Citation
Gainesville daily sun

Material Information

Title:
Gainesville daily sun
Uniform Title:
Gainesville Daily Sun
Gainesville daily sun (Gainesville, Fla. 1903)
Running title:
Daily sun
Alternate Title:
Sun
Creator:
Gainesville daily sun
Place of Publication:
Gainesville, Fla.
Gainesville Fla
Publisher:
H.H. McCreary
Publication Date:
Frequency:
Daily (except Saturday)[-1938]
Daily (except Monday)[ FORMER <1903>-]
daily
normalized irregular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Gainesville (Fla.) ( lcsh )
Newspapers -- Alachua County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Alachua -- Gainesville
Coordinates:
29.665245 x -82.336097

Notes

Abstract:
The Daily Sun was based in Gainesville, the seat of Alachua County and shipping center for Florida’s citrus region. The newspaper was formed through the merger in 1890 of the Gainesville Advocate and the Daily Morning Record. The Daily Sun described itself as a “democratic” paper. It was published daily, except Mondays, by Henry Hamilton McCreary, the scion of a prominent southern family. After completing a degree at the University of Kentucky, McCreary established himself as a newspaper editor at the age of twenty. McCreary also rose to prominence as a politician in the Democratic Party, first as a city councilman and later as a member of the state assembly, to which he was re-elected several times. McCreary considered himself a staunch patriot and fervently supported industrialization as a means of strengthening Florida and the nation. McCreary’s wife, born Irene Richardson, was well connected in the civic networks of Gainesville and northeast Florida and served both as vice-president of the Florida Federation of Women’s Clubs and president of the United Daughters of the Confederacy. The Daily Sun was continued, in 1903, by the Gainesville Daily Sun which briefly carried the title of the Gainesville Sun.
Additional Physical Form:
Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.
Dates or Sequential Designation:
-58th year (July 24, 1938).
General Note:
Description based on: Vol. 20, no. 48 (Apr. 5, 1903).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
32994415 ( OCLC )
002027051 ( ALEPHBIBNUM )
sn 95026977 ( LCCN )
sn 95026977 ( LCCN )

Related Items

Related Item:
Gainesville sun (Gainesville, Fla. : 1903)
Preceded by:
Daily sun (Gainesville, Fla.)
Succeeded by:
Alachua County news (Gainesville, Fla. : 1934)
Succeeded by:
Gainesville daily sun and the Alachua County news

Downloads

This item has the following downloads:


Full Text
,
4
"
.,

> "

.
\ -
"

;.i ':" r' ,-.
:1' d
:



,iatntm11e UlD un '







r : .:... - -

LXOL.XXII, NO. 105 GAINESVILLE, FLORIDA, FRIDAY; JUNE S St, 11)05) TEN'CENTS' A WEEK

.. ...1J _. u__ __ __
- ..;;:

2 eighty miles from the bon buoy off from the address lo the king It I I.

EOSSANS bROOSEVELT'S_. _ ,.- the, entrance to Woo Sung by the OSCAR NO lONGER' expected: that the strothtng will Issue COMMITTEE GIVEN
'
Rneelaa transport Rlon, boarding a proclamation to the Norwegian pro- i
party, after the paper ware examined ;' pie regarding; the dethronement of the
ACTOf removed h.r hatches and threw KING OF NORWAY monarch. PLENARY POWERSLooks

overboard 411 -bag of baaa. 115 bales

\ of cotton and 11 boxes of antimony.The Telegram( From the King.

,Refusing to Allow Warships Russians left again suddenly Storthing Declares Union of Stockholm. Sweden. June 8.-King Now Like Settlement of
stating that the steamer was released.It Oscar has sent a telegram to Premier
To Remain At Manila. 1* supposed .that they received a Countries Dissolved. iilchaelson aa follow: Strike la In Sight.

wireless message regarding tbe approach "lift* received tbe communication

'CLAIM HE'S PARTIAL TO JAPAN of Japanese warships KING TELEGRAPHS HIS PROTEST of the council of late., ANOTHER CONFERENCE CALLED

Record the roost decided protest -- _. .
"' ....I.n Press Declares That Th.lr LONDON RECEIVES YOUNG KINO. Dcotarca Action la UncaUsd For and against the method and action of the Commltte From Strikers Will Mast
government,"
Country la Now Helpleaa and Powrl Spain's Ruler Enjoying the Hospitality Desire a Decided J Protest Made Employers and Try to Bring About

*.., and of Course Their. Ships of Englishmen. Norwegians Th.r. I. No FeelIng FOUR DOLLARS A SQUARE INCH Pac.-Outcome of Meeting Will &.

Must B* Int.rn.d Till End of War. London June 8.-King Alfonso today Whatever Against the King. Watched With Much interact "
visited tbe city of London and Fabulous Price Paid' For New York
Bt. Petersburg June 8.--The Rua- enjoyed the hospitality of the lord Chrlatlana Norway' June 8:-Thostorthing City Property. Chicago, Juno $.Peace I Prospects>> tin
'aHan pr**.. notably the Novo Vremya nrayor and corporation at the Guild today declared the union between New York. June 8.-The sate to the the '.&Wller.' duke took 1"W-
,sod. Tfc Russ the latter frequently hall. For the first time since his maJejtj's I Norway and Sweden under one 'fcrcantlie'tnat company of St Louta Icaan of 11 f. today th*> temtikteis' joint
.reflecting the views of the foreign of- arrival in Ebglaad the weather t king to be dissolved and that the jut reported of the fmiiuu plat ol council having agreed" to accept th,<
Gee, display a great deal of rE'lent.I I was sufficiently fine to enable him king has ceased to act all king of Nor real estate at No. 1 Wall street at the riiitloywra'| conditions for another con,
tnea agalnat the United States for en- to appear In an open carriage, and way. The storthing further empowered corner of ltroadwni: her lven rise to h mice. 4
rclng the 4-hour rule In the cane for the first time an).thing In the nature the present state council to act Interesting complication showing Ihw The action. was Ukeu In tlm absence
of the three Russian cruisers at Majulla. of really large crowds gatheredto as a government of Norway until great rl .n In property M.lue* Iu tUJ of Pivsldent Sh 'M. I.." ,) May
Tb* Ruse quotes the American welcome him. further notice and to fxficlsw! the city. At the figure stunted In the Irana ,'r. attorney for .ibe nu-ichantii: wait no
noatrallty regulations and contends The welcome to the young monarchwas power hervtoitire appertaining to the action ITIMI.OUO. (ho plot brought tilled that a committee, {ponnenslnic pie>> .
that President Roosevelt in applying of the heartiest description. The king about $4 a ttquaiu liuh possibly the nary powers was ready to meet A similar
the principle that only injuries received route of tbe procession which passed An address to the king pee adopted highest price year paid In the worM'n committee of employers, It. war "
during storms, and not In tattle -: under a continuous archway of Hags declaring that no III feeling pas entertained bltlory. The property measure only I lleteil thus employers will 'un..nt to

can be repaired In American i and flowers wall lined with troops. ugitust him, his l.In..tf or ::0: feet on the> tlioadway' sld., and bana a conference: possibly today, ou this -
ports not only narrows the American Halts were made at tbe boundaries frontage on Wall street of :39 let"t busl.r.
regulations but Infi'luges recognized of the drift boroughs to receive and 10 Inches It contain: 1,170 mjuar* pienldcntVslker O.- Ullibona of the ,
principles! of international law. This_ answer the addresses of \local author fci truniHieia' council named the striker'
t.The
paper declares It has official warrant 1t1i 8. At each of these points the nrxt Llghcut/ lluuie on real es. r< i.ieH 'nutlvts.! On the co.uutlttvu uto 1
-'for the statement that representationsj decorations were ot an especially elaborate tutu tritusactloiiM In this city was that m..IIIIMtrl of every union now affected,
j! been made Washington; on the character and the crowds were r paid In 1ST' : by Anthony J. Hr..1! for bj' the 111'1"... Including the uxpre
ubject. The Novoa Vremya la ex I large. King Alfonso unrestrainedly the site of the Morgan banking hour t driver.

ceedlngly sarcastic. After a slap at showed his pleasure at the demonstrative 'at inroad and Wall sheets! This prop The revival of peace hopes which ., rI
Great Britain for, the alleged manner greeting which culminated In I Ia city, iueurinir 717 square feet war t'1I1""t'tC'd Would {IMltIll'dl1t{ !', far the
1n :alan fleet from the time it I left Cronatadt tered the Guild hall. There were asaembled the attorney 'who condiuted the Titinl crisis between the team owners aud '
.. and for trying to fore all the a brilliant gathering of members rijmpany's contract: the truck drlvera. Thw unltni had
po,,'u.' to accept her Interpretationof of the royal family, cabinet ministers "1 bate i.ot (the llnhl""t doubt! that tuts.l to reject I the arbitrall propo .
the rule of neutrality. NqrVrem1a'dedaree oe and naval military and court 1 have tecuri'd for our client the inns t .ul ut the owner, '
thai'president Roose. official The clty'a address of welcome J. valuable! piece of real estate Iu lit" "'hilt! the. action of live truck del
veil whom It refers to aa "Mr Rooae- was presented to the King In a ,e whole world. There I.I only flnn Broadway sera wa a shock lo the leant' owners,
velt," contaminated by England's example : gold casket only one Wall street and only one It was" not considered probabl In the
arbitrarily Interprets his own King Alfonso did not reply) to tb P tin 1 Wall street on earth It Is likely tight rules In a scuba. favorable to Japan presentation address, which referred 1 ) the present )lease will !be allowed I would msko) a movement at nnC'4t' to

adding: I to the admiration which the citizens to inn lo a clo ". 'Glyn, 'Jf courso, lock out the I.OwO driver In HHr! rm. t
"Mr. Roosevelt takes full advantage of London had for the art and literature the property will be Imptoted in M ploy, - -V, l

of the fact that Russia! la helpless and of Spain and the services of the manner in kteplng with toe vttlue uitdlocHllou. '- .
i **"--- r
--
powerless to do more than protest.. country in the, .cause of civilization ." .i .mot\ aRetutns
The Japanese minister Is reported to and which recalled the commercial i I I .- 7.---- ......,- From Fruitless Search.
KINO OSCAR. Nashville Tenn. June 8.-V. H.
his ties
have hastened to eipreia gratitudeto uniting the two ,countries
America" for this act of Impartiality the Bucdkh iatou aid taking him TO RECEIVE: HAol;: JoNifT OOPV. May, a wealthy. resident wf !frank!
to ...__, Iln. hat returned from Arkansas and
cooperate In he selection n
which Is partial to Japan. W" VICTIM OF "WIRE-TAPPERS." of a
trust Mr. Roosevelt U. .all.Ued with young prince of the house of Ih-rna. Squadron Waiting For Ships That Indian Territory after a trultleetsearch .

Ills auccess." 6t. Louis Man Claim H* Wa Swindled ; dott to occupyhe throne of -onway.; Dear Remalne of Famous Admiral. for hits ITjeor-oM son, Mil! *
, Th. admiralty, It can be stated, f II Out of '7000. The dhuoliitlon of the union between New fork. June *.-Th.. second), F. II May, who disappeared whil p
reconciled to the Internment, of th* Chicago, June 3.-:M, When, a wealthy Hweden and Norway bra beenpending mjuaclrort ol the North Atlantic flout, In Nashvlllw, on September 10. I9<11. '
. thre RUM Ian cruisers! st Manila but junk) dealer of St, IU, Mo., has for sonic time/ and had Its :I connlsiliig of (he armored. rrnla rllruoklyu At the time of bla dl" IW.r.nc.
,. oppose, on principle, tbe rule tbatwarship reported to the Chicago poilc tbe loss growth In the d,.,lr.. which grew' and| the protected rtuUor* young May war traveling for a Chicago '
injured In battle cannot repair Ot 17.000 by a "wire-tapping" aw1Shcet .' tronger ka time passed for the PII' ChatfiinooKrf, <}alvfou sod Tacoma, (concern and hi. account/ were
< their machinery and boilers a Cohen met five men ID St. Louis! Ubllihment of s"flRr.le' consular sys elected by the( navy department, tortcort found to tee correct In very d_tall. '" "
, neutral ports. The officials add tbatfriction I and they unfolded to him an elaborate for the two counlrlea. III* remain of John Paul Jonas" After spending about llo.Ouo |I" ? I
: over this minor question would I plan to ,beat the race which are i In King Oscar r-c.-ntly vetoed at from France, will meet (he vessels l searching for hU son without obtaining
the I Stockholm live from Cherbourg Thursday The 'be allgbt.*t c.w. the elder' May .
' b* exceedingly unfortunate Just at progress at the Latonla track. I7ecame mtasurc prseot to remain ,
time that President Roosevelt Is asan to Cbjcago with the men and I him by the council/ of state providing will be tran.f"rr.d to the Brook baa arrived' at tb* conclusion that tb-
< tiling tbe delicate role of trying to they. took him to a room la a building I for separate consular representative Ijn. near Admiral( C 1) tflgsbe' who youth was murdered iu a Naabvlll' 4
bring the boll'gerents! toc'>tbn. near B1xt*.a th street and Michigan : and tb* Norwegians malatalaed that was la command will board lila nAil: rambling hou.. and his body thrown
atenue. Tber. were Intricate electrical the king by so doing and partly by snip' off Tompkluiville' tola!. afternoon, Into the river wr dlspused of la aunts
No More Fatalities Reported. machinery ther and be thought his absence from Norway bad *u.- At the Brooklyn naryyard r rp.ai.ta{ civet way
Manila, June 8.-No deaths hare the schema was a good one. For p add bU! rights and duties a* king have ben. tully engaged on>> the flag( -5-u- -5
been reported among Russian officers tare. day h* remained there wits of Norway slip completing a platform which I. Larg River T.v bo4t vinka.I t
)u1nlll.||| Juuir |..After completing "

[.,tbe three cruiser commanded by Rear large sum of money, aggregating .. Sweden and Norway for separate consular meaning. the mahogany racing' thai' I la a Journey of 1.100 miles without 1.
Admiral Bnquiat, Among those who / $7.000. and then one of tilt systems was the fact that 8...- to receive the 'leaden' roftln containing mishap the towboat \\'. W' ', -
fcad narrow escape from death I* flv* men disappeared. The-Ie..la no den Is protectionist and Norway !I' She body of the commander tit tb. O'SNII on. of tb. largest .In the r r:
Captain Nebolaln. commander of the trace to the whereabouts of the swindler for fre. tra4, and also bttar.e of lion How me Hlcbard.Oo river .r.'e.' struck aa wt/struetloa 1 '4
Aurora oa which vessel ESnquUt hoist *. Xorwa ja* more .st.n.tt.tsea trade I lb. arrival' at CherUmrc the IH tb. canal today nil ssnl at tk. .

eel his flag: after the Oleg- bad been sad otb.. 41..ranel... af oonnerrUllairests. . --- Hh--._rlHjkn______ _-- ,lit_. K__ ....n.' ,.'. t._.. fW...__ ._...uMhtM., ...._ foot<< Of Eighth atreel.. frantaln-- ._-.. 1'a.r.rolttoniiad --- y; i
dtwabl.d. Wbfl Captain Nebolstn was Delcas, Reason ".r Resigning.Ne that are lo parllelpal la tb. final ta the fanning tower a shell- exploded York. J"a.A dID. ta At the op..DlBg of the a.Mloa the tribute In Ktenrh wai( rf. Tm cia,. TJ boat which< Ja tb. property of
|ther. but did DOt tnjar him. Inter the Paris cor re pond*tit of Th* Times. goveranieBt informed In. tUkrlblng after its arrival the remains will b* lb. Miwoagabela' lb IN.JU..d. Cast
k* left the bridge of the Aurora In the chief cu-, for Foreign MinisterDelca that It! r.UD4Ula".d office from today, tk.o lo ADU pQl1.. .nit Coat corapanr<, !. worth '100.'".' ',
barge of tb. first officer and went toe **.*'. realgwatioa was Doe U.1ft Ta. storthing thereupon vaaaimouJly and ass "h"ala.( from Now Orleans'

main deck la order to ,s,pvrvi.. state of Moroccan affair, but his re- Md without d.bet.e pa.M4 tile follow- seye Cremated on ....h. with a bff 1 tow of empty r mt barge.
.e work of subduing the flames, thUIng taut to lateraattoaeJIr* 'th* Asydalalaa u lag. resolution: Su Allan We : N . It .U believed.. tb. CX.Velll ran bral4. .
f'Ity. Jt Jose g .Twoboys
rots on fire aDd of caring rM.CM1ad..s nil..,.. Moth la rraae andEngland -Wnerea all the meo t>*rs of lb.council bares met death Navigation Ibrongti tb. canal r
by
and killed. Oa hi* way : the rorrespondVat alleges, of stain bar laW dowsi theft tb.. beach a..,.. They rrwatton on will not be Interfered .'IU .
were
th* main' deck another shell ... atroog Oaaneial Jaa...". were offices. sad"WArre.a OtjatoDRyan
and William J.ffr1.., both hII
Jed. aear Capala Nebolsta and brought to bear to reader 14. Delca its IIUI>.(r, the khi) *. has ILU ei'y, ad T and I Mlllr Mt at Kansas City. ;r
fragment *lt him! tkree la tb.eo. .j *..'. scheme I. respect to tk. talk /el.red btme4f uabJ. to .atao.1.k I. h.". n. boys bad years ta. tesptt" ,Kan MI* City, j... *.-.MUUrwny & Iu"
.. In the HK&t ie sad oa* la way abortive, Ir I. row exp*eted, a s.w guveraa.nt for |b. eouatry, .sp on ta* tI4.btaltb goo bre.bb pat of the Ualt.d. mates were
bs
right aak>. Tile captain was tk*_41patrh a44, that lie aegoti sad aced to band w.r.o la atta4.new today at Ib. owning
used for a few momenta. H*. how. Uaaa wkteh kave bees pr **4iBg -"her. the coum.tklcaJ regal. a Jetty thay tn., a ** .)loai of the third aaktiat mare 3
_.... ,______.. .. hole' b.re.th the pile sad r1.aa t.-
It..r '
recovered and proceeded with Uoa of &I.. )1m., .
,. 411k h./ Roan. aidtondos on th* subJett -- --- ----- '-v..'..*;"., Ifi9 It I. beU't/d National federaIHM.
,k after the wound <. lie then of Aa>r*..UU, .. ::11 Sew bare s lorthlag auibortae the .*a..b.eelt. mateb... tor lie beasts. that' they had. On. of the Inaportaat. jw iloii.*
to the bridge afld ocmtlaUo diffrreat ..*u#+ than wsa at Scat *.. the I'CNNiJ of ita&#. .110 retired to- II'.. sad t..r. ... buys was. soon. ew that will Mme up b/or the convnIJon '
toufd
command the Aurora wttbooivla secede _. day to exercise vatftMnhr avoilr* out tb.y wara trawl, Q..Ube,. its work U the better
tr.aated,
- -
surgical aid He nevernp a* th* Nrwgiaa Tbeltrharr.d pro ted Ion In blU of
any gnverairest' the lading forfeit
Tee-M..t.d aO oooef wreaked kted/.. .... "
rarclr
th* eom ad Of the eewly poser appertalaiag t. tk* king la .*..i. rroealMble .,.. ,
..nod of the flgbt. or white New Tort, J ROs* inn* andpeerbfy eotdssc, with 4oraars -- -- -
..tlt.JoIt. .
,.,.. .. Cw. .
Tey D alh.ThICegw
.... u **:).v 4 to hate sad rtUttag Iowa Ji. Arr. .d *
way IwC1awl }stew -tth tk *. ***,? tt f* atlU... LI"...,:
.. iko praise tM captala lute< ,. | bawleel at Sa4y Hook today whip *Mi ar.c.tII41&r< Vy" ice lad I ICart.", C*.. Jm.. f,, -/ufg. Jtbwr ( Jun* '.--'A cbemkat! anaJyat -
bta courage and ea4vraa ,. aa .ml4.t S4 anaate4 aetuo.*r that the aaioaH. ...... esdev Lad. his cUe est. stte.tr4 ".......' .f toy beads obtained a. a inttVjr "
-. *4n cfc oa Rosa.r flhesi aa4 was .a* klg ia 41a 4ve4 tm weasatlas a t-yar i44 girt ..*n.4 )l.arttlaOrlpp.
c I P '
ewaM4I lIa/Nt.r I, .
S4**> Brttts Vessel ,i: Tae *ca<3 ar u &...pe to lav. .*.. "ee wegl.a biagglcbsl M'C aa a I. If Ifu /CI.. sad '..ereyar,4. *.0.g. art.,nlo to ea..*. death J''
Jan 7.>+* 9- tD. -Th IWtUoraiaa I. t fcr.a., wtieh assay earrle* a ) ... tfc* retrlta t j.1 up.ss fsn4t. e. air.bua4. Tm. calM 41.4, aftkavtn* put the
are eight
(
p.Mr 1e
hartr4 hyli big clew Only ea wag MW. U"1'C4 befall srcvaetlone ea4* I* bar asootb: r.' 'ouer hole
flat asltb. of
: f14. 4wepJ0.rM tate saM"Ibeas
ftwutftat .tkpaaseh1p seer "wrsV tfteif th* 'kq>aaaagr'.ttslkth tbi. boenesbi aad'lh.lf b-zaK eN laa MI. la. sae of U y ..a4* *.*
sad .cctll...... .ill lied et U,4oM. TN j'"I..tal
boea4. *tDghaly beoi .... p4eptesf, Jlgtt. to !tAUJ,.. N .ral." II is
1PIIt. fta
; ..... ..apf. + Eal.k' .
wet 'WtdI. Afrrt'l1Ng ,
'Fi rs; (. '- J.
Jtjak'y'K1.a'bt4
'r 1 ; ,
J.atR J ._.. U..r ep tto tlatms4 that. .lbs beads ar. aad/
....,".Na '. .ir1: \. I.T-, ).. ?H_. : r ..... "" a la'k'' k
', .
bT" .f5 f& 9-\. \" \. ,,.' ;'''''''.'''''C'' ,." ;v. ., ., .
# f 4 \.1J G 'I". '' "
% t : "....,: {, I4'-t': >'# ':.t....' L '!"''' 1'''



""
.. '
; '

FLORIDA. JUNE- 9). 1905
GAINESVILLE
2 THE DAILY SUN: rn4

.

i BOND ORDINANCE BUILT UP HER HEALTHSPEEDY I EASTER CUSTOMS. I. DR MO.PFETT'S Cures Diarrhoea Cholera Dysentery Infan, ar.cl ,"",

... Bowel Troublu
'.. Cmrtomm O+..rvmnrr. of the P..t A of Chilebetw! ,
J Pre..t. Eagla... Any Age. AidDisateai,
PASSED COUNCIL CURE OF. MISS#" GOODE Borne of the old Easter customs In ttesuLtIa the BowtlS'Slrtn

,f ,....t ,_, -' ..' England are curiously barbaric and the Child sad MAID I'I'ens
'' 1."TEBTHINQ
mae X* Mad Wall by 'L7dla E. Pin* << EETHIHG FOWHI EABr,

.Almost Unanimous., Was That faam'a Write Gratefully Vegetable to Compound.Mrs. Flnkham.and observance, Costs Only 25c at Druggists, or maD 25c to.C.J.'MOFFEH; M. D., Sf Louis; ,
;. I rounded with more or less superstition longer, but tare thehealth
? I Hesitate no and life
tl : fliic Mother
Eody Its Passage. For the woode'rli'belp that shehaa. just enough to lend to It the charm of : your child, as thousands have done, by giving these powder 01.

: found Miss Cora.Ooocl, ass: : E. Chicago mystery. I TEETHINA Is easily given and quickly counteracts and oerOomes "
FOR ,EDUCATIONAL. PURPOSES Avenue, Chicago 111., believes it her I I Twentieth century maidens don the effects of the summe, :upon teeth/ngchildre4

,P, duty to write the following letter for bright yellow garter secure lnthelr, .. . .
publication.In'order that other women I.. belief that they will be engaged before - - < -
Qualified /oters'of the City Will Deter. ----- -
afflicted in the earn way may be I the tf'ftl' end*. Others give their tresses -- -- ----- -
'nutria; ; Whether: or Not Bond Shall be II I,I ". hundred strokes three times" with

Issued for S&O.OOO-Eleetlon to beHeld I the brush while thinking Intently of
\ . their heart's desire.! And who floes not FaySholesTypewriter
July 18th.,
their new
I take good care to wear d
? At an adjourned meeting of the City things on Easter day
Council held Th'uriday night an ordl'pance I Among the earliest of Easter customs -
the title of which are the following:
wai presented,
_, 'waii ; &aA11 At Queen's college. Oxford, a herring _
:
placed by the rook to simulate a man
"An ordinance to provide for the
! salad and
on horseback Is lid on a corn
; calling of an electionto determine ACKNOWLEDGED
+ brought to the table. This Is supposedto
whether or not bond shall be Issued represent a red herring riding awayon THE BEST

,y by the city of Gainesville for educational horseback and Is the last vestige of MACHINE ON THE MAItkLT
" purpose, and to provide for the the once popular pageants of rejoicingfor
(' issuance of said bends," the end of the Lenten fast. Has Tabu .T-

This ordinance was framed In accordance It was erstwhile a habit In English UnlVfltSAl ""nOOARO I
with a law patted at the recent i Cora 'Goode town for the boys after the Easter Every Mach >\*
x service to run Into the street and
teuton of the Legislature empowering
: benefited aa he was. Miss Goode Ii. snatch the buckles from the shoes of
; the city to Issue bonds for president of the Bryn Mawr Lawn the girls whom tbey were able to catch. Lightest Shift t Lightest Runriingl! The
i r educatlonal:purpotef, with which our Tennis Club of Chicago. She writes : Easter Monday, however It.was turn
,.., Champion Speed Writers of the World
readen are familiar. Dear Y Pinkham"I about and the women chased the men.
tt The ordlnanee was placed on tit' build tried np uy many system different, which remedial bad! become to try run to If the men refuse! to pay a sixpenceor Use the Fay-Sholes. More Fay-Sbole in

first, second and third reading and able from Duo of proper rent andbseemed help happened to wear boots the women ue in Gainesville than any other machine.
pasted the only dltientlng tote haun. to me.. tried to snatch their bats, and to recover
Mother is a great advocate of Lydia K.l'1nk.ham'
agalntt cam being President Nrnome.r Vegetable Compound for female trouble a hat cost a sixpence.In .

ti The ordinance directs the mayor to *, having used It,herself some yean ago some old towns great cakes were For Sale by. . _
Bo I to take It.
with great suoceat. began brought to church and there divided
+ wc k call an election on July 18 for the purpose and in lea than a month I was able to be out;
of 'submitting the question to the of bed and out of door, and In three month among the young people.A THE SUN Gainesville Fla.
Y I I was entirely well Really I nave never fell singular Easter custom was that ,
$ qualified voter ao strong and well as I have since." of "lifting and weaving. A man alt-
,After a few minor transactions, the I I No other medicine has such a record ting,contentedly In bh home wan-sur -....
council adjourned. of curea of female troubles as has LydiaE. prised by the servants and women of
Pini ham's Vegetable Compound. Ills household, who entered bearing a

.' THE. NEWS FROM BRONSON. I Women or irregular who are menstruation troubled with back-painful great armchair lined with white aDd G. S. MERCHANT & CO.
decorated with ribbons and favors.
flatulence leucorrhoea
ache, bloating (or ), -
Auction of MuUa-Th* Delinquent Tax falling, Inflammation or ulcerar The man was forced to alt In the chair Retailers and Jobber IDStaple

Sal*-Approaching Marriages.Emnson'June . Lion of the uterus, ovarian troubles, and be lifted by the women to each of
aintne_ indigestion,nervous prostration whom he must give a sixpence. On a
A.-The public auction or the blues, should take Immediate day In Easter week, either Monday or and Fancy Groceries
of elity-three: head of mules and action to ward off the serious consequences Tuesday, the man lifted the women ,
and be restored to perfect
t three honeby; Oco. W. Owen of 8avannab and EX with similar attendant ceremonies.
health strength by taking Lydia
receiver for the Wylly.Qab- Pinkham'a Vegetable Compound. Edward f. was lifted in bla bed by Brain, garden Seed and Fertilizers.SOUTH .
bets Company, brought the largeitcrowd Mra. Plnkham Invites all sick women his ladles and maids of honor, and a
a that hat assembled In Broncon to write her for advice.. Hhe haa guided record shows the payment made by I BIDE SQUARE. t t I GAINESVILLE. FLOKJU
thousands to health. Her experience him to have been some $2OOO In six I
for year In the. lot were male of ia very great, and she gives the benefitof pences.In Highest market price paid for Chicken. Eggs and other Pnxlnce

,, all dies. kind and colon, aDd they it to all who stand In need of wiN older days In England monks atEaster *

;$fy went at prlctt to suit the pocketbook ounaeL Address, Lynn Maaa. acted plays In churches, the favorite -! A Complete took ot Hay, Corn Oats, Flour Bran, Meal Cotton Seed MM)
of the wealthy turpentine manufacturer subject! being the resurrection. and B'.. W. handle! only the VERY BEST good at the LOW

It wall at the poor farmer. SUNDAY SCHOOL PICNIC.Mt. Not only were these plays enacted In EST PRICES and guarantee aatlafaotion alwayi.msTA .

s Th* highest price paid was $108, I the church oa these festival days, but

while th* lowest bid war $3. The latter . Morlah Colored Sunday School there was discing, particularly In the i RJL.TSBqgnp: ieeo.
i French cathedrals
pries was for a poor animal which : Will Go to Rocky Point.
Even the sun. It Is said, dances on
should ban been taken In charge by Mt. Morlah Baptist Chureh, colored Easter day. H.F.DUTTON&CO.DEALERS

corns society for the prevention of of which Rev II. M. Fleming Is pastor In Ireland great preparations were .

3 cruelty to animal and killed but It has arranged to give the members mad. for the last day of Lent. Holy ----
----
fall Into goodlhand and was led to a of the ohureh and Sabbath school a Saturday, about 0 o'clock a ben and apiece I

green pailur and will be treated by da,'. outing at Rocky Point today,and of bacon were put In the pot and I Sea Island:: CottOD.
the best veterinary surgeon In the a pleasant time I I. anticipated. at 12 there were eating and much merrymaking.

; country. Some of the other mulct The pary will leave'via the Galnevllle *. At 4 all rose to see the sundance

tore vldne of bad treatment, probe and Oulf railroad at 11:80 a. m., In honor of the resurrection.CASTOR! Sea Island Cotton Seed Bagging and Twine. Walrus

ably from cruel drivers at the log arriving at Rooky Point; at lldS. Returning Leather in Strips or Sides.

camp leave Rocky Point at 4:40 p. .
It was |111 o'clock when Reaslver m., arriving her at & o'clock. The IAFor
s Owcntttarted the auction. It WM Intended fare will be 20 cents for adults and 18oenti Infjuita .and Children Manufacturers of the James Doig Improved English

to eel) th* whole lot at onetime for children. Sea Island Cotton Gin, and Supplie for Same.

but at.hl highest bid was only I Rev. Fleming extend to everybodyan Tbi Kiwi Yea Hart Always! Boghf GAINESVILLE USA

14,000.:It wee decided to tell) them sap. Invitation to come and bring well- Dears th* FLORIDA,
; an.I,. By tblt' :mraoa the entire lot Oiled baikets aDd enjoy the day. Good

? ,- brought $,182.80.. order la guaranteed.If .. 8tgnaturoflrrlcall

Not a great deal of Interest was ABSTRACT & REALTY COMPANY
manifested at the delinquent tax tal. the Baby la Cutting Teeth ... !. Amrloml.

,, yttrday.only a few being present to B. sure and one that old and well- The practice Irrigation la very an-
4 bid on the landt. The 43.000: acres of I tried remedy, Mra. Wins low's Booth dent water having been stored and [Xi.oorporatoed1E.
1'" the Wylly.Qa.bbett Company aa welli4" loa Syrup for children teething. It distributed In this way In Egypt aa
several early. aa :200U B. C. Persia India Cey E. VOYLE MGR.
aa thousand acre of the CedarKey I soothes the child softens the gums,
TowoJCompanv: which WM advertised I allays all pain' cores wind colic and I.I Isthe Ion China a* well aa Peru and Mexico. Abatraet of Title and foil Information furnished ngardina land ta tbs
diarrhoea. Twsn- also bad Irrigation works ages ago. 8OaD',. Our manager hM lived In this county thirty janTana
beet remedy
.
to .11.| was paid on, which I
ti .0.. cent a bottle. Even In Arizona remain of ancient Irrigation I* thoroughly conversant with land title.
mad. the lUt tmall. A considerable works can be found which

t, amours of the land wa marsh laod of suggest that that section of the desert
NEW TERSELY TOLD. E. E.
but little value. may hay been compelled by men toblossom 7OYTr,

Oa of the mol popular young men aa the roaV many hundred PiRE ACCIDENT BURGLARY AND INDEMNITY'
The president today appointed INSUJ ..xOE" aep'
In Levy county I II to wed on* of Ala- James W. Taylor postmaster at Lafolette. off year ago seating a number 01 prominent American and En lida 8Ompaal.
char couo','* belle and ODe of Ala REAL ESTATE AND CITY LOA.li8.
.
Taan.General ..... '
Mar n...* ... GM3.inet
i oboe OODO', most popular young men J. M. Palmer of this city Little Ethel laying ddWn a book- _.. vllle's: : .B"1.orl..da. .
---
bey,, la to wed one of Levy count* belle. and Andrew Carnegie have donated Do prince always dress la -trtlk and -
Th. event will be Ee ,""l1..b.ec1 188g..IDZTTTO1T&
on Wednesday, respectively $100.000 sad $50.0*> aa a velvet and wear a cap with a whit
JaDe 14th, when Mr. 11. n, Rembert of nucleus to the $800.000 endowment feather and ride a sweet little whit

Lennon will marry Mill Alma McCook fund the Colorado college la ralatog. pony? lOCher-Not now my pet. CO.
of Oalnvllle, and on the *am. day They dress just like other boy*. Little
The students ef the Philippine Law
Mr. A. L King of Waldo will marryMlaa voted Ethel (sadlyTho I doat think 111
school Narlta have coagratulatlena .
Iennj White of Cedar Key. Mr. to the Japanese because of ever marry. -
&
Ys Rmbrt la oa* of the mot successful their Victoria, aaaerttag that they estavltsaed :SA :EEi1jEsDs
Tan eft Babi**. .
+ bntlneea men of the
j yoaag county ta* prestige of the Oriental
tl Mlaa IfeOook U a popular young lady *. Extreme hot weather t* a great tax

who hat a large *lrcl* of frlenda. Mr. upon the digestive power of bablee. a a.Nesi boles tasm....W.n....... ... Dvs RaaQ+salt..
Tb. Ualted States steam dredgeCauras. t1..asr. .... ... .......
a sea II. .r _......... .
''-'
should be wars
King U an fltalent employ of the 8. which went aabo. off the When ptiay and feeble they r......._,._....tart s ..W'ee JhMer. ..0.1.. V
A. I*., blaf now condactor on this dtvUlon boast of Long Island Saturday eight fI'.... a few dOMe of Whit** Cream ao.e.gs.. ......d tee 0.....ern....

4 of th* yttm. Miss Whit U ass .keen re oat4 and apparently Uaaduna Vermifnit atlmaUt.. th and. ehlMren'a raelUtat lbs ton to.dig' **Iswill .

Ski *oang* t daughter Col. and Mr*. ***:. She will be seat to the tloa of their food. eo that they snot G.A.IIT BVI1.: T.'R1;::. FLORXD
W. R. Whit of Cedar Key and hM a aavyyard fr laspecUoo.IX bHQme strongg. healthy and active.

larva amber of friend 0. M Ills .. today that aw bad Sold by \\ M.Johaaoa."doe .

M F. O. Bunker, Fred Oubbrly and J. leader** at.* rxtgBisjJasi aa director
....... THE EVERETT
-
B. Lattvrloh prominent citlseaa oft aC the BnataaAta USa Jbararaae toatoty. 'HOTEL
,. Cedar X.J....,.at tbelOoD', seat of taa reason, ft* said. was the op. by: doM aa>P aatd a ,

Lvy coant 00 bo In'*a ,....."'&J. ...ar.Bt tatosafaQUy .f hanwonloasMtioa ealeoer to his rectnvant. "If the messy 236 W. Bay St
war to ar*oa yes wa** yes are *tragttag "> JACKSONVILLE FIOIUDA.
Among the moat prominent eltlaens tu .... Wart ,* fir*< or* of the along Uke that they w...ldat. aida ,

of Moatbrook la Bronaoa yesterday 7. atagi ... *f,.... OMW rep:-
'kv ..,. ax-8oator N. A. Bluish I. K. -,-- -.. Centrally 1 ...., tbereagkly repatre4.. reaavateL' S"IJ drtsi.lel.Ear.peaa .

Rawl and J. 8. Blitca. Maa.EC. .

J. B. Eppr ca, I. T. Fa..... J. )I. JdUair- Visor*.' Gives to

4 Willi,o.W.WIUi... A.J.Mlxaoa and hair all that soft, dark,rich 4omiotr: ,:M-A.SON':: Jro-pri..e"tnD

J. A, lIa.kla..il...efiaae of 1TIU so natural to early life. Checks

Itttoa. win la Icwa yatrday.Brral hair fair '
faUinf keeps the soft
;
taaahra antvad .*...rdajr to
'
and smooth, end preventsM ftpiit. Advertise
+ 'l)> ...**...1 at tatac *ra*ettaalaa. tbtt > in THE S
'
;''tM .tvllleb Mi". to4a1. ,
.' . .
: 4. :, 4 .: -I; ., ..' ",. \\It'!, -, ".'.'J. !" ,,:;. '. '
,0 \ ;\ ''' ;\ "";t. 'i ,...tf L, ," ,.. >
m" 1I.l It \; ; -f'.u flkfe&Af. ,1'' , '" \V. !tr1o".
; !iJ 'f1t, ,
: "...1P' \ 6i''''' &&&S&3&!i ;' .w, if.W. J! 't.t.! ttt J "' u.



-
--

-pr-I-

__ _ _
_



,
.
q
EXPERIENCE. SPECIAL RATE TO BUFFALO.Via .
The Food That Does
Good JaJBs3l walfflHafcsas4lEnslB i aaG ..POILKA.OOT.CA"S.JjOWIS 3,
Prominent Transportation Man In Seaboard Air Line Account Session

Contact With a Florida Rattler. of B. P., O. E. TIMETh PAINT N i
THE j
Taut about exciting experience and I The Seaboard Air Line Railway has ,

>irbredth escapes. ," remarked VT. J. been dewinnated Florida Klks .... -1rIa.---... '.
by the I.. ...::.....,..= .:.= r
... ... .,_.. ... ..... __ _
__ : _
|i.he clever traveling freight Arsoeiation as their otfidial route from _..._.....-.._-...._... ...____.w r.....'no...._
.....--.......-- .. -.. ....
got of the Southern Railway, to. a ThsOodXtrerOt ttaolstoa" '..Xterol/e.ee" ter Florida' I., the brand Lodge ....*!iu at.Butl .

p'of friend iu the Brown House Cwcha.CoMa. MUiMau. BrMcfcltU. La Ortp. ...lu. It is toe drslrw to w..rrate a Above all. USE GOOD PAINT! .
by" Tlioridsy.; fellows S.*. TkTMt.. Law-, Catarrh. Pi......... The oil") liinrvd, eMl'I Just pun hnscrJ iiirte .I.Ie'.ht ont gees nqu.
have Florida Elks' train leave
yoa C-pdeII sad all fulmonary Dlw. XU special to IN of !rood puni 'lor which there i. nu subs iii -and the sanf WfT <9 f" the, '
ver.had any" Dracxlsta,two loos. ten sad 'U n. Tampa at 8 p. m. July 8h.: and' Jacksonville pure. rth linseed oil il i to buy tS< oil and ,
I'ToU a. about it, Billy" urged- one at 9 a. m. July 9th. The train
TRIAL BOTTLE FREE BY MAILto lliI
U>. crowd who w.. antleipatiogaetblng to con.iet of dining baggage ear and
all MtwUnc nom.and a4c1....MOZOMUISION .
of an exciting: nature-and drawing room Pullman sleepers .
I was not disappointed. : CO. OS Piae Stn.tlMw Yet Buffalo without I pan1Cly. For Awry gallon .f Kvtluelk p.II' Swy .se ,.IIM uf JutM U ail,
through to chaugv.The Thi awkc* two (ilkxu ot-fwint. ready fur use '>ou then, *ao "Well It was this way," continued route of travel will U via Seaboard putting on your house M alivr-"\ht genuine oil is in it." and paiat H lICIt F
pain unlrw connini 5O\ *of realty oil. We will funhci the rimes
pure explain
tranaportatioo manwith FULKS AS A FARMER.
shadt Richmond se.
f a to pawing through of Kinloch Flint it you rill call and L we us.STERNBERGER. {
t which almost made his teeth chat- Savannah Columbia, Camden and

..: "Every time I think of this ex- Popular School Teacher Has Crops Raleigh ; R. F. A P. to Washington & PHILLIPS

ie'nee it makes my hair stand on Which Will Make Big Yield. and Pena. R. K. Washington to Buffalo. ,

Hike Shakespeare's 'fretful porcnB Prof. J. II. Faa. the erstwhile efficient Only seventy-five1 |>a*''engers are I / GA ESVTLLE.FLO ._ I s
...
propositicna." and popular" principal of the required to secure this special train

fhlle his companions listened Injtly. Gainesville Graded and High School service ..

Mr. Ayer who Is a great and who has been engaged in teaching Round-trlp rates to Buffalo and return .-.- .. --- .. ---.... -. ._. ..
urtsman. related his story. in Alachoa and other counties for several from Gainesville $34.05.- ; Retail, Liquor Dealers Meet. I Train Goes Over Embankment.-
?A few: days before the.elosing of the years, was a ..111'or0 Gainesville Passengers from Miami and Key
Chicago Jun.8.Tbe annual convention 1..vlI'hhufll. Va.. Juno 8.-Spreadlncof
Anting season last year I wu at Zol- Thursday.Prof. West will re-purchse at Jacksonville.
of the National IJquor iv al-
thf fHlU un the Norfolk and Wet
Springs. It was a quiet afternoon Fulks has been for the past Through Pullman sleepers for Buffalo *
association began horr today. Between
era : ern at Itottfonl City, under a double
a friend suggested that we go few days at Kanapaha where he has a will positively... Tamp at 8 wholesale
UOO
500 and
liquor
<<
bonded coal I liidpu i ruin caused the 1
jting. This was perfectly agrees- prolific farm. His crop Is diversified, p. m. July 8th -an4 Jacksonville 9 a. realers from all parts of the United death of it m-itro tuninn and the I.. ,

to me, and securing guns, we I but amung other products is a tract often m.. July 9th for the Elks and their States were r".l1t at the opening Jury of two white and two negro ,

teed out. acres of cantaloupes, from which friends. Secure your Pullman sleepIng rsulon. The object of the meeting tram..... Th two t-ngtnrs| and 17 loaded

'It was only a short distance from the first shipment was made Thursday ear space now. Is to promote uncial and business Interest ram went over M 40 I r..nt embaak*

I station when the dogs 'flushed' In morning. The yield it is anticipatedwill Tickets OP sale at rates named for *, nient and are a total wr.'i-k.

slump 'of palmetto bushes what weak be good, and the fruit is extra all trains July 8th, 9th and 10'h. but .. t

to be a covey, but upon approach- choice. In order to reach Buffalo for the openIng I Wisconsin City Flooded. -

the place my friend who was This progressive teacber-farmer left session ask for sleeping cr reservation Fond du lore, \V. curFond 1 a

ead. discovered the biggest rsttle- on the noon train for Center Hill, on the Florida Elks' Special. du IMC city and county have been

ate I eVer saw My friend took de- where he has another farm. He expects A day in Washington sightseeingand swept hy a flood rntstllnK' a loss o: l

rate aim and fired with ,the result to ship a great many watermelons visiting the government buildingshas 15o.OH Buildings: .err torn from .

there was a quiver and everything from his Center 11111 f.rm. the been arranged. their foundation, and| ulinltt-rod.' the 6

M still. I approached his snakeship first consignment going through today. Stop-overs of ten days, within final fr..ru"nb passing out Into the lake.A .

'd examination showed that the rep- Notwithstanding the long and severe limit on all extended tickets, hat been _.- -- -.

lie was the possessor of seventeen rat- drouth which has prevailed at both arranged on the return trip at Philadelphia Itfiltoinlr Pll.l .

.. I wanted those rattles as a soove- Kanapaha and Center Hill Prof. Fulks Baltimore and Wn.hintuu. 1111.-1"l ii ItottitnilOMM pit III tin inrtiintalu II I

and Imagine my surprise and states that the crop. are maturing A trip to New York can bit taken Inconveniently of nUll".",I. bark of Ksllit. In I

tight on stooping down to separate nicely, and he expects to harvest on side-trip rate of $4 : tlio llHM-sllan littaniU. It U about four .x
Jr. Snake and the rattles to have the abundant crops.A Philadelphia to New York and feet .In 11 iaun.-t 1" ". Tiapit U |'.M-nlUr

pole make a vicious strike'at my -- - -- good six da,.. n.turo.l from the fart tint \U NlK-Vt In lht H It- A'

Be. Its head came so close to DELIGHTFUL AFFAIR. The Florida delegation will Wit Ji ItMIIMrkHtltt. folVO. .'I.'c.t pct 4
my sonally conducted by James F. Taylor, |>cr 1)IIIC'C't'l ovr tlr mouth. 1140 not poet
eek that I could feel the and I
wind
Kitchen Shower Tendered in Honor of traveling passenger agent of the 8ea- gently down but nr ,,".\,1.,1,. ilrnwn
le only thing which saved me was my board Tamps Fia.
Miss Alma McCook. In and 1 U"IIIIIW'lIr with ntiirtlliiit'
er nell in springing backward My For sleeper reservation or other information ty. The air' fU"blulllnlCJ il><' pit 'rl1lI.II'1 I
lend declares I sprang a distance of One of the most delightful as well as write tl. 0?, Hoyltton Jr., distinctly felt lir IHoc>|,le .

Q feet-but that's easy when a fel.e.red.ou most successful functions of the season passenger agent, or A. O. MsoDonwll, tint ,..1<<('. Hlranif" mxintU nn lieanlnlHo. a. FM ?N
'.'. know. w.. the kitchen shower tendered by assistant general '|ias.<*nier agent berry; night the IntiaUtlant. of
Jaeksouville, Fla..
''It was discovered that the first shot Prof and Mrs. Tom F. McBeath East tin)'locality IlKflnclljr hear it in>U<> .nlm

fernck the snake In the head and only Main street N., complimentary to Miss A GOOD DONATION.Firm tier to the btowluit uf a tlo-p .i">iinmhlpwlilstl

Innned him, but another well directed Alma McCook, who will be married on **. The uolar I I. lienrtl for al>out
tat finished the morning of the 14th inst. to Mr. the inn-olid and l then) unlmldes, fur a
the Job-and I have the of New York Clothiers Send I
littles here; In evidence," suddenly ex. Ilaikell Green Retnbert of LeD nOD. Check to Aid Hospital.Mrs. I space! of about nuttier leu Hv tnlmitc> IIM"oIJnch.' and thrufor kerosene Engine:

|aimed the speaker as he producedem A large number of friends of the ft'IIUIl1" ,
J F McKlnstry uf the Wo Absolutely, the aafr>" and oust eco. ,
before anyone hid an opportu young lady assembled to do honor and man's Hospital All Association la in .44,..... In ....r.I... nOIu cal p".*. ..r now on il", market. AllIs
,Ity to doubt the veracity of the story the presents were as abundant as they receipt check for $10 from the The addres.'o In 1'frnlau UIMHI 1 I let- *.-IH to 11) bona power Write for>> ;

call him down. were nsefol, embracing almost every HermanKrats Company cloth. tern whl4-li" gi through tlw ItfJIIIUm at prices,

-- kitchen utensil Imaginable. iers. New York to be used as aid to Calcutta are often plaint au.l | u xllfitf. This engine I I. nut a "Jsek at sit.. '
CROP WILL BE SHORT. The evening; delightfully spent the Gainesville and Alachua county An luillaii paler nv-eullr traiialntrnl trail. ." with diianio or liattHrl' and ;51
by those who had the pleasant privllege > our M' followIf; the Almighty sundry trlniri>rs to keep you "imtilrd"
Truss Denby Shipped First Peaches of to be present. hospital movement. |.Ir...Hi14t thl. <>nveloMi I >. ImvliiK arMr but It IB a "Uraoker Jack" to do your
the Season Monday. i - --_.. .--- -- The check Isacoompauled by a nice' o.l at Use city of Calcutta, In theuelghlorln.kl work and nu mistake Hold niulor nil
letter, which Is appreciated by the guarantee or your money leek, Stm
KM
Owing I to the unfavorable weather i SOLID TRAIN OF MELONS. of t'nlootoUh. at I lti lf.
I I j.lloity s ,
good ladles of the association who minting IMIIIM of flraJucl..wl ami l Iliili-
naditioos. the peach crop in this sec
duly acknowledged receipt. dad rncrrtianta. tw offcrwl to suit readl
Twsnty Two Csrloads Passsd Through GEO. W. MOYERS
lion it is anticipated will fall far short ,
Gainesville Bound North Thursday -- --- I what first Gain slue .
at
was hoped for and International Cotton Congress.Manchester manners and Lelover of the heart Florida
atlclpated. The heaviest milon train of the season ...
liiRlund, June &. -ThInternational -Mrrau Mialkh liI.ut111.. way tilsII -
[ Truss Denby, who owns a 'weDt,. pad through Gainesville Thursday Oottou rongrras today 1 f.. t.e 10ul{. Written on the truth of LOW UA1.'E
era orchard a short distance 'from the morning over the Atlantic Coatt. discussed the question of speculation tbe bl<-iKnl KiimMn. ".turt'.". In the

Jty, made hi* first consignment of the Line from points south This train In cotton. Baron Curlonl of Italy protested year 12O of th Hegira of our. Prophet ---

aason Monday, consisting of fifty-Ore was loaded'<1 exclusively with watermelons against the practice of buying and dl'|>atj| .-
ites. The fruit was small but nicelavored and comprised twenty-two cotton for delivery at distant dates, 1'I
and will probably bring ysolidoars.. alleging that It cave gamblers an opportunity Confedsrate .ans' Reunion. Louis* Railroad I.

rites.rMr. While the shipments were picked up I j I to bring disaster to the II villa, Ky June 14th to fifth'lOOb.

