThenhequotedthefirsttwolinesofthenonsenserhymeIdonotlikeyouDrFellThereasonwhyIcannottellThawsmoodwasnotalwaysjovialOnelineofquestionsthatmadehimknithisbrowshadtodowithhisrelaIonswithEvelynNosbltThawbe-foretheirmarriageAlthoughithasbeenallegedthatThawhasbrokenwithhiswifeandthatsheIsaidingtheoppositionheshowednstrongdesireyesterdaytoshieldhernameSusanMerrillthechiefwitnessatTuesdayssessionwasIncourtyes-terdaybutdidnottakethestandThawsworethathermostdamagingchargesagainsthimwereuntrueits¬¬¬¬>¬¬thelawunderwhichtheseamountshavebeenpaidasunconstitutional-andhandeddownthefollowingdecis-ionIntheFifthJudicialCircuitCourtLakeCountyFloridaDaveWhitevsLakeCountyThiscausecameontobeheardonargumentofdemurrertotheamendeddeclarationSection16Article2oftheoftheStateofFloridarequiresthateachlawenactedintheLegisla-tureshallembracebutonesubjectandmatterproperlyconnectedthere-withwhichsubjectshallbobrieflyexpressedInthetitleSectionofthegeneralstatconsti-tution¬¬
PAGE 1
THEPoLLYSUNtiAlNKSVlUKKuiillMliMWiIIt4JIDLYijU74wl+OFFICIALDIRECTORYStateOfficersWGllcbristTall-aiaseeSecretaryofState11ClayCraw-fordTallahasseeComptrollerACGroomTallabasseeTreasurerWVKnottTallahas-seeParkAITrammellTallahasseeCommlssiuierofAgricultureBEMcLtnTallahasseeSuptofPublicInstructionWmMHollowayTallahasseePresidentottheSenateFMHudsonMiamiCountyOfficersClerkandAuditorSHWlengesGainesvilleSuptPublicInstructionDrJLKelleyGainesvilleSheriffPGRamseyGainesvilleCountyJudgeHGMasonGalueAMllelasAssessorWWColsotiGaines-villeTaxDDickinsonGainesvilleDMatbesooGaines-villeSupervisorRegistrationCMoGrewGainesvilleCountyCommissionersJohnGDampierChairmanHagueJFTownsendCampvllleJWMayArcherChasWSummersTrentonOPCannonGainesvilleMembersScboolBWeeksChairmanHawthornJWMoodyLaCrosseOWMillerTrentonStateSenatorHILMcCrearyGainesvilleMembersHouseSydLCarterGainesvilleTADokeSantaFeCityOfficersMayorHoratioDavisTArnowTaxAssessorWilBradfordTaxCollectorTBEllisSrClerkandTreasurerMaxeyDellCityAttorneyREDavisBeardofAldermenGKBroomcPresidentSJBurnettIIIPhlfer-HSGravesCAColcloughWTPoundJAGoodwinBoardofPublicWorksHETay-lorChairmanWWHamptonsecre-taryIIFDuttonEJnalrdHVidalNoticeofApplicationtotellRealtyNoticeIBherebygiventhatfourweeksafterthepublicationofthisnoticeIwillapplytolionHGMasoncountyJudgeofAlodiumcoun-tyFloridaforanordertoselltheofSEofSection19T10RISandNEV4ofSec10ofT10SofR16EallInAlachuacountyFloridatopaythedebtsoftheestateofJoelHoltdeceased-MSLAMERAdAdministratorEstateofJoelHoltJuly2nd1909SHERIFFSSALENoticeisherebygiventhatunderandbyvirtueofacertainexecutionIssuedoutoftheJusticeCourtoftheTwentyfifthJusticeDistrictinandforAlachuacountyFloridabyHon1ACarlisletheJusticethereofanddatedthe23rddayofJuneAD1909InfavorofSamCookandagainstShadSamsIhavelevieduponandwillsellatpublicoutcryatthecastcourthousedoorinGainesvilleAlachuacountyFloridaonAugust2ndAD1909duringthelawfulhoursofsalethefollowingpropertytowitTwopillows2mattresses2blankets1setbedsprings2bed-steads3quilts2lamps1coat1pairpants1shirt2overcoats1trunkandcontents1clock1waterbucket1shotgunsametobesoldtosatisfysaidexecutionandcosts-PORAMSEY-AsSheriffofAlachuaCountyFlaWeAskYout-otikeCarddyourfemaletroublesbecausewearelUreitwlBhelpyouRemembefthatthisgreatfemaleremedyhasbroughtrelieftothousandsofsickwomensowhynottoyouForheadachebackacheperiodicalpainsfemaleweak-nessmanyhavesaiditisthebestmedicinetotakeTryIt1SoldinThisCitynGovernorAjjiCollectorWTreasurerJIIBoardRIMarshalBifirstgalIIAttorneyIstdSINEOFCARDIIIt¬¬¬¬¬NOTICEOFINCORPORATIONNoticeisherebygiventhatwetheinidvrlgnedintendtoapplytotheGovernorcftheStateofFloridaforLetterslatenttobeissuedUtheUBuildingandLoanAsso-ciationajrorostdcorporationunderthelavsoftheStateofFloridaofwhichcoiiinnythefollowingshallbetheArticlesofIncorporationThisnukeIsgivenpursuanttorequirementsoftheStateofFloridaandtheArticlesofIncorporationhavebeenfiledwiththeSecretaryofStateanalaregivenbelow-JSBODIFOKDJREDDINS-EEVOILECCPEDRICKLOUISCLYNCHJDGARDNERSHWIENGESJAGOODWIN-JMFENNELLArticle1Thenameofthecor-porationshallbeGainesvilleandLoanAssociationanditsprincipalplaceofbusinessshallbeGainesvilleAlachuacountyFloridaArticlegeneralnatureofthebusinesstobetransactedshallbetheaccumulationoffundsforbakingloanstoItsstockholdersuponrealestateandstockofthiscompanyandotherwiseaidingitsstockholderstopurchaseandconstructbuildingstopurchaseandselllandsandtenementsandhavinganotherpowersandrightsgivenbuildingandloanassociationsundertheLawsoftheStateofFloridaArticlecapitalstockofthisassociationtonotexceedIntheaggregateFourHundredThousandDollarstobedividedintosharesofthedenominationofHundredDollarseachoftheparvalueofOneHundredDollarsandshallbepaidforincashorbyInstallmentsArticle4ThetermforwhichthiscorporationistoexistisninetynineyearsArticle5Thebusinessofthisas-sociationshallbeconductedbyaPresidentaVicePresidentaSecre-taryaTreasurerandaBoardofnotlessthanfivenormorethannineDirectorsAllofsaidofficersshallbeelectedbythestockholdersatthemeetingtobeheldthefirstMonday-InJune1910andannuallythereafter-JSBodifordshallbePresidentJREddinsshallboVicePresidentEEVoyleshallbeSecretaryandAEVoyleshallbeTreasurerandHoratioDavisAttorneyandJSIJodlfordJREddinsCCPedrlckEEVoyleLCLynchJDGard-nerSHWlengesJAGoodwinand-JMFennellshallconstitutethefirsthoardofDirectorsallofsaidofficerstobecontinuedinofficeandconductthebusinessofthecorpora-tionuntiltheelectionandqualifica-tionoftheirsuccessorsatthefirstelectiontobeheldundertheofthisarticleArticlehighestIndebtednessorliabilitytowhichthiscorpora-tionshallatanytimesubjectitselfhallbeOneHundredThousandDollarsArticle7Thenamesofthesub-scriberstothesearticlesareasfol-lowsandtheplaceofresidenceIssetforthoppositeeachnamewiththeamountofstocksubscribedbyeach-JSBodlford10sharesGaines-villeFla-JREddins10sharesGainesvilleFlaBEVoyle10sharesGainesvilleFlaCCPedrlck10sharesGainesvilleFlaLouisCLynch10sharesGaines-villeFla-JDGardner10sharesGaines-villeFlaSHWlenges10sharesGaines-villeFlaJAGoodwin10sharesGaines-villeFla-JMFennel10sharesGainesvill-eFlaStateofFloridaAlachuaCountyBeforemetheundersignedauthor-itypersonallyappearedJSBodllordJREddinsEEVoyleCCPedrickLouisCLynchJDGard-nerSHWienpsJAGoodwinJMFennelltomewellknownandknowntometobethepersonswhosubscribedtheforegoingandseveral-lyacknowledgedbeforemethattheysubscribedthesameInwitnesswhereofIhavehereuntosetmyhandandaffixedmyofficialsealthis12thdayofJuly1909insaidcountyandStateSealGEODEVANSNotaryPublicStateofFloridaatLargeMyCommissionExpiresDe-cember71911NOTICEOFAPPLICATIONFORTAXDEEDUNDERSECTION8OFCHAPTER4LAWSOFFLOIUDANoticeisherebygiventhatECpurchaserofTaxCertificateNodatedtheCthdayofURDUAD1JhasfledlaidcertificateinmyofficeaidtamadeapplicationfortaxdeedtoissueInaccordancelAWSuldcertificateem-bracethefollowicirdescribedpropertysitu-atedinAlacbuacountyFloridaumit-NeHofSwNSecTp0SIt1010acresbBrtthedateoftheissuanceofsuchceitiUcateinthenameofWFLaoiffor-dtiJessaidcertificateshallberedeemedac-cordingtolawtaxdeedwilliuethereonocofAunifctAUia0-WitncshmyofficialsignatureandtbiiPdOrClrcuCourtAftbroBuild-Ing2The3TheOnoGTheSaw3saidlandcc1atithenthdaysealthedsyorJulrDSUVIINGEFlaUrJDcatopthecough3aieatprovi-sionsto-getherilbefelt0tbA171SLrO1ANDsadhssw1V1unN¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬=tToBeGivenAwaybytheMerchantsandTheSuntoCitizensofAlachuaCountyEachSectionContesttoCloseAugust1819Q9RealizingthatallshouldsharealikeinthedistributionleadingbusinesshoueeehavejoinedinthecombinationtogiveawayTwoOnDiamondRingtoresidentsofAlachuacountyinthreedifferentTheseprogressivefirmswillgiveOneVoteforeachpennyspentwiththemIntheeventofatieforofferedasimilarinallrespectsthere-towillbegiveneachofthosetieingTHEARHARPERPIANOCOofJacksonvillefromwhomthepianosforthiscontestwerepurchasedhaveagreedtoofferextraasTothefirstfivecandidatesineachdistrictexceptingthewinnersoftheinthesaiddistrictsonecertificateeachfor10000whichwillberedeemableincashasapaymentonanypianohandledbythemtheEverettHarvardDayton-orJohnChurchPianosInadditiontothistheywillgiveacertificategoodfor25toallothercontestantsintheraceandwillmakearrangementswithanyonetotakecareoftheirpilloronallpurchasesofinstrumentsatthecashpriceuilfnWillembracethecityandsuburbsandbaconfinedtouradiusoffourmilesineachdirectionThewinnerinthisdistrictwillbeawardedaHANDSOMEDIAMONDRINGEasternandSouthernSectionchelleallpointssouthWaldoHawthornIslandGroveLakeViewTacomamidallpointsalonglineofTJRyONEPIANOWesternandNorthernSectionWanneeWilcoxBellNewberryJonesvilleArcherandallsettlementscoveredbythisareaONEPIANOcJDOOCoeGnilHaITotalCashValuelOOQOOGetsPrizesIrWillcompriseterritoryfromFairblinksallpointseastandfromRoIWillcomprisennstationsfromtHaguetoSpringsiITWOPIANOSANDAIDIAMONDRINGndsectionTheGainesSectionLTrenton¬¬HowandWheretoGetVotesThefollowingmerchantswillgiveonevoteoreverycentpaidIntotheirestablishmentsforgoodswhichtkeyhandleGainesvilleFurnitureCompanyFurniturePhlferMorrisCoClothingandFurnishingGainesvilleHardwareCePlumbingandHardwareMrsFTMcCormickMillinery-WMJohnsonDrugsandMedicines-LCSmithShoesandJewelryMrsRWilsonDryGoodsandNotionsSaundersAEarleGroceriesandFeedStuffsCityBakeryBreadandPastry-PYSmithFreshMeatsCrawfordDavisLiveryandSaleStablesTheSunPrintingandPublishing-TheBrownHouseMealsandLodging-NFranciscoBananaHouseFruitsEtcEddinsMgfCoLumberandBuildingMaterialStandardFertilizerCoFertilizersdWhereVotesMayBeCastBallotboxeswillbefotmdIBtheestablish-mentsofthemerchantsgivingvotesurlatTheSunofficeVotesseatbysailauatdirectedtotheVotingContestDtDtrmeatetTheleaGainesvilleFloridaRulesandRegulations1ThecontestIBopemtoanyonelivingAlachuacountywhoIsknowsbytheconductorsofthecontestorvouchedforbysomereputablepersontothemwellknown2Noemployeeattachesorrelativeofthepro-prietorsofthetrailareeligibleteparticipatelathlacontestsadwillparticipatemanner8IatheeventofanlsvnaeratandlngbetweencandidatesorothersInterestedInthiscontesteachcontroversytraybereferredtothessm-ductoraofcontestwhoatonearethepersequalifiedtorenderdecisions4IntheeventacandidatedecidestofrithdrawfromtheracesuchcandidatewillsotfceallowedtotransfervotestothcreditofanothercandidateInUteMate1beladtaboveaaaedS-ao¬¬OdSabiertbera500voteNewSuiwerifcen700votes1500votesg4500votesft35000votesmonthssubscriptionmonthssubscription1200votes500Oneyearssubscription3500votesForacluboffiveoneyearsubscriptionsgrfV0030000votesForacluboftensixmonthsFubscriptionsCKuWiwO30000votes35030votesThereisnolimittohenumberofclubseachcontestantmaysecureSUN100Oneyearssubscriptic500votesForacluboffiveoneyearsubscriptions5000votesForaclubof25oneyearsubscriptions35000votesThereisnolimittothennmWofclubseachcontestantmaysecureSoicitingvotesbycandidatesorfriendswithinthestoresdistributingvotesisundesiredbytheoroorieiorsTaEDAILSTINT125Three250SixDetofiOTHEoet3CO1lSEMIWEEKLYfi
