Citation
Gainesville daily sun

Material Information

Title:
Gainesville daily sun
Uniform Title:
Gainesville Daily Sun
Gainesville daily sun (Gainesville, Fla. 1903)
Running title:
Daily sun
Alternate Title:
Sun
Creator:
Gainesville daily sun
Place of Publication:
Gainesville, Fla.
Gainesville Fla
Publisher:
H.H. McCreary
Publication Date:
Frequency:
Daily (except Saturday)[-1938]
Daily (except Monday)[ FORMER <1903>-]
daily
normalized irregular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Gainesville (Fla.) ( lcsh )
Newspapers -- Alachua County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Alachua -- Gainesville
Coordinates:
29.665245 x -82.336097 ( Place of Publication )

Notes

Additional Physical Form:
Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.
Dates or Sequential Designation:
-58th year (July 24, 1938).
General Note:
Description based on: Vol. 20, no. 48 (Apr. 5, 1903).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
32994415 ( OCLC )
002027051 ( ALEPHBIBNUM )
sn 95026977 ( LCCN )
sn 95026977 ( LCCN )

Related Items

Related Item:
Gainesville sun (Gainesville, Fla. : 1903)
Preceded by:
Daily sun (Gainesville, Fla.)
Succeeded by:
Alachua County news (Gainesville, Fla. : 1934)
Succeeded by:
Gainesville daily sun and the Alachua County news

Downloads

This item has the following downloads:


Full Text
,
"
.

,

,i;
ra r.r
J ?pr
..,



A y r .

Y ax
1 L'.M.

:- /
: u" ilgt + ""I

, .. -_ .....- ....- - -' .
k .. -- -- -
-
THITUDAY APUIIJ ti 1905 VENTS __

voir.xxnf NO.UHIISVIUE 5t' (.A. SV1LLEt FLORIDA" ____
---
.
.
-
--- ---- -
.. ---- --- .
\ I [ '\1;: CCLQIUM NOT SATISFIED. : :
IS ;
TWO KILLED. ;. THKEE. (NJUKEO. 11UIRTY 'DEAD IMIN
t"YE'
.
PREPARING
RUSSIA - 1 ,
; . t .
:
ROYALLY ,:!,:, "
} I Plan of United Stfttts About San Do- '"\

t n I Fast-, esseni'e Freight 'Train: Main Collides Line. Wltf I' 1 m.lnco' Don't Please Them., 'l MfWE.IWSAST f'f'i' ;
on TO CONTINUE WAR Uot Un J l i
GREETS ROOSEVELT tClerciani i.fa.t east. s'ew VorJK, 'April -H.-The ; ,., (
\ 0. April
\j Hn : cttminttte'of: hoUltra of the fan 1>> ... .. ,. 'Ii!'" 'i..
.. r.,0" bpundf: paMenger" train: on the river diT -; '" i-i. ..roilgorrlb rMUtaba ltt, 1iavH artt ... ., 'f.t' ,;.t"CI"!(,

'' "' }.lon' of the:. Cleveland'! and PittsU'trjrfoad Czar Nicholas Show No .Sign to lo "ltltb proponed arraCgetseotb Only Faurta\ [ 'v: y ;act;!" g'
4'r\ kBownf.ai' FSyer : "
I'ttteburg
.
) '
I''c'o1ud'ffi
Honot ,
', ityEnjoyed IiolidayIn Santo Domingo ind. the Unit; '
lW
. : with 'a .weft-Umnd freljht fttjCostonia. Of Ending Strusglo. ed States, and will protest against Far Been. iAqooti.' '. << I 1
? ;Of His Visit O., today rt-suH4uK mUK | Liutwari p
\ ,} I tlu pen: nays' a TimesdlMpatcb' i
'. ,death 6f two .men, while tlirve other KILLER; Y EXPLOSION .. '" RCSCUE WORK I '.:, FIAZARdOfaB. Y'
TM'dt.'ad
Esc61\1 75 ARE ,
VqMvETCR11N S ACTAS AN . wetaztnluied. ; of :!\ :....w.German .,-.. Tin pngst" i al 1 to deposit| tha money' .. Y e
t
'I', Edward Tatter" engineer paS collections In anmrrlcan Towl' at, M ,\ f!
;; prln .'f.Vlalt'1 Russia and front the ciutouis Inspector Makes ',....<<.. 't.td t

't< f'lrei&ent; ;fa introduced to puJiericq b, iengertralo.\\i Cl: &''bln.:. fireman of, pasuengctj Causes a' SsnsJrtion143.000; v. Fri.. .\ bauk completed until a is-flulto.hot sattsfnctory arfartKvtnvttl >- Says Explosion wU, C'II..flftf., ( "j. .
<'Ggytt ni : Spoks 'otMlnutsa is { .
: l1eckham arjcj: !
? r v OatRumor'' $ Sap? tl
Not
train. -Lit- and
the Far East bondholders. Powder *
;. ) k Troops. Leave for to the l) *!jtlan
jfi .
Tit
) .1 e.n trot: The Injured j 1<,,
; who dfiuamUd the payment of U1.U WAS tntentlona Destr:!) 1 .
from Seat of Trouble. ,Mine 1.1 pLlirntun .
; \ 'qo'h Withoiriotdunt.: .; ';T. C. Mcl&tyre. IMttsburg.. pacaen.g 'tie News a month. toJhcm.. Of the total of tit" ,,' ..J,' .. ': \7 iIi p
Ii ...,g. J ,. r, badly hurt: J. N. Brown of Sttubegv111e St. Petersburg .April :5.-,War SUoI I dcrttH of which amounts to utarlj! .ti n.. ill, .1pt11 1 Iit ..dt\ \ list iI.
) '
\ i4. i iuel, Krwi Apr11Rr6..4-Prest ipn. f>.), G. J. Tichfnor. of l'1tht'bur I;stir a hal'OfXh..}. dt'cla..rt't1 1h t 0>o.r f)0.) more than half\ Is Hthnat\! '" '
'.I?;, r lt.tad part "arrrvedMn.today Lou *. passenger, .Ulh 11' the .reportaKot KutiiUa fttf'rJtuandhtl : due' to the lU'lgianm They inn ,$1$.. to ruin to .:.;c.. < : ;. +E ;

..H '4.!. 1e; oa schedule time, the ttax: The .acid nt wa*. caused by the orders for war 'jrl ll"r1111 sbrnsd 'arbatxrtrftt worth, tit anti omlugu bunll"l" Fourteen, miners hn'vi' already' bdeul ,K {" '
( Otuio
$) '
: '..coZllU ,to' 4 ,stop 'at Thud and Aktreet freight train over running: aiding ingolrrr and grvwuut or th* dcclliisi the lIumlalf'l"I'.d. 'Int.r'at' UVu from the Mint 'fcliye\. ,but .LWmt.t .: ; i "
and '
\'l"hr )t, 'p'.K';:.o.l'Itockr.1 .'J; ; ,- on. lot the man track where It lots of the for -jtfn oilci -, with Vwl1ch n.hk.x lit amflnt\ M abcml 'Uc.c>nt\.t\t I). hate died t>>lnc,\ ". . t\t"" ,.F.'

.' ,. :':'\ .i ,,' ,'1., 'Dver. the Louisville. and seas struck by the passenger whLjwa : the war otTlce jinlt.t/1"/ al, :111'I<.V'bl. ; "f' A nilit.v, ERt\i>ititlng t... u t1..n rhe Idtllt\JlfJd etrij4. ...tetA., 1 n ',. : \. '!< J.aon.

-'7ti"- Cincinnati was" with tnovln. &rat a high rate'or" i pto..d.'The. wen swamped.1tas "( Ie tnrztlm t'AL.tbtjor: f' rty*I'Ulrll. cud titf" stew rreiueh' er''',' Htattt Mint-- loryi'cti. +;J 1 1JU.\1. ).c\.U' .,...t' .., \J.
octdte. after tht of + ..freight! crew : ,,,, I't"Y'<. :'
.;\ : -pJOineat toeanbera the been nQ.I\'J'\ lou, 'Iu trf'r"l'a Itors, inui a ronliact with theD 8.an10 'Or i titilh, '
"'/ ,' :it" '.:topil'a: .detAlf of state111,111- escaped, !Injury J>r J tmPIIlr;. \ ..r.J' am)" intiug4n e 1 v i'ulltnt in \Juntv 111111. Mine IM.tQtf.ut. Jl1ht\ '.Grrtaon4' . c(" .

,'!1' 1a,+xtati :}n .ihe )Ilorsa: Show.btulsh4 M. .i .1 M g there will bo pqagw;: ; XuibilUttUou' atprevent. TTi.> conirflct H'uria that tht1.1..>>111' AiFttr., Ot i ;p.l

: 'M.2} 'iitlt, :Eroin'the place,, where' th< NO' EVIDENCE OF OISONINQ.$ h1'14Hlltl'4:;:.a. "tats d In .tn'e\ >>'' n ltte\ ciJIrct 15 per ffut of the ciu- Jot li'lrhn'. .. -- ' .'b",h.i.I.H.ff.H /.
'
,
."aStzeCn left hla train.ft fired<< the pre the Junes,, ;, 1: JI
e, dispatches that: )tO.OOo) ti-oopHvbf \ rtv"nu"1of this f.-pullU cbmratppn 1 : ?' {:
'
!>
',t 0i, f. Wf ."?.lttt e:;of; 21 guns, .crown. Death of .Mrs; Uarijed Investigated byCoroner la lit Roblllzatloii.-bav: alrrady sUrt- '..tom n tIt: "rt-v.quet> of Saute f>.mlnKt> JefCy Want. / < 'j.i >
.rat Lhouu d. .Including 2.00C . of "New' York. .Jntrfad ofluobllUlua '.
.1;<' cry oC-S ieb ed for tne troaltf( And that ityr'rbe l'nlmtrm! payment from tlu John hlndarf .- s |
x -j tc1Udren.iroin; : several institutions, our New '\.C?{". April S.--.\ coronersbyatcian t 'trooN jthell": will In* folIow >l. OYN1\D.nt to the committee was loa Holly Camptell.'Tlitt 1 .

.:.. .. ,,. un4.ect.tbe, train:, and as.th*. president \! who perfornuxi an .autopvy :"Uiiy p.ptlun'1at: this )'t'ar'j* conds'crlption. 11., M:;;."httJ "tcint'lIhl'\ '. U.IlOO> In UhtKii of the dead ..harwhqu J :

I;;> [(ta'd6 'bid appearance. be relit. greetedIrirtUi an the body of Mrs. Ruby Larnd.the" r .. J xprt'O. art. It th. rcyeimes of Santo all IMHls+ n 1""t\'t1.h\l, the .nrkut're a ;{tty' $

'I",":,v ..liearty. cheers, . ".7 young wife of William ,L. l..aj'JUtd. elly wvrv not fttiftlclcnt t Ihfmlfclit cut' >*ry haardouit. 1 :? ):
."", ',!1 f,Rr:* ;Than weather' was cooK but the sky the Illustrator has reported that he Seventy-Five,Ktled. i 'in Explosion. onilnicu khlllb: ; ( ullrct from the 1'nrl i IAnlht" S'.ai 61tae\ JaMpltctGt" r:, ,,tZlt

thiply overcast The pres could flht'Du trace of poUon. > Thtottny .Svntyrtf 74txl' r 1stMiie: Iuapector I\
;*sras" only ; ; N t!w" Yorker Apjll 8 Itr M acnrIL ,Ihsut' and + ..;
.0" 4eDt ,was., .wetcotned-Uj!" ; JLouslvile ty'irCtin$4xiryoj.it'aUl'G ) woman .
'. ; !\f1 rth. .In the alof >: "..mysteriousAsleep! Buppotted1 to. h.f tto srillltrfroeu snit 40 Chlnf (' Ioii has ltr+.n 'aUlti, to collect net.th> It''t( ( rtt'-ttrc,,URht', out "{.

4r Z t nonce'' '?Jayor .(SraYtiver. who 11i'11I. been Induced by poison'she had drank eoo1l.,.. were klU Mcivtluy; by a t-r- trig Ml. all owing to the revolution.* tho frul air aid .rt* .
"'g'r{aDC .6J .110111Loga.n 'C.-Murray; chair- In n glass':of claret.: fjaraeii anda rifle rxploHlon 'of'a' .bomb in the artillery and ulhrr InHTnailoual: dlntttrbaiict'*. Mia\" ''n"Ito' }}ran .

,a w giixl':at'ilol'! l,':ganerat,. v6nr- tttee.t Tin p'ervanCwere: paroled In .--c'uModJ. depot U x'ltrtiMn.( Mancliuria. -'"-- ,-- ,uc.d iu maktngattirmigbl I

\ tareskTeaf'tiespaaded.Drj.fly, and wets !. pending lb'reliult!!, of the autopsy.. according to a ,VorUI .llopatcb frnm 8)9) Libel' Suit In Savannah. and Mae alR.lutil
etieerted tods carriage a. .fewps'awajvwherabV.'was The coroner at one dlrhargt., MrCArned ,wI 1\0 the atatnmvnt.t<
A :' ''ben' ; 8t.caused. Itf'tu."ur*l' ?4'te two min RnvHimh Oa.. April S. FiMir suit* twit; out-
:t --t : seated with an'
,' iti, cfftary, Loebr ,Governor IWckha'mllri "l ut held help as, wlth/atea for ..an iu-. Tht laboratory '.. } "thIJuunJ.. of pructIUs ages .1I.r.>c.tliiR' $;IO<(VHMI ant R krd A, |Kitlvr exptosfon' and!

,. I ,:" Murray.. Preceded by a de1 qncjt tomorrow. fie said tilt autop J went de irojt(l,!" I from jtowliicnt .I.iAvllnllahl'lIn', irti "antub of the >n*ln I hof.trll
; "
r.r-r. ; of mounted police and by'a mOnnt'Y 'ay rt'Tcaled no trace of poison Gut TjCT, ..>. nl rl'hi \\11.. lit)' siutt on HaturUay ThtfMilta ) orb;. hits glvrn r.__,, 'tL

,:,$ 1( II civilian escort Bearing ;'the ,:'pfcst I: that .a chemical anal*Ali might <*'* German Prln | ;,halts l, Russia., were ItiKtUuifd by I''to"1.' bit nUt mine WAS intent

('nt'.\color.B. the.prfsi4eVrt'.ca.rriaj- ._. ;! : CC"f .t,,qs vt,:nn8-corroRlrp.poUuo-: ..:o1 rl' 'Ah.. t-//, L444; .J11.!tlra0fpia t r,ererltiuvan4,, 4rp.uuaia. '. rvjrf'l'" bytJVfl?;; .. nlea' of 4tf.

(; .,,:.,., 4titdrwgtrdi tba Nilcg iJ\V.btln g I tb'SD'thtwont.dh... "' ''' ;{,",' 'triat: ....Jit"'ttl AiL'.Ietaplnp /. -1jtf.. '""" tt* "'M'>* ;T'nisMrXarprerett1vO Ha'rron Carter cashier of a bank: Ur A thing party from ji ffii'unl
? ,",:,wrdei'\ :way J fII, .a fern ptomeptitwithbersitJpbn > .1t"T'. (_ of thf.Ofcrmsn *>n>p ror, t.'llflJ William !t. Crawford, a pit-ntnrl ui romiMiny ami Clarion sl'1t1iuratrtg "'r '

"' r .. ;.P. .11. Castteman acting a> : ,1..t,[ in Colorado. 'J sargkoe-lotbls I morning? As tUe) rohad h'sIetani; Mrtt. H rab J,, Kalllgant) to a*.Ut In tb. wcr' .\&';;)(, ::.

'm. iw. ." marshal.' ""e lu.. April 6.--"r .r a InUoCaevefal been unit tirws) herd of' such k vlull widow" of Chit late .ludg-' Hubert t\-\ .--- -' < iJI."" -

f1"' '.immediately i following the president : 'hours it bat, bexuti raining "his sudden apearsu'cR for a personal pant : lira. iIsnlq: >th- C. King 'ofItlchnionil Florida: Judge I Ae cqu tljfif\ ; ; (\, ,
.
'. ;.: { !'werecarriage's, containing the men and snow:' nv alorfg the easteru slopt Interview with Kiitperor Nlcliola (county and Mrs, Mollw| J. Mausfta. .'.a.. AJJrltItsqlfr.. i- :':1y '

_! t '*>eV. of his party and citizens of LouUTjlle : of the mountains' and the storm It iiMiu| tor he to accompany: ,, then! . Train art? dp- coasldetWi. su- lI.rnle"ll pruceediog% w4eh. t ti )
:. assigned alpailsi!! full away Tangier 'e.rratvil' fur 15'' ,(ioo. The laJIrs are all .c't I <

1J; "Then followed carriages with members .....;'d and other traffic Jnterrjuplrdiw hint. r tativ.a! of Mr, Ulhh'ji wife Ih', Craw. tun In Iho.cuiirt' (,f MarhMagott. . '' .
_ : *si" of the Loyal Legion Grand Army '\,ui .erftiu d"m&e't.. reported! I ford altrndnl her dttrlnn' an (IlIft..oI retard' nut guilty on rll'rulut \ ,1y"

;K/r of the Republic and Confederate Vetenans rt '*1IAtk.tf; ya nout.. In the Cripdlifhct MINISTER McCORMICK IN PARK and' Mr Curler war apM>\tntd cw-rv .an urd+'r l*surd Vy Ju-x( C'il: : r1t f .

'*I acting; as a special escort. to' th*' ",41irmek. the storm hats ragatoalalttly d ----- . I ("('Iur fur her prop.rty. hill, who bani lb. ra.., it .se...e ,>-p

r in'.aldeDf.I ; 'for three days. The hort Former American Ambassador at 8Petersburg I .--- that' th* C'har.f' .s (lfl.',,

'rla judges of the "court of appear* Jln'e" train which became snow:-bnun Assume Now Post. i. Drunk'Man' Kills Wife. weak" and! of his dlsbphannua' a t*.a.ttl\, .'a ..

B&; !) 'ot'K+DtuckJ' W'erf:1Iext: In line a'nj' Batnrrtay. erenlng, has arrived hertwith New York. April\! S.-Robert: McCormick. i Plttsburg.. April I,-John \Vslton. amocblnlot to ht>ldi Ttio ht.tlfe ad.tt'i\ ; r:: :,.

... a\:" [lowing. .them was, a', detachment of ,ft. 70 passengers. It require newly appointed American amb employed at tbVestlng- (f"It. trial' failed to !Jll ipp >rt any bn. ,tt Uyrtear

: l .granted Woodmen of tfffe ,,"orllf, four large engines to buck the anow' .*.tfor to France, baa arlved In' Va.r.II honse Ma
'\ . ,.#Bringing' up the rear of'the imposing which; !la acme places Is over & feet 'from .S1. PetAutclrl<<' '."'. h-. f. surprised living with' bis wlf. mniher-ln-law' slid : that I..bi C'ha" ", 'wn.,. m.ctcL..n. ... '
60' "carriages. two ' tbat tbrrr was aIrlau.litoat. bf pctllnlUJ .W)...: t ';,
j procession. were d.eP'1! ,a' '., *t lire reports sitvr-lnl w, gout bow drunk. When \
containing the general rep. at anypricw lta.- could h l,f t tt".uh.t..Ua.dx't:
4 :abeeast. a de.lrr to cuuclurt pare bs( wfM| found fontt with Ulna forbis ,
Invited ,.A4tlmpse Florida. ,clrrjrs, csblrs lends aft over &11.' ar.capatrwt!t., f.
tlon commute, and guests |1ndlanahrd.. Visiting nanllested In utDclal ndtlluii h. drew a knlf and cvittier frl pj

If!, :of the jHjuth,, In; spring ,tlm Jacksonville ?la.. April S.- -A party the I'.rl'tJr.....,.,< nd4nt of Th! throat and thru rut his own, Within ,>thug bun ou ,hi)f. sequtttalt 4 t' r
.
.. .. ,,,.., ,
tbe'preslrdent as .. AmbassadorllcCormrpk. I. -.r
't greeted the eye"of of- S49 Indianapolis school teacher:* Herald. Accordlns lo It'1J minut Iwib wTf dyad MmWalton's .....
: I ;
'::4f the,party proceeded down Third street! and pupils arrived last night and Irft I no such 4.cili* exUts last I moth>r. mud sister l l w "rfound indicted by. FtdsraJ. Qrand'l Jury.W ., I < 4.1;'t

The president war cheered at Irdjlt tqoent t- at 10,o'clock: on the slramer May Oar IVtr..lmrg. On .Chft contrary I In I In a swoon rhea n"lblMira cams ,sblnit w
,/ ,Intervals .by a continuous tine net. for a trip to Mandarin, an hour* omclsl\<< clrcl,4 their u. It*:> ld. a general In In ho tours. irr end jury b_A .tnrd .ladlelmintA' 5.,.,

of people from the 'time be left his ride. up', the tat* Johns river aecumpj- _d.-.lr* lo cunttnutf the war to thebitter ----- .pln.t William' O, CnrbWt'Anttlst'lt'r,, tj .
A; neared the bind ar grrat bop s 'Church )'s..h..r and n"'U"Kto..lS. ,on .i'), {iII. i-
,/train until the party oled' by local school officials and mrnleri.of end and thert Shoots Wit. t .
ness section where greeting grew Into the board <>f trade. The tr/l/ that Admiral )
"a,. popular btatlon: H. was .ixtmpeltedto was tendered tbronith th. courtesy! ol th* Japan." n*..t and gain a victory; UU wlfi* as .bt' sat In her poi with ibm ptircfca. of otrmptaferRt.mAe. ". lii" .

{ I+ .lift; his bat often darUg. the drive,, the board of \radf The party will i which may in one; day change tbUre -n- In rliurcbj a...i threaTrMliiK the ulboirmbiprra << *. An ltidktm.nt. ""Mt, tirom. : ;

t "' '' as. bo neared Broadway he retPK U..., tomorrow for Tensacota, ,n.. i asi"frt or the war. All iW huge: ." by brmndlsbtaag'hr in"kIn "' rh. .r.. was 'u'.4 tptstMC :!'

!. M oored: hih bat end war kept. busy Low.. the; aDa'WlJ. custom for Indianapolis' It of llul. its ttow centrrd la thatDrrt. : ? rrvwlvt-r. I*. n. NottV ralkrd KU*. swine )adtr)4NAlaln, , IRd3, at.ttsblr'4. \11.:; )

. f.lall ."n4 IrU. --, 7 ... 'send ';pupils of 'Its fchnols" to mak'< and a toattU t*> ...." that tier of thv>> .biili'lluK and up lh. "tin. strr iof Clan. (be nantr uf ;klr. .iirrt0$: ,!.t f,\ '
k
.al'*: ,:'J"'tII"sl&1el&'\ arrived at ''Clio mp.a1FJfor'aitand a tour for educational purl'<"". ami the J*,Bfcu.-..' itn'tadroii i* k-,k.rd lh. turn, and OnsUy borIm*'li truh14..t'' | cf4 ntlt. .rrs, n_ ptsp t ,
l 10 o'clock. He waa 'l!I..- .. his bum, dyinn Nit tndkttnrat. dlltrs ttqm "k. bur'
:?r.';" ? ; ;; at -, } for soon. .. mile ,In for kltebeti of I' .
as trodttce* in a few worela' 'b1 GovernorgT. inwslIgati. lip hlclck. lnlantlyr, Tb.. woman will rrrorF. A''rr lady t In Jb. ..niitoiMrs. ul't"' ntmei.l"' :

set : :.;:' the. rfult .,f JAr,n*. .... \MTt :
the epeaker't'Wind -- 0 \
lite crowd 'around of Yoiiaie. suiwttfMj. tc; I nt 4rrwhdr. troubles.Mtnlstsr .
Bugrno .
parents April A &ll atd1 to a .
was limbed' to the non of butldlags' V at Wot SprinciArk. nilon. ..... -, .. --- ;" pr.i.t4f. l> ysebt Mylplt hl"prtIi i ;.
miU4 'IIIlt"tJf( UrilUb Ibdia
i cn\th various streets an-I atI lave 1I.eu. agency tram.abwr, CongrPrkla. Loaves. ... .te.". e*.'<.ti< 'iC op B(. Johns *iv.r 'mad .!* iVot
lni luy'wr .
started
.
an
a
;7 'mrtnOr "u1..rtIJIIILllktt .
i seemed. beyond the control ol i, says tka4" a Aprl) /--4ftrrntun->> '14.Ii P tied to Wt lJ' I ttc.llrtoly{ + uf, pbdotha
+ time
\' 4i thv police. oiuMJhh' of those in tlgatioa. altrglag that kit. th* tuung T1rliay manwss occurred there aecocopanl tit r.rbite'of +. It (.'410C"r, who has jue& vafMtrd Ih* : '* Thli .....(h..1.. 14,.'. :"tear4..rreit ; .. >
answered for money .. life and great da mat*" w /cab .
histemarkft. |I. mialsur' to China, tktler .. ;
hear and
conUl of Axoerictn n a.attr ;
'if- of the ptealdeiu prut ><< ;
t&ht < tu had b tw .r.-t
{: '. The. preaident spike less _"kb- f.'h her body ..Icbfcas. lie rath .frsl upon hU "pBSutmnC| as amt>n ts &
.. c. r.i 1'U.4 mad lh *
.. minute, and wa harlly.Woman's bstt, u al"< M*.lco. tft for AM.ric* l"*rlay elm> .SD.SC. tt.oup.mr .Wlmarontln ....p
. 'in l
: ,'ll1aa.J& arrived' h .*r*. 1'1. r srratchea:; on' Jam AlasJ .l, coo of .Ibaol finestfnonqueii mist
and Kow. n.pr**, 1statlr.n< ttt all Ille. ad4nlcm JlUtJf. t"1t.rit: i.. '
lisa
.. BiKlfr tkrigtkCjrjr to4sy In a
tnih
.c.. the cbin( and a h y In f4V, and" Mri Miayinjured. .
'''''' I forrtg a iir.tl')o. aaatmbl.d at tbr r.Uwat mart '."4 a ..t.u. .UPf'| r '
th In tbthoat. state stiarwmw
;, *. In addition to cat tiller big buidtpms) arrrack :
bid Aimarcwsll.. TlCklns Ia'fMrl..c{ 'rutwh /! ..
'lIl stalk to tnt-.04_ct of .eebuota .
rbo barn ezamitrd .
"k. Attorney In Cincinnati.Ctacinflatl. : 1'brslclene: : .-4 and B nrH Many Muv4 Iu (be. .flon .ime fluid *i7 ..
April 5.--Jiide:* franc!* .. I!.. body sab 4anUaU> 'tll411 rngrd.ibeor 1a''Jb.. nail** <|vanr. rvl>i>**4, ',I yroatb r"*
4' I It I ,
tresps.'snikJri
::f "f.t it Wing. i
..Cbsdwick. and mlIt4'C.l States Di irViAJu Hari ." T..r.'C. C.-..,. ,Co to Jill.Vlcbkat. ' Cs Pos
tr: \ n: fy SalUvoa anivnl hrre today S.crt tary :.:.j. j .!Ka... April t.-Carr't.' .- 1iciaratta. April *.--Th* ta>o of JMorgaa ",(bias ardor, n'* abet sad '
I.-*Kr.I.rt Hf 1 4 miwt"""wt bjr nob.rt arkr., :
appear bt-ture the United States O.aoa "April i.yiiiti; foots Hmhfa sad *11.'. *rr *t4a bars fatally ;
,
.p.t..tre"lt tt.1p e art t.pr-sttt to ."nt 'IItiottoo all whom saw bin today.<'.rb.r.ItN'.. a Un..4 lcyVTb). Myr a1ecb.1ae7.it, t*..arsK. trnd ..< W.I. M..... fn. ih. Xa* 1'att.rsuw ,ltld ewr.tl: nf ,iI. district to.M: ?!' ;-.

tr m stiy of sentence. wblcaLrs drwv* about the low lookedsaJ4 ....)lit .. trial for wrreDr. rA .sr feu"ir ... .,44.f'aH hr h'e+. 1' Iasi Trtl.rho '; ,
l wko arc .4iUA* '
r*.
uckritandI$1 *,, ..Maf'. .for W.e. i \
.
('- .at.lf'te b f . .aIA In pottf fnnrtUMtajr p..an'
.' 'e Chadwikk> are 'f't of WN..).MI. Wtiwf TeHk, harm- :>>
lag tier itadpo3t .
coMirt the #'uo4NimN'. Via fit a4> >med, otb War. 'tawat .. J'-.M..IU'1P"Yi"; y"Ysrrrag ,
tbr wsrf ease HUM s.
to aosL-a soon a* .. lrut
t ;'jai!J..rwsaxrd atiraia4ee. that ord.fr" Jodc mat s44 pi ltnproe.t' 1.j ,Ibe_... ,'.,. : w TihFrlt' *. IMMIS to lafl'l t saw)isy IBM la! orAf sa>sd.''lroi:'ta f aUrttfw rl..a*+ tbU |im. *. wallt Aprf1, th.. prt.<9onjavtut. .. \ ", .' \bt1..fHo. pt#iJ.it aera '!y.b. :\ 1 t

; (xradpy tbwrr' 'ibesrra1 s..paiuoaa oltt lr'd' pt.>'rMthn it .ur- w tara.tsbsd4)' Mrs, Ixnag r...1.f" ,... |. wait diet ""JooItof Aboo& tilt lIMt1k. ..... raT. --r.'f'au.

'I ., .I tIr'l"W.rr, : :.: ;;*ialted. *U4 al4tt rsra !lays trait .f.t r: { 4 dt ftOnrLn:* .fittar: +itttoaaj I '..lion. 4)fn..116." ryur (," .faM4'tbts.i tK* ea'aatisa' $054. .court oa Ibe ...J.It' tor .pnq pdKM<<; .. :' .'f, i, :.;.. :iL..,
sorlera .bra It' :
:' .btrt lkp'lsptrttk' to :! wrlu pt IkUnia. ud7 dJltI"" f
Out G.preevtlhetter paI 'Jill vorooa. '-'.\ \ ,.
.jpfrwt. It.M4 ..
.
.
) t : tar ," .r' i1
... few ._ t G. ... r 1YrJ .' ,,1 \ :\ \.
;:( : jffA 1'I"\ I '
... ,, r ""
.
I J .
1,1 iI
.'", , 't. 1ti, /! at ,of''' ( d7ill., ..
.
.. .,\ :,J;!; : ""
\ ?
f'I' ; i \ i
,' : l fS
.. : t"\"
--
J\"I' " : I!. -- ... ,, \1f..w. .,
I V"" = 'J IWl'r'\ vt..
"'"" f, "
: .\ \ .:,.... , "' : .J' ik. "< :: ; ; -.'i" . -
\ $ "
.
'I' .. ...,:.... Ll',' :+rl"' J . ., .' J"J ' ,'1- l''
,
I At' .," I "'''f \



----
.
-
:- : - ---- '\'


Ii GOOD ROADS WILL Begin aDd ""Tfl&Iaff">?ods Cure OsonmUIoa Begin TodaymmmmJ Today I Carload CATTLE of .r.ords HAVE for ARRIVED._Spring ))1' iLi' ++ i9,'1l1l"M'U"S.k: "' e


Farm Cam. }In Good TIm.. ( r
'
CONNECT GOOD TOWNS The earload of Hereford rrglstitr.dcattle VL'P 4kt GR1TESt. :

recently rar.ha.ed at Henrietta. The disease that has' done more :

Texas, by N. A. CaJImon, manager of than any other to week; tints and . EHEMY

Time Not Far When Gainesville _" Spring Park Farm Bonnlngton, notice humiliate life, is Contagions Blood J>>o ;- .' Itl ; shame andsuil'enng'gag\ .
,.. !
and Ocala May Visit.r' n..t 11j. J-fU Medicinal" "" "rw.rUuU Fol'Id l Jjropertti nf which baa already appeared in The hand in hand with this'great enemy, ,o son- always hated and fought:
It'n..II 'd
it as he has no-o ber'disease. It is the: fane (ul aU matters
.ir \ "r> Quickly KraUzed.In Sun arrived via the Seaboard Air Line Qf poisons''no r!
Mrli'K" L TRAVEL BY AUTOMOBILE Ch-.K" "{ ,ih'' Pale and Sallow Tue day night and \Vedneday were .<
In )'r(ir Strength tn the Weak to becomes poisoned and its chain of hoer! its toms begin to-show. Usually -
-- -- the F.'. "I"! ,.iri.i the I Invalid unloaded and driven to the farm, the first sign} is a small sore or ulce r all alarming in appearance

C Smith and..l. H. Spencer Arrived In 1'H'inf fr''m, f'dIJlu"tlnl:up the 8yntem( I>Jw"of ai
Wednesday, Having Made the Trip In <"li 'tinliiif' the Entire' 8vlllt'm. city. and throat begin.to ulcerate th.e hair ar tows drop out,, a red.eruption
Automobile From Ocala in a Little In I In Nir Kc; ''\11,11"'f>|'iug c; Out the tt'ornnut.the Thin PfakelI'm The consignment consisted of seventeen breaks out on the body copper-colore: p otches and sores maketheir:

by IN tot ,' iliren) . head' of Hot} cattle, all registered! appearanqf and the poison even work down into the bones and attacks; ,
More Than Four Hours. lb.In r>IliilVlin,'..l'/'- |toe" rink liP on nnrl lh white'tr T.ltll ri..Krnll'n h. ant! and wa one of the finest droves of eattie the nerves. Not only is, the disease l 1\ reditary, being'' transmitted from, r

r'K C. Smith and J. II. rfpenoer of I In 1".ttjflr| nnJ "
] Utmplcs that constitutions, etc.,. but is also so highly coNtag"ious that J life
'' Oeala are In th. city. The former :in a 1I..ar. ttlsd. as a whole was viewed by many cattle : .many_ a has
OZOMCLHIOJf1m been ruined by a friendly hand shake dv
or frVn sing the totletarticlesof
member of the Oelll l* Furniture: C'mi- an X"tl 4 JJ.C\JI.r. to Cold ran Wet. one poison. To care this hughting", deadly. i fcurse the?;
Mr. of
paDI. and is .uciatt"d with Spencer flock was the center of a To prove ,It* Medicinal Food Merita a. must be purified, and nothing will do it so-
( _; under the firm name of Smith A all who saw !It, quickly and *S. S S. It down 'the
> Trial' Dottle Free by Mall surely a goes to ,
Sneoeer, dealer* (In automobile. and Will t," sent fin rcw.u""t.Vr'.e' by letter Manager Callison states that' the I S S ,S very bottom of the trouble, drives out every particle *,
gas and ft.ioline ..nKln.... 'r''J' cam or postal 1 *'r
from Ocala on one of their Hide} touring OZlmulslo co..98 Pine St.,New York. I buying cattle for the present, as they It does not-hide or cover'anything, but from the t '
r1 cart, making the lima' from Oc.la All I>ru* l't-Two .Iuo: -50c. and HOO. now hue onf'! jf the best stocked farms first begins to expel the poison and build! up and strengthen the system* 'rk..

ev. to Micnnopy, partly over a sandy road, i .. -. ':" ---'-- ------ ---- not only in the Slate but in the entire S. S. S. is guaranteed purely vegetable We offer a reward of $1.000 Jor:
in a few moment over three hour. Southeast. proof that it contains a particle of mineral of any kind. Book.on the disease -..

I be time from Mioanopy( to (UfixtTllle MONTHLY MEETING Photographer Smith secured an excellent char, -with instructions for home treatment, and any advice desired, without, ,
e-
by way of Tacoma, Wacahuotaand photograph of the car which THE SWIFT SPECIFICCO,ATLANTA GA.

'r time.Arredondo, was mule In good: BOARD OF TRADE will be used for advertising- purpose ,

Cheated Death.
The machine i I' fourteen hor..*> --- r ,ahn

power, and I I. one of th. best manufactured Largely Attended and Interesting Kidney trouble often ends fatally,
1 but by choosing the right medicine E, W
deal of interest
It created great -
l among the curious here. Session of That 3ody. : II. Wolfe. of Bear irove, Iowa cheated .
fi
;3 18I1r.. Smith and Hpencrr! haw ---- death He say si "Two years ago I The East Florida Seminary

,i acme for the purpose of introducing WANT TO ADVERTISE CITY had kidney' trouble, which caused me. ,

I IM ISfr their machine and will remain herd ------ l great pain, suffering: and anxiety, butI ...
Committ. Was Appointed Confer took Electric Bitters, which effecteda TOSAL: : {
4 for two or three day*. They expect to tp ,t''.'
make an inspection of the newly contruoted With Pro Clarenc.8. Strouja In Matter complete cure. I have also found r .

a roads In thin vicinity twday of Adv rti;.inn;-Board Pleated at them of great benefit in generaLde .

*'I note with a great deal of interest bility and nerve trouble, and keep The Normal 'Glass ..
Actloo% of Citiren : Opens March 13
'4 that Alachua county people hare the them constantly on hand, since, As I :
Rood road fever," remarked Mr. The rra4lsr monthly meeting of the trod UUJ.have no equal." All druggists for .
.Continuing Eight Weeks.This
HraltK. "Il'. the belt thing In the ()aine vil| Hoard of Trade wa held at guarantee them at ro,. .. .

world for the advancement af a ...community the Hoard! uf'frad1 room, City Hall,
y at ha been demonstrated Infarlun. Wdnt""II"fll'rnonrl nt 3 o'clock, a Among the prominent visitors to is the Teachers' Normal Institute for Alaohua county and (fa ,
endorsed by the State Superintendent of the Normals 4
as under'
one
) I hope the tlm will come Kivxi crcvn< ) bring Credent. this city yesterday wan I''. A. Schuetzof his control. Lady teachers can be boarded fa the Young Ladies' t

IM Rod I believe It will, and not very far Them.. fiM u K'eHt sire of important Duluth, Minn., who has been spending Dormitory! and board can also be procured at reduced rates In The. ;
k dl.aa"t-"hln Ocala and Uainevlll buiinxmi "ftitiilntt befont the board at the past four months at Mannville\ city* !' : >,
t will be morn cWely bound *. neighbor thin rorrling.) AmotiK other thing dm Putnam county as the guest of his The classes in the Seminary: both in the Literary and Business : :

when our fins. J* and Jaineville cu..ed Mae |Ih" proposed vxtvniun of friend, ( ..org8 Berkelmann. Col. beides Departments the regular, will be Normal open to work.those desiring to enter at any time, .} '

't': friend may rlt! ejr II other freipient the, charter the city uf Ualneivlllr', Schuetz: is also a friend of Captain Antonio For further information address the Superintendent :f

X I ly. When the. roars pr- 'In proper con- which wjiil'| Rive to 'the city more innnlcipal Paul, special agent of the United yl'' : .

.. ditlcu\Jt will lit''! ah .*.., matter for ,CIJWVT" a* well a* extend the States general land office. lie, has JERE M..POU.N'D I" '
,
your pvopUjo\ break fait at. home, r.at limit to. point which, would greatly been for more than twentyyeara deputy ;;

dinner with t yir' Ocala (friend( ."p.-ndII lnrrea.. HIM popiilttlon of tins city. county auditor in his Stste, and GAINESVILLE. TLA.

pleasant defend return In plenty of The! l onfj tiinmended the action of stands hlK'i socially and politically.' ,. ',t'

time' for supper.. This U !wand to be the citlz n* In rarer mectltig TuendayMVenliVK He came to Florida for his health, and >
1
accomplUhr by an automobile trip *tiJ U wa tlu nature uf th.. 'ha. been greatly, benefited, and I i. well

over properly constructed rosdu and me.-tint( that evury enoouraKrint-nl pleased with the Slate and Its People -- -

It will nut b< many year befor, you and IrillUfhCr* bo exercUed toward the! He ezpect to remain with &l r. IterkelrnHtin -

p will see It," _. I..J. fIt' tb rneanr"iThn until about May[ 1. THE EVERETT HOTEL
---
-- -
rnNHt-r of advertising( : the city

Ballard't Horahound SyrupImmf'CJI.t..lr thrm.whhl"; lUlile Conference Christian How to Go to California.' 235. W. St.
Bay 'FLOJU
relieve hoarse, croMpycotiRh 11'orKrN', Institute and Chautau- ( JACKSONVILLE A..
r cjpjir.i.ed, rattling, ravplngand qua Willi \brcMiuhl" up. and after tome Travel via the Chicago, Uuion Pa

difHcult brealliliiK./: Henry O. dteante di"ui, sii'>ii committee comprising' \\'. 'cific A North-\Vetern Lin J. Two fait .Centrally !located, thoroughly repaired and renovated.. lowly furnished. v

,; I>rutRl lt't, HhulJ.b,,,,,, Wl.. write.. May M. 1''rl'| "r, ilea \V Hyde and II .'. 'through; trains rash day The Overland European Flan. -. }

10,1901 i I "I hive b_n selling Hal. Jordan *... appointed to confer with hlmitpdrlratriCllRhtedICauthan<

lard' llorrhoiind :'jrrup for two year, 11',. filar"ncv 11. tUroute in the matter three' day en route The California :8_ 1.t.SOI ., Pro-prLetnr

tad] have never had. a preparation, that Th.. ctiiiitUi met Dr. rurousa late In. KxpreM: through( service to San Fran

ha given hettnr.rtl.tactlntn. I notice( thl' fli-ruoon. and a tpveial matingof tigers, Loa Angeles and Portland The ---- - -- --

that when I ,..II.|| bottle they Annie the IU>..r<4 of Truth will be held this 'brut of everything. Full particulars A' _- .

back for mort 1 ran hoitectlv. rwpnm.rn sltrrnuuh., , which the oomniittfM will 'on application to W.'t B. Knlikem: I'. T. r-
t r>> *\ $1 in Sold by \\'. mukw it* rvitirt.The ( M.. C .\ S. \V U,., Chicago.
M JnhntonJ
i-unmiiUre sii ti"I: that the Fay-Sholes

IIII.ill..* ,tarn, ard. uth r* ".inK prlntnltaiionary 1 I Itld pHper here cheap
J. Flnloy Chapter.The .
(permit tlu* alii|< of -
Kiilar bii.lne.. mceiittJ ( ( uf the he flin,<*li<>f>* In be placrd upon the HEALTH IS YOUTH.