Denby states that at the begintng as far south as Webster, the majority trade. Continental nation, be point I The Alantlc Cuet Line will ..II from The following low cu.nlj.trlp! nt.

|. of the season his trees were alst of the train was made up In the Oisla ed out conducted their' business without all coupon stations June 12lh.: I8ih, from Jacksonville tu various points

breaking under the heavy burdens section. The melons were consigned recourse to this practice. Other ]JHlh i ani lath tickets to Louisville at North and West will be in effect ou

yield, and anticipating a larger principally to Eastern markets and inasmuch nelegatea agreed with the baron but I I rate of one cent per mile traveled l, dates shown. Proportionately low rales t' w

d, more fully matured fruit be relieved as the season has just begunon tae eoegreea was net unanimous oa plus 'w.nty.fie. rents, tickets limited from other points a(

the branches of a large qusnjjty watermelons, probabilities are that the atrbJecL I June 19th returning. Tickets can b.xt.nded I-OUIHVILLK.rCY. -list. 'Ie l 40.sc.

The drouth however seriously this shipment will bring: fine prices.Cures Woman Dies In Hospital.' until July 10th by deposit of T acted the growth and while hId e ticket with joint agent and payment of Iteunloii Jun. 13.1.1: Inclusive, with H-
Old Sores. Uaoon. Us- June '.-Mrs. IMIloaOcletree. cal limit' July 10.l'OItTI.ANDORKOOFtIat.o.
have under favorable conditions fifty cents at time uf depovit. Forfull
the woman whoa
nested about 2.00O orates, h. feels Westmoreland Kaos., May ft. 1902. twin babies Information write V. 0 ISnyls- /*).
were toed la the river a couple aecnunt 1.,1.0Ola," Centennial Fal,.
w that he will not get more 'h'D.o.ial Ballard Snow Liniment Co. Your ton. District Psscsnger Agent, Jack
of days ago. and who WM pooh after Tickets sold certain' dale. May :W to + 'c
3, to the warfed condition. Snow Liniment cared an old sore on ward carried t. the city hospital died sooyllle. Hie/ T. C. While, Division' Hpt. ,s. with" flail limit 9l udays.

- - the side of my chin that was supposedto and her body was carried to Adel. Passenger Agent, Tampa, Fls.j W. II. MAN rilAKOIKCn and UH ANOKLKH. :-

Teachsrs': Examination. be a cancer. Tb. sore was stubbornand Oa., tor Inttrtutat. tier husband. anda Leahy, Division ra*.enK.r Agent tta.y.n.ab. . VAL -llalt 'Ml 80. TUkets sold '

i The '.aeber.'ea.mlnaUoD which has would not yield to treatment on sister reside there umber of Oa. ; W J. Craig, Uoneral I certain dates ApIIID to August 14,In- +

tn In progress in this city since Tues lit I tried Snow Liniment which did her relatives are burled near there, at '..-ag.r Agent, Wilmington If, Of elusive final '.'urollanl& Dodsys from

|ay will be concluded today. All the work In short order. )r y sister, CedL Tlie report b.,. la that the . .. dat of sale, not to exeted Nov. SO.

pplieaata for second grade certificates Mr*. Sophia J. Carson. Alleasvllle. W6 Miffln Co., Pa., has a sore aDd .I.. to live together and she GOODHOUSEKEEPERS count International Kpworih I.... .. u
aished their examination Thursday, came to Mscoa. -
trasts that U is a cancer. Please send invention. Tie".'. auld June Vt lo
hUe the applicants for first gradeI her a BOa bottle Bold by W. M. Johnson July 9n. Inclusive t final return limit

Ill I conclude today.Of .... H.rLerw.U August 4. .

[ the twenty-nine applicants, Summer Tourist" Rales Via AtUntIc ..... IIUtTALO. N. Y-Ust |3a M, w-
teatyflve were contestants for see* Coast Line. IttrmlBjdism* Ala. June ..-Camp: soont Annual Meeting/ Grand todg
four for first grade ...riUIit Bedford ftorr+ st. I? c. V... of Wood. HhooW cult for II. I' O. 1:. TN"( .', sold July 8 to 10.
'! If you contemplate visiting summerreeorts laws "Anne' la Weo4lAwa M..t4tn' Inclusive final return limit July 36.TORONTO. .

-_. sew ticket agents Atlantic Coai, a kaadaofsje .,a.ll. abaft erected to IJALLAHD'SOBELISK OANAJ>A-It.r.. |M W.aeeouaifnlsmatlooal .
'.OUtANLY WOMAN. Line and get all information with reference tke memory' of u.. late Confederate Kpworth. League :
"' to rates rentes, erhedul. "a4 Uoaveotloa. Tl.keie said>> Jane 13 to
$? dead.
Tae Daughter of
Wood law aUrgely 7a. (.eludv.i float return limit
K iS 'V Pullman Mr**.. So aimer too r is t rs tee a........4 U raJeiag UM funds ust AugF
b a..vr.s Ill pctin.
!. effect toed the 76.w
an BOW principal resorts for
D..dr.rG throogboat lb. sentry with re- tae atonesoaL Tm address of NAHIWUJC, TKNM.-JUle lie 23.
two an erre.e.ee.lb. M.a tarn limit Ost .ber 1st. KaUM bar tae day wsa elo .*aUr delivered by seeoeal Psabp4v Coll*** H rcatp. wfclefc r*> ba aaaoatMt'd to all sprite, ettooe N O.v........." Tboaas }IIeC'.. M< tia ttal..e ta cnrta* ale and seashore rorts. for tb. 8rs, FLOUR Tic ket old ..,.a''. dai... Jon It t 0
our w..h bar .a to time roaad-trip tltkete are ow oa sal* July' 4. flaal limit' Hpt.mlMr Su.KNOXVlLf.K. ;
have d* 4ruff bar to resorts la 1(.. Eaflead territory. Acute Rh.yrwatlwrr, TRNM.-Kale tie M.aovoaat mV
aid fcy ran*** hair - Deep Uartoc or wreMktaa:pal.... oes - bumm.r Oehool of She H oU,.
tn the I>.das4rssQ w.*M to Ewa+ Stimulation" Without Irritation.la .. losied Irj Ifl''*. wf tfcKrac.worse" Your Iia4 will always be good] If lOCI T......., sold e rial0. dales June IS toJolf

tr prr+*rltom that .... of stomach aad liver trvebi* wbe a, test, or o* dint avoviax tee- ae OBELtMC.mm. 14,. 'Ineinsivei I IO. final r.taru limitBepienoer

bro. M.r3arlte. Iforpt.t tae proper treatment .U tostimelatetbee limbe,cad I. oobf or dtmtf w.atb4r,1.Is
lib d.a.r.W + naUtTO'. TKNN -l at. IIi I b J, aeoo >
gv.w as 1ee1/b g erca-M. without irrslaliag tasa.Orlao cared .....", by Hellerd'. 8oo r Ualneat ,- n I Annual M.*tl0O.rmaa Baptut

tfe.*rr tk* t.asv. r Laxative Prod Ujrap aids dlf..- gear Os..o.. .CribeonCrtfllL.sirilee. . ,.'ltr... T"-" .". Mid May :79tv> I'. 4
eST et. Kin sb. der.h tuna aM atlsB.lat.. ta-. liver ad bow Feb. 1..1Jt.12. ..A..t.... J CASU (co. IAII".c(,., deal return limit Jen. *).

a tterpte$4e.rd tee. In fatt 4.ra krMr s eU wltkvoat .IrrttaiU taese onraoe like was tro B44 with MtU. la my "'.11. For foil ..lIIfo'......... .........1.. and '
plum a *r4l.ary celaank_ It d... Jt scow got *o bah I said ass bead
*et4e Ca, D'' aM ......... ... grip ...4 la anllit a a4Wsa Ott?. Oas battle of B.Hard'a .... tat.. to any point K.North end West- tail 0 4
write OKI IIEKHINO.: :
>' to take. J. W. MeCollaes A U....., ... freak VegetabUe' daily Lad oa or Flnr-
2 earl oW b W. H. gooJs .
.
Ida Pa...Bir r Ag .l, L. A :C B. F{., 'rte
,
!lprtWor Agrafe CoaI'.f Joheew.
.. protnpUdelivered.. VJ9 Weal Osy $l? 1''fI oovlllf.NUdlT1NC1' Ins.
.
-

JII

I


_,l.-....tx"A. ut" ,. .. ., '" '-
.. .".'.-. 'I. ft.! ..'.1't', (. "' <<: "" ., ,' ,'".,- .... '.'"'' "-< ,.-,. ,, .r ...., . .." <<1.01,9. ,
r. loR .... '
,
.. ,' ,_ .
iIt,, : ,C''i '" -'.. 'I tr:'.. r' ,,.. T. .oj:,., I ."..,,".
I '
,
\)



I !.
..--c- :.--, .. .
r, DAfti ; \' .THE; BOCkMAN BILL, "'AND' '1TS A farmer who has been at Santa

'.BOARD OF CONTROL loss, Cal./for several( year*', has writ

h..., --, ;ci., ......'U' "" .' I tea to a gentleman In this city Inquiring -

Dame Rumor bas It ihat several about the< prices of farm undo

}F Dftered at the Post Otto at GaI.-nn... members of the recently' adjourned: In Florida, and also desiring to know A Healthy Liver Makes

p MI eeocd--lMS anall natter.M. Legislature of Florida who took an something in regard to crops aod the

active part In the passage of'the how price' they bring. There i i. plenty of A Well ManHERBIN,
H. McCREARY: Editor sod Publtaber.
noiorloo Bookman bill, If not already and suitable for farming: purposes for

___ _W.- W ASHLEY.--_..AsMXslate....---,-_Editor.__' slated for membership on the Board of ale here, but there is no one1' who

i JESSE E. BURTZ. City Editor.! Control provided for by Bald bill, are makes an effort to boom such lands, Aittle
.
at least active aspirants for inch posi Judicious advertising' might
I LOUIS J. BRUMBY. Oen'l TraveUos Agent.
tlons. This board together with the brine many people from the North and

','Y F. M. PREWITT.Snpt. ComponiB Room. State Board of Education hat the vitally Northwest Florida.

Important rod highly retponsible
4.( .OPFICH: roaTJUt. BLOCK. perform of ; the litet, 'J
duty to selecting PR.1
icy w Main Street. ., 8. Tat. pso a 43'tI The State of Mississippi has declined iWR; ;
for the two. ,institutions of learningprovided /: he offer of Andrew Carnegie of 25.000

THe DAILY BVK,published every morning txccpt for:by the bill, besides various for a library for the State University, ..... ..... ...
Monday,delivered by carrier In the city,or '
malted to any part of the United State,pontage other continuing* official duties.Ijode provided the State would appropriatea PURELY TOGKTAXLK 'COMPOUND the ?MOST PERt -

' I freeforyyeye.rj$2.y: six ,111001111; {i.ij threeSDOntb the interpretation of the like lam Governor V.rdaman soys ) LIVER MEDICUfX KMOWN. Do not fill your system.

*!or 30 cent* for five wek trictljrli ie &etm.; ''offlce" and "officer" by our supreme . hat the State U abundantly able to with Calomel. Arsenic or Quinine. BERBINE U''a B jniwj" '.

advance. I court -In the osse of State es.rel. support the University.with any equipment teed cure for all diseaaee produced by a TORPID LIVES.

l' ... Clyatt vs. Hockey, judge 801'Ia., it The and IMPURE BLOOD. It Will cure MALARIA without lea.
needed Carnegie dons-
f Steading notice.In local column 10 cents a/Una ing any of the deadly effects of many dru&a used for thou
for Ant inaertloit,and 5 cenU for each additional 477, this board of control is indisputably ions have 'ltrln to them that are purpose. One bottle purchased today mar: ave you frog

insertion. a civil office and the members sometimes rejected, and the State of a sick spell tomorrow. Quickly cures BIUcna....., Constipation '

Kate for display advertlalng. made known onapplication. thereofare, civil officers. M.ii! .ippi evidently desires to be free Dyspepsia, Malaria Chills, and all UvwCerovlaint
*. Used and recommended by the medical profession
Section of Article III of Con.
5 our to do as they see til In regard to libra generally.A >

The TwlceWe Bun 1.an elcb&-pallelort,. stitution provides a. follows : ries.
column paper publUhed every Monday sod "No senator or member of the IIousu PROMINENT PHYSICIAN'SENDORSEMENT

Thursday! and conUhi all'tlie news of the of Representatives shall, during the Th. Burled Bell.

week local State and general, end will pa time for which he was elected' be ap Near the little village of Raleigh In Dr. A. J. Hannah leading physician of Umatffla",

s mailed, poatagt free, to any part of the UoltMeutecor pointed' or elected to any civil office England, there la a hollow, said to bave Fla, says: "I have been using Herbine in my practice
Canada,for f t.o..year-ta advastiy.: under the Constitution of this State, been caused by an earthquake centuries and am well pleated with the results. I always'
that has been! created, or the emoluments -
y.f, whereof shall have been increased ago, which Is said to bave swallowed keep some on hand, and think it; a grand medicine
All advertiaing bill become due after firt
Biliousness and Liver Complaints.
whole the for
up a village. Including
time.
during such
,74 .ppe.nnc.of advertisement, nnleaa othcrwUe ,
n tlpulated in contract. Parties not known to u.win This provision of our organic law church. To this place the villagers of Large Bottle, SOc Avoid All Substitute

be required to pay for advertising ia ad. would seem to make It clear that no Raleigh were In the habit of repair-*
"'*occ. AddrcM, THE DAILY 8UN.04n.uVIu.a lug every Christmas morning, putting Ballard Snow Liniment Co.
member of this recent Legislature is
Psi. their ears to tbe ground and listening,
.$ ._,.. u_ __.. eligible for membership on such boardof as they asserted to the church bell St. Loula. 'V7 s. A.

'. The law prohibiting baseball and control ; and we have too much confidence ringing beneath them What was really -

In the devotion of our present heard was the bell of a neighboring
It stated does
fishing on Sunday, It not
Governor to his duty under the Constitution church, the sound being borne along
; go Into effect until July lit, 100J.
and laws to fear that he will violate I the surface of the ground. This cus- SOLD AND RECOMMENDED BY

either In the discharge of the' tom: was In existence, we believe, aa .
Russian leader General Llne- "W" :'JOHNSON Gain.es"V"i.1J..e_
: The. late as half a century ago-London ,
grave duty to appoint an absolutelyFair
'itch, It confident of victory In Man Tit-Bits.
and unbiased set of men on such
4 eburla. He possibly meant victory or I
death. board, regardless of the previously prepared Don't Coddle nnbfcer Plant. r-"''''''''''''''''''
p
slates that may be smashed Of all the freak remedies that are *

s Hon. Qeo. M. Nolan was nominatedfor 'thereby. ______________ sometimes proposed for nick' houseplants
mayor of Jacksonville In the second tbonei which a're recommended Ilf
You Insured
Are
1' TEDDY NOT WANTED. Tor rubber plant are the worst. They
primary Wednesday,* Nolan had ,
1 run all the way from applying beefsteak /
1,303 totes, Toomer 1,186. Nolan's majority According to a report from Washington and cantor oil to the root'" to cott- C

87. _,___ It is evident that PresidentRoosvelt *- log the lenvei with milk. Hive your In a Company that is Responsible, Have a Policy Correctly

will not be asked to assist In the plant a properly prepared soil and Written With Liberality of, Policy Contract and the Company r
Pentaeola hat elected Charles II.
'1. peace negotiations in the Far East. miftlclent light and keep the leaves free .0 Pays Losses Promptly s
} Bids of that city by a large majority .
mayor .
When Admiral Enqulst was notified from dust and scalp and you will find
the rote being the largest ever remain Manila' no nermiilty for such nostrum a*
that he could only at
: polled In that olty. The election has twenty-four hours it Is said that the the**. Make It a practice to go over the You Are AssuredThat \
.h been the "muddiest" In the history off I plants dally) with n soft cloth and remove
Bear howled< and declared that the
the olty. I any Indication of dust scale or
r' President of' the United States was not I Insects.-Country Life In America. no serious loss can overcome you without yon have some

He hat aroused the ire of r rure.
the ,
The Pennsylvania Railroad, not to man. i -.. -. -- -
all the Russian navy that Is afloat, with
be outdone by the Lake Shore hat pat

on a train between New York and Chicago the tab-marine yet to hear from. :
that makes the run In tliteen And for complying with the neutrality PIMPLES .Fire Life Accident and Health Insurance.. ,

It of bitter ,
hour*-three hours less than the law he the subject a attack .

1N Twentieth Century Limited. from the C..,'. official organ. -1 trod aU III... of bI r.s.dt.. wbt.b final None but Reliable Companies Represented. .c
But Russian attacks are not very dangerous M .s nreood. b.c a. Ia."..asthtyat
t.... .... a I et I.pl.. oil .: ..ck.Y.ad. .. .
and If our pugnacious President .. lV.-\' a.e.rsl.lkay ail I.f.. sr.o..I.Na. ;
The Pensaoola Dally Newt la lightly ..\. .: Qt tk.r a.d nqo maadl
In error regarding the Sunday amusements can help make terms of peace, ....tor.ra.la M /'rl..ds.". to tan 7 fail a afl.....wk.a... Ie t.rl.._..':.:E1 A. lvi. CUSHNIAN: : i
.,
law patted by the Legislature perhaps he can do something to createa L.l 0.Wi..... Ie sus .... ......_...J.I I )

ft.V.. 1&does not Include bathing on Sunday row. The fact I., Teddy would Justas Information cheerfully furnished. GAINESVILLE, FLORIDA '
fight to make -
soon a peace. bust For
V.I Cleanliness next to Godliness) sod a
law that would prevent bathing would TM OowelgcANOrsavrawrto /oaOOMi "O"O"O000 I'

ha of-. 'no-- -avail.Gaynor ,._.... FAVORS GAINESVILLE.

The following from The Levy Times- i PARTIAL PRICE LIST OP
a;
and Greene, who have been

making considerable trouble over be. Democrat the, published sentiment at of Branson Editor, Farmer expresses . s Whiskies Wines Beer and Milt.

Ing extradited from Canada, are now ,
i and the school board of Levy
in the hands of United States officers .
county. Brother Farmer la a gentle _.....al. ..... .. .
PI
and wilt have to stand trial for their W..sslYi. r4M il-: EXPRESS!' PREPAID. Balk
Geods-Jap Free-Not
.or 1N Ma.e
.
of excellent principles and his pH h. ( .6' : Prepaid.
7 swindling operations on the govern man aal: wdl S.i.na.yoss ::: :;CII.... 0 hD Q. Me....... I Q1II Q\a. 11 Q\a. 11.10 Per DaDoD:
It ard.d of much worth
moot work at Havannah.Chicago opinion 'r.<< t : ....!.* MM***? Ce.. Chla.t. a*H.Y. !99 Ruattag Club Rye ......... ea H 00 t T 00 B,..OlD.COI'D. wood grads.Nelar .
"1& it be hoped that the State Board I HIES County His...... 1 110 se T 10 lloo per OaUon:
of Educ.Uon.1II rite above sectionalism 1AL!ALE, TEl.uel Moooerem Rls ..........390 110 100 Rye.01 D'b.IIOPer Gallon. ytae .aU U.HADH'I .

It bound to keep up with the and will locate the University of "U" a'......... 9 7t I 00 1110 'ae.Oln. Corn. Rum. Be.far: the lDODe,.
I times, although located on Lake MichIf 8oo1..Dt'OJ1a..1O II ttG II u Pe.-- Per Gallon:
instead Florida Gainesville, the best, cleanest ........... "14" Itn and ADDL. Brandy. Mellow
an, of the ocean. A few day Malt\Vblak. 971 I 00 .110 eel ....
b7
and most centrally located school Peaeb 8r'aD4J.. .......... 9 75 8 00 9 10
.t they tidal that I FOLEY'SHONEYunTAR ".00 Per Dal1ott
ago got up a wave :
town in Florida. Reoo.alalnIO.lne.. APple BraDd. ........ 111 100 11110 Victoria Rye. Social Drops 117. Ked1cll1.
f eclipsed anything ever teen In freshwater .111.'. prior claims to this Institution Rolland Gla... ..... .. h. 1110 .1& .. q..ut
the wave rolling up about five Geneva Gin ......... .... 1 76 100 11110 LKP8T.LOUISBEER.: Per DoL

feet high and doing much damage aoprorer' the Levy County School Board and NonIII Carolina ConI. .. .. ..... 1M. 00 7 00 r---- Deer.. ... .. .......................II.._'_
Hoard of County Commissioners: ln Mountain ConI. 9 7. lOll 1110 U.PaJe . ... .... ...1 Oo
.
x along the water front.i ( ".maio.Ram.. ... .1110 .1& Tn BNndar ......... .. . ....... .. ..... I (n
session Monday, officially aigned a petition Medford Rum 9 ?6 .00 11110 ... ... ... ... .
--- -- : ... :.:,:: .. Milt. .U.4.r" ..... ... IfK >>
-- -- Drape llrundy. I" 100 .110 .. .
.
In behalf of Gainesville. Letthe Coburter.lmported .. ........ I op
i The recent wind aod rain storm Ant of Ke't'y. Bourbon l'ta .00 1110 Baaa Ab plana. .. ....... ......... *
college be located at Gainesville"The The erlglnai I Aaortneas ADdwed oa AU Goods of Same Oallul_ 8\Oa&Dlnta. ...... If>
ti that have swept over portions of WIs Price. Prices bJ the bbl 011 ppDnoatbnw.

cousin and Michigan were the moet LAXATIVE cough ,....,. .

.T sever for many yeart. The damage remnants of the Russian navy lA2ilirST. HANNE BROS J1CKSOSY1LL&
be scattered the Chinasea Tfcet .nulne
In Western< Michigan will amount tot seem to over ; FLA.7aa. .
and other waters of the East, carrying and TAR u ta
rot.KTa UONCT
t (X),()()). At Lansing Michigan, on
Tuesday, ..8 Inches of rain fell. In on piratical warfare, on merchantmen a Te>Mw package. lUfnee saUUtate M. GaABAM. President II. E. TATLOB, Cashier

the eastern portion many building that arc caught on the high s>r.f..rd nly by Gee W lima. Vie -Pre ident Lea OBAHAM, A..,. Cashier
....
.
.....
s were blown down. Peiley ea OexMpeiny* Ohl.....

1 ----- The Oosla- Star It trying to convincethe For Sale by J. W. XrCell ssJfcMCMAROWOMUi.('.. THE FIRST NATIONAL BANK

The Industrial edition of The Penta
... .
people of Marion county that they --" --- -
oola Dally Newt, Issued Tuesday
eon
need a new Man house. Hope he will ..
r taint eight pagea, printed on high be successful. Cott Fw... ..to..-.....: OF: G.A.JN"IDavrJ'L: : : .
grade enamel book paper, well illuttrated la.kayar .........__...", ,t__. ..
... _. .
trvtsaetaa. N -"--
and contains many faci andy Y.,,..,,.. .. ...... MNa... .. THE ONLY NATIONAL BANK IN ALAGEtUA XT '
CITY ... ... .
Burs or OHIO or hi. --
; Bguree: regarding the progress of that LVCAS CoVnT.Frlak TOL.DO'I.. .... ..., ....t '

hustling commercial center .\. a J. Cheney make oath that he 5.a. .*.sex....tu.pt.1s B...Oes......bb... Capital. - - . S . . S . . . $VO,000 00 .

1 shipping point Pentaoole Is one of tb". I I. ..nior partner of the firm of .. J. vr .,.wU.-.aiL Kefea .. las Surplus and Undivided

leader of the South. CheLe7A Co., doing business in the ClunUt aa.- ....... Profits. . 30,000 00 'ri

Dote a.......lrauj >: a eaakl.g b.was wtUI .... '
elty of Toledo eooaty and State aforesaid .... rMIII. ..&1 se say Mat Y she alas Boost .
w r--.
.wiYle
The North American of Philadelphia and that said firm will the Merebsss.Oorpor.doy ate. Ll.eesl allow..
pay b ass al anawa AU kilos. ,"-", ..-.. "t"
dfervea credit for moch of victory ...mof ONE HUNDRED DOLLARS R.X.TAYLOR.Cashier. \

,....'1, scored ajalnet the "rio," lu 11,}* .ub and every ease ol _,.,,.ts that 'I PATENTSGASNOW . n __ ---- l
( that city whose eoone iloa with the r.i" ut b* cored hy the nee ..f H_tl'. :;v.'!

gas steal proved one of the most aentatloaal l'.a.urbOure. FRANK J. CUKXKY

events ia the history of the Quaker Sworn to before me ... sooeeribed Deus$-oa._ Dt: N ..== L1FE n B. F. JORDAN ,
In this tia ol D- N
day
=
my preeeae - .. = ...... --
0",. The North American followed e" .. er. A. D. 1SS6. ..." -" -. 1N A14COYwvwtta.A.d.r. ACCIDKMT IH ,. ,
f't, the expoeor of the plant of the (yaw). A. W. O LEA SON, sail wow Pols-_ star, .
Pmwo.11aU's .04"'" a....,..,...
JfOVAXT
ooapany aeeklog the oily lease withpledges ..... .i..t.. .e 4 pscs txlatw THE OLDEST H.t
Internally
Catarrh Oar (. taken : '
of 15.000.000 toward a ajadl- -.w .ama tr rMs
and, sate dfreeUy oa tae blood --C..-. s. urrl ear....-. 1KD BEST COB INSURANCE : :
oats to atop the steal and helped In the and ntncoas surfae Of the system wasf.t G. "

I4 light until Major Weaver woa. The Send for Mwtlmoalale' fre.. I Puma ,
r F. J. CHENEY CO.. Toledo O.
of the North Anerlean hat
exposure
had a tendency to boom lu ubeorip- Sold Take by Hall's all d Family raggUte.rUle Tie for eonstlpation. GAINESVILLE""

i thus ia that ell,. .... POSTER Buoot

'- ...... ,....-... ... ..>.
--
.. 6



_ -A -

1
n



.
,
."" ... : ,
"
,...: i
DAILY SUN: -O*

I q.' i''1 I: .: i 4 II"i ,"!L A

I ;: H. WATERS, WILLS OF LUNATICS.

The q..*r __..... Tkat .,r. Mad.
PRACTICAL by I._.e P.r..... .uuej V. Reunioti

One of the manias which are! evidence : ,
HANGER by the Insane IC a desire to i ,
make a will. Of course' tilt_ documents -
are waste paper ns far as their LOUISVILLE KY.
House Paintingand legality Is concerned but the attendants ,

Decorating. and doctors treat thew lucunienta VERY LOW RATES VIA
with the greatest l'upt't..tu\ order to
House Corn' Galn"I\'IlIf', Fla. humor the demented (,N"ltUI"t'S.&lme '.
of those wilts would' be amusing SOUTHERN RY.$17.SO ,}># :
It It were not for the sad' condition ,
line of Paint and \"Ml Paper of mind of which they are the! outcome. I I
at lowest price to the trade. I tl.Vl>KSVILI.E: TO LOUISVILLE t
One man confined In an asylum left all I $17.80 I
I -1\11.1 l Ketnrn
his to the mikado of Japun
- ----- money on A
Daytona will be held June :22. t'OutlltJon'I. this dignitary\ : ; should via : Proportionate low rates from other points. Tickets will tlO> sold \
train will be run and a It the grave of the testator once each June 10. U, 13.: 13, with tltml limit JII..to9.. Can he extended until July "
be arranged to bt curried pro year and plant chry.a tht'llHn.11)On JO, IOCS, by 0 jpo! .i.uig ticket at Louisville and paying recur fiOcent*. 1;
It. The nMualnder of the estate 1 was to !
)., .. handed over to an Iran Binary charity The Official I I Route.sonville triendswilllesveJ"and-

htt of Pythias at Palatka ;, called the Brotherly. Love and Bountysoclcty. in IMCAI! through: I'll 11m..... coping Car and Diy Coaoh. l
for a grand time Ht th..ir 745 p, m., June> I'Jt, era Atlanta, ChaitanouKa and Lexington } arrive
celebration on Juno :221.: Another lunatic in a 1'nrUinu asylumleft LouUvlllrt 810p m.. J'nie IS. For artiouUr. reservations, eta., apply -
will be made music fur a will de,"Ulng the uliole! ) of his estate Passenger Offlce, U$ Vest Hay Street J C l.USK, t>. P. A., Jacksonville
: to the poHnetuiora or !Itotnntt< noses !, Fla.
a social hop Itivt'n. Re
re.ldlnjr In and near lnrU The rea ..t.. _-__.
will be served during\ the
eon for thin was that he li:id rather a
. ..
.
.
; and the occasion will t> one - - -- - ---
bandonie' nose of this .hili'| < and was
in the history of the order." constantly admiring It. similar bequest CLYDE: LINE:
-- -- ---- --- "
wan that of a patient who left his
Commits Suicide. roterty to en attendant doi-nune be
Co.. June 8.-F. D. Paulk. a MMmeitatxl' one of the tiKlleot nasal organs I
contractor of this place, the testator had ever soon
suicide here by taking lau One inan. who A\ns aftllcted with the
No' cause' can be ascribed to mania that he was sane but lJtllwd
It Is thought that he com- In the asylum unjustly devised\ n will
act In a moment of mental leaving 1 hla money to the .rorumlmilou-
Mr. Paulk was a mem' eni, of lunacy to enable them to nK
of the most prominent fam a large staff of men for the purpose of
: this county. visiting asylums and Hnccrtululug if
any w.nnnl"t \ In them without rea
( ( son.-New York Tlmee.
Deer Killed by Wolves. rra.r-'W"J: :: EBL S.A.JLJNGS:
Mich.. June 8.-Bark
<
IIKTWKKNJacksonville I
Tired ;
That Feeling.If
In the employ of the Tyoga : and New York, 91114

company which Is operating you are languld.dt'prf'd.lnoap- Calling at CIIAULKSTON, fl. O., both ways :
Deerton, 30 miles east of able for work It Indicates that your
that during the past two liver Is out of order turbine will a*- The Finest Steamship In the Coastwise Sertioe

have found the bones and sin nature to throw off headaches, '
of 84 deer. There Is no rheumatism and ailment akin to nervousness Clyd< New England and Southern Lines

that the animals were killed and restore the energies and Direct Service Between JACKSONVILLE, BOSTON and
during the past winter. vitality of round ani perfect health. PUOVIDENOE and All Eastern Points,
J. J Hubbard. Temple1'exas, writes Calling at Charleston both ways.
Bowen to B. Removed. "I have used llerbme for the past two SBJM..J-'W"mEXL: :: : Y S.A.TT.TISTQSSouthbound '
It than
years. has done me more good '
,
June 8. -The Dowen. all the doctors. It Is th. best medicine 1- . . .. . .From Lewis' Wharf Boston !
investigation la practically ever made for en II In and I..yer." Northbound.. ... . . . .. .... From Foot of Catherine ..., Jacksonville
Loomis Is to be exonerated of 60o. Hold by W M.. John.on.Deferred. .
,- .
aside perhaps from some Clyde St. Johns River Line
while Do wen will I
terminate his diplomatic ca. "What," asked the youth "was the Be>fvr.,e ri jA.OKUoNVii.uto and BANI"O"D

furnishing the press with happiest moment of your lifer Stopping at Palatka, Astnr, St. Francis Beresford (PeLand), and intermediate '
against Loomis Is the "The happiest moment of my life" Landings on B,. Johns Klver. ,
.' charge. answered" the sage of BaKerllle. "1s yet Steamer "Ol'l'Y.OF JACKSONVILLE"

I to When come. do yon expect It,.* queried the Is appointed to ..na. follows i Leave JACKSONVILLE Mondays. Tuesday
Agent Arrives. and Thursdays, 8 tSO p. m. Returning leave BANFOUU Uuadayi, ;
York June 8.-Enrique Cones Inquisitive youngster."When wedneidays and Fridays, 9 u80.. m. ,
-to ask fool
people cease goestlone"
minister of foreign relations Boutkbouad. Northbo' .a4
replied the philosophy dispenser.Chicago : ....acs ws M'IIJI'UI41 1U..s .
: and now confidential) :: News jj Leave 8:80 pm .. . . . . . .. . Jacksonville.. . . . . . .. .Arrive t0X am
< his government. the mis 8{ 6pm ........ . ... ...PalatkaBtOOam .. . . . ....... .. .I.eave StOQpnBifiOpm
is"E. Washington arrived here to Rag 11I_. ..AstortiBOam .... . .... .. . . .
will confer with President After all what's the ..! No matter .. .. Francis....... .. . . . 3tOOpmIrOOpm N
regarding the re-establish lose tn .. .... ... .. . Beresford DeLand) ......... ". . .
friendly relations between bow hard we may fight, we, ArrlvefliSOam..... .. HanfordIQiOOam. .,... . ........ ... . HtBOamIQiOOam
and the United States. the seemingly: end; BO' conquer.matter bow In the much end we we may are .. . .. .. Enterprise!: .'!...! ., . , .!.... _

wretchedly beaten; no matter how GENERAL PASS. AND TICKET OFFICE, 133 W. BAY JAOKBONVILLR

Dying of Famine much wo are In the pablte eye within W.O.rM, TPOKMONOKA,, JR.A-v U.a. P.... Aft.t W ert tier sr., ., n:*
ten...Jr rr.artt Areas O. P.WvELL.I uep.rrawadeeb
Its torments, like dying of eon two weeks after our death we are too .
The of dead to,bo talked about Tbere" A.,o'I..aQ".O' a.sei't..r.An..r:Y'ww oc. 'u.w.W.... e..rn..N..or..
I progress consump only one toe IB the world and that toBOW. 1'. UL Y I)1'. ()o.,
the beginning to the
very General General
Manager Agents
.Lawrence (Kan.) World. ;
I a long torture, both to victim cm! .Mbro e-k IhilUtBe.ll stew.......New YotkAir

"When I had .. _._ . . ...
consump ... .
D.. .. 0. ....... -- --- -- -
( first stage," writes Wm.My. Deed of roreign 'Trade Omce

rroe.. Md., "after try lag dif Whore would you prefer to go .. oar SE.A. J3 cDE D '.'
| .. and a good doctor In agent Toting Traveler-Well. If poealble -
last look Dr. King's New Dis. where tho native are regetarUae. .

which quickly and perfectly New To er. Line Railway.
.." Prompt relief and sore i:,
No Secret About It. coughs, cold., sore throat,
etc. Positively It Is no seers that for Opts. barns, .'
prevents . . ;Jb C/lC. . '" I
Guaranteed at all drag nlaer. fever sores,sore eyes, bolls,etc.,
Price 6Oo ar't tl a bottle.. Trial nothing U so effective at DaoU...'. Ar.
plea Ss1,.. "It didn't take long to
( Savannah Columbia Camden Southern
care bad sore I had and It ls all O. K. ,
r!. **...* !. .-..... "
for sore eyes writes D. I* Gregory ofIlop.
are not found In.;'oysters .,Tex. 35o at all drug el ores. Pines Raleigh Richmond washington
Sometimessaid a lapidary. > '
found In coroanuu. I once -- - ---

pearl. It wee the slae .of fUInsTI LLE'1t FATOItITEUEIWKT. Baltimore Philadelphia :
Its quality was good. It..
$ an oyster pearl, only It was a
/ <<. Cocoanut peerle are found New York
of the nut. It.. thought tS
7 are formed by the hardening ,

aura kind of flesh.crystallised They are tamer so or to Alachua Pool Parlors ,

pads are rare. They...
Threw Trains DatI "
a oyster poarla They are alee C. a....., rr.rkW. Elegant ) .
than oyster pearls hIDe Jeee
.**. Iran-parent"-PhJUdefc

\ Seaboard Florida Limited.: .

Til. m.tt. .t De....
tfclac that otrlkee the etraa. L+nat d IB the Porter Block, Booth Seaboard Express. : '

: ."... Swttsetlaad. sad .,... aid light.. Throe eatslawaller..
I ...... U tbe beUe. Met oa- Good ,sad proeape aad ooorteoo
aervtoe. The pobtle te oordially Invited SeaboardMail.
every b*'U bet when they are .H .
J__ __ ... .. 4' '_:"'-" _
for the waster aad wo hope for
rest then ceeaeo the infernal
diet from every ert 'am*. e, 1111 ERN PULLMAN EfUIPMENT 4
..aJbae and an oO.er kinds of .

wttlcfe! ply' for hirer efeerwtea. MISS n. mono The flZABOARp: FLORIDA LIMITED U a solid veetiboled trala, eons*
> they became a awreeetty eei posed ."'...'y: of sew tall.oa..q.lpmsl-Dining Oar, Double Prawingkooea "
bigtrware ee winter PftCJ>d BUepers.. "". .rooaI sad Obervatoa Care-operating between Hi. Aopstlae .
Get .... s>et render thsa gas and Jaekaoovllie So Mew Tort, via. Waeblagtoej' laving Bt. AogiMtlae. J
, palatable. NOTIONSAND IJiIO p. .. sad JaekeosivDIo,I rJO dally.s..ps .....s.,..

Cwt C.esu.nptlow.. ,.
Only Ijlne
Herrea. n..... Art..writeei Operating .

Hooey and Tar .U tho beet NOVELTIES.,, Dells Throat Pollmia. I'( d "- for eoogae, colds sad ....
,
t, ; tai il has .
I aaoer eared we> Snee..ser Is311&
j lei tae Ores ".....** Tea For fall larormttloei a.4 sleeper reeervatloa*sell oa aay_egeai Seaboard oe Os f
t..: t ...., of aojoao ..tag FeUy** write A. O. WAcDOaKLL,, H. O. *TON Ja. 4 s
10 Tar u4 at beta*satisfied. J. A. AiOIONS AM.. Oeaeral Paeoeag-t...... Paseeoger Agent* j1

x i _* Co. JACK40HVILLE. ,warDA.I ,

"J: -*-


t$1\

,... ,k ' .. ... ,.
"'i.I."<1\O. ) '::"'z -3. ",
t .. ", "
.
"jj.
!' '''' j : '.,,< ..,



.I . I. II V IYIIIL..WI. ., ll
.if
CABINET!: MEMBER IN ATLANTA. CURIOUS OATHS. :8VA32 7 3A OA1U '
I I I.
11:11R'i --

Secretary of Treasury1 '&$i.w' Visits pig 'War* .f .w .rl.* <. th. 1'- DcVERE B. MORRIS
Gate City,,of the outtr. SOSES WHERE AIL ELSE FAILS .10..'. SUtl M..t.. i JR. .

Atlanta June 8.-Colonel Robert J. ..Beat Couch Srrop Tut a Good, When a.. Chinaman: swear*' to tell the .DENTIST
.
tle la tiro Sold br truth be kneel! and : . .
Lowry. president of the Iwowry National dnmlfts. down a china I
saucer 1* given to him. The following' -
j bank U awaiting with much Interest iJ :
the arrival of 'hi* friend Secre e oath 1* then administered: "You shall I
tell the Office over Harass Eodel'a Pbcm 70-S rlnga.J .
truth and the whole truth. The
.. ;
tary of the Treasury Shaw. The colonel
tas advised that Secretary Shaw saucer .1* cracked, and If you do not Because .they are the best
tell the troth soul 1.will be
would arrive la Atlanta; Wednesraymorning Big' Find of Ptiosphat Rock. like the saucer your" when he break cracked the . A. CARLISLE, in the land for the money !

k about 10 o'clock. *on.llteJ. *re San Francisco, June 8.-A mlaerat'lacov.rT saucer. Other symbolic variations of ATTORNEY AT LAW
over the Southern railway Colonel ha been made In Baa the Chinese, oath are the extinguishing Ask you dealer for'the

1 Ix>wry said that he did not know how Diego county that may be worth mil- of a candle or cutting off of a cock's And Solicitor in Equity "Sunny Jim" Shoe and insist .

t long Secretary Shaw would be his lions. to California.. Phosphate rock bead-the light of the candle representing on getting.

guest but he hoped' that, the visit ha been picked up a* float near Bscondido -:|1: the witness'. soul and the fate .of Real ta&e, Conveyancing and General

'Would be a long one Colonel 'flI17 and .samples hare been for'warded 1 the cock: symbolizing the fate of a Practice. All business promptly
attended Office door Baa
: first met Secretary Shaw when In to the state mining bureau for perjurer. to. next to MAX KRAUSS
Office. QAiKxrrn.u FLORIDA. ,
,
} ,
1897 and.1898 ha became such a'prominent examination. The vane of phosphate)I I I In certain' parts of India tigers and .

1 figure' In the public eye. einse rock 1* tat It eontahw fertilizing ma-I:!)I lizards' akin take the place of theI RepresentingE.
'"tt that time the acquaintance has ripen terlal that. e&D. b* used for enriching I I I Bible of Christian countries and the JTERD1NAND BAYER.ATTORNEY .

ed, Into a mutual bond of. friendship.: the: oL If tbe rook 1* a* rich as Is penalty of breaking the oath la that AT LAW. A. WEIL &. CO. ::=
In one case the witness will become ,
F Not knowing the secretary' plan; supposed and the deposit 1* large the QAIBBSVILLE,. FLORID,
the of and In the
other
r Colonel Lowry was unable to make reanlt of this 1, prey a tiger WHOLESALE SH'OESor
: discovery nay be to add |I I that his body will be covered with
any arrangement for Sis entertain great ralue to the mineral
output of scales like a lizard. Can tell city (improved
your property.
ment In the of reception or' : All Deseriptleas.Sole .
way any this tte.
In Norwegian courts of law the pre- and ). phosphate,
thing of tbat sort lude to the oath proper -la a long tracking and farming lands. Send him

I 200 .. From. ... Colorado. homily on the sanctity of the oath and a list of what you offer for sale. 2H2n.
Fruit Grower In 8elon the terrible consequences of not keep-
% Boston June Wholesale desertions Agent MONARCH and SOTEB-
Adalrsvllle, Qa., 'JuneThe fruit !lag I It. When the witness Is duly BAKER.
made
are being from the cruiser W.E.
F grower of the north Mellon of the Colorado II I I crushed by the sense of his fearful responsibility ETON QUALITY Shoe. Every
In port here because of alleged -|
Hate met here about ,200 strong from harsh treatment on the part of 1 the oath Is administered ATTORNEY-AT-LAW, pair warranted...
the east and west of'the state north while be holds aloft his thumb and "
,
the officers of the skip. Six of the . SOLICITOR IN CHANCERY. . .
q' of Atlanta. Colonel I* A. Dean of I fore and middle fiugers as an emblemof J. Manasso. Agent
men slipped overboard from the cruiser -
.
Rome was elected chairman, and Mr. the trinity. ,
O. R. Casey secretary: The day 'want with llfe-preservers and swam 'I In an Italian court the witness with OAINESVILLE Alachoa Co., FL>.
ashore. Probably no ship la the bit right hand renting on an open Office 'in Endel Block. .
pent In discussion of and
way
I I
The Florida
United State navy ever anchored at! Bible declares, "I will swear: to tell the
means of aellidg'and shipping the
this port has bad so many desertions I truth the whole! truth and nothing but
crop. The .Idea of a central 'comml"'jtee and It Is estlmsted that the number the truth." Mohammedan: takes DR. J. U. ALDERMAN, Fruit and Truck GrowerL.

to sell the crop was on being put. has reached more than 200. the oath with bin forehead reverently
tbe chairman lost. Colonel M. I.
by; ,
resting on the open Koran lie takes J. BRUMBY, Editor and Prop'r,
: Johnson made a motion, which warn DENTIST.Over .
his Bible" in bill band and. stoopinglow
A Thousand Dollars' Worth of Good.
OCALA FLA
adopted, to APpoint'a committee of as If in the presence of a hlgberpOWf'r

wft five to see to the proper Icing of car "I have been afflicted with kidney slowly bows his head until It One Year. . . ..... ...... . ...1.00
at Icing stations and to Inspect the and bladder trouble for years, paining i touches the book which to him Is 10.I Duttoa Co' BaAL OalaeaTtTs:

fruit on arrival at six or seven of tho gravel or stones with excruciating I spired.In Slagle copies . . . . . . ... 10

principal market. pain," says A. H, Thurnes a well certain parts of Spain the witness

known coal operator of Buffalo, O. "I when taking an oath crosses the thumb Ds QORDON B. TISON.

Master PIVmbers In Session. not no relief from medicine until I began of one hand over the forefinger of the A handsomely illustrated magazine

Atlanta Jane'I'be first session taking Fole,'. Kidney Cure ; then other and kissing this symbolic, If DENTIST. devoted especially to the interest of

of the National Association of Master the result was surprising. A few dotes primitive, cross, lAY". "By this cross I the fruit and vegetable growers of
swear to toll the truth. Florida.A .
Plumbers were held at the Grand started the brickduitlike substance

i Opera lloune Tuesday, If the other' aDd now I have no pain across mj kid Offlee In Miller Law ZUcbanae.OAIBMVILLS. special trial subscription of six:
days of tbe convention go off with the nays! and I f*..I1ike l a new man. It has Huge Task. months will be sent on receipt of 23

same harmony and good spirit u the !I done me $1.000 worth of good" Fore,'. It was a huge task to undertake the FLA. eenti. Stamps taken. I

first day, the twenty-third convention Kidney Cure will cure-every form of cure of such a bad case> of kidney dii-

c will go on record a. tbe most harmonious kidney or bladder disease J. W. MeColl ease as that of C. F. Collier of Cherokee TilE WEST END

It,, In the history of the association u in A Co. la but Electric Bitters did it. mm COUNTYIIII,

Disagreement there was and w He writes : "My kidneys were so far FINE WINES. LIQUORS 4 CIGARS

*, plenty of It, In much business that A .....t.. nrl.... gone I could not sit on a chair withouta JOHN MENZIES Proprietor. Alachoa county is 806,400 acres in
K*. came up lot consideration but it was When the DenVer and Illo Grande cushion and suffered from dreadful area has 248 miles railroad 800
; Ill lit W. Bar n..JaekaonT&le, Fla
to build through the Ilocklesengineers miles road. M
prepared wagon poato1Ueea.J23 .
., of the kind that tends to help rather backache headache and depre..ion.la .
,
t said the canyon of the Arkansas public schools, 27 phosphate
than hinder the delegates In their de
could never' be penetrated its Electric Bitters, however I found a Faust beer bottle and draoght. Don't plant, 20 saw mills. t7 ,ocx> courthouse

: t liberations. entire length. There was one spot In cure, and by them wa restored to per- fail to call on me when in Jacksonville five newspapers, and produces

4 this awe Inspiring chasm where there' feat health 1 recommend this great - -- --- '--'--- ----------- corn, cotton rice, sager
Carnegle'a Money Not Wanted. oat., rye potatoes, pineapples or-
,
was not for roadbed either bole medicine to all with weak kidneys
room a on
Jackson Miss., June Governor IF YOU LOVE YOUR cages peaches, pears, plums pecans -,
James K. Vardaman made the statement stile of the stream. The wells of the liver: or stomach." Guaranteed and all !kinds of vegetables..
canyon carne down to the swift currentof bj all druggists ; price b0c.fll.a.ee..5 .
that the board of trustees of the the ArkaniiAS without foothold for a WIFE DON'T
r State university had turned down the Gainesville (the County Seal
man on either sl ; offer of Mr. Andrew Carnegie to give suggested n banging brltlno suspendedIx'tvroen That man was laughed at who oa
b + the trustees $2R,00 provided a like the walls of the canyon.; The his first voyage saM that the ocean ROAST HERBy Has fourteen churches, two public

amount wa put up by the state fort bridge was built with supports liubwlilml did not look so large as he supposed schools, the East Florida Seminary,
the purpose of building and equipping In the solid I rock and across It It would, but lie was not alone In experl < compelling her to bake the family private schools, three newspapers
United States land office, the best
I
bread the hot months.
a a library at tho late university. thus heavy tritnacontliiental l train. flit <*uclog dlnappolutinent. The horIzon during summer water fire alarm system, eleotria

Governor Vardaman stated to the Associated daily, with nothing but the slender ,,|i at sea gives no idea of the llmitlwH Bay your Bread from and gas lights, two ice factories,
1i 1'1'that he thought the Ironwork "between the river and the water beyond. A sea captain declare machine shops. three wood factories

F tats of Mlnsisaippi( was In puHltlon to top of the canyon. 2,000 feet above that the average landsman! cannot ..Keystone Bakery.. cotton gin, two moss faetorl.a.three ,
supply the university with any equipment (front Iron brace, which look almost see more than tea miles from the railroads, two fertilizer man
: that 1I".dtld.KIII.d ililer-llke In the vastness of the canyon ship In any direction and It would It's a laving of time work and money. ufacturing companies one flber
was
have teen thrown across the hive to be a mountain or some stationary Fresh Bread Delivered Daily manufactory, one rectifying turpentine

Companion With Bat. gorgr, ''being anchored securely In the object for him to be able to distinguish To all parts of the city. Also Cakes, stocked plant stores two embracing banks, and well'

ulitt-r side" *. Huge cables depend front it. The masts of a ship aresaid Pies and every other production of in the commercial line.everything
Amerlcu, la., June 8.-4>rdy Tar. tees, braces, holding a long Iron bridge.Mlilrh to be visible to the naked eye not the modern, uptodatebake
Tt'f. a youth of 13 or 14 years, wa* In extends not screw but parallel/ more than five miles. shop.

dieted for murder by the grand Judy with the course of the river.New It. T. SCIIAFER, .....'rlf..r KryiteneUakery. THE SUN
and In Jail. Several month J .. .
placed York Trlbnue. r Lied S. Child.Jenny
those. Ie:;.
ago )umig TUT ver during the progress LJnd ss a child of three years
.
F of a bull lit rue killed a youthful companion The Cllr "I ... I was the lark of her parents bouse. Asa --- ------ -- JOB PRINTING

,' Atisultm, Oliver, with a baseball You in IBM exhaust yourself; looklog t girl of nine she attracted the attention

bat In a schoolboy scrap Tarter lit !alias and gazetteer for the city of 1*. I of all lover of music and entered Matbusbek Pianos DEPARTMENTMakes

;' has since b.*eu out on bond, ,anil the IKK-JHIM It Is purely legendary hereIn the Stockholm conservatory .. a pupIL

finding\ of the Indictment was a sur I n brief statement of the legend: Her continuous studies at so tender an ,

prlae. to itiHiiy citizens Hew III be "Tlie' nirtgnltUvnt rlty of Is was sltu- age caused the sudden loss of her voice' ,
u"x alai \11th., roust of lUittauy wherenow sod for four full years she pursued her' a Specialty of All Kinds
tried for murder<1 I this week. YoungOliver NOTED FOR SWEETNESS A1 D PURITY ,
"U th.. 1'01nf former Pull'eInlin la the buy of Itouarnrne It theoretical and technical studies when N
+ John 1 U Oliver" WH4 tuillt below the l I.Vtol of the sea I suddenly the<< full sweet sounds came OF TONE:, POWER ANDDURABILITY. or Plain and Fancy

OIK! surrounded by massive walls. I back to the delight. as every one
-- --
.
Here In the fifth century was the I knows, of tboiiAanUs for many years.II .
Gets a Thirty.,"" Year Sentence .
court of the pious King Gradlon; and t -
'% llrl< *?.,,,it. "UI11Junl!' K.--Thlrty* of Ills wicked daughter Dahut who I tI ..*.. CommercialJob

Ate years' Imprisonment| .as the sentence bad a pleasant> habit of throwing tier Woman of the IIous. (banding bins a Beat pUeo for lids trrlo cUma'.. stands la '
3 Impott-d by Judge Reed on suitors Into a well when their society plate of C'OIIIr.r' -You look Ilk. a taw looser tbaa others.eowtrue ted of
. luau who bat better da .. Fon- awn _,.rtaJa..tad B lAOnard It Olamoud, who pleadedguilty liocume tiresome. One of her favorites 'I seen .
''; to burglary and criminal as- asked her tu obtain for him the silver dry Uretts-.Yes'm. tban'_. I have.There wortmaashlp UP to date otoMlaabl. Printing

y- soult. Olamouil' \ ,rented after aIn key which fastened the sluice gates lathe was a time, ma'am. Wen I wouktbare detail ad every iJs.orated. -

house J.'orot. ix-cupled by two city wall l\ahut accordingly stole i blushed to band snob a layout as .

hr women, one aged '73 yeara and the the key from her father's neck while be this ti I dog'--Chieago Tribune. .For.
.
other 76. had been entered by a burglar slept, the lover>> uula.ked the gntee and Sold by us continuously for .
R._... '..
Md one of the> wuinrn antaulted.U the sea ru'heU In and overwhelmed the I
was salt' In court that the woman city nud Its Inhabitants. Including the Church Worker-Would yon assist us, '
had lost the sight of one cye aa a result l'riU.1I., Only the" king escaped. The good sir to send a missionary to the OVER THIRTY TWO YEARS Business Men
n.n that the spirits of cannibals )lr. Uotrox-Notmocbt! I'm .
Y. of the assault, prasanU say
the drowned still haunt the spot, and vegetarian But I'll assist you to send without a single failure. If ton
ck the. bells of the submerged city are them some easily, digested cereallI'ock. want a piano for a lifetime's Professional Men ..,
N 'la
Diver Broken .
often heard ringing at low>> tide. ., .. service buy 'heMathushek.
-- -
Xloultrle. OA.. June 8.- Hanrey Rod
win. the 17-year-old! son of Mr*, M. R Cured of Bright' Disease.Deo. . Llrrd .. w.Tbe ..-. T Manufactories Etc

Godwin of Moultrle. waa accidentally A. Sherman, LUbon Red Mills. Tramp once lived oa water .
lady, for fix month The t..ad.r-YO'lt Pi.*.. ss tow sa .. .......*a% with .."n.ea. .
killed while la batting In bridle cre >k. I.awrence County N. Y. writesi "I ton't look | .,. or_ .*.. ....... Seat am ISirlal ..,..
fc near Chastaln. lie, with a number of had kidney disease for many years and like it. How did yea manage sow pr rreidM. writs Legal Blanks on Short Notice.The .
It? The sal Jo .
Trainv--l was a *
i, boy, wu ruonlug and jumping into had been. treated by physicians for foe vrfee TODAY,

.,, the water oa their heads. As Godwin twelve years t had taken a well kaown Great aDd formidable among men .. following letter from one of ear
was making (he leap he slipped sad kidney medicine and other remedies mall order eat tome is
the power o! laughter. Wo man la preof I ri self-erplaaa*
fell too near the edge; tae water being Ludden & BatesSouthern fury .
that were recommended but pot no relief against Its srlL-l opardl. I r

very shallow here, his neck was until I began; cuing Foley's Kidney --- i H. H. Louisville, Ky., Feb. 27. 190.
McCreary
broken and b. died lastantly, Cure. The flrst bait bottle relieved A Dad Scare. Gainesville., Fla

mo and four bottles have cured so* of MusiC House Dear Sir '
Received.
... IIItt w.P... Some day you will get a bad scare, the printing
L this terrible disease. Refer I began matter la. do* time, sad will thus
when feel I Ie ) say
pain bowels SAVANNAH
N I don't JOG a Jour
Mr. VHseguy- want anyotrhoa.aaaag'ea. taking. Foley's Kidney Core I had to OA It U perfectly satisfactory. I like she feavelup.a
In afraid and tear dlold.. Saf.' tin la
of trl- al' ,
; make wale boot every fUieea tula- so much.! Many thanks for
t 'ddu.. The Butcher:: assure yea u..... day and sight and passed a Dr. Klrag's New Life Fills, a ear cure, JOHN D. MURPHY, Mf.DTAI1I.JSBED . your prompt *tt..tfoa la filling order

tb t'V. M danger ef trichina ta these brkok-du. eabetana, and sometime a for all bowel sod stomach diseases, a 181. TIMan lnal,.
;i, '" M.*.<.*. 5T. Wteegz.y-W.U, hydrepbobU limy subsiaaee. I bH.v. I wo.kl su h as he.da b*, bUIoca....., costiveness. Ms*. M. C. ComtTjrsrr.
' ., tbea. If just a Ud-Cter- hu. died if I hat net taken Folev'aKMo ei 4. (Goaraate at all drag.gist. GAITHER i BRYAN, Stile Aj'tj r.