xml record header identifier oai:www.uflib.ufl.edu.ufdc:UF0002829801470datestamp 2009-04-08setSpec [UFDC_OAI_SET]metadata oai_dc:dc xmlns:oai_dc http:www.openarchives.orgOAI2.0oai_dc xmlns:dc http:purl.orgdcelements1.1 xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.openarchives.orgOAI2.0oai_dc.xsd dc:title Gainesville daily sunGainesville Daily SunDaily sunSunGainesville daily sun (Gainesville, Fla. 1903)dc:creator Gainesville daily sundc:subject Newspapers -- Gainesville (Fla.) ( lcsh )Newspapers -- Alachua County (Fla.) ( lcsh )dc:description b Additional Physical Form Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.Dates or Sequential Designation -58th year (July 24, 1938).Description based on: Vol. 20, no. 48 (Apr. 5, 1903).dc:publisher H.H. McCrearydc:date July 30, 1909dc:type Newspaperdc:identifier http://www.uflib.ufl.edu/ufdc/?b=UF00028298&v=0147032994415 (OCLC)002027051 (ALEPHBIBNUM)sn 95026977 (LCCN)sn 95026977 (LCCN)dc:source University of Floridadc:language Englishdc:coverage United States of America -- Florida -- Alachua -- Gainesville
PAGE 1
THliDAILYSUNGAINESVILLEFLORIDAJULY3019091qluovCJIM4rvne-RYIAIIVtthePoe0eGainesvilleViarMrKXWrXTOdelaHayBlackMMrfnr4tTan4fryBarrierUtheMrerMtMteMfpoteftheClte4StteietiziMUuthreeBMStaffIMttCMtato1lMtMCMtoftlbMKBOW-flTMTiriMVfcfernidgfcttfefortySrtMMffryvWtekeveryMAyaadyiaMiijM4alltksortoftileashhealorate4fCMfwla4winbeayeartoaraaet-AMaralMaMtMbeeafterTXDAILYSUX-ABTMTOUSItMfeMtttotasptfttolsetterco4RkUSBtheyatpresentwillbewenrtyaretowdeojoaseverewiaterasUwrayskepttilerangwellseveredwkkgrassduringthoItbedstotookasthoughThesttsKffttetteatwoKOfitksagotiutthseasoawhtebhadthetaafftreatlysettowouldwellSatefoptosibcrwillconetraeTitertoworewateriaUtewoodsaadpeaisIBthissecttoaBOWthantherehastarseveralyearsWMWelchafosterresidentofAlsoawacovatybutmanyyears-aeitUeaofMayoLaFayettecountymadeapleasantcallatTheSunofficeThursdayHereportsthefarmersofhissectioninaprosperousconditionaaaayofthemhavingmateriallyIm-provedtheirflnanclalconditionbydiversifyingtheircropsaswellasraisingmorecattleandhogsformar-ketrJudgeBullocksdecisiondeclaringunconstitutionalthelawrequiringthecountycommissionerstopayarewordoffiftydollarsforthearrestandconvictionofviolatorsofthelocaloptionlawwillatleastdoawaywiththopremiumonperjuryInhiscircuitNowletthecommissionersofAhchuacountyrefusetopayanymoreoftheseclaimsandtestthelawInthiscir-cuitWonderhowthepersonwhowrotoWondersfromWonderlandwouldappreciatealawwhichpreventedherfromobtainingahotcupofcoffeeorteaontheSabbathWhenyougetrightdowntobrasstacksonkeepSagtheSabbathdayholyitIsjustasstuckaviolationofthecommandtoprepareandservohotmealaUteSabbathasitIstoperformsayotherlabocorhaveitperformed-byothersFanaticismisbecomingalittletoorampantlaGainesvilleforthegoodofthetowaWekayojustreceivedthefirstanBouncementoftheLawDepartment-ofthoUniversityofFloridawhichistobeopenedlaGainesvilleSeptember29thThecourseofstudycoversaperiodoftwoyearsofthirtytwoweekseachandIncludesalloftheprescribedbytheSupremeCourtforthebarexaminationTheannualtuitionis45andthetotalminimumcostpfoneyearintheLawSchoolexclusiveofbooksandlaundryis165Thoseinterestedcangetfurth-erinformationbyaddressingPresi-dentMurpbreeorDeanFarrahatGainesvilleFloridaThejuryinthecaseofWillMoorechargedwiththemurderofScottatMiamireturnedaverdictofguiltyofmurderinthefirstdegreewithrecommendationtomercyThiswasMooressecondtrialthejuryInthefirsttrialofthocasehavingfailedtoagreeWillMoorewasrearedatCedarKeyandatonetimewasdevilinthooldFloridaStateJournalofficewhentheeditorofTheSunwaslocaleditorofthatpaperHowasaneXCelttonallybrightyouthandwearesorrytolearnofhissadfateWonftrftintfortwentyfileyi11taccountcfhiuaI-HlagedmotturrtiheMeAAtsanerXCAYEditorPubnterSutOllfi1rWdlitltRyItCftr7acliltIraIwtf1WcIIMaIMUnitedthetintUreUIenriIeIIIJIIIe-atYertWetrILJJerWaseverJUtofraJaforeatsub-JectsttiirlhailrcginieeodclaetarallandtoasttpMali4mtacxeawp111Itbefieiiiayeassrijgatafavreekai4tIet1y1-MeurceittleetlttlcadlrsfafetadIfeaa11pilafseafarcedeis-ryseakefreipanyhartetthIiWeaaloadsftpaiiMww1MeiniMleiatedwNaelbeestaeellbereealrdeitIs6-iwatAInaeIrakrwpetaldeTheyherosensersRcoatbeerPVJroffwrr¬¬¬¬¬<<>°WHATHIGHTARIFFCANNOTDOAtariffwasneverIntendedtosuppresscompetitioninImportsNopartyplatformhoweverextremehaseverdaredtoadvocateabsoluteexclusionHighprotectionregardedinitsbestaspectconcedesprivilegetoamoreorlesslimitedclassInreturnforspe-cialservicefromthoseprotectedHighprotectioncanconcedetheprivi-legeOnoofthethingsItcannotdoIstoexactthecompensationItIsadmittedthatbydintoffiguringInnumerousprofitsandcostsfavoredmanufacturershavesecuredmorepro-tectionthantheydeserveCanital-waysbeanownthattheyhavereturn-edtheirfaircontributiontogeneralprosperityofwhichhighwageswouldonlyformapartsomeadequatepricefortheadvantagestheyenjoyItIsthisquestionwhicharousesasenseofInjusticeIntheconsumingpublicwhereItIsnotdirectlyInterest-edlathefavoredmanufactureTothesehighprotectionbecomesanin-strumentofoppressionanditisin-cumbentuponitsbeneficiariestoshowthissectionofthepublicwhattheygetInreturnIftheclassmadouplargelyoftileliberalprofessionsbutUchidlBgclericalworkofallkindsremovedastepfromthemeredayworkerisnotbenefitedInfeesandsalariestheprotectedclassesfalltostakeouttheircaseItisclearalsothathightariffwhile-itcertainlystimulateshighpricesandtoalessextenthighwagescannotimprovethequalityoftheoutputItstendencywithhonorableexceptionsistodeterioratethequalityIfthemanufacturerofasarticleInwhichheknowshehasartificialmonopolyhasnocompetitiontofacehowillad-vancethepriceofthatcommodityun-tiltheconsumerIsforcedtoresorttosubstitutesFallingtomakeprofitOBafutureadvanceInpricethemanufacturerwillstriveforhisprofitIntheotherdirectionbygraduallythequalityofwhathesuppliesHightariffcannotprotectthecon-sumerfromthisandtheresultisthathoIscoercedIntoasacrificeforwhichagainItisdifficulttoshowthathoreceivesanadequatereturnespe-ciallyInthecaseofthosalariedorprofessionalclassesalreadyalludedtoLetItbeunderstoodthatasharpdifferenceisdrawnherebetweenhighprotectionasageneralpracticeandscientificprotectiontoencouragethegrowthofyoungindustriesInanewcountryHighprotectioncanhelptheyoungindustriesforatimebutonlysuchIndustriesasmustultimatelystrongenoughtostandontheirownfeetItcannottoanypopularadvantagekeepaliveanIndustrywhichafterbeingestablishedwoulddieIfhighprotectionwereremovedInsuchanIndustrybothcapitalandlaborarebeingmisappliedIfthecapitalistknowhisproperfunctionhewouldrealizethewisdomofaccepting-hisfailuregracefullywhilethelaborwhichIsmaintainedInsuchemploy-mentshouldbeasourceofprofittoacommunityelsewhereInsteadofaburdenIntherespectofexcessivecostforInefficientserviceItIBdoubtfulIfhightariffcanholdapermanentforeignmarketalthoughunquestionablyItcanstimulateex-portsatatimeofrestrictedhomeSellingtotheforeigneratonlyafractionoftheathomehoweverisforthoadvocatesofunlimitedprotectionandforthisreasontheyrestrictthemselvesasfaranpossibletothehomemarketWhereotherconditionsareequaltheycannotlongcompeteIntheworldsmarketasthedisappear-ancefromtheseasofourmercantilemarineshowsTherethehighest-ofhighprotectionhasfailedtoputusInapositiontocompetewithourneighborsandauthoritiesofgreatweightseriouslydoubtwhethershipsubsidieswouldhelpthomatterThiscountrycouldnotnowadopt-afreetradepolicywithoutthemosttremendousdislocationtoitsbusinessButthereoremanydegreesbetweenthatandgivingeverygreedyInterestallprivilegesthatItasksCongressmanSparkmanwillmake-atourofEuropethissummerasamemberoftheWaterwaysCommis-sionAContentedWomanIsalwaysfoundinthesamehousewithlIallardsSnowLinimentItkeepseverymemberofthefamilyfreefromachesandpainsithealscutsburrsanJscaldsandcurrlcuratistairaisinlututagoranJ-rjccia1lJlccnritiaLVlcScJtre-ducingbe-comeIircon-sumptiondangerousFn¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬¬>GALLSANDGULLIESWheneverweseengalledspotoragullybareofvegetationwecanthelpwonderinghowanylandowner-cangethisconsenttopermitthecon-tinuanceofsuchconditionsThelongertheyexisttheworsetheyWhyshouldanyfarmerper-mithimselftobethusrobbedofhisstockintradehiscapitalhisfarmthetimelostthroughthonecessityofmorefre-quentturnsorinworkingoveroraroundthemrightlyemployedwouldpreventtheirexistenceorrestorethemtoausefulconditionaftertheyhavebeenformedWedonotbelieveinfillinggullieswithrailsbrushorothermaterialswhicharelikelytobeInthewaylateronForgulliesorgalledspotsthebestremedyIsstrawcoarsestablemanureorsomeothermaterialthatwillImprovetheirfer-tilityFollowthiswithsomegrowingcropIfagullyplowdirtintoItturntheexcessofwaterInanotherdirectionandsowpeasifagalledspotplowdeeplyandkeepsomethinggrowingonItallthetimeWohaveseengulliestenfeetdeepfilledandbroughtuptothemostproductivepartsofthefieldInthreeorfouryearsbyaliberalapplicationofstrawleavesofcoarsestablemanureandthesowingofcowpeasItwillpaytofillthemupforthecropstheywillbringandifthefieldsaretobeputinconditionfortheuseofImplementsnecessaryforeconomicalcultivationthesescarredandgulliedfieldssocommoninmanypartsoftheSouthmustbemadetodisappearRaleighNCProgressiveFarmerHewsThisWeofferOneHundredDollarsRe-wardforcaseofCatarrhthatcan-notbecuredbyHallsCatarrhCure-FJCHENEYCOToledotheundersignedhaveknown-FJCheneyforthelast15yearsandbelievehimperfectlyhonorable-Inallbusinesstransactionsandfinan-ciallyablotocarryoutanyobligationsmadobyhisfirmWALDINGKINNANMARVINWholesaleDruggistsToledoOHallsCatarrhCureIstakenIntern-allyactingdirectlyuponthebloodandmucoussurfacesofthosystemTestimonialssentfreePrice75cperbottleSoldbyalldruggistsTakeHallsFamilyPillsforconsti-tutionTheforcallingcardsStatementofConditionofThoCuttonBankGainesvilleFlaasReport-edtotheStateComptrolleratCloseofBusinessTuesdayJuly27th1909Loans34149680Overdrafts100321BondsandCertificates931922BankingHouseFurnitureandFixtures3648519OtherResources136500Cashonbandandwithbanks1189070550926653LiabilitiesCapital7500000SurplusandProfits2534019Deposits38860884CashiersChecks29250CertifiedChecks2500NotesandBillsRedlscounted200000050926653StateofFloridaAlachuaCountyIEDTurnerCashierofTheDuttonBankdosolemnlyswearthattheabovestatementIstruetothebestofmyknowledgeandbeliefEDTURNERCashierSworntoandsubscribedbeforemethis27thdayofJuly1909CFGOODMANNotaryPublicCorrectAttestGKBroomeWBTaylorWRThomasPROCUREDANDDCFCNOCDSJXkiutfratrriiriu4frrIrfetuUJunfaxttrmetfpTnrftucNCOUNTRIESKiahtuJirtlrutiAajtiffi-WSHVDCFurthermoreO-WeISunofficeIibe-comeanyResources4fRrPrykNLyaslrf1