J .'hI.., Chanter' t/. it). ('. will' ,beheld Knif, N 'lirla wilt nut detract front the

Thursday afieriKwm, at :a I u''lne'k Ie.p.tIltPIrwin.halt l will pro a Diseases and Sickness Bring Old Age, Typewriter f,
at the residence of MM J I It 1I,1t.1l1.l Kri-nt -it"t>t it, nJvcrtiniiitf lialne.vlllt

MKV It '''I.H. 1'r..idrnt and ilvf I'ltili', 1/Diifrrrnce. and ChanIII Herbine. taken every morning before I ACKNOWLEDGED I ti
MM J I,. 1I1lIlV. }fee rte. t'*'lilI"(I \ breakfast: will keep you in robust
, ht'Mhh-rh you to.ward off disease.. It THE BEST.MACHINE

One Mlt.,1. cure roniipation. biliousness. ly.- OX 1IIE MAUKETI :
POLITICAL ANNOUNCtMENTS. $4.hf :M lntt,. )U'nil 1 oust ire icy I r>vp.U: fever kin, liver and kidney

rpuste HI i\f( tluj: ""i imu-h 1'nhllthl. complaint, It purifies the blood and Has Tabulator

Fur Mr,>ialTo '. turnM! **\.\ lAtiauHCiI'oUree: sin clear the complexion' : Mr*. JI. \\.. UnlYrRSAl[ nnDOARD[ I ONEvery
/' iljrnt Softiier' inn I Khan Wllklrn >.. !!"lIlh'hhnl')'. Tex., writes April 3, Machine.
th. \1' 'l.'Mf....11". 1"I have
used Morbiiie
ti I bur*">y annavnrr sly...if .. s era,_ IKMII t 'H-'si> vorb( n it-til In theY\1 li the best mrdictne fur constipation
didat fur r..vlseudn \\1 tea 011I. .>f rrrw and I'ver troutile It doe all you Lightest Shift U h'elRunning! The e +*
r4. utar.uai.xbirt to ter\ % 'f.. >nthe .f f tUeroutine claim fur it I highly' recommend (I."
cUlien( uf U.III."II,. m 'Ihe. Ilrhhli'r. .....,t. ,"0 Ot "buul" Sold bf \\*, !M. Johnon Champion 8p.ed.Wrhen of the World
mutiii|>sl lr-tilcfi, I late ,. Use th Fiy-9hole More )
(in their liaotl II 1 hate. durhrr/r.fur "1 ltr\i.til"f flours J IM ,L'U think hit nttt 1 irlr flp..nit", < Fav.ghole in .:

my duty a* marshal' I ti. i>wb n rntihifn ftNitf liriiiMc-" 11s* rinn' I ..iwntiuf! \ tnlon \:i intprt'... use In Uinesvllle than any other machine. ,
their ihtlulgvti and Ih.'t01.... lit fulure J mr* Ili\ .1>T'_MI N. If site fort nb tlrnt .- nt th.' rt'I"f'I't\llI.| didn't! I"I Frr'e1: --....
If they \u nut think I l hate d li..- >lilt iiu HIlihM mi to It an' lie ai.. t."t. I>. ......\II.>'1 to t''> tiilkltis .neon" me
r eharRed, my duly, then It r.-." Nits I lunn+( lill' Tat nn' tn.t"r.l I sort Ito.la'nlr. "niuliit' friend Thor tulkul''' ntlU mono For Sale by. . .
them I will N|>prr'iali' < Inppurt' \bun Ilk i '-'II'r, Journal .
*r''r, and'runti.e. I RtlllIt y 111 NrI1M foal had, K-'II"!
t a* bug in the offioe -
to *'lio" |,. In IM one liertlality .IV>t'M>iK Him tn sltt. i. i i iMr __ THE SON GainesYille Fla.
'pgClfully. OuTo 1'1'1t", ., I| -c. ,
it Sli, k JI-IUHIV. (Uui't tier 'M intrtik WIfe founTh., '
I out something tiMlny
trey > utI that watt mmur t \ : I won't that t
promUint never to tell. lhuai
have plaint ('I">,| |In th'N Uoiiw Johnny I i iHut. -- .
8M-W.I\ ahead -- - '- -
Fur NI.r''AI.! gn ; I'm lUtenlng ---- -
I'K. I \tr titari.'' 'm. It out '' r._-__. ._ '_ -_-:,. ....::: '" -
the' Vut.r' of aiaivir.rillp, or I I'll liAiK, ) v m one' SovP It"....",..",. : 7*.. if. Oa..... President II. .:. TATIOB, Cashier
I h. 1lalrarur A free bottle of r lrr. Tbacher's Liver anti
rbj .un""""'* mj.vlf >. ern 0.0.V.. HY )_. VI.w-Pr+idnt$ Las ha&uax Aut.
Cashier
1 didst' for the attire! ; ur ni rh"l. sub\ Btnutl $yupwillbnl to any reader of
4'1... 1MI' to the .rlu>n uf ih. vuitir .>1 .. .. .t: "I....... IhU {'-P" *. ho will write t... the Th. chrtcdiciae
O.hl.IU. .t ih. eoittinir nun1cl.al| I.. srt 1',1,* h"'I'.ll'. 'lilt Ia > Co., Chattanooga'seno THE FIRST NATIONAL
: .1.1>11. halt shtays. t." a 1."al l e"or: "Neal, < ... ''Mntlwont* BANK
hs 1".l1uo.t. '
sitatwrsrerIytorrudr I I, r "::0\11. /hill'n'N t hI" tf talk aboutMntai :

4 s my rich'aid and, and ju'lU iuf1u>i>. and."i-It" el in'....'UN'on,...1 pram ot. Lot r.'plar.l, )tit '>rt>|i "If. what a FIVE MILLION BRICK oir' Q-A i N jbua v.JLLE. t
*>.h a 'lu h hr iiu S!
9 4.t> a fair and hutlut "-t'n e. .llIdI s ''fSHtl I from hr r *
f.ar ur favor. H"'f II, lua.lulnl. 1 t.x 1 ti II'K,. THE ONLY NATIONAL BANK IN
,J, .- l\ burrs ?'. I now have the, n".tJ tr..t build ALACHUA CO
'via brick otadea, ljoriti t wire( at my
-- '--- rh4 l' ) .Lp.n.e fur !awes' each price deliver Capital. .9. . oooo . . .oo. . . . $50,000 00
%'if >>jn for only |\ .per, year .d "t any point In Florida. K N.
For
Marshal, JKLKS: Xacoa, tJa. Surplus and Undivided Profits. w'D.M
30,000
1 fc. ,l h oooo oo
r j aai>oau tnjMirdat .a "Ill.t.( -
for the oltiro of "hh.1 l "I It t- -- .. -. - ------..-. tat111Mt tT -.ktIIIc......."..1IttQ rMGaa..a so oaf Mall ta *
Oily of iiainvvvtlU, arid iKiUcit ibe '.i.' tae a sa.We4 ..__ N.... *"-- .... ea..ae.tM ataM rl.neda +
SUrKnl *$ na .u.t t ..-. Nt r
putt wf all the voter of ..i4 cit j at > r '"'rUIR. The doc i 4
ptHBloc loti n* of .il| ufQcvr ton' Sl+rs arUia. The H.E.TAYLOR 0MIa.tu. ,
tested and
If et..t4. I promise tu Kt*... Cn a11t. triad ,, _.._
StrsaparUIa.
e The -- -- - --- --- -----
pwpt. a tIRrrutu and ttuL.ft.rti, II rs SarsapaHlla '- --- --
esuetesof Its. d I.... g that'
1&t t'.tlaiote, "makes rich, red blood;
that otto, |VU'|_irullyk I
, _,' r ",KI'IH.l' 4. It.Cnsvlsv1t tirengthens the nerves;' build Advertise in THE SUNv
Up the Whole tvxtem.! j oa..

-- -


I ,
.r

kt l
t1.WAAVy". r t r n
e'4. J1' y I }1 rn



K ')

*f. "


N + ::. yt, )<. SHE DAILY SUN GAINESVILLE, FLORIDA APBIL 6,,*190.. i \ ,

,. -
A DELIGHTFUL' NEWS TERSELY TOt.O.Favler. .
OCCASION.. MONEY WASTED? a, r J
' i ** W 1 .
W. C. T;' U. and Friends EntertainedAt I I Ui.lhoJ: of the s'st! tal :,::;.,::" ::;":-':: ''';, : :": ', ":" '.. .: '";:' .' .. .; .. . :- " '. .., i,

the Home of Mrs. Turner.! HEALTH GONE? | sloop died }n PsMn toUa. He ha. .
I rrslUed In China for J(% j t-s. ---
The -
W. C. T. U, of r t
Gainesville i.IL i i. ": if. 3 t ''t'L4
(V.ui" bin
tooted for doing things. The latest - Tie'*report that the pc tau ears

watt reception giv i fn by Mr..,TarDrr Aftr Doctors Have AcknowledgedTheir tiom-d! the mHrrlaso ot .- Kin.; !? ii

z mt her home in North Gainesville[ to : Failure. W. Say G, F. P. i Spain: wih Princca Pair .:1, cf Cut

the members of the union and invitedgaesta. ,: Will Positively' Cure-Your ]J naugbt J is unfounded.

c About fifty were pre_$u&. Money Back if It Doesn't. f Six hundred: union paN! TS c.nl: paper '' For Infants land Ohildr+rt".

:Her large parlor was beautifully dee-i, hanger, tmck> In (voland. O. I \ ". ,'< /!f'C'A'
c orated with ferns.The It' a pretty hard matter in these today because their enH'1ll'n ref uaat : '
palms, .flowers and I s1qi The Kind You Haver
.
moat conspicuous was a picture of day believe to thai make there M ick i*, O'rally.pllrllllCw..rn.! me rvuitnly to advance their wages*. : .
d \
... Willard on a background of which will positively uure thi.i, die. Dr. Richard NelnVfl. professor olphllulosq ,I ,

'white; with a large: bow of whit rib. eases and wvaknessen p-cuMsr t.> the at the ,V"l\nna: university' ::i.:_' ffi.., . '.'" ,.., . Always Bought t
,; bon above, while over all were her last sex. !She: ba proOitbly "doctored" until has committed suicide there! by shootIKR. pclable1'reparaiiottforAs.
f" word, "How beautiful it it the pure and patience are both .x- / The piofossor's ll;ton Is attrlo- d
to be with
slmllating OwFoodandRcfiulnting
.. hall.ted-bat tried first une'rrpuedremedy '. : ,
UOIJ.Around.u all were palm ]t'ayes. after another-but always with tired to III beslth..V. the sltmoltndl3arite 1s of Bears theSignature

liThe decoration in the dining room the same re.ult-failure.-
were.of rose and old fashioned redpinks are one of these, we address you insympathetic the SliefflrlJ rolUng inllKt have broken ) .*vtMi: it*WKHrroinotcs 3 t

by, hundred. Delicate wafer G F. P (G confidence.riil.,', Female, Panacea I all rrcnnla la the Unltm! Stute by ----,1 m

,. ( and 'fruice" were served. i U no new, untried' prttpl"." "'". II I !h.. j+i making: S5.900: pounds of iron from ,

Aa this was all a memorial to Mis : Stood the teat of j ur. Mud had cured I I two' ('o:at furnaces., nessand,' \.Contains' nelilrr , ft

; Willard, an appropriate program of thouiiaods.. Iocaiof pr< laput (t.II.1 i I A general; htrlke of yuioti carriage ) .Morphine norXiitr *U. ofss
fog of the womb). Irregular
maalo, 'papers, and addresses were suppressed periods,' ovarian truuble or, ,r' and a.ijon' ball tern ag'alnn member 1't.OT'N.UtC OTIC. !M l

Ij,?. Riven consisting of a sketch of her life etc. I it has no equal You don't have of the \*arraK<' and Wajioa ManufacInreis' ......-...

1 by.Mr: *. Hauey ; a paper, "Oaf Uncrowned to tike our-word for it. either-get H asj.c5fHion, of Chicavo. U on, ItieyraLd....Sd/Itt.UIY1Q ,
t.; Queen by Air*. Fated ; ap ona-dullar bottle from your druggist lure than: 1C: <> plants! are atfcrttsl..M .
use it carefully a* directed, then if
J recitation: "The White Ribbon"
by you can conscientiously say you have the Hub.A e5.dat.s.IIr 4ai,
2", Mr\ Turner ; account of the unveiling not been benefited take the empty ..:., vd tl I IISa
lu U..
New Y 1'k.11'4 vUldng
t of the Willard statue by Mrs. oig, bottle back to the man who void it to .. ,. J. m
and he will instantly refund ton t'f..in! : ti pnrrot in a t'UKh" b Ou4
i' sand a beautiful.address by Mice E. M. you your .k",1
7' dollar. : : rxww.* > >
Larzalere of Philadelphia. A free If your druggist cannot. supply( you ..!.<..<. fully want n rrn KerV jNiiK w VTB iM* Use Y
will offering was given for her memorial send DA one dollar direct and we will .'f rotjulre no "u"tcnan.e from you
r, land.r : send you a bottle expre prepaid. If whatever" ivpllnl the 1"I"k flay bird Apo-frtl Hcmniy for(\mslifw .
Ion Sour Siomach.UiRrrtv.I'l\)
you feel that your case presents' any with hauteur.-1'unkri''a 1 Stntrsuaan.el '' .
peculiar features and that you need Woriiw.ConvuKan: w,Ko: wrish. ,

Board of Public Instruction. advice, write to the Ladies' tiealtd .\ 'hlf' ...... fleasi111dLUSyUFSLLEI! !: '. For overFacSimilu Wj
At Club care of the Gentle Medicine Co., .
a meeting of the Board of Public "HuL" hissed tli*> ht'II11I'Iu.' MupKMe oil
Instroetioaheld Chattanooga, Tenn., and your letter Si Culture' of
Monday, an order was will be antwered and the advice | our plot HluiuM' JIIklut'
very beat -
made by the board requiring all bills freely given by experienced and ..It.. at> thin Its likely I..." Hlinuttxt' a <2 *#S22lXKW Thirty Years

against the board and for school purpose sympathetic women. limn In the aiiillenco. "but then tlJ ru'li VOIllv '
'; to be presented the day before *o little of It )'uu'd hardly iut.. 11.l'hlllll1.lpbla ."-
4 _ _ _ _
the, regular meeting of the board, Court.- l'rcii9.i .
In Mayor's I "
which I I. held] the flat Tueeday in each .- ... .
' Joe Floyd was arraigned: in the municipal : 'ou Will And poetry' nowhere nnis
month. This means that bills mast be CASTO RIA _
you bring swine with you.' -Joubert.
court yesterday the 1
in the hands of upon
''i/ f Superintendent Kelley I EXACT COPY or WRAPPER
charge of fighting. and was lined $10
:
Monday such
f. .on preceding regular There Mrlliod. at U.rl.I...
:/ .: m eUng.. Dr, Kelloy: also request and costsThe charge was preferred There ere \ -r.v few ulluiiluiit" to ... ..---....maw v... SW, r

''! i The Sun to state that the accnmulatloaof by William Archer, who stated that ntcrUn In Latin fUithml. l hilt one of . . ...., .' : ': ', . . . . .. . .
}?1 .- warrants is very annoying and'incoave4lent Floyd started the row He stated that the?<..> 1 I" laloroKtlntf. *r:..<> 1lnl.1t1"<* ururimiH t 1.,

: and he would be glad to he went In to buy some chicken, that 'Hc-hlm of "III'\S"\IIJZ[ \ their' billy %. .

;' have' ..person\ to whom warrants are the attendant reported that the chicken ma k I lit; iulte. u IIhnrt'| .."I.I ...'. Vonni. . .. .--.... I
i 'made and receive had all been sold, that Floyd used and quit MriN. both during nn payable to apply
; the abusive. language/ :andjumped on to liar brotvllntz re.r..nu. 'im' .tniitly I ilit thl". G.' S. MERCHANT & GO. 1:
same a* soon after meeting as pos .
him. which resulted In a row. Hoi- In the wrltl iff< .of IVrHiu. 4 tli. *r< U ureferMif
Bible.'h 1.
,, "' :,
;W:
+, Among other business, the board, by ley William., accused of being mixed a ti UiN linlut. ''here are Retailers and Jobbers InStaple ,,1IjI f>I'.II1 tl
t he says" "tltree tllvorlt.11\ of derl.lloaf -
', requisition of the Gainesville sub- up in the same row, was dCharged, the I bandit I.! ..
u tutiii -"y iiutliiitf -
school district paid $2,000 Indebted. I.. there Kits no evidence sg-ifnii him. nldo the l head like "..*.>..' curs l I.J' put- and Fancy ;:

. '.i 'net of the' district. Thai money was I I tinf Kilt I the tUiiKde tike n doa land Groceri.rIt),ji ,,

.the property of the sub-ichool district. i ..n'II'I.III'l : 11 u? Ihl :I''''' uiniliiKt the inlinot _

tr but it.. disbursement i.I left .w-ILh. fl.aehool CASTOR IAFor (li.i litui'i tike. a lit.II''''. hill," la'Ai.t I Grain, Garden Seed and Fertilizer ; 'I' .,{
I board. I ten ttiotbn.1 nf uicx kcry urn plain, 1p ,9 M

-.. .- ------- Infkat and Children. I.utJun \rn I the ftiuix' of the lint?. 9OUTII HIDE HQI7AUK. I (JAIN" HVIJ.I.IC. FLORIDA": 1l\\ .

The Jacksonville schools] are having :Note uiitl lJuerie..+. Highest market price paid for Chickens.. Eggs': and other Pn The Kind Yea Kara
l Always BoagbtThe ;
trouble of their own. Oae of the I _' __ ... ; t
The ...1.e'. i.u.. 1- .,r ,
I :;s r
teaeher has resigned and the .
board
w the8lguAture The Mnnkes 11.)111:1'+ '"* |>rovn .to t>r afeitiiirkotile ''A Complete stook I .
wants her to remain except, perbai *, of taunt irK'in." A xtiulcntrlmlH and B.. Will handle only the VERY 1IENT flood at the LOW. ': '\.

one member. Its fllil'f fuillH( l lwllli I.. ......110..1 E8T' PRV).$. and guarantee setlsfaetlon always, ,,Y'' 'if ;

t H ..l\tIt. of f<>,*llfiic without touch -- --- .- ....". _..- > ',
1t' ,...... The TwtceWeek( S in ha a circu- and mitT W n 'llm-r .lt>\<'lo! |>incit of the "Ji., '!
wcnue 'hlt! t'..,.ft 1,1.l -, niiie I.Nplel., II"'01.1 1,1'
Venn l II both n and (
morning evening lation in Ala] -hu% that should
county
tar bran"e die always aceotiq nubs attract the attention of advertisers.It . ( ;: il>4tlea lii t the ilnrk.. TheC.rk..J FIRE. LIFE AND B. F. J 0 R DA N ';;i
the sun. never receding from him beyond tip 11I1.1 l the niinter U 4 fulls l I.ehlnil ?' f F
has twice, circulation of all the .
certain limit, while the rewt of It greatly liwreii'"" tit urfmt' eti ACCIDENT IN .
too 1""Df"t't'ltb the exception of Mercury other papers in the county, and a I'UKII. The relln of tlix r"I'rrlll'' are ; ;

are seen at nil possible' angularihtsiMfft & glance at our list and the price for IlIt..rlll..1. by n 'network of ...Ir".11| 'fBB.OLDBS iNSURANCE ,

( from the sun WhenYuu. advertising will continue' any businessman fine nerve rilwr*. a lulu-li ftipr. In a AND BEST COM r

i* f: the \v,.nt of the aim oho rUr>4 before that it lit l the best medium fur dee)i nerve 1"1'a n. lx-iif.lh the ...pIJ.ryIsla |

him nod I 111I n morning star hut your favor. and extemlluit/ nut Into Un folds. PANIE8 411'J f
.
.
when nil" 1 In f the .. -
) east of the nun hafter ,.
4 ... ... ... ... .. .. .. .. ... .
-1. rl.e'' him and l I" an evening tnr. -- ------- ---- --- ----- ----- --- -
I I POHTCR: BLOCK GAINESVILLE' r
CL YDE LINE .
About Rheumatism ,
............. ,. .. =-"' ,: i ,_ __ __
; There are few disease that inflict .r>*

7 more torture than rheumatism and
SE.A.3 a .A.E: D
there I I. probably no disease for which ,

ash a varied and useless lot of r roa

dies have ben nggeted. To say that \. Air Line Railway

a it ean be cored i*. therefore, a bold

; statement &Q Make, but Chamberlain's # . . I"" O it. . ,

::1 Pain Balm, which enjoys an .extensive
Savannah Columbia Camden Southern
x sat,', has met with great success in the !,

,reatfet of this' disease. One appli
Pines Raleigh Richmond Wash-
p atloa of Pain Balm, will relieve. the TIC-"GO''ii B3 ..Y-''B.A.I2aXNO.8 ,
.pith', and hundred of sufferers have BCTWCKJfJacUsonvllle
Baltimore Phila-
.; testified to permanent core by I lie use and New York ington, ,

'r... Why suffer when Pain Halm affords Calling at CllARLEHTON. 8. 0., both way. delphia New York '

it: each quick relief and costs bat a trifle? 'The Flint Steamship J In the Coastwise Service ,

For sale by all druggins. v Clyde New England and Southern LinedDlr -....- -...--_ --.r -

1".i(' Service Between JACKSONVILLE. BOSTON and Tlm-e Elegant Train Daily.
..,..... ,
M4 FKUVIDEMCE and Ail Eastern Point,
"; **5Vb.t are' roll "t"f 1 h.=:. trawl I.., ?!" Calling Charleston both ...1"SJr.JVlT .
**A .t.f. I'm sroln* In f.w M'tLm"
S
'r : : VV .m T..Y' A.TTJNGA Seaboard Florida Limited
"Meshy: For a rnsirnTlMrr
:t **Ne to tailor lie '......nt. hi* South U>and. . . ...... . .. .. . ,. Kroai Lewie. Wharf Ilaaoe "
".4_ ? tnr Korthboaod...... ... .... From Foot nt Catherine si., JaeaaoevllteClyde
j* meoey, ai..l 1'11.tunA' him I'll eetwl Seaboard

'him a eberk iwitSOFTNE8& ,,'_k'." St. Johns River Line Express% / ,

a.t..e.n J AckuONVIL" and ?8.1'0"
> OF SEALSKIN. Stopping Palatka, Astor, Bt Fra.oeltl. Bereeford |D.LajMii>d Ialer.* .1" LaadinCtt oa tit. Johoi fiver ,

', ... ........ Ioy !!_.. Hair W.... ,. CotnineDelaa Tuesday, November Ifi.SlMffitrs 181$ .. *

l f' ...... to Kr.4hrattf.atokla "CITI OF JACISOIYILLr lJ "FBED1 DeBBIBf''

!t: .. t* admired th. world over tot are appointed 10 sail a* follow Leave Jeksoevitle. daily eieept Ht0rdaye at MODERN PULLMAN
lt" some*. and gt.sdne.s; amt yet tbet 30SJ p. m. Ketumtaf.. leave* t .ford dally exewpt tturiday* at 9i9it. m. EQUIPMENTTbMKAIS04KD
teamisa batr quHr "wben' bassi'. and UM radtml eeva* .f *Hi =. 4....... .p. I'UmilU IJ311TED.le a solid vestiltKtled train, ,eoovpoeenl
r.bh troabt. .. daadrwfr w1lt.eb b co.... 1.10.,......... ..Jaeksoovllie.PalatLa. . . . . . "' "b.2I1lQao ...Itteivelf' o< new Pullmaa .qalpaieni-Diaing Car DoubUi V"'ac.
.
$sib _. .. . . . . . . ..... . ,Lav a*0
L'y a peNlferoue parulld that .ape eM pa pea Uoutn tfl l,.,.r.. Hi ate room .1Id Observation Oartcperatlag ....... ttttl < Aw
vttalttr ef tbe fair a"SU FOQt. ...twd.i Ifs . .. . .. . Astor . .. . I Wi pet ... .* sad Jaskirmelll.o Xew York via Washington; leaving' 31. A.Qo1II"+ .
;Kn4el4 le the only pepe.raton thus Ia :10...... . . . . .. .. ,ft. Frn ie. . . . . ::raCOpew :1110: p m. and Jfc *...vHI* J r9Ud.ily .U.pl tlIIDda,.. t
. . . . . .. .. .
.tt/1 to ta. daadveti.ern. Wtfll4tG1 dam.zrtvw .n.'ord (DwLaad) t oil p. --- -- - -
: !!( UIofte,M ran t.an1a4r ball'. but a ,ni..aat Arrive mo: am. Baaf.nfIQiOQ . , . ... . . . . I:aJ sr Lino ,
''I.} arewtb of ....-,.. .n haft Is e.r'- _._am. _. '_ _. ..._. ..... .__5J".*Pr*.!*__'.. ... .'. . .c.. __MUD_:_asfiBltLRAL Only Operating

'"w\i.:: '.
h f"ads iet. ...... ewe !halt ......1..1 eoattIIr :bL 1 1OLOlPOmt.. lL.Asa,GK r- ..... m w. RMrk.IW--.raa.. .
}',.e,1ma .. 5_...... fard4. DsW H 11', 0.Ctt0Ylcxt. I...bs...... .. Col".WYJaJ,..,..... .......
,.'i/ #....,................,....... For earl lafomatUm add sleeper reervatto rail 09 a A ,Ie! BUbollyd ,! r
h-J"a esw4! ,
dwgrle1I. xa m etsa-
; "a..xwa.. .,r.. x.- uAOa.
L -IgtL tLrwaaxlj..t .. "-
!' \ writ A, O. fcUeDOWKLL. *, Or BO U Jas
'k "' Wn.. J1 c. JiII'- TfE4.U.tblawl ,
,., ,.. .r rpldde ? P.txelty ".M. y, J.TU CO.. j ,
.' .' brit., aa.rst Paaa A&.al
ng.r l
'" \ ., 1laaR.e., . o..raa
a Agnate. '
L. L .a.;% : 1.&'c..:.. rw, ;*ie .,..........,. its-':-4s 1Sea1 .......... Yef'a JACJ OKY1LLE? TX ''Ar r jft ;
; 'iff! ', {'.""'" ..."! !,>.::1: 1I'! '.,./"< .... . -i .
1f Nv. ,\:1t.: :: , >>, "I' .,. < \w\ .,. ' J
", : , !1\\1.. ftL.: 'o\\\.\); '. _. ,,,,"'1"-,1))' i'' . ::1; I. ;' ''; ' .!'$. .". '1[. ."N."k., .J,
i'J .
.Jj,, -,'. ,': j '. !i; I I 'T'
(" .' ,, : .: i+
... IIi! .



i ,A h M +Ilir i r'I t 't 'l ltrkt + ,u a 1r

,-


1 N ..
l


THE DAILY SUN: GAINESVILLE, FLORIDA, APRIL (>. 1905 '- Jite .

___
------ u
: OOD'RD: f == -- .- j .:' ',:.t,):'::1J1t;
Fisk Firm Ii* Kncrtand. .
h - I 1.-1:
AS OTHERS SEE US. In mf'Cli4eTIJI! England nh II.-swere>I .

GOHHECT@hgOAII.V- gun % very favorite t1l8h at Chrfitinas tim, -4, \'

The following i is taken from the It't.t..r and lamprey pica three n-Kardwl ter'" ....' t .

.- ----- of J. H. Rodeheafer to The WW 'peUl !luxury.: Tbe vont! of, uJ ue:1f: (..

safely si she POd C+sse. tit GalDen1l1e.I'I",' Virginia Argti, |published at Bin*. fuct wa* very 4.1101. Ju, 1314 c.e 4jI'

e Not Far M*. ond-..*. au matter. wood, \V. Va. Mr. Bodeheaver. spent .L;(''rlff ot Clouceh.cr: provided tortyfji.r TI
flll STUUT
and Oca1r the pert winter In Gainearlllft and Orlando ; fir! UUo rt-yal J tab! !<> i;t n con vt<< JOUUUAL.::

""* B. H."cCR ARY. Editor and Pui.ltol.er and i I. careful obtierrer. He 412 5". bil. a .\uni nearly' otiuirulent: to
{t. W. ASSfUCY, A* clat, Mltor.L :. .L1(%) At tbe present day. T.Je, taken
TRAVEl _ .. .... returned home only recently i tbe'e nottd.and .
from 'n were especially .
JESSE E. RURTZ. CUr Fdltor.q. . Very tea people have any adequate It iK-rame an annual\ r-tistom\ tor ?. THE NATIONAL FINANCIAL A1',;". .

idea of Florida either* to Its reowr- tbe city of Glomftcr to st-ncl! a lam- I.
:LOUIS. J. HRt'MBV. Gent Trnl11"1I'rut.. DAILY NEWSPAPER. '. .
eel or its healthfulnes I have fp<*nt prey file to tlio kinif. There it, a record T'\

1"". M. PREW1TT. 8up tOn ponln Room.. the winter months iirmeipally, In Marion of runs complimentary prt cntaIxlnff .,

Orange and Alachua couati. ) xent.to' (Jrtti1} \'t'll) niul to Len ,

q. OFFJCI5. J-URTHK B1.OCK.:: I find the people hoipitabl1. kind .ociable Until the speaker", of the IJUK i,nrUuUionf. Reveals the News and .Facts; governing .

soy\V. M.I la 6trtel. rt. TItLItPIlOJOl&432Tit. Industrious and economical Owlutf'MUlie( taunlciiui'' corporation Values. .
..," Alacbua county hit. rn-s of the Rnrt net (>I<.u0it,_ler'tf annual custom! .. .
.JJ"'Y tlt.t'bh.hrd: ery nwrnlng ex- <*u. Dept Monday,delivered by c.rrlrr tn'the city,orDialled court houses to be found anywhere, .
.. retitcd It aDd event a l pie! to1ueen Victoria Movements..
to.oy partof thetnfedlatt'.puat.gh and 'the county U out of debt The tax .
.. rt Uli 'own fsppimv, 1 1 Id tineetiIyrn't '
J lrte,lot|3 a yur. lu.!6 ..Ix l iuonth: fl n three levy for county and State purposein. Reviews and criticises ,:
cede fur five wcdttldly 10Kcadlag 111"0'oll! \V.'ll liUMail. t'xnlllille.l..on.loll .- ,'analyzes Railroad ,
,
month wr 51. .
' $ cludin ichool ant road, i 1.0: mill, ' "
acini1ft' and Industrial .reports. : *
1 ,'' school tarn eigNt month.. a..eu d ralballon '- : .t . 4aj

*; feu tray ttoticn in kcal lulumn loirnli a line of "| ni.'T| 11 one-thlyd of lured A Dgvil Ride Has -complete tables of Earnings ,of w';". *P>'

, ioA for fin tu.ertlo.d. 5 ccnu for i.cb.ddittooaliaccrtioo. ra ae"l.oca'rd Often r luh'o' a fad accident. To Properties. . .. .*

near I the center of the heal accidental Injuries. me Bucklen'a .
toi RjiUor Arnica
3lve.t "A deep wdun In
my
1n.q pcnin.tilrt. in the latitude of the b<.**telirnitf inactive
application. "
foot, from ao accident, write Theodore l
to Itfl found i It Alachua. county Bonds.
Stihuele of Columbus 0. "cauied
.
d hem Twk ... -Week Hun I*an C1llh""IIC./ort" ..DdTha'.T. ,- Tr.. land I I. fertile, the county me great pain. Physicians were helpless Records the last sale of Bonds and the j

column paper. puUUbwl( *" ry Monday rich in resources, free from now andsevere hut. Hu klen'. Arnica Salve quick.y II
of yield on Investments at the ;
and cuntaln all the news the price. .
q ) healed it." Soothes and heal burn
devoid of chilling blasts
will be cold ,
; week 10<.1. ataW and groeral and
like magic. 25c at all druggiitt.Mhr Answers without
mailed, ponugrre, to any 1 part of the fniie4HUtoor and ottvtlttR every Inducement to those charge, inquiries coldcerning'.Investments. _

f Ctnatia. for f i.wa )4-1.. aclY'1u' who seek health and happine The .. .'\. .1'(1' :
the W't. ;;
AU advellalnr bill becom tine l after brat county. i ill about 250 fuel above the I <;ft'mllW.Pnrtr I'm Arranred.Mt. going to tell One who dally counolts TilE WALL ,STREET .
reof the extensive
crtherwinetipalatfd i *ea. There are
t advertisement. unites
f
appearance you ouiethlug, Kthel. Do Foil know JOURNAL Is better Invest v
to
,. la contract. P.rtle. not known to n* pine forests large depoi of phn- taut qualified money ..
.ii rrtll be required to pay for arfvetlliinir in ad- hate turpentine farm and I.tllt )Ihl.tt'\ut our party your safely and profitably and t* advise about Investments t
;> treat a dlfttcr proniUed' to marry me? I hopeyouil .
'vanc Addrew, TIIK DAII.V "tiN.c"U'uvUo& than one who does not. I '
fiLA. productive laody soil, Many clearwater forgive me tot taking ber awuy.IJttle .. >'.

.. lake are to be found in which Itbfol-"cl'h'e: ; you Mr. Orceuf
-- -- - -
1 very fine fish can be: easily caught. Of course I will. Why. that was what PUBLISHED DAILY BY- .
\t
Clues, like clrisatlon, must t'splnd.alld tbe party was arranged for W
This county lies in the center of the you :
you can't keep them back. know DOW JONES & CO. \
sea islands cotton belt and more of ,

that valuable commodity I I. raised in For aWeak Oigeation. '44 Broad Street New York. w ;

At the people of tho country rom to this county than in any other cec'tion
No medicine THE OLDEST nEWS AGENCY OF WALL STREET.
know Florida/ letter they cannot h.*lp of the South the number of bale bong can replace food bat ;f ,t

tot speak In hlnhrtt terms of Its pros.p.ct. about 8,000 and valued at 1810.000. Chamb">rlalo'a' Stomach and Liver Tablets tl! a Year, fl a Month. .

.. Iti rei6uree are not half >- "The COU.tl.ut I I. Jalneillle located will help you\ to digest: your food. (
'titr It i I. not the quantity of food taken INVESTORS READ THE WALL STREET JOURNAL
veloped, jel he can depend on them on HIM Atlantic Cuts'. Line, the that gives strength and vigor to the

c alone and never come 10 want St-atKianl. Air Line and Galnerllk and system but the amount digested and

Gulf Itallroad, and near to Alachua aatimilfttrd. It troubled with a weak

If Cftitro wooM' only run up Into the rAke a larxe body of fresh water. The digestion, don't fall to give these tab r.. .
,
Gulf of Mexico earth the American lt a trinl. Thousands. have been benefited ..,
b ,
*' population I I. about 6,000. and the city -
by their ue. They only cost a ..
fleet now at 1"enaC'oIA ant destroy it, I. beautifully located and well laid quarter. r'or sate by an druggist

he wool'J I bat: sweet ret eniie. There out shaded with magnificent large -..--- Heavy fighting I 111I expected soon in The Democrat carried Chicago by
the Far Eau, if the Russians will only 20,000 majority Donna ..
are only ten battleship, seven eull' water oaks. There Judge wa
are
many lovely Carton P.r. lo. ,\b ut n...... top running long enough. elected '
ere, tefen torpedo boatde.troyer.. and mal r._ ; -
? iotn"". with lawn, shrubbery, endowers It I I" n curious IIDrnitox'that. an a
three monitor In the bunch.
. .. fls beyond d" criptlon. The rule", the large: handed man IOVPH small .
: --- --- - I
-.-.-- .- treet are lighted' tlV j with electricity thlnjro, d.tnllll. exqulaltety.ltnlebed] object Dallas Republican! .will get up a Just as the war -newt ii becoming: .._

.. April, hnwert put in an appearance|> bJ an np-to-date plant. The city awn nud U. tulcrowoplc In bis tendencies banquet for President Roosevelt, and tale, Senator Tillman hal appeared

....... on Vdn"
f alternated and the. earth r.*jof every sort. lov- make a fair showing traction for a few months. on'J J

. duet was laid and the filling* about rom tinder A largo ruck at the hue ofa liiK oxtcntntli' end dlxplay.boii Immense
.
-
--
------ -
-
l' Oalnvttllle looked brlxhtwr than rvvr.Home
,;(,. hill about two mile from the city, .
that t U iiHa| n great went Ie. UN hnn.l- '
of the rape bushes alimit tho city and I.I PARTIAL PRICE
gathered into a large, well pro urltlng U "large nail perhaps! full of LIST OF
mer. 'literally ,tilled! with M) om u'ct".1 l rvuir
rr*< from which the
citynii'i'lifii fionrl''''bp''. while thnt of the large hand
v the rUltnrc to our beautiful H.t.ithrnl> It !. Those I I. . Whiskies
no large town InIh. ed uian In ..mI1I1I1UII'l'I't.'.. Wines Beer and Malt.
; bnmewerea.ento K United Mute that can furnish a ,

I ; k over the praspect_. ._ _.__. sup..rlor drinking\ water than i II found "+Inhtrn. Lotlerl. . ---

xi .---- In (ialu...vlll.>-U I.I soft, pleasant and I>r. I'linkcrTitko this prescription.! EXPRESS F1tEPAID
Edlmr' K tentVwN.hall l| of Tillt }Url''"'' When It will Htlicr Kill or euro you. Ptitlont I| Bulk (Joods! -JngD Fre<' -Xot, Prejiald.I .
purr we rrmember how important FuU Qt. Meaur .
4 QU. e Qta.Huntlntf )t Q.... '
wlok Jonrntli vouflhr for this But i\ "'*("' It kills e1.11(1'Per I
remedyKtaturo l\Iu\I"\ ( njt'T Pr. I'hakcr ( Gallon
.. .
good water I I. to the health of ctub RJ'tt tt f6 W 00- e 7 00 Rye, Gin Corn.
cure for nullpox : "'Snlphale > Nothing >i ntnn-d. nothing,: gnIntnl. My Nelson County .. Uood grade
Rye
:
. a 'mmur Ity. we fe..1 l that Gainesville 110 4 SiMonouram 7 M *S 00 Per GallonRye. -
i\ of' nine, one grainnlplnre/ hAt motto( In", "Xo euro, no pay." tit> I'm tflk- Rte ..... .. . 3 :30 4 50\( M OU .Gin. Corn Rum Fine quality.:

(Cdlala.II'.II') grain half tra. ,, much in this respect to lm proudof tog,: !-i <-liaiu-r: tin well a* you.-Plilla lelTlmr Hanne'a"44"Iye... .... 3 7ft/ Awl 960 Rye Gin Corn.tefittperiJallon:
> Rum.
; \- deat for( the lIIoDe .
t ful of .,. Mix I>blll. 1'1'(" "". Social Droim.. .... ...... 4 HO A hu' ISO+t 13AOPerGarlon.: )
.u. thoroughly with "
.
"O.IDe.UI.. Iina| 'else. a large and Ma1'Wbl""eJ'.3." % a Qt 0 !.V) 44 Rye Peach.nd Apple !nand,. Mellow-
two teaspoons of water and, then add . .. . ec1br..e.
cimtnodfou, tabernaole for the !. Peach DraDd, . ... 3 75 5 41 a ran
of o; Trial.
f four of Dose! ue ''e .. ....... "'.vw Per UHJJOfV
ounce water. Apt Brandy.
tit'pi>onful < 3 n a 00 0 SA ,
Mctorltt
I the National |Bible Conference and the : Daughter 11.00! i>klnx;: up from hernoreltI'npn. Its Social Drop. Rye. Medlclaa
.. .. .
rrery hour l 111e.l *ase will dl"'N'.r' Holland Ulo .. ... .... t go fl:SGenera 7 26 quality.
Florida Chautamiua. This building it ,In time of trim what" do Its . ....... .
&In i. ; a 111 A on n 110
twrlw hour, a. a rule' If.. |>rr' yo'i aupM| i* l>rlnj;'. tl.,. numtomfort Nonbl..rolln.Co'n..tfl.\ 1 LFp ST. LOUIS BEER. Per Doa.
awn I I. where n physician l I. very lame, with a reeking capacity of to ? Mountain Corn. ... .. a 1 a a 00 0 en MT Fal taaJk-er.. . . ....... .. . .. ..11& .
cannot e ;\XOor morn here a*.embl.>. hwln'.r n nvm: Pnpa-\u iiilttal. I Jamaica Hum ... ... t HI) 4 ja Ez ra Pale .. . . . . . . .."I".".... .00
Mlly IIhtain4'd thi> trlnrdy' might ImKivrn t'a 11lloul.l. think" Mrdtonl Rum . . .. a 7S A iw '. 5.1M St.ndard. ... .... .. . .. ...-.... .... .. .00
a trial.' some of the best Pt'"pJl'01' the ( rap. Hrandv. 3 7 5 skit MB )faiC. eztra dark. .. . . . ......, .. ,.. | ooHawi
tiifuf of 1e't'y. tlotirboa .* l obu !Imported . .. ..... ? ,-
Country to bt edified 3 6 Ot'AMOrtment /AOSame .00
by a number of 11it Hoxil tit ,t.tan i U. infinite'! la what AllowedOO Ala' !l.nte. . .. ... ....... . .". ". 11& fi't;"
Thr brilliant Senatur the most prominent. teacher and It rr< youiitt fromfolk _.. ... 14keaby the bbL on application.ir. n
"irrach"r* of all denomination -- '.
lion Park M I. I rnmmrll.", ,'ho. from -- -
Mi ..lliartnf the United ?<*tan>.. The Frightful Suffering; Relieved.1I1T..rll1ll ". .'
president of tin S, note al .r.lI.h..f't'l ) .' .."id a h'III".q"a) alo hold it* an- !f4KSM8T. HAflJRJE BROS. JACiiSOILLEe .. \
frightfully: from the virtt-,
his c"lle.Hiii>.. U ono of the youtift nuul .r...iun* In the building." -- a I'LA.. + .
lent 1 poinuit ii f undigested 1 foiad.C. (i.iray.nn . "' ;
--
Mt sal tu.Mubr.. ttemic :M yrar of ait". .. . - - -- .
JlU serer a. a public official tw/lt" ( of Lola' , Mi.... tnok Dr. King'\: '''''''I '''''I''I-- - --- .:?

S / ArrbbUbop Wbatelyof r>ot lln New Life Fill- "with the ,..olt." he
aome yrara, ado alien ho .. 4. 'li>etrd > okraaakrl I
a Yt'lInc man how It haptw write*. "that I wa cured" All) nom. ) r
of' hi. l 4
mnyor that trutli. t nltlioiiKh always stdulauely <w..1| disorders give way to
-r lnK Iwo torm, bviilK elected a I ruu.-tit after, U an rarely fouml. their tnnh\.. laxative proprriie, ::5o: at If You Are

rtinutx-r( the 11.11I.4"| of ]IlPprre| ..nta Xlivn the 1".lb deniurrrtl giving his all drug (tore*, guaranteedA Insured. -

tltoi iu IP\U 11.|| has al..,. t..-iuworker. a nllll\\"r. Whnteljr aaM : "IMI tell yon --- f

? t'a true lo' "'rry irunt rein>'''>d in why; It I... I..>.NUI. "* men" always, II..f..1'ilt'ttn working girl in California was --

Urn by the |>*''p|.., and .n able( and l g t-tnh nil their aide! 1 to t eng( U11 tendered) an engagement ring! by her / In Company that U Kevpoimble, liar a Volley Correctly. "
{L ritt.n. 1\
earnest ""ta'.r.' t..la.c al.a:01.,1.: lice aid 1. "c tr il lir' .aw..Pthrartvh* looked inside the \ Pays Lwses hit 1'ramptlyI Liberality uf ftti licJ' Contract and the Company I

cotta In Iu* manner toward all, kilo ---- band and aw It. did not have the union \.
\ >\ ..i.l.rr.t l \rt .
lctlon a* |>rrid.>nt of the ;Mual' ti| U'''nU.. or.Palk label and very gracefully returned U.

a t Yr,1r an rridrnce of hit ahlli', and |mt'u' VI.M 1 ...1 h ...hI ..re strHittt Mlfiut stare In .t.o"r"lIlb.au. You Are Assured r rO

lull \tine''InL._ ami . -- _.- --.. . -- ... .. )
Ii..sn't bol!>i .t ">un>ltf! l
t., ic.v (I.t; l M.'lJlhC"r. \\'hy. sir be

SPEAKER OF THE HOUSE. pisyed I"f' tray\ \'llIuh in "\Vo ji .n4*", MENANDWOMEN.tile CrattYf.w..ant. O That refuge DO*. aulo'10..* can overcome you without! you bare tome. .\ "

,r1 tVmns." .... -atl.t"'ntty that h''.. w 'e a$ e.. .. .orate..t.a.u..n \ 1J
nw+ t Irrtt.tt.rw .r .1..r.IYw ...
When the irnntwri of ih. lli>u>* tI' "'Woo' for w Mrttritinn. the. mxttitter week. ,a., w..rrw f a..a ...see.... "vr"
.. .l.e-w t.. Mt.,... _
asd _
Uf'I""D'.U' ., sN .stet.
in --
catteu nornlnstrd tv+sbtweattt. ..... :
t Jlu.a. AlbertV. UtWhrlfi' vt l>. :Ito a' "'h "The t!__". .Ts r..t.rattou ts. aa. + ) Fire Life Accident and Healiii tarace.None ( j l
i'-- .. .
'
.(>*ak.r of that tnt < teeth th 'ht wet la et.i..re.e+ ,
icut UKT.! a war ..t.- . .*. I., .as..w.H, r e ,
.n'11140' ,
conceded Nwione t y all that the vlrtton was "a..... ......... )",.,... $)aM' rltuncrt'enI : e tle+ M*M..,a mini built.u.M.T.r ew1.. ) but Reliable' Companies lepre....... :C+; t

Hi* ch ra.trr a* a bu Ulira .,.t.t.... -..t..1I"actl.... -_ .. ... ._--
tnaa and vltiivu ha won fur hun -.....-.
++
the htchr esteem ot all, How's This? ,"VI-IITE9S: ) r
rrP whilv hi. A.Information M.
+ N om.I.1< earns i it thai of an upright W. otter One llundrm Doliars UfO- CTJSHMAN, "

man In .<.ry Pn... KearUt* in tile ward for any rate of eatarrh that eta Cream I Vermifuge ( cheerfully fantiafced.. OAINE9VILLE. 'i;

'ill duty a. h* __. It. and bit *'#,.lt
, judfrnetit rarely lead Kim amt.. he I* >' J CHKXKT Co..Toledo. O. TIE 6C1X1ITEEJ ..../till\I'V .I\I1 ai''%I 11.I0
) oorteou*, whale! We, the anderalgefvl 0o' OZ.stabllata.G. ;
saul.d! and tvN ati..s have known F --. .. .
thoe qualtttw ot h..d and hrari tbat J. Cheney for the |at 15 yean, and bII. *. --- - 107s " ._._ ___ ''i'::

Z at make *,. him WORMREMEDY .
!
aC up that Mco-tnm bo) p.tt.csfy bf\t>Mar.r. en( nil , l'.
err a e*de4 Itxlat U d bustee.' tranaaetion end (flnanclallv '
4A o lUl .,aID.t I
ibis
the to ratty out any oblifatloo made :B.F -'-
uaaerupulou. who D-r-rTTO
are found t in by. hi fl'tw :4
...
... '
many hijck placr.. At th. head of the 1'alt.+) au. t.\. ,, 'fAa, ,\' 15 &oq.. ; }

tower kcu. of our Mate .VOM, .hoar '''''nl..,*'* 1t"'CI. Toi....|t'. O r:

.. worktac 'or the t.*., ID'.", ... of Hfcll1 'Iuu.h C.t>. t* iaVn h.,.ti TMC CMIUMCirS' FAYOIWt TOMC :s A ::rsrK

their' 1 t.loTrd $tat., ... look rally. a 'unK directly up 'n the h ietuat a.we.e -.......... EBS.
for and soil "'1. C."I.oa snH.Ma of Ik. e..trrrst we ..-... __... _w .. \
Jltrf. ellfoftl sotbieg tot aho.**t sad josatdtutatslratiou T..lttttoslah eat f.... Rie. Ballard-Snow p.a"""'e15..a''bwalet.am fat ass eeQ ..
: LInlmeot Co. Ps -
"
'" ot hi'DI' from $,p.sk'err b'l"abJUaU"til.. Itohi bL all *lrvj"+"vtia. Jtep. .T. i.ouna. "0, .Te....ILl..al.Mea M...laI...................fa.aerl..rt.- .e.Wai.r......-.....rtle..a. MIl.., .... ................r._...... :. Ii.!g

Gllchd4t. FaaU, f 'lie for otti M.aalW MisMU.M .IINi+r+ ....... r. arstus..rapeYeh as 1t ';y. i
patio.. Fer Halo Vf W. - I ?
M. J +
*iaesea. '
.
r ,
\ o-A.Ea v .EB: ;VP": e I ..l:6 '< 'VI '
"
.. .. '( ,\\r. .I" ...- ..l\\'... ,:.. '{' ,' ... M.ic f "
,
<: r
: .d I .. ; .1.\ <\I ,. '1'"" ,, > "tk'., } ttia '. '. :
.t..r. .... } I'fi.
"U : a
c-.M '" rJai.J 4 N'K 1. : ..1r. .t- II< ."i.).:. "'"10" 11, I" .." ,:jltck :" ' .l.< "
"C'
& s. _
rYi .A
. .
; .... ' .. ;' 1o\ ,(": "" '''' v. "
'ili '
: .
L '" . 4.1i;: ; '\ ./o'J... "' , ,':t'r: ,d":n ,"'h, ,1 : ..f''I ;"'...,''t.ye '.;;;?!'
I'u / ,.. :' a-- :-. . ,. -a .,. Y , ''I/o'/ "'M "',,.-;-::' ,t..ry41: .0.jPQ.Tn / ; "



? .