,{ ud J..IS.... "yCur*." J. MtOallom A Co.: .\I only fie. Try them. TAXTA. FLOKUil ,Oaul.nUl.t r Sew, Fla.orders so THE 8U% .


'r 7 *,
I

:.I, .' .,
,.>; \

../ ', ,. ., : t:, Y A 1 J' '. .!
'if..1;!Jo'l. '" ; -' !U' ''bi' .. t.. -, iuM1

tw "'7''V 1Y ...._ .-:. +-----.w rY..wMM.MMM..wow.r.w "w./.Mww hr+---



,r +y A i '' 1
n
tik r V'" 4 'S Y H S a' kl

.
\
..

.
'

THE DAILY SUN: GAINESVILLE, FLORIDA JUNE U, 1905 7

. ..... .
---- "' --- -
-------- 'r. '
... i

ROl I with Its claws as It fled from Its IMPORTANCE OF CARBON. \
'W 1' DISASTER suer. pur'j I Gainesville & Gulf Railway Company ,

Subsequently It transpired!! that where \Vlihot It or its ialTleot w. ,
aJCcESS' TIMES FOLLOWS SEEM. the bird had been was a dried upstream Could Have 5fo Arc 1.1.".. I ..

ING ILL LUCK. and contained gold dust and The: electric are light n" now so commonly Time Table in effect, April 9.lOOO.
---- ''---'-''- -
small nuggets In large quantities. \ used I la produced by the passageof --- : t.. H. .

t... Ilaiusgjte harbor was once flooded a powerful eloctrle current betweenthe No. 'o. 3.
How Bak. 1'elrole.n.. Deposit with a mighty shoal. of mullet and I, slightly! separated end. of u pair of Daily "t' t. No. 2. No. I. No. 8'' ..IllyExc't
We** Discovered Dylosf Seal D'.. carbon*'. ii twelve D..l,p Daily. : !o3TAT10N8. IAU,. u..t $Zti p, ,
when the dock gates were opened to allow ttirtiou rotl' nr > >oiit i i .
.. .a <..ape XOB>O'. Gold Secret.Tfc 8und. C
a ship to pass Into the Inner basin mhos I li>ijj! jiu.l from tluvo-rightbs to I tJQq'. i:
I
Orlcla of Tinted Ihtper i I tiLv
the flab followed, and tbe basin became one-half iuoh ta tllaaictn. |.l'a.-iM very
thick with them. tloaH.v end to cml lu 'the lamp.; The I .
The Baku petroleum; deposits, wblcbbare A MII.v; a M( lv A M: Ar. P lid At I" M At PM ,
h.inUm H fill o"u' 'I l rutted that
When lamp n.fs
yielded l millions of pound 3' worth the tide went down the authorities ,. '74b 2 ilS ,. . .. I . ........,N.irOeld . .. .... .... .. 120 810
lane oil. are situated In Russian Caucasus. bad the dock sluices opened and wlt'u10 ".' '...t:1, : B the upper 1 M t 2 i)8 . . . , . . . ....Irvine ........ . ....... ..' 107 800ROO
the water drained off. Over twenty; "Il. b w. wiI I'b t always t....da the |K>*1r 1- 12.5 . . . . . . nUu'Iar"l'au' . .. .. ..... .. 100 6MI
cart loads of mullet of two pounds tit .' ':"'. I".T.,1" _t11" : .,,- >iy thIfy ., 81)6 I :: M I. . . . . . .taoutheide.. . . . ... .... .. 12r5:. 6 bC. pmt
'Years ago a number of cattle were weight and upward were taken away U'II.I of 1 !.*:.-t i .- ,.J.ut a-, *n i'I i us the 8 10 '13\1 I' . . d..... HIckmal , ......._ ... ..... 12 to 5 4R ,
placed .on spveral' tracts of laud well el;. el 't.' tt. ., ut I* ctll.1: 11 tl i the cur 8 16 3 10 . . ,.... ........:'hake Hlln.ctotJ . . .... .. .1:1: 45 64''b
covered with herbcge. The animals.bowever from the floor of the basin and theirsale lx'n-s nr 1\1': .\f""aUJ-- see .l anted, abut S 8'J 33l) . .. . . . . Jt.Annpy . . . . ... .. .... 12 80 58K 'i.
refused to tl't'at first but brought to the coffers! of the Harmful HU t.; ;h'> ,. ",f n "... !irmlng: a lt4 3 40 i. .. . .. . . ..Tlt.oom . .......... .l20 t.108.u it
e council ueurly Lo 0i>. I. !'L. o'ot'trlc) ;3 4i: t . . . !I. . . . . .. 1:1: Jft 61.810 .\
later. In their hunger, they ate up the A piece of blue dropped by accident g/ ) 11 bjn'h, \"* ; .. iii, 13M I. .. . . . . .KlrttwC\txl.I. . . .1210 61')
Braes r&'enously.11! of them wt'fe.. into a vat of pulp was responsible fur .-1\1.1.. .to fatal \\: :: .ri'-nt i'lr. 8,3 : 415 I. . . ,. .. . . awhoata. . I. . . . J2(0 6'916 \
taken'Ill_ and a number died. the prixliu-tiou _of blue tlutt-d paper, ..re..1. 'I't.:1,..,rj;: J Ri '.l' 1". ?tit" tl.1I1 ClthIt. 4 40 . . . . . ... .Itocly Polut. . . . IJ 43 44) 1
; 1\ ,,' Lrnt. fbaa I ':.t' "IIrUIIIm' :, ..SAr'IOI' ) I . \ 1280 11)lltI
The cause of their death puecled the and to tills slight disaster the foundation ; 9 "I . . ..tillucrr1ilo.I . . i
,' 'l'lldd.r 11I'.tml b''i\ 1 lt IIIC'Ul' ) ) L. IS ib Lv 8 SO 9 :.IU WIOAl' ,,800 P '
'I
owner for some.time. In the long run i of a great industry Is to be ,.,w''I1'nt,1, : l-y ",t'm"+ .".' .i, il 'ii of n 8.\ b to "tS 53 I. . . . . 1\ntuy . . .I R tS' 8 to flat

be discovered, with the assistance of an trnowl.Hie the nlr nv urtlntafllR'l' 'n! !tV-: fo-ri of 1t (a) 8 M 1 06 . . ......... Cyril\ . . . . N to 8 80 160IY
Englishman, that below the meadows wife of William 1II"'t." n poor paper : blunt 1.0'111"1 the :. '11" h"-1\ : 20 I 7 03 7 U I' ........ . .Orahtttll. . fI Bl: 9 S2 18C ;
maker dropped n blue bug Into Olin 1240 7 15Ar, ': 2A: . .H4ml''u :0 910 110
rich oil th 4JiM 1\ "t" \.i'*
? !
were spring which caused the aWI1), -imp: \ t.- I.
of her husbund'w", pulp vats and ns a rno'l-ih . . . . 9c.o 10 Ito j. . }'alatll.a.H. R.l'1t1..1". ht l' 600 a ..... ..
grass to be poisoned! with paraffin. The result the pulp animncd a blue tint. upper tT.e ilowiiwunl JH .t I ft . . .j.I ... . .. . . . . -0 . . .. . .... .. .
Ion of bIB cattle brought a fortune.A Kant: considered. the paper to l-o ngruve Ii> nialntalu the \pet: r.* '' '-n.; 1. . . . a .48.8 45 I . (."lteCUy. U.8.A F'. .1104 I' 7 41 .. .. ..
summer or two back a pea wall on pecuniary loss' but when he rent The vnrbonx nw not lie ;r.*I "''i in'1jr.the : . . . ,1.,1 i I V 1f) 8.A.L. . ( 1 HI p.. ,
upHr| t 'the Suffolk coast wa""*, blown down during It up to Ix>n.. 1 <-..nvr. . ......,. S 55 al t :i ) H. A 1'. . 11 s'') a. IS.O, .. . . r 1.

a strong gale and when the tiderose ket. Indeed, it Itoounie HO popular that "crater." ordinarily\ ?11 ti: .:. i-.i. ;,'Vc! t . i 3' _. 7 f b 1'[ ........AU.nb,1 C. of Ua. ,.... 7 M O a g ou .. . . )
many acres of low lying laud were. Kant was asked. to. supply more. He of it u ,Inch In diameter. 1 N f "l I i in! II' At PM\r: AMIAr PMI LYA1I.L.PM.. . !
flooded by tbe 't4 tea. Tile farmer who did mid eventually made a great fortune end tho jrlowlnR! roiicatir' ,.!. -if

rented the land In and In out of his blue bag"' paper.A i-t t'.11' t Oalnolull1. and Fairfield unda -
were despair, : which emits the pwnitrr \p'irt Trains 3 and 4 do not run between nn ;.
order to save their crops they started chemist Nuremberg was pourIng till light. In lights", of Ui,,> 11-11." .>..-.t'somethlui 14. E. BARKER. nt''f'ra! 1I1'rln''n''M.'

draining the water off. I out some' jKjxisfortls from a bottle : like half n h 'r""I"" | !'" "'i' ->fI" en J.o'. J.Ut.141, A'l'n&:: J. D. WATKIN, General AIt..na. Y

Two' days later the water sodden : wlifn a few drops fell upon a pair he had of cl'g3.:: nnfiitratwl In this little crater : --- .- - . _. - - ..---" - . -. .. --,
gold! rimmed spE'l't8l'1'S.'hkh I" limited
and Its' temperature only
meadows were a sight wonderful to e-I recently purchased. hy tho vaporization of the carton.! Cnr- Take The
bold.- They thick of I Atlantic Coast LineFOR
were one carpet 'That's a catastrophe, he called to bon being the most refractory; nub-
fine mackerel 1 A big school of the fish I his wife. "I've upset some aquafortis stance known the teniporuturo ut the

bad swept In through tbe breach In the on my newicpes"' crater IH the highest yet priMlucetl artificially ALL EARTHLY POINTS

embankment and been ''carried to the "IIiii It spoilt themV' was the reply. and ranks next to that of the Via Via Via
Held by the Incoming sea. "Well," mild the (chemist "the glass sun. 'u Is fortunate that nature has \1"11\ i Popoftt Dupont. or t l+
H S Sou thfltaeatklp \W\ est t
N orth ast t
The farmers hired scores of carts to In corroded where the fluid touched It. provided us with such n *ul>.Rtunco n* or or 0 .... .yltl. sn4 "r?

collect the mackerel, and within twentyfour Then an Idea struck. him and gettlu carbon, combining, an It ,does the. highest Jao&'utu. Jael..w".IU. UonwomerrRapid f, s

hours the fish bad been packed a piece of window giant' he endeavoredto ; resUtiiiu-e to beat \> Ilk tho neit>''.
Into boxes and were en route to Billingsgate. I etch thereon. He succeeded after vary elii-trloal I conduct I II)'. Without Transit anti Unsurpassed Service

where they were sold for : many failures. Hy drawing designs oil II carbon or nu tilvalentmid| none ,U. Time Table' in !Tet April 16. 1905.

,over 000.Starving. the glass' with varnish and applying known-we could hare no are liht.Clwrles : .- For UAINE8VILLE Arrive FromIntsrobanffsabls
ill clad and bootless Robert I acpjafortts be made them appear as ou 1... ItriiHli In Atlunllc. Depart_ ____' ___ ,..,. -_., _. q' .. __. ....''_ _- -__ r .,__

Hyams, a boneless Jew wandered to a gray background. For many years 8.VUpm lUab Sprtags' andlnter 8-00.-;; zWil7

tbe top of a lonely bill on tile Yorkshire be kept his secret' close and made a STOP IT. .1"I mediate loInta Dally ,

moors. There: was a strong gale blow. ; small fortune) out of his designed glass., _

.Ing from the east and to protect himself Pearson's. London Weekly. Boasting of what you can do insteadof 12tlbpm I Ocala. L..bu'K; and Tampa, and 1s40pus

from the cold blast be entered a doing It.Thinking. Daily Intermt'dl.a.l'olo'. Daily ,

big abed of wood and gorse on tile summit THE PRICE OF TORTURE. that lite..U a grind and not 2OOpm Palatka JaokloD.m.. llUpm rq '

which was used to store fodder'for worth living.Exaggerating. \ Norah East aDd Wen '
Dally Dally
tbs abeep. 11:1........... Cewtwrl r..I....... and making mountain

Stepping, through the, door which wed the c.... Thereof. out of molehills.Talking 1:106: pm High l prlnp. Wsyorose aysnnah Brunswick 1111 pm

opened to the eastward. be was aston Among the monuments of superstition continually about yourselfand Dally L Albany Atlasta an Points North, slant West Dally
ished to find Inside over sixty wild which exist to this day tbe trawl ,..

ducks: half stunned but quacking vlo- er sees the "witch towers," the torture : your affairs.' I'J I 8.U...
lently. lie slammed the door to and chambers and the collections of Instruments I Haying unkind thing about acquaint- I

started catching the birds and wringing of torture In various towns on snces and friends. Dally
their necks. tbe continent-notably at Nuremberg Thinking tbat all the good chances<< --- ----....----.._-- ... ,

The: abed lay right In the flight Hues natlsbon. Munich and The Hague. But and opportunities are gone by, ': ,,
Of the myriads of wild docks that come perhaps nothing brings tbe system Thinking of yourself to the exclusion Oan'L urlh Spring \ DaAye

to Britain from tbe north and flying more vividly before as than tbs execu of everything and every one else. =.) .n. ltoaMJa, f
Four of to what would do :::.:-::." _
Speculating ss
low In their hundreds, !some of them tioner's tariffs still preserved. you
of Cornell In .1..'. aDd do MI1.a,. Tlaksta, good over UJOOO nUsa of among the prln
place
bad entered the door of the abed which these may be seen In the library some one your
sips) railways In the Southern flutes are on tale l"y the prlMlpal agents,
bad been left by the shepherd. university and among them especially best Inyour own. !
open
Through Pullman sleeper Port Tampa to Nsw York, via. Atlantic CoastLine d' .
and stunned themselves on the rear that issued by the archbishop Gating Idly' Into tbe future and also via Atlantic Coast Line and Southern Rall.a,.
wall.Hyams. elector o( Cologne In 1757. On four dreaming about It Instead of making Eliot complete Information, call on

sold tile lucky haul for a sum printed folio page It enumerates In tbe most of the present. J. A. GOODWIN. Ticket Aijant, Qalna.vlll*.

exceeding IS, and with this be was able Qftjr-flvs pars graphs every sort of bide Longing for tbe good things tbat others Add,...t ,

to clothe himself respectably and thus eons cruelty which an executioner have Instead of going to work and FRANK O. UOYLHTO.N. PI. r.... ,,".. W. D. 8TAR Tray P.... Ag_.
And employment. could commit upon a prisoner with the earning them for yourself,-Hucce"*. IM W. Bay st., Astor liutldlog. JaaksoatIlls, ...a. ,
On the beach which fringes the precipice sum allowed him for each, and for the H. M. EMEHHON: Traf. Mfr, W. J CHAIO, 0... Psas.Wilmington. Aga? r
below Cape Nome there U now a Instruments therein repaired. Typical A Herrl_... N. O. WUnilagtoe.f.0.

prosperous city peopled by .to,()()() miners examples from thla tariff are the following The terrors of the deep were perhaps _. ._. .._.. ---- -.- -.- _. -_. -------........ .._..
,
but at one time, and not so very : never more tbrtlllngly set forth than In :

tone ago the spot was uninhabited. Thas..... Ulb.J. tile description by' a young lady' who SOUTHERN RAILWAY.Effective
The discovery of tile gold In the district Tor .....Inun..... with last year made her first trip abroad. tt,
four horses .................. I Hi
and Its ultimate prosperity was for qaartcrlnsT ..... ... She kept a diary very much says tiNt April 10, 1903.ABEUYALft .
eftttrely doe to a seal. I. for beheading and burning .. I M New York herald Ilk. that of Mark
Two American hunters bad woundedthe 1. For strsnslinsT sixl burning.. Twain when for seven days he recorded .
I YisUbsla Tnl. Fast (.. la :r.. 10 JterUa ea4 Weet. Ica I'
... wood
S. For .11I". tbs pile of
strange creature and It led them a the fact that b* "got up. washed and ,
and kladUns- ................. tt
pretty dance: across the Ice and Into t. For burnt* silv ............. 4H. went to breskfast. I.. Jaak'onUI.. ,No. Ky 0 :dtOs 7 661" / L. Jseksunrllu. 'la., .80. fly 7 Up ;
an unknown: bay, where the seal was For breaking a Btaa alive eo There was one Important exception. 1'e Jesup ,Ito ky I04OpL"J..ap.. 00. " " .14o. Ry. JOBOp
killed after badly wounding one of the the wheel ............_........ 4 When abe crossed the cnsnnel tbe ex* Lv S..nn.h ,14o. ICJ'' 1 SOp 121h Ar Nceos. ..... . ,10. Ur. $ VOa '
'InlD .... 11 For setting up the wbeol with perUnca was so trying that abe felt Cohunta, ,1tG. It, 5Mp 100a Ar .UlaDI"1 0.. .eo.1ty. 1:101..
,lie body>> twtoted la It ....... I Utt. kern. .
tile seal flung Impelled to describe It Ar Cbarlo' ,80. ity 10 O p 816. AI ua. ?So/It,. 7 8blaArh.ensboro
death struggle
In Its For satttna off s band or sun ,, ,tco. It, i2Me: .. 1261p AtIsltoa. Oe" . .. . ,No. Ie,. 126.
np G.e ground and the banters, to tbetJ'acreeable dry flasors sad for bebeod- I firmly resolved to stay on deck d
. . ,. ,
tt Arian.tlle. .Mo 1t1 24.b a 2,10p Vb..ooa T.naeo.I1. 8 <&hA
surprise, found themselves .. For In.1t"I bumlnsr with- a hot t...... 1 M she wrote, "sltbougb the tempest In- IturhmoDd _ .80.' It) e Win. 45 47 Ar l esiegtoa, lay . , R O. I 20p rt
on a golden strand-tbe richest one In n. For bheadlns sod plating I crossed to such a frightful nurrlcane AI' Oinelnastr, 0. < . .. O. 'I40p )
tbe world. the bed "poll. ptk. ...... I M that It was only' with the greatest difficulty Charlotleeltle Ar L,Ilohbur. ,140.atJo.. ky 4.02.17. 1 f'lOp)p v iiae semi 0..,... a. t. our p ?
\
The death of a mule brought great :fo. For bodr bcheadlas!. tile -wheel. lwto sad leg pisc the : tbat I could hold up my parasol. A'W..hl..oa.. $o.Jty V 4.s OfOp Amlapn,, . . i Hl rear 710. l:
*
wealth to Frederick: Butler, s Klondike lag the head ttpoo a pikesltoc'tber -. I MMMMMBMMMMMMHMM. Ar n.talmoN. :P. it. It. II ar.. II 2&p Li7NniTri *$1 6: ':Ps Li... aMpA'
*-. who took part In toe IDf>morableroab" ISI A W.....,.. Sle .ory. Jtt'.. "
: \v. Ph'd.l'is J' J&, k. 146p 2frSa A' ( . I I. . . d' Lines 710.
to the gold fields of Yukon. He For leering a erisifa)Mier. IlortecMtus., the Rotten orator could Ar1e"Yok., 1'. k. It. flap llOta v te.laaat' 0,1 .a.It.AV. H46pCo. l

left bus mole standing one day on s bill .. wtton with......r.dhetplah.rrsick .. .r I repeat' word for word a took be badInet 1.A'C.......,..Illr.. .. ....... 728s:

plot, of land tar sway ..from the the flesh ......." ... ,... ... Htl. i read. Oa ooo occasion be made awager % ."h-'H. York anet Florida & J9; iNin..r; .. .0. tI y,"._' "p r
-claims and another miner who bad a Hand. with one flleaaa sad to win Itwent MIl' Puilusae Un.tag' Iloofll
For nonias a ttnfu* or Ci..ping A' Toledo, O. . .0. H. k D. a
Csr J'OrTam sad Jaekaoa
grudge against bis fellow digger shot to. the g...0"a W to aa aurtfoo. remained all day e AI Ih1.rot.1.Mteb..P.. .... 721hfo.
UMaDl..1 la tbe neck with bta revolver. c. For .... Ate tesd..r torture t 2t and .la the evening gsre a list of all the Till to stew, Yo,1I "4'
the oeroad of tor "' fyCl..JDU"O.; ,P. eaAr A'1 P'Jml&Id. '
e For srad
Wuhlntea sad il"' .
t..,... liM>lo4)ns' ...11.. the articles sold, the prices paid for UMnt ." YNlaus.. Drowieg Pltube"', .. . . ... b6a
,r,, ':The mule fell sod in Its agony kicked Itmbe .,__..... with salesfo sad tbe names of the ptnrrnaaers.. Tbeaccwrscy DoUr ti"'ei..tJ. sp,", .$ jPutb P y
the ground with Its boots. Whoawest Mm .. ............... > M < of bis memory ,.U ,SA tula J&ooIa l..pluc Car .I.'aoam. ao ,
up New York. Ar C1d.elesW, 0. . _ ,81. roar a 48s. .
returned be found several and M no through fifty-flr. Itrms and case attested by the auctions*'. dart t. a :1l ....

of strange weight and snapsaround .p.eiM'atlooa.-Aalrew D. Watte laAllanll wn. fonwd the rsrspttalsUoa with n.'TIIe Land of tb.llky" S. 10 ArsL" eleilil.. ,. Icy. .180. R,,.. AlLr

tbe dead animal. He *. kla book sad found thai to M ease bad l/o. . ....,.. R, 71sLr
the supposed peoWsa sad they Ota wan of wondoTfal. ssstwM'ji' made aslsgta .. .. FIa, $a. Uy 'I bop ; .
ofItrtgtt A' A...... AM U toIt
Ka_ ... aletako.I JII1a..II) Oa. .fIo. H It u. ,
old.r Tfco ,
's to be nuggets of vtrgla ( A' 4ltn .... ia. 'Itt' sy 1145.
tbH9'.1 bopettaJ tkosghte ..._ AlC.lambts.H.C, ., .110. U 1001s
r mule bad struck ooe of the I ArlineeptsTctu, ,Yttaao IDlp
l III Klondike. sad s .t ne s owa .btlKl i W. .--.. AI A""" ", 11. 0 .110. Ky IIIOp AI1Caa.atl 0' N 0, _. ..WItan" 0 40a
Uaaaera et A' I.s epriegs. $. O. 110. It, flip "' asi'Ar
to are ..
: Issportsjsov than
> case of gold bring dlatovanimal acresulidiets. - LW 1.1 uNi>xnMii K..U". Tenn,, ..... ler l00p P'3 l. .... ,t iiA'
t oreurred la Scotland' .'.. ibJt win l Insure **. Tt* lava la a great ssaaaf the> taws d > Loolnm., ,Naty llOa "d .yt/asr., Ark....... . _. .. fll0.Ar .
1 + "A doc, badly wounded by a tWtkxw prr..oa Laud Warn. as early peed oa ..... Ta law trashes .. be- 81. Loa" .fCo.I&1' 4610 '
Die ltd7kc rtoada Ltmtt.d:
a gsmkenT *.a. aerstcsvgold la Ute MS. fxwJW ta pUk out the ..... sad Utmrs' sad BOW aad 0... Ciaelaeatl. .4J. A t). I hits 1)al3y. 'goad tattbolo train sbro.gllIIO.
of sad ta ........ ,
on grease whteto was frtnads sat rtwuilM sarrvsa. : are wet let or aa.. ssv' eorr .
' known ss rb* Dvarobfa gold many epee tt will b-" fated that the pc or partfy. exslt ar Orb***, barbs 10-0.111 Pa ltmte Drswlsg 0ayieJaksmcs.t.Claieeae$1.. ; .

Go<*p*'. Over OXOOOprorfow gratretenemy rvMr wttnla ......at.NorWII rlaa ar re*..* vs. by a rsottasit, steady, Reoa'aad aoaelP.pisCstbetwes. p.. ls'-Panma.. Ibawiag Roos +
sear
0. meal was ...... Ibottchu. for ezsmpi&*. are tanilt .. ... tswrastMa opsratlosv iii. tbatf Ja.kso.'W. slid CS..),.....&. Maepieg 0. betweas Jakso.Tlle,

y" the slap by tb...nrt of the .ty greater btn.lnse'. t* saeenssJMM :. ta*.sir we brsatfcsv They air* their BI,.......... ..., .. cod Jt&a... aZMIIeat
.(.p.f. from .*st ta aad a* I.whets s4r to atrr Mraa Ate rliag t* Dialog. CU llegtlte. at7.

at silver saints ta ftpsbidbMwvrrvd health. a. tvaoty, at. bare say. no real their.-1117 they aid .evtiM.they ... J
: by a srovad+dIs saoo-ss raa extol In th* atswspbrve.4* '7tk... ar they bully ...., Data.D.tke. AT ACK.IONVJLLJ a'

It said that tn* fasMMS dia- wMrasI BM4.i.>...>ly or a srt .. ..... tf wtt!. Itad9 lOO .. SB. _
.at KUnberJey .*... first Uraetmw '" I..eeC A W ._II.f r.... .
) New Teak Ko 19 Wa... sad Florida Earsas. ..
yoorwlf sal yaa w,11 nave bleed row vTasblagtoa, e4 /- lsatoo
.. e' vU> awake Bor by a ftsa Jle etr'I'M I, bar. -
T4O awFj
k a* bad sLoCrale sa.b howaht frkca+al the god s( yea MttaW'.... fc* a bad Mtavt 8<<...sn.1nrf Clastaastl p. ..takn"") .. !ro.21> ''Wsslbl sad Florida UwFraat .
eta st -
>
f1oa
. .. ,
,
of bvadrsdsdo .......-..-....,.. A. ,. First TM.baIlk... J
some .. .... 1 tOD s.lw
oat ., a portion offf sated hte If .. wsat.4 eta sett ..Arse Cafcrajr.."' ___d. .Ltute, etev-yo. Is. Flsv tfaBlMd,**t M sv..
t*c Mr Xrrtes) atdL. Tine 4 |i"toovury Is int all yes rsasrtfit pas .. Jsa/pa41 rtgkt ..,. af .e akebawtte. .. .. r r r
,..., .. A- fart ****** as 1NdI'-pawrtay as js. ''
n "';.;._...-.f _'*** Pew..""j4 Csiterx : .......\ .. : ::, )'"1-: ." Iii.'e I7 lF.Ji, I !tAta'eaL A F1t' .Reaeaa Usmare A.O. t*.A:r.n.l,r ;V a
;; ,.;, .<,' ,\" &! d :: ". -'v. -' ,, :;I\'i.\\:: ,' .i fi !' i'r *:, ,x 'yr'tr yti7rt

.....'-



A y1 b. t pWp
F t '
'
I
( a



"


8. ' THE :DAiL1! : Btmq+ 1E8yit 1T FLOnm JUN$ 9 190ii

_.M, ,....._, __ __ .I.. t. -. : .......". ,

.
,F 'Mi.1 George I. Dolg mod daughter TO KEHOTEFBEeitESMi ; Mrs. C.: A. Harrod baa returned from

+ HEWS ,OF ;CTX| .AND J 1 1IF X. Ruth l are, visiting' '.the f rmer'. I 'PIMPLES a TI." to friends at Romeo. WllSOI'S.I

' i .......r. *.Mr*."John H.Blake.. . ,at palmetto.Jaate \ .. Lei .Sternberger A Phillips do your

COUNTY CONDENSED oIIIU&1G& Mstbews, ft charming .','w'lt. to days use painting; and .decorating; and see the

, ,. ",! young ,lady of ,TMoma, (.: a'goest.of : ,difference. I
Min Theera Fleming.: W.. Main street 8. i SATINOL'A N. A.Calllaon'of Spring Park Farm,

: matters of General: Interest Gathered 'Dr. J. D..Watkin4diparled' yesterday The. .J Ciaqibxlsii IsssMflsr.8AT1NOZ Benningtoo, was a business visitor to lie 'Villas l

IL by Our Reporters. 'for.Atlanta,, He: goes to attend the this eity ,yesterday.

commencement .exercises of Emory W. F; White of Newberry made The

c PERSONAL AND SOCIAL ITEMS College, of which" he ia a member of r San one, of those Informal calls yesterday I ia i all! (

the board of. trustees.A that places his name on the roll of

* .peelal..en'ee'ln'er' the :Gainesville r I.a I. honor.
What Has Happened What la Going; DOTDO.OD.S.:
and Gulf, the A&laD'Ics'OQ.;, ., Line Sd9 Special Agent A. Paul of the United .
Happen ;Told In Short Paragraph
4 to '
and the Seaboard Air Line has.,been States land office left yesterday for Us
'fl :SO, That '"He Who Rune May Read"'. Keeps Busy.
.Inatigurated'and, will ''be. continued d ;, points In West Florida on official busi

[
Try'Williams'Ice cream. aori. > a. : ..wl' L. Long of Cadillac was a caller

a 4 Old newspapers for sale at The San Mre. George M,'Lynch, who with her at The Son office yesterday, and left a Big 11.rt11 I ef

office, tr children ia spending a abort season M substantial token of his faith in its

t&dles'eallingcards latest with relatives( Melrose, writes that .. 'tabUlt,. :
'fa stylesat LIIIS
Son omee. .she is having .delightful time. She I.I ia 1 Don't accept the doubtful kinds-In- Eilllr.il1.rils,,

'i 'Wm. W. Lyon of Palatka is In '&be I expected: ''home about the first of the slat. on having Blue Ribbon lemon and I : .

". city: on business. coming week. vanilla. extracts. Takes less. Flavors ... all zsh'eogs. '

S I'erryMColeonwent: Jacksonville George W. Petty and R. J. Andrew perfectly.

vi. were In the city on business oonneeted and tnooer reloaded"U it'JU; to remove the representative of Kinglsnd A Co.,
) Wonderful Salve for saleby _
worst 0 of freckle Ftmpte Ttuu sallow.neat. -
with the United States land office .
ye packers Jacksonville, was working the
J. W. McCollam.A Co. XjTer Spot. BUokbesd. or any skis
terday. Mr. Andrews la a member of trade la this city' yesterday
L draws eruption In W Oars. Leaves the sklaelemr.oft. .
Sweet and. vines for
potato : the Board of County& Commltilonen b.sahy.sed reMore toe beauty ofyouth Rev. Thoe. P. of the First Presbyterian .
eale. J: N. Bone, 'phone 19. Hay Mrs. R. Wilson
of Bradford county Thousands testify to the merit of
'W Mrs. W, 'D. Befgler'' of 'Waldo Is' In SatinoU.Mfata Church will fill the weekly

the city, the guest of Mrs. J. ,II. Alder; A.,E. Wlttitoek left yesterday for AHoe IJrette wrlt, .&: Thlbodekuz.: La. appointment at North Gainesville Hall
5' ,nsn.. Alaobna, where he .initall'the big Oet. 16. '04.-"For four lean my face was, tonight preaching at 7:45 o'clock. A
THOMas
pomp for the .newice', '' plant. This completely covered with, frvoklc sod, plmptos. cordial invitation, I. extended to the T. F.
,Richard Holme of Hawthorn waa AU remedle IsQed.until wed two packages
made the Gainesville
pomp was by public
? .tran.so&Ingba.inew In this city 'yes.terdsy. of Skttnols. which oomptekely removed the ,
Foundry and Machine Works and baa reokl..sod JJ Dtta. My oomplexioa Is DOw, Mr./and Mrs. J. L. Medlin of Mere
a large capacity. Mr. Wittstook slates perfect and hope every lady h.Tiw freckle dithand Mine Hallie Lytch, a charming UnDnTAKJnfi( Sr
,3dlurltor.b.l Pedrick has gone to that it will require about two days to or pimple wlU try Sttlnolft." Prtee too t.n<3l.oo.
young lady of Clh, 8. C;, who has been
Lennon, where she Is the guest of Miss complete the work, when the plant / .by leadlae;druggists. or maiL
on a visit" to Mrs. Medlin, were in
Ida Little.. will NATIONAL TOILET CO.. Park, T aa.
begin the manufacture of ice immediately -
the Mrs. Medlin and
i W. T. Ob"Dat'the merchant of 'Ar. Sold In Gainesville by J. 8. Bodiford city yesterday. FULL LINE OF
.k: Co., J. W. McColIum A Co.. W. M. Miss Lytch proceeded to Clio where
; redondo, spent yesterday with his family M. E. Robinson of Ooala, the clever Johnson and all leading druggists.Mrs. the former will\ remain for some time NEW GOODS.

4 in,this city.Benjamin : tI salesman for Joseph .Rosenhelm & .. the guest of relatives and friends. -'--

I Turner, a successful planter Sons, shoes'Bavannah In the city. 0.' II. .flighsmlth of Jacksonville Joseph'Evans of Atlanta special Agents tor...
of the Wllllston section Mr. Robinson who Is more familiarly
was tradingin
representative or the Southern Belt
who has been here on a visit of Monuments Tombstonesand
this city known as "Sunny Jim" has made ,
yesterday. a
is here for few
several days to her sister, Mrs. W. W. Telephone Company, a
)Ir.. B. R, i Pound and son Felton great many friends in this section who poison left ''yesterday for Bronson, days on business for his company. Iron Fences.See .

t, have returned from Lakeland. where are always glad to see him, as much where she joined her husband and son, While nothing definite can be learned ,Our Samples

they have,been on a visit.. / for his sonny disposition as for anything Wad, for a visit to Levy county at this time it Is surmised that he is

Jame. F. Mead of Jacksonville, Ira else, for It's the disposition that friends and relatives. making arrangements to. begin the Personal attention to all matter I.
t has made the friends. construction of the long-distance line this line. Hall. and telegraph enters
+ ling freight agent of the Atlantic Remember the Gainesville' &: hit !
"" Spend a while at White Springs, theleading between this city and Jacksonville.Dr. remptly attended to.
Coast Line, I. In the city.A hat round trip rates to White Springs ... .
health resort of the State. On
handsome new sign ha. been Installed on Sundays at only) f!. Train leaves! BenJ. P', Richards and H. E. Taylor -
the far.famed Suwannee river. The Gainesville Florida
In front of the store of theY Gainesville at e ISO a. m., returning at cashiers of Dutton A: Co. and the ,
Gainesville and Gulf offers the following
laird, Hardware Company. . 9180 p.m.; and affording a whole day First National Bank,re."ect.lnlhue '
low round rates from Gainesville
trip
We will stop the leak In : roof or at this favorite'resort. Cheaper than lone to Atlantic. Beach, where they
r your
It will cost you nothing. BternbergerA \ i Sunday only, $1 ; ticket Rood hiring A buggy and passengers are enabled will attend the Joint convention of the THE CONTINENTAL

Phillips, the Paint Store. going Saturday and returning Monday.: to spend a day on the banks of Georgia State Bankers'and the Florida

4 For Rent-Five-room cottage In $2.60j ticket good for fifteen days. the famous old Snwanee. .river St.Y State Bankers' Associations, whieh will CAFE-UESTAURAJIT.,
Bouth Gainesville known. the Bill $3. Double dally service. For further i
.. be held at the Continental hotel today.
-
-
thorpe cottage. Apply at Sun office. particulars Inquire of ticket' agent tf They anticipate an Interesting meetlag. .

I' Dr.,N,J. Barry and son of Newberrywere Tb<* young people of North Gainesville .

In the city yesterday. Dr. Barry bent on having a good time, participated GtialSiauchter Joba .Stcoa of Lo a'oD. Ga., father

tit is a druggist of that progressive, town. In an old.fa.bioned chicken .f MrsW.' R. Anderson returned to

John Holder of Roobelle and E'?. WOo pillsu In the Campbell grove Wednesday hit home yesterday., after several] days
llb of Mbnteooha Were "h.1.Hofl.'o evening. There was a large crowd
among spent here" He was summoned on account
ti the county capital yesterday. present, and everyone expressed: themselves of the ,serious illness of Mrs.

,', John Robinson, a prominent cattleman as ,having a most enjoyable Anderson, who has been suffering with
lime. The evening was passed in various .
and who has
of Levy county; near Bronson'wastransacting typhoid fever recently
sJ business in this city& outdoor garnet) by the young peo been the victim' of so much mUforkone. -

f, ten!ay. yes pie' while the elder folks ",.Iked over Friends of the patient will be

matters of general Interest." sill gratified to learn that .her condition is ,,
Chat. It. Carter of Mlcanopy, for along
Dr sad Mrs.. Ji M. Dell who were i steadily improving. .
time"employed. conductor of (Pint corner South of P"olll).
the Atlantic Coast Line was In the. married 'in Ooala Wednesday evening, I r-- Account of Confederate Veterans' 0,.. Early ..4 Ut. Cray .c:.....

city yesterday.Pooket arrived In thiaeily' yesterday. They For Three Days Only: reunion the Seaboard Air Line Railway W..>... .ataa
were accompanied by the groom'sfather. '
Knives-Jntt rfeelrtd. $1.064. will sell round-trip tickets to Lou.. _
c
Captain J. Maxey Delt.. Mrs. -- -
.) 33 worth of "Bslrtl Hardware Co." isville. K;.. at the rate of $17.80, from '
John B Dvll aiwt son; Bloxhan: ,. andraBatrd.all Thursday Riday Saturday !
o knives, rind we guarantee everyone of June 10th to 19th inclusive., final limitto
[ of whom attended the I
p them, at )laird"..
\
leave Louisville June 19th, 1906. s Srt MOUNTS
nuptial. The happy eouple were met June' 8' 9 and 10.
Frlendiof Mss&erVrankeawelJwill} i t Limit" may be extended to leave! Louisville
at the tat'ion by several friends whoextended
i b. gratified to learn that he has recovered late 10 i
--, .. .. -- .. -- a* as July by depositing'
and best
ir; from a spell u f fever which eon- congratulations 1 ticket with :y. H. Richardson, special
.
with. awl Mrs. Dell will reside
Dr.
'fined him to his bed for several days, The Greatest Slaughter Prices you agent Louisville and paying 60 cents All the & d standards and
'
la East (HlnesvUto.After have Our is crowded i
it The friend or Dr. J. .F. .MClKla" ,. ever seen. store per ticket at time of deposit. the choicest of the new ones
:
of In tale with first-class reliable merchandise.
a eoaple days spent
Jr., will be pl<>ad to learn that he Is '
oily as tae guest of: Mr. and tr+. J, !t. and In order to rda.our stock a few; )Ir. and Mrs. A.W.: Sargent, ST., and as issued.
out again, after having been 'confined iHwt>lln-J. A. Plewellen returned to thousand dollars we have decided to: daughter, oP Avon Park, are in the city

I; to: .his room for several days with its home In M.,Intosb yesterday. II.I sell goods for ,>>Ie.. three days at rtdioolously -- for .s few days, the guests of; Mr. and Ask to- see them, as they

fever. I Is a member>of the firm of FlewellenQros.t.trocaars. low prt *.. We mention a few! Mrs. A. W. Bergen., Jr. They expect cannot be displayed to ad

Mis*.>s Ms>"l and Jennie Vellch of who plant quit ex.tenslvery. terns that will givw you an lad.K.to.. to leave Tuesday for New York and vantage a case.

,j .Jaokt.\n.m. returned to their home In Boston, the old home of the former..
prices
., He reports that the majority theway tve are cutting every
yesterday. attar ponding a few days of Uve crophave been disposed of, department. Remenb the dates This will be Mr. Sargent's flrst. visit

'ya -tl .a.antly ss the guests of their aunt, jut tbs melons' will be -n 1. a day or Thursday. Friday *ad SaturdayJ.ae out of the State ra twenty-two, years. Fine Fadeless FotografsFrom

Mrs, Truss IVnby."W. two.The total movement from Me. 8, 0 and 10. He is a progressive citizen of Av Locket to Life Sice.SMITH'S .

A. JOQVS of Kanspaha, memberof In tosh will be< about forty ears of Park and says that he is perfectly delighted -

the firm of Veuatble, Jones A Co., waterateluns. of which the Messrs' With every patehase of 11 worth l of with, that section. He U a STUDIQ.
.
1 naval stores operatorand manufacturers Flewtllen will ship lwenJ.ty. ears. merchandise we ...m..n you 10 poa'ttds printer by trade and was at one time --- -

of lumber was transacting bu l. I __. _- ._ -.n--____..,. -_._.'_----._-._-"-.-. _-__ ___----_.,_--___-__ _-_ best Granulated Svgar for 1. employed by the Hill Printing Company Some
x t ness in Gainesville\ yesterday, in this etty.PINKOSON. Men LeaveAn
READ THIS. :20! -__ n_" .y .n
Educational Notice-If you anticipate 1,000 yards yard-wide Sneetiag.
Estate (for the Widow
\ attending college\ aatlU for yards for B8e. DOING WELL.
the, purposeot taklns any eour year.* whatever ])Tiit-' ; ALA,.,July 13, 1899. 1,000 yards Checked Homespua tUc ,, ,

do not fall to see. Prof Itrinvon<< I*. }:. 1V. Hall S,. Louis.Mo.-Dear yard.. Urveer His Direction a Great Numberof To invest sod lose, or as a temptation
I and talk It over with him. It will pay girt XVa have been aelllag your Teiaa I 16 bolt. boil 10o Cheviots for shirts, Place Have been Cleared. to speculators. How. much
4& Hall's Great fo ;this .. at (MS yard.' better to leave her
yqu. Wonder Discovery, *
Under the traction of MarshalT1oko
&GO( >yards iMrkCalicoes, special <>,0ald.
"Work I Is progressing nicely on the two year and,recommend It toanyoaeafftrlog 'f. .oo the good work of clraalag up [$500
DeaD .residence, corner Franklin and with any kldasy trouble 1 piece Jesus fovpanti. 9Q yard. premises sad plaelD.'MID. in sanitary or 51,000 a Year Income

Kast Church streets, Ken Gainesville. .being the best remedy ';we ever sold, 10 doses t>btrtsKworth' "from&Oc to$1 U condition eonthsoea'to P"'<<"". The ; for Life, or for 20 or 30'Ye.rs"- r ,
this ale' U4.
This residence will be one of the hand Yours truly, J. R_ Yowi !lee, guaranteed Navy Blue Suits officer has bees successful In havingthe

w oinest and most modern in the city thla sale$S 99. majority of the places cleaned We will Mod JOG some (otere.tiag

when completed. A TEXAS WONDER. Loaded &.nl.Sftt box about the and ,ia one instancehas information showing how small aa
square
: lOdoaea wood Wah Board..fidea h.ajOOQ I annual outlay will yield a perm
,.
LaFontUee of{his
Miss Katharine One small bottle of the Tease Won yards Bae embroideries: te be aad carted away several "a oo-i neat yearly income for anyone fat

pie Is* ia the city and will "c1lJQm..1 i I der. Hall's Great Discovery, urea, all sold at half P""'.. loads of paper tad rubbish some of whom yes tare' to provide.C

A here as the guest 'of relatives and kidney" and bladder troubles, remorse 5 doaea Prv.ident Suspender to be which has bees laying about th. plae

''kw friends. She has Just completed a de i i gravel ears dlabetee. aeaUiuJ eaatojsions. sold at Kta.Do for mo.t"DOl" oaly aa eyesore to the I i W.r L HILL & W. B.Hartal .....p+, (.

; ligbtfol. stay, with friends In DeLand .weak and tame beaks, .rheoma- public bat detriment to health I Agents The &VTt1.iL
mis this, aale. It will .
and tjoateiaplatee a pleasant fait in : tam uiall irreguUriUee'of the kidkaeys eoatiftoe thm. daya great Tkarsday. Friday Officer Pinkoaoa requcete The Sun to Life l..f'&JIftO. (.*ef sew lertt,

, Jacksonville.-Timee-Ualoa. I and bladder la both men sad and Saturday, .Jan 8. 9 sad 1O- state that be will at once proceed **'uhan NILTE.'IT1LLF a t s: FLORLBJL: .:,,

Oliver J. Farmer of Browayn, editor women r>'Iul.'*. bladder troubles la rala or ahlne. Webs. Just Baaed a tnep"tioa of private premises aaduggteu .._ __
} d tad publisher of The' tevy TimesDemerat. -I I children If not sold by your druggist. few pricee. Cone sad Me yourself. that tenants lot ao time fa "AT-"Sr - Sh {

1' ". war ia ..this city yesterday and will be 1 swat! by mail on receipt
. made The SUM a fraternal call. Mr. One small tout U two aaositha treat PHIFER BROS. aaaaitary eoadiUo they will be. lietd. .
t Farmer Is one of the best and most m.at and seldom taUa to perfect acare. . which will aaturally prove ad.trineat. r,.. eool f urniehedroomrooms at Oe.aa
Or. Ernest W. Hall aele maasj.faetarsr. view 1I0MI. 1',... "
if; 'conservative writer .of the Florida P. O. box t 2*.84. Look Ko. NEW YORK RACKET IIaUa. J.Jp tins".
:
'
.. riYiWpL ,,
s
"' excellent. : It U hoped to have all Rateajtottt..P< .priM and is mstloc a . piper .M ford "tlllWllla'' Sold by all : plaeee elraawttitia week, soak rooas. Meals. ; '
.t ... .
S may >e .
I
'. J< ..!'?' .''TlaterAoaootstil 1i. PkiWro! Ooraer,'sl3altiavitltr I1tnW&?-. tie axt.' tea days.. ..1:&dour.. w.&. L N1diIJ IiM, N,, .; (t : ,'
\ > i' t .... *n+ t r -> 'bii.t't.tJf -' , ,
g 4 ii ,J '.I :tI '; ; ff,- 1fd <:.e.. ,Z'.,''" l','. !it.k., ,. ';i.u"' > ftrt''f....' ..I'f"':'! ,1m! : i.t',lop!'. ',p" ., "'i1f. ',:'' ,",,.. J \ -r
1'I'1:\:;:; '={; ;(tI.t'"ti.a,1! f. Jt' }, Jf. .. 1:' !