ettAt1gt9tarjtPrtuEzrfvlrRr-qiral¬¬¬¬¬¬¬¬<>>><>ForPermanentReliefTak-eractsdirectlyontheLiverItwillcureTONMALA1MAANCHULSItlaentirelyfreefromallpoisonousmineralsubstancesandIscomofItisforweakandwearyconstitutionstheweakenedglandsandallderangementsofthebodyTryatodayFiftyCentsaBottleAvoidAHSubttkutwBallardSnowCoSS1AIJLMIDSTLOUISMOUSAoldRoommiMlcftEFFECTIVEDEOIS108GainesvilleforFairfieldandlo-calpointsSouth1010amarriveGainesville425pmGainesvilleforSampsonCityPalatkaLakeCityandallpointsNorth600pmarriveGainesville930pmALGlassGinSuptEBarkerTrafficMgrNEWYORKCITYandRETURNTicketsonsalefromJacksonvilleeveryandThursdaybeginningwith17thuptoAug30thwithfinalreturnlimitSept30thStopoversallowedontheseticketsatRichmondWashingtonBaltimoreandPhiladelphiaReducedratestoothersummerresortsForinformationratesreservationsetcorwritetoAWFRITOTDivisionPassengerAgent138WestBayStJacksonvilleFlaSEABOARDA-irLineRailwayAVANNAHCOLUMBIACAMDENSOUTHERNPINESRALEIGHRICHMONDWASHINGTONBALTIMOREPHILADELPHIANEWYORKTwoElegantTrainsDailyEXPRESSSEABOARDMAILMODERNPULLMANEQUIPMENTLINKDailyThroughSleepersJiukorlilttoNewOrleansForfullInformationandsleepingcarreservationscallonanySeaboardorwrite8CBOYLSTONJrAssistantGeneraltsengerAgentJacksonvilleFlorida8CONpoectjandJOHNSONTYPEWRITERSMItaNMINtILLKIDSIfSUPPlIESMachinesforRnt1WriteforPricesTermsEtcRCDAVISaco2MWestStJACKSONVILLEyIMJHVIIwLTampaJacksonvilleHairyJL35OORAILROADican-onL-tIIOOOOOftJiY1VtiugI0AgentiTMMmsIUFtWMkEasyBayFLA-TheDENHA3IAgentoVIAATIAMTICCOAST1IMMon-dayoSEABOAR1it
PAGE 1
THEDAILYSUNGAINESVILLEFLORIDAJULY301909jwYISrrreSCLSomePyrotechnicProductsMustDryIntheOpenAirTRYINGFORNEWDESIGNSUtffiArtistsCmtinuallyfevfolnjtoWorkedOutInFIrtThCenstructktnftheSetfftsWwktheChemistThefirststepinmanufacturingOreworksIsthemakingofthecasesorbellsasthecylindersorotherrecep-tacleInwhichtheexplosivesandthecfeetalcalareplacedarecalledPracUcallyallofthesearemadeofInnuBerabtesheetsoftissuepaperpeltedaadrolledtogetheruntilthethicknessrequiredtoattainedMostofthesecasearemadehymachineryandaredeliveredaswantedtotheplaceswheretheyaretobefilledorchargedwiththeMaterialsthathavebeespre-paredAllthechargingIsdonebyBMCBlaeryexceptlathebigshellsthatthrowfertasetaofstarserarylag-cetenIatheseeachstarhastobeplacedlaapositionsoastoexplodeIBjusttherightwayatthepreperlatantOatofdoorslaptoasaatweatherthetefflIBeloffHeqikkmatchtheyarecalledaremadeThesearewoundOBreelsixoacresfeetacrossTheirbasisIsloosecottoncordcoveredwithvarioushighlyInfiatnmabtchemicalsQwlckWatchrowancandlesandaaaaberofotherpyrotechnicproductscasflotbedriedbyartificialbeatTheymeetlieIntheopennlruntilthemois-tureusedInmlxiagthechemicalsevaporatesAlltheyeararoundtheartistsonthestagofthepyrotechnicmanufacturersaretaxingtheirbrainsdesign-ingcolorschemestoboworkedoutInIreOutsideofthebigsetpieceswhicharemuchInvoguenTentdensofattentionIsgiventorocketsbombsandrocketbombsofwhichthereareInnumerablekindsWhentheartistevolvedsomestrikingcoloreffectheturnsoverhispaintingtothechemistswhosetaskItIntocombinevariouscombustibleingredi-entssoastoreproducewhatthepainterhasputonhiscanvasTheracebetweentheartdepartmentandthostaffchemistsIsunendingItIstheboriRtofthechutnlststhattheyeauduplicateintheirburningcolorsanycombinationofpaintsthatcanbepresentedtothemThesecolorsnreImpartedbytheheatedvaporsofcertainmetalsSodturnforInstancegivesayellowlightcalclamrodstrontiumcrimsonandbariumgreenThenumberofchemicalscommonandrareemployedinthemanufactureoffireworkslaprodigiousTakebluestarsforInataaceThesearecommonlyproducedbyacombinationofchlorateofpotashcalomelsulphuretofcopperoxychlorideofcopperdextrinstearlublackoxideofcoppercopperfilingsandsalammoniacEverymanufacturerhassiscarefullyguardedtradesecretsPyrotechnicsInItsvariousbranchesandnsawholeIstaughtInnoandthereIslittleprintedlit-eratureonthesubjectThoconstructionofthewtpiecesespeciallyIftheyarelargeInahugetuskFirsttheiirtlstdrawsthepic-tureItbicompleteIneverydetailofoutlineandshadeofcolorThisImarkedoffIntoequalsquareseachofwhichrepresentsAsquarefootlathedualreproductionIntireSectionseflightboards20by23feetnrebuiltmidlaidflitonthgroundurwlrectanglesnfootsquarearemarkedthereonOnthegectlonIHontltneitthepicturethattheartisthasmadewiththedifferentcolorinOlcatvdlutheirpropergroupingsLooseoverthisIsbuiltacheckerboardframe-worklightlatheThenromemienwithstripsofniltanTheytackthesetotheframeworkfollowingexactlyeverylinethathasbeenIndicatedontheboardsbelowleavingpracticallynhugelinedrawingInrattanThenconicmenwiththousandsofbigplusordinarypinsbutaboutaniiicblongThesearesetlutherattanauIncjiapartThwennfollowedbyotherwonwhocutthehandsoffthepinsAftertillcomesnpiugofmenwithbundlesoflittleihoworkatwoInciteslongbytothreequarterinchesIndiameterInvaryingcolorsorcombinationsofcolortocorrespondwiththeoriginaldrawingThesearecalledgcrbeWhentheyemitsheavesoftireThesearestuckonthePiusandgluedeachshadeofcolorInitsproperpieceatomtileframeworkAfterthishasboondoneanothergangcomeswithhundredsoffeetofquickmatchandconnectsallthesethousandsofgerlrcstogetherLooseendsarelefthereandtherefortiringwhenthepieceIsInplacereadytobesetottoThenthesesevtioiuiarehoist-edIntotheirproperpositionsandaftrInfinitelaboreverythingIsreadyforthewonderfuldelighttotheeyewhichslaylastbetweenoneandfouruituutosSoswiftlydoesthefirerunMAKINGfIREWORKSgmilsefcerttinsfireworkssayelfmotCirrsfea1rttfliMuni-versitytouequarterig-nitedr<¬¬¬¬¬¬¬¬¬°°fromgerliftoMgerUthroughtinquickmatchthattinlLvtpic-turethatIusuallyriNauntieIneverypartInthreeThereIsbolittleormidan-gernlHititfiringthesewtplivporevenInsettingofftheIximhsthatex-plodewithsuchfearsomenoiseTheendsofthequlfkmatchwheretheporttire1npptlnlbythemenwhodotheIgnitingarecarefullytimedthattheyloveplentyofchancetoofthewnyNowYorkPressADEBTOFHONORThDebtorCreditorandthePremissaryNoteThoInconsideratecreditorpressedforImmediatepaymentofhispromis-soryaoteButIhavenomoneysaidthedebtorwearily1sawyoupaythatmanwhojustwentoutretortedthecreditorIndig-nantlyThatwasadebtofhonorrepliedtheotherwithhauteurThecreditorImmediatelytoreupthepromissorynotewhichbeheldInbisbandandthrewItInthetireSoIsmineadebtofhonorhesimply80farsogoodandtbematterisproceedingalongtbeproperlinesforsuchcasesmadeandprovidedTiledebtorassuredhimselfthattbepromisetopayhadbeenreallycon-sumedPardonmehethenpolitelysaidbatyoutoreupthatnotevoluntarilyandfrommercenarymotivesIcan-notthereforerecognizeItasadebtofhonorWhichprovesthatnnicesenseofhonorisagoodthingtohavelyingabouthandyThecreditorsmiledindulgentlyObthatwasonlynropyItoreherepliedlietookanothernotefromhispocketThisIstheoriginalyouseeberemarkedwithpardonableprideWhichrotagainthatacarefulMianbeforeburninghisbridgesassureshimselfthatferryIsHtllldoingntthesummitoldchangeCASTORlotInfantsandChildrenTheKladYouHaveAlwaysftajltBoarsthoConcerningTwoSoundsWhenJosephHenryIumpklnwagchiefjusticeofGeorgiancasebroughtupfromColumbusInwhichnwealthycitizenaskedforaninjunctiontopreventtheconstructionfnplaningmillacrossthestreetverynearbispalatialresidenceIllsgrounds-forcomplaintconsistedchieflyIBthepropositionthatthenoiseofthemillwouldwakehimtooearlyinthesaornIngLetthemillbehuntsaidthechiefjusticeInrenderinghisdecisionLetItswheelsbepntlumuttonTheprog-ressofmachinerymustDotbestoppedtosuitthewhimsorthefearsofanymanComplainantsfearsareImagi-naryTinsnurdofthemachinerywillnotMnnnlanriOncontraryItwillprovealullabyIndeedtknowofbuttwosoundsInnilnmantautiolbmmitmunrlltoandilioyirethebrayingofaiasandthelonjiiiascoldingwomanAtlastaTouchingyoungSlaperlyseemsMidiafragilefellowIshouldhesitatetotouchhimforfoamhewouldbreakSamliewouldnthvsltatoaboutyouItbewasbroUeLondonTelegraphjWhyWomenAreLikeTugboatsiBiggsWhyarethetugs0tinWIscousinriverlikecoedswhowalk-upanddownStatestreetAndtheanswerBiggsSometoe-IoutandsometoeinWisconsinSphinx-IASubordinatePosition4-iWhatIsaspeakerofabpuseYourmotherIsfAndwhatareyouIIsupposeImightcalletitheleaderoftillminorityIPressPartlyBlankWhatsrtuCnilrlliasbeWellIlkrlriiofhasmanyamlssluslinkiManypeoplewithchronicthroatandlungtroublehavefoundcomfortandreliefInFoleysHoneyandTarasItcuresstubborncoughsafterothertreatmenthastailedLMRugglesReasnorloawritesThedoctorsaid1badconsumptionandIgotnobetteruntilItookFoleycHoneyandTarItstoppedthehemorrhagesandpaininmynrftvovnownsoutHas9bulletJWMcCollumCoallItiniitusgr-outtheUIbusinesstQndIxfsgnaturoorwasthatlitConstitutIonJackThatIIheII¬¬>+=JRGEO8WALDODENTISTGrahamBuildingEastMainStreetNPhene51LentREDWARDCLARKDENTISTOfficeslaGrahamBuildingoverSaundersCarlosstoreFloatNo356DaVEBEBMORRIBDENTISTOAaaoverGalsfrflTllleNaUoaaltealPhoae1MJHALDERMANDENTISTMNeoverDattoaGosFfeeZItGabieaTiUeTieBEBAKERSOLICITORINCHANCERYGAINESVILLEAlaehuaCoOfieeinHaytuansBlockFERDINANDBAYERATTORNEYATLAWFLOBIDAOaatellyourjuypropertyinrolandiruedIngandfarminglandsBeadhisiitnfHyonsrprforale3l43fJACARLISLEATTORNEYATLAWBolioitoriaEqoityReaEstateeraPracticeAllbusinessatteadedtoOfficenextogleGAINKSVILLIFWUBAFRANKCLARKTUGSWFISiiDINOCLARKFIELDINGLAWYERSPracticelaallCourtsStatecarFederalfticesOverGainesvilleNatloaaHankualnvsvtlloFloridaToomothemphasiscannotbeplacedotitimeneedofanAbstractInpurchasingrealestateacatInabagcannotbebettercxwrmpllflcdthanbythatofthejurcbaeofrealestatewithoutunAbtrnctDosafethocostIshav-inguspostyoufullyonthehistory-ofthatpropertywithanAbstractriadohyuslACHUACOUNTYABSTRACTCOFloridaTFTHOMASUNDERTAKINGCOFULLLINEOfNEWGOODSAGENTSFORVONCBENTSTOMHSTONEHandIRONFENCESPersonaltttenilootoallsauenitthisUaoMilleeltocrvborderpromptlyatundftdtoQalicsvlltPlerldaItU8INItSSJtIDRpsaWt3AIPUV1LLaffiBpIdoor80smallby8intillSeooursampleCAFDSsellAlaDistanc-eDSSslamATTORNEYATLAWFLITAidaastlflaybeLIwIBuyItyy<¬ABOUTADVERTISING2TheDollarThatCantBeSpent-ByHerbertKaufmanEverydollarspentinadvertisingisnetonlyaseeddollarwhichgrowsaprofitforthemerchantbutisactuallyretainedbyhimeyenafterhehaspaidittothepublisherAdvertisingcreatesagoodwillworththecostofthepublicity-ItactuallycostsnothingWhileitusesfundsitdoesnotusethemupIthelpsthefounderofabusinesstogrowrichandatthesametimekeepshisbusinessfromnotdyingwhenhedoestIteliminatesthepersonalequationItper-petuatesconfidenceinthestoreandmakesitpossibleforamerchanttowithdrawfromwithouthavingtheprofitsofthebusinesswithdrawnfromhimItchangesanametoaninstitutionaninstitutionthatwillsurviveafterthedeathofitsbuilder-ItisreallyaninsurancepolicywhichcostsnothingpaysapremiumeachyearinsteadofcallingforoneandrendersitpossibletochangetheentirepersonnelofabusinesswithoutdisturbingitsprosperityAdvertisingrendersthebusinessstrongerthanthemanindependentofhispresenceItpermanentizessystemsofmerchandisingthetrackofwhichisleftforotherstofollow-AbusinesswhichisnotadvertisedmustrelyuponthepersonalityofitsproprietorandpersonalityinbusinessisadecreasingfactorThepublicdoesnotwanttoknowthemanwhoownstheisntinterestedinhimbutinhisgoodsWhenanunadvertisedbusinesssolditisonlyworthasmuchasitsstockofgoodsandfixturesThereisnogoodwilltobepaiddoesnothasnotbeencreatedThenameoverthedoormeansnoth-ingexcepttothelimitedstreamofpeoplefcritheimmediateneighborhoodanyofwhomcouldtellyoumoreaboutsomestoretnmilesawaywhichhasregularlydelivered-itsshopnewstotheirbreakfasttables-Iti3shortsightedforanantobuildabusinesswhichdieswithhisdeathorceasestviihhisinactionasitisunfairforhimproviJforthecontinuanceofitsincome1308byTribuneCompanyChicagoSMerchantColetallersandJobbersInStapleandFancyGroceriesGrantGardenSeedandFertilizersSOUTHSIDESQUARE3GAINESVILLEFLORIDAHhjheatmarketpricepaidforChickensEggsandothcProduceACompletestockofHayCoraOatsFlourBranMealCottoaMealandRyeWehandleonlytheVeryRestgoodsatLowestPricessadguaranteesatisfactionaIIIstoreitiforitexistitnot-tfliIpyrlalATHEDMLYSuNlWtljftt0busi-nessto-ilnibtitCr-aGSeed¬<
PAGE 1
SUNuAiEVLLLKFLOKIIIAJULY3011IU1IfJt1rJ5TltSLY>>AERSCHAUMPIPE-ItRequiresCarefulSmokinptoColorItProperlyOrdinarilynmeerschaumspipeIsboiledforcoloringInapreparationofwaxwhichIsnbsorlxnlandnthincoatingofwaxIsheldonthesurfaceofthepipeandmadetotakeahighpolishUnderthewaxIretainedtheoiloftobaccowhichIsabsorbedbythepipenodItshueprowsdarkerInproportiontothetobaccousedAmeerschaumpipeatfirstshouldbosmokedveryslowlyandbeforeaondbowlfulhlightedthepipeshouldcooloffThisIstokeepthewnxnfarupthebowlanpossibleandrapidsmokingwilloverheatdrivingthewaxoffandleavingthepipedryandrawAnewpipeshouldneverbesmokedoutdoorsInextremelycoldweatherFlitthepipeandmuokedownnboutonethirdortotheheighttowhtvbyouwishcolorLeavetheremainderofthetobaccotuthepIpeanddonotemptyordisturbItforseveralweeks-oruntilthedwiredcolorIsobtainedWhensmokingputfreshtolMocoothetopandsmoketothesamelevelWhenonceburnedthepipecannotbesatisfactorilycoloredunlessthebunt-edportionIsremovedandthesurfaceagaintreatedbythebywhichmeerschaumispreparedThecolor-IngIsproducedbytheactionoftinsmokeupontheoilsandwaxwhicharesuperficiallyontheexterioroftinpipeandareappliedInthesameproc-essofmanufactureIxAnswersDMForMatchAclerkIntheblackgoodsdepartmeatofaBroadwaystoreputaboxofsafetymatchesInhispocketbeforeleavinghomeTheyllcomeinbandyformycus-tomersbesaidnottolightcigarorcigarettesmycustomersdontsmokeinthestorebuttotestthegoodstheybuyNodoubttheirtrickIsantediluvianEvemayflgleavesjustthatwayInthegardenofEdenforallIknowbutnomatterbowoldfashionedItmakesapersonseemthereareplentyofwomenwhowillnotbuyapieceofclothwithoutsettingalightedmatchtooneofthethreadstoseewhetherItburnsornotIfthethreadburnstheclothIspartcottonandtheshopperwonthaveItIfItdoesntburnitsallwoolandshebuyNewYorklobeHicksCAPUDINECuresSickHead-acheAlsoNervousHeadacheTravelersHeadacheandachesfromGripStom-achTroublesorFemaletroublesTryCapudlnoItsliquideffects1mmediatelySoldbydragglattReadthewantadslatodaysSuaGainesvilleFurnitureCoWeCarryLineofOakandMahoganySuitsOddDressersWashStandsChiffonniers-andChifforobesRefrigerators-IceCreamFreezersVudorPorchShadesandPorchRugsCompletelineofStovesandRangesGainesvilleFurniturejtprocessiOneshaveaFineIiFeetestedyCo-n¬¬FOURYEARS-OFMISERYC-uredPinktramsBaltimoreFormylifewasamiserytomeIsneeredirregulari-tiesgiiiffsensationsextremenervous-nessandthatallinmIgivenuphopeofeverwhenIbegantotakehamsCompoundThenasthoughnewlifemeandIamrecommendingallfriendsFORD1636LansdowneStBaltimoreMdThemostsuccessfulremedyinthisisEPinkhamsVegetableCompoundIthasstoodtodayismorewidelyandsuccessfullyhascuredthousandsofwomenwhohavetroubledwithdisplacementsinflaza-aaation4indigestionandnenroasmeanshadfailedIfaresufferingfromoftheMailmentsuphopeuntilhaveEVege-tableCompoundatriaLIflikespecialadviowritetoMrsI-MawkforitShehasin-tltounaadsthealthchargeTHECOOPERATIVECONTESTBusinessHousesThatAreInthePlanWhichWillIssueVotesThehandsomepianosanddiamondringtobegivenawayintheCoOperativeContestwillbethegrand-estdistributionofprizesoverofferedInAlachuacountyPartiestradingwithanyofthefollowingstoreswillbegivenonovoteforeverypennyspentGainesvilleFurnitureCompanyfurniturePhlfcrMorrisCoclothIngandfurnishingsGainesvilleHard-wareCoplumbingandhardwareMrsFTMcConnUvcmillineryWMJohnsondrugsandmedicinesLCSmithshoesandjewelryRWilsondrygoodsandnotionsSaun-dersEarlegroceriesandfeed-stuffsCityBakerybreadandpastry-PYSmithfreshmeatsCrawfordDavisliverynndsalestablesTheSunprintingandpublishingTheDrownHousemealsandlodgingNFranciscoBananaHousefruitsetcfrldinsMfgColumberandbuildingmaterialStandardFertilizerCofertilizerVoteswillbegivenonallordersforJobprintingatTheSunofficeandonsubscriptionsasfollowsTheDallySun125threemonthssubscriptionoldsubscribers500votesnew700votes250sixmonthssubscriptionoldsubscribers1200votesnew1500votes5oneyearssubscriptionoldsub-scribers3500votesnewsubscrib-ers4500votesForacluboffiveoaeyearsubscrip-tionsbefore12oclocknoonAug181909oldsubscribers30000votesnewsubscribers35000votesForacluboftensub-scriptionsbefore12oclocknoonAug181909oldsubscribers30000votesnewsubscribers35000votesThereisnolimittothenumberofclubseachcontestantmaysecurefTheSemiWeeklySunoneyearssubscription500votesForacluboffiveoneyearsubscrip-tions5000votesForacluboftwentyfiveoneyearsubscriptions35000votesThereIsnolimittothenumber-ofclubseachcontestantmaysecure-AMillionairesBabyAttendedbythebabyspecialistcouldnotbecuredofstomachorboweltroubleanyquickerorsurerthanyourbabyifyougiveitMcGeeBabyElixirCuresdlarrhoeadysenteryasclallderangementsofthestomachorbowelsPriceSJcentsand50centsSoldbyWMAFTERCompoundtelhadEthenIt-ocountryforthecureofbeesJlnabackacbeatulenc1PIfreeeisub-scrIbers1higbeetLydiadrstomachcaIr-regularitiesfeeanidtMrssub-scribersslxmonthspriced¬¬¬¬¬¬¬¬¬FaultiestWithMudAnotoUexiikrvrrecentlyreturnedfromcentralAfricatellsofnuniquemethodemployedbyhiscompanionsandhimselftoalleviatethedreadfulagonyofprolongedthirstInpartsofthedarkcontinenttherearegreatstretchcHofcountrywherenowater8ttodrinkistobefoundalthoughtherearehereBudtherepoolsofthickstagnantmudInsuchcountrythepartywanderedforliredayswithoutwaterandmightbareperishedbutforanideathatoccurredtotheirleaderFollowinghisadviceandexampletheycollectedthestagnantmuditwastobefoundandmadeitintolongpoulticeswhichtheyfas-tenedroundtheirbodiesnexttheskinThissimpleprocesstheyfoundtogivegreatreliefLondonAnswersInsuranceFremItalyInsurancecamefrommediaevalItaly-ItIsbelievedtodatefromthecenturyandatthattimeItwasknowninFlorenceTheRomansdidnotknowInsuranceThenearesttheycametoitwasthepracticeofacompanysupplyingthearraytoaguaranteefromthestateagainstthelossofshipsButthiswassoonabandonedbecausedamageshadbeencollectedforsunkenskipstooworthiestofloatStarvedtowhatcouldtruthfullybesaidofmanychildrenwhodieTheyhavewormspoorlittlethingstheydontknowitandyoudontrealizeIfyourchildIscrossfretfulpastycomplexlonedandlosesweightfornoap-parentreasongiveItWhitesCreamwillbesurprisedattheresultsandhowquicklyitpicksupSoldbyWMJohnsonITSFRESHEVERYDAYTileBreadPieandCakeyoueatshouldbenutritiousTheflourmixedwithpurerichmilkandbakedlathepurityfashionmakeourgoodsthemostdeliciousIttopossibletoproduceKEYSTONEBAKERYPhone165RTSchaferPrepGEOWDAVENPORTP-IANOtitORGANTunerandRebuilderEs-timatesFurnfeholPromptlyandAllWorkGuaranteedReferenceAddressJesseFrenchPianoCoGAINESVILLELnddcitBatesFLASMDAVISFANCYLIVERYE-xtraNiceStocktoSelectfromPri-vateHorsesforFamilyUseBuggiesharnessandWagonsSoldiDAVIST-HELIVERYMANVOYLEVOILEREALESTATEGAI-NESVILLEFLAFarmsDwellingsLotsForSaleLISTYOURPROPERTYWITHUSAbstractsofTitleMade-ToallLandsinAlorliuaCountyonshortFireInsuranceW-ritteninReliableCompaniesre-QuireDeath-IsItVermifugeyouTICotSMwher-eversixt-eenthmeatnot-ices¬¬NOTICEOFINCREASEINASSESSMENTSJuly1C1909theCityCounciloftheCityofGalaevllleFloridametasrequiredbylawforthepurposeofandequalizingtheassessmentoftaxesfortheyear1909andtheassessmentonthefollowingnamedlereonswasraisedasfollowsRaisedB3R420002seeNB5R5700mB7R5130SVsB1R6ieeijeeB8R6andB8R7160925eeNB5R7see7eeB7R72eeo2seeand2B22eoe2SeeB6R8eeeiase82R74eesee2eeo2seeB5BrushAdd600SeeofsB6ioeoi4eeswofsB6800OfB716002eeBsNNcoeSetLots6and7p1225030ft3004oeLot10rB2220025efeetB2l56let300seeWellsplacolSSOelie20e-V50leewD4R1EnnrnnffnnsPoundLotB2R3LHillR4R3SVDukeGinHouseLotMrsIreneMcCrearyLot4R3R6fMrsSADauknlghtTBStringfellowWSDorseyEvansHalleJEFutcbJTBudingerHBArnoldETFThomasLots1R8BFHamptonNJHVidalMrsOBMcBeatb8ftofNMrMrsEPCaterOvilleCoNAJDaCostaWMDaleLWFennellJWGlassMinnieCPerkinsEdMartinAEWIttstockHenryRamseyRThomasWRThomasJEAckleyJnoDingleCDeLoachi-iiiiwinswxAWelnsklLots8aad9BABFHamptonLot19Sec329Mrs8LRobbJasDolgNewCktiaesrilJeEACooperTwolotsDoleftRobertsosAMMrsRWilsonD3RoperAMMrsPBrushOvllloCoJBPadgettCorFraskltesadBertsaristreetsJJHaymansMrsJEMcCrany8MMixsonMrsSCSadlerOwenLloydGeoIBlakeFerdBayerSFWIttstockJBDavisEddinsMfgCoJGHarroldWNWilsonECPoundEstMrsLunaAveraJLKelleyLots4Bad7EtfLotMillersAddWLWilliamsELot1MillersAddMrsLJJonesLot5less1C23feetElsieCatoLots111and112fromtoMIWV2500soee70009oee1200isee1500l8eleezee2e-seseeiesee4e-aee4e26662J6f166616099IfVvV166619663664669661669leeIN4-AA4eeseeiee4esee25030ePortersAdd70100ThosCaveLots111and112PorttersAddCAColclough150Mr0CColclough1002WDiamondCoLots678D131416Part10Peelersannex8003oeeRnPeelerGregorysannex500EvansHal1Lot1Sec5TheCouncilwillmeetInthecouncilchamberonMondayAug-ust1909at8oclockpmtohearanddetermineallcomplaintsafterwhichdateunderthelawBOchangescanbemadeIntkoassessmeetronJMDELLCityClerkGainesvilleFlaJuly161909GEORGIASCHOOLOFTECHNOLOGYATLANTA6E8XSUTECHNICALINSTITUTEofhighestrankwhosegraduatesoccupyprominentandlucratirepositionsiaengineeringandcommerciallifeLocredinthemostprogressivecityoftheSouthwiththeaboundingopporUiaitiesoffereditsgraduatesintheEouthspreecatremarkabledevelopmentAdvancedcoursesinMechanicalElectricalTextileandCivilEngineeringEngineeringChemistryChemistryaadArchitectureExtensiveandnewequipmentofShopMillLaboratoriesetcNewLbraryandnewChemicalLaboratoryCostreasonablestudentsreceivedanytimeduringtheNextsessionopensSept22190973ForillustradcatalogaddressKQMATHESONAMLLDPreAtlantaGeerflaORMOREWmmWACENTURYdisofiSJxaaMAbBYCOMPANYOnCMooreSid15002000IrsIda51500L11SDavisStable5Oe4leettOsSVrItJH75letse24ftHIse7558IttiO5413ftHee8MVE7013tIIce8M30NCItndIftheIeesionwehavetestofolofiMcL-Rcof1gt1JFridayMrs791Starkeplace394Atr54111L30144124443444e144351341141tisttie1MachineryusersWPOAtABIEoTT-1rRYFHGIdi9YSawMiI15lYfood4lorkingMadtit-s4rsagvtaANTEruWP1QtLVORSYTNsTLAt4TA>>>¬>=>
|
|