,- ,
.1 K

pMj* THE DAILY SUN: GAINESVILLE FLORIDA APRIL: 6,, 1905'. '

,
---- -
P ,i'.:'::;J; ;: -- Not .. ....
1\" ":';:\t'J lonesvilla. Happenings. f.lOZLEY'S "Old you tell the landlord what an

1'.'!' -'if'.JonesYi1lepril5 -The social Riven awful leak there was to the roof T"
:{.b1( the Misses Hamilton at the home of "Yes.1 toM blmw r, + DoYouTe Quinthe

"'": 'their'mother. Mr*. W. J. Hamilton, onlast LEMON ELIXIR "What did he ayf;
"\ "He aiiM bpd fix the roof as coon a* s
'r;. ;/ Friday night was quite a success. It.', 10 to t :you do It you are a rlcttai
;you | ay the rent ywu owe. '
". 1 The evening was spent in playing of malaria.
11\11 I bt! I gne* It ain't much uf.al'ftk""I..lnu t
games until about 10 o'clock, *hen all KEfJULATES THE INal lo.'cler. Don't Do It. its Daaii roos). _
r
entered the dining room, where ice LIVER ... : 4rtr' W 0)11 julmVt it gill care malaria, but it laves" '',. r "''
cream, cake and lemonade were lI ned. r t
f' STOMACH,
.Those who were present were Mitses America Will Help Germany.
U01YELS, ;
label Lamb. Lillie Belle Meihvin, HERDINEih' ;
iiIDSEV Now York April ::.-luur parleurs r
Melissa and Clem Pickett, Estella and "
t : have. acr*>r Iln$; to a Tim si dispatch!
Irene Miller, Lurilla Sheffield and Liz frum llorlln. taken place lietwevn the IHH ft
The inventor of the famous "TKR-: !s purely YogetUo nml absolutely taaranteed
t,..1< _tie Griffin; Messr. )[00111, Corbett. R};L1. SCUAl'E' a man known wherever German! anti Aracrlcnn governments'! : to euro nuiUrlo, sick beadache. 1 1Iouanaa, t x i
0"Milton, Pickett, Aleman Green liller plow are sold and used, say: np(\ii the I tnestion ol the upen +l tc\)1' fast all stomach, ,kidney and liver complaints. ,, .

| North Petti, Griffin, Chatman, in Morocco. It fl1t1'hIRh..t.l. tho cor ,I.1 . TRY IT TODAY; t4 l'
Burke Weeks, Geo. Picke and Jones. respondent asserts that the Americar '
"I bare used MOZUSVS LKMONELIXIK 50 Cent tv Bottle All Druggteta.
'
,
'ff\W:\( .organised a Sunday school last government entirely mtwhUeil with \iit.' frd jyt
: fur 10 or U yearn: In my 't'r "1iI
Sunday a week ago, and had a very Uermanj'a determlnatlnn to prt' 'rt'e "
family for the IIlom.ob. liter and kMnerB. "i
[,dice meeting last Sunday. Mr. Greene and find It Is be best medicine I the( InteKrlty of the international trade For Sale by W. :M. Johnson Gainesville

Jt I our worthy superintendent. have ever used it U atwo a sure ni>eetflo In Morocco. -_ u _. _ __._ ___ ., .. . __._-_--,._ _,___"""'"""
for pain in the back or under thohbiraklertt.
.
Young men, take m'y advice and ---
I bare recommended It Innumerous
|never loan jour horse and buggy to an- eases to my workman when Equitable Directors to Meet.
f:other'young man to take his girl home, hick and unable to work and It has al* New York. April 3.-.\ nifetlns of ABSTRACT & REALTY COMPANY
(when'jours has to walk. See way irlven i''rf' ect ati, +fartlon. U.. I). the 'lreotora of the U.iuitabl Lift'
PreHfclem Atlanta Plow
TKKRRU.
'!' Assurance I
Mr. and Mrs. Monroe Kirby are Co.. Atlanta.KOZLEY'S." Society of the I nltwl Stale _
'made happy over the arrival of a baby has been callfil torThun'dayafternoon' JJnoorpO'ftted.1:

bay at their home.Messrs. when the que-htlon of acn'i pting or tIc E. E. VOYLE MGR. ? t
;" Pickett and Aleman of LEMON ELIXIR cliniiiR the tw.jmr mutuallxatlon
Gainesville visited the former1*. par- pan! proiwsed; last Katnr.hiv will||| come Abstracts of Title and full Information fiirnhnhf regarding land laenmity. M.
up for coniiU-ratlon. A Our manager has lived In this thirty years suit
staff of
[eats )Ir. and Mrs. II. A. Pickett, last ---- ------- uecouniants I. thnroiiKhly conversant with land titles.IE. s'
and rlerka .
week. Ills Bitter 6x.terteaee. from the state
Mis Lurilla Sheffield is visiting her "Cnu't you swallow even a sugarcoated UiMirance department starred work today
': for few weeks.Miss pllir I on the bunks of the I':+ullabln soci '
,
uncle. ; U. P. Miller, a IE. V a YZI:
"No. You see, iLc blamed thlnic I ty. ,
Lizzie Griffin visited Miss Liz- ,
.. seems to take its coat off before -
"t ale Rain of Archer last Sunday.Chamberlain's Itl\rt'j -
., ing on Its trip"Rheumtic FIR:, ACCIDENT, BURGLARY AND INDEMNITY IKSDRANCK. Rep*. ;
A Dandy for Burns. number of American and ,
: sensing a prominent English companies ,
( Cough Remedy the Pains Quickly Relieved. Dr. Bergln, Pans, 1)1.) write "I REAL ESTATK AND CITY LOANS.xeoo. .

:;: Best and Most Popular. The excruciating: / pains characteristicof have used lUllard'* Snow Liniment ; Gui eB"V"i.J.J.e :r a B"Lor:1do.:: :

:{ "Mothers buy it for croupy children: rheumatism and sciatica are quickly always recommend it to my friends, as
., .. ... . .. .
---- -- ---
- - -" - -
; 'railroad men buy it for severe coughs relieved by applying Chamberlain'sPain I am confident there no letter made.'It .

i '. and elderly people buy it for lagrippe Balm. The ureat' pain relieving is a dandy for burn' Those who :7 ms'r.A.BLXBZ3mD: : :: .

f.t, 'say Moore Bros., Eldon Iowa. "We power of the liniment has been the live on farms am especUlly liable to
,sell wore of Chamberlain'. Cough surprise and delight of thousands of many accidental cut, burn, Lrnl....,
Remedy than any other kind. It seem sufferers. The quick relief from pain which heal rapidly when Mallard's H.F.DUTTON.&CO.

': 'to have taken the lead aver several which it affords is alone worth many Bnow Liniment is applieil. It should
other good brands." There is no question times its cost. For rain b; all druggists. always be kept in the hnu. r. for eaes -OK'....;m INS-
but this medicine Is the best that - - of emergency." :m-!, Wi'. $100 bottle.
.' can be procured for coughs and colds, Hold by W M. Johnson Sea Islac.d ottol1.
...
.
whether 1* be a child or an adult that 4 Dlvtnnr TrnlM. .
,is afflicted. It always cures and cures A rnllroud enn.loj'1 in I>ul>IIn wan Attention, U. D, C.

:'' ,..quickly.. Sold by all druggists.OCrENDCO. strutting/ wnioquiMitlally!' l>..foro n traIn The regular monthly meeting of Sea Island!: Cotton Sood, Bagging and( Twine. Walrus
that war to run direct tn rk, while
. Kirby Smith Chapter. uno. will beheld
.' '
- be rv|*>aUtll.v\ fchout l. 'TliU train nl the home of )tr.. J N, Mlrobhar Louther in Strips or Sides.
doesn't top"A nny"11..",:" this afternoon at 3 o'clock. .\ full attendance --

. is desired! as there. will l be :Manufacturers of tho Jumes Doig Im rov xl Engliflh
xmnht man. said llurle ElK'l1. business of Importuner. |)..l..Ratvs; to [
"U a goad deal like a raczor. He kin the State Convention, which will meet S be mighty mteful In d. right; way hut In r..nnenta on May 3, will (H* elected.W .
fi f hOCUREDA' ................ be kin kick up n pow'ful'sturbance It MKM. J. N. STKOHIIAII, I'r.cI..L., GAINESVILLE, FLORIDA, U S
,
lor eftfMMtwlrim a.a1 ern MISH MALM UBAHAM.
wpb.tu > Secretary.
= haw lu.bt&a=:. trailW = It goes wrong."-Washington Btar.Cures .
-wn.r.-. IN ALL COONrniKS.: --,-- - -- --"T ---- __ -- --- . ., r.a wv y
.Ea-Va.d+fan .r,fas n-I..lt.14PJ.hsr.Woryl....k m tavtf rung Coughs 'and Cold. U' r ;. ,

Frtwit Vrtt.or sad ram bifrinnmint*t.u.su ... Prsetlcs Exclulively! >In. C.< Peterson, 624 Lake St., Topeka -.I gt '. .
in-ia dome.q.. "..... .... raew' o-..; Ian..ty. j "Of all cough remedies I
WaaHINQTON. D. C. Ballard'.* Ilorehoond\ Syrup I I. my :

favorite' ; it h.. done and will do all

6 that is claimed for It-to speedily cure

all coughs/ and colds-and it ia so sweet.

',.. and pleasant to the taste," 25>j, 60e, CALIFORNIA
,; -. $1.00 bottle. Sold by W.I. Johnson, at

.
THE DAILY SUN, 'I lOc A WEEK ---- "rN

--. .--- All Best work job Orst department-clau.DR. in the State. Do you want to live where the climate is mUd the year round '. ... . .

',. One Cent a Word where labor is never oppressed by stress of weather, and where

animal vitality is never lost by mere conflict with cold ? ,1 .

Advertisement*of tea words or more under- Do you want to live in a region where tho resources arc more '
[ "
0.OPTIC OLDSTI11
.
la lIJalle-.dIDJlenedfoOIIoC.advsoae each Inaertloa.IFlvaaw a Word. eat . varied than in any other equal area in the world,*whcre the division f t

I the adverU answer emeni.be advertisement. as -.d4J't'-S of great ranches affords a fine opportunity to get a small farm that ,r.,,,:

eomutenoeof all penwms tnserged soo > will assure you a competence ? __
sfvaed with Initial will be re.apecM4.
e '
eir lIam"will dot be lI1.eD0 Inontrers.Ktr SPECIALIST. Do you want to live where, with a minimum labor, you can .

.,. . ,
- --
WArTEDtALZ.ANTLDReUable :' : grow profitable crops of grapes and small fruit, oranges, lemons,

olives, prunes and almonds, alfalfa and grain, where crops arc sure, y ,

mee for I.ue manufaoloref.man to maa*.Salary e branch ton to this' city 7F business is good and capital easily finds profitable investment ? ,< -t-; n
..M*> per rear and extra-commbMotM. Will return t a
eat mad bate toot reference and SlXkO. I April flihand Then go to California, where both health and opportunity await
tab capital neonro. FiM ri i>*' nnn ewia ry.t
tr...M Maa'IT.. TM Cbanber Commerce.l>o4 coming.
..)lie... your r
tt

_.to distribute EROETIO workers,., sample everywhere and ad-to. Will Remain The Chicago Union Pacific and

iertlsiog matter. Good pay. No ran.bussing.
!:. Cooperative Advertising Co., Two ,
Days Only
ew York. '
.
- --
-
-- -
t North-Western Line 1 :!


ijI Office at the Is the most direct route to the Pacific Coast, and there arc two fast

through trains daily via this line over the famous double-track

rf railway between Chicago and the Missouri River. One-way ColcfHst ,!

ft5ntwllBq4Ecaw Brown House. 33 conepondingly tickets are on sale daily, March I to May ijrat Tk_


a they are the best
unusual chance to make the
an trip.
land for the !
|in the money
? 9:30 fo 3 p. m.Daring The e tickets are good on daily and pcr ocuiUf conducted .
; Ask yon dealer for the excursions, on which a double berth In a Pullman tourist

nnny Jim" Shoe and inU III stay; Iftt.. dot sleeping; car from Chicago costs only $,.co. Roundtrip tickets
are always on sale from all points at reduced rates via, the
on getting: it. ;
rt--- --- -- ---------
.. _,_ . ...- -- --
a ; Gl1NESTILLE"i. F.1fOftITE MAXKRADSS, Chicago & North-Wsstsrn, Union Pacific and '"

4 RESORT.llachua &..prttHatJ.a.aE. Southern Pacific Railways.! SAC ( ', 'tb ,


A. WElL !& co., ::;;.. ot.; '!!;a'j'"

Pool Parlors, WHOLESALE SHOES w. .. KHUSJMX. :1:'

,.T....C.a W-W.ay..,...."1. '. \;:i,
C. Bare, PrwyrVUr.i or9ol All ..mu.... raw ... Mw 1M mff .. <-. YMebab Lwbu. ... dal m .. n t j tt 19''
FILL IN TMI* COUPON ,..,w..w. oarxMgntoa.ataaW.w.N.. '
: ,! ';f .
'
A.nu for JIOXAECB sad WTESUO05 : AltO MAIL IT TO-DAY. .. : ,",, //Mr.'f.rll'.; y yt. t'.t1fli } ,1
I : m
i .
eoatJlAtid. Sbo.. Ztsry .-l. ':.:,. '
;j ; Loeled to the Ports B-od. QUAOTT 44t.i- t' 1 :
rt
." .. Thr :trs*.-alMv a.&blfl. pair nulollLJ.IiIlHH. ,;1 .-.,..,.,. .- ,1 ; ,:"-', "
A.. i kta.ud praaapt' .a4 e arwooa I

,,' 'IIi""""' ft.pGb .iaU7 ..rtdtdb _1ft Ace.t ___ ''I. '"... :' "" ':t _:.",., JI
,, .......... ..hi'... ..., M '..r'..,. ., "
't' ".. :
, : lo..r"
"', .J1; .' J! : .
"
\, 'If;;'; : '" *. ,
r ,I '" "' :4 ;'z;; ;? ri
"
"C: t.
!
"i.- .li : \ ';" t3"-
'
;!



-
;s-- "' ., ,

"" ",, >KiI },7 ,<\IlI"! '"' .. ....!KL. ....... ...n..H..p", ,,.,,,, I ill, -= ._' ,

"\1Y." .O O(1! //It, ... ....\ . .., I. ,. .. qq'1\ "" 1 .)"I q' ..........." ".!, i, " \,"_. .'., ..{( 1Ii ,, \ ,, \ ?' .. ," -W---.., ''" ',
,, .
.. .., .. ... "... .,' "e. __. > .' I ,. ', '>Ii ,, .r' )0" t' . < .
"" ,, ". "
,, .1" ,
:' : : //11' ". .
'I, ,. .... ....,",I<"'f"*;111qr/;, ,''' ." '. 1''r "'., '' ;",, iIIII;''Ir."r,, ."' ".. ',f,' \ ''.\' ", ,. .. . \" I "
,'
y ."

f/




THE DAILY SUN: GAINESVILLE, FLORIDA: ) APE1L 6,1905'

6 m- .. .
:
I ;C.A.BpS: :
BUSXNmeS':
KIRBY SMITH CHAPTER. plate in Nebraska. -...,.
-I I HiCONNEL elections: Being -- -'"- '.,
-
Omaha, Neb.. April 5.-City and village B. ; \
NEWS FROM ALL Daughters of the Confederacy Will elections are being held today in i DR. DuVERE MOIJBISt. 'r

& Gospel Hold Important Meeting. Today. alt townlJ'ln Nebraska outside of Omaha ''i'. ,
DENTIST '
. ...vOffice ,
_ 'fJ" PARTS OF FLORIDA The regular monthly meeting' of Kirby which J Is governed by a special 'vi..

Smith Chapter. U. D, O will beheld chatter. The Interest in generallj .. : /.Q 'i..r'-\

le Not Fai -- I at the house of the president, local and no party lines are drawn. I over Marcus Kndera. AJI w k,.PUb ,toe :-

and Oca From Various It Is gospel truth to. say that Mrs. J. N. Strobhar. this afternoon at Nebraska being a local option state: **. __ ___ ',; '.. I'
Brief Happenings I .
.r '," DO DISEASES such as rheumatism 3 o'clock. A full attendance it earnestly the principal issue Is that of licenseor A. CARLISLE,' f : ..
L TRAVF'v Sections of State. 'I desired, a*' there is important. no license.[ On this Inane a bar: J. .
/. neuralgia biliousness has been waged in 'sevE-ral ATTORNEY AT LAW i
--- business to be transacted. Delegate campaign "

.;' THE MOST IMPORTANT EVENTS: colic cold sore throat,backache, to the State Convention which 'will larger cities, pticipa) among whichis And Solicitor in Equity ,
,
. ,
-.-- meet at Pensacola on May 3, must be Lincoln York, Nebraska City ana

x S ,r< Transpiring in "The Land of Flowers." bolls bowel troubles, skin eruptions elected at t.hls.m..eting. iu order to }Fremont Real Estate, Convbyanetng and Ge.'".

Things "Boiled Down" to Suit the and all those eanged by send the names.to the Fensacola chapter eel Practice, All business promptly *A.,

of Interest to promptly. Kirby Smith' wishes to To Ask Governor Folk's Advice. attended to. Office next. door to Han, f\ :,. !t;
Busy Reader-Items local Imflammation, can be so end her full of delegates-four oftlae---- - -6AL"IIUt'f'It.U7FI.OIU ., '. ,'
quota New. YorlwApril.- embymaD! .,.. I ,. .:IJ
-
.
I4 r All Clasies. quickly,'safely and surely cured, in namber-besides:the prenidrnt who Alexander. Colby and. Robbing of the BARTER 'iI eFt'ERDiNAP1D '

Healy ruin have ended therater has an independent vote! Kt the State New Jersey legislature', will. it U reported ,

., y'pl famine at Key \\'....t. M by>> th e'use of HASfLINS Convention, making the number of start for SlUourl In a few ATTORNEY AT LAWS ::"

b A new !Ire< plant will l", built at WIZARD OIL. votes from Kirby Smith fire, days, as a committee to ask Governor GAINESVILLE. .- .FLOWi... )('

Tampa, making/ four in all. A committee will also be appointedat Folk to bUKKest the best manner o1 i l:

> A new steamer will be put uri the It gets right down In, around the meeting' this afternoon to arrange barring lobyista from the house-.and CaD sell your city property, .(tna= d 1,

Mobile. for' a simple memorial serviceat rendering their! work nil. Lobbyists animprovwl), pbospbateT '
from Tampa to Teasels of R
route the nerves aud, blood the Confederate Monument on our have been worying the New Jersey truck ogand farming land- oo ,him'' ..

I1 I1t t ft1t r The Jaekeowrflle the regular! baseball seasun until ttam..iIInoL April" the affected tissues where the Confederate 3femorial day-20th of legislature for years, and .lUrJs now a list of what you .offer (or pIe 21Uu.o'-.. ". ', '. I a

't open April-when the chapter hopes to have proposed to get rid of them..>lf possl ,P.
soothesand
20th. trouble is and gently
1 $ >> completed the atone coping around) ble. W.. E. BAKER,
Over ZVl .choul children from lndieupolis back to health. -
coaxes them the monument. Mrs J. F. McKinstrj, ATTORNEY-AT-LA.W
Florida Notice. Y
tare been loitrh/K(
Jr., will .be chairmaifl"ofthiscommittee. .-
this week. For all pain, chronic and All the ladies who have signed the .. . SOLICITOR IN CHANCERYV f Y

hu decided by bnllut charter list of the Ladles' Auxiliary -
Tarpon :Brings It is remarkable rem Kirby Smith Chapter will be hon
tu ) aDd acute, a Hospital Association and those who GAINESVILLE Alachua Co., FLA 1,
to hare an electric Ii6r>; ( 1laliL ored to co-operate mitji the Confederate : *

water work. edy, and has no equal In safety Veterans in any memorial services are willing to join this aMociatfon or Office in' Eo4el Block."w"
who tee interested. in the effort to
_ ti Tii re has been $3:I..MO ton. of phosphate and effectiveness in the medical I they may arrange. The United build a public hospital( 'in Oainevi\le, J. U. ALDERMAN. '

rook .hIJJ..d| | from Punta (orda : Daughters of the Confederacy was organized are"reqn*>iited tn meet at the residence DR. .

su far this year. world. Price 50o and $1.00. to' protect aud defend the of Mrs.'N.'D. Phillips, Wednendny af DENTIST.Successor .

Postmaster I Ilildretlt has at lust Rot Fully guaranteed.For memory of the Confederate soldier; ternoon April 6th, at. 4:30 o'clock. d2 b
]
and is installed in and an harmonious and loving affiliation [ toSeltfler Alderman
his commiMion now ...,. ,. --.- ,
- -- '- -
the Live Oak ostullce.> ( sale and recommended by with the dear Veterans I is as sacred - OvetDuttonkCohsflank. batnesvits'Special

''I The Tlmn-Uniori nay that Dural as are the graves of the Dead. attention to Crown and Brldfe work. .
Phone 7O-a...
county would build more ninjd roads ALL DRUGGISTS. "Gather the ancred dust of the warriors RefrigeratorsWe l _

with lets talk aDd more work. tried and true, r\R. GORDON ,B. TISON .,
.
- --- Who lure the flag of a Nation'strust I
The shipping of fruits from Central DENTIST.
0, Y. P. U. OF FLORIDA.In .
America to Tamps the coming winter, And felt in a cau.though lost but -

will be a good hum( for Florida Session With the D. Y. P. U. of Mt.Mori I Just, have the only and aenulneODORLESS Graduate Baltimore Colleire Dental Sura-err
oJt'I.It'don And died for me and you. Five years' experience In New York cn,.,
The Dade county circuit court .
h Bspllst Church Colored.
FUUn Specialties.
Cro...BrIo14re work and
n Monday for the April term with a "\VI' came not whence they came
vr. .
The se sion was opened at 10 a. m. Dear in their llfaless clay ALL Woaa:GOAaAjrrsDso.Office
;
4 big bunch! on the docket and many 'Fuesdsy. with Rev If. K. 11111 il'h.. Whether unknown or known to tn MOlerJUaw E1tohaue.OAltcMYlLU. .
T' cases will lie carried over fame FL. .
chair. The devotions were conductedby j

:, .. .. "" The Detroit !baseball team begins!; a Uer. L. \\\ Crlvller.[ Their country still the same." WEST END

; / series lu Jacksonville on Friday, play The excellent choir rendered several . TilE ,
--- - ----- ---
<.: Ing three days. The Jays will give street selections. ---- -- FINE WINES. LIQUORS A CIGARS

'""" .'*,. them a hustle for their money. The program prepared by the Katecutlve ; [ It will\ COST YOU NOTHING to JOHN MENZ1ES. Proprietor.tt .

'I!' J,; "': iSaundvrson I is soon to "be connectedby Commltte was adopted. You Must -31 W Bay ,t..Jacksonville.Fla.

t' ." long distance telephone with the No it the name of the following\ ) investigate. -

s 1, { outside worldSome people would La p f ron were chosen to report the workof Faust beer,bottle aud draught Don't "p

.1 y.., ..U.II.,01 If ,fiey could net K,.od cou- the meeting to t the following papers Sleep. fail to call on me when in Jacksonville

.. ., neolluns rti their own town tMrs Ice Cream Freezers';; \\"btU ) M
If cannot it is due to an and .
,
The MidWinter Fair, to be held in M I, K. Fowler. :Messenger ; Her, you
irritated congested state of :
R rA Tampa. will have reduced passenger W I), Yanii Metropolis ; Moses
the brain, which will soon de- 'Mathushek Pianos
rates on the railroads of the thatl. and Croom*. The Florida Kapt'st' ,
It is hoped there will be reduced! rates Un. O. T. Dorroh, The National velope into nervous prostration. Water and Steam Hose From 1 1-2 to ,
Nature demands andit .
sleep
.
on ethiblts.Hon. llsptitt Union ; the writer The ".
ialnesvtll :;un. is as important as food ; it 21-2 Inches. NOTED FOR SWEETNESS AM) PDBI-
1 T, J. Appleyard of the Lake is of her and
At a part building
; City Indey has a Ilible that has been the conclusion of this, some sweet This periodof TY Of TONE, POWER A5DDURABILITY.
sustaining
elections of music were chosen and process.
i'f In Col. Appleyard's family over tutuyearstbuut : relaxes the .
sung by the choir and congregation unconsciousness Water Coolers .
'r1 ten years before It was strain and
1 At this point \\'. J. Johnson came mental and physical ,
& published.Mrs.
to'restore Ice Chests
forward and delivered allows nature exhausted
Itoosc veil and h.r children are a very royal ; Best ptaao for this trrtaic climate. stands ta
I welcome address In behalf of tlm vitality. Fishing Tackle, I tone looser than other*.constructed
said to be eruisiOK lu ""ulJauen
r s.v church in which the! it. V. P. U met. Dr. Miles' Nervine brings best material, and most artistic
., ri near Miami the whii, Florida waterIs refreshing because it Palmer' Hammocks. .
Thecholr had a very sweet selection ) sleep, worfcmaoBblp obtainable.Up
considered pretty r kh for the toilet prepared which they heartIly I .oothcs the irritation and removes to date every
sang very -
by some ladies the congestion. detail and Co .

4if' Unless indications l belle the tact After the music Itev, i'. A. Callahan It is also a nerve builder ; it eoualed.Bold .

there will b.. soiurttiiug doing very U l D.. accompanied by Un. S, N. Vats, nourishes: and strengthens: every Baird Hardware Co. by at continuously for

shortly in the building of the proposed i I'l D.. came to the rostrum and Ue.. nerve in your body and OVER THIRTY TWO
tension of the F'. K.: (J. railway from Callahan preached a very excellent creates energy tn all the organs. GAINESVILLE, FLORIDA. YEARS

the mainland across and via the keysto sermon Nothing: will give strengthand --.----------------.-.---- without a tingle' failure. If jro*s A'! .

Key West Kev. Va.s offered and vitality as and want a piano for a lif. lme" {
prayer remarks sure 1'
_ A gaag of counterfeiters have been were made by It... II. K. II ill. quickly.. as tr. KEYSTONE BAKERY service bay the /

caught In .'......0\)1. bv the oily police A good collection was taken by Rev attacks Darin of the tapir past ppe winter! which t had left two IDe Nlathushe'k: :. Y'' '.<> 1

and United 8tates authorities., aDd are 1) .T, Spas very weak.. and In bad eondltlo, 1 R. T. HCIIAFER, Prep. ) f ')
fyll now held in J Jail. The men are all res.idenls The meeting; was dismissed for dlnor wan wife,ao after n.r,ou tntna I covM.not different a1P.remwent Prices a< low ae U eoaaUteat. 'wttk aaantiCa 'i
7 ne Ton wh of the city with one eteeptiou for a doctor. The doctne-T nty.C Corner Orove and Crt>reAli street, h or on ea.y term Scat oa II days, 'i
out. and a nl< end have teen turning out spurious Adsrooon Session. Nervine, and ..ae brought hoa Prose lab P. O. Iloi .UOAINKSVILLK. (or, price TODAY.
lId bottle, 1 hiil not ...,,1. fnr Nome tIme.
<< at a great rate The also
pinks .\& :Jt<5, prayer service was conduct. and bad terrlhje palna tn my hand. FLA. r
captured! the 'mould. which were of.fI"la.t..r After taklna- few doses of Nervtn*
rd by ;Mrs. 1111 and lH-a Itoooe. after the pain war not ." severe. ..an4J
k uf yarn, Their mould. were eUpt.; I am now taking the : Ludden & Bates1
msde to cu dune. Barter dollars which the names of the delegates were ball. and em verr. mu..tImr.I..' CHOICE UREADS CAKES sad PIES
enrolled and a motion 1IKNUY U. 8JJIT1I. Ca corbUl. Vt.Dr. .
prevailed to
Freak. ever: bar.DeUvered .
and lelt.tJ lullsr 11.)1.. piers Miles' N.-t_ U sold by your
elect
theoAleers from the floor. druggist wee will guarantee th.t the to All Parts or Cltr.Sataraetioa. '
The C.f|>enltrt' PUuioii : ,( 'i hu.* elected were as followsPresident. "...t battle will "_fIt.. If" fatla, he Southern Music, floe,
Will refund f!mar meney.MUes Uuarasteed
1. :""al :' So Ktrtuofier he ('''I.m- [ Rev II. K. Hill ; vioe-prest- Medical Co. Elkhart, Ind SAVANNAH, GA. '
--- ---- - "
dent, 1. l!. Williams
Joiuer' Prof. It. C.
a no I:
nioii
etwot to
spend| the day with' their frieitdt. at :r-eurry. ....iut secretary Mr. A -. --"-'. - '- -- ROOMS AND BOARDr JOHN D. MURPHY-, MZr.

..nacres.n: \'" today. The day will twIn W Itell. treasurer Rev UV. I.arU T* ..n,Finds Pot of Gold.r ESTABLISHED 18706AITHER ;,

'p"I't an l-t'fAttioued fl.h fry and ruler eon llnir secretary.; )".. Worth, TeL April" S., -A stir For Colored People a BRYAN, State Aj'u,
M K;
pl alt'. and the public generally: U in- Twreliuc. recording; secretary.The rial (lu The ll*<<'urd fruM .Mt.\ t'lee I TAMPA. FLORIDA.

'h-c1 to cum. and \ s that T A. UrJIu.

basket and "D4'"y the 4'y The atraoKemenl C II. Ilotley and VV .\ N'llkenun, hr.tuj m,.a pot rumalnCns nearly KITTIG..: M'CRAV --- -- - -- - ,

are in the htoti uf a alter which some Important remarks I:.,"K in KOUt: ("O n. :<) milvM iM rth of AlACHUA .

mlttee C'OIUI''II"r| I. :N "" "OI".1 were made And the nieeituB stout adjourned I here The tutu I Is atl tTnltf l State t 100 Went Liberty !'I' r f'.tr.'t"Ommo.btioCI i COUP YII/t r"

A. T. llarn! and. w II >an' until :,\) p. in, money oicepone or l ItO ptre uliJr..
tsaMr which l I. au sx4ra!<- that Itteaflau: K II. Alaeboa county (f. 808,400 acre.laarea.
Iluwtaa
will tve earriMt tliruj h "I a 'ir.I-et at. . reporter were either ttpaalth or Mexican twin ,I has 343 mike railroad, *00(
magnet ___, ------ --- Years a CD at- uW ln4Ua et,,ie*| teat\ .\ First.CUi. Rates miles wagon rod, M poatofibwe, 1

O.m. . .. .. .M....tl.nstLltr. If the Baby Is Cutting: ..ah- ..>mil' k'ixl' u' a treasure had b,. -n Uiri Keaaonable Most desirable' resort for' 123: r-ablte schools, 27 phoephate

1 4. S "i 1: ,.tR B.. sure and use tftat old and welltrf.J i led n.ar ii.>ro nJUnKT asad.. hi. colored people in the "il,. 'I I plaass.2saw mille. '175,000 court 'Er

.'C'. ..' \, ... .. ' I rniiniy. Mr., Window's SoothS Cad and jurOrs tnaJv! a ..,.r h for Ij j 1 duera houae, five newspapers. and pro.' ,

:1 ar14" ., t .e. ... .. 1 ", -" ;( S>|rup. for tl :itrvn trethlnit. It It at that .34*. bat were uoalttlr, to "U'OK"'S I'KO'LA.4TIO j jV.der rye.Born|'otau cotton>... pineapple rte. .Mgar.oats. or..

R Itl lln", J,....1 M '. > ht ... 'tl-' 't".h. the ehtld. softens the euros, cad aftMb'n gad fate up tb* search angel, pehev pear. proms p*. ,I':

rsndt'at.a.\ ",.r.. .t wa,..: -bt'. altajs all pain cures! wind colic and fs e.r 1 ,.... aear. the ptare bad IaI art by ,1"_ of tlM> you** aad a- un. and all kinds of vegetable*.
the 1t+'1auir... ..tf'\J a.t, \ .... the beet remedy for 4Uq ..-". ,,c item The auary 1.i 1. ta..r. *, ._..... 110 by .. ,..Cf.eI par olae.-
''h.l/q dUrrhora. T".ntyHre *,-6f u. n"s .f u.... ...> Itwioa. I. ,
At lle.eaa: four tViuurraMo and f'.Ir : cents a bottle, la a J cu.d ir.'e rat pfe..r.atte. W a. h.w.. a. afee .V .....ett,. do tete c, Gainesville the County Seal it!
!
i .t..a aa.w...... M> b. hr* M ..M <.... oa .
K.a' alieaa all.rmeu ....,. I..,t..t .\' ,'......, ter wwa ....r.- A.u. A f). ,..*, torl
Oe-eet 1":1." the .......... :fI'...... \M swes..1 ewUrl l.. AW_ .m lla : t
lkvurlaWO
cabdttatee ..r.. -.,.d f.e .. .,.. foutte.wehoreh.tw0paWie
tae
"L. .: ", 01..1. .. \ 1 I rav eea 1.rla of
1 aa&r\ waa ..l.e4M.T' .. . "\-'hll" I" V r t+d ie... r..i.wwaThe Softools[ the Kasi florMa 8eaaiurr '
'.kar I " 'a' IZah ... ar.- p..twt rap .tow' .1. .I. h HAEUPrutiul odaar $M..5 ,.. w...\ ..t.s.a.u a..x b. Lrtfm -hoote.l three N ''''p!'''': .
t.t .C..lj!Jij, rr7 auw.ewr. r"f 1M .4_. N the SM.'a..s. .,. Ewe Macs UalUd Slate land tdllee". \he beet "H'

'S* earth i twtiit. .! r.*vatr.t above lb.-t I I Botkrlihr; iad lithlatst :: _WKt 4P\.sea M.. M. -1Iha.....-.. -..see.. -._*.sMe-....N- .W water rape .lama' "IIHID. .',,'rie i .,
.arl..tatlnE t+4w It theM erraa' w..ar TN r-a m '... .wM a*5..uk a M. .< *aieMa a..s... Iii"".. tlrO' Me tsessr4urp; :

tVLS 11htIl ALL IL Si FAILS .e sway the ..vv I. peara ... and I I I..TW V Me. ,..ter.,s.. aw.asps*_e .I maehla shop. tbr.e womt fatort -. : ,,7*r
.
an twee/ .
p4 e..iLos ., \>ic tr out tn artottfr. aM ** .n toA. Ali Work ( C-... _. r...IA..f SsM -..... "e- ..r. eoclGlt ale two moss faatorlee 1.: !! a
$i i '!.,. 'tsrsat..d sau.f.esreryI ..., /tr, x Money r a ilia- a.s .... throve reilroeda. two '.nJU.*r wail'GOOD f
; db4... c.Illir I ........ .. ., .'.n.ri. Nstsaatatsaty
sped '
t w tla Q; i : w ..
''w.i I-IRII. ir.ii The tally dan: is a spleaJU 1 w.wise..y M4 Mal sag tae -.I see .. r,7.: ... .....'.,.18.. '&-11,. i, ::
a.h..1 I acrllU" ...... ills, ........ pt a&.two buk. sad wriJ ;:

r I I :1& rofd IQat-IQk' rug ti.f. IhP 8. Oak Ave? a li.Ia.ttttUrv, n...j *s.>....i J, -.. tlsftt?W-.,..,.rr a.Tdpsuse5 eeat'rJ Malaei' ... J I. "" ..".414.. 1M tonI'.... ._....b......., .,"''.7.' 1b'; :"Itillt. !!/ ;

.T I
.... .. ",,: 'r .111 :. w ''iJ,;
..
,. : " "' k. .
1 '
.. , J. 1r", J.f\.p.ffl
% : '\ \o t..v !: .
k r. .,, f
:
+6a'i. a\( 4"rt'twf m '.-, I ,"f'L"" ,:'.'-f;;'. "" ;, ,,,.,'tJ't.t.'> ..,. ;l., '., ,, 'irf'f"Jit'.f'f; ,{ "" 'r' ,

..
f*-1 -t



y VY
>

,,,,..j1.; ,
'\' ..
\ ",
"
1 .
.
*.i V" T ."p\ '' ., t 1"

rr : THE,, DAILY SUN: '(MINES\T&LE \LOIUIA) J\B.Lfi./"' 1,105!)

. ... .
;...'" .,, ,W(?Yn"V'

rt'?:tJfje. LEGISLATURE Women: as Well as. Men Are Made' THE NEWS FROM MELROSE.po.toffice J. tit'' PATTOX '. ' ; J. .liJ"i"r I i'9 i 'o/'Ii'i'//')9 i'/''','"'',I'

E. J. KIRK I v :
:" '.,;, ., : .1\i( ;
') : Miserable by Kidney and Prosper ,,' ., , f' .Y""

r ,: DOWN TO BUSINESS Bladder Trouble. tion is in That Gay-Town.Social Func- CIVIL, ENCINEER AID SKRVEYOR; \ I Real Estate, Loans,; . Rorit#.:; !'' iI!,

I Kidney trouble preys upon the mind Melrose' April 5.>> -The Metros p wt- Dealer in Real Estate. ; 1'1' ,' : Ft; ;
; Room 412. Stockton A Dut.ct i 81dR ,U J $ ..if'f '"
-
dlcouraKes n,1 en&ambition; beauty, otlieedid a rushing business! during the : ;, .;;. .' \r
rThrw! Good Bill i gntrodnced by .... -.. vigor and cheerfulness l. .. ' \ \.. ,
:= P"u quarter t+ >*tinf all previous reoonts .. I Jacksonville .. .1.1.1't; ; ; I" ,
:lm : << <' ,
p O. Box "
+t / <<: soon disappearwhen : 1PJL (;AlSCa1'1tLRLA.Prt'nlpi : : .. I. r, 1
'
'
"'i Senator Creary. in the i sue of money orU<*r.-vii : \ 'tI
the kidneys are: ; j .I;'.'
\, out of order or hiss: 342. and paling tfty-eight money order :. -- I ihe.I .In > Leon Co. Farm. For Salo.irb'' ; v \,. ,: \
i poiatn Innrf in JU-ttngs, Us/* I I\'
The I
i EAST. FLORIDA SEMINARY BILL j easetl. registering of packages, .kttent (1n to All! 11Iahn'II. : gains iu city hoi>..-S and lots. .'.. ,> .. ....;'ra) ..
trouble has .
Kidney
'J, etc.! amounted to eighty ;piece. Thu I I I ;', ". ,
'
become PO pre -alent . .. .... ._ . .I ,:i\r\ ,.i..
amount of general mail handled -- -- -------- -
wasal.o
Special, Appropriation: for That --Insti ,lo\ that it is not nncont-
1 o.J: mon for M child to be : larger' than any previoiM year.
tion Asked-Uniform Text Books Bill born afflicted with Rev. 1.". Lawlor of Jasper was the
PRIOE L IST
ajnd: Time of Holding' Court-A Bill weall.idnevs.. If the K uesl of Mr. and Mrs. Kunt-IU. at the - _

% child urinates loooflen if the urine scalds Huffman House during . OF.EUREKA .
Defining tue week
Vagrancy.to ; I pant'
the flesh, or if, when the child reaches an
.. The Daft:; Son.lahatsee. : . age when it should l>e able control I the Ids many friends were much pleadedto Ii .S '1yl

1 passage, it is yet anncletl with letl-wet- him again. R
FJa., April 5.-The Sen-
eland House ling, dependu'i>on it, tliecauscuf The Ladirs Aid Society report .a WINE & LIQUOR COm
got down to businesr7bHIttdookaethoughthe culty is kidney trouble. and. -.theJirs.tf'tep '
floanjinl result of 415 from :ho recent
: pres- frlioulj be towards the treatment of

would bo a balines session. these important organs. This! unpleasant pie[ supper. THU tHrEAT !MUTIIKKM: MAIL OllDEK HOUSE.PREPAID. ")
tEXNIU3
12 triable is due to a diseased comlitioii of I*. M. Tolles had n very large cabbage --- -- _... -----,-_._. "." .. u _
:The Senate.' the kidneys and bl.\ t.1ef ami not to a palmetto planted on Bellsmy S Full Quart Measure.
the Senate the . habit itirt..
n first
among im a ae t j.cople anpjxise.
Avenue fronting hi. hou,,,. It will Inn .
roe introduced were the' bills of Sen Women as well as men are made miserable Per Four filar stir I
with kidney and ;bladder trouble quite an addition to the town. Ul\llon Quvu Quarts Case.: ;'

10l',1IcOar7 Alacbua for uniform i and both need the swine: treat remedy.Th the next meeting of the Ladies' Literary n"t.tI.n..J'rtulfO.II. . . ... .. . . . .. . . U fIO H 01' M 110 'IICO f ?
j'" ;ten-'hooks in the public .chm>ls a bill of I It''h.h.It.'b''L..WIlL. . .. . . . .. .. . . . .. . 411t.1 411I' asu .S16
; mild and the immediate effect Society will be on April 7th the HaIo w'ft's uk1 Ky. , . . ... . . . . . . 111 i.. 1 un 1 Iin 0 fIO' 1 ,
'1/ providing a time for holding the terms Swam p-:. \'. AI'I.leJlratldy .. .. .. ... . ... .. . .. . . 4 :a t la TOO UIII'
' by drugxist. In fift .. I lit e or the paper to be read! by Mrs. N. C, 4\111I' IhaadJ. .. . .. .. . ,. .. .. . . . . . . Slit' :t" 4 1N 9 Al
:of the
1. coon of Eighth Judicial Circuit ; onedollarsize Patton bring "High Individual; : Character turf'lra M.It .. .. ..... . .. . .>I. . . ... . . 1s1,' 4 uI. amt .t to
' Ubijl for special for cent and };uleka. :s..I'e-"fJUrlln4Y. .. ... .." ,, , .T 47& r 00 U.ro Ai
a appropriation bottles. You may "II! is the Glory uf a nation" s.O.I..httnut: . . .. .... .. .. .". ." .".."..." ". . . .. 3113:11: \ 4Na" .N
the East Florida Seminary ; alto a bill Jou"\laS.\\ t',0..tu! SiI\! .II.ro .
have'a bottle : : I
. defining sample Mrs. K. M. King entertained a largo Eureka: S. C. l'uru. CS ....:, . .., ..... ... . . .. II.., ae''") 1 eo am
,. vagrancy by mail free also n Bon* < 8 _.*_ number of her friends at progressive lurekaN.t't'uvnXX: .. .. .. .., .. ..... .. . .. ... t1S 814 .11\ MXlhatrrk. : yI
Companion bill to the last two were pamphlet telling all about Swamp-Root : ..S (:. ( ..rn.XXXX . . . . . .... ..... a h, M, 3rl'lo r a..., ,.
.
irfclutlitiK of the thousands' testimonial ix-handed euchre! on Thursday evenng. "IIIC\Yth"H IQ.. . . . . . . . ........ .. . .101 41\11 a to 1a1l0
ntreduced In the House by l.epa. Tills many Ilrnult.reNr. . . ... . . . . . th. 1h, "T .11 1\0. lir}
letters received from sufferers The lucky winner. of the prices: . . . I.
nand unnrtroukttxr . . .. . .. . iitM1 :17M1 ttM Hass: .t't ,
Roseborough of Alachua. cured. In writing Dr. Kilmer & Co., were )lr.. t'\\.I.\. Vogelbnoh.: II. H. sunny IIr.'ule su.lr 1I'M". . . .. . . :t'll S is a (1.\ It a,
TJbci Baskin protesttoSenator Brown Binghamton, N. Y.. be sure and mentionthis .A h. "%1"h.tC . . t "al, 1 M .e 11I1 It 1"I"UIe
Tulles Mrs J. A. Itetnmel .
and Miss Velert .. a (11' .. WI III tu
Iding: hU seat Wall read in the Sen- paper. Don't make any mistake, Elsie: S hn..l1t'r.hO'r disk ant ' '' '' .' '. . . . . . a Ta sin SIX' IIi
>-nj ,toge.her with the certificate from but remember the name. Swamp-Root,
Dr. Kilmer's Swamp-Root. and the address delicious supper the party aiijourned Mil From .&() to S.50 Vet Gallon, UtlhC'l't'd.1'on. .
SecFetary of State
: liiiighamton. N. Y., on every at a very late! hour. r ti eehe InbrU. uf ""I.r'I'"I., ,.,.. Rtoek .iw1 noour* a N>tll Free. rave
"he wliol.. matter was referred tot bottle. Mr. '\'. A. Vogelbach lwrlv IMI, of ll toi"ll'ii>..\ Hy. ..", .r Committee on Election and Trio! : care a pros It..b..t..11. lh"r. \Vhi..krr uml secure n bottle rr... h.ve twelve l Iabek l of C'" .11. r0
-- ------- -.-- --------- ....- Rr..ulv..uehre party on Friday after N. l'\ Corn. and krcurv It IM'I"e free save !webs 'at.I" of Ear.M.: N. O Apple vl
Itr.nd, .. ... Mallarti..eave
and.eeureonetootlefree. Save twelve I l rl of eureka
t&e. MRS. ACKLEY ENTERTAINS. noon, six tables Inking tll! d. The DI,. tM.ul I.- fir*. ITtijf nf .Il "iMiil.. N>'/.tit a' vun> '*",'. store at. rib per rallna" Met n
prize winners were Mrs. f ilI(. w llsm! than M l luil<>Uvrr<<<.. No harre. for Jwn... lx>ir..>r dr..... All uf my 'HitU are '
Atlantis) Atlantis I Atlantis! lull Di"."u'?. All\ .t.II.llltt! lr.mlnf wliUklr. tot uvr my par itl Kti t<*r ,;"'hk-IO
% Her North Gainesville Home Scene of lyn Mrs. J, \\'. Johnson Mr. '\". 1 Arlington Runt I IS I..n m lb for jttu. MtwlnM.e1 UI& .i<,.aIC'IIU'n. \\'. fttmt rurry Pb..aiWr< 3
The great and only AtUntii, whose and minor, than th...> "ntI. ..I'e'i.llees on !lurirc .llIanllll..1 peeked am.ea d.. '
Happiness Gaiety. and Mrs. S. lllllam. Straw .Ylred Money rrfuiMlvd' If iTu
Exhibitions if both have delighted I is the people A delightful afternoon tea party.. I berry ice and cakes were th. refreshments : UINK: A LI UOU COMPANY,
hemispheres to
at
appear given at the home of Mrs.- Edgar Ack petrel at the close. of thegames' 1M '''' .:ST HAY !STIir.rtT.: JA'I\NVIU.Ia! VL.4.
|he Opera House for two nights April
I Ivy. North Oalnrsville. There were .
snd l 8.'Ladies.
assembled )piss I. E. Webster Mrs )1 r.. I'. J. Darlington and :Mrs. E. J .

see the beautiful Japanese tv. H. Palmer Mrs. Grave,. Mrs. M. Whitehead were among those vnlrr .