H. H. %I (3ART.UWSWendfblS~
W. WA SELWT. A@MftSeb26Mu

L OV 114J -DRUENY. V~ titaVelmi *wm.
F. X. P"Mw a OSet. cmpads

s.ew."SiaIL ~TOSWUIM"O

Not V04"" mevw#m..bse


Smiling sMOD"nIalnt%01 en. asgs"ago
ft" &adlee .15 ago" far si
les a.
nue ow Wdieplay 6sdwatg taftmg asmft
a,-mu.
The Twice-Wekam UIs bVIP
wislumapapr, e~ so sd
Thursiy, m esad eallebSOI Unad,, te
was.h, l ft" "t ad Polak. a" V60 be
Mailed, pp ahp INso aderuI ofIaeUsi~d
Ms" or nsisb, ofIlI"* ya pr-46ad"Aws.
AN udar0iisg....... ,....AN.di. 1tr ams

be Ia I 1 ed40.p" for eivwlm"ims& .
uosm. Mu, TM RuRLYSUN.

The low prebibiting baseball sod
flbhlg o@3 6day, It IisStaged, does not
* go isto se~e@&Quill July let, 190-1.

Tb~t Rosglan leader, (Jsearal List.
Vitehe Iso"m~emt of victory In man-
sehrla. He possibly means victory or
* death.
Hon. 0s.3.Nol. I was nom inaited
foe mayor of Jeeksomillle Il$e she see
.31 prlimary Wednesday.- Nolan had
1,9101 votes, Tomer 130166. Nolan's me-
joety 3a. -
Nassewla has eleeved Charles H.
Blies misperof It ha iy by aa ug. me.
jorill, she "so ebeling tdolargestever
psflkd Is tat .13g. Th* 01ealo inhas
boom ASthe ddeest" Is the MOM v~of
the oily.


of "M* i ,
aot tak an
i part is the ,, of ope pew
4OVtha 3p* kB Rsnt already
dead fe(or. A bI PtMe Based of
Oastrel priMd t PisMMill,are
s lst aesive a~p@ l for sueh pol-.
im. This bea-, ltghIer with the
Wl Dosea of Salr., has the li-
Sl6 ift iH00 responsible
d"o to pe i t -esesotl the site
ft oi"I -Wiunes of learlins
pW ie411Aqtb&Wit, besides various
met d laloe.
.j~jdItr' e tprtat ion of the
,I- '*i "Wiser" by our so
e fl0 f the eM ase of Bslate i.
fel. yX m vs. Hookes, judge, 89 Fla.,
al, ths beas of control Is idispola-
iy a sitll ofloe and the members
thereof ae oivil oilers.
itloo 6 of Article III of our Con-
stltelion provides as follows:
"#No senator or member of the House
of Representative@ stall, during the
time for whibh he was elected, be ap.
pointed' or elected to any evil oflee
under the constitution of thi State,
that has been reA ,d or the emolu-
ments whereof shall have been in-
ereased, during aose time."
This provision of our organic law
would aeem to make it elear that no
member of tbhi Neest Legislature is
eligible for smmbaship on sneb board
of control; and we bave too mueh oon-
fldenee in the devotion of our present
governorr to his doty under the Contel-
tation and laws to fear thai he will vi.
late either nla the discharge of the
grave duty to appoint an absolutely
fair sad unbiased at of men on soeh
board, regardless of the previously pre.
pared slate that may be smashed
thereby.
TEDDY NOT WANTED.
Aesordinl to a report from Washinl-
too, It so evident tbat Preiden tRooet-
velt will eot be asked to asset la the
peace naeotlatioa lan the Far 3atM
When Admireal EqoIst was netiled
that be ouMld only remi at Manila
twenty-foer bouns, It to sid that she
Beer bowled and declared that tbe
President of the OUted States was not


The Peoaselvala Railroad, aot to e me. -He has osed the i e of
be otide by the* Lake eore, h peut all the Ries ata vt aat l Saloat, with
on a tral between Hew Yorkaad O* lte sob.marlmeo get to oar fram.
aP that makee the mrin a sitooe And for e omplyg with theo etral.
beNr-lhree eonrs leae than theII law he is the oubje1t M of a bier#01
Twetieth Celtury Lmlted. iteek from she Os t e l orgsn.
Bet Rastlea attahe ae s very dam.
The Penaoila Daily News le slightly P".* sad if oer puaameleou Prm
I onrrNegaledig" te sunday Mdnt e help mtake arm of pea,.
mae law paed by the ei slao tare. rhap a Ia d oethingd to roate
It dee not laelade bathlan on da. a row. The e s. Tedd* y would juM i
OCanllas h maex teo dllalisaas sa d as wo sto pa e.
law that would prevent bathing woblid FAVO Ai.NEVL.
be of so avail. lAVORS GAIN8VILLE.
Oaymor and OrDese, who have boon The followlg ftie The Lvy Timew.
maklaig ooeemdhe trouble over be. De t, n.lis aW t asBroo e z.
iB oetradlited from anada, are BW pra'theN0 e0 mas dof dlitr Far.
is the bands ofl Uitd itles aeWl mr l? d the ekeeol b Lard of Levy
aad will have to stad trial for their osy. Brother armer is a gt
swldling operbutias on the govern, an of eellest p riseels sad his
most work at tarvanah. opialo Itoi 'IegNded of ab worthI
"It to be hope" that he State Bast
Chicags i bound to keep op with theof tl wUe
times, althoughln"dolAke Ke 8 salim and will legate siM Usnvrsy of
ip,. Instead of the cma. A low daiFs lord aollieS ,dhebao oloa.
a aeee t stand moest ntra ess wheel
age they got up a otat wage t oa tFlorida. IIs Gaie.
oillpled anything ever eeon i i freshils$Ol i smelain
waner, the wave rolling up aboeit hw espr o msoren
feet high and dolag moek damage to bh Led ofv Oot shel ear aIn
property along the water froat.
neion olia oo ely ll aly siada pae-
sition in behalf eof Glaeevtlle. Let
the reseas wind 0d Mi S tormse toolale"be d Ginesville."
hat have swept over portltoe of o b
easier and Mlthibgal ore thbo m e
sevor or manW y yan. The damg The e he I
ia Western Niehiga will amoseal Oa m so be mased r tov obina
At00,000 At anieag. Mi-higan slea sod other w esi ofth k e ar-
Taesty, 4.9 lashea of rain fell. In rying uO ptiatie watFw e en me-
the aOwtern portion many buildlinge kanbteen that are Saugt o the high
won blown down. e
.T....h e iekla tar is trying o evi
Theo iad tal edltiom of The aao sh te people of Maris one s tAt the
0lo Daily ews, el s ed Tuesday, eo- need a mew **on hese. Hope e will
taM Wt1l pagal, printed on high. be *luegesfal.
gedo saaml beak paper, well lie. -
te..s, a- -Manesl m.ay hc&r. nd 5.* r o, Orrv u .an s
nllmlldall fom or i L or S w. 1m
Sss. "ws %a be Proress. of t u, taWAS w -aI *
basdtag ammerewseater a nak 5. sh-q makes e "th that he
hbogpoant P esinse s io one ,It h ,. ioT puma of eow nof IF. a.
110 1 of the oh.Obe*L &Cy I Os.. dlig b eelsIe t e
diy o Telide, elg and lMe lesw
The ellt Amedma off Philadelphla sed, s.d that sia wi Inp Me
saeMre ll tor s of at the vicotr, *, fo a11111 01 DOLLAS
s@aamewsed n OI the ring" *s i. ,a& "and eowny 1ofeaofn
OaW dig whos emostio wish the ea.. t- be ond lM*me ..* -* hia
so gOl p isemeof tho memt st es. CatWare. m A3% 5.J. ST.
m^i euuate is th stasi the Q' Owtworsa bo b bs an ad Bmu-
tio in,--- em h-*isB a ft
?e Tw 3f AwM 116- e s.jr A. D.a Il
I IMeg i lth pWl eof ot (SaiA). A.V Ie .

mieanl and- w11e iaeV.2
40 11i I UMD 4d 1"G alegd0i do'00i11 W1
U. mme ewa 0 We The, s G0 a
aa l 1rt1 Am01e1a"s has F. SNO N.


At ta WerW n ias as
we so a -etonea l mt ill -
quirlag absotib prieas of ftta l
In Florida. sad elso debited to fow*
somebl6oglsvogard to eop sald the
priest they berig. There is plenty of
lied solseeM for farming purpose flr
sale here, but there is a one who
makes o MaW to boom Iseb land.. A
little judleltoes advertlenlo ml*
bring many people from the North asd
Northwestto Flnrids.

The State of M isissippi has declined
9he offer of Aadrew CCarWpie of MZ.000
for a library for the Ste oUniversity,
provided the tsate woold appropriate
a like som. Governor Vardaman says
that the ftate is abundantly able to
support the University wis4 anyequip.
ment it needed. The OCarolie dos.-
tione have *srinog to them that are
sometimes rejected, and the State of
Mi.ilslippi evidently desirec to be free
to do as they see tit in regard to librs-
rine. _____
Tbew ond""4 3e.
Near the little village ef Baleigh, I
Magland, there to a follow, saM to bave
been eased by an earthquake eas-
tNrte ago, which is said to have vwal-
lowed up a whole village. neldlag the
church. To this place the village etof
Raleigh were to the babit of repair-
iag every Christmas mornial puttia
their ears to the ground and llmimag
as they asserted, to the char Mell
riaging beneath them! What was geal-
ly beard was the bell of a nelbbortin
churcb, the sound being borne alai
the aurface of thoe groe d. TBis e -
tor was in existence, we believe, as
late as alf a century ago.-Loade
Tit-Bits.


-4I


'1


--W-s .-

A POUINWT PHYSICIANS
INDOSEUW
Dr. A.J. IHmwha-h p aof Umao%



two Dafs, ifsee AwM M ~adsd

kilrdSaw biumewtC4&
"Som. b Lea 1 .A*


- aD I- 9 WY
W. %T O3iNsoq SZ9G-*,Gea r ev1-13A


D-eet Cadde Rubber leafto. |F '^^r JmW^ f% V% V% ^ %AV^O
Of all the frek remeiles that m
sometime propenw4l for nick bot-@*
plaits tbose which are r ommeadd I W I-- i l i
for rubber plants are the worst. They |m
run all the way, from applying btef-e. il o E A W.UUW i 0
steak and castor nil to the roots to coat.
Ilg tihe laves with milk. (live your In a Company that is Reeponsible, Have a Policy Correelly
plan a properly prepared sell oand Written With Liberality of Policy Contrast and the Oompany
asuitent light and keep the leave free Pays Louse Promptly
from dust and seal, and you will lBd
as nwevilty for such Mnetrime as
them. Make lt a practietooeverl Yt lir
plants daily with a soft cloth and re- Y u A rV I u
mroe s7 IndieUon of dust. aete or J I
mr anytldesoutr o IJft la usarie. That no serious lose aan overcome you without you have some
lf eieref age. .



PINPLES m ea h \wh\
aIMM Nes but Reliable Oempaies Represented.


A 1I. CUSHMAHN,
il. ems lalm stle rfy faunmlsed. OAnXIUVILLz, FLOBIDA



SM PARTIAL PRICE LIST OP

fWliskies, Wins, her nd IMalt.


H.. EYTAR *".



noTIVE IUUSS


"uMp-son"* Wy AD
riLS aSON" TA b b

Fm lob by J. W. 3u00mieb ft.


mu PMffAIR


bssmme 4 GIL


w .. ......

IV..........R
. .......3si



Il. 8 a3


so*

so
eo
am


4
eo
so
41
bea


viea

so
9-
low
90
ON


Ballk Geebup Pies-lad PpLid
Rio. ~rOalu
3,. Is. .u. of wis
-64" Rye353W. m

"W'UN Rye.. P ewe Drops a re. m ewi. 3 m
IAW ST.U Pee Gl$ HAM er
m g g So .w 91 &P e ar
m i .. .. .... .. O
. . . . . . t o
... ..... ... o
. .. .. ... .. ..


g Adweisoa AU Gas3. of Sm


sms?. ruAuuuE um Usel


,ruoms. I PY


JAg 3LL


H. 3. TAvwa, Clw
Las GnAmAx. AwLtCAws


FIRST NATIONAL BlK


T ONLY NATIONAL BANK U A
:THE ONLY NATIONAL BANK IN ALA HUtA(X


*a and UadividW .0.30,000 00


I vu. B.F. JORDAN -


INSURANCE


PORTER BLoCw


C


___


I-- - .- - --- ftlm


___ i ____


Fr, W ,


O&PD


AMAMMdsmm m








7 i ., "


pp

, I


MOL 1I, NO. 105


mr= -s-


1tAMS 4-...-

MSEVELT'S ACT


4Of fthals to Allow Warships
. TTo remain At Kanil.

VLAM H4aS PARTIAL TO JAPAN

unmlasn Press Declaree That Their
Cewtry is Now Helpless and Powm
oeles, and of CoUrse Ther Ships
Must o eIntemred TUI Knd of War.


a. Petersburg. June I.-The Ru,
*ga presm. notably the Nevoa Vromya
Ape T- Rmes, the latter frequently
AMggintf the views of the foreign of
JM, display a great deal of resent
a*gnast the United Btates for en.
itlagl tbhe N-hour rule in the case
a the three Rslas cruisers at Ma
-Sa. The Rase quotes the American
iatrti y regulations and contend
that Plsdeat Roosevelt In applying
he prtancp; that only Injuries re
elved during storms. and not lan bat
tie, ean be repaired In American
prta, not only narrows tbe American
gonlstonsa, but infringes recognized
piselples of International laws. This
ppe' declares It hbaa oclal warrant
:-*r the statement that represeatations
have beta made to Washlngton on the
eSujet. The Novoe Vreuaya sy ex-
eeodlagly sarcastic. After a slap at
Oreat Britain lwr the alleged manner
la whio bher veasts dogged the Ro.a
iotan fleet from the time it left Croa-
.atedt and for trying to force all the
power1'to a Oept her Ilterpretatlon
et the rles of metralit the Nyoe
ViYrerB.iIw^ethat Preewt Reme-
velt. whom It reters to as "Mr, o-.
velt," coatasllated by bagland's a-
ample, arbitrarily laterprebt Is *own
rules In a smea favorable to Japan.
addlng:
"Mr. Roosevelt takes full advantage
of the fact that kRuiia la helpless and
powerless to do more than prutet.
qie Japanese niulister ih reported to
have hasteard to Ixptess hli gratitude
to Amertca for this act of mpartialli-
ty, whick lo partial to Japan. \W
trust Mr RAoseve, is natilled with
W8ls swco"e"
The admiralty, it ans be stated. la
aseoilled to the Internmeat of the
i.ree Rtsitas eruiersa at Maalla, but
appoesa. on principle, the role that
qarsilps tajared la battle eammet re-
itr their maobltery and beh le at
MlWl ports. The odelale add that
'fatoem ever this mimor qiestik wld
be easeeltagly amfertuate Jnmt at the
'tt that Presidest Reosevelt i as-
aeming the drilcate role of trying to
Wbriag the bel!igernats together.

No Mere Patalities Repoted.
Masila, June --No death have
bees reported smuon Russian oSoers
soldiers sle the arrival here of
thre cru aers commanded by Rear
1btaVst. Ameog these who
marrow oes pea from death isI
Nroeholtl. eam aader of theI
as whsk vessel bsbat heist'
hs a ag after the Olg had bees
led W7hile C1Atas Nbhiasta was
the m astas tower a shell eapleded
b. ut did tajre him. LbaeW
left the bridge of the Aurera Ito
of th $rst Oler "O west to
msia ed'a a ersae p te
wrkt of eMuMesag the an the'
being e oa re, adofareftr a
wenassM and killed. O ble way
matsa ec-k sat shell emW
ad ar (Capitals eboleta l
fragmasts bi' k' three I the
~ *e I teh riagt 0*1* ad s toI
1igh' ask.* Tbe eaptali wa
for a ew myaeate .e. ee.I
qun.k'. re, -,,red s4o promedI
after the* eAd4 He aft )
to '1be bride* ad nat
e aomuad rhe Aurora e tlbt
aly argicral aid He nOver
so comms4d 4f e tear
partd of the *Got er wblit
we btr. C11 sers*e I
-e rwa sad eseie a L-


U lb.4 p S.- M r a
5hIns y


GAINXSVLIL99 FJODIDA Ij IDAY, JUNE 5.,noe


I *eghty manl frlee me b l beey. *a
te* -Mtame- to We- *u. the
B-,i" tr- Mpet tSa. weadtils
ity. aftr U the iMen wre *Ula-
lead. removed hi w hia ma Uthrew
overboard 411 4eag of bee1s. 1i bale
of settea aad I bamn of satlmmy.
the o edams left aeS ls nmmety.
statlag that the seamer warm leaed.
it Is supOpe that they resolved a
wirelss meassa rew rdtag the ap


proach of Japanee warships.

LONDON RSCRIVES VOUNG KING.

Spain' Ruler Enjoylng the H epital-
Ity ef Englishmen.
London. June 8.-King Alfonso to
day visited the city of London and
enjoyed the hospitality of the lord
aiyor and corporation at the Guild.
hall. For the Gret time since bi e ma.
Jelst)I arrival In hglaad the weath-1
er wax sufflciently Gno to enable him
to appear in an open carriage. and
for the flrst time an)tblng in the na-
ture of really large crowds gathered
to welcome him.
The welcome to the young monarch
was of the hearUest description. Tht
route of the procession, which passed
under a continuous archway of tags
sad flowers. was lined with troops
Halts e're made at the boundaries
of the drift boroughs to receive and
answer the addrea.e of local author
Itlia. At seeh of theme point ths b
decorations were of an especially elab.
orate character and the crowds were
large. Klai Alfoaso unrestratnedly
showed his pleasure at the demon.
strative greeting. which culminated Is
a scene of great enthusiasm as he a.-
tered the (uild hall. here were as-
sembled a brilliant gathering of me .
hers of the royal family. cablaet asl-
aters and naval, military and court
ectals. The city's address of wel-
ome was presented to the king la
gold acsket.
Kies Alfoano did not reply to the
presentation address, which referred
to the admiration which the cillanas
of London had for the art and Iit era.
ture of Spain, sad thb services of the
country nl the cause of cevilluation,
and which recalled theb commercial
ties unitain the two couantrles.

VICTIM OW "WIRI TAPPERS."


St. Louel Man Claims He Was Swit-
died Out f $00A .
Chirate. Juoe I.--N. (,hc'n a weal
ly jus 1 dealer of 5t. l eise. Mo.. baa
reported to the Chicago pi..the ose s
af T7.8om by a "*wIre-tapplag" sawladle
OAhes meat iw m Ito St. Le As
sad they unfolded to bll a etaOerat
pMs to beat tbMe me wht mwe
psgroee at the Ldato8i (fraet. i
ame to o with the e* se ad
they tomk le to a rom la a b1itdag
seer Sltosetth Mtrt ad Met a
atease. fiere were tafarlte .
trmoal ashery the ad abe thoaghf
the meea e wr a iAoo d ae. *
three day he reaileo d lher9 wta
the perty. bDrtma that time be a4
raneed mlrp sie of smasy, ar
atisg WT.MS. a. (b ee a of the
ave mea dsappeared The a o
tra.e to the wheresheoa of te swis.


Deoicases ROseam Per Reeiv .
(*% Yora. Jne 8-A siato
the la 6s correaseaodt of Theb 1oaa.
the rhieft ans for ftret MNiater
tm ca~e's reaigatu was seAt the
state of Maoroesa abe. b but his r.
mes: to laIteresteoags e WO Aby-
aslas raa'i)sa bihla tno ame ad
Sgload. th. e-re*piadsst aa-ia- 4
lae oase1a. iabme *e


e inbs. in eest to theaw l
ways &be"te I is mew expaedoo

saw *~him eg*he"s roesafto
-oft hase* mw a 'im mewThe ws

Saw 49 &bfJ&UaIf- sew Jigs


mm is belieed
of on& Omak sot gu

m.le i owthe Smy "a

To=t hwb


OSCAR NO LINGER'

KIV NORWAY


8torthing Dealras Union of
Countries Uaolved.


KING TELBORAP MS HI PROTEST

Deelars Aotie oIs Uc tUed For and
Delre a Oided Protest Made.
N rwlegiane Se TIhere I No Feel.
Ing Whatever Agaist the King.
Christians. Norway. Jun' l I --The
slorthing today decield the union bti
twin Norway &ad Sweden under aono
king to be dissolved and that the
king has eased to Wst as klug of Nor.
a Thbe storthiog further empow.'
ercd the present state coniell to iact
as a goverunent of Norwae until
further notice and to %e'cilee the
power hliereiure app'rt.iIultil to ithe
king
An adilreci to the klti w s. aoilpted
declaring that no ill feeling ws e
tertaindl agasnat him. hie diAn > ety or


RING OSCAR.
the RAedlslh s*.., SO *d eking Iause
to cooujrate in ihe seeITItll. oel a
)oumns ptsee of the> loi eu of b. rta
dotted to ocrapy lI. thra efr eo Nueis
The diaauluain f he eonn bi.
tween Sweden*a ail Nirwey haa be,-a
pediang for somifaijie sad had i '
growth la the di %Irl whblch grew
tra ger as Ute aissied for th. .e..
ailabsmeat of a pirate eOsauiar s)ae
Ilas lor theb t-*e ,,,autlesa
Kiag Oear .: c.eoUy eted at
StkockotL th n. aasurp nwiested to
iB by ohnear;f ut el prMvidlag
w searate cosa i.ar apasIatlves
Mad the Merw*atsna mltli* d that
Sb by aS doing Mi anrtly by
Wt ani fro& NuraWy l4 sue
aded hla rights adsd t so kbitg
f Nerway. .
Oe of the causes of I desIen It
w*od* aAd N7O6Or r Ouar tea S.
Miar system was thl aaet that m *we
In is petectioiats aad xway ril
e frme trad aad al e W as. af
letwaf *mr este ygr ri a wa



semmns UleJrmpd Shm,

md wIt de"a eined Me Mns..s
* rteseles:
* Whera sft thb* maN0 of gasI
se elof sl:e haveW" do Seer
u4.


I
I
I

I
a
I
U
I
a
p
C
U
S
A
ft

a
ii

S
'a
T
U
to

N
'4


-W u' hi bmbjaeyd So U t%
doeba dNampa %Domse f 4640
a bewIsradesei or soaspury.

"Wbmm te atfm q
Pow" sm hWWmspowR
stwthg0*usbw as ftheaft C
Se avtl of sa wv-ia"--- W
so, MSo lotew ss l

of teho low sub m R
with Rewry

OM6 am Defsei
a n u p I M M A M W
as lie W,*


I
I
I
U


a
S
'I


TIN OEMTSiAw


bora the addre-ss to the king It iso AC MMn.Yyp IU
ag: e that the strothing will issue
a proeeaiation to the Norwegian peo
Im rlardlng the dethronement of the, PLENARY r r wm


Telegram From the King.
*ltokholat. Sweden. June i. Kio Looks Now Like SettleU ist O
Oear has se ml a telegram to Premier
Mieaeleon a flows: Strike Is In Sight.
"Have replve-d the omislatleoa --
of the 'mancell of sIate. ANOTHER CONFERENCE CALL-
Itecord the most doMeed protest
against the avet hod and aetios of the Committ PFrnm Strikers Will Met
goM erinent.
n.o.%._ ....mpleyer end Try to *ring Ablht
FOUR DOLLARS A SQUARE INCH P00-GO times of Meeting Will so
Watched With Much interest.
Fabulous Price Paid For Now York
City Property. t1lhcago. June 8 I'' Peae lrmlotwects
Nt, York. Jtun, 5 -The sale to the la the tomeaters' sllk,' th Me'r'anl, TSIe ii a (otillnpant) of HI Imltli, Ilese of life today the teamIta sll 1Joint
Just reims tl d of the famIIouu plat ol coninell havlag agreed It iacilept the,
iral ebllat iat No %%I a' l t.rei. t to ihe a siloyer' indiltias fois another con
eorneor of Hrowita%, has.. tven rilse to fesin'e.
lnltreasilnta great aeii, Is iprui'i.tI o ee inu t hI' mnr oif *lselident ihea. I.A'V) Mat)
cit) At the flKire ,namd i n i pn trai' linS ,vr,. atloravy for the nmeich.anti, watnu
arthin. STea$7 .e t ii pl,' p 1t ira19ght Cm,.II that a oonm lltM iteio s ,auing isl
about 14 an hquali' tInch| pa1l. l|i'he nuis) poeaers woo ready to n i'et a esli
highloet price a r pait in phd A. as I las ronialtl*e of employer It 'as
bistor lThe |iroprlo i,') Ia.m- uirel osun i.t'i't Ird the employers will r111 con t to
"0 fe~t sin thpe Hsodwsy side. and ihuN c olif'ernce. po"ssbly today. u this
a frontagie oun \'all 0. eet uf ':; f,' bi.4
10 Inches it ut', iii 1,170 ..1siie i l I' 'lnt Walkoer 0. (llionl n of thi
le 1. 1 i. a, N.is n' rounilcli amedi tih i e l I 'i .
Tilw in %I Lt L', .'-t ltisie, on Irieal i* r > t eitalivii on the ro.ueihtlI *i '
tale trIrtisse't li Iits iinI it> wa s that iniv'iiil'i of every nloae now alffer'td
paid in 1117 .l h Aslntlib J Ih i elJi e iir b tire sltike. Ilrcluding the ucipaer'a
Lbh .si'e of the' lurgain baikligiK himuse drivse.r
at Ilrolea aet lia ll ..'.si. T'ile prruop Thre Ival of peace l hopes walchi
trty. lu**asurlut TIT nweisare' I< lt. w( e*'xpe'ted would poestpuis., for the
lroughl $3140 7 a i.ilarrli fooit oitl-l timi lreliia at least. the inipeadtai
the altrIti -) Ahe oitinseltie lid the' 'It 'i crlsiln eolwiren the ea si ow pers sald
t'cinllli l olitractI the trui ck dftlrvrs Thoe uniieni bad
h 1 1 lhoar I Ih,' t'h IIls I d it'til i at ti.i to roej ct thi ll arlitration pro
I have s eure ,I lisr our citnllls ltheio In- posil tif the owuare.
valuale pilalce e r'tal a-lIn lI IIh* Whille the artletos of sthee Iriek drtl
whole airld Tlhere ri only oune Broad.* we was a shock ino the tl-m owners,
way. onl o.ne` Waill street and onuly ones It wo not( raslddered lirotlble. In the
No. I Wall itret on earth. It Is like- light of other developments that they
ly tihl. Se. s.nt lne..a will Ibe allowed would oo a ovenieti(t at oncef to

l t111 I tle a (lio "'140. otf usrse'. lock ouat th 18,000 driver iin 0-",Ir '.
the e,|1.1ri> 4 1 !:1 I Ic I| I s | eel III a pl ) a
1 .tl se11 e .11 i0. r' il ti A :i l |i i. ItsIq Milnll


TO tIC1siv PAi'j: J6n' SOD o

Squadron Waiting For Ships That
Sear Romains of Famous Admirals
N'-l '.ir irk Ie The' eoned
itwtiatritn i lh, \.,I ri Atsaillte lr tl.
Cp latinl ii of I t ,o ie ; s re|d tr Wsaer
ItruuIal u ld the ptooteld eraslerM
('hallitan.wss, liais '*,clsa and Tacoma.
seletird b) 'te tin> stitlparrte t le
eeort the* remalis. of Joelt Paul Joe*&
from iPranre, will aWeI the vTomwsl
fre ('hberboargc T'rierta> The re.
malea will be transferred to the reak.
I)m. Uar Admiral (' I Stasheb, who
*a I s samead will board his Bas.
tsip of TomphlavlUoe thig aftersoft.
At the 1 reei il nsfypas earp e rs
have been busily eagad tu lthe B
ft aoompletlan a platform whlch Is
lel the "Mabgapsy sarmoasbaggs.
mealag thei ashogasy rselis Iat ila
to rsele** the leadee 0*sa Voulataltsg
the body of the Wmmateir of the(
IMs Homme Rrftlard
Oa the real at Cherbmrs the
OberTide *ill be pet by the *earbhley
that aee so paielpes. is la t e ast
tribute Is Pre*b watesw T*- days
aftsr Hts arrival the renmari, .la hi
taoe to Asalpoul


ft"s Ciemte en Soesh.
Alewcr fity. x1 jae m s e
6My have Met deat6 by wssaflga M
the hseeb h,.b .' %v, meveof ri~a
Rise eDWillim jert, bokt of
"bs a aped 4v4 sa" A fyee.rs, vreep
"Off The beIGsbad passt*o1a 4brof
heap 40.(0 e6eb &hick wetv* to ha
11" to busid a mt,' They fGs a

lute ~ 1 braer 'h c.sdanIeg
kwr If a beipvaid Shot theyha
matsbve, f sqthe I" bwwe* mom
ls Mad hles he G" e"a go"


51rl the 'cr *rl j
so Mot *pro elommm"~
bpshme h *woeeg"


JeoJm -4

nsaSdsiOr -wow fl
bilem 14 m e.


I
I





I

I
I
9
U


RIturn Proem Fruitles Sarch,.
NamhtVlllu. Ten.., June M V II
.a)*. a wealtby re-sidenf utf riank
fla, hl Preturned from Aiansass anti
Indian Territory, after. a fruitvlle
searrb for hibl IT)earoll son. Niles
P. I MNaye. who disappeared wbhllt
ls N1ahvtile Sept *pember 10. 1-04
At the time of his dis"pearaaee
10g May9 wasa ravlngl forS a Phi
a1oe 1mwara. Mad hbl o seeas were
o taod to be eorret a every detail
After spadlta aboit e10.19 l
bli M his b m without obtals
I* the lNaIe elew. the elder May*
baa rrvd a4 the A hlmim that thee
Meoth w aamwd m1 1 Naashvill.
*PMbi hwM sad his bbody Ibrown
ai the river dispeeed of is some
aOber way.

L.Wao iveT oWMe GMkAs.
L", esifwl. JWge &.-After *em
pislat a Jarawm s f .M0 llles wi
t mlISape *. o oWist w,
OVe. if the 5aspeat Is the
W ers1e`1, 1Mi 1at obstruetes
Im 0e W aa 11 8at he
hms af ~t. Copataa Car

"b bd the paperty T
1 1110 Of 1eHdatd CIeM
m 0 11110 I Wo rth 1149.11.
a" me P e i-s- i fIm Nmew Orlesa
N* O W mpy eal barge.
It In at re xoeil a s" be
USU^ .-hbI- Oough thei anal
ItoM kJ am "as" aw ftn

i n o asn ame lfy.
hlas L--Mbiers fream
aM d the Vs9aMd Wltes were
B aMtAB Cdftj M She -a*t
elo s akd ast waves
bm d do tird agoi eMo e
e asilbems' ".enak be e
O of tm mwow a" stelm$s-

B tsW i tertis the batter
M gi fte la ae f ladlap forfeu
1.


PeihusA TWOs Cernbeeth
Jpp. 1,- -4 fselsa Matp.
ti Wf r 6406 0bedood aasa prim
ow aao I,'er p sene arisl
sm~e" ta"tso e@"eds
SM~smumresao 48=0adeath
~ *16 dAaRMr h"" qpa la.~
~~.r~ is ba m ma
~hrnA

MAN


"UI\''


,1.?


.


'1


O


e 4


("lly-












drblm Isb a

Ie.H." ,rmatrk d W.
elbvt r travellan frmih
lthe o there Rtalway, so
Irluade ina the Brows MtieM
y. Yoo fell"$ bvel
b6esa Is, Billy." ormed eem
r wlt, wrho was amticlpla
oI a ez xingl naatae-sed
mad1appeosoed.
1i 1as t his way." costoluad
no, s lth a sba.-
1ea aln his mthk *ohm-
snwy *bim 1 iaksn of Shie a-.
It No e w my hair aued ao
1 -* a--we'l 'tflfal par**-

bl oopealoap listed in.
l Mr. Aper, who ls a gres
realod his ery.
daste before the elosia of the
on last Faor I wa is Zol.
It was a quiet aftermoom,
4 Man eoag ed that we go
ll TL. Thie perfectly agrees
to me, and eeorilg gla, we

wn oaly a short dismeu e from
Giates when the doga 'flusled' l
p pOlmeoso beehe what we
to be a covey, bat upona pproiek-
ahs pla. my friend, who was
.* dlsonnrd the biggest rattle
leversaw. Myfriend tookde.
ai and ifred, with thke rmat
was aqueivr lsd everything
iill. I approeIhed khi easeship
Sznmloatioo showed that She rp.
Sa the poeesor of seventeeno a.
I wanted those rattles asaoav
sad lmagine my sorprie sad
SORstooping down to separate
a ak* and the rattles, so have the
Ito make a vicious strikeast mFy
SIts head ame so lose to my
k bat I eould feel the wind, sad
eoly thing which saved me was my.
ina springing backward. My
Sdelare I sprang a dissano of
fess-but that's eay when a fl.-
Soaed, you know.
l was discovered that the fret shot
Ik he ake to the hoead d e ly
sebd himb bat another well diroWed
i alkshqd the job-and I have the
oes here la evidee." osddealy *i.
dmld the speaker as he produced
, before aayose had as opports-
to doubt the veraeity of the story
IM eall him down.
OROP WILL BE SHORT.
was Denby Shipped First Peaches of
the S lees Moday.
Owlng to the unfavorable weather
ditiose., the peaeh crop in thie *eo.
I It is anticipated will fall far abort
WkA wa at first hoped for and
alpatred.
frs. Denby. who owns a tweaty-
e orchard a short distant from the
i, Nmde hig firs etsffiamess of he
cn M ,aday. oatlodtag of ftay-*ve
Rfe. the frolt wm emaM b minawly
pod, sad will probably britag so d


*r. Deaby stasestht Ia the begia.
igffthesoomas his ee wee at .
i bheeahtag under the heavy borders
ili, and t elmpeaea a klee
|sees fully meatated fEmlt, he o.
pe I she bm heM ofa ae qes
p. The drouth, however. asrionsty
:ated the growth. sad while he
l have uoder favorable aeedtleas
aboes2. 000 rae. be feela
Sthat bhe will uot get meae she
owig s to the dwarfed eoeditles.
-r --j^hhddi --E - bitadtc-
se eaers' eta siiaiss whieb hb
SI-s pags tla le eltyala Tues.
* 1fl be e aeledtd odWay. All
O- ttme ue mu -s esaftifsa es
0.d t.ley l a b .Thma
00 doe epptheeas fe Seat gm e

S,,,iwestese emmese ar .
A for pe m -e sOeWN.


VW6IW.



anes ON- s





soe&*W mSm


SsbF


on to" -sva
-if.N


'lik,


|* i= f.. .n*i.. L




Popular School Teacher HaI rop



Which WM Make S i Yield.
Prof. J. H. Fulks.sthe veswhileo .
etest amd popular priasipal of the
Osimesville Graded arnd High Bhool
sad who hea be esoagaged i teebhia
Ia Ale kha sad other eoasti os ort wv
eral year was a viisor to OGalesvill
Tharday.
Prof Fulks has been for the pasa
few day at Esspaha, where he a
prolific farm. lls erop is diveralfed
bus amag other prodes Is ai treat ol
tse ma esof eaasaloolpoe, from whlob
the Alrethipmeat was made Thureday
morning. The yield It is aateipastae
will be good. and the fruit is eltra
ehoiee
This progreuelve eaherfarmer left
on the noon train for Olaser Hill
where he has another farm. He *x-
peota to ship a gross emay watsorel
oan from his Onsoer Hill farm, she
irat oooameast geing throol h teday
Nodwthstanding the long and nevore
drouth whisk has prvallied as both
Kaspaha and Cenoter Hill. Prof. Falkl
states that the erope are mat rlag
ileely, and he expects go harvel
abundant crops.
A DELIGHTFUL AFFAIR.
Kitchen Shower Tendered In Honor ot
Miss Alma McOook.
One of the most delightful as well a
most sueeesftl fueetioas of the seem
wa the kitehan ehower tendered hy
Prof. aad Mrs Tom F. MeoBath,. eat
Mail street N., eomplimeatary to Min
Alma MeOook, who will be married on
the mornia of the 14th insS. to Mr.
Haskall Ore Rembers of Laoeoo.
A large aomber of friends of the
youag lady assembled to do holor ad
the praeseat were as abundant as they
were u ofel, ombroelo almost every
hitsboha ulteal imagiasble.
The evening wuedelightfully spoue
by hoe who had the plesseo s privi.
lee to be preat.s.
SOLID TRAIN OF MELONS.
Twenty.Twe Carloads Passed Through
Gainesvile Seend North Thursday.


The heaviest amelo trata of the se-*
seO paa*ed throgCh .alasevllle Ther.-
day morning over the AMlantle Coast
Lim eram points moth. This stala
wea leadd xel elvoly with water.
mlen., mad eompised mt/osy-be
liars. I
While the hipmoase wore picked up
ai ftr seathas Webetr. she majeeky
at she tslts wasmodO p la the Otale
mis. The mhees wee 8i-40
wlepally Date oam mebews, Ondl.-
memm as e seesmo ha est bgs
- uaimless, peeamlMties am thae
this h alp t will belre Is prim.
Cures Old Sores.
Weaeemglnad, Kaew., Nay 6,. IM.
lalaud Sew Unimeas Oa.: TYe
ewo LUimes aved sa old ere e
doe ide of e caiU thamwso esoppm~
to be a e st. lTie a was abb sei
SW weM aw 9" Mt sovi mme uS
il I trld me Uiaimes, wihd i
he week Is shAuM es N ei ow.
M1a. is J. as es. sae 'I4t

ber a Me boals. t@ W. E. J .

SummWer TPeesriesA We A lmalk
Cems inS.


I




I
I


It yes satmpklel lslhtagl ui

slowe so od oo6 sisd~ewish mad
emma S.. -sounm, sm"O sa
Pefoh -Inu mee
masealebutse piwIU

ama



of MMA ginh od umNeow
aspo "asmmsis soa~


Uo~r wl ION
W. pu


P'M WAL Tg T@ SUPM J.ET
via skeabrdAir se Accn seem .
*Ia of I. p. o. .
Thbe 8meard Air LUe Railway bee
WMoN detami ad og lhe Floridla I1kI ,GN
A eltailus a the ireel ut 1 rouse from
Sfullo. It il the diteUdL m o u.rrrl0t i Aho*e all. U MS GOOD PAINTI

b Florida Blke' iapsl train tu liea1Ie sls sub w- ,
T ampsatSp. m. Joly &h. and l *-. PIm. oian oduismabuyld 0eu n
oasile at 0 e. m. Jeuy 5th The Seia
to ***4t of daiallsc lialt ear a d
drawls room PeUlman pleepers
through so utlae withoutt ebasp. f .' am d r M e
Tte m se of strvel will w v1 a f t- ai pear* .r a smhs toeinde eiu
bards itselfl, pMeasios htr *' meb Wie At wl s
IlSvashI, Oinelleba Camdo M sad
*~; R. r.3& P. to Wash.iaSO, STERNBERGER & PHILLIPS,
&ad PeAs. I. W hil gwIn so to B
* 151. Osly 5wOetSy- Iaaoen' lh OALZ TEV ttLT.. ,OZCDA..
a rqualled so nere sell p*clil iratlle
S arrloo. .
I iemad.trip ralm o B lefalo and to. o-. .*
lots frorem GalmeWillies.96.
a Ptmn e mSfree isianlId Key Retall Liquor DOeler Meet. Train Goes Over Imbeakment.
We" will ro-pehaMeO s Jacksonaviloe. Cicao. Jne .- 'he annual con l.-hliml i Vi lJune --4Wpriedtag
1 T lhre Pollustes WtMpers for Buo welion of the National Iqut I*kai of hI. ,l, o11n t Norfolk and Wet.
a fato llpostivelsleenl Tampa as 8 rs' assocalltlon begasl here today W- rt at lok.rt'i. t t under a dhlo-
Sflowilll polsislglose Ttwmptin 6w 0 and w0O wholesale liquor head,.,i rci I eld,. lt. caused the
, p. m. Jly 6ib d Jllaoonkville 9 a. rulers Irom all parts of the lUnited death rof ,,i t*i, m, an nd the Ia-
f' a .Julyth for thiBike and their states were phraut at the opel111 Jur) of a. li ,,it. al tw *eogro
b frids. uSeensOyr Pullman elep- ,season. The object of the meeting tratul(. Th. * InIi,. a lgr space sow. to in promote aiorial and business, la ed rat ,rilnt i.,' a i tiit *'mbaok*
I Tiekest esO rIlet as5 f named for tre..ts oint and Iare a tiotL:; is
all treaiJely ith,8th al 10th, bu - ...
i lilder t1o isemh lbhs for the ope Wiscenoin City Flooded.
SIl sel i fa loe Iasa eor s rar* F,,td d, I.d,'. W, ..-- .ond
, vaslo s O She Ploridaa ikep* peial. dau lae city iy d county byav been
A day is WeeMhklts eight-los i wet,, h a. fll ,,ilalling a los. of
* sad vislsag the government buildlopgs lIst.(i lIsttilidgns er. torn front
has bee arrested. their fouaiviatinu a mil htliatrird the
. SB0p*-overof sea days. within final fra ulnta palising al1t into thihe lake.
Sllmit a all eseodd tickkels, has bree
arranged on she resirs trip at P1hila. 4 n..eo.mte.em Pie.
I delphls, SBalulto sad W e'bkit stU. T11II iM n tMLi"0h |ll II Dit l fll- to*mcatll
A trip to Mew York eas be takoeu in tatla of Inthsatali. hlu-k nf Kailnu. i i t
S *ei*eleatly os elidr4lip rate of $4 thie llnwallan l:lntli It it nihit rfuir
Phihedelphis to Noew York and return, feet In *diamlieto.r 'le. loi iI i, I ill'l
goodtl days. frlin I,,' fi* t flint I t kI i n 1 I lit ii
The Fioidols doleUes will be p.er. with 'remi irknlhei frll. e I'l e ..f I \..
soil oeasdeted by Jamns F T'rylor, r w plaivd over t li. tmouithilt f trOuhi5 panegrrSeOt of lithe I gently down. Iht are *utihlpnlyr 1Irann Iii
board, lmps, Fit. 10 Iand disappear with istartliln ralill
For sl(peor roserO tioAn rw other in. ty. The air rusbhilo li-ia llt vo |ii t,'0t IM
I formasie write. M. O. Hitlatin. Jr.. dlstilntly felt by l.o|plre stnii.linnI *I,
pI pMO s .ent ,or A Mlaol)onll. tw edle ltranr* oi...ml. ia re.l' Iravl
assist otinestal pas.Lnuer igent, ao le Every nightI the inhabitant. if
Ja ksov i three loll lity dislntiylclhear a uhlten lit
A OOD DONATION. liar to the blowln g if Ra dwp ste.nmn ilp
whistlep The hiois Is laerl for al ul t
Firm of New York Clothiers Send **re i'onds and ota n utulmlde. fowr a
space of Iabolt tee. nillltl(llet *aId tll
Oheck to Aid Hospital. I tare of about n ..l. uinteshd the.
'ceoutnea for another five seensmaos.Reve* Kai"sp.
Mrs. J F MeKlatry of the Wo-. Absolutely the allm and Inoit eo.
me's Hospital All AI i tilon iso Is seA .... or l Persl. atoeminl p)rW now lrfelp of ahlite to e$10 from the The aiddlesa s In 'erman lies lll tlse *I--16 toC) hUror-gw.ir Writr fr
Herm-a.Krat *lino Oemaspy, eloth. toe whitt- go thlroulhi thM poMtua0e at prio*
kn. New York. to be nWd as aid to Cakutlf are often lquaiut and puaistll This engine is not a *Jack at ill
I tIe almelille ad Albus count An ldian pper rel lly trantalted trade"' with dymnama r hsierI litr antil
onesI fof llo,,w "If the Alulighty sundry triowere So heepit yu peeleded."
hopl*l moOet. ld ,-o l t this e~lsoelope. having a*r but is tI a "Ortker Jeek" odo your
T oe kIoss eompauled by a alc rl1vel at Uo ity of at ('alkeait. In the work, ad so miedIke. 1ld iut under (ill
loller, whikl Is apprwlated by tithe Buleellh.hotI of l'aiooelah, t th V gualrmee or your miny* hItek Ml>.s-
good ladiO eS the seetllaionu, ho elnatllng hline' of tllrajodren and ullh plily ianelf.
duly asWkowweded r*oeip. dad, marrheanta. it lif .red to snd relied SEO. W. MOYERS,
.- .by thb- hiaply Olgit if my eyes, of tlr
Inlt nmcal Cotton Congress. ltoot nsmernors ado Idlover of thb heart Florlda
Ma)eblaer, I alsand. Jule |. Tha' --MeMe Phlalkli Ina)ut Ally, assay his
fater.asioMs (o'um romrea today life be* tog Written us the tMest ofL OW ATE8
dituesd the questoi of speculation thie ble-wed e Hmamn,N etalrday, In the
ia eottea. be Corloae f gItaly pro. year 12M of the II gir'l o otur PtropheS .-
tested masla the praeM- f biuyiag &ad dlet.r"d st "ing-a.a I Lolvlls"e & Na.NshVill:.
Cotton for d0illry at latsat date, I
allegiag thaIt tgav e ga ri asp, Confederatel Veterans Reunion. Louis* eR ltid.
pwteulty li brita ditsor to the ville, Ky. June 14th to 10th. *906.
tnde. OsMeat N al tSIf he polet.i The Alaatile (Des line wiilsell froI The followlai low rountd.srp rate*
*d e. iOtId s the t b e withall asli epol stallons Jin** Itk, Iash, from JMteoevIlle* o various point
sot enemsrm to this prelleg. Other 4ilk seA lkh. tikholte i .oolewtlle t Ntlloh sed Wol will be is *elsl on
del~e aWOeed with t hbaresb. but se of6l moe smI per mile ilavoled, dme aoewm. Propors sesil Lo rste.
tho eogu wa ot imaIeue eI pile swees*.e el ns. sIeketo limited tft ho*ltr palm*U
*0 8o -- Jase lftheurnlni Tiekee ea kbe OUIAVILL. KY -Kate llO .oe.
W, egee Ion eI *stodeed masil Joly Ith by deposit of meas Usited Oufedeoreeno Vos*moa'
Mohls. ie hJoleew is en aid a mess o Resae., JeM III laeluesive. wish fl.
Sw* tm af e la to im a esupa. tt wite V v ps PORTLAID,%OROO5--Mas*I)os.
i dan eg. sad wrkh we M *ftor os. t)-* ete Psoangr Ape., Jaeek. Tml soM eeah iss* May II so
ee arrid the city Irhl. d od *l yle Fil T C. White. Ilesieo lispt. wishM SaS 1Iit f0 dsy
ad btr body uwa cauhd to Ael, Pa*o Ag*ei. Tmp Fa, W H NA4N FIANOI)0 sad LOI ANUS.
OG.. tr latbrmeat ee ftu a sad leah9. DItleles Pa s*g Ag.i. 1* LBR. UAL -BsS I Siu. Tioee.e sold
wltier fMole ter A mat -r oaa sah, (s. w J. 0Ci, (..,rl e me a dte Apr ll 0so Aseum 14.,n.
bar rts are brl* MM terhr, at F *r AIoas. WlmII.> I,. I c. sl i jlstI d ey fIroem
a. The report kr to ket .o t -. .*v
a- -e '-. . GOOD -o oss SUs
Jell tleelmeo Seal reso* Ihas
HOUSE EEPERS
M i *itn IIUFFwAILO, II. T.--IMe su no. *


-p


bum5 upi s" 11Wesibn sou t" 106Juy0
RA LL A R WSWADA-goaa.SS,1U

=fisofrMoftmi. i) rLi Tc_ 1 rinte,.limitsAug.


DLLIJfI


FLOUR

sIeed wmsl s~e p.s od it yse
ma OUIkLM


IVo euLes mUdw to


as IL5as

*e-I Zsdes 3"eM S

~~ "Seal botslimit

Tlgxx -gge $ se go.
!MitI Sabm lo ags$I
knot e Mtecob"Nis leeS 0

2% s, &wa. Jm Lguua


'I


I.


~331e~e~lLk- ~~I)


i_








NIT


T77


seo -tary of T1'
S Gate City of,
Atlanta, Jue
lawn, president
tinal beak. Is aw
toeet the arrival '
tery of the TrIearS .
omel was advised thtI
would arrive Ia
noralng about 10 Iwel A
over the Somthgei aIway
Lowry said that a e li Mt hlu
long 10retW m weold S
guest,* bt t tged t tht o W
would o S lg em. o ieOmel.JWl
il.t aI i.r t* w* i
1Il 11 to gbhem seo AI

dl" IW Y utvalwea Mlo fim

Otrawi ywrre w ...soS
sMy etts f 2or m
oa t way of MI w
arof that lsort.