Imooa which was presented to Allanis Dor man. )Ir.. Koofille, Miss CJirardMrt. taming friends at dinner. r' t: ,rrdr

by the Emperor of Japan after! ap- : Robb M. I)., Misn McCracken The line weather is the cause of . zn
earing before him. On exhibition
in Mrs J. D. Turner, Mrs. Wolf Miss E. many picnics, the public park at Earle.
indow A. L. Vidal A Co.
o/
;
A. Larzelere.It ton being a favorite spot on account of
A refined entertainment. which DROP A POSTAL CARD TO '
you has scarcely been iny privilege! to its pretty surroundings.: .. Marion
in't aflord mil .
-to *----.- be entertained In so artistic a man Robinson gave a picnic there on $at*

')Iie. Susie Lou Ellis\ a charming net, each little detail In ,Us ingenious( urday in honor of her friends the

oong lady of High Springs, was shopping ness showing the hand of skill dictated Misses Clara Corbett! and Nannie H..v-

in the city yesterday. by the soul of the artists. Mrs. ell of Oainrsvllle. All report having Sternberger

AckUy with her inimitable gracious! had a most pleasant time.

sweetness, assisted by her charming 1 The members the Melrose Heading

friend Mr. I. :Webster, seemed to Olub and friends had a pionio uu _
_
UlCiOO AnDflODIDA exhale the fragrance/ of their person Monday at the same! place, which also. &

: alily upon all, that each was so bright was a very enjoyable affair, the steam Phillips:?
'
and witty, I could not point out! the I er Avert having been chattered for the Tit ____
i
stars, but call it a galaxy GCKKT. occasion. ry1'I

UMlnO[ -- --....---- -- T. b. !:Ills. Jr., of Gainesville was In 110 West Main St. N.

Last Hope Vanished. town on Saturday on Irgal business ,

with the justice's court of District U. .
When leading physicians salt that
".. M. Smlthnrt of ('..Un. la., had Ins Rev. U. D. Frank l held two services And they will send a representative with,

at the Episcopal church on Sunday .
la Louisville & Nashville R. R. curable consumption hi. lat bop va .
which well of Wall Paints lie.
t nithed ; but Dr. King's New Diteovery were very attended, samples Paper, ,, .
'
At an election for
delegates
to the
Pullman for consumption coughs and colds diocesan who will give an estimate
on
convention next month II. you any
>nly solid train with ob- kept him out of his grave. He .sy.:
S.tion and library cars from Florida von NoitJiy and $i. rnutou were eject
"This great specific completely curedme first-class work have to be dons '
'. Louis, Chicago, the West and I ed. you
and saved lift Since then 1
thwest with much quicker time ray .
._ by the way of any otner line. have used it for over 10 years, and eon T UJL
Ill meals In dining' car-service a la eider it a marvelous throat ind lung ....<<..."1 It....,...t.....

e. Finest dining cry' service in the cure." Strictly scientific cure for Tti"1 Inn* lifiM*
th. I t had "'OJI" Into rttfL &
cough, sore throats or colds ; sure pre Sternberger Phillips
aye St Augustln daily, 8:20 a. m.are One uxmilnK a little 'm'llh..d..J' manflppoarc
i Jaoksonsville. daily, 9-.3O a. m. venlivn of pneumonia Guaranteed raml..lAnerK. ,,
'
licago next day 4:8O p. m. IVOc and It I 00 bottles at all drug store. "
3l Louie next day, 1:35 m. Trial bottle free. 1 "I'vo just married my fourth wife
p. 1 Artistic and Decorators. .
jgb Pullman drawing-room i be said" "I'm entitled to a bounty, Paper Hangers :

|Ira dally from Jacksonville The Dally Sun for $9 per year. aln't .r'-Chkago Tribune. .

.L S:05 p. m. train to Diralh.me. - -- --. -.. -- -.-".--- - .- .-... - . . .. -- .. .. ... - . . , .
try
> St Louis, Chicago
'#'. 8:55 a. m. train to P<<'D- Take The c

bile at1 New Orleans Atlantic Coast LineFOR . . . . . _n.. . .... .. .. .. . .. . _. _.....__...._. _._...
fserrie is desired ask fore


at. L.,write Pullman A N.George reservations.eto.E. lierrlag, ALL EARTHLY POINTS Gainesville & Gulf Railway CompanyTHE 3


Monger Agent,Jaeksonville I VI.a Via Vi.11Dupoal FRUIT &
209 est Bar street. ; L' t Dupes S 5111 th \\1T ttop..t. of VEGETABLE ROUTE

'- -- - ::w. as S JaeksoavU.or =I n es t /Noayom.n..lr>na. OF FLORIDA.

Tim.. Table! In effeot (bbl 23.1KB.No. .
H. WATERS -":- _' . ., ..r. .+..rwM..4ew.w.... .. .. AI ."' -__ _s.m..wMYNP" 11Ky a
Rapid Transit and Unsurpassed Service

*. tern
PRACTICAL Time Tab a In effoet Jan. S, 1800. Yca. 4. !CI). S. No. I. No. CoI"

(, Depart For GAINESVILLE; Arrive. !roots Iciest Dally DalHTATlUJfH." I Dally. DaU". JCzs pt 'f'Nnnday

------.;:=: "' .=-- sea tr ,
>ER HANGER -,4&pm t : e--7-----;
3 [I High Spriag S 811 a ra eLv

Dally m.dlate PoinU- _.. /ally P H:}L., I' W Lv A M 1 Ae.1' It AI A )1lAtl'M'

.t"! House Painting l2:40pm Oea i. Leeebura and Tampa, and It-tOpm 7 1..1. .. ... .. . ,...... .Ka I ffl.ld... ....,. .. .__.. .. . .. . G U,

Decorating. Intermediate ToloU 4OO .. . . I . . .. ... .Irvpj| .-_,.. ... ....... .. . .... ... 16U
and
Daily Dally 7M 7N j. . . I. . ... . . . .. . DaoRarvaa; .. ...d. ..... . .. ...e. f btu

1114.e + 2 U6 pm Falatlus. Jacksonville, 1.1011" 7H OOM i . . . ; . .. .j.{ . . . .r otjtrisld... .. err ...... . .. .. a1/
Geer .IDeItJlIc', Fla. I North East aDd West 10 .I. . . i . .. ..r-! ..... HUkman. .. ...._... .. ...... . . .. . a" y'D
Daily I Dally M .I. . . . r.. .. ..._.1...*..... Lak.lJllUG..too.. ... ._. .. .,. . ,. .. . a.( ..

line of Paint and Wall Paper 12l&am High prints, Wayeroe, Savannah. Brunswick "Ia ftH ,) "I. . . . . . .f.! . .. Ml**..*?? ... .. .. ....r.5. ...... y'JI'e
sk at lowest priers U> lb. trade t. AtlaaU all Point i 1 pm lit . . .f/ . . . : . ,...Tao..... . ._....,....... . . .. a .7 .

a. --- Daily. -.M ----Albany.- - -"--" .'.-,- --.. .North. ._._-_East West.. I Ally.. H.44 I; ... ......:!. . .. . .j. .. .a. . KIrkwoed.w. ... ,. .... .... 101\
-- N, . . . / . . .f! .. .. .. .. (J' .. ... ,. ..... .. 6eJII)

1:Upm }( ;! N COM '. ......i/ .. . . ... . ... eIw.t.I.. ... . f .... . 'e, a
Dally I' .Qeb.U..ltkaDCIpaa.cICitra( Dally: } 9 UB I. . ..... .,... . . .W*...b v t... ... ...,,.. .. .t. . ... . .,
I1
J .. ._ .. 11 16 y.'i., . . . . ... . .Jt.H'Jiy' Point. .... ,. .. . ...... tau8fiAr '
- -- -- --- - :.. . . .. tl"f" ...... .00
-
ISS n. nORTOn. SU&amDaily I f'"l" : 1120, 11 Ii Lrf!. 4 30 1. "'lalnarviU ."".. ( 20 A. t 40A" Sufi .../!.,

High' epringsInterchangeable : ft 40COLT. . . . t1 M I
l i 1JsI11 It M t {1813 rkllarrty..I. ...? J. 210 :';1 i ii
.%.Monday I : ... !loadal i 12 tjQ i I' M 7 .- t:i.. . .,_ ..lyrll.........." 140 lie W I $41 ;;j
.._- _. -' -- .. - --- -..., --- -- ..IIJ/) ti f 7 u : _... ....Utaha..... ,... N ,2 1 12 tIC '

: NOTIONS Mileage Ttea .U.I'.i.WU;; ocipal < sates:.tb;; ; IS 40 ,7 WAri) 7 9s ; . ,Hampton t'tt,.... .. 4910 1 to 114", 9 1'j ,

i railways. th. Boothrn Htat., a\n on sal by the prla.lp&lTtoroogA "C..Ia. . . . .176:1| : !j 14 ,!_rAkeItQtlAlr,9H.4Ir.712 u..,:a :\'j "
."1 Pullman al<*.p**' Port Tampa to 9w York, via .UI.44 tkout . . .r ..?. . . t1l 00 .: ..Ia1.1irJlOGYUr.! J. 0.. W'. 1114 ..::.... sir. ...hr, ';i Ir $ :"I.
G AND Lie ; alo vU AUantte Coast Lin and 800&..... liallway.. . . .1 i ft 40 1 M i . .J..01 '. (I. iII, djb... 124 31f" i.I i;a\\'I: ;t.t' gtlirf.I; r ,
.uti For eosopUt "'Of"I&CIoa. call MS . i. I4 pi. _..T4aJI&5.ft' .... IP a., .A.. L..... 1.4i. Pi',1 ,M. I 1I......".! f "NOVELTIES. J. A. GOODWIN. Tlcfcrt a.'ne-n'U" . ; ;;; ii io }n 10 a ...,..Vstdeata. 1:).8. 'IUf; 4 A. A ;' t ... \:
.
Ajeot. J.y,. j 4 10 .. M 0 *.L -. ,' '. fl. \f, !l;" ,\
.. s .. ,. aeon ".,..' 1 ::r-.r'.r.'f,. ",. ,,'!,\1. '.., ,I: ";
Addra; .. Y.S a; T'* P,1,! ........Atlantac rice.... .TNr. ... ;: ; <.' \'\ 't.,I
,
'r ;
FRANC C. BOYLSTON. Dt.. Pai. A W, 8TARXT. M .y' e. ,
.- t.l" < glkttl.sa' 1. 'W. Hay at.. Astor iTaliilaf. Ja.kj.MsviU. rla. flj B'/t.; 'i""; ,. .1
0. M. )';EMERfiOS' Traf. ML?.,. W. J CRAIG oV.. rue, A... ea ":::i A i ;" tJ.-s: :.fir :,(." 'f'" ';

: ,:T. .A. A1I1IONS, WiblltfaSk: >> :(. c. Wools(tan.1f.. o.r J TT. HILL Ac nt, .1.1. .:..: ; ,. ; ,." ... ,"" \ 'J, ,
.
,
.. \C' \
.. \ I ...... \',fJ'! ....., ''1't,1'0' "I\, /,( \:(!
.w J1.1I };, :W>k "' ..... " '",, ' . ,../* 'r:,' ' ,,',"
"
mt.1 ., .,!! : "', ,' '!-.<, " \ I''NI', "'.1',;,,arth'a'
.
.... "1<1 :'Zfb.()#'. . , .1 "
iP .J7'; :: \ ,I I
,'
rir .. '
... U jJ.t'"
Y r d of'' '' M' .;' .
j ''i .t' '' Ak"J r. '

1 l t...:,f a::'.r'" ''. 't..' '.4 '- .t"i, ."'" 'M'f'' ;.' .SMd, ,t' ftc'. ))1.r4! J'J't'. .;.+ ),i ii ., ,,
I '''\' ' :' '' \. ' ' : '.' ;: '( :
.
.. , >
?
.. :, \ :- ,, ', ; ; -. : ;. :
,
: ,. .
t.



; I m.,nah ;,




THE DAILY SON:

. ----------r------- --.. 'L '" :
-- --
-
,>> ,,".,,t'','L.! -- . - of Alschaa----- -was- In I E.K. MeUae of Palatka baa accepted CatVe en >Cancelling: Contract : 4

".<".. I' ' Rer. W. C. Foster yesterday, lie 1 a position at operator In ibe dispatch--' Ft.: Worth, Tex., April 6.-X Special Wlls'itrN M I r\:\1
CITY AND few hours
'I" 2 NEWS\ OF the was city en route for a 'Mlnanopy: where he er't office of the Atlantic Coast Lin*. to The Record, from Oklahoma topedStater Cu:; , ....
of the wben Warren Bennett .
it regarded aa one says
Mr. MoRae
friends for a day or two. ,."
visit
J' COUNTY CONDENSED will roost competent operator in the employ deputy marshal for Osage Indian The I,
Don't before you see Crawford & mancattlE' }
buy -
nation announce
GOOD RQ of the
Dvls' fine tock. Tby alwey carry a aystetn.Mrs. will cancel their! contract will Busy
of tine mules and hortes. A fresh George Evan departed( yesterday men
Jot .
of General Interest Gath- i. Wait and buy the government, for grazing lease, Ii Store. .
Matter* Saturday.
GONHEG t ] car to cum for Tampa, where the was summoned .
dealer d&wlw. In iview of the fact .. -
ered by Our Reporters of established. on racoon of the Illness of her the Osage country \.,

# After brief visit to this city J. B. mother N"V.. T. Gibton. It le that the dipping trf cattle Is so. pros Dress Fabrics a .a1 ,'
lIe says a large t .
operation.
the Carter & Dor- carious an
Fw Pate representing the found the condition of the ;
ie Not PERSONAL AND SOCIAL ITEMS ough Music House of Valdosta Ga., hoped herd of cattle' brought from Texas< lions ,for Vt1om .'...JJ
,
and 0-- returned to Jacksonville yesterday. patient ImproYf'd.O was damaged greatly by the dlplng .;.

'" What Has Happentdand What .Ooing and bliss Maggie leer Chat, \Varren has just returned and the trip afterward to the Osasi Wean n't. ,
/ Mr. 8. A. Patterson where he
to Happen Told In Short Paragraphs yesterday for from Jacksonville, nation. A recent order ot,the bureau :,
McCarroll departed went a few days ago to >are an operation of animal) industrymak'es the dlpplnj '"
So That "Ha Who Runs May Read"It Lake View, where they will visit relatives his throat. The the :
performed Osage .cou
upon of cattle going Into New Gingha4 i ; '
:
I
S. Jackion.Friend's ,
Mr. and Mrs W. .
In The Sun. operation waa performed by Dr. An- try compulsory.Mob ,..
Lsdies'ealingcard. la latest styles of Mrs. J. 11. Brinon, who dradeaapeelall.t.and. friends of Mr. -------- That Wash. ," *

at San office. has been Indisposed with fever for the Warren wUbe gratified, 'to learn bat Foiled by Officer. e.w.Pe'realest
weeks, will I" gratified at Memphis. Tenn.. AprL C.--Ato speelal N .
U. Matter of Waldo was in the past two his condition ft, greatly improved. '
A. the Information that she ii i out Again.It's _t .: __ .- I the" ''News-Scimitar from .Fulton That "XVatfcu .
city yetterdsy. Dr. and 31r..'Clyde L. Carter arrived attempted
that a mob twice
and if Ky., says
Get your tJ., ball goods at \Vnlt' ; better Tale ud than never Blui- Ribbon Tue.Ca,.night via the Gainesville and I to force the'jail here last night in an New Sp ing'Dress'.G' t'$s::
2td hate never
liloycle Store. you Golf from Atlanta where they were effort to. lynch three negroes who arE
I.a i I. "
now
E. 0. MeMahan has gone to Alachua Lemon and Vanilla Extracts: married Sunday, mention of which has charged with shoting officer Eater in all t.be.1afel' weave.

i on business for a few days. good time to try then already been made in Tbe Ban.! They Mayor Wall members of theclty coun .
.J. $
At Dry oak and pine wood for tale. J. James Holder of Kvchrlle. member were met at Sampson City by Hon.and cl! and prominent; citizens, defended

N. Bone da cf the firm of HoMrr & 1'ope, manu- Mrs. 8yd I.. Carter parents of the the prisoners and defeated the mob Special aria'

J. \V. Kngli'h: of Tacoma was a visitor factureriof naval stores wa transacting groom, and several friend'who gavethem The negroes will be taken to Hickmanfor

to this city yesterday.For business In this city yesterday. a',oa..reception. Prv Carter, it safe-keeping. The report hat "Our entire stock .f Bags .frem,

f Rent-Offices over ChIU,'. (1. L. Thompson who ha been! residing will be remembered has just gradual been circulated tbat they were lynched the smalleSt size up to 9x12.ft.: ,,size'

'Li / store. Inquire It. II. Porter. pith his family at 603 North 'ed from, the Atlanta Medical College but this was a mistake. trill, be .<
JfcElbln of Albion was In the Garden street, Juts moved lo the : and was doubly blessed by receiving jIJ11COlIn

btringfellow cottage; East Orange a ''wife and diploma within Water Notice. .
.
ally on business yesterday
street. two days. Friends here extend congratulations. -
Blmnnton'a Wonderful Salve for .a>e To city water consumers t Your MRS. R. WILSBJI.
visit to
After brief but pleasant for June
quarter'ending
water rent
by J. W, McCollum A Co. .
their .Iftl:'. )Ir.. J. F. IIi1!; Mrs. C. Ii. C. If. Dunaterof New York special 30ih, It05, is now due and payable at

Mr. and Mrs. M. A. Dairies of Cyril Carter of Ocala. and Mi. Belle Chilly representative of Foley A Company, I this office. If not paid on or before --:.: - ... ,..-

were visitors to this city yesterday.W of Mieauopy have returned to their Chicago, manufacturers of Foley'a April 10th. 1905, your" water supply

J. Hodge of Alachua was a visitor hoin*.. Money of Tart who has been in this will, without. further notice be dig- T. F. T.HOIIASUndertaRin.R.

to this city yesterday. J. 31. Thomas, the successful salesman city for the past month with his wife continued. Fee fur turning on again

Keep your bowels regular by lh- use for the Sheffield Iron Works of and baby expects to tetarn to their $1. By orJer of City Council.J. .
; Liver I M. Dei.L: ,
of Chamberlain's Stomach and Macon Ga., departed yesterday for home today ')fr. Dunater made The
"' Clerk and Treasurer.
Tabl. ia. There It nothing better. 0.1 City Co-
tale by all druggist/ Rrooktville and other points in South Sun an agreeable parting: call yetter Gainesville. Fla., April 1st, 1905. ,
Florida on bailnets. da,. He stitt't that he came for the
Mr, and Mr.' J. E. Thrasher of
Micanopy were trading in the city yea Engineer 11. B. Anderson of the Atlantic baby's health and that the little one The Job printing department of The .

terday. Const Line, with headquartera In has greatly Improved. Both himself Daily Sun is splendidly equipped and

Js f4. : three deeds 'alalka[ was In the city yesterday on and wife are well pleated with Gainesville the work guaranteed to please.

enclosed Lost-Saturday in ofllcial night envelope. Return business connected with tbe division ,and declare it Is one of the cleanest FULL LINE OF

to Kittle McCray's I latiraut.. superintendent's olllce. healthiest cities they have c1v rdlltt'd. ,

Bridget McCray. Si George: Wright, formerly a merchant NEW OODS::

E. W. HAD ford of Fort White was of this city, but now a residentof - .__._- The CashGrocery .

registered at the Brown House jester Lakeland was at the Brown House tj*.For Sate --

day. yesterday His old friends here were A complete drag store consisting of

Attorney Hyd L. Carter departed glad to greet him again. drug$ suns shelving, counters and pre- Personal attention to aU .matters la

yesterday for (Ocala on provisional The spring millinery opening atHyde's seriptioncan.drug*, soda toun', .'C., Co. this line. Mall and telegraph order
f and if not sold at private sale will on
: boslnei will be of interest to the ladies. promptly attended to.
April 1CL be told at nubile auction.
Imported bats and bats of our trimming -
On Saturday April ALta, 1006 we will E. Ti.. Voi-t.
and all kinds of headgear for the
_ line mille.and hones. Administrator of Estate of 8. B. Old-
have a carload of
ladies. Remember tbe dates Wednesdsy
j
R. EMERSON & CO.
Walt and tee them before buying. and Thursday, April 12th and 13th. dings, deceased. ,
r'
+
Crawford ]Davit.) dJcwln . Gainesville Florida
k r 1.1 Large stock' to select from. d&wlt .

t ti W. T, Williams of Jacksonville Captain V.*. T. Jackson.. of Bronson We have the Choicest Goods

pending a few days in the city on las retarded lo the city from Wau. .W'
on our daily .
business. burg Lake, where he has been looking h MEW YORK R. MeCLELLAN

For Sal*.-A nice milch cow at low. after his grove interests He stales IiLN13.
..... ....
eat prlo. Also hare a Frankllu typewriter that the trees are full of bloom, and

and a . -
2d gain. )1,*. W. M. 110110".". dtf Best White Bacon per pound . ICXj .
season
Captain and Mrs. 1.. F.. Marker have Durkee's Salad Dressing . . . . 26o3ueen
returned front l visit to Jreen Among the visitors to this city it W. Olives . . . . . trio
pleasant> FLORIDA.
| . . . . . 25o
D. of Jacksonville travelng CHEAPEST "STORE' ON: EAxTiIMsnnsn's 8 Cans Cora "
J 1 Cove Hprini; Yarrington 3 Cant Peas, . ... ... , , . . 25e: -
c ; Nicely furnished rooms to rent en representative of The Times- 8 Cana Tomatoe. 3 Ib. cans. . . . 25c Funeral Directors and
3 t suite. For particular apply on premises Union, Mr Yarrington was formerly :rCans Roast Beef . . . . . 25a
Turner hou(', 307 VVrst Liberty In the employ of The Sun and IB one II Fresh blot Oranges,not frozen, 20o Licensed Embalmers
_ street Mutt desirable location In the of the most vnergetlo nuttier in 'the per dozen. ,
city tf.K Fresh Onions( and Turnips. -
Stale, lie will
doubt
t no make a suecr Grape Fruit
r+ U. (iud.ln of high Spring wa .. of hi. new position Fresh Extra Fine Coffee. Manufacturer* of and Dealers In
Picture Frames, Rubber Stamps, lit
among avUll those who 'favored. Ualnrsvlllewith Ur. J .>. Watkins, commercial agentof Borated All, Order,Fr''inptlv Filled. Uettfft. Unhelsterj. Eaetmaa KeUks ..
y..tarlaj.WantedLady
the Gainesville and Golf
Hallway, Phone .176 tt Cameras, and I'Ja.t-cra-
or gentleman! of fair has returned to his home at :Micanopy: ,
education to trawl fur a firm of $280uuOeftplul. ,- from an ofllcial trip to South Florida. phers Nnpplleti.Onlen .
Halary, ".012 -
per year Talcum
and ... lie reports the groves in fine condition!
eipens | raid .ekl"dd r. bv Telrrraph er Telqla"-
llo. U. Clows: Ualntsvllle. .Kla.. :2illev. / and the trees full of bloom with pres- ,fare You will receive prenpt. aUtaUen. .

E. A. Gray of Mioanopy, pastor peels for a big orange crop next sea The UeaaUe Article" ,

of the Methodist church at that |plane, ,. son the Best Talea.r.wdrr -

was In the city yesterday.Mr. - -- --.. - ... ---..--. -. .... made, at Insure Your LifeTalk GAINESVILLEPRESSING
and Mrv, r' II huller of Jack'soitvllU I

w.r. rcititlvrrd at the Hrown READ THIS. Per Box llie

house ,..,..rda,. Over the CLUB
Hleveoton. Ala., June 6 1901.lr. .
John /.lrt>ut>r of Kochell J cue of Beth Plata( and Vlelet.
)) K.V.. II all. S,. Louis UnSIrI -
the pronrrMlv<< rrtiileni. of that |>lace.wa I have been a great sufferer from bladder New IO YEAR POLICY
trailing.. In the oily yrtlrrtlay.Tlie trouble fvr Iwo years and mv ease fader Sew Xaaajremeat.

ladles o( .\I.<,hua county are Invlte was of a very serious nature compelling .. .r the. . CHAS. R. ELLIS, Proprietor.
mco t<) have several painful and
l tu aiirml Hitarrat milUu.
'....oitij at U. W 11Je'., Wednesday ryo dangerous many different(x>railont.remedies.1 have alto I took lakm Hirsch & Bros. Mutual Life JIB I W. rnioj Ht. Plane'Uti ( .
mud TkunUar. llth
April and 13th. A Root
Swamp for three and
years War.ner's -
tine
display of spring and summer hat -
Safe Curt
and mllllnvry novelur two years and they only
Rave itinerary relief After having ..WITH. .
J It, c. .,h..rl. mo 0' High :S|'rng.! two u&"ralious and.! preparing for the Umbrellas and Membership $1.50

r, 4 prnrr.*lve merchants' was trau,,a<,lIng > thin!, I saw your Texas K'onderadr W.
vrru' rd and purchased bottle. I 1 B.oNMIBOK? J
busiu.es In Ihi clly yesterday, .' immediate relief' a and hat eon.unurtt Kot.1111O.t : special Per Month.

W."IIC'''> of loch lo ta ouv of shypru.peroua to i int|>ruv* ever slnoe. Aly dllG.fl P'.rlsolsEveryone W. L. HILL J) Igents.OAII"4B5VILLE. n
)" said my bladder had .
,; : fanner* of 'that er.tiun. grown lo.Klhtr
yV tilt in three ptao<>'. and I uf.rnnK t -
was aou&tu' visit.r* to th... ('It, yes.t.rlsj almost was FLA. 1: ( Itaala l)jel.r,.PrmUiia and TaU.rta.r. -
death
No man living . _'.- _._. ._.__ __ _ _ . Ill w.rk
'can say n\ore\ lhau I can "1 for your fully guaruu n. guarante d. as well all

V1 I..t\.r ,"I ::0-,0..1.' } ta sgeuts T.u. Wumlvr. and.! 1 call it a world'swonder tetxl. just received and ?e scads. 'n.pl artce.
for r' lrt>aiik...Mir. .. ianU and I hop all who .ull"r will .
K att gasoline THE CONTINENTAL -' - o__ ... __.__
give' II a lrial. sale. These
eeainea liltj. kuluinubtU. IM>.I WUhiug you sueees.. I now on
",..... Write t tot ?nti and he rh.. to am Your truly, are otJghtdirect l from'"uctor"t Cirr-RESTlVHAST. EE.MITH'S
11(0.1.. or at New Homo W C. lUvta-t.
i
ew.ng S
apply
and the low-
mae-b'' Ii5 s esvill.. "1 .. MOUNTSt
V- ----
J. I.. MrJIm I of M"t...jilh, nlfmwr est prices are named. WELL

wf the tlrmof J L Mrtllin IV naval l llorv A TEXAS WONDER. i
Come ) and
Df.raior .an the. l'"ty onbnaib.a l>u" mall bottle of ih. Texas Won- early: get AU the old t tundards and!
_ ywl.rday' d.r. llall'sOri-al Ih..ov.ry, O.f4I. all ftr>t choice.Phifer. he
choicest of
I khlra., and bladder troubles remove* ; the new only i'

)Ir, and Mr. p II. t uiuu of \lmhiTrnu srav.t,. earve diab U>s. seminal emits' is issued. (', {fAJt ,
)> and )Ira \> I: Hnlltll of .,,)n.. weak and lam beeks. rheuma- f.
to see them a. sansei iSI'';
tow and all lrrKuarilir! of the kM-i they .. ,< ,
lUrutiacbsni" arc h.n" > i>n a titt neja and bladder la both displayed to advantage in a MM, '4I

to )1,.. A, K: lasts t "Om... ",.'..,.i.. bladder traeW.s mew and,In BrosIS ... .

r'f Hovees end hal*.-I I .bat a cattoJ: ehlhlr.e-Ill U If not sold' by your drusgirs SPECIAL 'MOUNTS for L F.':S.School : ::I
wet t> mail iT
y oa
r.e.tpl .
$2
f h or" asd. mule at Edwards' $ Children 's '
t.a One small bottle" is two moolAs' tr..au and Babiet. r').t} (
t le.
N Among the lot ar a fw saddle meat and Uooi IS Corner & a
hursea and a aumter It' sttoog PU". U,.s Kra"t \fails\ 1UU.to ale p.rt mono et a Fine Fadeless FotograrflFrom ;

healthy Wdl be,sold'IUP.AU..o4 fares lI"It. fa.iur.,. 1', O. bell tl1Y. el./Love Me. GAINESVILLE mess..ea.yaeat\or h.roteedq. ;l
at FLA
god sualne, &la.rvesoatbi... t'. I'*. 11 pn-e.C''u fall. | : to.a4 lor "iIDODial." Sold b, its) .. htll ......... Bete t..... Loekti to LU. Si... ,tl'f
i drtaRgiil.. ................
Pli. ..... .. ..... <- -....... - .i SMITH'S STUDIO.w
i .
e' l]\

( .
4"', "{
"
.'If' (
.
; 't.., \
., ,,, . ..\ .JIt .... ". ,., .. ., ..- lIl!.H b..,.-"'I i3 :'Y.'o!' '.In,, \
.
---- .. Ur ,,., .' ,. 1''. .'" -v ,ML-11- r;' x" w,- 11"i"Uf \ "t-i-....
< "
.... ., II&v. v fit' v'k ,: ; ,.. > ,, .. .'4: .
.\ tL. \< l'tt E fJi..r.\' : 41'' .oj :( .of. >Jf. ;( r\, ,.} "
1 ;,'w,< t....,. ...;.,.' '.;\' f;." ," -. ' ",':""i', ,c ."7w"',S1,.. ... ,. .:Po,;, ":"" ';" ',.it,;. !fi',j-1'i.. h':4f/\: .. ,:ri ; 1.5'.1.t1 '. ..'\ '., t tYav-,\ .. ".. ( v.t.tWt'd.:'

..... :'" """ ;'. .
"wrw



I

';\)',.;:;,:),,,' ,.',rIft"If.\" """"I' " ,'
"
,I 1'" "I .' 1'\1
'"'' !- ,
-
,I .. ... -
(I' I, /
." .


A;''e'' .. -gr';IIIJP""



! c: 1\, ,..,, :. ., '
:t "'
: V
;
..... ,, ,..It' .
: ..' '. "


Published Twice a Week--: -Monday and Thursday .

... .- :. --::-.=: ---:-:-:-.-::":'::::::'';: ::'. ,
.
r - --- :
- ::: --
-- - -- -. :: ::: :"::' :: : -
- --
12 GAINESVILLE FLORIDA. : THURSDAY? ; AVJUL I I ti.; UHH'\! ONE DOLLAR. A YEAR
NO.
..XXIV. . .. ___.___.__ =:= :. '.:' --: 1
---.- -- - ------'----------
-- ---
'-. ---- -- -- --- .
r
'
- .: -- - -y--
TWO KILLED; THH&E INJUHEO. peers. was analysed and both the RUSSIA PREPARING.
.
; HON. PARK TRAMMELL - GOY. BROWARD'SMESSAGE "institutions, of higher learning" aDd .1

L Fast Peaaenger Train Collides Wltr: the common schools, especially the 1 utter "

Freight on Min Line. READ received their full. \ share of attention TO CONTINUE WAR 1 ;

r WILL, BE PRESIDENT Cleveland. 0., April &.-A fast' eastbound The "formulating; and copying' 1T"

'. passenger train'ou the river dl of the school\ laws into M uniform system -

; vision of the Cleveland and PUtsbitrj Senate and $Hous&0rganized and embracing\ whole nohmn of 4f
Show No Sign
Nicholas
,r '. Caucus at Tallahassee So Declared Fljer I Czar ;
road known as the Plttsuurg our public "Hiuostion, is recotniuen*

*>. : : At Meeting Last Night. collided with a westbound fret&Ut atCbMonia. Adjourned Until Tomorrow. dad I. as also the passage of laws providing Of Ending Stru'!gl*. '

.... . O.. to.lay! resulting; in th! fur the adoption of a uniform
death of two men.- while three otacn AN ABLE STATE DOCUMENT system of text books. This Utterrvronunotlatioti
y 4 4'' SENATOR WEST IS HONORED 75 ARE KILLED BY EXPLOSION ;
.' "\.',, were Injured. The dead: --- is practically directly ti
-
I-tfward Tulrer engineer of passenger C. M. Brown Occupied His Seat in the III line with the bill Introduced by Sen* and
I Withdrew in Favor of Trammell and German Prince Visits Russia
traJn. Senate-A Protest Was Entered by aloe McCreary lime last session ( UKW: ), i
jior,,; Was Made President Pro Tern-Gen. H. C. ,Bin Ing. fireman of 1'\Mwncl Baskin-Action No) and which received such favorable Causes a Sen.atlon-HOCOO Fresh

121 i oral Gilchrist of OeSoto Nominated train. Senator-Elect mention throughout the press, being Troops Leave for the Far Cast-Lit ay '

for Speaker-McCreary for Page. The Injured: Yet Taken in the Matter. referred back from the committee tie News from Seat of Trouble.

'. ..,:. T. C. Mclntyre.' Pittsbiirg, passer.' huw"Vt."f00 late fur its full consider
.' Special tone Daily Sun: get badly hurt; J. N. frown of Stvu Si>ecUI to The Dullr Sun. alien St. i'-UTHliurt., April 5 War Mla>

.1;. Tallahassee April S.There was a benvllle 0.; O. J. Tlchrnor. of plttk, Tallal.a..ee Flt., April; -i -The Sen. titer t?., "':i 'nn itnUxy declared! that
charitable institutions,,
The State
",yt tI, great feeling of harmony in the Senate burg passenger, all;htly. ate' and House of Repre..*utatives met the insane asylum State reform the rebuts of ltinil tH'unt >rmait
;-r tbla evening, with the result that I The acident was. caused by tat and organized thin morning, alter school and the hire of convicts were l.r. for war lust rrh\I abroad are 1 l '

'4fir Weet realising the strength freight train over running a siding It which an adjournment wa" taken until hall-h'lIt and 1 grew out of thu ilecUnatlou V),
Senator discussed and Important extracts
: I going on to the main; track whenli tomorrow afternoon.Hon. of th" [ort1lu l otfvrH with which 'f U
: of his opponent for the presidency of was struck by the passenger whK.:.1I O. M. Brown iH*'.oiad| ; his teat from the new convict lease are quoted. the war ottlcc mid the Bdintralty have ,

t the Senate withdrew and in thecau- I was moving; at a high rattt of peril. ia the Senate. A proirvt' "was' filed "1nato.elt'c' One clause of this |I".*.. provides that t"'t-u swMniHd. lit' insists l that there' .

1 j,i .cue tonight Hon. Park Trammell ol I The members' of the freight crescaped w Daskiu, but as yinoao- the new hospital lessees, .farm must and purchase equipmentnear the, has lu-vn h.1 relitxutlou In the preparattnna ". 1 i:

1,' nominated by acclamation, injury by Jumping.} lion was taken.Qovernor'a. present continue\ the war hut says '
Polk
: was, tcala if required to 1.1'0 by the
: ;ft;.. tllt'r.V III lu no nm mubllUatlon
*; while Senator West was elected in the Message. citmtiiUsioner of agriculture.Under >
NO EVIDENCE OF POISONING. prfhcut ekplnlnlnx. a* IIII"'t4',110 !'atB;
|c, tern. The of His KxoelUncj: Nspoleoo brad of "reunions it I.
tame manner president pro I message the Illllt'Alch{ that "'\.01,10 itxK>i>* of

;il.., Gen. Albert W. Gilchrist of DeSotc Death of Mrs. Lamed Investigated b) B. Hroward, (insertion of Florida recommended! I Fir-t, Tnat county last mobllUutiou have already starved : '. ,
chosen for Speaker Coroner of New York. to the Legislature of 11XXS began commissionerxercle a more careful fur the front and that Instead of '\ ",,'
unanimously
;
was New York" April 5.-A coroner! by this congratulation : "Never in the examination of applicants' rights. 'immobilizing trooV4| Ih, "ne will be fnt-? { '

!, of the House. U. Walker defeated physician who performed an autcpay history of our State wire all of its material Second, That the applicant should huh)' A pmtlon of tales yvsr's cond {i/

I j : Bevia by one vote for reading clerk.Master on the body of Mrs. Ruby I.aruc'd conditions more encouraging. have speedier" hearing "The JU.O- crlptton.SeventyFIvs. .
-
Elmer McCreary, candidate the young wife, of William I. Learned Blessed with a salubrious climate and sign roll of the Slate," says. the < Sovernnr. .'t, ,

for page in Senate won, easily, receiving the illustrator, has reported thut In cheerful surrounding' our people enjoy "has Inert-moil front lC7fl In Killed in Explosion. :.

could Und no trace of p ltllon. Tin jxcellent ht1I.th! Stimulated: by 100. tu nearly 8UD in IrtM. and there :-;...w'url.., April R.-l4evrntyttve.; ,,
twenty-two votes. young woman died Sunday night In a an honorable ambition to progress., and are numoron new ones now on tile" persons, Inclii'linir.' four artlllvry olH. V:!

Senator Brown. mysterious sleep suppot\ >d to hart encouraged; by the fruitful r..u".uf No action on these can lw taken, lu. errs ::1(1( imlltrrytneii and 40 ChlnoMcoolies. a tea(r.

Hon. C. M. Brown of Marjon and been Induced by poison she had funk labor intelligently and industrially ,U-I cause the fluid raised! by the two-mill! were killed Monday by' a terrific ij.

Sumter is on hand and will doubtless In a glass of claret. learned anta rt'ctfltl..markable strides have been : tax has l..eu exhausted The Oov rj
participate in the caucus tonight, and servant were paroled In ciistoil); made in developing the utmost limit' ernor shows'thst under a con"ervatlvt' .. )' depot| In llnrbln ManchurU. ': ''
pending the result of the autopsy. less resources of the $:;tate and in Inv estimate' .a four.mill levy will tie necessary ui-conlhitf to A World dispatch from ">'I.
favorable for the retention ,'
the chances seem The coroner at once discharged: provf'mellt.of formerfonUUIont. Our, for the, 1''II"I''n I fund. Hi. rUurB.The! two men who "

of hit' teat, although there Lamed and the servant from "-'I..t.I ly seaport" lacllllies.otir pint f4 rtt., our The Us 11 rood Cuinnirtsion is moat riiiueil lhe>xplo,,lo wcrw also klllnl. ,

may be changes; to ocoa r tomorrow that but hold them as witnesses. for un In phosphate deposits our tith and oyster strongly .endorsed and it i ili '''lIIIII'IO"I' The lnt>ur.tnry sod thousands. of per... ,
quett tomorrow. He ald the autopsjr fa"u.anl lands, aiiivndment jrcttles \H'ft'l1'.t ru)..d, ,
pasture
will lead to a different termination. supplies, our ''' -- h ._ revealed no trace of pu aou. tm our fruit groves, our vegetable farms. be .ubinllleil to the people making __ ;

B. Y. P. U. OF FLORIDA. that a cbem'.cal: analysis might Gilt our tob.cuo plantations excellenischool the Railroad (.lctlnminlnn a ootiatl.tullonal German Prlnct Visits| Russia. 1tat j

./ cover traces fit non-corru lvc poUcning ., our low rate of State taxation. branch" gf lhtfute, .; govern P.-tcr.turit.: April\ ..-1 I ; 41 a, m.Prliirp .

.' of in the, stomach.Storm 'laolll"J,\ pub. -- llmry of l'runls, representative
In SessionWith the B, Y. P. U. Mt. our trsnsportattoij ment.Several. ,

.: Moriah Baptist Church Colored. nq-- He accommodations! and the I generahlih amendments Io the |,rea"nl of the Herman emperor reached I\1
> Colorado. stai.dlnff of our people, and. th. I primary election law are urged one 'rlll1f)1l.NOI 1 fcMo: (thli morulrig. As them ;

r, The session was opened at 10 a. m.. Denver Colo.. April 5.-After it lulof ; br .bloualook fur ilia fiiinr*. arc .t. being that esn Jidal''s '11.. "a swnrrIteoilsed Imd hint no news hero of such. a Vtv ,

Tuesday, with U<-v. II. K. Hill in the several lionrn' It has begun: rululni trading to the State a largo ami l dfir statement nf all expenses, Incurred It. his sudden aIi.araner for a person- i;
,
chair. The devotions were conducted and Knowing along I'hi- eastern .lop ' III !Interview wIlls Kmtieror Nicholas :
able class ofiminljirantt. by lilm It and (u slstytherein ,
by Rev. L. W. Criviler.( ;af the mountains and the alarm li UM>n the hrels of his brnthcr's t|>e. If the spirit of our roadan"ntal'III1- / (tI.e semen of( all itonlribuilurt
The excellent: : choir rendered several again tat f.ill;! away. Train are Ulayed crvsted: considerable,. seu-. :'
ciple of go .rnrnent is otnvrvvil and to his campaign lund ." Other -*> \
rk ,
sweet selections. and other traffic Interrupted' 111110'1. "
Florida with her ral'
.ur ro"d.
rigidly /
The program; prepared by the Executive but no M"rf'''. damage III rixirt i am.ndrneu|i 'l"unalll''Ild..et are the '..... _:.t ; ',I "' I
f area of fertile laud and balmy. elintsieand -- 'I '
penalties for mUrtuiiiilloK l/fl-
Commttte was adopted. from slides .'r washouu. lu the Crip rules MINISTER McCORMICK IN PARIS.
her bound let. resources ,tot unci" .
try or IntlniUlaii.ui& suit lliiovernors
pie Creek district: the storm ban says
of the followingpersons raged )
Next the name. velotx-d, will in time becoinw OHM ol -
( "I. furth.r reconimvud Ambassador
constantly fur three days. The sborl H
were chosen to report the' work Elates in the Union," Former American at 8L
the furemosi
line train which became snuw.1ounr'Natnrday that any person accepting bribe hexempt I i
Petersburg Assume N.w Poet.J
the following ;
of the meeting to ; papers "
i evening, has urrlvi-d hen A most nolabln. feature of the mes. from punishment who ..Ulln. New York. April G.-nob.rt McCor* Y'

a'h Mrs.: M. E. Fowler. Messenger ; Her.W. with Its 70 pas engfrs. It requlrmTour sage of the Oorernor. which by the form or testify against the person or snick newly| npM,tntet| Aniertcan 1i

; D. Vann Metropolis ; Moses large engines to buck the snow way, contains about 15.0UO word, lithe persons who bribe or Inilmldats) him u.cJor Io France, hut art4 In .aID:1' ;

i Croomf, The Florida Iii pttst. which in some places in over S; fret omission of any meiitiou whatever in any way" I. mum 01. ......" 14".. says h.. U
:;, and drain Under the head of IIfe 'Insurance
'1 ',' deep. of the great land Everglade pilwd *t lime reports| Hat Ibere ;
J Rev, C. T.. Porroh, The National) age plans which out to 'important a lh- ()overtior recoininend! "'hat Ih.JApI.lahHe a desire tu tJohacl.IUP.\ at any t
\
.\ f;' Baptist Union ; the writer, The Indlanalns Visaing Florida.Jacksonville. . figure In th* Oovernor's sticcrMful : ; enact such! rnxasurvt as price rusiilfevti In official' circle, .,*. "fr"I. ,
Gainesville ',
", Hau.i .,... April 5.-A partyof campaign It is however believed this will h* necessary torstablUtt a life inuranc ... the furls correspondent *>f Th. ;,.
'0" At the conclusion of this, some sweet :40 Indianapolis school l teacher omission was Intentional', and that the busineis by the State," givingthe 'herald Awonllut'' AmbataatlorMrCormlrk

I' elections of music wens chosen and and pupils arrived lat night and Mt questions Invoked will form the teat following figures to support his po 010 fHi il..lr* exists. laMt

.eUDJr bJ' the choir and congregation at 10 o'clock! on the steamer May Ua\;* later on for special, m...."" In which sltlwai Ix> s"t In Florida by all companies |vt.-r.liiirg, lp the contrary In

At this point W :J. Johnson came rwr, for' a trip' to Mandarin, an hour, they will be cxciuilvfly iiiseu....
forward and 'delivered aver, royal. ride up the $t. Johns th..,. arcumj.e{ the Franchise tax )l, Neal, l ilvulre in r.mlha".. th> war la Lb... t.t;

,. welcome address in behalf of the nled by local schnol officials and MIO ((lovernor was very short but to the M.I3U.VU.XI. ItveslpUln Florida for Miter crud and there are great hoped 4':
period llOlM.a7fl.lM.,
sam ,
". church in which the B. Y. P. U met. bent of the bo srd l of 'trade. The trop point saying "Immensely' valuable Attention I U ealUd to Iliac faot that IbM Admiral lt"j", .t eriNhy will meet 'r

"" The choir had a very sweet selection was tendered through thn ( irtt-y ol Franchises and special, privileges} under the constltotlou' "I.h' e.,nsu I lit* jspsiiMi* Pled( and gain a victory ,
the board of trade; Tb "III) State which In day chang lb. ens ;I
prepared which they sang very heart party ranted by the and pruteeted by by eoualieanusi be taken this year, my nuns I'
n rave tomorrow for Pcn.acola.<< It 1> the law am unjustly allowed to avoid Among other matters urged I. an as* I lire aspect| of tb war, All lhA Leper? ::"

t "4, .. ,After the rau.lc Her. 1*, A. Callahan, the annual custom for Indianapolis (c rontrlbutlng to lit* expense of main lUlant to the tltat. Auditor the prohibition : Russia are now renivred lit tnrrt :b.. "
t send puplf of Its schools to makea mining Roverbm.at: under which of shooting tame pigeons for Itet, and a btU( between that 'lI'a,4, :
D. D. accompanied bv Kev. S. N. Vat., of ,alr! nf
prohibition
port, tn<* the '
.t' tour for 'ctlonl f. looked :i"1
purpose. a..1 t the J."l&h" squadron
theta and.
\ ,!":.. .!>. D..came to the rustrnm and Kev. 'hctuldinlC prosper aeau liquor to Se ""Dol. ludian, aril fish /tl'' 1 ',
: -- i nutate wealth. Every eneouragv- loi oyster prvt4.$ton, 1',1' ,".""a. .
: .: .: Callahan excellent.sermon. .'tJ'
:.' preached a very Investigating Supposed ftufcld i I Ii neat should be ..,...4.1 to r trprlsind Senator, MeOreary and K pr...nt- _... ...., _.. t.VI.

i It" and Crlppl Crag C :U" April I-Tb. capital to a....t (a dveloping' the illvet Tlllmao and Hoaboroncri are all .,.", Earthquak..n India '* ? .
Rev. YaM offered re* ,
:r, prayer h.r. and already busy I "lootingih after 'Ii :'
,marks were mad. by Rev. II. K. Hill. p..u..nta
;$f). A good collection was taken by Rev bar* mltted suicide at Hot HprlngaArk. I'. every otie Iho
/i-1 ,D. P. Spas, rurally bs r st r-" 'an luv. Ibe law and ,...|'.lnolC of all an ",lute CO"9Ir Leaves ,...,,". /ia|i lOa;. ibst a "l.Mal .artluiuakwrurrvtl .,,"'.", 1S

# The meeting was dismissed for din tl.itilou, alleglnK that tli* young maD .abU eontnbtitton to UM ..itnss ofcovernment. P'kln, Aprli J 4,-Afl.rM*,n -.liJ-'lnIf lbr" arcowpanl' by MriocM
[
'ner. .as nvurdd for his noo y, Tkfj! honestly, fairly and 'oajtr. wha was just ,.r..I1 |bMM S.>.. of lift sn l great datoMgw to pabIc :- 1 ;rt;,
S Afternoon Session.At say ne bad "'t.H-O ".WoO sod I 10(11I,1 4 eonotnically ad mlnl.Ie rwd," | >( of American mlnUt_r to China 11<< _"II other balWings. Tb.' town, 111:

2:45 prayer service was conducted blrb Is otUslng. ne txxty" wbkb. Io this Mineetlon ,h. (I"v"roortroagly 'I upon hU .inpt>nltn
i by Mae Bell and Des Booae, after boa srrl Iu-d here hr .cratrbe on reeomri."mt.<< a State Board of I Slratra. f left for 'flu'rh' to'tay via, u.1 Jnm Majjltf.. ouwf ... 'I"Cj "i',(?fwisps.

whtatTtbe names of the df legate. were the chin sad a tmvf lirui. "od.r tw ? right eye In addition to the rot .fn the .... a..rmlbet at hit r4ft.
rnfelga 'It.n. Other big
enrolled and a motion prevailed to *>af mvftt (I' sort Uglslatio, *) .. will 'Iu..4. bQU4Ia. atsh, )l
elect the officers from the door throat Phfiilnans who have esamlav .attend in. l>errodtble ".. lag 10 leper IhUM ass .'.11.1"1 W bt" blot '..,,'..U. TMippr'Mrb >> "relied acxt Dam,.sral. Many. nowswf,

l lfaos elected went at follow s ..s tb. body .t b.tAtaU.t. tntheory aardr > bti.iureere Hot now eoAtrib vii The "!Adore' was !U"'....l ),1CASD" t u 'M asllte quarter rt>llap..d.Crwssders '):,, ,
.
; "' trvwps. ..
.
"bar* toward the .s !
President. Rev. It. K Hill ; vie-prrsU hag a proper

deot. A. C. Willlama; Prof. B. C.teerry $.
assistant secretary ; )I,... A. O.Du. Aprilecs.tary slay fail fords tti.m (p>rtHi>l{ M.,MTnei April. i --DK ewer of J 11aa.. Aprtt f-Carrie ,tig; !f ,

t W. Belt,treasors-r: R... L. W. Larj.vllter. ,.b .w ere biro today wUestdnrvv >e *..iU>nt flajtawlal. .oa/JUi..* of )g.irgan ,tmltb aid bite. anc.d h-4' '!'nn, >)dfa.SleVbesa.iry: +'.. 1441", Ja.uw i..w.v'

correspond<< (, secretary MiST abuat tb. town Ux>k4 ..1,1., IK h HUM U reviewed. bees she .arlet.al a.i ..uoSit the :lei Pattrrss.q. 'a t lACT % fbou. taaavsraa4. eraea.. '\ '

M E. Tw.*t;u.. recording) secretary.Th himself. said! If fe.Is much b.c< r, tad HOa.ow&J ,la apprnpnalfea6 asxl ..apse.1tur. '.....r Ybnax .rdaf ease Inrors Nil" .era, WBO .fll1 avaidJic! trial for wreck* /

oflS..,. were, 'installed by Uev. t Oat ia* tu.dt'loae: of kls a' .IUi feat .* it org-4. .\ very large JI'f.IKoo' .ae.. tip sails in pots rosin t c< tu) af front of a ..rioT.'t. ; '. :1.. '

"ys C, H. Holley sod W A. UTiUertoa. Mon Improve: by tb. a.* journey, of IM me* aa.. WM
'after whica some Inportaat rrmarkswerw ; fcSrh .e eajojre .SsBias..'. 3g,. load' alf ir.-&.trlf' .o...fo<(rth of aim.nlle. I kit fls....... April T, 1i. post 1 114- peat to jell.. Pudgy t. ftfflflft, lei'ltefs+ris+s'

mad aa4 the m*.U.jc stood ad- Hay haj not 4veJ4M era ale Qltatjplaaa .ad of tax tU a use other .f tfc. l ";atlas frll, jatfott .'W. "
Joarmed nasH T:3) p. m. bet fr. esp ets f.8 r.a&ta bats aoMxtnt mtBn yeses court ca aiM Jt.4:: .)'

R. II. fJtI1Ifan. rvftorter. ear a fo-w .*,.. mirr..of r.veats. for f'doealloDal pore rritE of aatH. a.tes.,, fi"tJ'J'1 Co loan.e r" "'" 1't.j,
r ... ..J"oiI"C'jAt. ... 1
it ltiU '
....,iJ.. ..... ..,..< :r.. .'
""'1./ ,'1':
jt'J' '
"J ;
k..1'-'. ;"" rat Ya4rLkVl, 'I' '. : ..,., ,," .. iw.wMr xi e. .+M wt-- '.- n ,J;: t: ., !

,"HI't" u... pr.........J; I lJ W'..,..W...., "''''''l ", j, l1 .=:;tl : : rI



u --,-' '\f r.' -:::: :

i M h t

LL x C' nr,*,,*' JE1NSflWTiiED_ 'BY !


,CORNER STONE BULLETFatal ,
MURDERER'S

-- LEMON ELIXIR ,- j1CATORJAInfants;

Impressive Ceremonies} Scheduledfor Ending of Church Festival'
JIEGCLATEH THE III k'j' 1

This Afternoon .LIVER .. 1.; Which Cost Man His Life. p' -- -.I.. .. _9 I For and Children
I STOMACH .' - : -"'-
.. '
BISHOP WEED TO OFFICIATE I BOWELH, FELL OUT WITH WOMAN t

Kln! EYS.. 'SID I; The Kind You Have

1'' The Ceremonies Win; Be Held Under Alex Johnson Had Misunderstanding DI ,

His Direction -, Sabbath School 11 The inventor of the famous "TEK- With Sisterof LeRoy. Jones When ?, ",. Always Bought
_ UKLL SCRAPE a man known wherever .
Teachers and Scholars Will Assist plow. are sold and used says: Brother Resented-Friends Inte \cgefaWe Preparation forAssimilaling .

' I Several MinlsterslExpscted., '.rred, but Johnson Wast-ater Killed. dtcFoodandRegula- ,
of Itng Ihc Bears theSignature
reached this
"I bare used MOZLKY'S tJCUON :Information hal city "
\
-----
The fmpressiveiservices; of laying slurS ELIXIR for 10 or IS yesrs Inmy: a killing colored church ff>8t.inlln
cornerstone of the elegant new Holy family for the .t.omaeb. liver nod ldd the "''t.. Joseph neighborhood near __ _
Trinity EpUcopsl/ church building; will neys.' sod Urn It t*the beat medicine: t Archer, In which Alex Johnson lost ,
be held this afternoon at 4:30 6'clnck, bare ever used. Jl Is also a mire upe- his life having been shot in. the back Promotes DigesliorvChcerfur-; '
;
cute for pain (In the back: or under'the. '
and it Is needless to add that It will tx kbotiklen. I bare recommended U" laDuiaerou of the head by LeRoy Jones.. I ness Rest.Conlains neither : \, of
"F'. a ceremony well auended. "a lid one ;eases to my workmen when From the particulars which could be $um.Morphine nor>Iu\eral. .
r which will live long hi the memory of sick: and unable to work,led It bM a1- learned it appears that. Jones and a >\iOT 7JAlt C OTIC. ,
ways trlTen perfect raU taetton. II. D. ... ;
the and those who witness
: congregation TERRELL. Pre.ident Atlanta flow slater of Johnson both of whom were ,I
'it.wr Ca.. Al.Jut." attending the festival had a quarrel, I Jiryoe.,oU.Dr SUrflzr.PfrC/IEH! "
The,' Rt. Rev. Bishop E. O.Weed.of tOZLEY'S when Jones used some abusive language I

the Diocese of Florida, with headquarters ; towards her, it is said cursing; J'rea.rr.
R, sera In Jacksonville wilt officiate, LEMON ELIXIR.. her N.turall.Joholoo, who was also d.4r- #I' I nw.

making the principal talk. Bishop present resented the Insult to his sts- I I ;
: Weed is an eloquent and pleasing; -- ter, and he and Jone began to fight.;

speaker and there Is DO, doubt bat TRUCKING MOVEMENT they were Separated by friends, however i L: Use
'
that the Impressive ritual of the Episcopal and It was thought that 'all was
>tl periecl Remedy for Cons lipa-
church, specially designed for '
over when It is said that Jones secured Sour Stomach Diarrhoea .
_t't" occasions of this klndJwill be carriedout IS VERY HEAVY a pistol,.and at a late hour as lion Worms.Convulsions.Feverish-
in a meatier which'will prove interesting .Johnson was leaving the place firedat ness and Loss OF SLEEK For Over
to all who hear it. him the ball taking effect in the
The congregation will, be. joined_ by Nine Carloads of Lectuce Moved beak of the head Death was instanta Facsimile Signature; of
;* the, dunday-sohonl of HoTrinity 6. neous. 5
from this Section
whfeh'will affiliate in.the ceremonies.The Monday. There was a large crowd at the festival Niv =(. Thirty Years

program will comprise reading and things; went smoothly until
recitations, etc., inflnddltlon to the FIRST SHIPMENT f QF CUKES this fight and subsequent tragedy oc

t address of Bishop Weed.. curred which resulted in a general)
They Were Consigned from ,Bushnell
Seventeen ministers within easy access scene of animation and excitement. CASTORIA
of Gain'sville have been extended by Winston & Lewis to,, New York Jones. who did the killing. Is a reU
,Invltatfous, t6 be present, and Rev.Francis .' Markets, and Will No Doubt Bring dent of Long Pond, this county. He EXACT COPT OF WRAPPER. _

H. Cralghlll expects a number Fine Prices-Other Movements.The has always been regarded as a peaceable 'TN."IITAUII__... ....._err.

( oS of them to respond. It Is quite certain 'law-abidiug man. and those who -, ,,.,.,- ,, -" .... ,"- ..."". ..,.., . .. ,-.. ". ,
that a number will be here which will movement of vegetables from knew him were surprised at his action

_ "" make the ceremonies all the more l Im I' the Hue of the Gainesville and Gulf He made his escape and Up to this

t pr"'II ve.r railway, which trevvrses. une of the time hays not been captured.
The new Holy Trinity church .1 be most fertile( section of Florida has ,

'when completed one of the handsomest begun; in earnest, and many" carloads A Dare-Devil--Ride-
edifices In the State. The building, each week for the next few months I
1 Often results 'in a sad accident., To
which Is located of East31aln
at the corner will be moved.,
and East Masonic streets will be The Gainesville and Gulf Monday heal accidental injuries, use Ilucklen's DROP A POSTAL CARD TO
Arnica Salve. "A wound In
constructed of the patent MaCarrell handled six solid carloads f diversified I deep my
foot, from au accident," writes Theodore -
s;*7 j Imitation of and said
stone an granite products from the section south of
to be equally as durable. The church Gainesville, all of which were transferred Schuel of Columbus, 0., "caused,
me great pain Physicians were help Sternberger
will have a seating capacity of about to the Seaboard Air Line at. this .
less but IJucklen's
Arnica Salve
quickly
its 800, and will be a modern 'up' -to-due point b"elnft consigned to Eastern markets "
I healed It. Soothes and heals burns
building in every way, and one of While,the consignments. were like magic. :25o! at all druggists.,
?zr which the congregation and city may diversified, the bulk of the shipmentswere
well feel proud pea.bransan1;' lettuce Cucumbers &

Holy Trinity SundaySchool.The are Just corning to maturity, and Important Oerlsicn Rendered.Montgomery. Phillips

"F 'cla.r. and scholars of the will/ be ready for shipment within the : AU: April! ,-The enprein ,

__ ,1.r above school are! urgently requested to next week *" *- court ha. Landed dpwn! the following ,
assemble at the church on Tuesday The first. shipment of cucumbers to iJt-clsIon.! Kire Insurance for. 110 West Main St. N.
afternoon at 4 o'clock promptly, to leave the State was from llushnell feitur of rollcyvby taking additional ,
take part in the ceremony of laying' Monday, and were consigned; by Winston Insurance without consent It the Insured .

i the cornerstone of the new church t% Lewis, extensive truckers to J. In a flrr 'Insurance. company effects And they will send a representative withsamples
F. PMBUCOTT UVLIOCK .\ G. Lipman, .commission merchants mlitlonal Insurance" on the In.lIurrd .
,
New York, for whom W. F. Buchananis property In Violation of an r v- of Wall Paper Paints Etc.
Superintendent.
pre.ne . the representative In this sentlon.
-- The cukes wure tine, fully matured and securing tho writtetf consent ol who will give you an, estimate on any '
the 1 .
lnaurer an rentilredj' thin conoii. -
ar
: handsome, and will no doubt bring (tiles a breach of the (condition--- and first-class work
i CASTOR line prices, since they wilU4 virtuallythe a forfeiture of the policy and operalea you have lobe done.

_ Per Infants and,Children. first in the Northern market. thus rendering it void unless such
M)Buchanan, who has just returned forfeiture Is waived.
The Kind Yea Hall
lr Always Bought from the Ojala section states that I

t 'Beam the Kastorllng Bro. the extensive melon) Sternberger & Phillips
planters qf Martin, have a stand of
rt; B1patureotTHE ,
one hundred acres of cantaloupes 'in T. F. THOMASUndertaking

h full bloom, and will probably be the Artistic Paper Hangers and Decorators.
NEWS FROM ALACHUA. earliest shippers In the 81"'''. This
firm expects to make the first .lilpm -
Notes of Interest From, That Thriving .nt May 'JO. Mr. Buchanan thinks Co .

urt-P."onal: sntlon.Alaohua. they have calculated a little early, but .

t;4 y April a.-dr.I J. C. Kther- believes they wilk be' enabled to ship --- --.. -" ,, _. -- " . -.. --_ .. .- .. .- ..
edge and little daughter Kathleen, i by May 25. This will t tIe several daysIn

stye an..d0 Alachua this week to make advance of previous records, and if

this their future home, Mr. KlheridgeK" the melons are shipped Into the market FULL IINE OF
having located her in the real l estate at that time, and are fully matured \

jfl 1( > business.Mrs. and ripe, they will bring goodprices. NEW GOODS. I !

d ttrysnt, of Windsor (1).., the : )
milliner for Mrs. G, !H. Ramsey came The movement of lettuce from this ,
-- .
In this week. section I Is heavy at this season. The

t Mr, A. 8. Johnson the .genial and ggrgat, shipments yesterday comprised l>i>onal attention to all mutter. .latliU
accommodating agent of the 8. A. L. nine curs, The majority of the II... Hall and telegraph order '

..F hallway, It painting his house In West product went 10 Eastern: market promptly. attended I.. #
Alachua this week.

n 0. Williams and wife are off to DR. CArtTER MARRIED.

s; Tampa to spend a few days with )lr.wnUam. I
Was United In Marriage to Miss Idslu
Gainesville Florida
.
;,t brothtrThomas Wi llama. ,
Hall Sunday .
Evening.The
J. G. 8hetfl.ld) formerly of this ( _._ ,
--'--'----- -- ---------
place, but now of Lake City, was in numerous friends of I>,. Clyde AND OTHERS ,f
town for a few days this week I.. Carter of this oily, who has just R.MeCLELLANUndertaking: ,l t

II. N. LeRoy, of the firm Williams' graduated from the Atlanta Medical' WITHOUT HESITANCY
A Co. spent two days 'In Jacksonville College) will be surprised to learn of t
this week. his marriage in Atlanta Sunday to Co. Indorse

The boiler and machinery for the 1 ice Miss Idalu Hall a. charming young

plant 'Is now being; placed In position, lady of West Point, Ga.Mr. Mark
and. the work is rapidly progressing, abd Mrs Carter expect to arrivein GAINESVILLE.-FLORIDA. Rogers Whiskey

J, C. Ethsrldge, the real estate Gainesville today, when they will
\. man, hat purchased of J. O. heUM( b* given a royal welcome by the Funeral Directors and as the limit of perfection 'in distilling. Rich i mellow and
groom's parents and frieuds. smooth, it r lea..e the palates of many u.er*. Will please
; 100 acres of land oo the west side of first
at
Licensed Embaliners. yours opportunity which
The extends congratulations we invite you to take.
and will at
town commence once<<
-
x
clearing and fencing twentyfivepreparatory aeU". Bitten -
4 by a Dog
for setting out Nasatseturen or sad Dealer la Ocala House Wine
pecan At I.tl' hour Saturday afternoon a Rooms Ocala FJa.
'. trees.F. tartars Fraa***. ItabWr. tilalap4. art
of Mr .
ou and )1 n. P H. Ilak.,. East ,
:J. B. Godfrey, cashier of the .'1.. Gainesville, had the nusfortaa, Gels,. aUtery. CastasaaCVsseras 5..
to o*
: chua bank was lo Gainesville this bitten taks. aa4 1' ."'fte
week by a dug in the neighborhood.WfciU .. = --
i --- ----------- ---
phew ttppttes.
.
.
'v; -"M the wound is not considered
}. W. L. lllU of the Mutual Llf losuranee serious< it Is wry painful ai> t the lad -
,t. Company has rturned tfrvm a sill be laid op a.U lnoooTenleac fur Order ..y Telecrayk .r Tt,.,.... etisAd0 in THE SUN'LAY
t bu.IDen trip to l3avannab."I' a few days. sIll receive preps .....u... .


...
f ,I
-j.
'.J. .
' "'
-
M'it. \
\.
..+ ''i

,
,. ., ,-, y'VN
'" ,, ''''_ J' ..
.
"'_.. '.Y.- Me 1o;
A . '\.1i'I':< "11,:'"" "." ' :p,

Y :1
'"



,....


..
'
,'
"iP '
,

I ,
.
I _
THE GAINESVILLE SUN: APJRIL I ((5, 1005) :) *

.. .. ,
- - _.
-- - - --
----- -- -- -
---- -

STONE LAID GRO\VIX"G UPThere's DUTTON COMPANY

CORNER 'YAK.E] THISIJI1IIMLircSlOOD

HOLY TRINITYServices something the matter MADE A. BIG DEAL _
AT i
with the child that fails j 'w. BOOK <<
I wvM. :-.
z.-I ,
A child thatrovs i
t 1
grow up. '
Tuesday Afternoon Well Parcrussd Interests of HillerComalsy & .. ,* .-. .. \ .. \
: too much however ."" ." < v.
,-, up ... '
Attended and Irnpressiva. Miners of Phosphate. JFREDE .- .., .::_ : Z
... without} proper filling out of ,_ I '

'. WERE ADDRESSED BY DR. WEED ilesh. is almost as badly! off;: ;;.' lfARTER' OF A MILLION

"!. q a
There Was a Large Crowd Present. Nothing will help these pale Supposed to Have Bun Paid for These 5YRU*

Those in Attendance Being Treatedto thin wcedy children, like Vast Interests, Which Cover Three I, i

an Impressive Program-Congregation Scott's Emulsion. It suppliesthe Counties and Are Among the Richest URI't Jr"ttl1! I'iq'N.' .., IWrtU'lf*. IM..fnnoA.it the lIre.n" t.une.I.elkin 1)1..1.r.. tt)4 ,
.
.,
Lands in the State tlpttlon| ltlictinmtlMit.s! >,>, irli 1r"ubleNantt all olhr tn'uhlrs IxtvluvOr
; and Sunday School Present. Phosphate their" origin in nit UKI.-UM. or.'l..mirn'.t\\ Itwr llnry "llv** r.siilito? ..." nail '
rounding out of flesh and IItn.llu' m-l...rHtionH". %lv Kx"| hem l..'r.. r-IU-f but lr. TbahI't'! Uwr nod
The laying; of the cornerstone of the The Dutton Phospuatf Company of Ul(.* $yru )rum'' t.. ttitviinM t>v.ulilnir I tti.IIrrInahwnlthy'undtlion. "n W-init your .)NI'<>III imnhiki fuumuUiuWn. of ll..> .... It
< n u the only
thin who for ,..r.l
new Holy Trinity church of this city the rich inward nourishment city years "njuJt'l1th" Shut d MM IW work Iw i>iit,I"'Iv n.1'1.\1"" thx n.u.n ..f the trouble preparation,
took distinction of being 'the largest Tbtlltyl1'I'm".r ."...>......ikbinry.| ..nn W'akin... l In Chot.rNllof tb Hack sick '
place at 4:40 Tuesday afternoon, of vital! headaeh.pnln.lnloins .bad.n. .*. iuii..l>n.w.> of th.,llilith*. hlli-cnlor! or.. blood and organs miner of phosphate in I-lorida if not urine, Momiiirlno.. '. . ... .. ye
and there was n large attendance of loir milky or '''.11..| >t '.1.* | uilrmt, nnm<.. vomiting. V
members and friend of the society to which insures rapid growth a in the world, has just added another are MMlc.coutlr tine .;ytnii"lli iii>.n..>hoi t illwaMxl uii.l twdd ktilm-jK! llu-t..,m tl furrv.1..n"t nrel.v't or uutiuturnlly Un-m nab loitgue" ThrM
witness the ceremonies. quarter of a million dollar. to it* iulerestn. Only one r..nnetyeotsi,11"sliIhorurntI sp'1gN'rtlrr ....I..n/II n..lh ('nmbln..1.. )Pl
required t) the Irvntiiirnl of l.tvrrun.l "'hln.- iilmitm..
> >,111"1 thus is| hr 'fb."hCln
At the hour appointed the procession healthy and uniform develop having purchased the t'utlr"phu.phalt' Un-paml UI Including land ttel..t .<" t M.u(1rnk. (M"y A'.|>nl<>), Yellow 1'.w'k.. htndnllon, tlvtlmnaT
formed at the old church and pro men t. interests. (1tivea( ksaennaWlr) '*'|<,.rllllirntiNU, l...U<|., ..t I'ot.It"n. hu.'hu.Juulter
.
mines and machinery from F.tlwanllliller : 1k> ..1 "
ceeded to the new edifice beaded by __ I rr.' pl..n.l"IreThu.h.r'.leahhTGNkwith l'Olln.l.ItNIMIrh. { '.. fortli
Rev. O. D. Frankel. followed by Bishop -- -- .fc Company of Oonln "1'he.n n- a"liIlras.I :rwrtU) lo- 1itrAll .lrusrcllB, ao ....... mid .1....* per bottle.TBAQuzilt .
Weed and Rector Craighlll. the THE NEWS FROM ARCHM'. terests are situated In the eUUII II'*' of MEDICINE CO.. CIIATTA.NOOOX. TENN.

choir immediately) following. As they Marion, Citrua and Httrnaiido. and the tq..

reached the grounds -I'aim cxxlf was Machinery for Foundry and PAachneShop lands are! said to be. very rich in pltosphattf - ._ . -..-- _". __-. --_ '-_ _-

repeated and the regular corner- Arriving;-Other "':otes. dt'po.ittl.ClUe THE FEET OF ALL t

atone ceremonies were performed the Archer April ".-Mrs. M. t'llattl ,,- the price paid for these! vat,

stone bearing the words. "Holy Trinity, and sisters made a vl.ltto! Mr.( C. C. Interests is not divulged it u believedto WELL DRESSED MEN
also I Dorman at Cedar Ky last week re i b.i in the neighborhood of $'.>50UO j
1905 a cross. '
Ar' J Just as carefully attlrrd .. the
After a short prayer the list of de. turning on Sunday morning.; Miller A Company were operating IHIuierous nest nl I their person and they art altl..r..rtliin
posits contained in the atone was read Miss Dora Srqitb who spent. last. mines and be,ide* ownrd lance r "Herting their Shoes a* they ,
as follows : week visiting Mi s Bessie Smith at Dutton tracts of valuable phoapliaitt I.IIh. C ant of tdflr cravats, hat, (".',, or '
iron.>T'' '!'Ibis. u why $MITII':$ fehw
Edward Hiller Ocala.
head of Itt
History of the Parish by Miss. Mar has returned to Archer err no .iipular with fastidious. people.Thfy .
garet Tebeau.A Mrs. Waddell has returned to her firm of Hitler A Company, will closeout require| In their footwear that

list of the vestry committee' and home at Marietta Oa., after a pleasant his interests and r< move to Uir- citnibiitaiioii, of style and parochial organization. vittt here. She made many friends mingham Ala. which our yiiova are so justly famous h

List of contributors to building fund. here who will be ,glad: to welcome her Our UN, of low Shoes runnel lw e\

Current copies of The Daily Sun and return. relied for Duality' and Price. Try u*. 4)ao.v.uQ )
Weekly Star. Mrs. J. H. Tucker Lire Oak. 11,11hlDg .- .

Copy of the service used in laying her, parent., BIr. and Mrs C. W. Every L. C. SMITH, H. Side Square,
corner-stone. Cauknight. Her husband Joel II. V"
UAINKSVIU.K.: : : FMIKIUA. .
Journal, of the last Diocesan convene Tucker spent the Sabbath here. ..
tion. Mrs. Irwin has returned from Dun. neartAche I

Photographs of interior and exterior nellon where she has been Visiting; her
Gainesville and Machine Works.
of the old church. husband Mr. Irwin. r Every pain in the breast difficult Foundry

Catalogue of East Florida Seminary. Little Luoile Osborn who has been breathing, palpitation[

Ancient coin found in a Florida phosphate very ill at the betel Is slowly improve fluttering or dizzy spell means -M

mine contributed by' Dr. B. P. Ing. that your heart is straining itself Iron and, Hrata Ca.Unn.. f.ouumolire aiut Machinery repairs. W" guarantee

Iticharda.. Her Mr. Koseborough the Synod in its effort to keep} in
Pressed flower__ from the Holy Land fcal Evangelist will begin a revival inotioii. This is dangerous. KiH>il work and iiionipt delivery at reaioimttle price I.tK'Ateti' In :

contributed by Mrs. J. N. Strobhar. meeting at the Presbyterian church Sonic,sudden strain' from overexertion H.mili., laineivllle, on K, .\. I.. and (l. A O. llailroatU,
Confederate bill and lines upon the tonight; or excitement will

same contributed by Mrs N. D. Phil. W. H. Powell was on the sick list completely exhaust the nerve*, -. -- ... *. 1 ylistahilahed

lips. last week but I is o. k. un his regular or rupture the walls or arteries In i 81.

Photograph of Rev. B. F. Matran trip this week. of the heart and it will stop.

D. D who initiated the movement for Mr. and Mrs. Wood, former residentsof Relieve this terrible strain at The Oldest House in
the new chnrch. Archer after spending the winter once with Dr. Miles' Heart Whiskey Georgia'

After the box had been laid in its St. Petersburg, are expected here on Cure. It invigorates and i
place. the choir sang hymn 293. "Oh Monday evening. Their daughter:: ,.. strengthen! the heart nerves! { UU .HIIAIIl'i: WIIJ.IAMHliiaranteed !
alone W. B. Pine of Jacksonville, Is expected and muscles stimulates the ( R years old. Hy chit
Thpu. in whom is found etc.. gallon f3.: <)0. 4 full quart. $3.A: ;
which Wed delivered quite soon heart :action and relieves the
after Bishop avery KXI'IIIIMH: : :" I'llI.l'AlU:
interesting dedicatory address, Two carloads of machinery for the pain and misery.
: UtU.: J. (ULIIMAN: II YKOuarantetnl :
which was followed by another hymn foundry and machine shop have arrived Take no chances : make your I

and an offertory. and the frame of the building Is heart strong and vigorous with rl + : Ma I Ion U.71Iun B years quarts old UTlh.43.IW.. '
Dave Taylor' and Lewis Deyatn Dr. Miles' Heart Cure.
The clergy and officers walked around up. ixrui.ss: : 1'.UI'.u.
pert expect to have everything; in shape "I Buffered terribly with henrt dl*. ,
service closed
the walls and the was
...*. I haInteq trentr l.y A \'II. itvt: 't 4Unaranrend
with and the benedictionThe for Mr. .).Maildox the proprietor by different phvMlcUna for my ahle! i "
a hymn
.... .. 4 old!, Hy the
will.out r ull 1 went to a i>liy:it* year
pastors of the other churches in May 1st.Alex flan In Mrmphln. who cUlm.f tlmt .. gallon :J.MJ.) 4 full quarts n.Ta.IX"IUH4 4
and the nice Jolinton was shot and instantly I luiil dropsy of thv! h.t. lie rut .:... .r '
the city were present It the X-ray oil me, and In r.ll'lnl'1I. : : l'Ur..uOtJ.lt't'UlW bt
was impressive throughout. killed by LeroyJ ones at a negro festival with ti'w in<.Hiloln. bo came nr.ir f.. .ikInx >
. Jones a flnlult t'f mo. Homo limit brfurj r:, uvi:
on Baturua night. escaped
- --- ----- .
this alII" Younj. of Hi. I.uul'Wn"'
My the. gallon |J 'JH. 4 full. quartsth
Cheated Death. In town. ll enndtllon
All colored. our saw mr
and recommended Dr. Mite' II.ari co: >. KXIMIK.HH: : rittU'Altt
Kidney trouble often ends fatally Our postmistress, 311. Minnie Snave.ly Cure to mw I .'iv" It little attention b
but by choosing the right medicine E. ) is ,visiting Jacksonville this week. until my.return. from lrrdpMn.. win Ol.ll KE>Tl''KY (OHM
I eonrlu l-1 to try it, and am H...M!<1 Guaranteed ft old Hy th. galluu3.1.". 4 full (I..arl,3.:3.:: "
II. Wolfe of'Bear Grove Iowa,cheated J. B. McDonald has charge of the ottlee to ay threw hulls cured m.. years
CHAIUIfJOOiI1fCHr EXl'RIsII'IIEL'AIU: : :
death. He says : "Two years ago I In her absence.Mr. ruthYUle.. Wo.
01.1) l'OI%TJR: CLL'IIOuarar tilt
.,'
Da. Mll Heart Cvr I..ola
had kidney trouble, which caused me and Mrs. Lin ton Oborn have returned druggut. who will ",.. thrt by full 47.711. '
your ou.r. >te.MJ 4 years old. Hy the gallonJ tAJ 4 quarta 44
great pain offering and anxiety, butI from. delightful trip to Cuba the h. will flr,t refund bottle your will mon b._.fti y.", If U" tails EXVILEtl: :' "Ktl.AID

took Electric Bitters, which effecteda Miles Medical Co., Elkhart, Ind We handle all tli*' leading b brands of Ie,.. and lJou rbun WhisHie in lh. mar
complete cure. I have also found SABBATH SCHOOL PROGRAM. ket and will nu ftO per cent on your purchases. Send fur prier, list and tlacatalogue.
In debility Nail, free upoo applkallon
them of great benefit general ---- 4
Twenty-Second Anniversary of La .
and nerve trouble and keep Cross Sunday School. The *I bas of tan.""I', THE ALTMAYER & FLATAU LIQUOR COMPANY,
them eonstantly on hand since as I Matlwnuil| roKler will \IM' Inter '
,oo. O"' lo. lt rouitrii NTiierr.: XAIOTT, utOKOU.I & '
The anniversary of
find they have no .equal. All druggists twenty-second ,.1..1 In it'| .- f..ll.'lblug.luotatlorri fr 'ia 1

guarantee: th.m at COc. the founding of the LaCrosse Baptist. 1e..1...... 1e..I wisp Inn..ltt'. Itl" ., ,.-- '. .. ... I ,
"Sunday school was held 'in th* little sign or HiinIlly| Into algebra. .h"11t", -
church at LaCrosse Sunday afternoon was lie Jlrd inifll: .li .utl...., wbu wroteon ,
Dr. CoMstaln Will Ratum. Jy
and was largely attended from the .uhJ...-t ..r algebra. In his .
A letter from Dr. O. Goldstein dated every treatise calleilYh.-taton .-
of \Vllle.puMUItetl
section In that of whom
vicinity
'. Ocala. April 4, bears tha Information many about 1W7. k. aaya, "rft YOUR MONEY BACK
have been regular attendants for
that the Doctor will reach here on the many avoids tlw teillotia repetition of tl
afternoon of the Oth and may be found years. wont. I. 'I''U" t". I will aette. as I
at tha Brown llnase for three or four The meeting was presided over by dm often 'lit wnrke nag. a pure of -If tho Ci'cxKlH; Don't Suit.
Captain 11. C. Parker superintendent parnlU-l,. lino. ..f one IrngilH, thu
days.Th.
Doctor is partial to Gainesville. and founder of th* school and who has t.reausa 06' : rhTnif" ran b*> inure THAT IS OUR MOTTO AND WE LIVE UP TO IT. ,,

because he says it is the best town and not miMed a doen meetings of th. _.wl_' ... a .... N..r'
I .. the best people>> In the 8t..'.. H. did school In the twentytwo years It has -
....,.......1 ?heu.,5..
1
Intend retorninp this having Corn '
Whiskeys Whiskey
'k not year been in existence.: nit school Is a Rye .
been twl lee here already bat declare "!Attk mi lit.-T' -UlmeU. the leUwjr ..."...a'
great: pride of the Captain, a* well U !...M >*(..
< I'KllOAU.
he could not resist the temptation to warmly' "I fte 9*r took a <)r fof
"drop by" for a short tim. should b*>, for It baa proved a great' lii life l I'm DlMt.lIrd.1 '
tn''IMn" ** ")? nn> a Copper| lh'N. .
It will b* remembered that the Doe suTftft and a great hesl! ff, strung .>. au, two "t font fat-leal put C. White . . $1 65 r
4 ;: tor recently bought a city lot her. The program comprised some Inter 'ucrU." Qucxm City . . ,%

horn II* may and decide make Gainesville to build an bis elegant Florida citing literary and venal .umboP.1 "Well. HMt" i." .Itld." retorted l itt Sunny S >uth . . -.' .',() N. U. Hotter . . 3 00 t

among which wrr* addressee by Rev headquarters out KKU.: \ . . . Si s ooPcxllgre
L. U. O.iK-r; of Apopka. Dr. J. L. Kl* ruT .!e... aril I'm a* rich .. any t..odO&a' N. C 1 Fine . . . 14 00 '
, . 4 uQ I <> y
fj.
How's This? of your cllmt pttt togvth.r, '
ley and Prof ii l'it.1.: Lynch .,f this

'W* offer One Hand red Dollars Reward i ell,. aDd Prof J C Adkl.. of Htrobl _. ._ _. Overboil . . . 4 (H> Laurel Va ly. . . a 00
-- -- -"' -
for "J.y ease of catarrh that cannot Th afternoon was passed In a most

b* cured by Hall's Catarrh Cor. I pleaslag. aed Interesting maaaer by tb. CIIAKLKSaSMITII' !

> J. Cn* a-Y Cu.troledo.0. : .large erowd present Ooof the prlo' 1'alatkslla. :
*, the undersigned, hav known K. I.;pat featam of the program was Ib DIPlOMA un=== =PfK!R OAuon $S4. !

i ; Cheney for the last lA J.ar..aDd b jliev eboir. which was about forty strong M' :<'UL I'KItT LIAT.flonter&yXX .

f, him perfectly honorabJ la all aa4 rendered .om *. *U.DI vocal \ ..... II DOXXXX

botlaess \nftnD.. and Soaamially SOttSlC. .. .... . . .. ..... 300 r
able to carry oat any obligaUosi mad Captain! Parker makes U a prattle Gold MedaL . . .. . X <0OI4fUk WE: HAVE OTHERS. WRITE US.
.r. . .... .. 3 *W
;r byblsBrra.WAM to bob each an ...", Innar
year eon
.
.e >rsut K as ,* ,laa"r.. Royal rW*| . . 4b
rI tlhol.asJ.Itruggalt.Toledo.- O. vie. sad this ... one of th. most .M- Lrwis'M. -.1. ft 00
rsfa1 im. Ui. hUlory of the aehool.WKr Cora WBiUl.y . 1 W to ,later-a1lr - . I *> W 4 WCa JDI14t
"
val; SUM! oiox>.. ..,rM'H' n* 'N sr.t4>m a 4011&wortb. eC frail ... *. OocMls at losat prise.( Kstra ? ,
.ti T..umosial..sas: : fr*,. Prte :-+ prtMidbraKdrn 'eoa.e.a.-d. ter ,..,.. ago. .s. 'dofJa,.' ebargw for Joes V-ftl., JO*; I galr. ab
h, .!' ""' :rartb ka wasted MW. Vml.*.all t e Irks: 3Qs. 'i1 a will ftlhirw prIo. P.O. Boy 4C] JACKSONVILLE ftAt 2IJ W. I'

...'Iit1 lR"4F' .. , ,t; ,la w tartastasld i'fait ca a>........&)1IoIk... ..'., ; far J. IAtta reed b sell. n **. jj

\ s oe ,:',',rr r,,".I''JI. ,"1 "i"'t. ,""t , "" r .s r r
"" t!' '" ,
"
4'



.
_.
"
,.
.. ..... ,
!
-, .


4 .' Tim GAINESVILLE SUN: APRIL 6,1905r J

_" '" .. __ .' .. L -,. -... --.--- . '- --.------- __ I

OAIhESVILtZ -*' GOOD ROADS. State. It is a wonder to the stranger R ,

h.c' ix -. who visits thlfj delightful: )lake 'that
,, : ID driving'east from"Gainesville one there I is+ botrolte line from Gaines

"' > . .' ,..:... r. will appreciate. the goodTroad to be iile", to this, fatoinaiiug spot. or at :

Catered December l(.1009.,.t 6 Vste. Ille.rig. found for ,some, di.tanc <, and then I least a guodrearrisge road. Don't 1yJ :'o Illl 11w'

aa.ooadwatter.utter ot March I. 1W* , ''.Act of Coorreaa when. the and .Is encountered, It will -- -- .
.. . seem as though there is reason for all FLORIDA LEGISLATURE.Under .

Published I the talk on this subject that haG been
Every Jlomday sad,Thursday
it GftlucftTlU "Florida heard, It would seem that the State the above heading The St. AuK0tlne .
I ;
1ii woold be justified in taking up the Record has the' following sensible .
I -
H. II. McCREARY.: Editor and pobl'r. matter. article: .
. Good roads are at ..IIenUai'to the "It seems to be a custom t?oJ1g

a welfare. of any community .. I I. the many to speak slightingly the
orS
;.TEBMS ascanytox. t health of the people or their IndutrUl State's legislators and the dudea'lthey" I HOUSOLD-:

c ue Twlce-ft-Week; : : Sort |1 a year; six and commercial activity.' Wit hoot hare to perform. Such a thing t I. to : ; !

months; 50c..,, f.,tingle. copies, Bo. good, highway the development'I b4I regretted since the effect cannot

1 i f.1 '"','AarKirnsiva' RATE t these latter factor of prosperity woo Id but bfi harmful to the riling generation
:Local advertisements, 15 cents a line be hampered Ifs Indeed'not' rendered who are already taking a keen interest -
for th first and 10 tents for each add!- I impossible, ) 'Electric ;.I1"e p1a,. In everything that pertains 'to -
lonal''insertion.Displayed / .
'y I lug an important part 'in| transporting tie welfare of one of the greatest
; advertisements for 'three, commodities' from the rural di trlet States in the Union. .
all: and 12 'month at rates,
tr Prices" furnished upon 'rlicial to distant :market, but, we hare nqt "The coming eoaion will be of great FURNISIIINGSUntil

t Marriage'and'Death notices Iniertedfree. reached that stage where the aid melh I importance, since many weighty matters .
\Obituaries, ¢ a line. ode are to be .whojly di'c.rq.d, nor It I are to be brought up for final l

L I it probable) ,the time "tfleyar;;; come action. The election of a United

_ ''i+1 Oua CLCBBIXO LIST when they can be unlreria .c21.pen.ed I State. Senator will bo only a matter of

'.th. Bon find the 'IHrfce-a-Week with. The horns will.*t, ave bis form since the choice of Hon. Jas. P.