Prult ma e Us t0o S
Adalrvill a. N6, S. | ||
srwers of the Msi
state u *t he udmb mta g
the east mNd WOW g th
Of AMI mare A Du 4




me we e ar oTa M ,eonmml M.L

spelt ot uiseslsd to taope" ae

et o an arrials t six or seves of the
oaelp f m i arkets.e




Met P0tembere In *e*.
A mtst. Ji e !.--t e Ir as lsis
ot the Nativesl AseMo-tesof MMe



ter Plumbers were ld t at the anmd
Opera Hose oTuesday. I U ti otM
das of the oelvesti so of with the
S aLe wmaro 4 mad spirit as the
Great day. the twutythird eouveltl

wi go on records the meot barme.
ilen iva the history orf the olthe
tie. Disagreemet there was, nd
piety of it. Ji me.- b*JleS s t l
came up for ownsidoW aoc, but it was
of the lad that tends to help raf MM




m KHo Tardamany. Ide the otar
met that the board of trustee of the
tate savelrlty had tooed diret the
offer of Mr. Andrew 0araosl to give
the t drusteay $th 000 provided a le
will out was put up by the state for
the purpose of bilatord nd eq upping
a Ilbra.ry the ithae l, versity.
ovr up for ardaman stated to the It w
of thed Press that he thou hlp rathe
state of llAtesl:pp was let position to
supply the unive-rlie with any equip-
tnt that was e ededlt I tir








Killed Copani Withr he.
Ameratloiu.s.r








er, a youth 13 or 14 years. was nted.
dited f.or murder bya the tgred
mad plat te board of tverual t of
tago eoun Tarver during the pIwa
of he tllrso e 21.000ed l youthful k
panon Atutus Oliverby with a b for
tie purple bee out old bolad and q thu
statdi of Mhend:pptmeat was a sur to
*upri|I toh uatinlvrt wit He will equp
tried for thatiltr his wk. YouI d
Olve r %a& t%,.t-in ti former ft11ie
man Jlled I. e len With

Ckto a Tharty Five Year SOeStOL
Aidnripc. (ain.. Jun e .-lrady Tir-
ver, a youth ot i me 14 yeaT. wa o**






diestd ftpo nrdr by thJd* *rad4
led rlard I Jail t ed. ho pleaded
gmlty to buTarv:r and cra in t al pr
ball latin a thulaoy arscrap. TararW






wliam one a oudt o: beard ad the
other T?. had brrn vtoo*rod by a berl-
lar ind one of the ionrnt wa a ultd.
triwd 9lr nil nr ilhr *eek. Yogia







sutll of the fr assault
man John 1. (i.. .






Gt a Thirty Fiv Yar Sokenn.






Mo1ltrle. (i iJune 4J1rTerty (o


*V Chart li 'e wli a lamer of
te e 1 ,i theep: to uoofe se.
.fod im iofle 4 W Js id Rel d e
gulty to burmv and cranial a
houwslein t'..--t.I Kiuild by (w
othr 7.t had brfn 'imrrd IT a burg





r Mottltre. <)a Jum S 4a~rtey Glod



B hewas. wa mming aad uaiplng ate


1


A Thousand Dollars' Worth of Good.
"I have been afMlited with kidney
and bladder trouble for years, passing
Sravel or stones with ezoerelatia
paln." says A. H. Thorne, a well
koown eastl operator of Buffalo, O "I
eot ao relief from medlolne until I be.
pan taking Foley's Kid ey Cure; then
the resell was surprising. A frw doses
started the briek-duestlike subteanee
and now I have no pain sermos my kid-
aeys and I feel like a new man. It has
done me $1.000 worth of good." Foley's
Kidney Oure w11 eure every form of
kidney or bladder disease. J. W. Me-
0ollum A Co.
A-oal- rt-
A maskso harma*.
When thio eaoer aad Rio Orande
prepared to build through the Rockies
esloeemn mid the canyon of the Ar-
kanoa could mover be peoetrated Its
entire length. There was oue p"t In
thi awe Inspirtag chsm where there
was not room for a roadbed on either
side of the stream. The walls of the
teanyou came down to the swift correct
of the Arkaansa without foothold for a
was on ether side. But an gneerow
uggspted a banging bridge suspended
between the walls of the canyoea. The
bridge was built with supports im.
bedded In the solid rock. and ncres it
the heavy transcontinental trails flit
daily, wirth nothing but th slender
Ironwork between the river and the
top, of the carnyo, 2.000 feet above.
(Urest Iron broes. which look almost
oqilder-like In the vastness of the ean.
yo,. bare betw thrown arroes the
grge. belan anchored earurely In the
aber sides. 1IUgo eabetr depend from
thbeo baces, hbeodi a lo g Iron bridgm .
whbih extends sot sarem but parallel
with the coure of the river.-New
York Tribune.
T.e, (4er of is.
ou might exhaust younwit looking
In atism aeul geetteer for the city of las
birause it i pourey legeadary. Hlere
Is a lrietf siatemet of the Ihgnd:
"'l0W maniniflet r tity of sl was att-
tetil on the coast ot Brittany where
now ia the boy of Douaranmes. It
wan Iullt below the level of th e
and surrounded by masalve wlls.
tere In the fifth century was the
mourt of the |lles Kiag Gradles and
of his wicked daughter. D)e t,. who
bad a pleasant habit of throwing her
mnltors lite a well whb their socstey
ber maw tiresoe. One lof her tarvrite
asked her to obtals for him the asli
key which fasteed the aluke gai tIa4
to city wall. ihabt aeerlaigl ay sle
the key fem baher fathetr'ea e wMle be
alept, the lover umleked the gates Md
the rseaked ta and overwhelmed tMe
city and It labldT ast.. tieudig the
Warem Oly S.e kMs e1ape4d. MW
Broda peses say $et the epirits of
toe drfwad t .i bet lt s1 ud
the bolo tf oe u -- S- Idty an
often bheel rstaging at law tla"
Oured e IoiD Disease.
te.e A. Shenarsa. LiShe Red Milla,
14a**e***s a ty. T, writes: "
bed I dues dge e har am*a sVmnad
had beea tiest M b phyptde Owl
tweire yeast bead bM a ea bhome
hkide mediele ads eMw gagig
that -worakaae re etead g feee e
hif, ustU I bea em isse Pa lmae
Cure The Is hat bomls sem
me &d feen beo l hm e l dpwof

*atc Pabyl>Csl~a


resting on the open Koraa. He takha
his "Bible" labin bin bd and atopa
low, as It in tbhe presence of a b r
power, slowly bows his bead atfi It
touchee the book which to him is to.
spptrd.
In certain parts of Spaln the witaes
when taking an oath crosses the themb
ot one hand over the forefUtagr of tbe
better and, kaissin this ayaboll, It
primitive. cross. anyl., "By this eroes I
swear to tell the ruth. 1."

Huge Task.
It was a huge ltak Lo undertake the
cure of saoh a bad ease of kidney die.
ease a that of C. F. Collier of Obero-
kee. Ia but Elere Bitters did It.
He writes: "My kidneys were so far
gone, I could aot sit on a chair without
a eunablo: and suffered from dreltual
baskaehe, headache, and depresalo.
nla ietre Bitters, however. I found a
coar, aod by them was restored to per-
fes health. I recommend this great
oele edWleise to all with wiek kM-
seya. liveror stomesh." Giarsateed
by all drunggste; pri Me.

That mea was liaugbe at who oa
bl his et voyare said that the ocem
did not look so large as be supposed
It woulM, but he was met alone la es
perimelag disappolItmelt. Tba her.
Ilao at em lves no ides of the Un-
Itlae water beyond. A am captain de-
clares that the average landsman c a-
not s twere than too miles from the
ship nla ay lirection. and It weeomld
have to be a munnatala or some staoes-
ary object for him to be able to di-
tigalea it. The masts of a ahlp a
sad to be visibte to the asked eye et
oere than Sve miles.
Jeny Lied a a CUIM.
Jes y Uad asa eMM eof ars years
was the lark of bher paestw' bMs. As
a girl eof A hme ab atateed the *t-
ties of all lovers of mlate sad lbted
the gtkhola ciof uarv ai y asa a pul.
Her teatlinous stes aot so e r nas
ap eased tthe nadim l of bai evotm.
sad for four full yeare per si her
th sptkl and rtae kel studies, whbm
se y dthe full w eet sa m
baok, to the dellgKt. ever y O
keows. of thbouam for msay years.

Woman of the Bes (besalag him a
plate of mte who hbaa se better tay. Po.
dry Uretis- Tre', t.ablie. I hava
T mhe was a time. m w. w'a I wo-I
bave blmhed to habu eah a laWt an
to a >dog -teWg Tilbo w .


D ENT IS A.

Om teMUM 00se hk. 9eamtL


Du G TIms-sOW,.
OWITIT.


Ob0e is Miler Law raekase.
GAuImvIN.LA. PL.


THE WEST END,
FINE WINES. LIQUORS 4 CIOARI
JONK Mal Preog, or.
110m1 w. *11 mm.. Jmesvlol ViaI.
aus boer, bedloe ad dmraght. Doe'
fall to esil on m when Ia JmamouvlUe


IF TN LIVE YlO

WIFE IN

MOT IER
By eompellieg bher so bake the family
bread darlg the hot summer months.
Boy your Breed from

...Keystone Bakery...
It's a avlin of time, work mad money.
haA IDred Ietven4 lly
To all peru of the eity. Abe Cakes,
Pies #ad evr other produetiom of
the amern, p-tsodate
bee hop.
IL T. MCRAfI Prpteo Kreyte
-T m. rs wumw n



Ma~k


l m T1X ru owut A



Mes pine far Je r" le" ciMe. msoee ts
01mw 001 01 abem. eWaiwmma o

Oe-i *Twy


mma my am mumnemesly #ee
(bauret Worker-WeldeI isS US ,
md skr. to d a me TinTT TS T EAiS
inlhis? Mr Out-S t wohl I'm F


VoH" ut room" PullwNItsta de* kshell,..Uf "M
Om sawmew nmiy d euull m shr leie


Mes 1rmp- UIem bed e"wow.r
No Wol 1. 'NO&x me t g. kph Irm room a ame a a05MU MaM a
inte lab"like it. wm domeow t Omfwuesiism siews
ata lb. TamPOW- ilmw. s :..I





&M &L iSo o. %M Weta bad man.. -IES
On re '~bmbI AVAN3AN, GA
be wpsa ~ is a ,



SI e V'U ""! lasso MMIA


Sbo& wa et s * M* *m*m* Tier.


ISm -Ao lawd em symbois a ATTOBIEY AT LAW
1WWth m.isst a t a e ut ng o rso eaeC m Aoir oe ne r la Eqa-ty
eto K n badu ch 3 t the eas a ag amgg -4 """
madbea eksaettheT
^ ia- m 1 6 omtthe w prw soul sam do' a e 1 ,Ming m.e
-i ~s, es a b maltlt a the aote atf a ast .



I W ke te tuehe pla of at Me

-pl lgt* f-n cou ptroe msudnew a UDA, nd .BAY





bre'r tr M IdM pelf tfity UM oathe is adt s.t*ATTORNEY*AT*LAW,

0 0 0 ftpW eveM hom t"e erpl- m C ta t iger aas i em lem 9' 3
AdISt hi T b will be covered t*
0009 me u t Of sail Ek a a ared. "I sllllwr apt1, (i
In ,erwegl a courts of law1the pe. p ,i" md .wn

.i pt h se emrtls, truth. teb whole truth ande of mth M b
INgSe I s it. Whm the iteisdely W,.KiX.



Nal we bat here, etsa4a1 the abu er tho t yth." The Mosns tso D J. ALDAMA.
hasM reeatMehe tha pa00. timibWty th e foathmd rrATTotY-T-
9 44 9p of he d m tEx dld18 he h1oldb aloft his t b m ib SLICITOR W COHANCERY....
rov f s ra j gandt ille a as emblem ....- -
Ow wit INOewpremvarnd swam iuItanIta court the wltie. dwith GAINESVU.LE. Aloahma o., FLA.
-who b le. P m dae s hip IntMhle, right band restingcm a nopel 0ee io Mdel Block.
VAR"ied IUi4el a7 554noerhOred t 51blo, doelaros, "I will sweir to til thle
" PhasbGOd me iamy dertlo s, Itruth, the whe truth mmd nothing ba
Id Is estimated tat the number the truth." The Mohammedan takes D. J. H. ALDI&AMAN.
reted more tham 300. the oath with him forced re v6mtly


S..For...


Business Men,

Professional Men,

Manufactories, Etc

Local BlAms n Shrt


mail eider ealegMe itses Z
nory:





Ww- ---- "
.T,,
_-I-


r '..*1


MAX KXAUS&



WHOLESALE tlIit




Sots AS=%th1WrU C empand M



ioe Awl .i.
pair waratsed.




The Florida
Fruit and Truck Grower
1. J. DRUE, 3Witer mm PVwh ,
OCALA, VIAM

iagle espies................. i


A ha ndeomely illustrated mapgle
devoted eapomally to the latem of
the trult sad vegetable growem of
Florida.
A speeal trial subseription of Lsi
math wU be mat on reselpt of X
eote. Bamps takes.


ALCHUA COUN1T1.,
Al"ahus esmty is M,400 seme la
are, hm. Sbon mile sellrad 00
1m2l 1pe. > l ,
p mepstID w=ou, $
plMate, 0w S il, PIN wartl
hose, IAe aespapes, ed pe.
douees eora, eastee, rise, e .
angeS pehe, pea plm
eaa. and all k bd e e


Has fourteen eharme seime
"boos, the be FMug F = mu.

vu.Jse ebuo, bl.me se rue s
wate, Ialearm seysem, esleoi
amd iope'a y two lee fateode,
.three wead he:
ri, etteaet m, two mm faetdow
three raltad, two fertilier
fmterlag sompa mes,i ome
amuebeory, ae es rectify ofr.
pomste. plans, two bsad well
iowhed sOrNes ombimelmge-wa"
tiIa nante ao la i me

THE SUN

JOB PRINTING

DEPARTMENT

Makes a Specialty of All Kilds
of Plain and Faney



Job Printing
altd kic aado-,tbb*
water *r lr ytOi,*-t
aodAA ll/ta tw oe b(.
mah-aoatre of lb*
*i^ MfA^f t t-^^^^ l^^^kJ^
n-# euy*t w-ao--


)


0


I












THE DAILY SUN: AINYICBILLE, FJ1OIDA. JUI91 9, 1o..


T


)M DISASTER


TIMES FOLLOWS SEEM-
,f: I1N~ ILL LUCK.



*, t-o Tsle Paer.
I l kn petroleum depolts~ which
as htV ided milloma of pounds' worth
o4eoall, are aitated nla Russlan au.

-loo ago a numl.er of cattle were
on mrveral trintta of laud well
sg i with herbi:ge. The animal.
bOllNlYr, refused to feed at flrst. but
In1S'1 their hunger. they ate up the
Iimig ravenously. All of them werv
4l l, and a number died.
Sase of their death puwtled the
s- r for some time. In the long run
hedlVHersd, with the axwlatauce of an
Maluhmanl that below the meadows
gM rich oil springs which caused the
IgIII to be poisoned with paraffin. The
ltel hil cattle brought a fortune.
A agmmer or two back a wse wall on
lbq 81sk coast waa blown down dur-
1 a strleng gait, and when the tide
uy Kacres of low lying land were
d g by the *ia. The farmers who
agigf the land were in despair, and In
4jig to save their crops they starte-l
g the water off.
days later the water sodden
il w l were a sight wonderful to be-
Iii. They were one thick aropet of
fi Mackerel! A big school of the fish
hIswept il through the breach in the
Moamt and been carried to the
by the ln-omlng sa.
t1e farmers hired scores of carts to
@~dist the mackerel, and within twen.
s her bours the fish bad been packed
lfte ba and were ea route to Bll-
gigapto, where they were sold for

fiarvlag. Ill clad and bootles. Robert
iyea, a bomelse Jew, wandered to
e of ea loosely hill on the Yorkabshire
aMm. Tbere was a strmeg gale blow-
g fom the east, and to protect him.
g trm the cold blast be entered a
tdL st f wood and swee on the sum-
55 whdl was used to store fodder for

USafto through the door. whieb
gA to the eastward, be was aston-
Mid to Bad lsMde over sizty wild
blht harf stumasl, but quaseing vio-

l Si stabl the bM is sad wrtaf
6Wlr seeks.
sotd lay r"ght to at "t tMa
ie mplet at wid dodha tt Sum
I eSarto .m. t e Bert. e a, o disyt
S task humird. mm et hem
amimte s dear at tshe wMi h
S bm lefa t pes by be uahphub
a a-tmaed themlsra a the t ard

| gsU KM the teeky hal ter a eOm
Sut sa a wit he ewa I b&e
Sigd MeO serw pectably sat thas
so te M ON of rt.
wtolw ftpe e5me the 1 1e1w a
Or eoph peple F 0 11MWmt0-
Stoe at mee, sa m se amt as rA
a.tthe ile ws m imha iW



-l g sestm sa d ft led t1em a
I aee a11-t111 m es a ewe asd iot
mOw har, wherw ts sno was
Vo n adly MwOi 0me _

bb is as strgiese the al ases
mi' gl seadteeImats. to th








Imes to M eA d w III as





he iha eaes kn Wet
h eM -eeg


.wme or' a
a m am we
som he as mwk
Oslo 0mw -
-~d Sm" ad-
WO p ee "pwmrh


now to~
ftsp
SU he
=A65
a- "ow


with Its claws as it Bled fYom Its pur- IMPO~RTANCE OF CARBON.
suer..I -
Sultimmuentlr itIt ronspired that where W11111004iIt or 155 EquilatoIWS
the bird had lbeten was a dried ulo rcoud Nate soe %rI-Ihtb.
stream and coutaiined gold dust' and 71w e(lef-trie sare MWigtii1141iW 0so m-
small nugget In large quantities. Eflibtly i~'I -d14 l'oodScvtoI 1..% fl tit' jt55
ftaansgte harbor was once looded of a lit'wir!.l elertek' uM :.it 1KWioM
with a mighty sboat of mullet. and IThe s.ilght13 '..irsted il.~(at ia oir of
whusa the dock got*@ wpme opened tit, l- cairlooni r~t . *or earbolu,. --'~It te
low a ulip to pan into th. Inuner basin ila i:~.i riit zts or
the Babh followed.,sold the baosin beesac'tate 41111 ? ii. iiiit-i t InII 'I t ver-
tbk qft wththem. ti ,,,1 10 ,,1* ini ii' i Tem
When the tide went down the aathnw- ILip .1 i 4 *11110t~ that
AU.. bhad the dock slulos cienod and 114 11:1 ~- !~ III)pt'
the water drained off. Over twenty l''
@art Seeds of bullet of two pounet iiii "'th
weight and upward were taken away htou t.1iatsh
from the door of the baptn, and their toI'I Ir
Psale brought to tMe solferit of the Var.t4- 0 a 4
gale council nearly L:4wt. 'Ait; ~ a
A piece of blue idroli'.sd by a ecldent. I I 4 4
Into a rat of pal) aljWisro-4fipiii'Atlblt'for i
the Ibroductiiiiii of liltieftited paper.
ausi to thi, Pigl~hiut dknoler thibi' "di-oi
datloit of a great Wiltistry isto bto., 'I
trittiv.el i ~I~iildt '~i s-;.' '~

jw'r ginaker. sirog ei 41 it bMite tI4gia int o li
off her huptushnisowl',elip vatm, and not.a
result the lpullp :'o-iiiiiiiI a Witst- ut. ,i* ....
L~aid tivonklered the pajter to II bee :r ..t n .'i
gruatti lfcuuilary oisiw. but when tIII, entte ls'rsr5 ttt
it III, to loiittlof it found a reach ntii~r- the iisiirti' r v.4 ith1ie i
ket. lutiveosi. t ibecate so plspitlltr tha~t .~*..iii'~
c:nst vi-Am tioedto hasupply imosre. Ile c oI of ro or. 1. 1ti rslyItiter-


did tid eventually m ile a grent rfor
tt11'. out of hls "blue bag" ipal"''
A chemist of \ureilerg was itmir
litig itit PeOlIIe nqifortln froii a ottle
whent a few drulo fell Upon a pair of
gSoil rinmanid ipectacles, which he l:uid
rit. ly turchta.ced.
r"Tlint'r a f0it'tctrophe," hlie ca&lil to
lil w ife. "I've iliMset Pomie oatiafortis
on llly uew e i-s."
"ll:,w it lpollt them?" was the reply.
"Well." maid the ihemint. "the glass
II corroded where the fluid touched it."
TheUi an Idktea struck him. andt. getting
a piece of window glaws. be endeavored
to etch tbereilu. lie succeeded after
many failure. Ity drawing design on
the glass with varnish and applying
aquafortle he made them appear as on
a gray background. For many years
be kept bas secret close and tad@ a
small fortune out of his designed glass.
-Pearson's London Weekly.

THE PRICE OF TORTURE.
ah***p I '(Vsteary Pu iabmeftl
sed the oetl TYh***t.
Amoag the monusests of supermtl-
tlon wblhc exist to this day. the travel-
er W the "witAl towers." the torture
chambena ad I eolleetleue 0 t a1itrau-
Ml"t eS toertwu la voI rte tows Os
th e at et--Itably at N uembeog.
RattabeM. Muslb sad theo WlgW. But
pr a"ap ethibg hrta the areeom
meo e vidly bfwe us tha the esse
tkiear' tarWe still plrereid. Iear of
sie may hte se la the library St Car-
aUil miaersity ad smaeg tem gaSpe-
eally that ieued by the arebbWbop
elector t solge la 1757. On few?
printed frtue page. it esumat. tis
afty4re pragraphs every emt t bid-

-MM eIarty whica sm em tater lk
mid eommat p= a p lmer. wIth the
sum asw s Mhm her ON & se1W the
-nstrumeate henia -equ Typs
eassapie tm thas rtmi are n* asft
beywo:


1.~ ~~~Tk Ie oueemdrwt
..... ..... .....

1. ~~b "a ad we"aa


A Verslowup 0 loe- whel i
be 686twolinbU-----.....
w P gmo4 aea beat m-sa


as bud ......

aehes %o"IDa so-

U.P...rms .............
a. IO, ow 0 NO wbm
-O do .......

hIM Ifowfa"Ma

IlOsv mm...........


S
S


epsi~uU~-ANOW D. WWf to

Ad tmmM


T"malsommsme m d t



" &- -- 44
-U'.', W


soe&" smI mms sme -ad
OW 11wWb-U'd006
0 1 W ome let no


end. theI ulW ing Inent 1i t
which eli vitm the it reetr I'r r
tal light In lillights f l ,
4linetlhi g li1i0l..1 h1lf a h .
roy i% 4usvitratd i A I n' [
ter. anli iti teui' erat ti i nI i 1,1i -
by thi vaoratiotn of tVict .i-;l, Ii 'nr
lion I'-liiKg the ti0 t tr.- I' i V "- 'il0
staice known, the tenii.,'i tiitr' f thl,
crater lo tihe highest yt Iyr, tlnu,-'i artli
flclally isud ranks oeit ito tht of tllN
sun. It In fortunate tlhata iuiiintr. hbai
provided us with such 1s ilithtancet' am
carlmn. soi.oining, ias II doIes' tI is iIgh
eat resiisitai' to abeai iil th Ihs nii -
eary ehletrical conduct ii i VItit
carlbtn or anu einilralenut iild now.' I
known- we 'couki hae io i nrr liiht
Charles F. Hirush In Atlatir'.

STOP IT.
Roasting of what you .i in do lnitea.l
of doing it.
'bhiAking that life tis trinil andl not
worth living
Exaggerating and making mountallia
out of moleholls.
Talking continually alout yourself
and your affair.
Saylag saiad things about acquaint
semcand d Mids.
ThtaklBag that all the good cbhaare
sad sppIrt I -- are t e ~by.
Tlakte et yearself t the esolumhio
et evyirth sad every i else.
Epeslthil as to what you would do
Its aq* M else's pise sad do you
bat ype owon.
OGasing ily Into the future and
daealmb aheot It l Iniaad of making
the meat d se preheat.
I-MgiO are asNod w agto that oth
w hve imtMd of gw ig to w .*and
esang them fhr yours.lfh-Scrse.

The terre of the deep we perhaps
sever math eagly sei Mm ham is
do MIas -es by a 7WM tody who
IMt yewa me her maIt e abistsi.
he a t Upa ry. very mas. k yu the
NMew TWOt UsMd. s tat ao Mark
TW2l'm. U m he eem io s he seam *.
wnt do meakwfs%"
thesem w limpeate smsepdies.
palm M was t tryte eat a felt
eWip to dnrefi1 1.
41 1air mvsaea asftap m an ."
I" ei. Ialthegh the"n s.
-e to nmA a t4a0 00lSuAe
S" waseVsy wth de pSam sa&s
eily that 3O heN "M g pof eses.M
A U athWe MaemNep.
S nboom 1 8e4We.mOWN

noto e w o w p a h 1111"


SM r at s, sen Wam& a









s SNIPno dil


Gainesville & Gulf Railway
Time Table in eoeet April 9. 100.I


No.4.-
owly
hle't
@mWday


Lv A



745

Vol#


9 15
9 45 1
11 w I


12 20-
.94


NCo 4.
D 7


N4.. 2
'.st''


.v NI1,A Ahi

245

33
840
a345
4 16


6401 15
1766 7(16
7 M r7 It
9 w 10 50


. . . .

PM~ At AN


ATTAIONr.


No.'.
1~I1y.'


4...?


go.of
Dp#I


..Ar.P.lArt PM
... ajIrt ld ........ ........ 1 30
. . In t e ........... .......... 107
ruIaran .......... S100
... H i man ........ ........ 1 0
.l.ke NMiiUbn.trt .... ..... .. I1 45
%t'nl.lipy ...... I 10
. Kirkwood . ...... 11 I8
. 'lystt . .. . ..... . ll
w.V,,a n, ta . ...... II (O
y P< 11 43

.... ... Hllansy H 0 to
... ......... yril . 4(41I 3 0
.lumpMt ('ity ... H 9 in
... Paltk,(4 R. F. fM) p1'6 *


At~


G6G

646o
64 M
644)


4141


its


8 46 Luke city, U Gd 1 04 p7i41I
1% W p ..l sbacS. A. L. 411tP..
11 00) a ..adsa 4 .a ...' 4 to p. 6~ c:.
4 wl p.... unn,O 04.F. .I113N)&.1240
~A~....... Atlanta. C. of (46. 7ito *s 90Ok
An' FILvA VLv PMi..


Tr nse 8 end 4 do not run between lain.ivrile sad Fairfeld on Sunday
L. E. MARKER. general Superfnutndens.
J. F. HILl, Agten. J. D. WATKINH, GOneral Apent.


Take The Atlantic Coast Line

FOR ALL EARTHLY POINTS

North Dst A th West" De"
i*ljM^u't* Jufearvtue lde n v Mi Mtfomrv


Depart For
6 (RIc5fl


Rapid Transit and Unmurpamed 8arvios
Time Table in *eet April 1, iNM.
UAINEHVILLE A


irreo FPm


High Sprlap usd later. lo~ss


L'etlp medaw fPtato I I~ls
12;:16 Pm U als meburg sad Tampa, mWd*p
Daily Itensediate Posmw
2.00pm f thJs~avk~lIle.13p
I a&lTyNorth, Sme" MAd wonI l
mob pm lghlpriap, Wayresn. letvamuash, S wleh, Iturm
Daill Albasy. AtMISala6al Poises Peth, EastWON


8:16Pma Res X sam mOian
Daily Defty






LineAl T aAt*" u

J. A. OOW.Tkbd LmAs" odmvis


Lum.he As&e a


SOUTHERN RAILWAY.
v A p. .. ... ,u....


IZ jb"WiYlle. .2 o
L SpR-
io t.rI S A
At A
At A


U~' I -
* *4 ~*4*4 *I
* 4',.,. 4 *4
*~4~e4
''.4.4
-.4.. '4
4.. 4.4.


r* *


ma


5- 9A


B ...BH

* .*..*.....


p


0 w a d 914b 11


. ad no loopb


rl


-- ~t31


ww"Tum


> .- II f --


-.400


m


.


,,


I Wbo-ow


am jecb~ 21_xww_16











* I *~LLT 13WA~j8YjLEFLORIDA. JUNE 9,v 1"S


i! '









i!'

I-

5









r.
4










r




i


lbstoesb a MMIisstemps of5the a. ~onem. wmaa"eamn shm M St d tdbI% oNb
A6 Lg bog, h ~sw m ades sebtis di. awof is I.. tldarn W" wa% ODOM
son 5of 60 NOW- W hm WI is bee bm1fees MWd 8 aggas lybto 'rl5515. I
w..wof 001. mad Mrs.umamas$& swgobe mN o ae is I"i~f.L 'IO.Xl

a sineb obbIik m .w""bo "OWN 0 ohehe
fti" *m-w, en o&THE EVERETT 'HOTEL.,
0 Xomn s d sem noeast 51Wy. fm ago's" t t
en~ gsisu tm~* ~ m.- ges .~ W U~y8&,JACUO"VLUa LN I~~
tmywl" bmmn ta- *oofft5ftm a eNYat ftm
5a I I a%" W&=~m V-~ ~ uS~-~ e~~
3~A. th. 13. _______________MOM&_
a IN oo b
-Ln. -9 A 5&N&ft m %amqqp cuma__-


*M 5.
* 04m5 Owl


A


'91


"T UI A TH EASTER CUSTOMS. ,d..,
oftP~ be aremeofl tbhe maum l Chit,
cuoi lOOK A"se.. Aids D1146
.10 Seem fot old Easter eastome In Bows



iiw -iwMllhep that e hae I jt a4- to lend to It the charm of away I NBa BT
Ia leao curiously barba e, and H

FOR "l">"s ? s I.-a..-w-m c ent ary mage en. don ,.
mfo bright yelplow gartic sea re a o t. dofU_ _ fa tl s_ ___ _ __ )
SW tohe for da, Others give. other tresses. r I
juthe brush while thinking aentily of
their heart-m desire. And who loss not
jsnersed meetg of the O~tt thngs on master day?
M pggl wit a 4t*Among the earlet of EasBter cas- T pw.
F mO p Lt4 th rd B a d a wh b torns are the follow iag:
SAt Qeens college, Oxford. a herring
-Ab -I oOWlbaeI pr ovide thrsplaced by the rok to simulate a man
"ahundheor secktrksetonhaeoendm"dand

bees.eeeuo be t -brout toeble thisn kgI soase A WoED
er eO gdia te I r to represent a red berring ridwn g away TUE EST
s .on horsebct k and lasthe last vestige of tNACweIE 1i T
m0 Pa4pd s, do prmo.de for bh the once popular pageants of rejoi-ln
I-- ---.- tdesmt5" fonr the end of tr Leten of ast. eE I E TU
At 0 ia ,e ,waS frat Td l,, a *A It was erstwhile a habit I bl -Englih -O -
e "s weinth s Maw psed sf the v towns for the fboys all t he of ng Every Ma*n >
lg o" toes o p ove Leg flosrse *ma cedbd y tws M o rooktothelle., from the haoe ofa
1 11 8 4o 1 i si s ond for d.t. D'ar .B, ir wh o m ty e abe to tch. t ightet Shift Lightest onn ain! The
ed es S 00r 41161, wi bh wheh our T Ibroughto to w Ites da ter M o ay bl The I, iwasupptu
'mbgme fallIar. fr Wosborntadred ~ hedwom ng t Chamapion Sped Writer. of the World
h dissee wa pi sed on i d an h It the men refused to pay a speu Use the oFaySholes. Mor F ols n
e, me sad third readage ad sa une or happened to wear boots the women use in Gainesville than ny other meen.
pf sedi Nhe ionly diese1ting vote tried to snatch their batH, sad to ye _
Sills e tbelag rees" eas InroomAe. Itw. cover a hat cost a siIpence.
It m e d ooe me r saseo In some old town gret ekes were r Sale by
esll sa o TeelMne slgS for the pur. Ivwinabs e brought to church and there divided mEve ry
i*-edo *-bli em'...o theaoa th-,W evaoud g peoleTHE S b, GalesVcU1 Fl(ot:Ii
M~lsoflo a"S *s bnondso s" of o"Httlg and oweavl." A man sit-
0 f m(lr 1trneaeatonm, thoe xloh .siia s h *m c to tMlag Eatea teodly ito bei k e w a.s .-
Smil e nittr* ftheiopedsbleoahLWr praised by the servants and women of
U rIw oI-plds e -Is= ht 1Ilaboum l d who ente ed bearing a
la.. mtrthl 8 MEROHANT 0
Aus f M The Dlfue Tax eO. l thh o lense The man was for ed to it p the chair R etailer sad Jobter, ls
-too k .. padhird Ind -- tn duties, ov "anri meaew anad t itted by the womeo, to each o
I s ttrs iedi.etout s osIesoi whom mast give a wpemt. On a r
sesm, leame -The pebble sBe o s or the -s-oead abo me day ia M oster wak, a ther Moeday or I o I
TM Mlaste n eofs t em od ao to 111 0%ho1In Todays tmeold at o i ns e wommot dfoOhaes wr F Sd PA 1b--
absemby 0... W. Oweas e. S b with t td uphe andFeanacyBrereeivided

ales *M omkoee e jd elle eo mr d y s e s nP a y i th w uu Mdewas pt at -tas l Te s dA y k the mang"Vie.women
vpl fh, em ..ve fe. "th Wtohllyb* Its t t dTb
bs Csy. buesghf the Isges Ia. iahAm be"Ibes Paghk wome his iuola s. t etm a s hoe at TESU N, ea
mewM thao mumbled Ia ses1 1oa. hehsguMie roa d wea the paymt made by sOUTH SIDE SQUARE. : GAINVILLE. FL:A
A ft o. b a t r trc I ** o plthemiw-s to ie lth1hitd. *t It 101 101 gimer h as a na d In0m po rf JChs-vm. O-
Seinas. ha os ledo fere mad te of Iaeda am thr e balmse presedk. At 4 eC to anotn M
0l *e ls I ml pn ,in tad ed e11*eest Wh o we~C Weo~osemed il w inw elde. r d d Wal g bad easri at

7eome as F** as the pe f .A SUNDAY s oMooL PNI. Net amy wc ths plys meted W 0 s mtn alwe.
T^ihe pssr ---- paid was SIm, the chaeo wthem tsndal v ae Jm s Sm Enbuti-
aMhbi theI le D Mi waso. The le.* Mt. Mltr ih leUed monday Sahee wth as da partl t larly i a theh ailr ir and Joe as
S pom was S. pee Itmal whi WII r to eky P blmi. el e m th e dra L
e owhm te usno it gisea daneso-t eOn i Ia . .
hisioM h ie B s -bem to eoa-i tgo i Ms. NMrls Baptis bdaren hIaed dao a, ia s twee .k, e o t..
am asl teeso the preem im of of whN0 0et. Is. 6. O emug Is pm* i rtelwad s emt prpaItioma wIn H a a11 IV i
e s gi.ds ad wo led of s te e ad a h el a Satrday. about end ste a benl sad
s"A pastser do will be teaed ; esag as Edeeay t weds.sl f be wm put ed toh pit, sa b e Id by J- COttOnm
he best veearlmy snirpes ls the iMestimaes slelb sate paled. at 13 there were esaut= sad e ee es. a
nmad te.p.... Sam. of the other m stes e t wlenva iss he Galbnme resashao t At 4 re s &E to 1the s .













tN MM WM bMi to be" betl-use S&^i to six-. c
re widesa of bsweremasIno, paoVe e Mdf teed as s a. a., a" marke pi paid fo hc Sen sa Ct0 e BkI and Twine. Wa |ru
ell fese s ene drive. as he ley atrivg as 5k?1 5sh I5s su11 45. *e Tast hmr iB n)8 Or Bidem a

oweas seeesaw Is ww a r ds a ga CA STOR IA anucturerM of the Jn.md o oig Imrtted EngiLO
Wadedto mnil she whele tate So *a fe 11e l S- Island Cotton Gin, and 8uppldJ Same
tie, O wlt ats6 p hoirest p hpSUN DaA -y 3P V11mis.ecdsl tody eerybod *wy h Tlll N p s A iN. BT UD Sto AWivess.
aI&m Psopaiddeelse to sel 16. ,hm. ta et t at Ll. dm m___G_ 4a them__ ._ _I__ID_,_U_
00a We bmln l abd wasLThe Aa Is$-. ed bosheo rd sejeg she-TATB Ap. (Deed __it

aapet dl ee wf s, It Is MK de
a ted as othe L m to: a W the Sag to Oung Teeth teasa tea as eat AB*SIRAC & REALTY C
sht"yw e a? few bein p-ms *** b"bseabeU. w pe *b r a N ni Mt -ater bb h Me md a day
bM 01101061a Twhre "aoof0oefWll if k pl oew.H. j. isasIwsast. t Ia otfrl Ite m S~ta o ee astr Wo JU j jTTON & CAi*

s q Tl ef 0s amd o t whle was ada al b Is pe r palma. s t too esaki sm wee st -i a0 e1th OM TMi s fr ha s lio f.e e DEALERS I
efe A sto sell, was idm ea w001 h 1e0 fM h ta.lgdS ebthtaStudy.hbo ut 9t wia hnshd
ma she lies small. A edeell eeseM* 11 oigaA eofs w waseptfs he e PKa n wd
heb VUf the lad was marshad ref NEWSi. n ti t t 12 athemwnhoa ades r El 11 to.
MSa.a of the moss poputelar soesg m The ps twin a te *ome as the i ea- hsndebA t4S, AOlZNTi sUtLAm AND teeipr
tn lev eaty Is so wed e *m Ala e wa. Toaie laaster ata. |a em" aI mom o I n tae a T


he eeat will be *a Wedaes se. ar* eetivega pee Mesa& m u1 as a o etoet and r a wp th a whb 1S id s
Juae s4th. hen M W t. embers et aleisus to Mae salPol esaswst 1er 4a0 e a aw atBtl -
U walaseIlle. sad on whe nme daolvera. r s og hen s o s te e "aw WCA1A
Me. A. rs. Ie of Waldo will masoy Weuf a OWhave aIs MUMtu aahem I ieaot eleh VU ____te _ams__________ ngis
mb6 ealg White e l aedar Key. Mr. sateems ts the Jng, m 14=d -f "'_ _inads A
aniub ils es* the ml e ideeies"Fml ask ,g.eie. s am ai s et o ngeir Ta. asI.
A Isso do""is iI p sepsup. PonaS tale. Iseese has seaser to a gweas eU


'I

I.




*4
)i ~


Numi- oe_!l!Aq.41


~ ___ __ ___I


llaUWv 3Po a -4-1 P









I.


..ALL

WOF FFLORIDA


'lMea of Stte.


TI! MU9T IMPORTANT EVENTS
TremJlslg in "The Land of Flowers."
ThMs "BSolIed Down" to Suit the
hsap Meader-Items of Interest to
AN OChess.
--"'ITe el~rks of Miami will organize a

ake 0ity defeated White Springs at
be@"all Monday, 14 to 4.
]Pdthe will bave a white and black
movgalJ ehool this summer.
]Psojela's health board will now
didatfet the city after the municipal

Mig Nary Hamlin of Miami was
r1 ever by an auto and sustained only
alight lajaries.
ftwpp Springs refused the railroad
eepMiay permission to put up a wood-
s depotes building in the fire !imits.
The dry weather is affeeting the corn
g*ep la many portions of the State.
sad *here will hardly be half a crop.
Admse & Richardson of St. Augus.
tatngave nearly completed their cold
seW plant, Sto eot upwards of $2,000.
uaps will send a team from the
Light lfaiatry to St. Augustine August
ad, to try for a plaee on the State team
so egirt.
The essnlag factory at Lowell is be.
a@Shed to eompletioo and it ia ex-
to be ready for tomatoes In a
In.g,


It ib stated that the Seaboard Al
W aOd the Atlantic Ooast Line rail
ems will be running to Miami with
te Set ten loyea.
Il is poerally conceded that Jael
am Ule will be selsteod as the plan
gr hbldian the enoampmnent of th
abst"oop this ear .
iMdletmo Is to have a saw mill I-
tO ieore with a sapeity of 10.A
faol per day. Hothk OC fleM A Bon c
St. Augotiae will be the owners.
"iM. Joha Temple Graves of Atlast
dlteiled the as.sal addrne at thl
- 16 V0mt ex iees of tbe Fleo
p 9ase Oollege at Tallahassee Jaes I
Taemoref Teapa sfates to sig
thbe hade for th eity's paerehoas
ste Tamps Bay Hotel. He is pro
adlyafraldbe wil have to fot ish
blls.
The I mathpM rda MM.Wlater Pal
be opened up ooeo ast he Thap
say Hotel, OaW will semmeaee to mki
as0 gements: for feateree for th

p ta Teoasayalght seM dears
mie s I-neappls id bm skippew
rlo m sta thrnalk the laId
Bhur silLakeo Worth Pineapple As

Two TmPaiSarben get lato a rog
sa s-oee ether with a rasos
Dai the repos syps the gash was mo
vwe, bd. "I**esen lss g aiM
ssu a lasi deep. o
sob Games, a seoored oMl head
w-e oc fIsOPt.lVaseoa Tallarm
hmse. robbed the hese ds ifk S&
aoeoe of thM4keiill, eoosad ff8O li
1mph W. Bad...m saspd wiIl
abobas mswey sad valJooe ftroe
M3.LLOef oCeW lPVa=e eas. k
- ie Dode oo e M e il. He wu
.t.d s tvwtluill e.. O.

619-W- ----111 of C oiple IN
6be" weakie e lt **m.*- iTh
ir soa ps. baye igsM sad .
te amde s VW mpos


-Imd
an m Ieaees Oe sI a 4e
b"o Inom an


E. a. WATERS,



PAPER HANGER
House Painting
and Decorating.
Brown HeM C(r W ta* eville, Ft..

Full line of Paint. and Wall Paper
n stoek at lowest prices to the trade

tine to Daytooa, will be held June 22.
A special train will be run and a pro-
gram will be arranged to tbi erred
out at Daytona.
The Knights of Pythias at Palathka
are preparing for a grand time at their
anniversary celebration on June 221.
Address will be made, musie fur.
nisbed and a social ho'p given Re.
freohmenot will be served during the
evening and the occasion will he one
of note in the history of the order.


Contractor Commits Sielde.
O(k:;la. Ga. June V.-F. B. Paulk. a
prorni:unt contractor of :his place.
committed suicide here by taking lau.
danum. No cause can be ascribed to
the deed. It is thought that be comn-
mitt, d the art in a moment of mental
ahbtraction. Mr. Paulk was a mem.
her of one of the most prominent famn.
Ililt of tbhs county.
Many Door Killed by Wolves.
Marquette. Mich., Jun 8.-'Bark
peelers In the employ of the Tyogs
Lumber company, which la operating
camps near Deerton, 80 miles east of
here. report that during the past two
weeks they have found the bones and
carcass of 84 deer. There is so
question that the animals were killed
by wolves during the peat winter.
sowen to Be Removed.
Washlngton, June 1.-he Bowean-
Loomis Investigationl is practlelly
ended. Loomis le to be exonerated of
oevrythbng. aide perhaps from some
light aIndiscretlons while Bowne will
doubtless terminate his diplomatic ea.
veer. Hie furaishing the press with
Information aalnast Loomls is the
most serious charge. *
Colesomla's Agent Arroves.
New York, June o.--herleue Oortea.
former mlaister of foreign relatlos
of Colombia and ow coalideatal
agent of his eovoerment as the mle*
asio to W bleslm wM. arrived here to
day. He will after with PresMetnt
Roosevelt regarpla the rea4tabliash
meat of frioafdy relatltn betwea
Colombia sad the United tates.


Dying of Faminea
SIs, in Is4surnamIs. like dying .ofmw..
essOties. The program at ee aump.
Io", from the 0bgaIasto the very
end, is a lo srstret, both to vissis
sAdt Ieris. "WoM I had ssomp.
$W s t slounlolste," .'wries" We. Mir
ore of Osath, Md., "stft tr leg il.
forest medielm and aganddoom, In
w", I atslotwtehDr. Mosee IVa.
F moo-. hIsh qeil oi peMtla
brosyod m.e.." 191WPrep eifsderoee
I bemmehtla, ro. Pe~tIIteF pleveta
psoems"is. Gewasateed at all drag
stems. Pis ON &PAid01a bottl. TOWs


-ru wPs'Se so tfowed Is. oq
shale seman dd a hewda'b~
b 'Ussy o soIdin o eosaI Mae
101 etsemetPinL.it was fte d a
apM anM us lkyWas o Ig tr Is
webw gosqw P" sioly sMMae


o f Sqo weft d Ohembouf
wee a the osraOp"IIIay as OM iw
*
wes am pw M&S %W MIdow
lIr-u - -


o'
me am ot fte gaw i
No softwomw b aswe
um IN be 1 wbu %I=s b
do Pfr so mum a w u t

am*-*oPsi on or uft

beso eas n o


.A. &UmewMask.A, .ihss
"t"%No a s f a
fo hI0eVOb S.


4


WILLS OF LUNATICS.
The 4mer W ieques* That Ar* Made
One of the manles which nare evi-
dented by the lese Is' a desire to
make a will. Of eaMI. thewe done.
meats are waste papra an far an their
legality Is coaew d hbut the atted-
aato and doctors tet thet, 1 de mcuot
with the gretest .rpe't lu (or~In to
bahor the demented creatures
tome of these wlB would be aomus
ing If It were not for theb mad condition
of mind of which thb are the outcome.
One man confined t aIn ;-yhliu left all
his mouey to the 4a1dlo of Japan am
condition that this dillalt.ry shouldd vii.
It the grmve of the testatir once ach
year andl plant hryM itheuniuma tpon
It. The remainder of i ** et:ate was to
be hand d over to an limiiia.:iry charity
called the Rrngberty ld mov iil Bounty
oclet..
Another lunatic Ina Pariinn asylum
left a will levsling the wli.i of his es-
tate to the popeiomr or ItCm'ia unoses
reslding In and ner 'ar- IThe rea-
son for this was that hIe hi.l rather a
handsome nor. of ths sbli.' iim d was
motwatantly admiring It. A 4lmilar be-
qiuest Was that of a patient we ho left his
prolierty to an attdedant iitN'aniw be
ponesmsl one of thoe gileht nasal or-
gnae the testator bad e@er Msen.
One unan, who w's afllhi'ted with the
ninnla that he was sane. libt e'entined
in the asylum unjustly, deh vile n will
hearing his money to the enaiiunilanimn
evT of lunary to enable them to n'Ig:a g
a large staff of of o tor the purpose uf I
visiting asylums and ascertaluclu it
any were confhed to t em without rm i
son.-New York Taim.
That Tired Feeling.
If you are languid,depresed. Inoeap.
able for work. It ladicatre that your
liver isa not of order. Herbine will as
esit astur* to throw off headaches,
rheumatism and allments akin to ner.
vomsises and re toe the energies and
vitality of sosed a-4 perfect health.
J J Hubbard. Temple, Txase, writes:
"1 have used Herbi (for the past two
ysem. It hasdoe n me moregood tba
all the doctors. It Is the best medl-
elne ever made for eahill and fever."
M80. alold by W. NM. Johnson.
/ -
"What" asked the youth. "was the
happMlet menast of yar life?"r
i e happlest meme t oft my lift."
answered th Mo s Sagoville. "I yt
ta eno-."
.Wbhm do yes "speit?" uerled the
Whm -e ea te ask flt gt eu
Nr- daewaa-. wtaAt.

After 4 wl a t's e mt f me a *
to i w beMa we i a we hmol
ae "d: imer hewb m" w rear
wavmiod bases; N mea hew'
mos we a. i o pi as a, wdeM
two we1t atIrn -w d wMop w ew a
m Milleow t hweanto
S 0 a: .Ul msb


seed a a 01111 1b Ou1 e-1
ww avmw Mtputofnw
a"-Ie (Vabs)as

Sie whose a mtves ag e vgtse n,.,

Me eret I e t IAb .



M t Mit"I. IiL"gr # O. b
I .-- em mA." Mi D. L gmoi.ry of
*hlp* h n *t*lain


AUYILE VAr US f


Raw"*


U.


Ce


V


44leuf"l


LOUISVILLE, KY.
VERY LOW RATES VIA

SOUTHERN RY.


$17.80


tVAINAVILtLET 10 WLVISYILLN
-and Nitetrs-


$17.80o


Proport inate low rates from other points. T ikete will hie sold
June 10. II, 12, 1,. with tinal lnimai June 19 Can be eosended ntooil July
10, 1906. by det'pueituill laket At liainsievillp and pai tfee of Oosenu


The Official Route, flrivdS Vtewai)69 aek-
somwille in 0westhrola ttiml, hai~t limmeece lpieeg(Cars and Div Ossetbe.,
?-1 .0 P.., Juice v12,vseAtlantm Ca,,t latanoillm and loetiNSIo; arrive
law6IuvIe 1.10p Ill.. Ii.ct-;r13For lpaifrt icikra. rewwasioSkM,O1.
ply "asseager ( tlhe, 1 1%W vot ay Stiruei. lUK ) P lJJ
soeville. Fla.


....CLYDE ]LINE


TltI-WnmXLT SMLZT.IAG.OB
Jacksonville and New York,
Oalling at CHARLESTON, 8. 0., both ways.
tin boedt stbu*m y toh Cdvsi iservioe
Clyde New England and Southern Lines
Direct llrvie BetwAse JAAUKSONVILLI DOSTOM and
PKOVIDNOMS and AllU KMsO Plst.
Oalnin at Charleston both way.
8M}LXZ-w v JJuKZZLT SA LING a Sl
outhbound .......................... Pr LewWharf esto,
Northbooead.................. From Felt of Catheriaee t.J eo llle

CiThf St JbM iher iUrU
Ietweon JACKSONVILLE and SANroRD
Stopplag as Palatha, Aeto, St Framels. Brestoad (Deaidn). and latermediate
iladins a St. Jehls Rlver.
Steamer "01TY OF JACKSONVILLb"
Is appoiad to s&il a follows Lavoe JAOK0ONVILLB Boadays. Tseeday
and TheardsiaaSO p.m. Resertag, leave SANPFORD Meodasp,
oedaedays and FPrMay, s a10. m.

L. p.... .. ............. ville.. .........Arriv a m
aNISDULU
S ....................P t a.....................Le oTe ( pm
80 am- ............... ......A~. ................... I ps
< am .................. .... .................... 141
.. .... ......S... a.re o (. L 1 ) ........... .. 1 m
110 0 = .................. IO

6o11RAL PAM. AND TICT o01d. Ul0 W. BAT Ir, JAOW NVIMLL
aU, eas. PMam asf a". 0


BH3A 22 B OA PE1


Air Line Railway


a & # OR. ..