(N.Y.) World one ear..1$1' 00 place and must, bee ,.A;wlth. Taliaferro was made by primary."A .
The San and the Atlanta '(Ga.) I bit .
The advent of the su I" very important itemwill, be that
Weekly:: .Oonstitotlon One year.. 1 75 created the demand >f roads educational matter mammoth stock that
7 relating have
The ,,Bon and the'Atlanta (Ga.) '( t.o' you seen our ?
14, Seml-''= and Joarn.t.4)ne year. 1 60, and made. thehlghwsyeven ''mpo'ft II+ of the There Js nothing of more vital interest we are now receiving at our store. We have
The Bun the BemUWeekly at the'expensit of the aDd under the new regime it will be '

Times-Union'"on... "year. ,., . 1 fX). entire State, .(m -"rstlvw. The ea". given every consideration."Of the largest stock ever offered in

I going methods of generation' or moreago courts the Everglades will come
..,-ye' will not accept stamps of alarger have' no place" In :the conduct of In for considerable attention since

denomination, than:2 cents. I II affair ',,:Ja,. Everything: I I. sacrificed Governor Broward has made special

I In an effort to accomplish the greatest investigation of condition and i i. an
v{ Cities' like civlxatlon' mod expand, results with the slightest outlay,and It earnest advocate of the drainage FINE FURNITUREAs

and yon can't keep them back. it thU that commend the good road scheme, whereby it i I. proposed to redeem -

movement. from waite thousand of-acre of
l A woman with a secret to tell, never The Interests Involved in good road.. rich farming land"
_
'w can forgive another woman who already ! are of great! magnitude, and the result The people who make such remarks

; know ft. attaining from them would )be fur- often dolt unwittingly' and take the

laa reaching The question should com habit from bud numerous item that well as the Medium Priced grades. If it'sa

Among those who are moving for mand a careful consideration of all the appear in the paper regarding: the
I palace or a cottage we can furnish with the
people.
peace mil effectively Is a modest old ._ .. action. of our State a* well a* national
,man named Oyatna. NEWNAN'S- -LAKE.-- I lawmaker. essentials to make life worth the living.

.
--
it". The twentieth century American girl I While the southern Dortloti of the INTERSTATE COMMERCE.
'i: can take care of herself better than 'State I I. lnglng prater of the lovely --'--
Is anybody else can take care of her. Ukea and river that there abound While; President Roosevelt hat

rqj, not a word I I.. mentioned of beautiful started in to reorganize the Panama
Canal Commission the time I I. coming Gainesville Furniture Co.
Newnan'n
A'6aleJD, Ma**., woman wa married Luke, fire mile eaal of when"lt
will be him
for
%; one day, eloped the next and wa Galn .avllle, and no word:!
y' '+, arrested on the thl d. O, the witch 1r i J"le..forltl.I a poi thAt could bemade
It be advisable
not
may
r i ir the must charming In the coan-
+<, Kaiser Wllhelm. ha. taken anotherobservation try. All along lt. shores are, high to do that before the passage of some

and reports that the yellow bank covered with shade tree of bill providing for au Increase in the GAINESVILLE, FLORIDA. f
membership and powers of the commission -
peril ,Is gelling several shades yellower. nearly every, variety found In Florida,
Q .
+ a* a preliminary; to more effective
--, .._ .-.. Including grand magnolia, palmettoe regulation.
Llnevlloh oaks and gum tree, and in ninny rate .
n" Gen. declares that the enemy
In discussing thl The Wall
beautiful cedar. queitlon ..
plane The wood
nut -
; can't hold agalnt "Kuklanvalor Sterna Journal of Kesv York says that I
+ ,
4 ," A II" term for sprinting/:, eh? In many place are very tropical and a Interstate, Commerce Commission
more romantic pot would be hard to at
Frcder8hoff find at present constituted does not commend
m Mrs has been rfl.1 The lake In about-aix miles wide and I the measure uf confidence which There is No Excuse
sleeted president' of the National .
twelve mile long and Its water areas it essential if it i I.* to be put in po*
greet of .uthe,.. She Is from New session of power to regulate railway
clear a* any to be found in the
York and has children Bhe hast
: sven .. . . .... . . .. . rdu. There are men of ability und
-- -- - For Your Not Good
held this oRloe since l00:!. character on the. Interstate Com- Owning a

._u- OPERATION AVOIDED mew Commission, and we woold not

The Standard oil trust hat paid a fine iienk|' with depreciation. of anyone of

t of $100 In 'a Kentucky court. There' them: personally, but a* a body they and
EXPERIENCE OF MISS MERKLEY .Buggy
nothing half-way about those Ken dn not pollen. that dUtiction which .. arness.R .

t' tucklan. When they start' In to cripple Bb* Vfm Told Tbe an Operation Was : .h"leI! belong to a commission in

a tttut, they never hesitate to err. In. ...b1.. How She Becaped It which I I. to be" placed such great au- ..

ploy heroic measure. ttioiity' over the greate:; .ainpi/ bu.l.i -
When physician tells a woman Buf
feting with ovarian or womb trouble if** Interest In the country One of,
Wo have them
As the'people of the country come to that an operation 1.1 neoeseary. the very the first eentiaU/ of Federal regula'tuitiof at all prices and '

know Florida better they cannot help thought of the knife and the operating I' rate I I. a rate regulating com- \ve make terms that
table strikes terror to her heart and are pleasing.
| nila,ion uf the highest standard and
Its
but peak In hlgl"" terms of prospects
full of .
our honpitala arc women coming
M Us resources are not half developed for ovarian or womb operatluna. one uf the tint. thing which PreiidentUooevell Have you investigated ourINSTALLMENT . . _
eY wA't- yet she can depend on them will have to attend to in
\ alone aid never com*'to want. cave the next Congress pa*"ea a rate
. law will t>M t" reurganlse the Inter.state .
-..- ..--.--,-------. .- Commerce COlnminlou.

The .A-- _. Plan ?
people
Tampa are putting up avery - -- -
V pertinent' tight for the Florida M SPEAKER OF THE HOUSE. '
{
State Mid-Winter Fair movement In I

A kthat city The uberlptloa" to stock W'd k When the member of the House of I Use the Buggy while you are pay-

Phe ire expected to teach >>OXOand if the ICepreentatlre in caucus nominated

r Jecl. I I. hot a *.UOh\ will not be Hon. AlbertV., Oilchrlat of De Soto a.I I ing for it. Our money investednot -

r tault. 9s speaker l of that aujfutl body, "it wa ,
Jt ,'_ .._. _:...::,:"':: .conceded by all that the selection wa yours.Ve're willing to trust

Gulf o gttro would only| run Up |into the "It"i one ills character a* a buti- ,
youFive .
.
.
fleet .
now\)(texloo| catch the Am,,'rlon l I" ''* maD and citizen has won for him J
h.
would at iVniaeola and destroy it, .. highest esteem of all, while, hi*
.
are only ten\Ve sweet revenge. There + oilleial career i i. that of an upright/

.I. err, seven tor<\ haUI..hlr"Y"Q| | "" erul.. 1 I man in every .en.". Fearleai In his t

three monlton,_ 'do boat dettroyera and rr/l'ar 'A/rn41 'dull a* he seer it. and his excellent( W. R. T.

n the buneh. .. -... 'y... 1 jitdttment.rarely wholeouled lead him sod amiss, he i lecvnsrteou. Buggies
The msnufsctQ |*ooe'a*'
In Florida will '- d There are cnra where an operation tho e qualities. of head and heart that
b4'a -11m. brick i la thin> only NMUN'e.a' when one conftJJem e.> to make up great men-men who i ir
t 3V Ibtt will be of materlbuilding anther Industry the great number. of cease of . needed, "..lay to do battle again I I Sold Last Week at
interests of 'h 'tHon.Ut to tie ovarian anti trtnnb tn.nbl*> cured by the unscrupulous who are found In
brick are! perfectly wool I.,.tllft .:. IMnkhamH Ve r"'table <\w ;, maul high j>''ac.AI the head uf the f!t
the test of lire a* ..U.. St.t. Ttu'. pound after physicians have .t'riJWCl lower house of our State anions, whu
yd and stand o]>cr.tk"'... no woman should ."bmlt to are workinr for the bet loter. .'. of i
and another Item of vast 1m el.y brisk one without drat trytnff the VeretblCompound | their beloved State, we' I look for and I $52.50'
the cat* which! _u about half orul)('- ': 'nt' writing Mr*. Pinkham. **tpe<'t nothing but an honest and Jot
J w of.the Georgia pre..e.l brick. Wit" Lynn M AM., for ..hl",. which ia tree. ;; administration of his trust from Speak j

4: they have been ued' they have j\'e.cor..r price* Miss Manrret Merfcley of :'s Third fir (ltlchrls-.. --- I

entirely *atifs tory. \area Street, MilwaukeeVU.:, write: I|i The brilliant jDCli..alor; from j i

: VV -. :-:.=T.; f>> ar Mr*, llnkb.mM ?-- I Polk lion I 1'\ If. Trammrltehoa.n':

Editor: $ant \V. Small of The n\ 1.trlt naina vtrmffth.Ibrouc"extramekhfiotintf the pelvto aerTOaauase orxMi.fmurtax & I, prevalent, a: the Senate at Tallahassee Better come while they last. We have the

wick Journal vouches for Ibis remedya Uown |..k>M oat rrmrnpe ratnt' >II..im Ml ccllraKQr) it one of the youngI I:goods the
t *to anok Mrtik a sure pure<< for smsllpoxt "etoU!: u makb\l an etntinUaa. BaM I had oratriaaK. Ib't tueoiber, toeing :u years of age. I ,
1 L phate of sine one grain i foxglove : to 'rr+u0k ud a3 rsatloa std advt d as os-a. |{ia career a* a public official: began Got your Buggy now-don't it off another .
.
: aa 'TU this l.trost ty uh jn'se.t ant 4s I.d put
digllalls' ), one grain t half-leatpoon- t'au Mnk ..'a "....*hle Oom4)tu -1,lseeueyran ago, when he was elected |I II
,;i JTal of sugar. Mix thoroughly with aw'Lit: ak'n rtls >Ur b+*Vtt.. all mayor of hi. dame oily of Lakeland, day. Come today.

: two '...*(1000. of water and then add :, Oven _I sTnnpMaa a.UoftC. t.4r0s da..c.1 ant _atid u.. I am !,I _nine to terms belnc elected a 1 4rY

foar ounces of water. Dose, '...poon. I ll.vonlK\ 'number of the tlou"* of Repree. --_._-- _.__..
flll'ey.r, bout J> *.... will disappear the ronnukK1 ao4 wrnb trouble are stead- j Jtive t ln lAti lie has always! been awntker
frtnV tecresw 15
asaooe wotnen. true to trust reposed In
:' to twelve hours, a. a rule*' If a person -j haveato' X IT p.rkts AMM very Wh...nfa.. II 1 him by the I"PUpt..oct every! an able and I W.
I* where physician cannot b+ iesll left. .i.t... b.ay'tent and s.ee.aivw-if yatrhtee artist deleter tWiac. always R. THOMAS
obtain the remedy might b j don"a. swelllnt, low d4wa lit the tro.** In his raaatter toward all. ,
tdal.'r .1 I'ah. .I'1i kh&aa" down pal", leoaar I ..1"tlOG" as rre.i4eo* of th. S*... U".I
at yea ft_ "jDI'' ') "'U ..". L"u.a'1e en vvidleocs: of Ma ability a 4Ufitf '
f ,.\ Onasto. GA'NESVILLE FLORIDA t j

...... .
.. :,. .>
V lij," ', ,. :!:
.. ( 4 ' ., d>,"' \ .,.
iff. f (1 . '0' : ..-'. "t" 0:.
\,,,...1til11 ...:ttt J .. '.;I>v '. t' "
17' YLA M ., '." -. :I' tW';;. .,\.. , 4''V ,, ./
d 'f' 4 t ..j .. ..... ,t .. .J... .i.1' "L .N f: .
r.' '
"
: ;:\! l',1' 1($, fET-



4(r11Yd,1,

..<<
)
, :. ii, ,


.,



THE GAINESVILLE SUN: APE1L ((5 j. 11)05) ,

-- _.-.-. -.-- -- - -__ _. ___ __ . -. .._-_-_..___. . .___ . .__ -. --.-_.... .-..- .. .. _-....n.. ,
T

; -GOOD ROADS WILL MONTHLY MEETING HOW TWO:BEAUTIFUL WORD- ESCAPED


CONNECT GO OP TOWNS BOARD OF TRADE

-- PELVIC CATARRH BY AID OF PE-RU-NA.l "Y ;


Time Not Far When Gainesville Largely Attended and Interesting;

and Ocala May Visit. Session of That Body.

B I I Female Weakness Is Usually Pelvic Catarrh. Pe ru-na.

WILL AUTOMOBILE I WANT TO ADVERTISE CITY
I Cures Catarrh Wherever Located. \

E. C. Smith and J. H. Spencer Arrived I t Committee Was Appointed to Confer
r
.A: Lyfednesday, Having Made the Trip I With Dr. Clarence B. Strouse In Mat- e 1Irr.
Uc le 1tIMt! u ? S1S4 W Clifton St.
by Automobile From Ocala in a Lit. ter of Advertising-Board Pleased at Mo.,
%
r
3f
tie More Than Four Hours.E. Actions of Citizens. t'J "I found after trying many different medicines .

..C. Smith and J. fl. Spencer of The regular monthly meeting of the h' rI ; to restore me to health, that Fernna was the only '"
Ocala in the s ',Y :' i thing whch* Auld be depended upon. I began .
are city. The former Is a Gainesville Board of Trade was held at i
member of the Ocala' Furniture Company the Board of Trade rooms City Ball Ii + taking it when I was in a decline, Induced by Jr
and is ; p+ female weakness' and overwrought nerrea."I ": '
associated with Mr. 8pen- Wednesday afternoon at .3 o'clock a
eer aDder the firm name of Smith A good crowd being present. of ; : r 4 began to feel stronger during the fret week I
I $ f a a r took Fernna and '
'Speocpr. desleu in automobiles and Ther was a great deal of important f my health improved daily until a
,f now I am in perfect health and life I
enjoy at
gtfa and pvsolintt engines. They came business coming before the board at .
"
never did before Lizzie
from Ocala on one of their Glide tour thic meeting. Among other things di.- cif ;c 1 Redding
ing cite making thIS time from Ocalato cussed was the proposed extension nf i pI4 '1x >'> > > *> *>t> i

Micunopy partly over' a sandy road the charter of the city of Gainesville

in a sew" moment over three hour. which would give. to the city more municipal -

Ibe time from Mieanopy to Gainesville power, as well an extend the

by way of Tacoma \Vacahoota limits to a point which would greatly

and Arredondo was made In good increase the population of the city.

Lime The board commended the action of

The machine is fourteen horsepower the citizens in mats meeting Tuesday

and is one of the beet manufac evening. and it wa the nature of the

tured. It created a great deal of Interest meeting that every encouragementand
4 among the curious here. influence be exercised toward. the-

.:, Messrs. Smith and Spencer have passage of the measure.
errae for the purpose of introducingtheir The matter of advertising. the city
.,: machine and will remain hera through the Bible Conference Chris ; % \.C ,r. :

,( 'for two or threw day They expect to tian Workers' Institute and Chautauqua ..........- v I
make an inspection or the newly constructed was, brought up and after some Mrs. MaMc llriwlfonl, 1:) Church .trvt road. in this vicinity today discussion a committee comprising W. Vt., MeeretaryVhlttter Oratorio '1 .sj

"I note with a great deal of interest. M. Pepper, Geo. W. Hyde and U. F. Society; ,writes A'
that Alachua county people have the '' Jordan was appointed to confer with "Peruna i* certainly a wonderful medicine r t

good roads fever," remarked Mr. 'I' I),.Clarence U. Strouse in the matter. for the ills of women. I have heard it

Smith "It' the best thing in the The committee met Dr. Btrouse late in spoken of in the highest praise by many i 2 -1

world for the advancement at a comjnunity the afternoon and a special meetingof and certainly my experienco is well worthyof +, '

as has been demonstrated in the Board of Trade will be held this a good word. '

Marion I hope the time will --come afternoon at which the committee will "I began to have severe pains acrou my

and I believe it will and not very far make its report. I back about a year ago. brought on by a r x tit
distant- when Ocala and Gainesville The committee suggests that the cold and each subsequent month brought w *,' ?7

will be more closely bound an neighbors business men and other using printed me pain and distress. II1 iV. ?t k

when our Ocala and Gainesville stationary permit the advertising of f "Yonrreme8ywasprescribedttnd, the way ,'?, ; Lt."2'/2 --

friends. may visit each other frequently. the functions to be placed upon the acted upon my system was almost too good % / .&VING.J ,

ly. \\ the roads am ia proper'condition ' same, which will not detract from therespective tit be true. I certainly have regained my I .4 .... ,j Y, .
it will be an easy matter for business, but will prove. a and strength. and I no longer suffer 'SO' - -- ....

your people. to breakfast at home eat great ag *nt in advertising Gainesvilleand ; periodical paina-and extreme lassitude.- % dl.caacs. |ncliUnB|( pelvis ra.1 I In I'nnalhr_ women find a prompt

dinner with their Ocala friend, spend| 1 the Bible Conference and Chau- i Mable Bradford.,..---.y' : S ..... ..... .....---......-i forth a life IonIC "tluly. I;, ..otl'.rl11.I1'"t cure ,
a pleasant day and return in plenty of tauqua. .- . _...- _ 1'rrunatmrescatarrhtvhither of the \ ThoimamU or lentlinunlnU to thin .ff .
Thousands of Women Cured Year ...'i rfoelvr l llarttnitit
Every arw
time for supper. This Is bound to be THE NEWS FROM MELROSE. fM'lvto' or\tMn.\ or any other urgan oth... liy everyynar.
by Corrcspondrnce-Tlils Is What U Tim KIKM! that I'nruna )h. "<*- w
liiiniuii
accomplished by automobile ly.
an trip
roiiill..ht il In this class of .
< -
Dr. Hartman Proposes to Do I | I'A. tau
over properly constructed road., and Postoffice is Prospering-Social Function for You WithoutCharf Pe-ru-nA, a Natural Deautln r.J'I'I'UD" .earrely .betover-ertlntsted, 1

it will not "be many years before you I In That. Gay Town. Women who suffer should l l real the prixluce* clean rntic.iu imtubran I .... ........ a..M..-....-..NM 1....'..1Ifyun
will see I.. Melrose April 6.-The Melrose .post- do not dtorh"l prompt tad
evidences, prtinrntwl Iiore. We hare i M, the !hula! of faUi It) iiinietry
office did a rushing business during the I.atlfAolory, rn.nll* front the nee of
and
A DELIGHTFUL OCCASION. thousand of let torn from grateful a perfect romptexluu.
past quarter beating all previous. records friends who tell the same lltor,.. The women have not l been slow toi ill||.. 1'rriina. wrlle at ono to I>r, hart ;

'w. C. T. U, and Friends EntertainedAt in the issue of money orders-vis i Half the Isle that are peculiarlywoman's cover" &fll.luur"' cue. and 'lin vt" 111 Iw ples.cd| to give'
342. and fifty-eight toward rrvtorlnu' .
paying money or- own are of a catarrlialcharacter. ) youthful beauty
the Home of Mrs. Turner. iU vulunltlo * ders. Th registering of packages, Female weakness w". not than all theilovicv known lo ..ciwn"'"'j.Many you ; '
A< <.*.>. I>r. Ifarlinsii trt<.litnntIlartman
The W. C. T. U. of Gainesville I.
ututaratood for [ a girl 11.Caln",1 l her faded<<
etc.. amounted to eighty pieces. Tho many year \ nfA Thu $'nltarlfJI.Iu"\ .
noted for doing things.; The latest amount of general mail handled was Ur. It.rtm n de.M,rv *" the credit ofhaving |MIIV, many a matron has |fti/; li"ii was a reception given by Mrs. Turner also )larger than any previous year. dt"h'rmll1rd Its real character.Jr. . late Ilaf: her comely *i>pc-au.uO. ill j .r'rtlr .ulln.t..atll' ,C

a' her home in North Gainesville to Her 8. .... Vwlor'of Japer was the' b-a wad, '..hurt.1, ...t uhaoJ n.luK: I'eruuu.:1uTICK .. ... . '. ..... ...._..-.-.....

the members of the unions and invited .. .
guest of Mr. and Mrs Kunella'" at the --- "
guests. About fifty were preterit. Huffman house during the pact week. with the ju'tlce'' court V. .l> 1/. f.. (I. tl.M. ;
Her large parlor was beautifully decorated i M., tr gas, lv. R>. :r t. ..11, .tl,ar; *>, lid Tt>W(>*l>llI ...
His many friends were much pleased Rev. O r>, 1'rackel held two tervices IMK.I UNI.n:" HKCTKI.V OK CIIAITKH U. .1.rnI" ,.-. sat ....lLln" ;kiln 'ruwn.btptl.'
with palm. Mowers and ferns. to him I, *''**, ,.,\ Wr Ol1* KI4)ltIUA I Htti e l I4E:...r, 111101 $*"'1..... I, 4. li. l* slid
most see again at the Kpueopal c church on Hun ,ninth b.1I of ,.....,&1.,_ U suit It ..11 t'uw Welp
The conspicuous was a picture ofMiss Notice to fI..ht ylveii Hint (.' I' ll<''i*., .. M
The Ladies' Aid lu KniM" "U l>:Ui l.
.Society reports a day, which were vi ry well attended.At : purot.a.er h.Ir..I Tm. (;..r.lnestw N". ....". f". ,
Wills background of Ji>b"o. While J. V Huff
on a financial: remit of 918 from the recent an election for delegates t) the i. <"'.4 th"" 4tll iUV of N>*.. \. II I..U. bee alas, A, ('. ".14 Ik N hmUltV \ ki t
white with a large bow of white rib- ..101 e. rundel* in mr omo*. .,.! b.. male se' I M. 'IIsoakl 'Ilin ''tA... ,
,
pie supper. diocesan convention next month II |.lJ".tl,.m f.., t I).*M| toUtuo lo' ..,.,..'4et..S 'rbo",., lf.f e.nl
bon above while over all were her lad with tall'. ...M > .. ....... Ai..b ArrUtr "
; H c-rtll oalf "" .1. the hsI It.nder.un r. .
P. ) Toll r .J.r 11
I. had. tlsras
s very large cabbage von NUll zI&, and H. Button were i>|ect- loeI,ttC 12.,14 proh...rtr.ile.te4. h. .41.'tt4l.I +err ,
words "How beautiful I i. to be with .I iV. i'l.iipioi j IL: WllIfruff9 .
t1.rkts, I"j '
k.wtI1454.f
palmetto planted on Bellamy ed. ( "'" t I r Lieu W N. wlLb
God." Around all were palm leaves. se i. "..!. ... Tt>. V. It. t). 1 N. ,!. iserry a l4s1q.'
Avenue fronting his house. It. will be .
Jkl last
'ria" Iwlntf a.rd i I IK .hUt of \
I I KliionUI.Wl M H I
I.aal.r
The decorations in the dining room quite an addition to the town. Jonesvill Happenings. i the 1".' ._.at *nb .?erIU/rote. 'In H>. taws.>( {. .* Moi*.llK. I' It'll.llwosW
.
were of roses and old fashioned red The next meeting of the Ladies' Literary Jonesville, AJI,1I6I I he social given I J.n. ,, Juaesttak.w.skl .,."UI"a'.1.....",..A ameo 1 I .. !P4.II. lu'|..tI....'.lt n J. II II.Khljf MrullteJ.
pioks by hundred. Delicate wafers ..1In. lo 1... tat (lord wui 'M> Society will be on April 7th, the by the Misses Hamilton at the home! o' u.. lib dar Itl Al-flt. A. )U. 'lira.Wltaew .
W 1f.,1 I' V tylJ
and "fruic were"tHved. tit:" of the paper to b" read by Mrs. their mother SIn W J. Hamilton, on I *r unfoI.l. ,I.,fta wn' N.1 1.051 in:. I." T M Kirov r J. r' :Nlpv.r veep i'91
I UK 11<1.TV1 Hat, A. tt I..A I ,.....,.., fII '
I
II O. A luNteere
memorial Miss
As this to
was all a
1'axton being "High Itdlvidaal Character last Friday' night wa quit a ....ee..1. 1>'. It. Wl,:!''t'IE'' II. Ml.K. iot.Itll. XVH. Mirntn5> t
Willard an appropriate of 1-1 Clerk drevJt Court Al_l>u4 Cv n... I .
program II. I lssne.p A Kliv.
is the Glory of a nation" The evening was t pent 'In playing I 1.I . _. J. T. $" .U wrune.rNshw.l
music papers, and addresses were Mrs. K, M. King: en.ilalbf'd. large games until about 10 o'otock when all 1' :TJT' N rr) iKiAitu 01" IHJJII.KIN- : N.....'''. Kb*.. A|>rU .. lee .x

given consisting of a sketch of her life number of her friends at pro< by Mrs. Haney ; a paper "Our Uncrowned > slX'hsnded euchre cake aod lemonade served. .
on Thursday evening. cream were W. 'M u1I1Md .'du.... t.v.r.rsand (l.n.unlaa.
: Queen" by Mrs. Patch ; a The winners of Those who were Misses r..Ut'1Od ..." .,. ..1 A Iat7hQ4 .."" ,.", r'V..., ,.. r
luuky the prices prevent were 11 m '
lII..iu.e llt.ru Iith.fure,
M
rM urtns tibia the.. 1_....."y ....*o. (1*. | Y
recitation "The \Vblt Ribbon", by were Mr. W. A. VogelbieK II. B. )rat ftl Lamb, 1.1111. Hell M.thvln' ...,tr-t. ...,. ..U,.... tuur h.rsorshl" ......, hail ':..lt* ,Illtttff.-.'t,
Mrs. Turner; account of the unveiling Tulles, Mrs. J. A. lUuiruel and Miss Melissa and Olem I'l-ketl.'Btulla artd'' 14 4*..Uloi..1.1 ma.<.M.....b.U.al of the Willard statue by Mrs. Doig. Elsie l hurlW. After enjoying: a Irene Mlll.r. Lurllla HhrflUtd and I.'.. ft. .... '.. .... .,. i". i.. ..t.Z3.. tJ .... v* ..*! 7>. aplrnrr.f. l)* fof*> the| tax l"OIQIn'NfqU41' .
.
TUWB MU 14, nii. If K* ', .Mt H* lon. I. IL. "
and a beautiful address by Miss J-:. M.Iwsrsalera delicious supper the party adjournedat ate (Irlftln ; Meet,., )Mrthll Curb-tt. J II..M... ''uwMbfv H. !<.*.. Ie r....t. ..lit t tl /'re Just .rr..1. toy fourth wIt.." +
of Philadelphia. A freewill ...4Uua... .e_i to UIe .....,. 4aserta..l dt..rent .. b. .f.1.I 1, "I'm entitled to a boonty.ain't .,
I .,
IMckrtl Ali"n
a very late hour. Milton ii, Ureen Miller .
tt> r..nw.wtD4fAtn'''''''' I'h IT Chlcac' TrlbUM.
offering was given for her memorial )1,.. W. A. Vogelbach; cave a pro. North IVttlt. (Info,

fond.___ .__ ___ jrt-.I..e euchre party on Friday afternoon Uurko Weeks. Oro. I'lektt .Ch.nn'l I' -. . .. . . . .- M.'_'"_,-,

In Mayor's Court. six table Icing filled. The W.. orxoised a Sunday tcltixtl> last

|.rize winners were Mrs. II. W Ham- ftultd. week and had The Bank of
Joe Floyd was arraigned In the muul a ago, a very Alachua
l ipal court! yesterday upon tbs lyn, Mr. J. W. Johnson Mr. vV. Darlington dice! meeting J last Hjn
charge of d ratlaa. and was fined 410 and Mrs B. IMllacn. Straw. i* our worthy .up.rinteiHsnt. .,

. :and costs. The charge was preferredby berry Ice and cakes were lb. refreshments Young men, tale my ad vl.. and Alachua Fiat ;

I William Archer, who stated that N'ruJ at the aloe of the never loan your hor" and buggy to an .. .. ,
-
:Floyd started the row. II. stated that games.Mrs. other fount man lo take. hi* gift home, -- Y ;r

.fe. went In to bay some chicken that I'. J, arliagton and Mr. E. J. when yours has to walk. 87 We herewith present Htatomcnt of Tho Bunk: of Ala ? '

the attendant reported that the chick-: Whitehead were among those entertaining )I,. wed Mr*. )ho' KUby ar. .'
'ass had all been sold, that Floyd od friend at dinner. made happy over the arrival of n baby i chua at tho (do' *) of its first HX! montliH binlne**,.as

abusive language and jumped oo to The One weather Is the cause ofmany boy at their horn. I follow: '1ML$1Vli'Elit

.... which resulted In Ifol17 I picnic, the public parkas Earl* M4 LurlCa AheM-M U visiting her I ... . .
a row. ; ..;;:::;..-. .........:;;::::::;:::
Williams, accused of bwlog mixed ton being a favorite spot on aeeoaat of cask l K. J' Miller, for a few w..>*. LI4IIII.IT1CMI

Up in the same row. was discharged, It. pretty sarroandiogs. KiM Marion MU& IJtai Urifllw visited Mf*. Us.
demand
doe
UOjUjQ
criOverdraft
Capital
oo
I a* teen was ao evWeocj; against Din. Robiasoo gave a picnic tb.n* a'. Eat* lie lisle of Area** 'feet *.Dda y.lo '..0.es red, JJ'M'fJUDle StIcJQIT Capital' M'OIJ . .. . t2l5ntX as
orday In hooor of Kr. frtoads, tlto --. . .-- ,
*. .*.ir..J 890 KFurftltwr >
Democrats win tn Montana.Mont. :die.*s Clare Corbels ao4 :7aeni B.v. Ho'., Qa to c.rif..ia. and Yule.. 7.UO 8!* Undivided: : ProfiK (...1) . 1M N

'' 'DlUu_ April -lho'dpaJ all of U.t..UJ.11 report having. Travel via th* CM*.ir Ualwi Paelflc .. Do from Hanks and Uacfcur 4,719: M D.pwil. : 33 1'y4 ;
Cash oa head 1.*7ft OZ'
:-, :'elections- : In Vontaaa feave rr*.U4 bad a most plaat tin*.. A J
b>I eetM-vally IB favor of tb. Desaocrafs. Tko 11M1M of the Melrose Head through train ..... day. ?few Overland Total I41.Xl 2$ Total . . '

f(L ,,- J1Itt".Jot.u )lrGaht....... aa' trertcaadfSate let Club aad frtvods bad a pfealo( oo Limited,.UeirMilt&t. ..J.I.... ihsn : : '" ..': : . ... -.. .' l 25. .
1 wax elected mayor, wbt>> !* Monday at tfco *am. plAce, which also .".... d.,. ea twI'f', n. CaliforafaYsprs. : :::'.tvw. -: '; .::;.'

'. the Democrats elected a city treaxorrr.At wa. a very ..joyabi affair the steamer :. through ..,,1oM toffs Yrrrr" Our aim I i. to to strong, to to liberal to bo prompt t 10 wry (N'lJ.pot'4ttt' "oar

1Jdn-a four Democratic and four ,Alert having boNa eJaan.td for lboerasieo. elects" Los .4.<<.... aid .f1Iaa4. n. well sad truly bo4foc their ,,..*,.... W..al4alitll oar own r w crauf N (
t JtrroWJeau' aldsroMa .._. .. AtOreatrslte. ? t4 .f . full goo.true. .- ..
: v ryUla<< paUtolsnta t.rus4 u u. .. .u., .JIa .OUM bad-I j, W. 'oda.
,' ': the DaUo camdldala T. B. Zim.. Jr., of Ualfecsvfll was la appflctttloss to W, 3. Kel kw, f JOtI secoor?U 4

:".,.:_, )'".i lj JC'.T'L.! .>..:tS. (... tow or ouanlay on J.pJ bu.L lent 1)1.. O 4 L W .1:,_, CIIIcq.o" T"I 1!'., 3B-,, Oocifrey: Ca.
1:, \ /,,," .

t." .I '&,f.h", ,,1-.,.-. # .it ,.>;;. 4 ", J,.i t, rJ;a;& ,".',.:"II' ," ,wa 1&rr. L. .,. .: ;" 'yl'< .A o i1, .':;r.\\ ,. t.t. ldij. ,," 1. "\ \jot,, ,. ,j"\1'\) ;"A "U'F.j." .J It #. ::1. I l. '.; .

-



4 ......-." ... - iii

.. ,l'At-,90 " I.""fIJ. '. ,
.. .
'
." .t." "I.' '" r ;r. ''' ,', .
\ ;
'I\I 1t'! .
'. "'{1'" ,' .1 <'" I . < .. ... ,10.'.. ." ."
) .
.. : .. I, ',.'7,. ,'\ '..

., '
, ,
... .
.

.

H C; TJU GrAINESVILLE SUN: APBIIJ '6.. 905.


I
-- .
W -- -

"I MRS. HANEY WAS HERE. SPECIAL MASTER'S: SALE. LEGAL ADVERTISEMENTS.NOTICE 'I

FIGHTING WILL' BE Under and by virtue Of a Wounds.and of the Circuit Court Ubtb Judicial Circuit t
Made Fine Talks on Temperance at Florida. In and for Alchu count7.on MI*rrth FOR PUBLICATION.Land .
Methodist Church and E. F. S. day of February-. 1>. IVA. ink* certain cause I
Office OainenrQIe, Elav.March .
RESUMED SHORTLYJapanese pending therein, wherein J. M. 8w._ U at
On Monday evening at the :Methodl complainant .William WUhotte.. as tru.- 13.: 11106.Notice .
sores of kind caused tee for Annie Wilbolte. VVUJt.m M. YVUhoite Is hereby given that the followimt-
any by t church. Mm. C. S. Haney, State Individually! and Annie Wilbolte are defendant named settler ban filed notice of bte Intention
any kind of accident burns wbereln it wan lcreed that in default to make final proof 'In support of hi*ol"'..and
curs *
'
'organizer:;: of the \\ C. T. U., gave a the payment of a certain um ttt money thereto that laid proof will be made before Registerand
Are Screening Then scalds, bruises, sprains, eta, are temperance lecture to an appreciative mentioned. ten. dy after the date of Receiver at Gainesville./ Fla... on April 'J9.
best treated by the immediate the Bald decree. and wherein I. W. E. Baker, .1906.Y1 x:
application aualence.Mr.l apeelal maMerIn MaId cause was authorUert HUGH J. Jour of Newb<
1 Movement Carefully. of .. Haney i is. a lady of refinementand to nell the loiultt and tenements in the Bald d,.- Hd. 3:161: <6 for the St4 of SwM of Section U.
eree.pecWede . tberefoie. default baring been I Tp. JO S.. H. 10 K. _
..r iWHswa aw WBlwa> all made In the payment of the Hald gumof money
well informed
education, on He
name the following "
witnesses to
f ..
priynj
HAMLINS for the .Mpave of time ttn-ielo wettlon'+d.1. W. '
.i
R3 CHINESE BANK FINDS ITS MONEYPressure : bbi continuous residence upon and ciUUvaU. aW
of the will
phaae temperance question 1'::. Halter.> cl l master an aforesaid otter of Wild land, viz:
.,
: forMJeanalwi1! eU before the court house
and her address was full of rich Whey Bailey O. A. Munn. L T.
r door OalneMville.:. Alachuu. county. Florida, Suinr Walter
Is Being Brought on the Chinese thought and helpful suggestions.: to all on Monday. the lot day of May. A. D. Iduft. between Donelaon, all of Newberry. Fla.
: WIZARD OIL the legal bourn of Bale to the bltfbebt pd W. O. ROBINSON. Register.
1 I. ..:Empire to Form an Open' Alii temperance workers.On and best. bidder therefor, for ea"h. tie! follow- \
morning she talk tog described real estate. """tu.c '1. Ivlntf and
j4fi 'ance :With Mikado's Forces--St. P. Tuesday gave a being in the county of Aloonua mud the State:: NOTICE.
i to the student of the Seminary and of Florida, towlt:
All persons Indebted to the late S. B. Oldntra. .
'
'
tersburg -- of the
I . and Toklo Receive Reports. Tat, great, soothing, curative i trade a very tine imprenion. This Souineam Ueirlnnin iiuurter at the Northwest of Section corner Twenty-four and credltorm legatees distributees and
all other having claim
Gunshu Pass April 4.-A retfwal remedy: relieves pain, reduces wt,.- an ii doing a great work for ((24) TOWIU.MP Nine 10). Southof Kane Twentytwo against tbe persona estate of IJ..H.: Ulddln ra.de or demands eased
(:y:; taut: thence South J74 feet to a
of flghting. la *'xiK>cttxi' shortly The swe1lli1g' and' inflammation and! t the cause i the:: represents. Long may take: thence ...:slit.. eiirbty ((1u> rods to a stake, are hereby tllled. within notified two to year present.them tai the under -

4 concentration of the Russian! army Is heals np all open wounds and she lire to work "for God and Home thence thence west North. along 274 feet sold to"section" the half line-section eighty line<*") March 19)16. EDMUND E. VOYUi.
Admtnlxtrator of the Estate of S. B.
x complete with its advance:: lined south lOre It In tho one perfect, modern and Native. Land." OBSEKVKH.C : rod to tbe place of bevlnnloff. containing tenacrrS deceased. Gbldlnirs VJ3AFORECLOSCRE
more or less. W. K. HAh hH! .
's' of tho ,'Btatlon of Slplnkfaoi. 74 mite dressing, or treatment, for a - An :Special! Master In Chancery.

north of Tie Pans. -The Japanese are wound. Its quick use will positively !: OF MORTGAGE.
< nf<.rlliitc f.;..ni| nrl>on."Don't i In the Circuit Court. Eighth Judicial
+ SHERIFF'S ;, Circuit
SALF.Under
Bcrcenlns tholr .
inovementB tall blood '
by prevent poisoning
you feel foolish: peddling Alachua County. Florida -In Chancery
1 cncans of cavalry and it is illfflcutt 'tu Always keep it at hand. lheIWII'4'n..Ic HI asked the and by virtue of an execution iwueil F. J. Hammond vs. Lewis Hood and'Cora
they to.'II1" out of the Circuit Court Eta Mb Judicial Circuit Hood his wife-Foreclosure of 'o1ort.rawe;
locate bulk ut their army'. Says; Mrs. Jessie Farris, of Elizabeth man of ftu% >re Ideals! of Florida for Alacbua county in a unit Order Publication.

H A heavy' ; .movement scoms to be la Ky. : "My little boy was "Yt' ." answered tbe streetfakir "I 1 on Mary the G.Chancery White et.Hide al tit of plaintiff Maid court.und Nora wherein. S. Died It appearing In the above by aflWivIt stated appended that to tbe bill

f a progress wi thQ Ituolan ftan..... Tin badly burned on both legs, which feel rather fo )liMh. But what rio you Kollln et. _I. U defendant and directed to all I I Hood and Core! Hood. bU wife cause the defendants Lewis

railroad ttatioo at Changtiifu/ 40( toGO drawn out of that think of flip i) 'ogle who buy 'slu- and every the HherifTi or the State of Florida' therein named. are nOr Ments of the State
were so shape I. I. W. Fennell. sheriff of Alacbua county. of Florida! and that their residence I
miles I above, Tie 1'ars, U occupd!: ) he could not even crawl. I tried "'""bln ton "'WI'. Florida have levied upon and will Hell before and they are over tbe age of twentyone unknown -
the house door Monday the h.t day
court on
'by ; It Is therefore ordered
that
1" apaueuJ artillery. but no tar &* : many remedies without relief, but of May. A. U. Ist,5. tbe same being legal naleday. non-resldent yean: defendants be and they are hereby MaW
ABcertalJ: all1p It duce between the legal hour of kale, to thebluheot
nut (rovrr. very required to appear to tbe Bill of Complaint
Hamlins Wizard' Oil mads
-
finally ana best bidder tberefor. for cash taefollowing
tiled In said before
laryap cause
body of troops. A two whotlei: on or Monday, the
dencrlbed reul be-
enlate. lyingand
he Athiiay of June. A. D. IHOft. otherwise
and the
perfect
a cure can now
cart of the Huiau-Chlnf! 8 t banK\ cue . .OKDKU: YOUR. . inir in Aluchua county Florida town: allegations of said bill will be taken as confessed
I I otM I. 2. 3.of amis coniatn'nir
fiord walk and run. We thought we < seven acreseach by Maid defendants
mining than: ISOO.OuO, was lost an .shown by map recorded on punliu
.
It In further ordered that this order tx
pub
t during the retreat (ruin Mukden .hasbeen' should have to amputate both his I records of" Alachuu county. Morlda. In flat !llhed once a week f orelitht consecutive weeks

} found but the cash of legs, and feel that Hamlins Wizard "look:. "A. Page er1, made by \V.TaYlor.Co In l"be UaineATllle Sun. a newspaper published
chest! t Wines Etc. : together with all and flnirular lobe tenementM. In aid and State.
Ninth' regiment of artillery which was OU saved his life." Price COo and Whiskeys hereditament and appurtenances to This March county with I9u5.
a : tbe same belonging or In tiny woe ap|>ertalnInir. S. H. WIENGES. Clerk Circuit Court.
albO lust Is lUll uurllscuverca.A $LOO. A true copy of the originaL
morem '' Sold and recommended Said property levied upon und to be sold' a* (Seal) S. H. WIENGES. Clerk
nt of (he Chinese bandit by the property of Mary O. White. Nora S. Kol-
led by JapniH, ofllclalu! ttiroujh Moagolla . . fromHenry . . HnN. John tlrabam. William M. Graham and EVANS HAILE. Sol'r. for ComD1't.NOTICE .
ALL DRUGGISTS Douglass S. Jrahain to imU.sf. the cuiitsof Maid
1 'In the dlrectioa of Tsltalbar, 3U cult, together with such other co.ma. may OF APPLICATION Fore TAX
sn'UU'\'If.'U have accrued therein together with the .um
of Harl ln has
d' > uoen report .. . Free of Liar an and for attorney fee ln..uldcaun' e. DEED UNDER SECTION H OF CHAPTER
- -- -- - -- ---- ----- -
-- - -- ----
cd and prcaturo: Is being; brought: by to"all...fy said' eaeou lln. 4UW. LAWS OF FLORIDA.

the Jiiinne In China for an open .\ H<*)tfli i is-Inc haul l rHen up( In the Sheriff\ of Aluchua I* W.County FENNELS.! Florida. Notice Is hereby !given that Wade &. IteV.purcha.tersof .
6
alliance with Japan.: pulpit, t to level the rouKrexiitloii 'In II. A. TU"A SHEIC.Comll"' '" Sol'r. TaxCertUlcatesNo QH&m.dated
the 31: day of July. A.. D. I IKM. have filed said
t, Yuan tih| Kla, governor of Pe Chi JI. prnyer vlion n iiinn In 1l 1(0 front rowof The only up-to-date cerU o.te. In my omce and have made application
NOTICE: FOR rUBtJCATION. lor tax deed to issue In accordance with
province and General Ma commanderof the Kull"'iy took out lilx IinixlUer- law Said certificates embrace the following

thu Chinese lorce, on the frontier, chief to vrlpM hI. lirow, forcettlmr that: :Mail Order House U. S. Land Ortlce at HainesvUle.. Fla.. described property situated la Alachua coun

t' cue said' to be ut the head of this I a pnok of runt. wne \\'rlll'II&,1| l tll' in It March 1. I'ft. ty. Florida, towtt:
sql
Notice I I' heretic iilveu that In nomnliance Nw* of SwH) and Ne X of SwW Section U.
tattoo General lncvitch'i heudqilarler Noisily tho whole deck WI' wntlereo1 in the South. . . with the provlolonx" the Act of t.mltrrell8: of Tp. lu. 1C I&. _
over the floor of Itio ifiillery. "Oh. June 8. IwTH. entitled "An Act for tbe vale of The said land being assessed at the date of
r >;a .are: Jn Urueral Kurona'tkln'M old Umber lands' la the :State of C.e. 'lfornla. Ore the liwuanoe.of Much certificates in the name
'' trnln. Iron nun. solemnly remarked' the -- -.. .. ..-- too. Nevada, sad oVaMlilnntoii. Territory.;' at of John Frlel' and Unknown.
minister. "Muroly paalm bulk hilt - -- ---'-'-'- extended to all tbe public land :States! by-Act Unless said oertldcatea shall be redeemed ac
: The Clitne o continuo to bring In your' t of August 4. I", l. J..rue"\\'.Douglass Urady. cording to law, tax deed will issue thereon r>n
ic; stores been but 111 !! county of trftfayette :State! of Florida ban the let day of May. A. D. 1HOS.
Mood 16 & 18 Clay and 501 W. Bay Sts this day nle4 In this ifflce his worn statement' Witness my ontolal klcrnature. and seal this
S'i -- - - - No. 131. for th No. I. Township No 7 S.. Mange No. IIt. H. \WIENOES.IK .
t Movements of Jap Army, A Wit Virginia' couple that did not Jacksonville, Florida. and will offer proof to show that the land Clerk "Circuit Court Alaobua Co.. Fla.
Toklo April :i.-Noon.-A of nouiibt in more valuable for It" tImber or atone
port want to get; Into hot water during the than for agricultural purposes. mod to entabllHh -
7 the Kalyuan forro drove -the HusnUns marriage ceremony stood In' the middle bis claim to Maid land before Register and NOTICE OF APPLICATION FOR TAX
t{ from MlenhtiAcblrh -- - Receive.- Ualnenvlllp Florida on Monday DKEU: UNDER SECTION OF CHAPTER
yF and occupied! thevillage of a stream while the ceremonywas the nth day of May. Itta.He 4HH, LAWS OF FLORIDA.
airJ northern heights on MercliSint. names as wItneHxc: C. C Hiuhoox of
Since
that time
performed. they Write for Price List Etc. Hatch lienil. Fla.: C. A. llowell of Hatch Notice Is hereby given that It. P. HaU.
IyS hare been In hot water. llend. Fla.: 1.. U. Itedlll of Grady Fla.: J. H. purchaser of Tax Certttlcate No. 217
The llnation Inothrr directions Is Crlbbsof Orady. fla. dated tbe 8d day of July. A. U. I\III). has
Any and all ivrrHon claliulnx adversely the.b..ed.rH.f'd died acid. certllloate lu my omce. and bas
'unchanged.General. --- ------- -
lands are requested to tile made application for tax deed to lusue in accordance
their (.lalm.. In this oClce on or before laid Kth with law. Said certllloate embrace
Jtt day of May\ IWXV tbe following' described property, situated. In
Llnevltch Reports. pit W. (J. NO BIN SOX. KeirUter. Alachua county. Florida towlt:
t /8t.: retemburxr. April 4. KJeneral' ABSTRACT & REALTY COMPANY U.vetof:R. Ill SeX of Se)4) of SeH Section 17.Tp.