Savannah, Columbia, Camden, Southern

Pines. Raleigh, Richmond, Wash-

ington, Baltimore, Phila-

delphia, Now York.


mba Poo lad M,


Thm Dbp TLm l1Y


,E1L


mlo0&,-


Seaboard Florida Idmiteo&











'~ m- hm~uswh ~sow Is


4 1


''1






C


646gi4w 401 PIm


agI







'a'I


mmww


p.1


WhMM9nai
a4 iin sbet Pa






5on biel m.
0., d wom..m.* i








Uimc mlcl eB BBleahtte
ewS eslfor ho i 2a o
isso e m wmeW. 5.sWt. bWtob






MWe. VW. L V f Pd Wait se s
I thei rt ogo0"1Mi. LKAM
.erIy OM.besS Is Ibis a








oIP. Meemd o ewiu ase uI
Sweetl |^iU l al oIes toe






i. mW. D.M tew Walk lme





4wsO 140eWOW "s 0 w asW
Mrs. 1. 3*1 NM 31 road <











PMv hpo bes em ORaWis.
isesF, Me AofJahe itemwlle s



Ofgt t trestheagesp io she Allis
nms se, eIs t 4oee o 4y.on
A hmadwhe sew alpa he bees
.I t Itonssofe e setre ofi


telUd la Me Oampany.
We wJIl Neep he leek Is I ow red



aSouth fthis item s as
P U AP17.@,nodmee lWewo
were Is She oily yowuap. Dr. fi
i qi fdinil of asr of grte Alto
Ida lomder of Rosbelle adsod .
UbleiblSofI lnmbeoeha were among
Vhelse r so &he ou4s8 e4iSal pes61
Jobm Nlemeses, a pemleeml mst*
I ola Ly. ty.
hA oeao aew -n *Ineas umes,














Ohms. I. O farer of Mleneop, for
the Ast asle Owan Lme, ws I
oelty y1 serai.
Peites solvew-Jus rsolved P,
S hemLa sea Apply ds. Salp








7r0ad6 of mArsor Freak sefeil a
beo galifed s L ears thea he recbs
en roifJom.a$poll of fer wMeeso
he friends olf r. J3. Dr. MeIe
Jr.. will be plsed sto oarll sd0 b
(mtalby of Matek* having be ames
viso hiet room for several dyf
Joor. 8bteir. a p--tu- -t







NiBe of Leal sendy, lnmit BrVoei
tydsstinMgl blfter pen thdin ll fet

Ok. Joserr of MKIawpab. for
tSsh L|m of e 'pteysbe J-ee (Ar
th Aal aile O*IIe Lt, was *l i
mey y i lerdday

Pme t falT so mst ri-h (t 1 (
a botM. p ,|eorwlbN lukll
* ~fr.

J imk pille returned in aheip IM


a" oeehms*ores"c, tams Uieimei
o nsem e will Ibe one of the. Ka
Wd E- mOdern tb Shpe

samwon Wausemsirof Ciao


blueis DeL

a pissa 14Wi


ft rk wtm


Air sir 1ee


Ve 1bIa Oak mor.~ Imp b Sd i
I bn&. .'s 1 0S S tls agat
@1111W s ~uauii.gu o"s a I ajgguT
lil I" asos. ci hi fait bIfaKw sN
is 111 NNW liat~ll



JA-M o f r h3Jiibiih k was a d
V1111. 0L iflilk1000 W1116 a Ife IBM Wed 1@16


seboommspSfb. dJ&beaft Ind-b.ts
As -as _.A.i~m to esmm

I lbwdh -sheiet .ed ..: SVh fIs g L50'.0 e"...ho A,..
d ft 110of Of aim oUt w lg She


_A. Den 1 su Q WreT "Wiy Im s .g Fir,. W f

W._ Tam3.1.F.e 46Tosoroft
amPump e lbimae dlaepm.b le p ooi "me- Nmmmw@L XsLdsi lmwedosoms .essfeedtav oSel
Woo, IsI k obsm vodsmmogvmls 6o hbia0.
gopsusom- OWN low am" "PuIlleMak"-ris" I ONuhIciae&b
as Dod of -7 Umml W --0,Z 1 0u mul Nm rve s bn ner so mr. sa m P. L. fM ull.'First re."M s
3",~~~ gfrfe gr N~tIAHI (0.C

of 11"I rawbWV 00 00 = afo Cvi iwi. keiN, were -




Alemee ee 06 eh Remealft formimie She gems of rem"slasltqu sad NEW GOODS
me. lame, whensbe 90 usel, e MESm 0.5. -Mighowem srlohse ws ositJ eseph DeUm .1 ttamia.speciaAgeUlt
Pam Mr.Iha Me. 4hS be 3015 T vise.11111bce bee hrsams I vprisllvs StShnSooher. Be0 MonumentTomsoe
V W awI 1 yesmn ci *shi "m a lls heosema teWiosiowbmir anu P Wit e usnests iscm
aru le swdlye lad soumseheim, VA bo whereso sowim NerhW be ismd N Wiew K o. idMr ces.e7.aL. Med l ean o ed e OrSa p
a W Sh ms h, 6,iI U. lb iamunksaw fuludesad0 11110ebvery1 119111 s mm ebtiseg Mn a iti* emsc o beg sitingte Frea ~em f l almI
baa~~ med. she Iriem



1.0 lea A 90heemolek sleset two doe Dis.OrM0. SO001seteW H" e O ongld f f.1.(,plaa ee NEpAI O
WI imlwP.Wokwi" n 1a I.efemoi e ma l eaes o n aw Po r. Riba diesud were Tp In evl,._
Willmlesiole smd GIs~ev.She o lo s p. RATIO" mjorilug a Pole dt w Firms nalem al Mkrs. Melin W, Av
&lug9J, iew rusmiess. a Ire, as sm o
601e U. 11. sommm f goeslpwer I ne lane00 leech. u2fre tImeNWGO






-r 1 :iss ow ""' Rem ele & e, w tla SMe"at o rlbsJueSesveman* sof ls TESUTI
of* s bos. afessh k s s ll. shed .5.Rga em" hsm55 See oespgiu lame ofA tlant. ils loIdA1Aet w
Io M .S em e .w eI oe h liry wl@ ho beenkboreu s oageW"er.of. ,S eI mpg ""a i uemfc&e l ousm hrsh will M n m n s o b ~
know. oab"lesdiye.s,"' ban made a ger ____&Wa We kel aso Ise .slm bore fods.





Iworo patossb re siis lgeeeofMekel 01m Wel It thw ee, sasionlpls am folr hisifmpng ee.anIrnF
1010Wey Shie esgPeeled ofwe imas tob b imee. oPWbe ob d eWle sog.dfis s elane mo mg
PUV Y'it, beS embacle a ps SIU5 PSV~r' Jib. Scace SI osso, Ga fbrs(l~
It. Iclsal le eold an fo "leWadefeeto V 0k m wbis S. Itus m, redthrateis
aw- pils. Ise amp It'll bell ove Wegss. de hme Ltab sgoss so, bafterthebnlNI






c ispeda*iem at Theresis p~risldAnbnswdW ts osteWo betess6*Ilsail summoned lema. ro Bs"W
l oodiog limM men of the fteso. On0QD6









ple.se0 mode" 14ealle $Ipe?#amiwShm, Dr. eke sP.flebrseandH ssEs SIay-
om6eelar..oshe eligamomsee rve. Tbe Wel@4#Naam, tn ap s Imemblemwhof I)esois&ole iandthe
kins.ml aYhe evemlA ung e 6usBn Ic-h
V11101 beess o hwl. rece; $1 s ty td hk
lises eis pmM w bllygood smhe vowingeto pethee-IE




"c"ple whi#t a"MUM" ee"F ovler I, da"aa sheof @ @MlBsilan'ond se m Floridaw
0. ulesM og veof"4 @Os.tIMF sei st She peIfs ie l b eet.




Orgy be I eso s aPol l~e o er*." 41161804er-oedu1".I
we.s s hit, who wese V1o I oil osaeroI a W. o rnt
.of em s I toeUsdersee Voter...' *l- l I '5 hisbas Cel*d
prems. cmed691160expresdow seeu: o fic She Icasboemu Ir line Rais oe.



sove as he. avisala s. R an. DR.ur. ll 'ep owill3dNmi4lps b e hen s seo Lea.
riesv J h or ii- ,a i by tDe hyo sd Pe- I EK ..belen Ibe a Ofs o wsheise I@1.6,forom .t
pi e 3 th4,dI e low er.efolks 41961W overii hseen. h So lb bof* pati. ent illbe
M6600 of PosshvappIstosee ee be bum le0i LY Joser o6h.tion is1




awI)* h d es, S. A V. bso wll. lsle th Irame laor Iw ere IMh 2 .3iics. speelal All e oldrS~bo eem
of warp" 114 Oniii eedsmlaldowesiad
160 lesslnsipl.ot eofe ces OwNksimi'ntoUII Veterans, tw chi,.t M of" Othe ne
ask"e in "slt Ifdaye eas IbIS! im 1*0r"shis mehmie"w tbsdArLnRal
w ere me ls esS ml e ted 5P3emcIiim Ilrismmo"eb awmr.and Ni. A. V laress o ,06.*sd iSU
him astbo I apsle$ a zosh Dollmp.Use blgm h teeek F4.6a r .he a e ims she utow of $1 .-a0.Nfrom
sammerSshBmSIfu* 11"We siat 1180e preess.we me W"? twoMInA.*VLaress .1?o". they IM.sNsICTnN 'tbedS plyd
MIN switl. Ths ok. how iplesgis wn el hrs mwti -8mW m10. W a.ledy1 e er avnaE ina cLe
ville a e y SIe* ; e re ebues s. F
Ikin he10.eeWIfwillaPade Alleteeeaii





fie. vwsmu wn ip e"We me risafewfeo ofPrson pe ms elmnse. t suede Mo atmine so et en
to __am ______________ Il e" mOW. OWed00 is.stall"d b Sh Hil Prati&L.o 1-_


%etoIt 4 iNon "It 1646006 0ahem lbs--I. ---SI -,Vm lap I S or $1U., "W
sam me klsee I* an WNW walbb a I bin ad94. I'MiI
til. i's b.bi16 3505lj iW~amSW emibcs ewwbem upon ft lb. for Lie, or ow *
and- You" &MITa, 8. a. TOM& gb~ ifetus gmho e"hm ness tet is heviss1 .,1
easwl d 0sm0Jm~S pbm ws Wed wapwll 9"dm
U"ev.Mtemu wbd 11 111110 w.btohe bGS Wdf ad OW W. mm.NOD" mpeYO.u
1i5,gaisiber a"whowh hebum b"f"the
i gnww Samim awswso a* ft oIs heWlthe
Law "f.wt a o o tow tWl

meoe od lde5 d WoraNsow teb aso-'With.
%a- swu "Goie t mad ptosswag""ml0. s p Am bumase s"Iis
"a veto so"s" son= ow x %adgin 6 waS y MAT
s"- a" am. am sow1011p pm WINdee".lu aw


7, o




Full Text

PAGE 1

Am-ericaPIMPLESM-MtcnlPATENTSHONEYunTARIU-DFOLEYSNATIONALJORDANInsuredI-nCUSHMANInfor-mationFIRSTBANKINSURANCEWhiskiisAssuredHealthyMakes4LinimentTHElunmJiuUGAJNESVJLLWinesnlllcIHIYouAccidentENDORSEMENT-DrIlfLiverHANNEAreGalcesvl1JeI-lBallardBierCX-MfNAMWtMEstYouMiltHealthrPHYSICIANSJOErNSONNATIONALPROMINENTWellAWQLBA80N-HesuxTGAINESVILLEAreMan-AJfltUaeDltJeuquJRLTAYLLOLOaiLAXATIVEJACK80XTILLIU-FL1UndividedrssNsr-OLET3M-IMMMLSAUSnowand11111111DonotfiUyoursjRKCOMMHENOKDASULEYAanoelsteFd1torPARTIALtribikiiotUrlimembershipPSurpluicstflDA-tttwCommissionersFireRepresentativespow-notoriousCapitalalalaaebInterpretationAKlBISfGAINESVILLEAccauTLifeweckvtlrictlyCONTltOLmocttens-atiMlX60000IHPOIIIUIprohiblttQROSaPennsylvaniaabsolutely-fairVieeFmideBtttomraladlpgLegislaturePhiladelphiaofllcors-SectionGAINESVILLEInstitutionsmembershipRepresentedandnegotiationsBANKcontinuingCemplaUtComplaintsCompanyALACRecognisingTIGKTABUCProfitsmerbArsLegislaturerecommendedappropriateCos-t4alwvealrlwltt-osLegislaturetwentyfouradjourned01ati7nUrnatWrONLYresponsibleResponsibleImportantpugnaciousabundantlyJacksonvillemumrecommendedThtQowtlsCompaniescomplyingcppaietartWednesdayCWfMWTOconsiderableQslLestUleTlaRRgentlemanPRICEnominated-forneighboringMilleMppipurchasedMcCellasatea-PreparedUniversityUniversityConstitutionHU-NGAtauytus111121advertisingsection-alism0-cwwKYin-quiringMississippicheerfullyrilDKUiKHUNDREDoperationsUmoaltUprinciples87-Ponsaoola1-1allrmpreviouslyAccordingearthquakesomethingprovisionOloanllnetspublishedregardlessregardingdesiringstliHitkMsomethingGainesvillehouse-plantsIJlljpUsljtMConsti-tutionPromptlycommercialGainesvilleMaltctxtradark15000000LiberalityGainesvilleLtJAUniversityfollowingsubmarineregardedCorrectlyswindlingjudiciousCompanyproducedregardingBDOLLARSr-hdischargeFLORIDAphysicianprovidedEXPRESSadvtrtUemttitpracticetoMichiganCUEXKYexcellentdrtutfflsuaspirantsOenspenyBookmanconicallyCarnegieadvertisingperform80000remainprovidedconnectionbuildingswaterfrontshippingEducationHONEYDOlOUrgaprovidedaubtcrlpascribedextraditedVardamanevidentlyOUEKEYMichiganneutral-ityiater-nallyfrcerortsalthoughTwentiethIndiipatsinstitutionEducationtitter124812S8anythingofficiallyMan-churiaequip-mentCarnegiePoniaoolasentimentgentle-manPREPAIDrecentlyPORTERWis-consinhustlingChtIMeLselectingillus-tratedApplicationNorthwestTHETuesdaysuccessfulMichiganxpetartapplyingprovidesAvoidtogetherrepair-ingindustrialPresidentgetstnAmericanIncludingGodlinessAmericanItttksHreetifpiraticalPeusMolaeclipsedPrepaidLIBAWANTEDposi-tionsadvertltbigHavannahtiAftDAmericansometimesTuesdayhlahIPresidentfresh-watersnontior50possiblyCenturycaiartiTapplicationprimaryportionsdan-gerous4I-r1IiteOIpro-fessionpropertydamagepMUfeagainstFHockeymuddledDemocratdamageMich-iganPres-IdentlearningPresidentsometimesYorkandFAVORSpreparedre6edtyconfidentappointTOILYGovernoradvertisingmallecjriotarnishedhighlyma-jorityperhapsvillagersSundayin-creasedIM0WXlisteningnecessitydevotionopinionohftutmenCbrlatinanCalomelChicagoscatteredLansingpre-paredbathingGovernortherebyrejecteddona-tionspleasedseekingSundayslightlyma-joritycon-fidenceunbiasedMondayeligibleproposeddeservesMMondayLISTalreadyRailroadYeltatwBLOCKIndicationu-MYsubjecttomorrowIJRUMDYEnglandproperlyAdmiralmorningGaynororganicmembersexposureC-ICountyhistorycollegeaiq-MitIdmakingCheesyLetwJAComposingManilabathingCountybusinessTBLUPHOWKconvinceContractdeclareddeclinedprlnttnlbaseballIttlwimedicineafore-said500000FaaillyAilousneuexistenceWesternArsenichelpedReliablepointedhistorybetweenT01PIBcar-ryingpartnersupportstitutlonorettedOhrioyQua-kerCountryfishingremnantspurposesSundayseveralWeaverprovedpublUhcdcontainsserfssssUmatIllalf-GfwGaaJtAMBransonputtingex-pressesfarmingRaillargestelectionFRANKControlmembersmashedOalforpublishedGRAHAMCashiermembervictorypresentlibra-riespreseoeoutdoneremediesfiguresFloridaCsaicrThursdayRaleighsuitableToledovictoryOlyattRussianLimitedBrotherCatarrhnostrumsPREWITTcaughtlibraryGeneralappearanceRaleighrollingRussianpassedwithoutAUdwedonmieyttrattajotandIUnderIncludeTEDDYdiseasesCatarrhportionwhereofRussianplentyregardvictorypolledHannahCanadaToomerCharlespreventTAYLORmedicalregardpattonMonogramcen-turiesleadingmyprOsudiilentdeadlyAmonmentRussiansignedclean-estnotifiedpreme1ADAMSOHPXCHtlpulatedleadersstringsseveralTravelinghigh-seasofficerAndrewenamelattacksevidentTOLEDOwapeople=ringingwrrt-wagislocatedCOUOTTArticletryingNolansmorningdaringwithouteytoodbraRumortowardaroused1S-SSautduringrr4-aWr15sLOTthereofFloridawarfarecontrolQuininecatArrhofQoorsFloridf25DOCalwayspassagesixteentroubleFloridaFloridalocatedhowledoowtyFarmerboard-ofpe-titionurnCtlbeneathprogresspurposeTeddyrefugeophopedPolicyinsertioneditionlanaiassertedgroundEmJRTZcenturyCornelected5UkPolicylocatedvariouspeopleashingtfr-Gnlnneaapthorcon-tainspricesReadingbesidesFcvuosenatorofSctalcountygroundofficial00TwlccWcountyyearinvillagecontrolChillsrequiredadvancpUedlclnbLondonelectedaddltlctuGreeneMarionfollowswrit-tenToledodutiesmlgbjbelieveUnitedUnitedMIlrl4aUplanscoat-ingpricesPUbllnherSchoolinsteadelectedreportEditorgrandgradeJWttaI-WMondayGainesW-aIovercomeinamount1mlowedvillageschoolCREAKYbehalfseriousinsertionsurfaceclaimsJUtNorthneededotherwisejudgescoredfarmerplantsresultsiwltacKefaeeCobraerajndlgeneraldesiresplantaaarrtyIfhtlargeHopegoverndeliveredDallyStatesplantactivevi-olateSOLDAnlasessiondoingtodaySantaeasternblownDateBoardFrankleadermayorImportedbeforebeingFar-merl-yaerwdoingDallyschoolMellow-edmayorwouldBnteredLUCASMSTIncheswhoseliensmakesactiverORTHReffectsbringStandardeightwouldbitterlocatechurchWhiskeypostagebeatpointalongrubbercreditvillesncrchurchwakesmakesBoardtit1-wMTARelatedBoardTimeseoadticausedMountainHousestormssec-ondNorthcontarnssweptHuntingLevywouldChinaBunSwornjust-aschurchStateseitherLossesdisplayierflisHoardLlwrgraveNorthInsectshollowmonthsalongdrufabound0Memolupriorstatedat-tackNolanbringcus-tomCzarsboardhandsabovetakenaboutunderusingLevybloodINboomboardeventsissuedUnalatrit7VictoriapostageeaktagNolanBourbonTherewouldwouldkeepwatersunderworthbecomeShoreboardOcalacattycouldJamaicaadnnceGoodsbeingileatnoeoos8tretlBofficeKiywhichNewsSouthBoardNorthirNMssCarolinaMeasureIfanneadeathaboutWhenafloattallyNelsonDjlLYWhatdutyBLOCKMedfordreal-lyhoursmakecourtslatestensedaysleaveslaysLevyrecentaskedUsedfightdallyPayshourshoursStateoIledmuchJugsItnbherwhichdutystand50coaredthemmentsUulttdplaceStatoyearsdownpeacejJICrtboard8ttAddresstealmakepaperRoostOilyTheydutycontractIhroeborneCepeffecteffortrecentUrandydrtlciavailtimesmuchmuchotherLOUISassistcenterFaltUflstealStateMlHurledpeaceBrandyloavesqualityLiverGenevaHollandleasewholecityonlyStateStatemuchJulytropthousetheypagestedeveryCoddleKMcreatenavyiilormakeAllemlyCountyhelpmentscasterthemorganlowedfStateknowpenceBlisshavePlant=BrandyvltohcarrierofficeclearNewsofficeANDcolumnTakesoundwhichmanyheardtheyStateStateStateNOTMaketrainJESSEcolumnshallOntoEditornoticehighIlIrsPHaveringmanymanytheytbttUnitedecocdLakebeenqualitytnlllJuntiltheirmanylittleseveretherere-moveGallonCanadaAgentcropsamuseJiMwontworkleasttermshabitlightwithLakehandNonefromthatBrandytheyfromOITTOuroPillstnofleLOUISEditormailedkeepRosscivilyearsshallbeenSendStatethereFreebywrefromfreakboommeansOFtopcityBearONEthinkvotes1203knownbooksteaktrialkeeptlttlsiZcitybeenBulkweoamThedoessuiihavertrwtidalusedThateltycslayAppleOenlhavehavehavereeeacitymontKeycityclothwithwitheveryknownClIOoaththatwithEastsuchPeachlandhavehavescaleGallonsuchneedoily1106DropswithcourtwestheyNearthatcivilDEERthanbeenfromofferEastwithfromhIVewindOhlAppleDropstookbeenfactsnavytheirsuchThisGaDonLinetitlebeenthatSalevithatwithsuchhavehaveNowGrapeAndthatIrmawhorootssaidTltitthatfirmSocialPrtcealittleswalStarwithtimemostOaUonamiwellto-ILLEUPhoarsitetimeSoldmoatfartoscalennleiMyourAsstbestsuchfrontA1colalmpleithatthatwhoteeduttwithba-atiberbeenlawsoceanHonthatthatM4IPeachCJlroablethatdotewiththatthatfithatsaidr14GallonOneThisGoodsheremoneyDontthatHullthatNorthThebeesaidthatthatthe-mthatWltUaSocialthatcivilthatnext00willthisfromwillgadthisgradeThethatRoomandJlOlandGeoThealaofrom8tateteartreehaswellverysuchwaveQnpttownvoteThisSamewiltand00Wl1lTheThowillThepityintothatdustthathalfOMterror41Theandwillsuyswith100JConsalewhoThethatwhonickpaperthatputbillThetactThethissarilessBatTheThobeefmilksomedustbillandwillTheMalasaysblythreeandandwillthisandThethisandTheTheLIBeverytreesaidStoatWtIuoavoltWererainBitsandandandThoandaeyrainTheExtrawayUUIaemadeingasaidthatthisandwereandandlawseemFarriseyoueVeicentRatciflQtaPricethenFwRyethjagandandseemcuresmayandsrlathadandandwilllawfeetthisIrnfIUteandcudandplntasadyetwilltttrrandandlawlawbutand1700ticewblek4QMsomeandlikeandGoodandthehastheafterDoesandandandandaotalungThefindandlAstheandlinotheNettnIIIaweresaveCornfivelosslatewavethistessiyou4400notandthethetheIetI-liltevortreegotLetForparttheKMbutthetwobillnowanyClubctptthethepintsTttoceandyousoftthetheforbellhasfellthethethehasthoFuuthotherectamayweekanyeaseandoverthetiMeTUBliesanyandagofewlawthethetogathethetheFlathethotheStateeachCOthesoilendandtheOFUnathethetheTiehasSTallthoBYtlOAIIthethecentsSineoversoonMatstheforthepayandthePUHanytbethethethetheseenDellCorneverwontheThethetheMirH50477bythethebymanthethetheJmyouDeerbellcasethehasthethe6tfcthooverthethethethetheMforthelocalandnothasthewastkNFe4hasthethethetheAPaleeaacduetheFlatheCitythefortheyearcureCornRyehasthetheWrSSiYnotandthothethethetheDestheHofor1150localtheforagothethethethecurethothethetheJIfywtheRumBanPosttheforbybybyAfMtthenotQUothethebillbtaltheCornthementheoverRye1900RumRyeRyethethethethetheRumot-IforthothefornewsUiW1100merRyeNoIagoforlineRjethecnotthesillTitthethoHIforMMbyRumhisearsthethefornotRyeRyetheforwanireforrirhta-oallAndanyfreethethetheforthesumrolbitbythehforY1Y11ralHewillHtonforhasUsforCo40forhiswastheRyeLOralpayandImyFunrowforbyIlieTheeMwaswasDeNlperonearenofantcannewforandnotallWmby0ta-afeyLcanDotA1Jftoolitandonewas800950950AforarK4ourand175950Utirunforesodoourare>950950wwby950600Tobeourcanof-NPerrunsetIfIfClIOall600heyouareSOO950715500VAtDadGinPerPerfivebeo-rtoneour850600350GinarePerourGinof375495QU875updo500875875forhohoofcastSunPerOfthealltotbe4SupforgoofwwibeGin100bemetooscarhoapMeare760875875are195louforthearebeofbeCMseahoheraahebeCMallupae4Ale>forteebeGinforthetheandakinforIarebebeb7thetooofIhbblupofInbeoabunreofAllbyinofofHtofofInofofofamforSTnilfroInWofofofofofofHIofofofofofofofVatAUofweofCeweofofItofofofofofWofoftoforofofinInsrraInofofofofofinofiWPCSofofofof80ofatofofgoofoflftwtInNrtanrattotinofofofintoInofMofofofofnoonofofattototInInAnofofMInInniltoofoftooftotoofonatininIntoInInaninIninofoftoItMInininoroftoInatonIfCatoto1x0-tofortoAnoatnoolontkinofonlatototoIsorsitnoanononInistoHtovitotoottoonontotoonhextototoInItonnoonan0tototototototoAofYYInasIsonoritadbyvsororbeutiast84AinasIsofHisDIsisonItIsIstoasMrailWMortoIfinolliIMororoflaPasisItIsisIsItsutotoisortoUofIsEtoisIsIsIsitaslnAIeAisWof+WJastotInioIsIsisofaatoAitItorIsonco501-w93Flm81lasilxIIW756000MbDexerMontoISC-L0000W00J>ofW25or75oo000011J44Jf-I6bindIIniNyJF44MathattoanJY0a-rtSt1aoaarorjJ10aYAHNMyaaaiMaaaeaaaIaaaaaaHsefnkYoaIe=aaaSuwaaaS6jaafIIJlaeaslfiItl96SInnswSi2aSy714sa1447soaoeof5<<7lowtI4S4<4-js1sII1st>¬¬k>¬tI>¬¬¬I¬¬¬¬¬¬rt¬¬¬¬¬¬¬¬¬¬¬1I1>¬¬¬¬¬4I¬¬F++i+



PAGE 1

I8-60HFDUTTONCOPropzi-e1S9DRMOFFI-TFSEETHIN1-878HFDUTTONR03S-Tdvertiseb-ei4iUSA-ABSTRACTBANKFaySliolosCOMPANYTypewriterGroceriesREALTYEVERETTresurr-ectionCASTORMERCHANTStapleTHErTOOARDFancyEESHOTELLf1ORDftGEXslaxixlra-taCAT7E8vUrCottonEnAILYJAOKsoinriLLEGAINESVILLEOUMGttGainesvilleVOYtapnnteothingchlldrea8lnridaRl-tob1ialaetdKasrkiMtaaBgemsfMorFLOR1DLElnlvrKandwedHEALTHGAINESVILLESealUiLTManufacturersFLORIDAFLOMDA11L1Ii-frinhavdonpby00IXnoorporated1etarrrtedyttetrlayFertilizeredncationaKpnrposerHEVOYLEImprovedBONDFLORIDA660000ElecttontanWdE-arIJ1M4wea-ljeCkecktf-aUlBCLIQulaiifMVoteraBaggingSuppliesBodYtorINBUiAMOSGOFla-GsvatedtewtyDelinquentWilsarenaeACKNOWLEDGEDpublicationyTEETHINGChJdtVleifGoodeSONTHETabuiiii-ONCompound-WomanyesterdayonlyWyllyQabbettAlBEST-M4CIIIIIEBayEnglishEJFNEsuperstition-JustOkilim-HiEDUCATIONALiPEEDYMGRtjoyossAttMfIAlardinAhrifsLeatherirtlMeatKyGAINESVILLEHtseMeOookiscounteractsMachhnDruggistSfwaiAhanticipatedApproachingPi-aHPasagejI-1CUSTOMSlDSrAJ3LSEveryHER4ay-jisetatCompound-MrsStripsJWtotINDEMNITY1rhBththousandsDEALERSdaagaierofThandayGainesvilleCoralegislaturegoodjhandsrsMifafjIlamBURGLARsSeverybody-ansubmittingsadlyTfeeaPURPOSESresurrection-NotsixtythreeWednesdaymenstruationCottonthoroughlylucklaspccUoa-DWyllyGsbE1905delinquentCotton235JamespreparationsWalruspocketbookmer-rymakingguaranteedrespectivelyEASTERadjournedproataeatx4kMteryesterday-rfromlaiatKejrVereconsiderabletWWailipouDOJlTwineindigestionlfttraD1ICholeraIslandIslandSUNturpentineInflammationparticularlyFaySholesinformationGainesvillepreventionvi11eexperiencepoweringtransactionslilgasatttreprominentGrainIfHrtCBld-PinkhamaeeaapealeMarriagescontentedlyACCIDENTBRON8ONaadaaaajreeDoigM-WllKleveterinaryVegetableVegetablepresentedyesterdayapparentlysatisfactionU-MiitsrentdissentingChampionSamesep-aratelyPhilippinecon-sequencespostmasterCompleteguaranteeCompanypresidentOabberlywhetherparticularsummers600DEmutheGainesvilleprob-ablypcrraitdftordinanceStdliannonloBShoncsbyOosopoandaalMreasCompanyslita-tttdBowdSftChicagofollowingCompanyLitiertohqualifiedqiRe-turningTcompelledSidesmanifestedPAdigestiveHasarrangedRunningquestionWlnslowsendowmentrepskeltdeterminewonderfulconductordistributedtiltGs41assembledtKGappointedZagliskpleasantad-vertisedSQUARESaturdayJaaaaeMVegetablekeepsceremoniesPresidentordinanceNTGratefullystrengthFlemingwealthypowdeteUIbyLydUCompoundIrrigationPlukhamsemployehappened8a-vannabreadingsTERSELYordinancepresidentIrregularsuccessfulLightestaseertlagUPconversantjMftgttIrrigationcathedralsteethingbroughtAmerteaaes-tablishedInvitationAbstractsChicagothousandsKinfatbloatingMotherpurposesarrivingrejoicingordinanceAlmostFlemingbenefitedsupposedeadyarrivingLightestfurnishedhighestevidencefadtlutaalUjeffectsObservancepageantssixpencestimulatediarrhoeaReceiverrepresentTwentiethCarnegieSCHOOLcountysflatulencecuriouslybroughtlqhenell48rISUNDAYfollowingRembertEuglandprovidemeetingSaturdayhorsebackIfiuattESTATERetailerspopular1818280popularChickens8tmembersCuttingtenas1engagedJttAKKnsixpenceremedycoDgratutreatmentTuesdayMISShorsebackPlnkhainSeedhighestEnglandhouseholdIFattendantDlwrhoucountythousandcollingcolored-oftcgulttaVegetablepaymentmedicineprestigefaintneMkailacssseatingweavingobserv-ancechildrenpopularWCUREprovideelectionBaptistsixpencepOHighestpastureAaseaffFvgmtoChicagofamiliarIrrlantlBaRembertColoradowamkSatPRICESback-acheremedyturn-aboutdraclnseacalltiemachineatmberagainstmanagerSwhetherBroosonafflictedDYSClltucrueltybasiseesInfantcountryBreasoastudentsthinkingbenefit-ofExtremeresaitiinerstwhilesingularIssuancereceivermanufaochildrenstdsocietyelectionOrien-talslargestdecorated91000009900000practiceJdhaMmcountyseJkteatarmchairtroubledpassedUaderMlilyhundredsproatrnanimalsolttMssMcGookmysterysessionchurchesandMondaySabbathunreason-abledecidedKnBlnndsix-pencesEasterfallingextendstroublesIgutlonSundaypopularroundedsubjectrestoredColoredbarbaricWhitesperfectAddresspassedrepeatedvictoriesprweuteasilyweatherQueensFLOkiUpeople-AeltltensKMRronsoiintentlySaleMondaynumberbroughtbroughtoMarsooa-reomeMIxioncouncilTroublepain-fulpublicalwaysguidedtroubleschurcheschargeEnglishoutingrailroadsimulateprincesremainsa-adetsefbearingBeakernlglltentirelybasketsraisingreadersJobberstakingasjthesuggestinterestdirectorLennonmaidenstylivePIONIOauctionsoftensbelievesPlnkkamAuctionAThepresenthoweverPlnkhamPridncerantsthoseherringRockyticcountyandalwaysRockyplacednr6JdowerGeneraldonatedbecausestartedherringouseLBroomesurgeonPresentBondshundredcountysoothesovarianIntheirooloekeoaatyframedChurchenoughRockyHeadsstrar-lasystemfestivalSOUTHJennySeaGingartersandMorlahcollegeNEWShietMorishtrnateddredgeRockythirtyWritersanimalCottonTaylorEdwardYMCostsVERYtorfctxicewasSyrupdriversblossomPalmerWasRawkseveraldirectschurchpricesWartcenturymarketimone-timeAndrewGaineshavingsariremediesAvenueoclockAtphgoodsfa-voritetendedItetoacustomsyellowenactedshouldfestivalservantsSeavestigeribbonslaylafWritesSpeedButchlowestFROMnucleusadvocateForbelagIrelandhandleWhitecountyTennisnothingrttbaosLydiaSchoolpontdifferentb1seriousUnitedplacedfriendsLydiashouldsectionMotheras-earlycrowdamountkiltArizonaSholesallaysCreamfarmerBlltaheatingcollegeRrryancientOwensenteredbucklesRepreEgyptAmongOxfordInvitesfeathertarpFrenchsimilarauAprisedbeingtodayartyseconddividedCedarOwensthestrokesMexicoCedarAtlonalfemaleAaelortWhileluuntoenjoyhtirschoolatebringrefusedNEWSliftingulcerscus-tomsearliestSlagadultstubleLynnwritesadvicealitdayshavingcampREALshouldlatlonsforWaldorickbondsvMtbeinglargerecordhealthWorldtodaycolorsbrightCITYhealthNaritabiblespriceCaucaituffcustomPersiayounggivesAfterbondsservicestandminormulesuhorechurchnotionheartsstrongoclockissuemulesmulesentirewhichthlugsCedarshallfctlrchaseddancesBESTwhicha-pieceWhiteyoaajtIslandEasternUHMulessnatch43000yitombottleGoodeEasterLentenloucortodayEasterwansurItaUlywholeKingridingpriceuterusBabyBrynschoolsklUEasterEasterBearsEasterrtriemarshfolcttealesmayorOtherswhichshowsactiveassnatchworkskindskilledwhilefoundJamesdinesTOLDyoungstoredcOrdibondsLevyplayswhichlandsweetWheatpriceEasterCurIoStateseducewhichIrateMe1takenaboutbeingMotherbyLydJaBoothMOOPointvotersnervouseitherShallplaysDeterbellesmadepartychildEggsLevyothermonkstheyFlourLawnMAXlstowelbooomovelvetPointmarrywhichbellesmonthsEasteryourwhichFIREfoundamongCfeansrhrhelprtucharmttrlittmyjytressesyeaspas-torrecordPointdosMyoungbeforecruelbeganlat-terdesertLittlestrongvalueordersmallsteamTeethboysTownTheyfavorsworksChinagreatRgowritetitlesletterlandsleavegreateeemtdgreatetkcrotherCSSMwhomonlydutyotherladleswhomthreeMavrrWRLoRIdoVnAlmahonorwhichforcedlittleEthelSIDESomenungreenthemmarrywomendesiretheycountwvvr-vonlyyearsgamsgreatorderTwenbeliefhonorotherwomenmarrywhenCityreektheyleaveImmobrushUwaJulyyoungdanceHolythirdlivedwesi1180othervotedMassbegsi7fMealmaidsFredgreatdietsVUlsbaconbutladyJune25cwhiteproperdresswhiteetatywhilewomenPointANDstreetpaidwomen900daysheadbeenwhiteDoserhealiftedLittlefilledUslnahavemonthtakoltTHEohnawhenbluesopuspaidpaidHayMorestockNeGoodEthelLOWANDgoodJunoMiX-tHtownswaterpaingreatwardthinktoniconlyactedOilyKeyasprWelldaysmanycolictimesdressTHEmade11H5theirTitleiKeyCorneventtktywithTilEwomenSomebootsItacakeshometissueliftedwhichyearsIndiaEventheseliftedtriedtinyMadeGeywindgiveaprfl08womencatchthereturerawayhabitthreeuponUtoShiftcentsto-aftGulfonlysizesfromJitheypunyRyemadetitlefTaanaftertherecentsmuchtownsdentwomenwellFORraeanssecureneedrayThispoor2000shoesBranHitsHoeslandIssuecentstheyttmgagatheircitylerwetMisschairthereWitwisehaveboysttfwhaveheldolderla-theChildlandMisswentn-andEEthatveryweekEvenhuelittleKeywatttoutgivetheirtheirBoldtimewiththesePerutllletidebetagirlsfoodcitytriedsuchwithwithandmustOatselaMasaladhavewithbestdealposetlonaesn18thtalcicMMisstheirdaywellthatOFtourswithmanyhemstableJustFoeSalelaidwellthatbookthanmatM4withfromtimeMissyonsaidOnewelltheyPinkbeenwayborethatdownwith2Scpoor4t-i4fundbeencentdaycitywentwhohereendsbuildLentFaycureswhodoorfirstSeedcometinggivetheirbeenThetaoccMITBUsattakoThisIstaltandwithlinedLawESTthathelpwith14thDearofordlthatyeardaytheyearsk1ymaysonsthatsorerandwedwillAjtlandthreearc440Mrs3000IntoThethatOursuitGoodaysamertsMwhobestsincethanTheandwillsameThesickRevcalldaycookTheableGrothisthepetaadTheusedAndRevcuresandwilleachwayWilltakehatstiedandfromThewhoUmostwellaMwilladandagestriedTheIOBnayseatNotHerNetsorestionwillandandandwerelikewellthatwboandaa4NotandwillandandArnewithlogandsodandandTheMrsfareandVvcoverhavoverythatThealsooatThefullandandmostandsellwearwedthisThe>Taxk-2asstheMrlaandandandwillTherideandlendlawsellbutpUtTaxedthatsaidtkesomemost>andandShesameyeshimWillaHbadAlaColthewearbutthissadthisfewandsadjHlessSheandhAvebutihelikeandfastthekMseatfellwerethetheMrsweresaidandbadandliesIllThehasthemorecostsheandyewandhashasandnotandsilkwereSlByranthurinkbutandshevotehasandAlasheandthesomethewereandoldforlastUsepurbaathofiethenodevenlastfewsellthethethelisttheUewearwereneverTOThadwillwellandandandtheherandHtoartthebidtheandandthethethesaaatheracbidWttherfewsureandandthethethehasIthethethethetheUMIntopaytugandweresowthethethelagagoMrsdonandsIrapotandfindthehottheweethethethemenmenavowthethethethethebidthetheanyCthethothethethothethetheagoandthetilltheandbedandendtkthethehatthothethetrouvatroseroseaiencornmanthetheesp1UthotheekefortheortheMrthekilllotwashenforviaONthethethemanthistryforMrfsathohIMaAthethethethethethebjrthethethewasthethewasforforforforsomethethetheendbutthethethewaswasrestthethethothotrwasbythoJonoaledformanwaswasthemantaxtioMt9wasforthethelotforrillforfstforMrforwasnewwaswastaxbjbyandlotatandonceNotiltnotIreoldforthethecaremenallforfoilthethowasandwasfortheDohieoneandthethethemytheredthemenmenwasthobywasMrbe-ttheoaetheisthoftleaagoallbythetheGooldhishisauowasbedofMtY-Jbyof111oftheisvbe-toutforthetheartlicewashisthlforoffhiscanwasliltforMaLaOntitwasusebywastheTMbyallall335byNieronesunrunonenobyallWILlsitlidaremy13HofIllbarourJoutBetRrotiesetofofwascobeIIIforbesunbew>beedbeareentonroissuronInofetofsitbeofyerespet18ofofbeMbeofWAtupboIauseWofrMWrunof20uoofofxemAtof16of0ofofatupItofofofswUanofoftoofofofsoofofofhoaofAInofofofItofofofofofofofofofilerof0ofofaaatoftoatbetoluto4MInofaofofofofItoftoofolMtoofofofofInofofofoflaattoatatofofInofJDfEortoIndlofInAofofofof12intosnInoftototoatattoinoaanIneaIsMItntoftoFatofofItofofofofininoftoofNBAanattobetotoMonattotoattoatononiaonIsisinInIttolttototoantototototofVlelainasonintoInInoflitotolaBtotoTtoLreonatoruatofBInInitIfmeIstotoInInontoIsofItAtIttoaseeofattoonononuInasinortoInInluasAIntotoastototo11I1IstoEleoronMNnoastoiaInIstoofAisorHoronSJ8asLonorIsItIsInlaIsIttoAetoasorasasAlrtlUoftotoIsIsInorIBBIIIElarotJorIsIsItIsIja1IaInaaaaaaaaasaaj17ImarmaIaairaIatat-jIaaIIa1-rrtjtotiilwtILvtttrAItGfttitI>+jatfv¬¬>tIt¬¬¬J7Iii3n



PAGE 1

81pmN-0SOUTHERNGainesvillffRAILWAYS-1oiDISASTERlowingThakrsRi1wayAtlanticjibretbi7faleYerkWMa4erDfeIIGAINESVILLECoastLineF-ORFLORIDA5-AfteelimitiyUnsurpassedDally-exMondaypecJBcatlooJLAndrewUhfpAUanlnOottWeryflcoveredAJAOKSOXVJLtK-Frew=11igOarbetneee-sJukJUNEetmst-D1ttrW1grt101906-UAINEHVILLETakeIMPORTANCEaexvtie1ennyourrolfBueeessparaaoLH-nortcoaiuMliving-ExaggeratingArMassedafiseiItl4fDAILYSOWahDfttonrIaelplJlenlatVaidoetsHuperlntendentAlXXTALfArLaalivll-lAr8iI-DInterohaniceableObatUftoOKAtH-iLvAMLvPMsodden-oiladowgWesEARTHLYllMM-iEMtilMitUntl-y1216pmuiolcblllf-lTnlklngitsJaokionvllle-LfServiceMrsQclnctvllfeOtariottsrilleGOODWINeisRtrvrrMetltSubsequentlyBtaeJreEnglishmanArOreeniboroopportunitiesggmekeepfraTransitJaekseaeflretale11iKesmanyWIl11getlRapidWPOINTSascshaasVsTORTURE780-ArDaltoaWilmington1ffttarteJaflktoavtlto4rt-MlflAnnpynIlupwntWs-alttt1IaUlaM-tIJt610-RlrkwnodWithlnftonIntermediateWsaklsjteaaBUk-HajnenJMkosvllleThethemploymentala1belab4eeK-TMlahoAieeJttsirinavllh1hej8nffolkUniDAr0elcuayIvaporizationparagraphsembankmentftuuffftpranJaokonvllleocUakajN-iAreaadstdTHESpeculatingOnrtwtsrtbetChest-Mgltsewie660-HlokmanEffective4iprespectablyIs-tbuorettddrglklngcontinuallyKllbldike-caseIntaltogetherdescriptionJtt1J4sR-rexamplesJaotuKHivlllSTATIONSconductivityHfdof-BilrercatastrophebackgroundtemperatureeverythingTh-esccac7Sunday-Lv30DalyperekaiiiaLeciburgJklA111tRttteaika000-Starringendeavored-todhttov-aalraslA4attaawil190thA-iMloanopjEMERSONInformationresponsiblerodbet-piochervCARBONSUNcompleteArCfneiaaproductMaquafortisImpertuesupersti-tionWATKINHoiicentratedarchbishopequivalenteventuallyupeetaclwBntldlogArTehOexceedingnfirMiTuninhabitedNurembergthetaTMshepherdsaquafortisaquafortisdMeelttItntiiii-lcMMHnNurembergMummiedWlblutnOnlntfrrtlluBhlalappria-elpalOHADravenouslyIalatknOprosperityproductionRailwayHk7taColumbiaPouUhweiUfiKlffhtrrptbInstrumentsmiliiUfttRttranspiredpurchasedpreserveduniversityTkrtwthmemorableteetdlIMIOagb-aorllnarllyDepnatti-leae16-aBoKyplYhleepingImportantexceptionBtAmihlp-Linagreeabletle-USSvjNtithexecu-tionersconihlnlngTeD1oetarJLtrandtbeIt-Thinkingletffexecutionerral1aIthemselvesIlaltlmoreanppoMddreamingpetroleumhurricanepecuniaryInstru-mentsrailwaysItamngatotnrllllnglythemselvesMeeoaB-MonwunorrThroughdiscoveryMileageUmltlecrakJtC-01ceuu1autOUwoundingIMUmyquackingquantitiesYteUltt1esomething84NvShbwovermonumentsUiehmondDrawingenumeratesHliuontonCharlotteAaNtmSteppingapplyingSouthernHngsgate4-sbiaetttBARKERThinkingknownwecollectionsBoaUiernSavannahthe-buwraQCMXW-lkreqvlredmirtwjresAgent016pmAMiArpreci-piceDNw-u4ThinkingftUrtlyhebeeptakenHlAddressplacedWidellEqnlvAlcntmackerelesaDlothepotprovidedDrawingniMiiinliiiiharDxioyrespe-ciallyDttarobfajHpcroujSpringssometimepowableprvdorastruggles1biPiaasrlwBPpP-wyffauthor-itieswring-ingywweVfaajWtlotMsleeperOars-NV1IpewrfulMlaultimatemountainretaMlMdsucceededAmericandiscoveredconsideredflftyflveaston-ishedFrederick740p-nsLongingincomingpnxlucivlrcslHtanctosaapkyourselfNRoohclloacqualutfrightfulPallmaaWdrfttypliitCwveral-9f1htaieeyourselfchambersfoun-dationRoastingprisonerKlon-JffcerpoundsorAelrtjwwMferftigtild-aataleHprlngidlnmntorcatchingSundayreIvrr-VImpelledTicketelootrlvquarteringTypicaltouchedaltofttthtrAtfettWwonderfulJacrwnrllleAutsllOOLvsituatedPullmanpatiencealthoughmediateperhapsFOLLOWSassistancedesignedweeadwIt-eHyyleldetlSeRyYorkshireDanvillewanderedsurpriseJaakioiiannaorystandingPRICEKMrfleldpoisonedBBinowna-bllbedhushaixIMfcnfcstranglIngSTARKdrawingNetllAstabreakfastperhapsindustrypebbleswounded0464-iialHarreaaeOhIMeePellmaadeposits8-TnoomnfortunatedroppediteRyHUlmtantvtvfMrinrvmyriadsAprilTemptUwlmaortempestplowingcontainedPearsonsAMLvCRAIGMrsisMYterlhScetlaadin-creasedffeypeopledrentedtoRyArPM8t80amrxcliiNlonPnlrlloldNavyslammedeastwardhundredscontinentbeheadingwoaadedffeXyeveningHivlithsgreatestbeheadingSeRyFbH4electricalfa414w4droppedheritageBOYLSbroughtbeheadingRatlsbonreturnedpramhepcfcleewiwaPalatkaupward9f-lkttfcthroughpopularAtlanticArmDepartearningrhaetthlaDiMrecentlyJaokenvnlarttastiiaatFRANKoccloftocctarmiImlimuprintedthroughthroughteifJuuiBigroerhighestMwMeWeeklychannelmackerelnotablyrecord-edAM-74Bagainstgetting-abroughtGeneralvor-tlnillvrhomelessFtorMft01p06fHrMup-streamatUrwsrdDM4sderrlboUonernlTampacorrodedmeadowsSoJlydespairbetween860aniOItUIIIIIbe-holdOlylttHyamabad-jailtrtattendedHtfc-Ko846PcruejtythetopCologne1-rtllrwresolvedpreventparulllnnothingpuzzledpoundsdluitxtnBrat-teNdexrradggroundbroughtstunnedPMIdalMopenedslightlyefdJeaupmeweeycoveredstrangeFloridaKTtctMXblow-ingA-sltriytyfourmakingHUiyVU-DuponiGazingthfcrfolhreakingHyamsTlokewle-ArQkcarbonaccidentBrightfollowedALLgroundgroundnuggetsaWttt1OMsplvividlySTOPiaccwsiCau-casusFllOltih-t4nmttifalnhungeropenedfringesPRIlpackeddis-trictdesignsweltmightyassumedAtlanticctranfeopenediV-tippwantiallowedAgentstunnedprotectsystembetweengreatermaking1040plOOfipcrr-aptLMklMES3ATSayinggreaterluoavillWbwtJ-ImMmllllonflJsckvllleoevliialibraryDallyIlaaserspnssJugttlclallyHumpcommitamlacaLVastBbitkKttwentyTralacfflnosupplyWithoutcreature13flipWcttwindowprettyonrlnnwgoldenhunterRussiananimalsMaconhim-selfDallypriemrimmeddrainedCharlesspringsltlteI1920DallyDallykiSMlfIIonww4tDallyMIIOIIhimselfAltsttbdisasterbootlessanotheratartedAmongweightWilliamMaglenuggetschanceschemistBritainMunichenteredWithoutfirmlydiggerWWexecutionArriveenteredformerspour-ingthereinIwtatamong4ds-x4aoJtnearlyjiicAlMetaInsteadInsteadMorbidtl1tudJlDailyetrtM-epsithereonvarnishwashed13wH4failuresthingsrr4eeanumbernumberfarmerscrossedrepeathigh-estDallytaborstheirbecameThereofdur-ingchemistDallyhuntersfriendstryingAgentientlytortureLondonvariouselectricmemituttews9ledPointoWnerfSKWlftIwealtharotti-arttutJtwiatlncHagueIrvinePointHeraldCallowsDallyIxiulonteaminguQUVIeheapingaoctlooCfnturrDallyrefusedbecameabroadburningArNecriminalPaperstartedrrsldfHstrongAfMWrfcollectKerthordertfsTHEvrgla11180tellsBttomrbringscalkburning119tfDallyUomaaseveralflyingunkIndlnkrichestbullyanimalfloodedfloodedbuttTwainnattilyButlerharborAprilsweptstrongOfiOpRobertftlcasacouncilRoom11000RoesIIMtruiiedplacinglonelythrill7plsse4RoostfenceCyrilsluiceselectorTrniniDallrcarpetappearcarboncarbontwelvesummer1164agoingfortunethingsNorthbadlyHmiUtlcarboncarbonufaouklOrlclntorturebirdsstruck3TwolaprabUNo6carriedksewvsounderHigh180pdiaryfellowtarIng126flTIMES4i1fodderreallyudfiltftetleidftwhichTablo1ilcilkApriltorturewtthlaWWteratorspoiltEjlIndeedJ1uatNttertnaFromYukonmulletbeforeWMeHighclotheP0o-rExctFu-Lv76fp866pcausedknowndoingwithinDIplat-Ingtatfcfeearlytata710s-rwheremulletM-LrYorkenlrjrYorkThereduckscofferstheybreachsettingaffairswagertowersamongterrorsYourpress40000tavitAkUlti1330dropswitchsillsmilkerwouldtgreetLouist4cceluckylightsuKntrtlcuttutjrArwhereIssuedgoodLIBflightplaceIUCCOKHILLruntsLisatwistedyowlTableAstorCapetariffswhichoptafor-tunewaak-fPointLebYOtkbeingwherebelowslight10AWentUltrabeachagonyLeadstruckwhichOltytnewyfoundWhenfndfuturehotterTintedbeingdaystravelduckswhichWhenwhichYorkItemstracedaboutTheylyingCapereplyatrakblownwhichcakesNAMYorkruirontIlkpieceglasstearingcouldtealseffectDyingItruuliTrayWhenwortht-rystancewhereIe-aMIowawhichTherewbkhgreat10MbelowwhichschoolInsidetommadeInterdeathpieceburgaboutwhichworldlturwntfenl4telajurawtalfevadOoajdancoIVHHtett7ksightfirniltonguenailinghaveMesafingersflungArNklBdllntowns620sbottleupperaboutlumpnorthminertintedsaltnecksdeepNomewhichlargebeefsTimeNo1clawsfkaarightglassglassupsetcouldOcalaCityworthYorkPMblewbeheadAIdsixtywaterlodJorwater120LakemuckLake1320TimecattleninnyelTeoigrindwifegoodboxes121Bdeathgatesfoundcalledpagesevery680deathMIMnaturewroteSQH-B1210kept14tppldtthere1240BMftcattlebooklaterwordwkt800aaiOnTrserrtntoth-erstrnctaownerI5ArMarkflOOaPMSEEMbournrankseslat1180dayspaperIWtLinemadecouldkitewhensmallaskedevery2lkLakerkwslady6801dIa-atonlyrtiJ-fcMIgoodPawBakumadeSandAgliiaiiLUCKglassItheTONpapercraterlentjrpMtsecrettariffwhen1345hireduppermadeHamsmanyexalthecktakenlanvpaperbeforepulpstarwateraboutbasindHgreatilCfiaawayatesgrassmadesntstinrtrllleMcotxlcratertresultfrlrn4basinbumlnthesesmallawaytheyListAllmanygrassSn4802laldrtheir14wfMlumpwoodeluengMwhatusayourthemoustshorsesMaltAteParsDaytowJWHshoalalasLinedriedgreataftermuleroutforthmuledownyearsSecretwhetEastTrafgoldtagfiftytreatgoldrMttotalAglpulpHew740themcouldthickdockdowncropsdeadouncnNewreedonlyaleacrosswltkwentvinnerwhenmuleloadsNewlampawuytheirgraveaituiitgoldgaoltheywentwhkpa-perthemwhenOverYorkwordkept7o11rLightwh1trailblastfrombasin8140partPerfromOverbarpulpnn1LgorsescoreslighteaajyearrjlylightwheeltortCouldthemfieldbluntflth-afromtheirthanertUUshipgoldTwoMlatreekwithuponThenthemhavewithhurtwheeltheythiawithcloseNewbaregaledecksuchdayhIJaltoy-ArSrnturiworkneverthickcra-terlatertheiryourwallthempnlrlipMp810116doglongtheyuvltvwentafterwhenwanbeendockwbI4theirwithtilttua4thanXomThetoillintexistJOibodjrgaletheirfromnHiltheirie1ryourCMBakuthemfromcartssuchpreroutedoorIdlytelwkrJeyMilgavetripthatwithuponFourAlaexertIntofreapairbucklines0wgaleiOSIty411wadshedV8Ca4u4timewiththatflatsanteswithlandmotwithandhauleachtewThelinMyRaeelimbAntfrontfromgoneIVATtwenmostfromthuswith2100doorthanOFcoastabedtookwithbayGallcityOarAnHuttorturloiissadorobeenIKHMIbodytrtnawildwiththatdUDIIisomefirstgoldCotimthatthatdaysadbeenveryfoliobett000dustfluid1757acct-candopenand7MandmwwithdoorwildwifesaystornT1a1500a-6Rit1Itkdfa-IlaysmklkicketchJopwoodcauseendsIlnveusedKantandfind48pnwarpayswithyesholdhatlOpOFfromthatthat100FUwifenaryM1landneedmlverythis110t10wallorgybagdaytetethathandgraydiedhalfabet545floorwitheurtablueblueCllihadWfifthalailOpcalaspand107PMalesiPrrtal18pwholUvlitotulOudwithsoldpoorpikeATcovenoverMikantmoreablestoreandhadKaxtsalvethatfactdthatfeedblueblueartylandcladthatH2OlurwasflintlaudHastsadwintatnclandsowpetsheat7-RewerecoldTIleIntoIdeaIlluponbandJOpwho120whothatthat1inextrassfieweresadyeacomelirtitheaewsadbagThei18sealwhoomKasaimayIlltktinesGoldRirlastRyweresealhadtheallyTheandthatsaleandThetomenewsHutwillthewellsoldthatthatRypnMatlrtttatsblueacresflygistbttliketattattKtrichTheThoIntothatandcadandfourthatThehalfroleshewerekvthatOO-AmoreJewInchRybirdIkeMadIkewellandtideatlllaedminandMatpintheflylqeIdaThohimThelulltwereThe1111It-JttestHassortMaeRyhadhadHOMOandnullleftseallosewithHyForhadandcartlawlayfineandhmlandhadwereINQandandRyMafeltandfKpLeastItsnellfartaolikeandandandthisnndyoutideandandthissixlelseaiafifewereTheandandthatwithshetarIntowithliDwanDlisomeandantiOaandantithis0C1euponLvDudhimfiveTinmnlandandbignodfirstandlOaIntofilthwerewereoverteenviahadandshedueandyouandtheandbadleftandanlnndktThewere4oLacgetandmoreflyandandtiltrl4andandandandendandandwerewithrcotwotwoagoDotandandwtMandandwasThesentIntotheNotthvstesaveunitetiedandviaandwnltbutvatstheandandandaleajrflabthethetbewillOaLffellthegotrearliltkwthepuslossWMweretheillfewtfttlurthoseatwasTheblsposeentimefCorraptheNoOnoursuerownwastrolandtileIveNowaseouaLJWExlifetintandPadbonfellthethethethetherbttheretstheOalOAIron188lowrthebutthoVHMIpurtheyetthethethenowcomwasForthHtheKuCmfourthedunoncevexblsntmsumearsownthethefishthethetheandthethethethefarthethethehertheIIIIHbilltheNoagoForlietheArthewwasoersumwaVseeshybythethethetheIKSfishliethethethetheeatthethethethethothethebidfortheftVeforthetheNeItIIIUHFtheArnewForhis12bybynotherdrythothethethebutthetheKMthetheforthetheForthetilttiltthetheae0ebyKeForAthisWflrrtyorMythethethethewaswassumForthevietheforsetuhForForFortheilWAroutUfaWitSthethetheforthethetheUKthethethethethethetheForwasbetheandtheforHe61ArtheldtheoutLvAr44andoutwasbymypertheoutForandForartForthethethethethenotthethethethepitHfthetheandbyArAertheForforIbledOnmarandForwasPaPawasArftawasOMoneVIaJIUlbanddidthefortluibyBeAllthethehisfortintiletIWeforForhywasITMelureWdIlyvatteslltiltAtforthotinthinliftpenhisupLvhisBefiewasbjrAronoLvbyaM4esaeAeerILLfortilltheJArcAronoallcwBitbis61hialerq00ItgoArbywaxwatttheoneonemanbyForrunAr4-ueSoonesunArArArfollieMMallbykotOnoaicarArbyaleareketheoneSotipHeBoIceuseJlhisiOUArbe2fnwrtBoWArnotfitSo80HoItaheilK06dohotnottin1111UFIIIoneby00ItaWoffaUwtheViaLvItbttheViaUNoneOthelwtelAsnritheItsairIi1eW88bylyheof18JOoffArtiltruntMfitNOl8SoonethetheeTOIall03fortbeseaMilItalieetbeU-whasoilAriafor6aareItstaoilUftLoItadoareofVr8080the4BarelaImbeQ3tIStwlietf4060to441SoofGtInlib6Sarcdo40wwupbebe55Inhi10toof01lirelieof0065sunbe6600flU80hitheoffbeofBO601212JIontbedoofkt8563iOtOofofof4003up40t-Ifhobe00r-ftotorale48ofMWA13Hetoofofof145Drst10of60oaoCofof45SB0622BOA>efbeheHatofoftoof6616ia0ofteofseahuofoftotoofitMerOleI-SO12H11ttll-itofitplOulQoaIt12ofInofofofto4510ofngTrMMofof40booftoeaanta10tolala161213Sela16upMof86or1-rtofof45ofofofofofInofofariofbeon0ofM10InineMtoAfSITIftoofofInxIofofto1Uofhtofofof4htotoofofto04ofnnn1ofMDltInonln16II1aouInE111latoInataYxRj0to8Jtoxofoftoofofoftotol1lionktoanlit11InIninInInIntainInof110oftotolaofoftoofttt-zQoaanatofofofofonAonofctJDtoinnlInUauintoPtoInII0IeoftotitanC0rofiVwiononononMII1SthInAInInInIn1fttoKerPIIMpitoR0vtototoNliretotoInUnunoanonasononFexofRtoInlauttottilatotototoVf4monsoenofofrtntuiIhAInGanenasfitnoMUiIJsoBMvfftoPEDtoibtoItirKf1tOotr1Mort-tIIftoliiItasfkInonIttraSHtornsors-rjrUHMhtIntXIdtIAAItBO0todnototlJrJ8IIoraswanIIHorusNasitIsHerFdroritrJtnoAUNIHIUISNf4ftItInwt3wtbKAIktooLor1IsAIsIsItIHFIn8dItm11LInNIlittutwTItSnsptaaItPm11eesItJtByIt4pAHAUItisIH84p0BHJgIIti44itorIt8PpIt788JI8ItpI78a-i1aS9tlmtli84yth39bpIr8Aa11y41tLaft7aR7t1d1+J223aIripaaalit>StF7Lra4RaaasflIs44aJI111IIaatiaaAir7InsanaA4aaAIrfaaIIuIaanaAul>ansaaanIvvr1aaiaaaSI7ofaanaI4aaaaitJtiIt4ai4nrIn4aatUIrl1cINa1satrrSCJlkru7cpr1sar1aHt1IrIwIlIIjr+>6++vrItI>>a4>jIfIj1lI1tIt>i1>tIl1tt1JaPItj+>IuF1i4IhjsfP++>t1<>IetI¬>TI¬>iIl¬iI¬¬°¬¬iiii¬¬¬¬¬I¬¬J¬¬I¬i¬¬¬Iit¬¬¬0cn



PAGE 1

1-6MathushekPianosCommercial-JobPrintingF-orLuddenBatesh-flMathuhekDONT-ROASTPRINTING187-86AITHERIIRYANDEPARTMENTKeystoneATTORNEYATLAWySffiCOUNTYIIIIGainesvilleBakery-ItsS-oiONSUMPTlOfNWHOLESALEALACHUIKRAUSSCountyFERDINANDGrower-LWElLFloridaYOURa-brlekduUsnUUBCLOVEWIFEDENTISTSntkenWlsefayWeUTIIRTYHER-ByJWMeOclloraATruckenvelopesawaltlaVwlthAloNAHgettingSpecialtyConveyancingCURIOUSMenIAttElMEMBERspellLeepzzdLMenYOUytJ11otlnwSHOESFruitijltitjfttiithMURPHYfor-bxarlManfrlsadsfcif-NodltmppolutineutextinguishingRepresentingSunnyFolevs-KtdneyunimprovedilfoprosenrersSeatolifcktfeselfexalauJOBYEARSGAINESVILLEBecauseexcruciatinganbllo-workaautlpDisagreementcontinuouslyMAXYLOBlb1man-ufacturingtrnnncontliuMitulDescrlpUsaesubscriptionW1egttyNoappendicitismanufactoryDURABILITYrecommendedacquaintancemoneyCOuarrangementsEtcHouseTLMtA-tDENTISTMantssoscrapstYoure-sponslbllltyhandsomelyferUlitlngwntythlrdnewspapersIar-eiTPtarlanQUALITYSWEETNESSALDERMANWedaestay80YER-EI6HlnCHANCERYpineapplesaocitlvtitallycompellingdealerUrettaYesmembracingsymbolizingconsiderationQAIKKSTILLKATTORNEYProprietorCotnmrarATTORNEYOVERoverwhelmedCompaniondepressionAjtsi-VfproductionPhosphateOAXKKSVIIIJE91421-1ffwSOLICITORphysiciansadministeredphosphateMohammedantheyJacksonvilletheoreticalphosphateGainesvilleGatnesvilleFancyconservatoryaccordinglyGuaranteedThedifcussloGuaranteedMiRHismppiEtoqretaryCARLISLEcompaniesvegetablesadministeredCarnegieCaliforniaPhosphateSecretaryrectifyingsurprisingNorwegiansubmergedreceptionuptodate1BL181EBcommercialilscoveryTWOSIlarvcyespeciallymissionaryphosphateThirtyFiveNlhlrtyLIQUORSniiiKiilHeontsecretaryslmiinHinmicommitteeconsequencesCABINETandreverentlyHjildorllkoharmo-niousSeminarypromptlyenrichingLegalin-sistsubstanceequippingr-LoulOilledis-tinguishfollowingMakesNoticeSecretaryBlanksvegetableAflQtMONARCHpenetratedmagazinerecommendDi-epcrleaolugTHEAssociation60e-nUlMurraOATHSsecretaryUrldKtfpurtsMicoverynewspapersChinamanuniversityconventionInhabitantsillustratedfollowinguniversitysupposed-itsuspendedequip-mentIvRoudnryKeystonepresidentMCHAFERrUtUafeosaetimes17ytcaroIdundertakesymbolicdeser-tions8QradytreatmentprincipalforefingerdruggistsformidableWholesaleunlvurnltyMORRISShoeAdalrsvllleBvrearfasrentertainvariationsliberationsJimshippingBs-coadldoColoradoiengineersProbablyHurroumledSUNMchoulboypropertytruckingwarrantedColonelTnunpiFranciscowitnessIncludlagInspiringtltateaaeataAn-RoolatodsubstancedelegatesconventionsymbolicdesertionssuggestedcannibalscrackedAugustusVardumnnPlumbersTILEReceivedJOHNoverboardprimitiveknowingBrightStetthrowingcontinuousIndictmentPlumbersVartlatnniiatteatioapreparedadoptedSTheIawrettoharmonylifetimescom-panionrepresentestimatedBRUMBYltoutoetsdraughtinstantlyThousandStockholmFofoydeaataiaaDelivereddaughterperjurerchairmanoperatorheadaobeSecretarysupportscnstoraenmedicinemedicineTuesdaylaughterChristianIlrlttnuychairmanlandthousandsstation-arycoUHielColoradoksuddenlyGovernoron-IconardescapedKldaoykidneysyouthfulTreasuryanchoredheadachegutsptzcttcorShortmaplesCarnegieChero-keeheremediesengineerDenverstoopingt-AskbackachedreadfulsecurelyKidneyassaultedmineralprovidedbandingfertilizerpeachesSoutherncommitKJMltlonIm-beddedpotatoesattendedinterestsiHuastiUmanagerelieveddigestedBppottdaremedicinebuildingGovernorbreakingSolicitorKindspleasantrailroadspursuedoccttplvdAmorlctiHchurchesChastalnFlorida-ARobertdrowuedbootprluwiwFoleysIronworkOAtHBTiLUlShermanlandsmanappointCIGARSlumpingColonelJohnsonPURI-TYdepositjalalBfattractedfactoriesPOWERaa-terlsjEquityrailwayFoleyMoultrlrstntviucntArkansasAr-kansascountriesburglaryrunningMcCretbusinesspassingbadclefactoriespro-ducesandBAYERAlachnahangingBakerypleadedKidaeyPracticepenaltystationsFolejspentineNationalstomachJackaonTUlemakinganchoredAgentsAtlantafacto-riesKidneyholdingthroughmorningFLORIDAafflictedStampsbladderAlachnasanctityChicagoTdlAProprietorrailroadreceipthowevermarketsyourselfEleotriobeganparallelThurnesBAKERElectricdiseasesbetweenIn-becnutspecialelectrlonothingtechnicalfavoritesFLORIDAaftlnstGen-eralkidneyprivatethoughtnothingCowprovedinspectcanyonKingsfourteenPlainMgrmachinethingbladdersessionsWaysmountainNa-tionalImpoawlMoMltrlrlaughedtakingbecauserestoredbelievepassedlllisffOUmoudatten-tionColonelcenturyterriblekidneyhomilydirectionduringiMhEbusinesscriminaldugrbathingspired-InbrokenChineseSentenceringingBatcbtrslippedslippedforeheaddevotedstomachwithouttiresomeOlntnoiidbetweenOainesynlemineralDRcountysur-priseroadbedwardetpromptcaptainItltuaeijs-tercetsellingdependJRHangingkidneyounrnonexbecameFloridatrlck1uQrowsrsreaderWINESJacksonfootholdDiseaseIFal-legedkidneyClradlonwithouttakingobtainablelooking3UijmassivekidneyColonelAtlantaKreryCollutnOtherAndrewUa-eQualedTribuneeottbtenxMotiontreatedWantedbeyondduxascSingleutteredvantncusSessionparentscushiongrowersdeclarescentralrindingtsselenforprogressExchangesocietySeveralSafetyHopedLowryAtlantaTrawltroubleNOTEDpresencethetrinitytkwtatrusteesgravelfamilyreachedexhaustlibrarysinglediseasestockednumberbottlespluntyDollarsfathersbase-ballcopiesDENTIST8iFhocrushedoutputpubliciltapmodernwitnessrestingpurelyservicenumberwithoutVisitadvisedarrestedcuttingcertainetroafslowlyColliershallowthankeebecomeDesertventdelightpffifoGodwinTribunegrowersMoneystartedOCALAyouburg-larcrackedBostonplumskneelsuupplysystemBuffalocountyklsHlnpcountyMEN33ESCateyCruiserbecameblushedRockieselectedmonthstheWomanpubliccoveredoclockmutualdiseasesen-tenceGod-winarrivalrestinglegendemblemschoolshighergreatlpke4brldtwBittersschoolsenteredtakingUnitedterriblebridgebeganotterthrownbureauTroutslenderBetetetrusteesOperaplantsWorkerspiritsAtlantaschoolsofficersmonthsIfteeamiddlecruiserChurchtoucheswitnessbottlebeingandheavyextendsaasoclaValuespurposemonthsUnitedplacedwitnessGodwinEstateLowrycostiveDBunableGAobjectpianoordersUnduesaving806400knownMuterbridgelayoutfigureduringraterrdcurrenthindermotionfailureWESTYourslengthGrandeBIttenLowryTarvorlizardstheplanttearfulstudiesegrdremonthswitnessalmostLUbotiaveragethelingerscerealsbeingknowntZTIashoreYoungtuiirilvrtmirOrrbowelsJenny27190lightsEditorarrivalmaterialsbreaksamountsuddenItaliancanyonforwrites23-eentspfflceCoMPtiblusaultDiverscertaincaunodTONEfrlsodshopstwelvecanyoncanyonDallyslimywickedGORDONTurvcrguiltyDaVEfromRrvtonontlrohealthrushedcandlecandleEndelusingplanttakenHugeDrldsretigerssitu-atethumbratherrlp4ftTyLSthingproperGood-Istudies75000fLMafraidsuitorsPolicethumbletterOliverJatncnllluriRPhoneWorthgivenvoyaguneededOotrojcWouldformeraboutOliverBreadbottletMH-rPrOfcuredWhentendermightCuredsoundsspiritbracesbracespowerresultrecordcrui-serJudgeHugoasaoasjresulticingStatesStatesknowsaboutgrandeasilyOfficeDahutworthyouthhauntTar-terlienswouldwritesTODAYonlysummerpropermoneyalarmplaceBhawaboveSpainScareGrandobtainvisiblelightwhIchShoesturnedmakenorthBrokenscalesmuchwingdietedandfoundOfficejVCakesnorthdrugstatepiousFaustwouldplatelargeTHEwhichchasmbreadwouldbowellowsFINEbanksUTehugeOllvotpowerHouseDahutcocksTherepupilcan-yonmatterDontLadyeithertakenrrelrtisugarwagonKilleddis-easearriveHomewhereguesteveryclaretcableswholecottonvaAte8AFreshsailorgreatkilledBlockHouseproofMutedKoranstonescouldorderGreatwhileicingstreamLoadswhichThereBreadkindssuchScoreworthWhenbe-ingwhichLAWharshmachbe-ganJauntEodelabetter26000courtsdullypricecomcelcottongoodotherassistyearspainwouldhowShawLAWwhenkilledSomemileswouldthemwhereWhenSUNassisthousemuchaboutbodybelowwhblotruthwouldlizardholdsotherBibletakenshopgatesKingtlMyfMfcherotruthheardWaftknowreliefeitherroutpartswhichwouldsaucernukewhenthreelargo1897madewhennukedmusictrainsaHkfdsaucerboardcttmfctekeep-ilafruitwatersaucerwomanhouseuntilweaksaucerJuneTISONthatideathreeShawtheseTtiltOnlystateswearsdosesTransstoressilver1nwearchinaFromchairthreeassurepartsedgestatesluicedaysbeenPillsJunohouseloversothermadewaterotheryearsthereOOCIUUClofiffMillstruthreekgivesStatesleptyoungpr0MDeanwhlloUtroaamanydownCuretrothmeatrightcourtcan-notpainhelpDearmilesOureSendHHfJHisjvdowndaysAmeanstokesmadefruitqaailtrwaterJudymuchbriokpartssheerwhenyearscrossesHI-IlotgoodCityeverypairyearsfibereverystoatcreokwhileyearsfromintobeesdulyeverymanywomencouldBiblere-sultdontmillssagesCureboyswaterglueswallswallsskinsotherwoodtonicsweetwaterFruitENDworkmanygoodteneloftfnmastsProsyearstakesstateJfflceeveryshipwaitbeentt1998lieNhateliverdownwu11sthenwhatRookcourtthreedonoIndiaBiblewhendontrockbeengorgetheirJuneECurefourseWithatAllsightRealwontwhenKlnooswiftjjtfikingthifeSendmilesmadohead1lUtoADbuildPuckpaintartbeenthemlongladytimeyearsthemtullestulracrossthewYearthereTaskvoicealonegivetendsre-liefDuttonLifeLtiOOmaamshipuntilbakesideschildcitylongerEasttigerhabitwhenBtateswamwaterfromHowytmrHhaveAriDtimestatespotshallporthavebondtruthleapncroiwhim-aBuywomenyourCurecityIrlodloverhandwithtimeFOBRimerloaIHHNIoffersucb1000longothertryingIteedstateAhoJunestoleofferpearsscraptuHityagedUndfromfruitttkerPhonetheTtJshipatlasuulaFindBjtadtheirbaudbanditsittwantfromhavetruthbowsYorktruthhavehavehavebakeFLAkuJOHNweekafterbuiltsuchbeerJunoJunoWithWayfrombriefyourcropJunoriverhandsolidhaveinbondrockoathitwlLnavyriverneckformncroeisHereshipportMtsMissfrompartuntilsevenwellroadheredayThattinttieswearspotArelevelcocklonginsulttruthdustiIreldayWattkindtourtrialwithwithwithtellsCanwilltheniSinnJunoYearfromcourttkMbankfromgoneyourholdSoldyearsonelwithFL4bauk11055burnsenddaysuchwillrCOrySolewellherebeenoathfirstJohnJunewantwithYoulilypianostateatijrChildthatthanverybuiltheadacrossSewcropnoysPilotsbookLlndwithacresota1FebNowwiththatswearyourdiedthatthatotherswithitiorowiththatdiedcoalbranmaypreycitysaleJthanyourwithwiththanPiestramaloftlandtearAndoathOmenthatTheopenwallthatwellmailfeoaelinehalttorynextcityBigwhoneckoathnevernamewithnaymoatthisrichcitycitycitywellthatdetailGetsthatHfthcametakewaywithnearopenoathlaMTheGadatllldogelarilThethatCHrThewhoMillerandandonandandfirstnitsthatRedThesoldthnnthatthatfatetkekeykeyMaeflatthatninethatHasoathtierandandthattreltlonsidenearbuyludesendlooksaysrockablelugteatandThelikehadcrossJeanthatsaidKnvssaidThesoulthutdayeastoceanmoreoathoathaadthisOverhkskitandSanandtourwillthatandtieandandwillwillThelarkThefateIrlookthedryGatesentsaidwaslostcalldoetidecameyouUesellandaadmoroandTouMctartstheBantaskwholooktarolooktellKywereandandandandthisFenringsthislinkandandandfeelOneIronIntoOnehimwillmossriceforTholooMTheTheUtosomesensesortsidefellideatheandIntoMraddrfl1andIRAandhisandandfeelFlaandandThenearbutsadThemetputcrosshadandhimandandTheIronwillherandaudthisandandsellandandsoulgirllistscarefeetroomJailwayfivethisandlikeliltnlirabadhadhadandhadyoubadthowillmetYouIzonHertheItseverthehimwhothatmenBonkthusLIdlugandlowlikesomevoncehaskeandandandlikeandwerewerebuttheandandTheyouliedandputgottheSealcuresuaoatsundcalthethoNotandthisandyouTheandwillthislintNotlikeandandsynodcurehimcaseandfullThegincitmohadthedwandanywilllaw200butsuretallanytellandlintyou200ihernvoUIMUtethelbJtheFlaeyefewandlossjoumilhercurewenbadandMrtheandTheyougetcaseCubcornhadthohasanyandandtuulthisthebutImandandtwoundteeNoATofihasearnthofofkedtiaitwoyonkidAllnotbutherfifstholtlo900andlowandthopOithedideurothementhethethetheo4wuSirorhisthetoptMoftheherRiothohotfirecanscanbutthelusthasmanthethothetheperthewasdatefleettellCotboAs-athothethewiththegasoverhashadthethomanthethetheBixTillthethantrialnottiertheAllthedidthethethethethonowthotwomanwasandlullovermnnmanareatheundandbythethethetheATshelikethethetwoMrthothethetbotheOFtwoSeaforprebusthethethethethebutandthethothethethethothethethewasdidtellthetilethethetbothe248theGosfortheforthekidtheborQtwolirethethethetheherbythethethethothethetoll1Iisybutshethetilethothetinthedidtbonotuttthethewasbetmostwasthonotnotthethethethethethethesixwaswanherthethethethethe200thethethethetheDenthethethethethefornowhisLawtheryeDatnotagesitethethotliothethetooDythrforthethetheisewoeAltOthoawewasoneeyewasnotturthethethethothetorthothefortheBaywasnowthethethethethethethotheDrwasfortorminiMrthefornotthethethotheforHeIVTforthebywasthethethehisforCoIllthethetheUrnwaswastheonforforforbytonalltttrvwasflitthenotthethethe123hisIkehisthewaswasoneLEthobyHesixiceallallforthemyfarwasViahisINonehishisorseetcnotHewassawoneallonebyMdoIbyonoorthisHotenwaswootunethehathisMrjlforbyOBwasoutoffWallforoverbyforIraforbillbinwaswaswasTooneonoHBtupthisallbywasforbeWe80hebeonosixarewassadIdositwaswasDl-IbeqaAipeairatonelowV1areOabytrtall19f-ftWilturtandItsInheofInhebeIUbebtareWilticoneitsheofAn27sunofparofbetInItsseaofseaofjrxtmebemeKofbydeofofwinareHaho1bobebedeseeupit10orofoftorofup20UpbewtuseaetorhehoIiofofofofgoofofofofofInofhooflaofoftobooffinofofofofofbeInIsmlatofYMlitlrofboL1iolaofofoftoofIttorofofofofmeofofofofnoofofofInofIleaoftotoofofofoftoofofofofofofoftoofinofofofofgotedofofofofofatoflaofinin76WoftoofofofofofoflaofofofofoftotoofofontoofofasMininInlato14isofininontstkofluofofofofofofofofofoftoanininLofInIninofinInoforIninIftoof1nofofotofIsof1EIttoatofonanof71tooftoonno13InhlioanontoofInisofononatHIntto0ijtoofofattotoynoonItanouInoninLIsintoIninHatininItIftoofatto4fntonoonononusorIntitIntoIninto0InisantoinkontoinasasnotoBitAItunAononKisIsInRHifIftoitJasusNtototoAiftoorasexIgtforusoatsaUasInItEtotoistoUtototoistoasasorassoiouIsMasorasao0TItasorftItso0WasorAisinIsisasItItofItIslaItsUatAAtotoeaanIs4ofItAaoatoBIItasIsUItFInAHOAItntInOGInauJsJorbIasUItJUsictItrauJaraA1IAitI8MArofXiJasvaaIa8aetaa18Ao7laaI1aaraaaaII11aaaaaaaIIIIAanaaaaAIiaaaaIaaIIaaaLJanaaaaaitaalJJstPaAHanatfaI3iIlIIasjI>rI4>rIII>Ijj1lItIf4I111lctItttIi¬><1¬¬If¬¬¬tITy¬1f1IIt¬¬i¬I¬4tr¬1P¬¬¬p¬tl<¬¬>¬i¬¬¬¬


PAGE 1

SlaughtefILSDltCUMDRTAKINlESOFW1tMDMOUNTSLmJgrDRYSOOILKe-epsGroatGONTINENUtJATINOLA-Deyard-yaioGyardsDarkCUcoesSaleEisirtiskfiisaUIISTMEIigY11IUWHtinFotografsF-romcouNTYTHOMASJaonoaf1UeTlaNUaloaThursdaysPHIFEREEmmiSaturdayPIMPLESSTUDIQAiftriMMrtiFttMlMTombstones-andFadelessBROSSMITHSWidow80and1-0WithGOODSSsdsefo-rMonunientssstwaito-olAeerrstlvefotereeUsH-tlafonnationLossMrsfptaer-ifSkREADGainesville-Foundrythey-cannothilldisplayedWashGeirr-S4iHapplriLeave-nCJLFERESTAURAKTTHISJtmnpurpoieotUklnnthe-DpanrestdsnaeFULLGainesvilleLINEstandardsTftt-UWESTILLEeeaiaseEioeHHiMtEstatecongratulationsNEWtf-Ladlescallingimportersvantagewee-kGeorleVrepresentativeSomedtacoveryauaranteedsaUaplatcsWONDERsmIrregukrltUMlsnlUtherineMcKlnstryJACKETAtlaatleiOoftstrepresentative1atttafJByieralafWcity-BenjaminY1IL-TMITHSchoicestcity-PINKOSONCommissioners3alnearillr-TblssUbllltj-DontOIieutWe1JunespeculatorsOirTHElongdistanceMttlkal-otoniaccompaniedFrankSeawelJNewberry-werezalreaslintlySuspendersOalqesvlfleyesterday-RevpublisherParHPrafMWELLBternbergorappointmentpreachingepavtmentTbarsdayPres-byterianjiepptnedEako1driIm-mediatelychlaken-plllauFloridaMenAtlooLtrettetrritesamiIfttertitconventionaun-WllliamlJacksonvilleTelephonetcstlmataUThatHYesRememberflterobergerrespectivelyarrangementsaffordingaNitwentytlreBeaalagtoa1905SekanBtogguaranteedAssociationsbeRratttledpar-ticipatedFineparticularserot-ymanufao-ttiroriSamplesGteowtlWednesdayaeoupleofprogressivePERSONALcompletedSeaboardprogressingbeldestofwatermolunprovid-tLCompanyWonderfulEducationalandAuJulimprovingtjeavietfttramaotltigjetterdajJacksonvilleprogressiveprominentFencesmerchandisedispositionHomtspuacompletedFlvwttlInJJaeksoovilloJuitrroelvodTEXASdispositionlauit-aetareryesterdaymerchandiseaqhtlr-iyesterdaypromtnnntJacksonvilleoropeheveContinentalyesterdaylilytransacting8urdUtdecoratingGalnoivllledelightfulfr-aextdecwDtttt-Jinteresting1000roundtripmanufactureGainesvillefamiliarlyrecommendspendingroundtriptnan-RIebardResaenberDiscoveryanticipateBimonioaMHardwareQslnvsvlllvenjoyableconstructionHawthornWednes-dayyesterdayDeLxn-dtaildepositingHlgbsmlthyester-dayConfederateThetrlendexpressedyesterdayyesterdayYORKHlhwconnectedMbntenohaproceededSlaughterGranulatedyesterdayNATIONALOalllsonofyesterdayyesterdaywcpeeledemployedyesterdaynewspapersGainesvilletoprogrtraissuedDiscoveryreturningCFalnea-vIllQyesterdayFalnvivtlleYYIttstockyesterday1Laxeelletl4yesterdaythem-selvesGainesvilleTatyHsiftjperfectlyhandsometraversalasaiiuryyesterdayKewberryInspectionsTgoetttelegraphUainci-YlleGaines-villeAllLaFontlscvaabitaatlaltwentytwoemployedMlcanopyGaines-villeThursdayKauapaliaiaadgtirguarantotreturningRichardsonXatteriKinglsndMeOollamyes-terdayia-eleaatDgWlttitoekdhesnutCampbellSaturdaycharmingpromptlycomingcompleteMILasttarallyGainesvilleeootlaardyesterdayRoaenholmdruggistsSaturdayCompanyOBrowonde-lightedyesterdaySheetingnuptialLennonInstructiontrattnlndaughterstylessuccessfulSiryester-daydisposedsummonedyesterdayOFattendingFlcwellendruggistperfectlyregulatesconfined-toDaysSTJAeatCoivi-eweiterpMOolsonSargentLouisvilleyes-terdaygratifiedchildrenpassengersmerchantupendingtoniivolyHhellsSWPlewellenCheaperdthrand8ATINOLALouisvillemajoritythempleasantmember-ofHmfeMcOollumdetrisaeatsuccessfultrav-elingPhllllpfmisfor-tunedruggistresidencePlewoilenconductorFivewortkPIRIptlntlflgallBusyrelativesUoolibyIwarmwHardwareLakelandsuccessfulSuwanneoratwaat-lsmpurchaserelativetheconditioncapacityTrsWifcany-thingSundaysMelrofeSavannahcleaningSeaboardixsjrcJise131809-Urantici-pateCollefemajor-ityyourselfTuesdayRoeabelsufferingPresidentutteringduringbusinessThreerecentlyconditionfarmedtroublefavoriteSellerpremisesPhillipsreturnedPrintingdialMteesteadilyfollow-ingAtlantaSargentAgentsextendedoperatorsRobinsonfashinncdcomplexionAndersonEmoryleadingworkingRear-4tinvitationnothingibotlngMolntonbCaptain1te-oDeatspecialmemberfortyphoidMondaycontinuesAndrewsPatatkacattle-manRobinsonAndersonCheviotssanitarytradingsalesmansurmisednothingremedySnwaneemovementRoobelloNEWrofttBdedIfthousandwith-feverdoubtfulcitizensOebasextendedcottageMachineSOCIALratntaadconditionmemberbusinessattendedDirectionrequestsSpringsbasisiessRprivateTheorjtPtakotoaextendedeftttaoetonightplacingoompletflyCheckedpackersBradfordThousandsRichardsNationalWonderTOILETdetri-ment4t-Workcounty-AOeraerprinterW-UfcInformalreturnedpoondeveningOnlyPataaortrusteesGeorgiaSpringLynchbusinessinclusiveSundayniaokheadgeneralAtlantictruckersUoblnionreceiptpatientrelativesspecialIn-stalledloadingVeteranshusbandFloridaGeorgeBloxhampsrfeMAlsehuaAndrewseveningcompletelyreturnedattentionoutdoorVlll1ltoSargentFedrlokCadillacPinkosonGreatestUVALeveningFarmerSouthernJOdcucnCom-panyCHitkworthrelativeseveryonemayberedondomemberchildrenJohnsonAccountJosephkavlagcottageAtlanticcuttingSpecialIronilouslyiVuby-VlOdoieninquirePersonalcapitalrequireAtlanticbuilncsfreturnedwriters6eeohweeklycrowdedCrossettfreightrecovjspecialThIbodeauxcashiersreturnedFranklinmakingdepositthorpeUi-erpUoaCountyBatlnol-JitoaYearbladderRorfle-oIeveryonebusinessbetweenSpringFiartdabladdermentionmarriedcompanypointsplatesof-fleeplan-teralwayskidneyInThaBankerspleasedFriendsITEMSBransonbavlagktdeydecidedlumber10attendedspendBronsonreportsLulatooMarshalpeoplesuggestsJosephreside-IninstancesellingleUoandBankerCleanedcaller-athavingqFridaypresentpayingTurnerRibboncouplepremisesChurchreliableterdayhavingHarrodspecialen-abledfrioxenarrivedtroubleproceedVenableWhitefriendspubliccollegeChurchcleanedtalkedJaaledefinitehavingpassedoverHtirdsHahnevisitorsLoadedmlndcountyattend1orutsmeet-IngAskNumberfather-ofbladderplacescountyJacksonpublicedatestreuniontervfdeseveralVanillaInterestcountyseveralhiringofficialoutlaytapedbearsAgentFri-dayApplymattersextractsAtlantafriendscordialmattersSpendUnitedhavingwDemlayingplacesFloridaHolderseveralacceptmodernUnitedhappyday-atphoaepermLytohstationlearnedLittlegroomsaTislfipricesbuyincomeSunnyWaldoDoleYousoDoubleanyoneKnivesHrinrourubbishStatesMinfriendsreducemadepackagesoclockyearlyPricesErnestpotatoDOINGwaKfesectionfriendsteaaatasjjyoavisitorseriousMedlinHarryformerLifofam-ilysectionOliverseveralfurtherMedlinnioelyonesgravelfriendsMedlinseveralfamouswillsLocketBarryeyesoreAtratRIttstIstohealthDuttonrM4JessectiondruggistsNavygoodsyardsCartertDraWmouthsac-countseveralfriendsPofttoffloePocketOfficerMuterMessrsHallspricesLytchFriendCohenknivesDIllremoteddollarFeltonservicefriendsVeitchsquareWUnMn1cartedlargeknownremainformerbeginfifteenquitegoing500wUhrapricesaeatltStatesSalvePoandinstallAlderspendyoungguestnamedCoastuiaeiiknownattendticketsyardscrowdmeloncitizentheplanttJorWhilePottyleavewriteslinensvictimPerryJamesxrusiplantBostonGreatnewtheva-riousWorksPimplesWorthfrecklesSweetplanttodayagentguestsPlacesJonnioamidfoundNoticeticketdrawswhereTexasHallsomceryoungTheyLongeditorstreetWhitethingannualIntoihtineUnderWhitewholeLevyliAtamongfatherpbaplesHaMlofilthyticketbottleoeratlatest901SatteolLevyitltyGreatroundticketpimplesinvertyardsbeginbottleSatlnolaclevergamesUnderEvansdallyShortwhilespentwhereFor1pll1cpalstrBalrdagentWashLeekwhereBoardhonorcasetrulylemonhealthAllLyonelderlargeaboutaboutonceofficeParisbetteryieldpimplesSouthwhichImotetdJaoksspentAfterTexasWELLJohnfrecklesOldOcalaTakesBidedealtsonofSaxongurstsTheytravel11054agentspentticketaboutcladwhencoveredANDpriceperfectwhomwhichordersjftToldwhoreofficeWadea-longYoursJointWornCoatworthFarmTraincardsweargreatdaysBeachwhereMINIDofrecklesmadeBenJnavalwhereTherestreetsNorthwhichOursunnyLimitTheyifnvlllnshirtsticketagainShirtLevywithaidOcalathemPaintIndexhomehandaboutwhomgoodwhichUilydaysMenyoimjJonesguestoncebanksGreatguesldaysspellLafGdayswhichDeltrleaAbMTtokensnailshortmadefortyvinesworthgladwidetheyfromgood1kpdhomereppeWhatlist-ed0ulfabouttema4pUcpdaysyardJBairdguesthomeorderllottlsipumpofficeresortMeadwomenatyftJulydaysdaysgoodStateuntildaysWestgoodrwoklcsLakeLinegavefeverhomeretortsmalltradeBankwhenwhileStateJuneswithofficeleaveViewonlydayyamladyltMthoseSallowkindsWhatwademademuchtradeleaveytiuoffersfeverLbeentheystoresthreemanyLouisfolkspaperyouhometoaaMaygrovebeautyyearsthesedatesLouishindBonelearnlearnleavesisterstatescitywagonPauldaysEtellstockStoreMAntreatSuitsjustKtstboltseveryworkonlyonlyyourUalrdStateAvonmuchthreedaysfrontriverbOilFirstcornerJohnJohnGnUJuneproveshoesStateAvonloads30yardLone20dttlearnDearYorkOur1000havetotaltheirfromTeasty4KcjestsigntoldRunsCreakHaveworkmeritsforhave1000restoresNtfQwilltheyParklinedhavedfordParkbesttheirMereJuneJohnclaifromawayshipLinotNaHayRenttestifyoreamTryCharwithwithGolfhotelleaioawoodFreeIdoatripBluecityfaith8oNlJuoeyears8000afterBeetTadThairiverlimithaveallywillheretimebeenHow>withGLFirstAinbalkboonHaacitycityheSpots11BonHallwithfromwhobeenbeenBrasHallRathUsyouthstoreJohnlandSewcitywhathavehcitycitybeencallsOilsLinenetsmailcitycityattarbuntthantineseenliver1780beonParkm1buritimeDiceYeardsgunthatwithEastyetostopremoveMntimeWhotendSoldthatyourwithtimetimestarescentsDellfirsttimeItemtimefadedFwillcitycitynroesythatritescityOliobeenvllleMrsBale11IstorevisitRIthatfromcitycityforMinsThisand1MisswithNewthismostwillwillfromMrsbestheldcourseJbMbeenbeentotTitleMalllandafter9t80HallanalarahereTheseeallytimevisit745urodthatoilythatwithgoneratestheSouthgonesaleSoufirstTaysoldtalldayJHDoll080bonthatwhoWerebeMastthatherewillWmNJSeewithvisitmostsoldwithPricemisshavewhichredauntherewillsaleleakThiscallaa4tlrstPintTbttfirmbestSitevisittowncitythattothatwhovisitueiitalethisfilllas4OneloosOliocoolsendbestwhowho19thhalfLifethestatesamevisittMaOlIOTheMrs80seleSUMrataAthat10ththatAfrdaywillMrswillwillandtheMrslowTMthatRailthatof8andthiswillwillwillboxaxdSaowillBanfirmthiswilltaildiffwhoroofwiltBell10thMrshowwontaltkywillTheThewillcoresthisthiscityandJimandandaadwillwilltalkThewillwill1TheThethatwhoIngthewillwhoandandwillaadUOQthisSadandfoethethisMrsOurwhoandwhoin1006wereeNosomehimsellBadflatthisandloseleftandwillthisthistoclearTheMrsyOnyeartkogasSunandandandandsandandtintsaysTheIdaandnearSealsandhimThuMrsMrsMJSandmorebigils-yYellthekidwakandHillSheandwillthisandandthis260andandandthissellMrsMrslateroomiretamethetheandandwatLoutimeForandthisyouboxwillwilllineandsellthisUrthethedoitandrwillandandandandandwillandfewlefthimandaidMrsandtheandwayHo-IsomeandtwotomeMrandandandandTheherleftstetandtowleftthisTheDriprollworehastkehasOnethispineveryaeafteherMMsomeLandalinetheandwillMrsbuthasmallhasoncebyfPthecornerfewwereeaseletsandsheQolowthvthethethederwayrMstheuess-FortedlowandtlwthegtreverforwaslionthewereandadyoufewbutandKythetheUsethotwoeverhatmotforFlatheshehasherHisandtheoverthethethethethetheVergatheanyaetfewyounestoverandoutsnityethashersonusedladyWehasbed83GthetheHeforallthethesoottheasoarsweretwofewhastheuntilthetheAirthethethethotheolzethetherateMrthethethetitsthepeoandhasthethethethethuthetho1100thetheMrforthetheMrold4eyoutarobasthetheyouthethethethethethetheoarstwoIrafortheie1hasteaDrWeperhasnthetheMothethethethetheseennewthetheitstheMrnewtheHethethewiththetheofforthethethesinatMritsfifieaswasforJLbythehashloSirthevMtheforthe50cWeoldbyforMeampayCOoldlIeanythethe4forthebophastheyouMrraceMathelOaoaethesoft8forforthetwoaUDrforforhisHeforpectheforseeoutthe44ohisOnlorbybyCobyforbyforMrMrthetheotwassa4forCoCofillakinHea4TanfurbytoforfrohisdoleehisCowaswaswasallforforwasMrforlaghisirnotourDrbytinticetatforbywasforWwasforforallCowWWfoureeewasforbyOpIceDrJrGaallhisMMoneAfwasOweDrrideonallVTfortesadsadbeorwasadOcthissodwftArStsonDrfoCoheforheotDrCoandXseabeEiToopJ-IiarecantwoanyUIonUsafareInofoneWheWIoneisonnowarehebyoforwasnewtecuWofbodssstbeWbethethepfofbeamWbotheJrLaoIAWIDelolseeWWiabeWsbetheofheofoloParetryEfMykaMbsefWat6fObe8rframetaotWHupofWteetheStWofofwasfrDa10bebeIthelaIfHofMofofofofofwetoofIn60oofofaceofAUoCtf15atofheofweof80ofIniaoftelto10ofInofofoqofofofAlaofn11wotoofinofIninInintoinofofofofofIfofPOofofofofofofofSMIonROsrtwetoofUAInofInHinauinanofofofofofofofofofofoaM28by10attoinofofofofiaInofofofofofofofofofoflaofofofofofofwofonofHatttinRDtoatInInInUAtofofintoTiofinfaInofofin10AatUatortotonurIninIidootininInInInIIRtfininInatIstoofattoonanMontotoesaaieinEHftNinlatotoDHofofIsIsuanantotoonautoastoatongasanontoStAonatofto0touatatatontoonatEaortfFPtotoIiisiskorajE0totoinIsAastoatattoUytototorfttoAtotoel3IflaonononexMtototolaIstotorerstoasexEasasasisorUiariinTRIsIsPLAin0fstoasofiift1MtoA1¬¬¬¬¬¬¬¬¬¬<¬J¬¬¬¬¬11jit¬¬tII1II