Unevltch In a dispatch dated April 2. FORECLOSURE OF MOIITUAUE.la The ....141.nd being assessed! at the date of

says; ( the Circuit Court. Eighth Judicial. Circuit the Issuance of such certificate In the name
of II. 1'':. DavisUnless .
Q1 "The situation remains> unchanged. (Xb.oorporatec11:: 1 Andrew Alachua J.County Jolly va. Florida-John S. -In Alker Chancery.and tlar- said certificate shall be redeemed

4 b "A Itunlan< ,patrol during the night E. E. VOYLE. MGR.A.belraau derof ret IJ: I'Imlth-'oreeIOllure Ihibllcallon./ of Morurairetfr- on according tbe 3d day to law or May.tax deed A. D. IMA.will .issue thereon

of March 27, surrounded a Japanese Witness my official signature and seal thta
It appearing by amdavlt appended to the the: th day of Marcb. A. D. 1iJ01'I \.
patrol ronKUtliiR of six dragoons lathe of Title and full Information furnished regarding lands In this bill Bled In tbe above mated cause thai Johns. I I S. II. WIBNaKR.

t village\ of Jlalcbancb nta, on tho cnon',. Our manager has lived In this scanty thirty years and Alker and named Uarret are S.non Smith-reddentaof tbe defendanuttherein the State Pd Clerk Circuit Court Autcbua Co.. Fla.

t4F extreme |Uu.-I.n! left Five of the thoroughly conversant with land titles. of Florida whose resldeno are unknown
: and that they are over the aye of twenty-one
Japanese were kllUvi. A sergeant was yearn: it In therefore ordered that. Hald nonresident GEO. S. HACKER & SON
captured. defendants be and they are hereby
LE. required to appear to the lull or Complaint
S7Q;
IE. E:
'Y
,
-- tiled In Mild cause on or before Monday, the MANCrACTUKERS OF
5th day of June. A. IX Iwrt. otherwise the
PERSONNEL. OF CANAL BOARD. alteration of said till will betaken aaconfenoed -

d \ FlUE ACCIDENT BURGLARY AND INDEMNITY INStJRAUOE. Bepr. by oald defendants.it
44 U I further ordered that tbU order )>e pubHalied -
President Appoints New Commission canting a number of prominent American and English eompanles. once a week. foreltfbtroiu.e >ut.I.e.k..
Befor. Leaving Washington. REAL ESTATE AND CITY LOANS. In The Galm..,n1e Sun. a newspaper |iubu..bed
'In the
oaM eounty and State.
Washington April :S. -The personnel l Gatn es"V':1.:1.Le r 2 ':: : ..aMen Thin March f th. 111I.... I !
'
S. H.
of WJENUKS.Clerk Circuit' Court. i
.
the
now" isthmian cabal commission A true ropy of original

Is as follows: -- ._ --. --- ----...-.. -.._-- -. (Iseall 2'. H. WIKNUKS. Clerk.
; '.. J. )I. Kl VEKS. Sot'r. for COU>I> 't.ptrriTios .
Theodore p.
Hhonts. chairman: ----- '

Cbarles f I:. M m>on. governor of canal' FOR ELECTION 0e..

Cone: John .Wallace '
chief
engineer;
T.the Honorable Hoard of lubllo Instruction Q e
, b ';: Rear Adralwl M T. Hndicott. If. S. of Alxebua County Florida: .
a+ + .rowt e sand
: N.i; llrlgadler leneral Peter O Ilalns. V>. the undeMiItt-ned taxpayers and voter
rMln la the territory' de" U. 8. A.. retlr ti > IS BaJtt. also all of Se-cttono 1. 1. J. 4. ..
Io,11
n t. Corp engineer, V S. A. ; Ik-u- ,
aad U. Towaahjpa.
Kane 1&t: :: alan aU of I Building Material
Jamln )I. HarnH I HectkKM &.. '0. :SI. :$M. tai s.9.SI, nand X Township ,
M. Kaa> e l, Past: also all
' ( of Township H. I
,,l These names were announced at the I Range I* .;.... except Sections 9. tu. ai and
;,. tsar department today and In connecs of.dotnontrtmpecttaltyP. 'tlUoa your kooora- C1IAKLKSTON', H. C.
bit body to eaU an elevtloo to determine
(tun with" the announcements Secretary Women wB.ther the above described territory shall

Tafl gaveout for publication a _tat* b.<.uee :a Mr.>cial Tax S' 'boo| [Ustrhst.. for the Sasb Weights Cord Hardware
lno of levying sad rx>Iler>Ua., a district ,
Jitrnt ihowJujj the allotments of sal! rennin t...for the exclusive uv at |.blle free ,
arloM M>txx>ls within. lbl district. Km l< >etfuUy sub
;o lb. new cntnmtaslonera and I''ecI.J. AND

'p his own letter to th' president and C II Thomas. II L. TbouAs. J.It Tboma.

a .>n\! fn m tho pre.ldcnt containing the and ChildrenWho Slaughter.W K. Pot.Chsrks.letcher. J. A. 'I'b..I.' H. Laos U S. G-L A SS-

plan: for trgsulcstlun ur the
commUslon Note- The above pvtttlon will' M presented
ti *. The reimms therefur and W tb. noant of Iunn o la.u\JcUott 11I1 Alacbua

y s'' r (he particular! dutle. to t>e ao ...""n\4.1; couitv on TtM..sdaT..- May- mad.- -IwA.' - - -- E. 1L HACEER ProurietorW. )

f ( each tH>mmUtlon"r. NOTICE A111.ICATIOS VTm TAX

-., ..--- wish to dress well should ur.m: tISt.tRrCTIOS.or CMAITEH _ _..::J. t

.<*.. LAWS or >'LOIUD A .

Canadian Dies In Texas. order their goods by mail from Notice :U hereby gives that 1'11. Atwiract' Jk II. SIBLEY,
K.aliv CVif> ny. preba.ea of Tat
>X Worth. Te April 4.-J. \\'. te.Vi U\ dated the .ta day of July Certtflc A. 1>- : PHYSICIAN AND SITROEON. Y

.rain, \Viutteiu-K.. Manitoba.ou 'm .s r*'l, bas lied sata. rtt3caur la any\ office, and !. -

< 4 dead In !Inx1 at Terrell T.- .. ha. mate: apoileaOo. forlaxdeedtufksu..Ir ID lr sot aIr medlnie4 i v.roe' bath ...d .i.* )L
\ :n aeeurdanee _
with taw. Said .
+ bot.l. flu has been there ten brneatb.folowindescribed. muewrtf.a.rUAVatrem.-. tJ'1't"aJ wits' n.dtrna veatm.al hi 'N wta b* coed 111 .._uo.ofwhatever
dayspru.peeting tre.t-.t tr' dkreaSEs
B 8. H.H LEVY BRO & CO. au-dim Aleebua eowoty. KtorM*. w.n asters ordarstkeOh .. -
lie ate supper 'at u+us Wt of .e4" of >w y S.e. >>0.. TA a. Range

last night ant wu found in the r vun ,. tiS1rTbe ...ldla :i being MsI at tae 4l of ee la Porter IIl'k.111 E Malo St. 1''(. +r. ,

:No letter was left, He, had fti inH '>h. l M.aa* of *ea r rttd at. la UM -BM of (Lantxarttta, .'10&1>>A.PATENTS.
5. C Jt I'. Ity. CanUn..n
noa.,. VM CO jvars of s.". SAVANNAH GEORGIA. ..'" _rU foa'.a... r.ot".1'c1 s. -- ' .. -' . ... .". .. ------
.
6 -'- -" -" --_- eonlllW ... law 11 heed wtu Lee tberro* .a*

a a Dowte Left Dllla! Unpad: the Vttaw IXk4ar 01 Aiwtt. A. U r.**
mr ontoial .i.raatare and seal IIi1J4 '
&n hl.mUc'r I \\1.\::, t OBBBBE tk. Uta tar w. Marea, A. U 'iii"
'I tr IlL U. Wf)::*. ,rv:
: baa 1't't'O"'r1t'd lulaul uijsh A.all''>t .
d. C11I Cteesft Court Alsel ,.. a F &. ,ilsi.
+. of Xh -- -- -- .
II. IK>wle >n. I'l fur $ : ;

Y whirl reprfK'iti an Itnpals. ba .'fI.,". ADIILN15TRATRLX :14T r. ..,.....,......a.-......-. or lit.-er7vwaaa------'. ;*+ttu

r advanced by Crag tuOrr (hev %. It .mm b HUG now RtADT. T. the I P4.lt. % LN....... ta.tt .W' von tauaar..,..mr..r t-y or..a.....a.r
-" .
aa4)) .
t'rv" all. of ... l A,..., caws rasa fwd aamw y.tmwl- '
.es of Dowl.'a rsaipAixn In fc>*tclsoo t'ran Hk r-. *,.. sad K Ail rera.str. \'.'.... .m1.rrt I ___ ae a''
-I .......
N.ue. Mar UuaxwrtawU =ea
-
on his first vuit: here ar r ireturnlrg Y. .....-...
lakow tMf Ikaktfc tie rvna.mftw ... .. ...-
Mrs from Austral There: vo .. ...... possesses M %A ...t..1. ms netater ..... __ _,e. rr. ...... -
' INrstrt..a the _*. .f Ar WWM tam's. C-.....u.wMHIMGftNIe. .. rmer t CM.,
d IU. of W>3 'r a *ojourn at the 5r.. wg M-' fc. th. Itv M. MMuaw .' .... 0.'_

a ra.ta.o. Hotel, about\ fl.OOO fnr advertisl&g Write for Our Spring Catalogue. --Ar (wajt*te *M f...Alwtwa Meaty..*.....
ft KterU... .. sad tlJl for rat of tae open<< ... aw ...caw asst "W i Na''e.' ama

hOtWL It... aaid. that flans won r.Saint........ me__ ..s.............. ,. D-SWIFT*
I.ACA w aJiI.U..t.;

,,13kafI's-cnt1'04.' by cwrta ;Mr*. Oral, j I A ts.1. % t Ihlajo e.t: :*"

a r1 >t 'J .r4lm. { r .. .'..... ."'.. .. <.'..... .... \,:. .ry'li-'pr; ;..:"" : I":"tIr:."' ,.,. :.. ,.,,.'.' .,'.,.. .. :Ill",,, :It\I"4, .. ;"\ ".!:I'. ..,;I.'t '01. "j. .''.'.H 1 '.1i '

I' :-- II3L',1td{



-., '" 1+ ,4'tftsULLil' ) i'mttT&'t''IJtl''j1FlClf'' < v* nNI ( ' '11'w", , ,?, ..... tiUJlrrl.I' t
,,' : : (i' .
"t''f" ( ;: '
:, wt:: : : : ', ,.,' ,
._ : ..... .,L' . _n .._..,..
-
"" "' r- I I B l Si WMMSB MMHMW BM i ai M MWM MM'NEWS ,
I:
: ? :
!
p-, : COLSON AND O'NEArr- '
FROM ALL
---- -

for Alderman P.drick's ,

.,. Certified by Council.' i PARTS OF FLORIDA ,,.'at1 .''..

Council hid a special'

Tuesday eve.nine for the: pur r

candidates for the Brief Happenings From Various I

F alderman to tilt the vas Sections of State.
Food work
by the recent resignation. to ___

Ped rick. THE MOST IMPORTANT EVENTS on is food to liveon.
only two petitions pre I

*", of Dr. J. II. Colsoo and
Transpiring In "Th Land of Flowers." i .
'
O'Neal, and these name i..
"Boiled Down" to Suit the !
I Both Things
as candidate arc
II j I and our people may fret Busy R.ador-Items of Interest to I A man works to '

I: the election of either the AU Classes. live. live
He must ;
I : an efficient r-pretenta-

A lodge. of the Daughters;\ of Kebvkha to work.; .

; election will. be held on has been or ani&e'-\. 1'almrttu.. k

s'' : Richard Warren, a Miami negro,: I leheld He does both t

fir robbing Cha... I.. Woodward.! :

: In Hie n..nn.. Eustis will build brick and cementtsidewalks better onUneeda

: hoar it snUI" of one wlo\ :>> Is in place o? the old board' .

j "h" I lIn lh' duiui." or walk
Biscuit
lnMrmnstbut many who P
Negro women and children are receiving ,
; l tt.'r IIr tln' P 1.J.rn..t'! ''' have
I beansat
for
;; : without any kuowll'tl; of Miami.$1.50 Pr day picking the soda cracker

i ,; nt*. Tlu' rvsl.Mi; ur

I l't'lt which HtretolM's ui-rot-"* Thedredgingln the harbor of Key that contains' in the
J < !<" and Parlh, alm<,"t on a West ha deepened the water upward,

:., .tnuitor. Ill''''* moot tlu of 15 feat.llurrell. balanced
: most properly :; .
l mtutli trade wI and", nnd
Micken was tho negro killed
hetry rulll'4- ore fl'"I"'nt.; '
*% ...tlo of thN r-,tott. on the A. U. 1.. near S,. l'eter.burg. proportions .

iiNo t\* the ilol! lrtiit->. Monday[ March 27.:
a greater amount
; *'+lvt. cnlin. The nanu III)\\'- Tampa cigar cigarette and beer

iiitu-i! of the KlKtilncauce\! stamps helped the internal revenue of nutriment than

: (It I'.v sailors in the past i $50.086.2fi for the month of March.
:. s>!jiw| ran Into that rosU: food made
will. clone any
St. Petersburg merchants
; In' vnlu fur +rlud. as'
hung lioavlly, null nil their stores at 0 p. m. after April l&th from flour.

> | bo to =November" 1st, except Saturday
: a
I 11.> it* n pnlntovl lIp William Illack and Louie freeman
I .
1\ J.thII..J o"'un. also black of Pentacola, have been

.r..K ocr Old .,..... arrested fur making counterfeit coins. U.Jneed 1>

*' 1'wnch piMioralhcu ask, Miami will haa pawn shop-two
that In' had such an creel
a to one, as the sign indicate*-that if
., that It wan l.vaut'In'
acid tou haul l the floor with jOlt put in anything you'll never get

( I : thirty thus H every tin)". I It r it out. !

:! i (,l rl klity of the ttpluc' I More Germans are going. to locate at. ,
)> (">old nut d Pensacola. While other localities are
'1th It weak nUloinlnnl nm
talking about it Teusacola is doing busi ,
,
result In iwrtnl 'onlt'"tlon
onjresUon InterftroM with ness. 5'NATIONAl.

(' and with the action!
Jesse finer, the negro who hot his
'. The poison' destroying:
,, wife still I hrl.and.)
at Hough's near
..' liver ht I losst'iiftl, nut In
rt'>lult4. Mud nrtt'rlwwIeroslM! was himself shot and killed while resisting

"* ftunp i'U nt n much arlloi, arrest. BISCUIT COHFAITY
tin t1,'xlbl! .
l It.r kivplnc spine The grand jury in the United .State::\
>rultinl muvi-lcH' Htronu :and
court at Jacksonville aUt'r" three
,
..' circulation' I I.* kept fri-iv
days' sesninn, has found 83 true bill.
1I'ulth
\' I" l hotel l off.1;
for the April term of court on the
f
The l.lllle (duns criminal docket. f),.*', /ftf 1S }

] !Clark: I 12. 'arr met Senator
The Went 1'nlin Graham Cracker ,
Ima'm.- fishing industry at
; !.-;: the time of the fi-
.,) nml I ousln; .U'batr Bench has. paid out during the past' Buller Thin Biscuit

l ilesrlK'! Itlni In hN lnKk, twelve months over thirteen thousand!

-" "1 hail never hennl' Co I dollars for fish alone, and over ails Social Tea Biscuit ,

it vol'"-.% M.> din-p' Riiil nynii)- thousand for labor
t had u sort of .on"IIIIII way. Lemon
: The Melbourne[ Time was, twelve
to (ell
'I
ptliiK
to any'. um
Hint I can trust myself tn year old on Saturday, and was so full Sews"t

.' n.. though you were the of advertising and business that it

t I Inborn be i>ul.l eoiidile. barely had time to mention the fact a

jlte fort four and wan We wish it many more years of I'roll' ,
1 'U... little glunt. I wan' an- perity.

tied be had MO .rood a Cc. I
: The following Florida postmastershave

Curncd to Death. been appointed William H. Cox

) : Slacktand! ; Itlanche t:. Swire Ilork- '
I I; x. C.. April 4.-.Mr! *. IW : -:
wood j Simeon O. Dell Alaehua; Mary
= '. wife! of a prainliitut r> s
al. WOOO'OIl, Alapattaht Robert L. ..
> Ihtrltet ton. waN luirmvi I.., I V'JIc- 1 I .
; Smith Carraway ; |Oeo. M. Huninwr.Conoley ,
r home while: sujxTint': n-.'
I < \': nf leaven from th ; Tliomss A. McCallum!' Doress PRIOE: ZIST. '

: | .. leaves were burning and ; Joseph W.HtreetKlarbee| : ;; Miron OPEUREKA

; < tat u -ar. her ilresx f'l
l; : I : | 111.1) fanned the fiaino. In a Harmony ; Henry AV. Fisher: Holt.

..' WAS ablate! and .h4- rust . I WINE & mm co

lione\ of a nelxhhor, where Frightful Suffering Rsllevsd. '
'- tried| to put out ih< .
._ .
.. .
< C:?. Aim cut nt the same poisons of undigested fexxj<< G. O I, - -- -

.' adjoln'n.tu"'n' of IIlet1 Orayson of Lnla )11..., took Dr, King. I XNRt.'SS! / Mull Quart Alcrture.Itmtlou .

c William Ruche met her New Life Pill., "with the result" he: I',., ......, IIIh her
.: the name wa... site writes! "that I was cured." All stomach W..1' Q..rl' raa.Italn4.lt'l .
and bowel I disorders glee( way to Pvttat. as(..11 .. . (I 1X1 11 to i es rult us 4Hol.lt
) burned that the n..b their '. "tt..t wM.a.y. ". : :, . 1\1' 0. II N' .It Trr
la laxative
: body. ton properties Zta as Ita",".""'. Okt Use " II ., I a. I NI a flU ',
all drug stores, guaranteed. ..:.0,... N. C'. AIq+wUr.r.AV, . .... . ... . . 75" tq r u, ,II W a
H, c. A,...1.. I U"4-.dr. .. .. . .. .... .. e M I a, i ItA 111
/.grey. Melt/ . ..., :.t..,... .., CA' III) nI.l
,. Results Fatally. : _. N c. rv Orr. bnlM Mq..ln.f Ilea.. U t'r.h HrtMlyKorrta .. . .. ....,....... . to ti :I. .a. e i ,
AprilAfter .\h\l.t all br.-M. *..t\ '>r J',; IMWII N,, <% <3ofHFr . ......... .. . .. . aM Ass es tN 7
l : of magazine and pf r-rr t *.a N. C' c.tI. x X ......._.." . :a a, a'as I ss a ens,
will rut .">ft 1'n.a MTV well. Tb t..rooW.. N, r .V>r'', XXX .......' .. t M ,,, ,.. awfc
patch near her horn teeth iiiii-t lx> arty' fire and auN Jwluroent !, Eu.kq N C' Cura. JCXXJCOKI ..... .. . l flu" a tu II I. y '
Hammers, saturated her ; (:.... Ibxtrku. . ,. .... . .......... !III I M/ a ,. ISMu
entplnyr.l l Iti tln-lr 11- The jlxsaw. ; II..r8oM.t. t4. ... 1 Ass "",, a rlt *, t leiMauer
!tUOlltoftfl t and Iitnltlnj ere .xlremrly l\stllt\ rot Jllr::.... 1wuuq IC"a 74 1 rq 15% I ii aw a ,
Itoafir Itmok "her MiMb.. I rq II Jot I M It as
> herself to death Mrs. .
.
than a mflll I' and l moat are new) r..w, tII..I". r, I.A a lit, i It t1
... ih* aged. wife of a farm In a pprlnic frame that will bold tLrm "la. Ylf,.t a t.1 a .. i re. i* *>> ,rl
Orient n mall place lyina tight so that they will not doutU. Oft EM* .St 1 r1 110 a a, It not +

!) ." east of thin city. Atr Jewelers saws will U< r ee
... t na"Uproviotiii attempt li spring bras *... ...t". ...... fl' ttslw-iI.. t'a/at. NLwY aM ...W a butt/u ', Musa
: a f.-w years ago lo the Sn t..,.. Mrt... rd II......." eM it,. .c.. **...... a 4utli. rn0. ...... ,..1(*et b.kn| /1;
-. . .. Itaaea.at'. Thos-. W..",., ..+.4 -",. a bo,"... bw. hae ...,.. '.be.. of 1:1I-: .*. I,.
I .' < yn rr.nC'lfICf,. Cal aa f N, tS. t:<.u sod t..w.M a ......1.-. ".w. ,..,.. IAb./. pf 11.11. "'(, 0 AtNM '
...,. .., .. .., .. .... ... .. aa4 .. ;
:i. ">,, reed by n Jormn nr.ed" MId e new .joa If. I e .t. l. .d 1Mf.: ( ...,.
& --i J. 1. l 1IA/K1, 4o. b.tta.r.... 111,.. of ala ........ .......... *l ewa>t>...'. ...". .... sew ,.s .sUee Hart r(i
K-.r !nr<- that -vn _hf lass .... ..",.,... N.a."""esi. fur ;..... bot. w ct,.,.... All .s 8tr 6.ul.q a,. .
.'"' '. fsea _a uM A 1M.S..I..d a..d.01. ......_ .aI4.r.c.s ..., al UW ,..r .r1Afr Wboast.
: .u.A .ugtrsr fr.u, Practical BoileMtiker tod Itt lIht .ds ..I ,... ,.*s. 4 It wla..ywu d ..s ......,..... W. &... ..rrr .-....... ar
: ...._ 1.... atwww .,...-.. .H....laJ ....... ea Ia."" q..OUp Ie.. ....... .., Writ .... tel .
,. ,_ ,.... Jot_, a,1gamed 1f ao..1. aw _n.l..l.rt, .
: '.If&E.WI": : A f 0.I5T.jACKHCMVtU '
Mop Vanished. All Work Ooarsntee-1 t+t1atl.ta.etol. LIIfU{ .
/a1 W MtT NAY tlTKKJBT .& lAe 1
[ : in* physicians said that -
., ": & ." of !1'ekfa Ja.. had In.
', his lat hop ,.- 6O7 8. Oak Are,. O ii"''tilU' f'la. ..

J & Dr. Klec's: ot.w It\- ": - -
\/' .. ,
: ----- ------
coughs and cold -- ----------------------------- --- '

<;K speeifleeompUut/of hU grave lie' says : J. AV. PA'JTON, : :GAINESVILLE: BOTTLWS WOI KS.. 1


\," .'. ,: my life isee then 1 CIVIL EXCIIEEfi AID SORYETOB ,rairyatfaattI .1''_ '\. n

tot ever 10 years, ao4 eoo- Dealer la Beil EsUH. Soda Water iU Mayors II 11:
? marvelous throat lad beg fire CJBief ., Root uzd Birck Far, Cider/! .

tly ekniin CQre for rlal.aavu&.s j OAINKHVILLT. FLORIDA #
throats or eoM ; .or. pen P. O. Ben 163. Fl..
psieaaoala. ( ttarst *d, I wrUoe tow hM c... .... fatlf ere .1ItIIfIIL h. Inw1 N ,....,.-.1.. :'" '"
t bottle* at all drag su>m. ._----- - '. ---_. -'" .
'I'H. Prom" AtteotJoo to All Botla... .-' .
-'
II
,(
rf"
.
',.r
...
., ",' > M
.
"" ..!:\,' "...., .!t,
J
J.np
'I''; SJi. X l
i li 1.."" > ,. " ,."., ... \ .. .. .',) V "". .
-:: ... \.-' .} r ..: 'It. ,,!ti''mm
ii



kd_ : THE 0MNESVJLI: : $' SDK:, APBiL'7N" r ;.; ; '. F" "

_ ,
-
.

'Vuran&, Peed' for Ml* *t this otiie.p arar..r.Aper's. TO BEAUTIFY sa .
NEWS OF CITY AND BO per dozen '$2J5ft pr hun-. THE LEGISLATURE -

d r tr f Cash must acoAtopaoy ,order. 'YOUR COMPLEXION!
,
J.'O. Hikes of WacaooMt DOWN
COUNTY CONDENSED Assistant TO BUSINESS IN 10

railroad and r-x press '*gi t !at thai -- DAYS, USESatiD..61a
point' and a 'clever ytmnft In.Dr was

Hatters of General Interest Gathered trading {4, the city yett rdar.Ma Three Good Bills Introduced by :

by'Our Reporters. a rice A mow, formerly' of thfa eity f I Your doctor will tell you that Senator McCreary. -""- ""'.- -
..
bat pow residing at Mkwuopy, was thin,pale, weak nervous children

greeting old friends here yesterday,all become strong and well THE UXEtyUALLED OUUTlflELSATINOLA
PERSbNAL SOCIAL t FLORIDA SEMINARY BILL
AND ,ITEMS of whom were glad to.tee him by taking Ayer's Sarsaparilla.:' EAST

Mesdames' Chas. Eddy and J. II, Small doses, for a few days.Sarsaparilla.
for That Instl-
What Hat Happened and What II Doing I Special Appropriation
Palter.
oO of Orange eights were t
al to Happen Told In Short Paragraph shopping; In the city yesterday, and tion Asked-Uniform Text-Books Bill -

ii So That "He Who Rune May Read- registered at the Drown Hotisev and Time of Holding Court-A Bill 0illllf
-
It In The Sun. \V. J. 'Hillman and J. O. ftos. prominent The change is very prompt Defining Vagrancy.;

from,Tuead .p'e. Dotty Sun: cUUens of Lire Oak were registered and very marked. Ask your Special toTbe DallT Sun.

n Point at the Brown house yerterdsy.Tht !"" I doctor why if 'Is. He has our Tallahassee Fia.' April 5.-The Senate -
D-W. L. Barton of Rocky
r
:: former Is an extensive| naval formula and will explain.
House down to business
in and
was the city yesterday., got
store. operator, : ........*U man.. old for ...-.th..0
II.:K. Williams of Waldo was regls _t'-slt I emiM n.. b.r....*f thin M For Sale-Ttioroiighhred B rnd Plymouth 15..tae fw w_11..",er'. IlAn..rtU.__
tered at the Brown House.yesterday.Mr. Rock ,:_u. My cockerels' are I, paN., .v... t, Nrcua.iea.vloeaaed.N.J._ .. h..It." would be a fThe business- session

"' and Mr*. T. B. Johnson of Ocala from BUtmnre firm Ono lollar form. .. ._ Senate.
I +
+ visitors Gainesville' dating of 15 eggs Mrs. AV. H.. Drrbrr, n'solta.All_no....... Jn.Aas.,........ N..
were to yesterdayO. , Mtcanopy, F'aJ'' *r-ls;-3ki: for In the Senate among the first measures "

r L. McLain aDd son {.." returned Hon< II. 11. McCreary and son Elmer : The Children introduced were the bill of Senator
oar from Hague; where they have been on :
tnr T.U"h.wb.r. uniform
departed Sunday of Alachtia fur
McGreary
a visit to )(. 1>. Bryan Is a new Otttoverr. rruuanteedand
I they will remain during the ',-#ion of,.ousnes..con.tlp.t'on. prevent i Fe- text books i in the public schools; a bill money refunded If It fauslto: remove the
Captain J. I..1.. Johnston hu returned I the Lgl' .Uttire, Mr. McCreary rrpre. oovery. Cure these with AyO"'. Pllle. wont cane of Freckles.Pimple Tao S&llow-

from Daytona where be has ,: seating the Tbht1.S eubd Di: .triet in ... ....-.--------.- providing time for holding the termsof MMI. Liver Spow. Bl.ckhea6*. or any skin'
court of th J Eighth Judicial Circuit;: Leaves the skin tear.
been on a visit to relatives. the State Senate. eruption lo :M dada
E. W. Sanford of Fort White was a bill for a special appropriation for _.... healthy. aDd restore the beauty of
m W. T, Ohesnut, the merceant prince H. C: rn:veo., the jeweler' or High registered at the Brown House J elter. the EMI Florida Seminary ; alto a bill 70D\". Thousands testy to the malts of

r of Arredondo after a brief visit. to his Springs( was among tho.e who paid day Katinola.' Pnoe toa and 11.00 by leadlnjr tfru-
+; family here, has returned to his du- defining vagrancy.Companion irt***or mall. Prepared only br
Gainesville visit yesterday Mr.
a ,
Mr. and Mrs. J. E. Thrasher of bill to the last two were '
NATIONAL TOILET 5 0., Paris, Tenu.
division
tiei.F Steven Is also watch |ins *e1nr Micaoopy were trading in the city yes iotroJuced in the House by Hep Till-
., M. Prewltt foreman; of the composing for the Atlantic. Coast Mne. He enjoys and of Alachua. Bold in Gainesville by J. S. Bodiford i
terday. man Roseborougli A Co.. J. W. McCollum A Co.. W. M.
rooms of The Bun, ,Is confined a Quo business,
E. B. Godwin of High Springs wa The Basfcinprotest to Senator Brown Johnson and all leading' druggists.

44 to his home. with fever. Friends hope The spring tniilrnery op-nlnc at among those who favored Gainesville holding his sent wan read 'in the Sen- .. .
rat, that he will be oat In a short time, Hyde's will be of interest to the ladles ate together with the certificate from - -- -- ----
,
with a visit yeterday.Kev. .
Imported hats and hats of oar trimming Board of Public Instruction.
O. Y. Crawford of the firm of Craw.
the of State.
and all kinds of headgero.. the E. A. Gray of Micanopy. pastor Secretary
z of the Hoard of Public
ord A: Davis, departed yesterday for ladles. Remember the dales, Wednesday of the Methudutehurch at that place The whole matter was referred to A* a meeting

ilentucky. where be want to purehftseft and Thursday April 12th and 13th. the Committee on Elections and Privilege JnuruotioD held Monday, an order was

carload of floe stock, Including turpentine Large stock to select from dAwlt was in the yesterday.. : *. made by the board requiring all bills
._
work moles and good driving A sidewalk is being< constructed In The Job printing department of The against the board and for school pur-

horses. He expects to return the latter front of the property ofV, T, Ches- : Dally tlun'is, splendidly equipped and CATTLE HAVE ARRIVED. | used .0 be presented the day before

part of tbe week. nut, Alschua avenue, which will be I the work guaranteed to plea". the regular: meeting of the board

I and Mrs. appreciated by pedestrians rhf have John JCelrouer of Rochelle, one of Carload of Hereford for Spring Park which is held the first Tuesday in each
k Mr. Ella 6app of Jennings Farm Came in Good Time.
Lake have arrived<< In the eU,. They oceasloiaJo' use the thoroughfare. :The the progressive residents of that place, mouth. Thin means that bills must bin

came for the purpose of pladinc ,the work l to being done under the supervision was trading in the city. yesterday The carload of Hereford registered the hsnd of Superintendent:! Kelley:

u latter in lLa Odd Yellows banltarlum of Contractor D. Edwards.!: J. K'. Cut heart, one of High Springs' cattle recently purchased at Henrietta on Monday: preceding such' regular
t' Texas, by N. A. Ca'ilfson: manager of 1)r. also
for an operation which will be per. Captain' IV T. Jackson, who baa beenon progressive merchants was transacting meeting Kelley request

uq formed today. Friends of the lady a visit to hi. daughter. Mrs. Emmett -' basines in this oily JII.te-rd. Spring I'ark Faun }5mnli.jtoii, notice The dun to state that the accumulation
nf which lI"a. already appeared in The i i. and
of annoying
'% hope that she will stand the operation Johnson Cbarlestonf for the past W. A. Pace of Lociiloosa, one of the warrants very ;
Bun, arrived via the Seaboard Air Line be
Inconvenient and he would glad to
g successfully. nine months, arrived In thiscity yesterday prosperous farmer. that section,
Tuesday night,. and Wednesday were
have to wham warrants are
:' V. W. Watson one of the old landmarks from Bronton and departed In was among the visitors to this city yes persons
unloaded and driven to the farm
made payable to apply and receivesame
"'3 the afternoon for his,. grove on Wau- 'terday.
of Kirk wood, was In the city
eight miles to the westward of the
as soon after the'meeting aa pos
'k" yesterday He war lu K'1rkwood wben burg Lake to look at his orange blos- 1'. L. Medlin of Meredith, member

r it was all woods, lie says that the aorai. He will return tomorrow to his of the Hrmof J. L. M..d1in.Co.., naval city.The consignment consisted of sible.

: seventeen Among other bosiiu, the board byrequisition
: beans and cabbage fine he Brother 1>r. J. M, Jackouv whom stores in the
t are as as operator, was city on head of fine cattle, all registered of the tilnesville subschool -
this time of tbe and liaison a visit for treatment,, a* the business
at yesterday.
ever saw year, and of the finest droves of cat-
was one district, paid $2.000 indebtedness
Captain has been quite sick for thepal'
he has them from 10 to 16 Inches tall '
tle in-tkia t+tate. The droveas
ever seen
ol the district. This money WM
five months with lagrJppo and pbls.
audio full bloom
rheumatism. a whole was viewed by many cattle the property of the lib-school district

( The home of J. 11. Gerald East Birmingham, Ala., are here oo a hit men who know- good cow', and the but its disbursement is left with tl.e

w' Main street N., which has been in V. P. Henderson of Arne, the peach I to :Mrs.: A. S. Davies. flock was the center of admiration. ofall school board.

p course of construction for the past and pecan grower was a visitor to On Ssturda' April 8th, l9 *, we will who saw it. .

few weeks, will b. completed In a Gainesville yesterday Mr. Hender have a carload of floe mules and hor.... Manager Calliton state that the Water Notice.To .

) short time, and will be one nf, the son has seventy, acre In peaches, Walt and He them beforebuying.. Spring Park Company has finished city water consumers : Your
Crawford Jb DavU. d&wlw
handsomest and most modern In the whleh are bearing prolifically and buying cattle: for the present as they ".tel'rt'ut for quarter ending June
eighty. acres, 1,000 trees In pecans, Rev. W. O. Foster of Alachu was. in
oily. The building Is two stories, and BOW have one of the best stocked farms 30th JPO3: is now die and payable at
which he expects to bear within the Ute city for a few hours yesterday, lie
.+ will contain seven rooms and bath. not only in the State, but in the entire this otiice. If not paid| tin or before
The work under thedlreitlon aezt four yearn The latterarv grafted was en route to Mi..snopy, where be Sou thea.I.
was performed April UHh, 1 1005 your water supply ,
trees of the finest most hardy varieties ,- will visit friends f\p. day or bwo.' I
of Contractor Whiting. )Jr.Herald Photographer South secured an excellent ] wilUwithoul further notice: be dUcontained. .

and family are to be congratulated and when they crate. In full James Holder of ItooheUe, member photograph of the car, which Fee fcr turning on again

upon the new possession bearing will prove a permanent income i>f the firm of Holder A Pope, manufacturers will be used, for advertising purposes, 1. By order of City Council.J. .

for the owner. of naval stores, was transacting M. DXLL,
jFVtMn n"dll""tlav' lJaUJ.VI:
>loan Thurtday't Daily ,&t...: business In this city yesterday. MRS. ACKi.tr ENTERTAINS. City Clerk and Treasurer.
J, ll. Fowe.ler Lennon was a business Gainesville, Fla., April'1st. 1905. '
A, G. Masters of Waldo WM In the
After a brief but pleasant visit to
5 .
visitor to this city yesterday.
city yesterday, their slt r,. Mrs. .'. P hill Mrs. C; K. Her North Gainesville H.me Scene of - ----
I), M, Davidson of High Hprlngs "a.tr.o.ac&IDII .
J. "\V. Kagliih of Tacomawas a visitor Carter c4 Ocala and,Miss Belle ChlttyofMicaaopy Happiness. and Gaiety. Before YOM
business in this city
: yes Co this city yesterday. havvreturned to their A delightful afternoon tea party was

':' terday. E. O. MoMahan has gone.to Alachaa homes. given at the home of )1"..Edgar Ack-
Castor Hague of the village by th.
en business for a few days Don'l buy before you sae Craufurd d Icy North Gsvinesville. There were Insure Your Life

same name was trading In the city It. MoKlbln of Albion was In the- Davi Hoe" slock. They always carry a assembled Miss I. E. Webster, Mrs.

yesterday. lot of tine mules and horse. A fresJk W. H. Palmer Mu. Graves Mrs. M.

Mrs 8. A. Robinson has gone to Red- city on business yesterday. car to eoine 8.h..da.a" and boy Dorraan, MTSX Rcovllle, Miss Glrard

; + dick where she will visit her son, J. M. W. J. sledge of Alachua: was a vl>>- of established. dealers d&wlw, Mrs. Kobb. M. I)., Mis McCraeken. Talk Over ihs

'iU>r to Ibis city yesterday. The ladies of AJaohu county are !&ntiled .
.N. Uobloson.Mrs. )1... J. D.Turner, Mr*. Wolf, Mi** E.
-. .. _..__. . << to attend the great sniUlnery
------- ---- -- A. Larzeleru.It | .
: II. II. McGrvary departed yesterday opening at U. W. Hyde's, Wednesday, New IC-YEAR POLICY
for Tacoma, where she will READ THIS.Htevenson. and Thursday April Itch and 13th. A has 'scarcely been my privilege' to

tD.ke brief visit to Mr. and Mrs. A. tine display of spring and summer hats be entertained.. In so- artistic a man ., ef IW . .

c 1, Kmerson..Mrs. Ala.,.June 0, IW1.Dr. and millinery :aoveltie. n.r, each little detail its ingeniousness -

E.W.llalldt.l.oui.t& IVsrSir Captain til'. T. Jackson ol Urtvatonha
showing the had of skill: dictated Mutual
W. )B.: Dow made a brief' trip tlloohclltt Life i
r 1 have been a great suHarvr: fronx,bladder returned to the city from Wau- by the soul of the artists. Mt...
yesterday to meet a friend trouble fwr two years and nvy easewas .
burg Lake, where he has been (p klng Aekleywilh her inimiub's. gracious 1
who was en rout from Jaeksonvil to of a very serious nature, cotnpU. .. "11'11' . 4
lag me to have several' Alu.kalud after his grove hltH."'. lie states sweetness, assisted by her charming
.
$t. Petersburg.S. dangerous operation.. 1 have. also taken that the tree are fall of Moons, and friend Mrs. I. E. Webster seemed lo

8. Phlfcr of High Spring member many different& remedies" I took that he esleess| a Bas crop the romlng exhale the fragrance,> of their p rsoality *- Wi ': Nileiil! J 5..1. .
of the brut of l'hUu A Phifer. swamp Hoot fur three years aid Warner1 :
HafeCure t... .ars and they poly lesson upon alt, that each was so bright
visitor' .0'
New York llaoktt blur, was a gave. temporary relief. Aftei having Horse aid .Iul.-l have a carload and witty I could not point out tke W. L. HILLGAINESVILLE.I -' ap.ts.l

r to ibis city yesterday two operations an* pNp.riaa'O" the *l horses and mules at inwards': 8taWe star,but call it a galaxy.' GC&TV.Arways .

".. W, Blruble of High Springs, MM third. 1 saw your Texas Wonder ad. *. Aronng tho lot are a few saddle .
widely' known residents of vrtld and p.ure,..." a b.4tl I got kor,e* and a number of strong Liberal Churches. .. -
of the most almost I immediate relief sad have continued healthy '...rl"'loe.n.t farm mules.
a that town, was transacting. < business In to 'improve ever sine. My doe- Will b.. void at reasonable prices., Call Every church will be given a liberal R. MeCLELLAN *

this city. yesterday.Mr. tare said my bladder had grown together .1 and eiantine tKero. O. P. \lu.UA quantity of L. A M. paint. Call for It. .

and Mrs. T, K. INckett of New- In three' place, and 1 was snJrerlDK i Dr. J I). Watkins, commercial agentof 4 gallons Ijjngman Mantises L. A I
almost death, No '
man living
1; v berry are In the city Mr. Pickett U era say store than I can say lot yonr the Gainesville mad. Golf Railway.. M. Paint. mixed. with three gallons !Undertaking Co.GAINESVILLE.

tbe senior member of th. Slim of T. n.l'1ek.n' Texas Wonder, aDd 1 call it a 'rt'rWa has returned to bis home at Micanopy linseed oil. will paint a house IvV ./;

A Bun tnsnutaeturvrs of lumber. wonder and. 1 bop all who softer. will from an oRtetal trip to South Florida. B, Uarr. Charleston. W. Va t

DulutU. give it a trial. Wishing Yoar' you success, I ll* report the groves in fine condition write 1'.lalf'dnDk.llbura block FLORIDA.. J"
am truly :
Miss Bessie IVeckhsra.. a charming W. C. "U1U., and use trees full of bloom with prm- with 1..k M. Stands out a* IhJuh' >
peels for a tUg orange erop next wa. ..artllab ." :
young lady of Windsor was in the eity | Funeral l Directors and
son '
rout to High A TEXAS WONDER. Wears aad ewers like gold! ,
Bund,. She was en
Bprlngs. where she will b. the guest of : One small bottle of tbe Texas Won lit and Mrs. Clyde L. Carter arrived. Do.'& pay $5.00 a gallon for tin...,.! f I Licensed EtnooJmcr&\;:\

friends for a few days.II. 4.,. Hall's Great Dis.ov.ry, "itr*. all TuetCsy night via the Gainesville and oUt which you do In ..ad.rr.u_ '
-
bladder troubles, remove Gulf from Atlanta, where thy were ,.ia&. ""

MeL. Grady, one of High Strings'progressive lI.1da.r.aD4. diabetes. . seminal emiaaUnas. marriH Sunday, mention of which has Boy oil ,...._from the barrel at :SO at.a.ra.. '_w.rsat award D..ir.ia
young buatntss torn' was a .weak and lame ba ka. rheumaUam PicUr rrajsMw KMwrdaaa 5lp5.
in ,
already been wad The true They cents ;"+** gallon and mix It with I..
;,. visitor to this city yesterday Mr.. .. wad aDd all bladder irregularitie ia bulb of men tie kidneys and- were met at Sarnpson City by lion and A 11. U..4.. h pb.bttery. J:.te-k,';"

Grady is eottdu tluct a gentlemen's fornishiag women, regulates bladder trouble i.cblkfren. I. )h.. bjd IM Carter parents of tb. It makes paint cost about L2O per Dsawra,. and tb*ts 7lteJrplin. :

'' store lu lllgh Hprings. If not sold by your. dnutgist.' groans and ..,.(.1 l friend, who gave gal to*. &W by 8.1. Thomas, Gaines. pb.i'. ;J''
Dr. n. 1V. Tanner the druggist of will be vent by nail oo ,...Ip& of f 1. them a royal reeeptioa. 1),. Carter 't villi J. O. Ultbop.lMhqa.. f/!>;.