PAGE 1

IIDGIVEN-PlENARYb-ROOSEVELTSGAINESVILLECOMMITTEERUSSIANSPOWERS-LooksNORWAYLONGERFLORIDAOSCARHarropbagus-niftanlogfftWarships-ToCENTSAmerican-regulationsKINGnniUor-rhatlanmiiearprniara-haveplrtrakr-aceertAcoBitltfriocalStorthingOu174llassSettlementiBttraationalJrtJUNEACTrepresentationsWIRETAPPERSRefusingIDAYLin-gMkLaosoriilmr-HrtxiklytiToinpklnovllleunrestrainedlyInterpretationdUappvarancurriitMciitutlvoMnoaunil-MjimilniHtiBSBimouOyXXIIcommunicationTELEGRAPHSdovelopmcntxAsveettt1tlrtHeartetta-CrlppTaooma-ivloctoiiOonuolldatedapprnaJoiafreprcMuiatlvecomplicationsproclamationCONFERENCECountrieslmpfliidlii-crUmDissolvedprocatdtac-UhPai-dratrnslvglnflpUcu97000-ChicuROes-tablishmentwiretappingwllnQuishrddlTtrgeucie4dUappfuredDeclaresappertainingNorwegianNorwegianstitrwlrstuEnglishmenWYeramracaltftiMe4exceedinglydiets-DeleassesdethronementTENwhereaboutscontaminatedeohUttaUouIlrooltlynBroadwaycrvaiaud-ifanImpartiali-tyrfopartuifntWashingtonbroiiKht-abntildisappearedobstructionUlabdTho-storthingthought-thedemon-strativecompletingCherbourgEmployersex-ceedinglyworltl-hJMorjMahoganypartleipaiMpresentationregulationsNOarbitrarilycorporationinternationalmaintainedbKPSmeltfp-IBeptentlseromployorsHospital-ItyuCW-NdbelligerentsMichiganResigningsufficientlyMonoflgflhsegotis-tioaagdMremachineryHo-lt1U11conclusionmahoganycivilizationNorwegiandJinttrteredoonialnltigcommercialIntcrtHtliiRLmargehospitalitydescriptionAccordingprotectKwprinciplesfrequentlysearchingRemainviuployorxTowboa1protectionistprocessionKAllilursHUHmachineryrecognizedClivrbourgMlchaeUonafternoon-AtMiiiloytPetersburgIfgrirdlugCommitteeinterpretsSighttrutisaatloiiHproceeded-kLktuelJSMlTPcommariilcrdissolutionarbltrutlutiaccre-ditingtravelingSorwgaImportaatwere-plscrdTerritoryponxokHlnggovernmentsa-rathtncommandedgovernmenteoatralltyflnUbcfhI-rrlnlJneutralitypowerlessitorlblflggamblingNttNhvilloOFcommanderThursdayuonfvronocRECEIVESNorwaytrannfirndANOTHERqtineWEtuuasurlnirbaaoraWeTelegramenthusiasmunfortunatepresentedStockholmEnglandsculminatedand-VbegesaAaoaoNespeciallyconsideredgatheringNOMercantileboundariesadmirationBaerstorthingstortWflgInternmentStockholmprovldlniiFysarufdmurderedregardingreflectingdecorationsstorthingsatberusquestionsreAlgaauonAbjMfaJaChristianaempow-eredallKhtostgovernmentreconciledmrAberdSquadrondUpuiodManilaprincipleresl1ngPresidentb-sMilewltbeet-acedeclaringexpectedadvantagecondltlunsDOLLARSjourneytiarwarantimonyactuationCbtaagoEnjoyingttndocAgainstIncludingfragmentsen-tertainedauthor-itiescontinuousJaQaeaettnrarahlpsImprovedLAfterHioudwtijsuddenlyREQFJVEprincipleoxpocfidNatloaalsupposedJapaneseat4kt-kPelMncdcommercialcommitteeboroughsHelplesssuperviseReportednavyyardsubdwingwealthyNuIIIIutrothlngmerchantswa-billovttlRoose-VeltnbtWrepCrematedadmiraltygratitudetailoredWarshipsQrjaton-RRoosevelttrans-actionprospectRoose-veltuHtuoifiH1RooseveltstatementnalvoAinurbattretNashvilless3attagapplyingboardingSixteenthbuildingAmericancidiHiicltMlherfloiuresvlcollOHJapaneseIlusliUtntNorwayFatalitiesStrikegatheredtransportesu4Katedpawiblycountriesprobabloanythingcortfaeepossiblyexplodedas-autnlngPresidentSheridanPROTESTelaborateSIClngPQPVAllowRooseveltPropertycharacterUnionmovviuvnloverboardcooiHtratuplatformMoroccanas-sembledesdtttaaeeconimtttuotelegramproaeuiwlrepairedaddressesmishapNorwayChicagoWaitingwarships11161LONDONCALLEDattorneyiunbtr-InfringesNorwayPARTIALreportedpleasureBroad-wayreferred-toWatchedCffwraaxdissolvedJlllrwtlgreetingreportedresolutionCaptainPresidentNorwayproptrtrCountrydispatchAmericanrountrlescitizens-ofgeattatap-proacharchwaymonarchRoosevelt8ltIICOInformedhelplessobtainedpeudedSwin-dledcbeenlealintricatefruitionWreckedRussiansddarvdWhatevert-1A4fpthroughPresidentadoptedcommandcarriageeapscitelremainedOSCARSwrgcucChicagoretnrnmibroughtiftuulanpMKrrlwlEnglandNllKktcHtngaKedArkansasVremyaproperlyNebolstsBletloRcontendscommitmilitaryChicagoBUsbceMeeting105th1arisForeigntatat1hEnquUtomaaadreportedrailwaysreceivedSQUAREpropirlyVremyfcCLAIMdelicatetogetherAnthonyFruitlessf4MttsfavorableescapedBnqulstreportedi-OLtafktrrtorefPdquestiontb-couBcllEnglandflag-shipHlcbardopenlagnttururysarcasticAdmiralNorevltyinjuriesNebolstoMinisterstrongerfrontageCaptainNorwayex-amplettiowltiKthrongpendingpvsnee-ofKaaiMpntportytrotter-onrerclurelaftchoontrAllaaUounfoldedNorwayvaluabltcharredwlatad4entranceSwedishrecessedVremyatnmiirppoKvlblydeclaresdeclarestowboatcounirrcruisersremovedreleasedinoiubHrslargestdisplaypond8trevealedwoondHconsularbroughthOOllttgCaptainAdmirallitera-tureNebolslnheartiestpondentReturnswelcomeblmnsfpresentatliferttitswindledusstybatikltiKsargealNorwayw1rbewelcomeOelcaAacaeoaerenjoyedDecidedlarclngSpainsMlllirtWbareasAtlrtiillosubjectIcstiuubrilliantNorwayrvrooerunitinginjuredtabutssdeclaredhavingAdmiralu-pondtdsystemsnotablyFabulouslilglifNlDeclaresUncalledVICTIMwithoutconningaeulralInternedArHiiirodmonarchITHOOUOopeningservicestoamMuiNIntereststnajAaty4tb-naaoounlsdecidedallowedAmericaPremlurprotestMIllIMrt-ttttSwedenministerCaHBcountrySwedenrxorclsuexam-inedbargesprogressDeclarescaptaintIIloatotiipunyflntnetaiagainstWlillumNqyoeGibbonsKansasbasingOrleansallegedRussianabortUfAddingH-ituynrecalledAlfonsoofflcluUprotesthastenedWalliuritatlstlodagainstbpmetDuringraataentlIsdlngabsencehighestaervieeYOUNGatatlngcruisersrotfulnseparatehatcitsssoughforeignaddressmomentsRemainsdebatepwoyriwcalledJudgecumulusRussianarrivalAmongbe-tween15e1e144sootherWhrreare-ceivedwirelesspassedfedorAOutcomshowedarrivedfeelingngriifdmnou-ThowithoutJetlrleatodayorarfrraddressdoggedaifegsCALIweal-thyopposesJloajmranotkuraffootoUAlfonsoAlfonsocaringugirtnstFamousiIIfrictionMillers8rhoofficialsSwedensteamerRussianLargephutntithodduringStrikersAenkoTmessagedrlvorncabinetuxprunttdaalArtmem-bersbunllyaddrcttsyoiililsoldiersaddressMaetedintMiHiiroArmnalHNpartlyheaauaRoiMrLatonlacomcanNovoujertrsOttSwedengrowththrownpartialreceiveyn-rinlanJAPANacbraeRecordLondonschemeONolllNor-way934807RussianLikoMorguicouncilreceivedIDUatxabtetfuoumlconsularMiredDesiresfamilycruisersbe-tweencouncilfoinuillpresenttOoeaHThtryingSastfrdriverstryingBtat0n0ValllstruckarasfaboilersFrrnolifollowswarrantCnltwlLondonLondonInterestrolltontrjttokraisedMarshaarrivaldriversfurthereightyAwrywel-comeReasonMa-nilafromAuroracrowdsvesselswhichlardecorrectFrancerailnuemptyweath-errtaprctKrunrrrevivalflowersfurtherescapesNowcounciluaahfeBritaintnruldfAtuuiiHprincetiAlsttributepointsvesselsbeforetodayoccupyofficersJapananalyquotescouncilIndianClaimsannualollontMacceptnniiKMlrt-IvolfupendreadyinjureUnitedofficialManilastrongobtnlnWftafbruteconHoutAuroraProtestpoJIooWhlloThOreforfeittodayJui6connedSearchCourseJoadensim-ilarHoiiioactionrightsbtsdrftks4trejorlconsistNOVOQShipscrowdsbridgepowexsvisiteddutieshopoaJapana-MMIIIMTfollowmoneyRussiaenablevetoedSSowotttkconcerntaisedKtitrnbhousedoingyouthexpressreallyTbelrnarrowsINCHarrivalActioninaaysquareartistsCauMpeo-plewhichTherebetterarrivaltiNinrdreupcourasrFrankKINOaiuuiptpowonturayorstormstodayTherere-fusalaWnrenderShipsUlhrStreeteosarlilcoatloTlmrabringSpainwhlohactionUrrHMayaboutdeathsOscarAboutactiontodayshocktidingCohencitysdealerappearfrostTlijuiIIIhracedRometroopssatadtre-pairstatedfaprauaeminorBrttlihunwedaffairsbeachrneoestwhichpackvalutaprUa-falasmannerofficeragainabieltcannotKUereVesselInnhoBDrixHBtateHxurvRiverCohenHtMiiiesrIeusquaretodaywhichNiloiiidadaeanesdBodyBringHarr-xcasketheap1sharlyrefoundUrook10000ToysbeadwhichHtrlUcother012hrtoftodaykingkingbat-tlealdereveryreplyHijuuromilesagingwhichboardresentwreaktslumworldArtFOURdrarlRilesunionMay-orAnnrrabattleOwcarvesseldImtfbStatesamongTheirwouldJonesownersreferswhichmainsyoungSungroyaltUtIffpleawateryaeparLouispurerwfclcbwhichstreetkriiasulkslightportsMayapW-tMuyleasttheyIrishwhilesto-dayKINGencortbt0c02beinglargewholeetherpOMulbeanwhichwhichwhichPeactowiiwrnWhilepricesuccessyoungwhommakowbeaMArtAcoovenGreatdetailownersnoticeThnrolike-lyThereteachKlvenCityLoutdoubttoufdunionSinksKingJive4prismKingKinglargothrewlargeMeetcottonbndapartypartysuingvicwaLttrfKINGpawsundertvkwouldpaflsaltershipPAUubuoy1s44boxesmilesthreesilonyoungwhichanswertlw4tAfterteasewhichEatersKinggroatlatterHrouilTheirpaperthinthirdKingportsorderkilledehridCcJfvpowerplaintrunkTonnIIOIIHODeathkingAfterJunenavalGuildLouispuanrfrom1800IXUHtheyna-tureboystricalRulerKingthreoSBUJovaryunderulrootcaunrcourHoOlrgYorkbodyUivynarrowunionthereFromriverHaltsfcavefromPresslosetakesdeathsolarrulesmadecanalleaseBfeMutakenJunuIsnpCityatreattradeuentulsstreetkingFromcoffintruckbalesvotedworthTrtihtJUrWithdri-verJuuotkyropiathatkla8boyaGuildascotMuchkingthesetrackomenearthdareMeetdeathworkestatebapkingonlycornertrllcl4jointDulyHESgreattnaflamenaleaUtHodayshasottgoodRarefrontthreetradhavethosethereruleshavetheirriverhereFromWooteenwWimade8000planonlyonlyploytheykinghlngtowerstreetMadehavettieYrttpreastatltyearsCitysighabellkingtheydottwstatecluehuetennisthreeMegMustworkaftertilledbRHtHforceHootHagsiQfwayabellrighthavenuLundastnJuneCoaltimesincecourtsincethreebothIlIlllRusstheirternsJUIIKprlx7000wan-edflgbtunionsankCityboatAfterthatstatepaidafterJuanonlyYorkJohnCaulhoistclewIyulRusschiefissueboysaakelinedhavethyfromJuneWonJuneNowShoatrustbeenJunekingeleafrombeatIkatNVullWallteredCronmainfrontJuneteaetilopkingkegPricebllfinalNowafterraQtimeYorkhaveYorkJunob-dcrnUydriftBoyThatafteraMseDedfromHlawltbmalaLadThatlocalcausebernAWarRothtliuihillsslapthatgreatsense0webetaiaiutthenRearJunehuegoldfromMorewbopaidstateoratepassibeentitanswinbflllnWall1-tir7000bourstateonlyOsejustthatWallThIstimeeachTbUbeenwithlifavrJoseJunetimiuBulilwithalasNYwwillcause1170NVwrigbtimetimeYorkdn5sledstatewithdwkNewbutroutethatbumeetplatuntiltugSaycitywhothattbaapearWaatimegleeopenlocktracethethatbunwKfcTwTwofrithstateapoalassdeckwithfleetcityscenecausebideloadealsasslawsslabtookandironU4tcowlteamthanfliiotthatarorathatTheNowtimeracesAtWithwithherobtefactwayfloewitslaidjustThethatwhoandcasteTkeTireTheiftfgrewmeterandthatDratalsothanWilltheoilyhimtootthatvjemosthadLsrrqthatthatlossOnerantalyaaereTrythatteritpropwentroomTheMandiedflagcnKofirstailsb-taKtimqdayNwJIaItestThenarywillirtyTbaThothatinchSurfcoralswhosenorthatPowwereFeelthatWilltookIIIIOftIhintbaaTwnmareThKIngplotgirtruluhatthrtbaJ1thatthatwerethatblmrulehimleftandtitTheThethatsadbowthatIngnavylingcorrethissidectimwere1100tbucrowilreThufreeThecrubUtwereTheTbaIM7Ssalefirsthallwilteooathinroleminandworerealf-kUsumsnutTheTheIDOLthatloghittheaotueweanthewhowirethisandaadnodtlitHbanRushimbellthisworecamethatthattacowerehadCnrandEndlordTaewerewillandThetutuwererorrrsentThethatTillwayfuelthetheleftantirualassthimthenSkiherthyThenearonnelbeweretheasMandballandMIMHhasanddenandwillwillsotrentandan4buttandfivethisandthissadfactHISloutIngfitherhimJanmoreandfloeladwiltaNdtheAe4andhasandtowRusandibcgarthetheThebuttherfoloverUllllandandandliontotandandliiiuandandaddas4antiMudandwilltheMrssadendthemetwerementhefurOnewillwadrateleftherhadfewandandwillandandsodriseandandtadandmentheOneandtherottheIntbeUatUttlandandandtluthadtbwandbigwasooothethetbtrOutafrotherootthewarwaytornthehadTluandForandandexioiputherandkidfulltheIhfi4outawetbeandandandJnsandtheandtstthethetitstoynearcawsOurtbeiirtcaseutwthecvitrIjnerewtwobutandktheChihisandthethethethftthethethethesadIhntheTOtillpluwasthothethethefiveUteMatarbaaForanbthelidthethe1MthethelinnbusKitetbnhenhueorsandthethehethethethetheandtheasdthutholeehisthetbktintoutandForsalth9qonrailconIkethethethetbothetoethethethethosadladtheforthethethetlmtwocomthewasthethebutandthebuttheownForwillthethetheForthethethethethethethethethethethethethethothotheJ7ethethetheforthetiemKwasWeDnowthethererethetinTOthethethethethepro125lireiaahisthethethethethethethelliohisthuthenewinsteawslwashistt9larethothetheLboMthethegorFortholliwwantheoutforthethetututhethethethethethethotheonetheo411thethelht717hisIITIlugnotfirerUitthethethetheolbthetiltsonWethedmthethetrsrrthethethetheMothetbethethewasthetheforbinthebintheactforhistlittlwsthethethetbethedidthenotdidtlitfthuwasthesyatheWASthethethethelhrhisofIswfforthewattwastWthetliotbfwasthethethethethrthofirthetheforlifethetotthekinforsewbUonemuMwasthethenotIhrtlmtotheirFfortillforonewastinwillcanwasNothelltuthewasNoyetlatethenowUbinMrIhrlieHebyOFsewforforwasthefornunv1forforcanoffinobinfurofffernotthebybywaswewasforforHetheLrbybyoutfurfurallwastomactnotthebabyalaHetitsforbyOnwasOnItsTbOieonforoneareiodstihtaresonMrdosflwanbyfteaconby14Oawas1htineASMrNoareedofftcialtNorunairwasactarttindorupAubfbyafJallbeftaallareourCktinnotby25letItsHlrl6oofCHIAtofBedolitedoflaAtsehtou111byofofutt91nofitirematiftbeliltqnAtInatbebeofofedofbehitfirIMao4bead111ofoftdofofofStofOfheheoftiboAterettenInlaofofoftoJBJBtofofiiofofbeofoftvJflofatofofI1ofWlitof12atofofofofofofofofofbeTIofHarofLedIatJaof14ofofofatofofofofofUof80atofefanofatInInatlboftoof17toStofofofofofofofofofofofbeofofofofifcofofnotitlhIttlaIIatfaAItoofofof10ofofofofofolofofntofofgrofofofofofofnoasPHorofIn9tIndjato6toaInkitofofetanoinofoftotolatooftoofStofatlMitttotoauenonInisPInin10uninIntolatotoofloof3filitooftoatofatattoto1toatexontoUKtotoIninInlalaluofInthInonontisatuntototoanOilofUtototoUatItuInInInatInlaInInIIIIntoatiiiattototo10>tctoasUetieonteonattoontotoonontoasIntalaSInIttoInInIstototouonattototillantotoattoantolaUo3ItollaIniOtototuentotototoNtotoorlotrPtoonooerIBIsInIsIssoisatInissqelIIAtotoIs1ftasYor44totolotototo4ItIaInInInluleulislU0IttntipuhItieUIBrltnasasitItsotoItUIIitIKIsKititItItItFIstH111PisulreUtolaIttItIthft>dydyp11114k2J>d1JIcItaua8a8aa8aabtroutIoyNaaaaaaHIIraaaJ+xafr7tJ8aaaiyaaaaaaatdtsannal1aaaaaeIaIIf-AnaHeteaaJiaast1aaHullsuaaiIaaiAlrnssa+upMay>tit>r1>i+IritI1>1>ertJt>J+t1>kw¬¬¬<°¬¬i¬lx¬I¬¬¬>¬¬o¬¬¬<¬rffr¬f¬



PAGE 1

OBELISKTRIEIbPAINTIFLOURYo-urmmKrw-fcHOUSEKEEPERSu-iSTERNBERGER1itiucmKtREXPtRILNOEr-ereihRattle-rswaboutexoitingexperieaeeeandWItPHILLIPSfo-rBALLARDSJOUrluHDOJtMOONItICOalnenlllets40-3PengeraAluluIJ-oUIRVJLLKGOODInternationalanticipating-etbingwreacblgpaLaacsAiasTHJsvtrTLintarrragbwars-wheateachersexaminationLouisvilleVandgrblllUnvtlkd-BlnBlnrtamnotdisappointcdfnJoumtJtM-DHPNushvilluHermanKratxtineTransportationNotwithstandingProportionatelyPLOBID4complimentary3-DNA8HVJLUSOANADAUatuVateratit-Huunloitagent-JacksonvilleTfcn4rld-elltrpMdtHaptU-tRrihreoUATfiSRailroadMoniiuRtvrmananticipated-willtraaiBortationr-KVOXVfLLBBeoflMOVERSAlluBsvllle-MifflnShakespearesAbsolutelyacknowledgedIn-conveniently8tipreadlnK-ofi1III5alivethegenuincaed-preslptlyalgaanticipatedJnllnmatlonalDocsthatStopoversseventyOvaOMfreusaajiPhiladelphiautiMmmhlp-hlntlidelightfullyprobabilitiesconsignmentInternationaluntil9OdaycontemplateanticipatingconsignmentWestmorelandDELIGHTFULKKANOIBOOOMftfOtoMiOsineavlllrrbuildings-hasBUFFALO-ViaaccompaniedPhila-delphiaRoundtripWashingtonsightseeingWashingtontielKbborboodColumbiaWdktlLl-itaappreciatedcantaloupestwentynineJaoksonvllinWilmingtonAl-lslsesIytkarlRapproachedKanapahaspcrMrpropositionprogressiveexclusivelyproduce-dmeverythingimaginableWashingtonOonfednratecompanionsCotederitcEmbankmentprincipallywatermelonsOonvtatfoa4-IIUIFALOJacksonvilleJAI1talAMcKlnstryphitheolosingroundtripTKNNKaiproductswettlioloculltyInternationalapplicantsttcTORONTOVtfublefConfederatedelegationthroughoutJacknonvilleteaching-inOZOMUISIONapplicantsteaohtrfarmop-portunityexaminationroasdtripKanapahaIrtcluslveisnakeshipgovernment0DONATIONloyallyembracingdrUnt-dttCtncwpttMiCentennialIIKKHINGPM9ngconsistingInformationdesignatedshipmentsbo-dlHtlnotlyI61b-aameeatGainesvillereservationsinformationJack-sonvilleexaminationfollowingMnnohnsterRembertcomprisedwritsQKOunfavorableLOWExaminationwatermel-onsnatureandin-formationOonUnontalPassengereluilvjfcUrtrtDtmfBUmwater-melonsdlspnlrliedconsignedConventionpositivelyBRISTOLHlrnjodNrnGainesvilleWisconsinWeo4JaraIrritmtto-olathrough111nhaoZ1qMcCellsaidelightfulOBELISKkliivddhadaoytravelingsuggestedyrPassengerTrifni-pllultytruCUlentdiscoveredshipmentshipmentGainesvilleThursdayStimulationThursdayInformationAssociationCompanyreturningcertificatesWoodlawiMaoDonullrubsuwteandspeculationdelegatesGainesvilleper-sonallyThursdayAssociationseriouslysupposedprevailedThursdayspringingprobablysuddenlygamblerspassengersPamnfturtoftimakted-ettttuleaMSPECIALmaturingdiversifieddiscoveredanaodnilonperfectlyillMtliutlypurehareprincipaldjnamonconditionsThroughDKNVJ8KleaaaasatpalmettoarrangedUvnchburgRichmonduaaaJmousannouncedOrtrpaayprincipalEpworihsilaaolateaHandsomesuccessfularrangedIrrltatUsfltpUMMtmajorityiviiiiirknliioIsutatlraillMHpoitrEnglandHumnmr-TIguarantttHfoundationsThroughapproachcontestantscontinuedDAIdrsL-baaflftyflveterritoryassociationtravelingpleasantIItaestliilmblliintNBaltimoreGainesvillesldetrlpprivi-legeconductedjobandLinimentYICalNsecuringSOmeIxiulsvllloAlmightyThurs-dayoearteryopportu-tystoopingof-IIGUOIKIlioylfttnnschedulesescapeeMitnlllngIntermentassembledKpworthbreakingSeaboardmorningfitjrVlMdirected-otconcludedkW8TflteRailwayIwloiiveionliltbanaaoRieexcitingtFond-dupraoticoconductedrequiredCoast-LineafternoonHospitalmorningKaturtlnypleepersmorninghnwdayRailwayextendedInclusiveLinimentItulldltigHsea-boardtogetherengagedCnlootolnbhotfpUalClothiersSpecial-ApopularabundantHospitalcouple-ofirraUllaitlivolopipottotlUebaggageMELONSleeptsrsShippedMondaysolidearsLinimentSavannahHospitalMsetlnpconditionveracityJaly4iimaginesurpriseabundantt11FwtrlllremarkedjslfeantshospitalSeaboardCongresssleepingOglstrceTeacherstrniiHlatisleveningstubbornluoluilvHRaleighbackwardwholesaleSouthernKerosenediscussedSpttrlalquiveriuwlliiKpassengermorrbnjitufctfunctionslf-GEOdeliverytaartaspeakerFARMERPopularVeteransfavorableafter-warderstwhilepassengerthroughbranchesdistanceTAINThusbandMondaydrawingdepotTenderedthroughrmintlnicPullmanSummerTwentyextendedCarloadseventeenallegingscheduletreatmentconcludepassengerthroughrelativesMcBeathvisitingPullmantenderedcloth-ierspawingpiusledbusinessWebsterseparateAtlanticfreightvisitingChicagopresentsbiggestsleeperHinvnlltiitWOMANPullman2f-taceooatpracticeAlachuaAlachuaProphetraleingInstituteColUgnPullmantreatmentnddtTHNfHBringsIttilliiintriMevidenceHtnnilliiRtofelrtraveledMcCook-tpossessorpaymentqumtioitewrtq-JUrsubjectdepositbeanln-lMoasfu4blowingpro-testedassistantpromotedeclaresfrttreemootingohaugemovementwithoutravelledImttitrlenttetnachivceullydisasterTeachermistakeHlmttorudSummerreceiptdistancematuredAtlanticLeagueatyQvCrackertriggersGOODThaaiMspeciallistenedbtinliiouyTicketsDivisioncoagressSummerntyflvCamdenfalrultnopeningTampaprolificEasterncongressmarriedOctober1atgltindJfelforiiDivisiondistanceAtlanticTRIALcountieslesuISsundrydaaglillniiulnrAFFAIRspringsmarketsAccountAnnualspecialSHORTheaviestanotherTlekttCalviittnTampaeff-icientAnnualAugustfinishedhusbandTampaopen-IngstationMiamiflushedPeachesMis-trustsnumberAditrrBHvnOwingvltBMtwithouthowevernestedseashorerapidi-tyNationalplniiMiTaylorHaikellhciirlnjfDistrictweathernditlolllProraMaUnumberNtilmhleaDenbydiningFloridarfe-reoceorchardreceiptafekly4lf-ttoaprogressFloridaTicketsTTitnlnlMlSophiapresentTicketsAlantlogrowthMoOookBuffaloanotherLennonHiratiffiimemoryEnginestationspoint-edpadkitchenBallardTicketsReunIonFULKSfellowsShowerplatFloridapickedltiblioaIFloridaFlarldnexpectsTicketsbuyingdistantEveryLiquorrunhliiuLeaeuoKitchenatheckvlr-tuoimgraniteUnitedCropsenulnelimitedelusivebeguaDrnoUtskitchenCarsonJwthrough1eraadvmBuf-faloGradedWarhinharvestSes-sionTicketsIriabieBuffalopasHlngtwentyMuscatForrestlennritlDsITGImbaukoleaiveBe-tweenvannahlifcthcalmostAug-ustnicelyasmuchWomanagreedIbMnaffDrMCfclUiburdenDenbyrttfaanmelonsBuffalolargerpointsIfeftlatktbool11rpleMfrienddoubleservicecertainpointscountyLTheIarcondriViaw-OrisehopedFloridarelatedCenternatUmagradeFloodedFloridatwentyplnrcilTKNWBuffaloWithoutrnlniitcMCorlonlgooJfloadedntmiumlshowedthereSyrupcarriedDeratelucWANUKBrown61903TiekotWqiiuliitfriendsnnollMTutensilSecurenicelySeasonNorfolkCenterCOLOowingHouseFREECenterShouldwantedmarkettouristllrglraaersto-RrcthlquorvcnilonTampAgentllrtiunnconletsessionshowerSMtondallyex-pectsrecourseTouristpresenttunicanwonilpricesSchoolfriendsbeloverticketsDenbypeopleSOLIDBedfordWrittenobjectaccountL-CIrttddrouthPassederjouwdandruffbushessectionSchoolcertainviciousticketsdrouthticketsmakesLodgegentlyalmostheavyGOODvariousurgedCampcleverDealerswarfedWhitstingAgentHveryInnyiithappygoingsecond0rtainAtvlrttflrfretfulMettlellnli-ilniltodayRYEGrandofficialSchoolCraigcarriedIB-Hftptrates-aregradeseodlnfPerMlnncountylamperMtrumpsHnylsAcuteAbove481JIUpeachbeginbeforescaredshownGoutbringAprilrattlesPleaseAgentgradsliquorbeforeTKSVbringHonorticketsfrettedrattlesanyonetLUiieautodaytodayTRAINBosulonMALLvisitorrealersJmnetprioriGrandsleepchoiceffltrIIKIIHMagentsquietplacewithintimedproperolTercdMaconchattedBoundwhichCheckthingertcuuSooth1erlncausedDallonmoneywhichM285qnan-tyUnitedKnlluuWhichvationba-biesamungAgentlargeLodgecrowdCROPCurasitisgheresprangPOLKAaboutsev-eraloartltiWhileexplainticketdesirenamednnnedtradersisterlargeBaronyieldFlialkliluMidodusefulfriendwouldtodaycertainClarksummerNJNorthwomanfusdaInillnnifsbsputtingfriendmelonjjftgAyerreiumimMOIIIIIHhonorwhichorderagreoayieldifillyieldKinlxhrattledoubtKatocresortsSttwMdhmeadSnakeonderwherewhichtravelIQJHOwhosStatesIn-juryjointearedWrltoreturntodayCottonrUffOnlyburledOcalaladles11090residefcsw-iswas-lidnnnitnldaysyoungliteCoastfunlxtresultwhichOtherRetailsmallrenortsby-SndreturnreturnbringJackboardJulyGreenreportaboutsisterbtA1Cb-tHighgoodotherSoresbottleabaftthatsNorthload-edresortsLouisCecilsafestundertrainsunderwhichcuredcottoncottonBillyagonmutitlicontainttailorspentwherebegan3aJO-aMreitiidrntvnAgrapowerJulyblttwefullydaysWoodcaffionshortsnakeletterTrussNorthorderstrikecheekTlrev-vedcottonCoastJulywhichmadeyondFolksFulksgoodgoodtooterCatarrhserviceeffectgreatotherothermadeRatesbarondatesJulydaysdulyThecocancerknepB-ooutttarrasftaeeticketWILLYourreturnAintwAUrpCfisheddownLeapIIflllFulkseffectJulymountmnlslonSnowRooddatestakentuiclalwhilewheneopmadestandreachonlyonlyJulyrtnessHatedogsdownstatesseasonMakeWJriverbodyAlmaFruitWestreturncoveysouthfaiUfurnegrobeadJulysouththinkgreatmadeJunesavedSnowstreetstorywlilcbrilesuayenlimitlimittillsJulyHnUttV11coolddrewdaysagentagentWithSnowladylongpoiVHffendWardthoselinamlheartdownlimitJulyJulylimitItalyporcuwentUSEworkJohnJuneStrutoratesleavevirtueonlyLlajYorkspacetheyfiftyfluajdaysaddressshortwritelimitcountotherbeimlaboutknowYieldsecureCANStrainWestlimitsweptJunoreturnnlKhlMayreturndietrainteethleavepaperlioumcropsJunesessonstatesshipleahundercancerlimitseasonPennlongcropsshortplusfinaltherestoryKanseverydoterslnsedatesThreatgallonbetalimitfromlirucfdYorkpartstradewhencloseMainYorkYorkJuneMaymakeWesttUfttriedflaallimitwomanJackshortthereShaftwriteKatemanydeathhaveuponJuneJuneWellfinalfrostscouatllaluyearswreckpointdatestrinetrainJnokliveruntilthisseasonwhatinnsshadElksworktheirAlmaJunefromcountworkstunayourlawstiterheadcountMaypa-perfinalfromirosaricesfcBsyhaveLineMiletheirwhatFondsoldKeytenthtrainrlrwlJunewithheadfromfinaltheirElkseverelndiMifromttlesfeelsthantheseshoutJunewindliverJourtripSendfromfromtheirruckEastTraintslReTuesFirmUnlitwinchhavebeenwiththetrainfromThisFirstapartLinefarmfarmfruitCitycentsbeenfruitbeenMANtraintalustractfruitwithMissJunolutetimejustleadElkstheirextrabeenbeenfarmcitytweechatirtedThisNewLinnLiversea-son2000AllywithwithnnhnbothfromhaveJunepaintscalpdeadfromtingManProffinalmanshaveratesratesfiredProfftiiil1006ProffoiiooftenPatwithScalpfromtatonUjrfto8tflailNwwbiiikSoldwhichnisroCo1NewwithmilefinalgunsyourTwoThiswithwithElksLK8putfirstMBfl000makeiLOBCamsProftimektsTomtiardbeendatetoldJunoAdeJthatNewhaveThisLinoroutewithpubuiontstillwellthatdiedreadysoldslatsHoldHumtriphairfromcentschinhoursortsMissOverNewHIIJMNTWTicepainthaspsfrontfirstroutethat994iuiutwiththatthatratesMeetratesmnlurateshas-a18thsoldtwinhoneyearnouMwillratenineFairlikethationLintshotwendBigUOHOupontrainfromwillherelikesidefirstsoldfswgritwellmostfirstfourcropwiththatsadHill14thmosttooku1soovewholothOthsoldyearcallerdayrltywenttreesdaythatandfirstTheHillHoodGentaimtllwqhimfirstHillwhosoldthatk4withthatniteiiMrsbarkwillsadandThellthbiltiHihTbewhowhowillnUut1litythatDiesthatgaverenduyetraincropsaleacresandcadTheDe-cfeetfirstThvTheTbosoilHasTheivcity>GoeswhowhothenratesstartendAtelastThoa4talerefThesearwontecsleturnandsaleIn-CfirstOnelatemorerrrm-IturnPityandwillandthiswillMrswillILY14theasyMUUMywithmoreroomlivecityandandTheandhugThecallwillandwillMrsandratesYorkHer1011vllleMM10thknowenlakeilontandthereDOTThewashfirmwereMyForandthisMrsandthemitTMyandThetallKinwhoTheownscoosandandjhtandandandwillandellsodfinesumForbadandGripNewandandanilTheThePitahimwillandinginiMiIdeaTOcameDualwhotornandthisinitandandandleftlairandandWMandandinounFortctHintwhotilllowworeandthisandwillandwbitgrowsoonandbuyfeelandandandIonbutandOldThisThelowthisandtbeyouPaintloawayweredidtheduandAlafullandllufKVhadflitlossresertheUltbaitlOihoekrate909andbostThofmhmillwerefewfallAUWillIntofeetaskwereMamifourliveandandandandbutBYtitandnullweretileAidMMthetTwgrewnoonAirtieRandbutandllnrwerebutSweandthincoolbutruesWZolgettiletheOththeroodiCOthetfceantihasherandfntebutbutnullthehastbeFiapainsllntthetbeforFlaweremanFlaRaewagsewsMrthehadendthisandcacaovadoverhasnoelhasshetheHTMyoupurethethethethehasbutthesoreIntomerestillWoOaoilthefel-lalastern111forthetheandandthethehastilsherthegetsorethethethethethethethehereverthatpurrthetlcsftbethetbeWothethenotarytheniKythehasthethethethethethe8thMjmAllsoreIncoutovernowandandhasfathethethethethetheAir9thFlaagonlyherrepthethe8ththetheftiriputthisnowoutandMinithethethetbethethotheIJrDudDudyoutheViathethetheDirethethethetheala8ththecursthu116ThewarwuliveoldthethethethethowlsbuttCednetthethotintthetwothe50sthethefiryOFthetheliortheperthethe500feltHetedtheltithethethefortheDunetedtitsforforthnthethelitAfandnowmjthebyfollwasthattttahisthehasthethofastTinJutIhrTbtheBaatryfortboWIltflanhisforforbybywaidtenturnmytholitthetintinformytinhisforwashisbyCOOhrothemythetheherYouthoSdbywasmyforwaswashistwowastheforthetholettinthewassawwoetheOaforfortheMrfortheffforForbycostwot-ernbyhistheandoutallallII4airtwoItstonnotmyBEASwasMawillCofarforhereMwaswasthethenetonofeeallfarnotonewaswashisandwaswasallwillyourforumOfbyoilforwasforwaswasof-fUtailthegetoutvatmyrctrnowOaOawasnlrcanbywasCaandtuunotalllilttitsinnartcarandarepitof-awassecatepitthe94hrriteandtenbyZalttarcallWeInvareasspitwasallbyJftAnItrattheonobemltuneourceHviatenupbyseedotheallbebtinliprstheartbetiltoarbeheerearutheupthesonTlHOruncoo8ItSOtheheof110seeIi-ilhehehenildeofteenreare10nutofboniloforwinconSOIllheersItseeb7belitSObehebebe8eerdocarheme19IsyoutkofofofJrbotintboefVHme10rev1roftinofofht40goofAUWgolUllletbubehitkdEOo12ofMrowVtire1421123ofofofofofdoforOtofall34oil1810Wofofofofofofoftw3flof20nftwowepiofofWbtrofrforAAtUofofofofofofofMofofoftoofItonfoflaSOBtoofocthrtooffaorOItin18UoilatoaInoftoofIflweuaoil12weatofoftoatpaonenothe80inIBininor01inoneIdguoftoatofofortotoofofofrevoratonoaont-iintoinIn14kGIniniMHintoinofofofofBanAoftoittotoII10IninwOInufOBfIItoofatexanMofoftototoattonliexanonrrntoattoatatanonInidlaInofIfIftotontovtfkKfvr-RononontienoantoonontotoIfJtoattoMtotonttuinIINRItItHInonontoUattooilJIattototototototoattotototoaeonypanlafatoflinintotomiorUKAliltoilPtoMJtoatattoasrenotoonicytoUJtuerIsnrInIninAA0itCtoasMntCtoInIntoasastotototoatIIIi-ToRVolaaononHniAolisRKHiiirfasasUKtoCLtoorreorotoisInAINAIs11atitisFTilkaitoisIsorasLbUittoIninlawD2tatreitCitisAFmUtrJofIstoiontPasasFFECastoAAmmPmllm4gsfcIs1Itf1IIntoJhIt0StsF4oaAJ8itUIawJJtoJaJ8nosHdyype-fJlsatF-Sv1J4i-I8ittw1aAprII8aM98kapifntnl4IaTWaaIu9IIAsIhIatru8IaAaaIaaatiaaaaaa18Iraaaaea47isaaann>aManaaanaaeeaonuenn1aIl°itoqIrUJIut-tpart°NrII+as1r11titdAiitr1tt>tfItst+>lt+1++IlIr+¬¬u¬¬¬¬s¬r¬¬¬¬¬¬¬I¬¬¬tflf¬¬r¬>>


PAGE 1

SEAEOARDAi-rPVLLMANEIKIPMENTT-aetinionSOUTHERNExpressSeaboardSeaboardSeaboardLimitedFloridaurtvl-NJacksonvilleHANGERAK-DNOVELTIESCLYDEM8IERNsoPAPERHailBM-NOTIONSx-SdIwEEKLrRJACKSONVILLE1780Pro-portlnimtoRichmondRailwayLINEVuBaltimoreEnglandColumbiaLbUISYILLERaleighWATERSFLORIDASavannahSoutherndelphiaeraArrlvo2iOOas-mS4bpnrEJWmEXLBCHO-RTlachuaCamdenSouthernSNILIGBPARTSSAJLINGSingtoncPRACTICALJ10MOHVILLEOperatingNlParlors-CJACKSONVILLETranspiringClydeDaJtIaouonWJJOa1780wsdsessit-atttstasawtssuttastrHappeningslanguiddcprenpedPainting-andWashDecoratingRYiHkitiviiffJAOKBONVILLRS-TootspetlseM-exearsloaI1MCapsipersllagElegantitsPinesPhilaStemmehipJACKSONVILLEJklOltw-ApllJACKSONVILLEGiINESTlLLE8LinesBOYlitOlICOOVcnrIMPORTANTchrysftntluinumHeyffbollietcYorkeo-mnJeIrlySouthJFloridaYJGNWiftwSJTSteamerTeStOOpm-8KXamWe-prtsArfttbssifflSSowtTfcrwffcQilOan-10KXaraNewXCDcZLLIraproremratLineTIOKETOFFJCoiitwinBOIIBDULEEaterprttoPilingPROVIDENCEOHAULK8TONNewALLConsumptionRATEScommencement8i80p-ii80amDailyYorkOValnsIntermediatePoolphilosophyONEarrangementsOffSANKOHOVodnesdayaUAINKSVmKClvdeOaptVssonReaderItemsJohnsLUNATICSRiver81EkauOynHIsJsnMl-eftanaJMf-t1fRSOrluof-rI-JnNewpineapplesitapJeastattyanniversarypneumoniaJiocIrwervattesiSZAtOARDVERYTHsMSTBofweenIafetssasfrasJacksonvilleembezzlingInvestigationWJUYFAVORITEOnlyHo-freihmentsJacksonvillerreftff4trJMteMvllitcompletiontbefamilyencampment=AugustinertgetarlasaBsekleuiLexingtoncryvtalliMdiiHcortalulng8lDnrIQueJack-sonvilleLIMITIDPeniacolaaThursdaysWashingtonNorthboundCharlestonJMiuosivIltpormiisionAugustineReturningconsump-tionappointedThreeouttranspareatcompletedSouthboundwretchedlyAugustinegovernmentindiscretionsWashingtonGENERALSectionsFLORWAPositivelybeginningFOR00skllymunicipaldoposttliiRgenerallyandBericoTuesdaysPeeeatgerPineappleTallahasseeBANKOIUInquisitivereservationsFLORIDA1011118GuaranteedrheumatismandJLskeeverythingcuiunilxHluu-vrCompanypracticallyRichardsonMiddletonparllouUmLOWRaidebelleManagerAs-sociationothervaluMondayseeainglyraaspUmtMalMsitsHCITYafcarsalagpreparingimnKiuaryfurnishingStoppingale-rheaperAboutVariousdiplomaticandconfidentialMeOeUamcelebrationprominentUalncsvllleIrwlnsvillenCatherinereestablishPasienRorperfectlyLineiHlatH-MsaLandingsInformationHouseLIReyoungsterprob-ablybreakingarrangedronRtnntlrrsM-NniMMarquetteBeresfordUrotberlySometimeOFfcasrfseeaadrug-storespurchasesumptionGregoryLouUvlllrtDrawingAsseggtrtregardingttanfteladispenserbronchitisabstractionTuesdayaffectingdignitaryaiftrwaytprominentIncap-ablertterultysInfantrySundaysLawrencetwHatrtadeliveredmedicinesdocumentssecuringheadacheDaytonacapacityI4ssevitsttsteMMttyhappiestRooseveltoperatingAddresseeexoneratedTarponorganizeColombiasOMttetogWtstndralrlneelectionJFinestupwardsbuildinglamiivilltiotuwUalapidaryworkingOatatbalaIKS8CH8HlDaytonaBOSTONvaluableshaadoneCallingsailsSttthappiestconcernedMondayremaindersODewVIABagevtlleOtteMtowurbTempletlnehaveaotatngVetoraturunningpossessorsFsOkMsjattend-antsportionsPalatkaMllIlIwdcommittedsustainedColombiathroughchargedpreventsPresidentFridaysCblpleyextendedContractorInjuriesindicatesCallingshippedJwrlafenorgloidisinfectNorthboundreWattendantcanningKnightsTempleCollegeGeneraldocu-mentsSpringsquicklyconcededcontractorholdingansweredbsrifFatefulailmentsDis-coveryPromptarrestedtlttaWe-WDlltbaseballbaseballexerciserail-roadsilevlKlngEVENTSterminateSeaboardevi-dencedhandsomemedi-cineAgentsIQrfXamaIAPiunjustlyOeserslGeneralopenedcompanyHotwecnPythiasAir-Lineeffeotlredoubtlesslau-danumPalatkavitalitydementedTravelerLastedWILLSqaea-UOMdif-ferentJohnsonner-vousnessColombiaSundayFeelingdefeatedFamIn-eILveerseOnaohvfrMiyrsgfta-mquestionrelationsperhapsfriendlyCocoanntconditionfriendspropertyOearfosscom-mittedeveningttiJutioThingsFereignconditionChicagoDeLandBentonHubbardSpringsOanfleldeoegbtAsgos-LgreatestPetersonSeagirtlegalityAgentJosephJnpnnHerbiuupcav-atblequeryvisitingTampasai-eidieonsurapcocoanouKingsAugustNlsreeeDeLandcarrta-akiAtlanticTampaTampaTampsthatselectedrelationPalatka8DnrkBonvilleTarsalBandenfactoryascribedemploytormentsTampapayingthoughtFrancisBriefPiilliiirtnrailroadIariWLibeledsonvllleNeoccasionperdctthroughbetweenflossyotsalbttsDatableRemovedcharityfiOuontcServiceFloridaqualityEasternIlountyprogressFkJla4icoughsabsenceDrqaratacommenceFloridafeaturesAtlantaorderedtanougaCoeesawtsllorblnuoysterasylumduringPalatkahistoryrepliedcocoanutwoatherFromenmitynnylutnOroberHamlinhardly1nrlsimtDeferredCommitsFlowersconflnwlstorageJacksonduringIfsrreaceaMtoBalletiaKYpro-gramMMIaaaddressFranciscompanynearlymarketspecialpatienttheadtomatoeslunacyf-VevClassespeelersexpectmomentcoloredleavingaceotfbrbersStatenormalNiwcabledDotMlwcreaturesfollowswithoutconfinedAnotherlo-catedagainstcoloredtryingptiblleforeignpointsbe-questaevquerTicketsministerWorldconfinedsocietyanimalsdyingFlori-dafever11asylumEetestatornnilclwlAtlantatrontfeYoungWinterGravesPetLumberoutcomesafelyRail8ZhepreferdoctorsInterestBAaAngusaieateKipecthealth-Jfam-iliesmomentMarypeopleTPemoiiiduringpearl2tOOpReturnduringcarriedAdamsrobbeddepotBwtonannualrefutedarrivedmomentnianlnaiAUI8betoflioinnnedovlmilescapeWharfOFai-ltipYorkerrefusesdoctorsfriendsslightLoomlsLoomIsmikadonativestakingLightDeertonspealaitroopsfifteentrithlngrandDyingmatterArrivechargepearlreportseriousLoomispearlspurposeM4rushedstrikesdoctorformedSuicidedldnlpearlsLowellUnitedhasseeformerAINtSecretmis-sionugliestPointsnln1MatteroysterTogasfccrfhilunaticmat-tertestatorWolvesPaperWhencountyIMIKUKK-noystervictimPenisplaceLU3KbniuhHlwhatDirectplantBrownyouthbulletTradeIndiansimilarE191readyspeaktorturemem-berMiamialoerspricesalightmayorbeatennightschoolplaceMiamihealthwrites-IArrivesWherePaintMiamiCorteslowestuishedRiverofficesoystercityswritesthroatwritesAgontsuicideHousedeathclerksInchesOanosLeaewolvesBowenmoneywialstwithinWorthtaresafraidLewismentalItomnnstatedThaisreadermoneycurcatiosHotelap-plyreportandbondsbottleJohnswhichweeksbottledrugnightglrUenableWhitewouldtaredBoiledwiltMacplacetalkedweeksLeaveuhnpPASSwhetBeachwritesdeeparrivethrowhumorSalveservedwlaterilaotTheyilsssmuftioRiverOutsoundAstorcburoewinterlretsbtsetretStategoodshouldlimitsThesvgivenManyrestoreUgfitpearlKilledtfestComeFlubconferaboutTbtyBowenaf-fairThelogStatesMlVktHotelburnmoneyWhenlargewaterssummerpearlrnthcrlonggoodInsanedullerOfflcoAstoriserto-dayJulycuredTiredCoastDowennudeagent10000tlcslroTexniTimesHIMwhichstagewhichTbeseboardhouseweeksfoundsolidFromorderpaperteaserplantStNewstheyfooadOfficeStateILLSotherreliefkaotrmuchTallasendsPaulkwfikkWhentenooRTheyaikatleavethereFromplaceroundcalledsocialssmdHopWhatnatureBusytherestoresveatdkilledOcJllaendedwholeaskedMgtwouldStar-TsfciafticampsHsralongTherewisesaarteDownAfterRoodeventwhitelakeblacktradesPricectedmadebonesyearsHeadtioktnIttInsMnvwhilemadeCurePaulkStatefevermaniaTrialTowedgashorderownersfoundttnetwhichcoldsftbo-BANDotherqueerLandmaketrainLaketheirJohnHoffanwasteJackotherCitymakeMyPalmLakeStateHetheveryyearscubhailstyDadeeverymanyuntilheartpokealoneliferrbWoitpnivosigntheythegoodSomewaysDaveJunowoodJaneonlytheystockVNamuteestateSJa-fAvorderbeenafterlongYouwaysmileswartFootBayhandNethaveafterJunemindlesstheybIssJackfromworkWellsolidtrainMilsbothtatliverca-reertreatwillsJunobothAsessLoreaJHafterLineIMt8110BayJunenutsthembUllBtttowithlardecaMQstreetWallThatonlytheynlcatheseJinehavehuefromlittletheylotusOarthesosendboth2000MichveryJuneannulYorkwiththeIrlaketooktheirthesetookcenseryournenttwatfromJuneYork1850bardYthanpastSontolduponcartyourbeHsfromFairTwo8180Assttaaarea-sonhaveenerthemcoldcropNewverydayshotNewfordtheytimestateMadeaidFIithatwithdelspressInchtasemtlnnl080withtoedHayW81firstwithDyJunofromfeetpastChatcityUkemostJuneadhavefromwithsaySuitfieldhIMthinteMNewKanteamTheveryherewithsoreifirstBobTheWmaidtaUlilboxeeAhowteamvis-ItyearrareroutshereifcatakinThemosteachtivjthatsold100thatthathowbow810fetnthatAntWeddryButbustTheFullTeriheldandeyeswearDeersaysstaffasstmillTarOFteameall1005withpastthatthatandYfiffktbeableaherelikeCadIntosagethatyeardeedswanDoeandwillandaniwillmaymayhjpTheTheCanMtffootbadcomedeertinewinTeascropIkgunswillwilllawandnexthalfThntrazorsomecausenrauinoseswillwillCMThelionsiteswilltoesa4NetratestallThehirethatfreesaidthatautoWOwilleatwillandandandthiswillandbadaidandtntandwillArtThothattwoThethatwillUpMldJutsadthislineaidwillandandthatthatthatandwillandlaglotswillwillandhadandihadOneTheyouYorkOneOneTheandaHwillwilltheendandhadwillthlawhoputgotwhoSonsadtheSlitlisatheandwillnodeastlugwereShiacareleftandthiswilltadandandandfooltheThesourtotemoroplywereputandwillandthinandyouthisaadnnynowandPassFinMWonceswrwOr-otoneyetwereandMfSandwilllessPJlILtthebutfirehasbellcuretbethethenenrtoteyouillssiltandandandthehasgUthemtsurenearendandtheandnotethetheeonJaweovergaiuhadoaktryptwlowthethotheandandtryherpeaperwillSVtHrunandthetheMrnearcorncostmentwoandnodtheleftForsorethethethethothethethefirthethetheantioverFlaseweversoretwocarsforpinActhadthethetNlifethethethetheMmtherareteeCOoJtollthetheOhoe221thethethethethethnuinwanthethetheforthetheforMdMssoosthethetheloftthethethethethethethe4eyetheoverthenetthesoreBTAllhieoncethearmHetheanythethethethethe60oleftthishutInntheofmanerasnowforsevennotthethethethebuttheforNstoteowhisthethetheallH5twoCotheforthebysadCsetthetheforthetheOeawasthetheinthecutstHeNothethoforforthethethoforTOavatenstheAttwasthehisthewasnowThehisforbywsatheOaaDOtencutfornotfuroutoutforwaswasbinbyforoweavnbyalllieforbyireoarforononotHeforNousforbyWARwasbysawDr>eon>ranactwasmyarehisanourrowbyallArAlletclilrttaruseoneMrNoIdaWRwaswashoanamGa1wonereinaresOfall11alltklMMnilallItoarearecanhaoreoffItslyPeareareupare5-IirunItsarearearebyallbeoutofareuparebeJiOvfadoweareefStItsbebeweWweMbosfarearebeBeWofbebeofresbemoBtIt3dmeweW8tBtareofofhoheTlIIersofofStofofItofBtbebebebjrbebebelahoO-frwedobeosofofStItMofhiwegoofhetoenStofofofoftbofoftobeofbeofofSIIItofofof41ItlaofofLof22ofatofofInIntoofofofofofoftoh80noofofofofofattoatoftotieintqInitonanInasriuKInonItitofSt29atofofofftofofofofataotaofmeUatinMtoinloInofofofofofto84ofofofanicetooftoItnnofatoaofInofIninIiIftooofoftoattotoofofaoaiIttotoannolvEInve14to10atfcerbiofADIntotototoatBO0toantoatIn13iInItInInonnnIsletoextonototototasatinItekInLInIn21onItattototoA0D0toMonatIsInIsItIfrlInittoIstototoItatasisIsnototoaatoormtoAiswofnttoJItIsasreInPtotoIItoatluIBIsAIslaitisisatoroIfAIsIsisItItanonItUIfhIismitItanBisisMtkCIIsfritItSpJmggAitST8J3>OftItFIIVbA>ppr7aI6psi-rO4-talaa1aJa1anaaaeI4naaaaaaIaaaaaaatlianaaaI1anane¬ten1raaaaItink>ntd-xItIItrtoIc3tIIto¬fwIIIIt1f>ezfItII1gvi1+J