.,t High Springs waa In the city yvsttr- One email bottle to two montba treat will iN ..remenberad' baa just grado. -_ Onlers fcy Tektftapb *>r TelsMittrt
meat and seldom faUa to perfect eenrsj. mud trawl the Atlanta Medical Col- .
"" day and made The Sua an afrveableoall. Dr. Krnst W. Halt,sol. maastra leg. and was? dovbly Meed- by r,.- Jeraey Cows for Sat*. will I"ft'd.-" atU U9u t r

., Dr. Tanner ride. at Alaehua .'U..... P. O. box 39. St. Louia MOo cvivlag a wife and a diploma wttain A few good good graded young Jsr. ---- -- .

for many ?eau. and U well known la Bend for testlnoaials.. Sold by -Udru"l4 two day*. Pri mti here extend eoatfratnlatHMts. ..,eowI with young "It... J. B, Sai
in The
that seal I o1 .. ttibestoa.' Lake SioxKitoa Farm. wn Advertise

1

"
"V "
100

.. ;
.' ,.to: "
;

I .' ,; ". M. ..., . ",I .. : $'-:1:< .. "! '.' t-.'......v-""'...' M1 $ : '









-~ ~~1


THE GAINESVILLE SUN: APRIL 6, 104


Smith and J. H. Spencer Arrived Commetta Wks Appointed to C
p With Dr. Clarence 8. Strouse in Mat*


b J1 Automobile From Ocala in a Lit.
ft Mora Than Four Hours.
S 5 0. Smith and J. II. ,peneer of
Oeila are in the city The former s a
/jMISber of the (Ocal Furniture Com.*
i; s. sad is associated with Mr. Spen-
loder the firm name of Smith A
.-ier, dealers in automobiles and
0 and p',soline engines. They earse
tfeem Oals on one of their Glide tour.
t ear making the time from Oeala
S'o o Misonopy. partly over a sandy rued,
t a lew moment over three hour.
1 he time from Mioanopy to Galne..
ville, hy way of Taeoma, Waeahoota
*ad Arredondo, was made ln good
time.
The machine is fourteen horee-
power, and is one of the best maeufac-
tured. It created a great deal of in-
teeet among t te curious here.
Messrs. Smith and Spencer have
0e1ge for the purpose of introdueing
their maehine, and will remain hera
for twe or three days. They expect to
.make an lnspeetio of the newly con-.
s rested roads in this vicinity today.
"I mote with a great deal of interest
that Alaehus county people have the
aod roads fever," rewarded Mr.
alth. "It' the best tEin in the
wrld for the advanoement a a omn-
xantity, as has been demonstrated in
Marise. I hope the time will oome--
1ad I believe it will, and not very far
diltaat-when Oeals and Oaineville
will be more closely bound as neigh.
baer, when our Ocals and Gala aville
friends may visit eaoh other frequent-
I. When the roads art, in proper con.
ditlon it will be an easy matter for
yoer people to breakfast at home, eat
dimmer with their Oaala friend., spend
a pleasant day and return in plenty of
slme for supper. This Is bound to be
aesomplisbed by an automobile trip
over properly seuetruoed roads. and
it will not be many years before you
will see is "
A DELIGHTFUL OCCASION.
W. C. T. U. and Friends Entertained
At the Home of Mrs. Turner.
The W. C. T. U. of Gainesville is
aitod for doing things. The latest
Wisa reception Oiwen by Mrs. Turner
at her home in NorLh Gainesville to
the members of the untons and invited
gellas. About fifty were present.
Hor large parlor was beautifully dee.
osIied with palms, flowers and ferns
the Iaoet conspicuous was a picture of
Miss WiMard on a background of
w1hte, with a large bow of while rib.
bes above, while over all were her laet
weedi, "How beautiful it ie to be with
OG ." Around all were pal leaves.
IThe decorations in the dlsing room
owe of roses anJ old fashioned red
plmb by hundreds. Delieste wafen
Ids "fruiee" were served.
Ashis was all a memorial to Miss
Willed, an appropriate program of
mige, papers, and addresses were
glea soasieting of a sketch of her life
by Me. Baney. a paper. "Our Us.
espwed Quees." by Mrs. Fateh: a
agistllo. "The Walte Ribbon", by
lw. ToRer; seesaat of the unveiling
*lobe Willard statoue tby Mrs. lDois.
Saab m tifl addree by MNE M
J4aslere of Philadelphia. A free.
v dl ebriag was gives for her rnm-m-
iI feted.
In Mavr'a Ouawt.
Joe Floyd waes arraigmed is the mu.

U e Of fagtie. slad was sed 10

WUIihm Areaher. who eaed thaI
sli taredthe .row Hesd siat
-it lm se by saml eiahe s. esM

ieaeg ,ad jemped So

v.hd, -od me..t .d-

was me neWm esma a.


~ec~tsW.0 to MsMOI.
MoW. 41r11i-Muis
IaVot!)tans hsit room""


W elecld M obo

0of to lD WOa 051
ift "L MIAto
.009o


toer of Advertising-Board Pleased at
Actions of Citizens.
The regular monthly metlaW of4 thO
Gaineville Board of Trade wa held at
the Board of Trade rooms. City Hall.
Wednesday afternoon ast o'clock, as
good crowd belia pre ts.
There was a grea deal of important
buslnese coming before ththkbord at
thick meetiag. Among other thingR dis.
cussed was the proposed extension of
sthe harder ( the eity of Itaineeville,
wbheh would give to the city more mu-
iaicipal power. as well as extend the
limits to a point which would greatly
lnereas the population of the city.
The board commended the action of
the eltisens in mass meeting Tuenday
evening, and it was the nature of the
meeting that every enooouragement
and infljenoo be exercised towards the
passage of the measure.
The matter of advertising the city
throougih the Bible Conference, Chris.
tian Workers' Instituteo ad Chautau.
qua was brought up. and after some
disoinsioa a committee comprising W.
M. Pepper, Geo. W. Hyde and B. F.
Jordan was appointed to confer with
l)r. Clarence B. Strouse is the matter.
The committee met Dr. Stroone late in
the afternoon, aod a special meeting
of the Board of Trade will be held thlls
afternoon, at which the committee will
make its report.
The committee suggests that the
business men and other* uaing printed
stationary permit the advertising of
the funetion. to be placed upon the
same, which will not detract from the
respective business, bat will prove a
great agent in advertising Gainesville
and the Bible Conference and Chau.
tauqua.
THE NEWS FROM MELROSE.

Postoffice is Prospering--ocial Func-
tion in That Gay Town.
ilelreoe. April 5.-The Melrose poet-.
odleedid a rushing|bsianessdurnE thie
past quarter, beating all prevkmes ee-
ords in the Issue of mooney ordere--vis:
342, and paying flfty-eight mosey or-
den. The registeriax of packages,
etc.. amounted to eighty pieces. The
amount of general mail handled was
also larger than any previous year.
Rev. 8. F. I,awlor of Jasper, was the
guest of Mr and Mrs Kunells at the
Hufflnan House during the past week.
His many friends were much pleased
to see him again.
The Ladide' Aid Society reports
fleancial rult of $15 ham the reeua
pie slipper.
P M. Tolloe Iad a very large o ab
bage palmetto planted on Bellamy
Avenue fronting his house. It will be
quite an addition to the town.
The neat meeting of the Ladies' Lit.
erary Soeiety will be on April 7th, the
tit e of the paper to b. read by Mrs.
Paxton being. lHigh individual Char-
acter is the Glory of a nation,"
ire EK M. King entertained a large
s.umtbr of her frneeds at proqreslve
six- landed eachre on Thureday era*.
ain The luohy winners of me priase
were Mrs. W A. Vogelbeeh. H. 1.
Tolles Mrs. J A. Remael ad Mins
Elsie shBrlor. After eaj)opie a
del ciom supper the party adjoerlod
at a very late boer.
Mr. W. A. Voleadh save a pea-
iresiseiv uebre party -m Friday mtser*
on, o1s table. tbe*g 1liaed. The
irisxe Inni weefe M. H. W. Nm*I
ly. Mrs. J W Johase. Me W. Ds.
Iegon aid Mrs. 1. Si am. Isee-s
berry lee and cakee wo* the afve .
mets erve I st the elas .1 she

MsM. P. J lasrhiate ad- Me. J.
Whlsehn we siam ese oeoe*.
lltelag friends at dieaar.
The Se weather 10 the s s 1f
aMg **pIt, the pueblo Be lt hmis
I lg a faorto pes a am M mM of
leb plea mreadaso. Mise lMas
aldma gaie a pcanle thes aos SBI


softis h~ fk edS
Uhaes Ote Corb*U MA 3e Uss901
80 1 dwuWe". AlltraOWS Mf
am- plommet t~er.
bhe Ck m o the& AUdpme 4w i

a amsho" 6had a owl
too 1
Im~mism.Sh
I IL bess 4mbarofta'S


0 0 *9 ~ 6---.. g*a@5 0 0a to 0.0-4..-040 _10*.".
~ :1~ r. 11 tt..It..tldlUX, 1134 INChhftus .Vs. I
.M U., % t i tA:
"l fiiftnd after trying amany difbreat modiciass
to :"Ftors me to heal* kMthaPelM wasthe only
: thtni( which ri)uld be depended upw. I bepan.
ttal.king it whent I was in a decoa.indMUMe by

I4 hs",n to t,e%*I '.tr'~upr during t&M 20 wek I
Ii'ttoo k Pet-nn and my health impievdo*aU MW~
no I am in perfeet, health and aft 7 hswlI
nee idbfr.-Lzi Rdig


.. ...... .

Mrs. Mali@ irlford. 1 ;Chitirelh ireet.
Hurlington, Vt., t4ecretar \\'hbttier Orstrlo *o
oiety, writes:
'Pera iu s eatAtly a wonderful medicine 0,
Shr the il of Weaa. I have head it
:pokm f the hnM at praise by many,
aad eotainly my expin'o is well worthy

"I to ave aore pains across my
back about a y ago. brought on by a
:* old, sad each bsluaent month brought" ,
a **o dmlWad dt .
aTear y a prescribed.and the way
Sit MstWUpaymy iswaalmosttoo good .
at beU trme. I ottmln have rnpined my
kwidth d tr gtha wid I no Io r suffer
'pia p inWext.ree lstud..".... .,,,, .
**G... oes*. o ooo *o*o4 4 o4 4 ee .rrh lifts. l4mi ..tiiii).
i i. otinia .ireis ealtiarrh, whe.ll,.r irf tht'
TIboeso aso fWoes oC-Ure v W pe,.lvle iiesrjalla or eany the r ,irgan of thie
by Cerregoui-sea-This ta What unstiiu.i iv
Sr. N artlali iiPrep s Sto be
roW You Witheet Charge. Pe-run, a N4altul Ueautifler.
Women who suffer .lihtld re-ad the Ierauna pro.luiwe clean, tnue uels i'stin
evidessee pmreseted h.tre. VWe here braneo, the aitsa *>f fa'al inimetiry
thousands of letter from grat etl anm a wperf'et o4niials-xlton.
rtendd whotell the ma>, i story. The womrnat heW n,,t lween elow t eallit.
Half the ills that are pek-uliarly Pover th.t a t4pirise uf Perrana will tdo
woman' owa are of a estarrhal more toward re-tourlnt youthful twenty
eharaeter. F emrale weakner was unot than all the d(e und.irstoeil for many years. MIlay a ilrl has resiaitnl hler fitleid
Ior. Illrtman de.wrv the eri.dit f l ans% jiaoiv a nstron hae Ienrtlsa'.t
Slavtha li dnet .rmilted It resta ehsraT t,'r. it .1..i<, .i* he,'r r Icuiuily >la|i ian'o uby
I.. tb' iasued- *.,latrit *nfl't oatarlist i tls'.-s 'IerI .:i .


In I'.rrnna lh,,ne wnioen ftlud a prompt
atid pIwrminent crure
'ht .nB.kal(gof t et- atIntin islale to hls al.
fret ar. reowlvedl Sly Ihr. Illartiiss every
yoar. Thln immI that I'erunsi has0 o-
r 'ii|al.ilt eIl in title clsa ) of t ,aw... ean
.u(ar t ly bIe srvrr cutlnIlat*d.
9 *****&*** & *M* **6 ** *0
I f)u au do nst tderitir pempt andl
0 tr0fiMoary realtlt frolm the we of
: '.rians write at onue to Dr. liart-
Smain, ila t u a full slatriinot 'nt f your
's"*e, atidl ht ill lie pleasedtl to givel
i o 11,14 valUal AIIIl vln. Kr1at; I
I ,(d-r-. l t. llrs iiano. I'reetllelnta
* n.f 'rTl llar tiea Manltarii, (ium-*
4 I. to, <'osl,.. A ll '1trry-e i|il,',..go ,0 Ia-d
i e, tl' i'* fl 't(*llnt
I ....... ..o ...*.OO ....* .8


esIth lbe jastife.'aroartit( u ftI iriet 14 IV 51. 1 811.A 114 % V1 i~ t'l TA It "lieN IfA'I-h 1#IV% I itsN.Sa'N
Row C PF esIaskel told swor esr. Io.9 j rI~iII I If' N Il~ iiAlblul~ cragS am.b&I l"t ?piwsmh
viors as the VK p ieculal eh w eb o an u,, inA % ei I i l~ am .11 bait -of % i ro lh#tt I I i I
Nulfe b o-o-1191bo I i .sel 'sesI .441 a~ I s
day, which veto veery wall Wlebded. w* os ovee'.r loamir of Tit% 4 PiInvloo o ilfl..losi~?. II0 ~ s, %41119#4 for .19P WI
At an plt'ctloso fur d~se'glOWS to) Ih,. dSA t4he I41todis W 111t ~95A 10S1 Oft holoo ild A 41k.14 11SN molh
dioecean amwisintiofl next mU tah IH 11*91tatss hof I1a a ted lit la"' "" teep"S Arra ~~s1,111I'looisfe s.Nato-ld
won w h I~i skya d 14 1411111(m werew it 4. to",t Iut. sej T.;W hIt~s4ilreto r M on Itioe O C a rawu
ad po.pbwda avt VIuarnW '4 Ilo
Thepaletlan le: at11. AHeo lot 90. ki4 Mg

Jonesville, April fi- I hoemlaslg givn r .I eafibl e= Pootisiq1 ka t fo -." ols..F. ooF". o. I?. k ~tSpiabi
ImM 1N soleeaw stidooeera)W b&--to* I ,#0e.1i -01 oft..I.1rH ir
by tbo Mimes *Iam~rnof nas tWe behofe 0'O ~dal off Aloelti.A It 511111111iT W It 0440"
t"eir Mother. Mrs W .1 HaMMItOs,0311 dm fat11d"tlo W wi%*Io tb S
lest Friday sight was qulite a3.4 4.1 eItUIi A P PeA I i i $~I.t1AI WN0110it aee
P4IIk4 I-& Iwot t ',; .4 r 11 .'ss a4 si 4 -11W Nsn*W
The evealoig 35u g~seo ent io playseg Ist Ilr 4jatI aeiA..'.'*~'~~I hot woo...06 4U W I Seals
tam" 'Intel atlinut 11) W11110111whe I'll Prwrtritoli T''no 1PAII)4)3"7r 1111u.l~it 'i "''1i istW
catered the duahing r~hi?3, wAem tr- ic.'tlITW( A.LNAei I.
remo sake sed loomossde wereeserve~d. w ,wA ms, W. 5.SMftwiew kAAoso. 4avmI-a, orto I If*, ol #,* Itemirea
Uhese whoo warerpoet t won Mi... "d eeg'Itaeed `~' Ofu"who" 'Pue tp's" nVa. *.ftI loaa-oi~lm
Mabel 14mb. Lelie Itele Uslhv A. tIpiyefeffwitile lkeb. 5.Ses.VP clue A. s .t is*.
XMel1 a sdClemlis- he 1S. 3ael~ I heleShe616"M 901 mmol* Irsi I.A I).I.tAses au

I 4Uui sa. *ad oessoot t I tmeI I sItinri my teerth wlh.
ale (lrioul Messers. l -0" lre3I rtits U 96 100 ewijS sweN 1 "41i*aid
Mite. ike'.A~ee, hres el. a m to is to 6 em 4..eeoof.El *tad he f b e l"'10:4 ea so lisi to a 11111111 .
We, en k th P 1t~i. IsU .C a m h ~ ~ ~ ~ fkt. .ea. *9Ift ft. -0t -j -. l -i11-'I'rl
Lerk. Weeks. Ol-i Pit'ken Owsea" e.


meter "Mya peer art. a" b" soa."#
wola n"sig I& hu walk ),M0.meWT e h Bookhprast oft u Al Te ak.Ms
'Tessad mos. SK- i~r W E SW lc ua l

hson I "asham" I falvaowb":


ll&ume &"toie thes rwmshd cu aNho(10 f La i." it ntm bW 1.t
bas" enefllow sdIf:nse ~ I P' l

am"Lame UON* o I Ot Li. ma~ detoso 40Fassere CO
do ftt ofAmbe liks *Imt 1,011111111111 a" heme" MA



aft IdmisWodolsiw .m 1111110

IMm "P so mool Od~hims o ato hboom".o he 1, @*be Pf ; Wgme

-mi -M usmmad el. OW00 *Waft mNNO via aw e"I't
of@N W sw4 nOnb"" m bat ef otmtl _


ir


6 F


er lmen Gainesville
ad Oost. May Visit

i^,- TRAVEL BY AUTOMOBILE,
- . 1 IA


MONTHLY MEETING HOW TWO BEAUTIFUL WOMEN ESCAPED

BOARD OF TRADE PLVIC CATARRH BY AID OF PE-RU-

Largely Attended and InterUsting, -- .
s.itn t at 3ody. Female Weakness Is Usually Pelvic Catarrh. Pe-ru-ni

WANT TO ADVERTISE CITY Cgures Catarrh Wherever Located.









$


(2;.


~INK~IL 'LO~A THURS9DAY, ARI


to onx


000., the tina
STtM' sad A

Uwas c~k
'at -lowb





qos~LW5 vfThesk
sueiTM4prim












may. Pugapled by a de.
Id PDhA"a io


tMle e4derue Vete
eseml to w

m *jj ofrtIs lme


we-e


a to w .40 emu
mm owbilivWt "a


mw hABU

$ad woshWh


q rrvefta
4 3 b Ws16




no'S esm-Wtb 4atbs is
of W-~ qtoo" wlSh I&
mPIPz Wi= it-- MAO N
M$fs" &A .~W" hemtll


wrwoei hwo 7
4 .0 t a-s


Tasiden Llme. 1
Ap A laot MbI
4 utrgbasemthe river di.
*~a ihq wound adud Pittebiwo

C~mem~e.04 tiaday. ritoit&&iS is that


~SR *10. .g~ai'rof PMo



T. C. Ud~&yvw'. PittibuM .paWD


I* bor "pot; J. 1N. B"Ww. of *tou
-1Ule 0. J. Tickemor. of Pitt*
phassevo, Slightly.
Tb. sd44 waa% caused by #3w
t" sUso ver tumoolog a .141mg Is
sof 4 14Vthe manm track. wh~rp It
Wf stftick bY We Passenger. %-slI- i
W5PV~~5 ahtuhtat.of speed.
I" umisof the froelgt t rue

wgvM o, OFSNING.

ohf~IL~qedlovsevoaletd by

NWebTO a.ANNil -A ostesif
Wheeaa who peclormed anm eltop,
oranf body of UmrsRolby Latead.
the 16mmg wit. of W1Iliam L IA15od
Ome Soul ntor. has reported theAtb
esmi4oi so trace of poison. -The
young wee. .941W saa sley astoma

b10m by Pao" Ss he Italdu
to ,aclaret. lIarued 800
a Woeparoled. tl.iemistod
podleg4 rsult if the autopsy.
*The o~ at aas" dscarbsod UMr
rAned the eivast f(om cualtudy
bust held omas witapselv for Pa is.
quest tom~rrilw. litsaid Uthe utop
sy n-vftno me trceof poloWea.bt







APMI.-t.1-r a ot'eo


ewauugthe SOsniv as"


o~~fto bo i
wU4~d~ pace.Is" over Iees

hdLfl t day. esh
wb"beame5-A party
Ivdhs asbositoucher.
010"o. i mom eat. h ress it
5~ek the a* meoaw
wudk a =16 toeuI m h5ur


W p~4 mIs.6usob sambern


*Alftrade. 1"Wtrig


foPeesseis. It 6s
t~p o~ far SaIe s IeaS
4 'Its hob sato wNam
~ Wse'D~I~-li~st ps,,usas



4 om ofamp* vmbmamd "t
m" -i~s. at so Ovkvmg
"'IMP" v siseud %toes
Alleff til lha so I aM
OWeme O gM i'"1
~ ~~Ai $WON

bo
VIP ~
tw


TO OSNUUE WAR

Oram hI abaw No sip
Of Rmag Stau;glo.

is AAR IuLik'Yev XPLOSS@W


~sfi ~n~mMAN Pos"
TuoueWLem overs k nPr Se*-Ut.
hts ow, from Seat of Treme,.


t.Petcrabore.AorilI -Wir Min-
Icte'r ash y relatedd 4"~t
tho re Coue.'I ~ a


the aro h ot 'u
berm ow rolt tar teb*.
bas- boom so 1c40c 1 1
OWt oe "a avr
thou. wil o iebe~

01Rlebeosl. It I wook

that fill ofp


Now nYo

Pa rtftol


tiltory doput* In
accordleg s
lot -Pro. rsb=s~
caused hI wz
The I~bViasI
jeOWtSlirsWverd"


in EasploOIO
"I -swievety-Sov
IOU, artIller eol
b tmcl 44 Cb1ofiee
;at wietu by a trri
bio1b Ina the owt
mtrt..cc. !daocburls.
oio eptiob temm
etwo mm s wo
Woo-te also hilt~. i
Ithsools~as ofelPros


0m!m Pri


tatii 0 jtba. ab emvusr.reacrbeJ
-1MC5460Isle ,lb mwuSS. An clom.
had M4W0 bkW*s 61 0eOf ieba %"'w
it, NOis ede soiawresm fo'R a prrs-11
%PO ierI~W 100d a ieuimer's wt.,lhol.
as Tesgio rer#Avtvd cagsidetSabb ses
so I IWta.

MinITERMCORICKIN PARIS.

Peemer Amoret'n Ambumbd~w at St.
Peters" gApfeeuPO~ OsL
Now Yak. Aprilt. I e, MaCur.

h. Tde Wto #*Wse. M"ONd IS t'e
isfe f AsL.p~sssgO.h sW
pehesit 'w s 0aseepe.t Im Wes
a OMMM 1 Simsnelhdopus. a14so
prija "meeme.5inis ww iOle'S... e
hMa3 do rt earreopffistof atThe
HMusM. AfeerlmewfaAmbewede'
1M0mSoUt. somerte desIre WaSW* is
St. P~weubin oildo OtiometuyIn
goeisimugod"sOwther.-a. "". ashanp
Olal deiet to 400011164 T he War to th#
bkUer aid. MWado#-e.- Weve et1hope's

Sb. Ispm~ss. Ueand fob aVewsotr
whlbmb ay lis ameday o46sW the *a
tire a"ee of the war.- As fubsopme
or BSalem&ane dew (4800d to ibet
spoat. nd a bweb wwn that See
&ad the j~gseoadtein I. ls ~eubd



imLaa IIIAos.4dimat"sto a
aewo ve O Sfe.I-abaft weftIsht
d"s. am 00 a l~ist" % Swbomb baa
aerrrred 26Mev- mwps"n W o rwss
Ims Ow 5d pt es

NUNN is U4 me seSe

L o 011001a0 d how"


4


MIsCUS


Inspector Wak" 1
says Emptfeele
Powder and Not Si
miss Was Inteniti


CCt~UMN IS NOT S W~

Plan of Uofted &We, mA66A 60i 4
Imin" .Don't 1P011e111s111T1111111111
Now w *~l. prfi &--The B~ARIs
wJillaLtet of boldres itthe iassOw
atitno 1 i"WU.reullsto 10 ae ltyblMg
I* I* with the prepaottd arm 2gia gestl
bot two-~i it ftuto Dominugo sand the Umh..-
ed hitvahc, mmd will iproet 'against
tbs it.un. says a ITimseedlosepei from

The onopiwsl to dooposit the o wiwy
froMsthe Customs CoeblosetlIna s a
Amerk-an ban tik mil a *illmite. S0-
f~eseu is tompIet.F4 10b" lot s,
fact ory to the Ihiglas hiedholiska.
WIP, do-U~wondtI he PaeymetH ofStW-914
a Mouth 1leahIL (M thfel". ofs) $0
uhim tit which amovat. to sews 010
W.004.ohn"m r'then half to Mtftutq
duw to the Wl~egaus. Thoy i~o Site
W10,91111 wow&& of Savitte' tlhwiupo lou")
evil tht. a midae-lsui tauapid it*stl
A etv""1106 h 10 boltit SW ok 11hla
Vvt~l*ar's 04441" Vow P'rvnlth eyed,
Itot..madne a emtfalt wct *ithh entbuaW

fb. costrar providt-t. that lthe% cown-
VV"t~E c'tsli. t 3 p. r ..'itt of UP outn-
o* roseamxe of ilse r'eptal'iie. chars"d
.0" sthe revoutaet of lialo Dousiva.
#ft;, The ndifulsmspayment front tht
S~eihm'10 1118 e OmmlkttOc w*60 tO

empresAm. If The ,'revses eof Msnte
tkittaigo cit v wrie no suaflelvat, lb.r
*llglaa tl ilght o*ulet rtift mtho Po'rl

.41r the sit two ytears tlb. mwb
wigionh'as khee. wspir etit collrect *th-
Ing satall tis*5It.' ow ritvaulaaion'


Big Libel S..t Ine Savannah.
ftasiuub, Cos. April 5 I'noir suit$
icr libul oafs I .15mb rin s i' hi duam.
Iii s agraialt 8.1ogdeiO SieSart, askril
frivnp lmitt~eint Vaevsunuh,eanp, aSCr
S91#4 to the city cuwet on teatter'it)
omits SWNWa ulilitsed b) I'qtom%

pop (~rtt.r crnb let of a b"a'.: D.
William N.('rnwflirwd.a ph~ils1fIw
physiitan; Mroe Sarah .1 I'mllipmt.
sidoc of the' lt iaiJude R'A~wtv ft.
fiscavit;sips wiawti-rig*. Kimato
Rilchmond wemtol. and Mirs Mollie J.
W&lPU. of ame..Teen bob& M
miod ..g 11116oAMO. The lgdles We W11~
rijti'tV s ol tMr Ulhb's wlt- Fit. ('tic.
ford attendriti her doWimon Moves.,
slid Mr (nfl.? was a*p1atot1,d pet
twvrlfrcr Sr hr propwrlt.

DPuW* man K~W ie
fPtistlsbwrgApril 1,-ios eWeltles. a
ineobbiuW omphied at ib. Wevams
bowseth soifetm"hMyesaw said
otsteu'ieeiw, west how deiak Wheal
his wig.fue loW Iutil90 be hm r
his suedlilvahe dWW aC hulbe MW owt
owe lkewelsal O lb.. pt MhI. uma. WN
is usbeslao" we"h 0"dedv"
Wales. Intberimand uWOW iwvr
ftoal inaS a so" whost eeWewe ms,
Is In the room.

shoo" Wille tomeCuef.s. I
j~Wwolls. Ne. April 16- Altarr OWN-
laig bit wife ms sea%& Go Mbe, Mpow
is 46ob "lisd thrue" elmg these
~1e1111111Ps sby fialele so",wk
uf thM be~Ingso u be-o-11_


:saroi


-1 -


0" two. 4"N"" b4p"
so ratlarom
NOW
10 sake dam

Down"


.,,. ^


Mesesm, Ill.At A#4i

potedt. o rFWeto i3*
Fuortoe s ar a1iS
%akvm fees themalso
halva died I
The adeeMAd


Iterat bi314.


Jort) Ward. -
Juhn ~dlI
Hoilly #'aimpbs'1S
'TtsIm. lueait (of the40-
aill b""n liwctt4t ho
eve Is icry inneK
I aot Might Ns~
hIummi ant td z4glNtWO
.hobo GrabamW69de
awml We'.e rt kommhe 40
the. Wlecalir am

eacce'#4toeej i e1bi
and %so tiroungi
given O oit tbp 6
uIIreI Wine 3I"pm

mesouth of rhoevote

thatI the #m41eowas


16malornflgto eSelo Sms

Pleride Aide B
Martabo, vu. AprW
jemlift ILIJ4&e, so
I brniest pruoopdimp w
Om~ 10.the cuaurt lot
d"Clored g olt *ay as
as orid asd r1111,14by ju4
,kill. *ho board Ohe *
tugt The ebargoo *lie
*04 GodtWhwe d
ts b6"d T60ovgm
jhv tIaltolled tosn

I @am No 410
lhey mom an -U
Ireesoaft 01 m WoVp*
bllted uhsmas hIs ~Wp




Nsook" "d 4111111001 S
Obe'v of asapoR D
:it lu. 3UVWI

sabe -long



met lalhatis
Ad MIMI. IANVR&


Soedolng p J11 Sb
- Wto Now IM p






ywok IL a&


I -- ITTIT- NIA, - I








10


PERammoAL in@AL Itm



~~u.Ife Aw. S-Fsaw, S-I


it~m x 4, uwesu i.
WIIm of0 Wa sf u g. ;
a s Sw E BMs
fM.Iap Mrs. T. T. Jobm jo
ema w (o sob Ieie ,
0. L. MLaNm uod dlove O
from Hage, whoesd lh tv
*vi se i M. 0. spi. -

" W ied, ft"-w to b M d
b i "iiw ~ w iwho6hasN
W. T. Ob mease aiWeseves prices
of Arnlls., ahb af viest to hI
foeily hoeas, bres eed so hi de*.
tie.
W. N. ?eIwt, gonms of She oem.
pldagf weBof ak e,k0 lt, smald
to hs bomw ofh IIter. uios *ops
am he wihldeb e e sOes t iem,
0. Y. Crowfl f eofe a rI of Oraw.
'ood a Davis, Doagd "Powrdo for
ntegh* oeM be v t po rshaeI
ai arked ofle gab& I-sl-sft s sr.
pnmese. week males sad gaol driving
horses. HReo sxpeso tomevr lat
ter part of she awek.
Mr. a0d M. 3.SU Na of Jeoatgs
labk have arrived l the oity. They
eam for fo pupss of pmoc lo.
latter tain the Odd afaos seeselater
Tor an opeale wabsk wittll bo pe
oermeod today. PFes& of Sb ledy
bpI shal Ise will s6a4d the opeesles
susev nfeu lly.
T. W. Watoeo.oe of the old lead*
mak of Kirkhwoeed, ae to o ealy
e4eey. me was i tIKirkwood wheoa
ist w t Wooeeds. May thal the
bow oawdeabh ae fas n as he


veras at ae tsium of the year, eNd
he a sem from 10 to 15 liashe tall
at Is fall bloom
The hoon of J. B. Gerald. aest
Mailstlret, N.. whieh bas boos i
soam of ooes Ltlton for hWe poas
lw weebM will beo splosed Is a
etrt Muew. and will b eo ome f ti
hadamoiet& and met moldeam Is ohe
oity. The beilMig Is two sorlet, esd
will seseia aaeve roi ase baet.
The work was pe sed elf he
dinet*oe of ooStroaer Whslftg. Mr.
Geoald and eamly an to be oSagMt-*
jose u eam amh sNw pssumft.a
AmolanodA8 DhO* AD n
J. U. oFweler of Lmee was a buil-
am vilsr ato tbhisa ay jyistdie.
D. N. Davieesa of Ht1i ep1tm Ia"
rseam aeUal bu0isaea ai this olty y-
tod"


a


(Caser MHagu of the village by hd
eaoe same was tradai l. thIn e
yesterday.
Mn. S. A. obiMse has gos to Rod-
410d, Otere she willtl v ri berm. K.
M. RoeMson.
Mn. H H. MNolary doparsed re-1
werIy for Taomte, **were will
ibo a brief visd to Mr. aid Mm. A.
a. 3senoe.
Mn. W. I low made a brief trip to
aielite yert.rday to meet a friu,
we soesa route from Jeeboeatvile t
It. Psegbaerlr.
I. PU er of High Sprage. me--
her of te arm of Philfr A Phile.
evW TK aesi torev, a a vi sit
so eib elsy ye *eted.
W. W. bselI of Hioh bpriap.eoe
of he -WAg WIely known rPs60110 off
Shot oews. wae tesseest g busiaess ti
oeioy losaday lo
Mi. e Mo&. I. Piekols of New-
angis e*toI deo. Mr. Pitshes i
eeeowr eoMh*of eta areof T. a.
l e& iM tWeMs of bI*
baeer. Di,

yeI l M Wo d l s i. a ib 40e
saw". Bs -m -" rs to MO
dego besdio Ie thbe gUe # tO
f iav eW a iOW 4Wpp
a. MeL. o**igh sI

vihe mIor yami s
Oggag tenai**s*' m


H L Do.%ae te lo m f0 A
9p son -* u o m* ls
eda 88hoe o


*e ipes3




4%kOft-






MeCreary aed alse .e
midag fore ?Talhmeeereo
e$lfmalN e deieg thae 'eiea 1at
L411b, fr. Mr. M.Cree rt pmee
matig ge .Tbly.See med blalets In

fR. C. Steve. s jeweler ofr mh
SpOiUa4. oa m~e those who paid
Osegevilte a .vit yessordey. Mr.
see"Im sale divko welh lespesr
Iw sh*e Asles Co ases Line. Hr *.
joyes Ise bualsme.
sprieo n mll"ery opucnims at
Oill be ofM IesM s$o IGe k4iss.
fl gid hee of mee trim.
fmig, Aent mleof hadgear fg" sh
ebliss. lemembe he assl. Wede.-
fay sad T7h1e68e .April 15th aild th.
Lfe La*k to U" frem. dAwh
A idewalk i belng sas eamted Is

mv, A; a seame, whibh wun be
mppeeted big lpedetreas who have
qOemio sae she osbhy ftmar. The
wek Is bet dIeee ader the$ sper.
v bi of Ose spoeer D. G. dwsres.
OpAlPs W. T. Jhkme. whoe h been
oa a kte this daughter, Mm.s. nm ,
moat Jhie Ohaaioesol t r the pe.
lse meshi wAdved this it y gas Ie-
setl fo Bmoes O., ad depared Is
She 6f1rme for his grove an Wnm-
barg labe to eek as his erase ime
sumd. me will retwa tpomil to h is
beol m. Dr. J.M. Jeshoe. so whom
Wbes b" vaWI$ fe#e h fesumam. athe


4


O4sea has been qise sloek for the
pas4 loe meeste with leg.'lppe and
rheumatism.
V. P. Henderanson of Ame,$ the paeob
sld peaa grower, was a visieor lo
Olaeeville yesterday. Mr. Header
lme has *avnty serm Is peashoea
whloeb are bearing proillSeaJo, ad
lably same, 1,000 tres, Is pseoe,
weh he rnpeoosl btoer witiA lhe
aost for ylean. The lottrae grafti
ed Sreeo of the flams. ama hady l
*till. ad whob thy oee tIn full
belrial will prove a pe aneat la-
somI for o owner.
p01%~ir a4 Do* 6"0
A. 6. MMloer of Walde was In the
city yaeelordy.
I. W. liosh of Taeoms wai a vl-
ieOr tol a eliy y*teoday.
.0 oMMaMha has gooo to Alahaeb
* beWies for a few daps.
t. MeoIbi of Albion wet in the
ei*y lbusine yetesday.
W. J. IodW e Alaebua was a via-
laer o ib1s eily yesti0day.


READ THIS.
Nis veuamo, Aba, Jww 6. 190
ae. W. sll. 1%. to: 1)ar or--
I hae" been a panUsam Tr iem hls-
Ins a#ubs cea W=69 sad 0sp Is
beeelms evM mpIl
lug~w re~ atcee pinfulwoo.
OW 11010PU3 ShAft" uis
low* ouNpw MA !sUs' a e hmel
sue pseusaendpeuadi boe onae
Muelnd t lewse"of eSiahm. my o.
Used et impous bad ell. M te.
Msim ~. MAdI wIM "I.

"~dmd I man I" a weed%
sa sM" bfw al ow sheeuew *
01 tw.WM on $em.


A TEXAS UUMt
UM mud bWttleof IM TurnWee
lee. ~ b"al OWN W ime, mA i

Malls. In s. noel"
sm"Qup


71,


-for

Children


p -nm ..i


EWwW UV WjWW --

1Tro O.&ab M mdby
&Mesa my~.


ers




Ayer's SaruspePrID
d~,for a few dams

parilla
sho Is veM. prompt
vr whki& sk Hyaour
whafrI.ked.has our
OWd WIN explain.


SEThk-3L J.


Ba'.'tin".~


IMLL


Special Appropriation for That hisS
lie Asked-UnIform Text.-ooUh M
lad Thme of Holding Court-A ll
Dean"We VaDrawcy.

Tallabhsaee. Faa., April 5.-Tbe ens-
ate and HousM got down to belesea
today awl is looks as iogh tbe pres-
ent would be a 0diesa selon.
Thoe Senate.
l thbe Seiase among the Brat meOa-
our itroidouod were the bills o Sen-
ator lMeOmsry of Alachoa fur uniform
tses books i the public sehbols; a bill
pmiMlos a time for holding the terme
u( eool of the ightbh Judicial Circuit;


Z. W. Sauford of Fort Whilte was a bil for a speal appropriation for
eglteored at she Brows House -aster* she Ea Florida Seminary; also a bill
day. defleles varancey.
Mr. and Mrs. J. E. Thresher of Oompemioa bills to the last two were
Nimaepy were trading is the city yes- ltrejeced in the House by Reps. Till.
terday. man and Roseborougis of Alachua.
E. B. Godwin of High Springs was The Basan protest to Senator Brown
amoog thuse who favored (lainesille holding hie seat was read in the Sea-
with a visit yesterday. ate. toiltber with the certificate from
Rev. 1. A. Gray of Miatoopy. pastor the Seeretary of Otate
of the NMolbudsestohreh #t that plasee.. The whole matter was referred to
WaI In h Wcity yesterday, the Commile oin Elections and Privi-
The Job printias department of The lege
Daily tu0 s splendidly equipped and CATTh HAVE ARRIVED.
the week guaranteed to pleaon.
Jom sletrouer eo Roebhlle. one of Carload of Herefordsfor S8pring Park l
she progressive residents of that place. Farm Came n Good Time
was tradlng in the eity yesterday. The carload of Hereford registered
J. XH. Oatheart. one of Nigh bprinps' estle recently purhamed at Henrietta,I
pmrogesM e merehents, was seanseet- Texas, by N. A-. UsCllso, manager of
tag beelses in this oily yesterday dpring Park Faon. Benniai..ton. notice
W. A. ee of s e of the of with la al rady appeared in The
W. A. Paee of la ioflat. ose of the o un. arrived via the S eabard Air Line
pwsperoes farmers of that section. Tuesday nuiht, and Wednesday were
w m the viiors to this ity yes- unloaded and driven to the farm.
tLMday. eight miles to the westward of the
L.Melin of Meredith, member ity.
of the am of J L. Medlin & (o.. naval The consigtnamot insisted of scven-
swses operators. wea in the oity on teen head of fine settle, all registered.
beiaoess yesterday. and was one of tie finest droves of cat-
Mr. mad Mrs. P. I. quinn of Memo tle ever seen ithis tate. The drove
phi. Tos and Mse. W. R. paum of as a whole was viewed by many cattle.
lrlieghosm, Ala., are here*o a visit sme who know a good cot, and the
to Mne. A. U. Davie seek was the center of admiration of
Oe 4lasIty April th. 10t we will all who saw it.
vO a ei0 dof e mauloand hoerm. Manager Callie. state. that the
WaIt esd see them before buytg. Spring Park CGmpany has flnihed
rawfoed &kvi. dkwLw buying settle for the prewnt, as they
oev. W. 0. Poster of AlIshO wasI new have ose of *he beet *t*eked farms
e elity for a few houer yetIlday. He Met only is the State. but in the entire
IsA rMele to lnaOnopy, wbere he oeutbaet.
will visit frlode fo& a day o atwo. Pbhoegrapher s mith scored an ex-
Jamee Holder of oebellke. member sellent photograph of the ear, which
tf the firm of Holder A Pope. i u- will be used for advertisiie purposes,
feeterersof naval stores, was atres- -
*sllng business la tis eiti yesterday. MRS. ACikKEY ENTERTAINS.
After a brief but ple nt visit to'. -
their siter. Ma. P Hill. Mrs. C. I. Her North GainesviNe Mome Scene of
OaSetr *4 ( eala sad Miss e llo Chiy Happinaes and Gaiety
of Micanopy have returned to their A delightful afternoon tea party was
hoaes. given at the home of Ms. Edgar Aek-
lloe's buy befoseou l oOm urd fo6 ly. North (etoieoville. There were
DIav's te ooeek. Thery always rry a assembled Mes I. E Webster, Mrs.
leW of Sae malesad hom. A fresh W. H. Pat oa, MU. Graves. Mrs. N.
eaw so nse astuday. Walt sid be Dorman, Ml a eovilla. Mbs tGirard.
of eetihed dealer. Awlw. Mrs. Robb, M. .. Me NeCraoken.
The ladies of Alasobesounty are i. Ms. J. D. tlrier. Mrs. Wolf. Miss E.
vised to atte emi gre t mo liiey A. .m.ry
epetiag at U. W. Hyd's. Weday A .,-lrse
and Thuaday. April Ith and tkh. A It has aeaeOly bneea my privilege to
See display of sprit and suoamer ham beol eatertseled il so artists a mas-
sad millinery wollties. er, sas e llk de il Ina its iseloos.
Captain W. T. Jaoeeoi ol Bromon Mssoshowing the hood of skill dieta-


sATINOLA Ws s aw d*e wry. NDartaeed
ae meane retesi it h mevs, the
w** ee, tr heem im Mlei. Ta S ae.w-
men ueri e a em. mah e w e skieW
erupioa. b 0 defta Laves We aim elear.
sea. beels. ea, iaresr 0be eas ut of
youth. Thbsmwsat wlry so te e inttq of
lase.as. P Ose e am Pd0 Iysseashg erug-
glwt eroalL frsteed elOl by
lT10 L To 01L T Pafir, Tmu.
Sold In Oainesvill by J. 5. odilford
A& CO., J.W. )eIOWlum&OD.. W. M
Johuso a ad all lealt dreatss.

Board of Pub I lnsr1etion.
A a meeting of the Board of Public
Instruction held Monday, an older was
made by the boar requiring all bills
ngaisst the board and for school pur.
; oueis o be presented the day before
the regular meeting of the board.
which ie held tne firsb Ttesday in each
mouth. Thiu nmeaisa that bills must be
',in the hand% of Superiateadent Kelley
on Monday preceding sueh regular
meotine i Dr. Kelley a so request
The dun to state that the aumoiula.
tion of warrant& is very anuoyg and
inconvenient, and he would be ald tu
have persons to whom warinta are
made payable to apply aad reilve
same as soon after thremeetiDg as pos-
sible.
Amosal other busiiisws the board, by
Srequis"lou of the iaineoville sub-
school district. paid *2.000 indebted-
nes* ofthe* district. This momey was
the property of th" sub-.chool district.
but is disbursement is left with tie
school board.
Water Notice.
'ro eity water eosumers: Your
water rent for quarter endiln June
80th, 9 0., is now d .e and payable at
this iofte. If not paid o or before
April luih. 190r,, your water -epply
will, without further notee, be dis-
conbialued. Fee fore turning ea aais
$1 By orJer of City Couoeil.
J. M. DSLL,
City Clerk and Toeswrer.
(Gainesville. Fia.. April laS, 1I .L






Insure Your [Lif


has seared Io the city tuen Wau- sod by the oul of the artists. Mr nm d W%1&
bers Lake. whe om hoas bee emklsal AekIey, wth her isimitlab'. ramoius
aftehr "h groin t" ee. He stata *swooto asted by ber iharnming w
W th e tree ae full of Moo., ad frid. I. I Webt rW smeid s .
tht he rspesst a is erop the somion exhale lte fragesae of their pos ee- I
emema aily upem all. sam eek was so tbri
NeHr-s a Males-1 have a earke d m i*iy. I osd nt poit *Os O We La IL L .
ol teoem aId mai at Edward' O stan. but mll it a galaxy. Gri Aa
We. Asmas ih lot are a e fo ddet -
h -orl an lia s a ed m g I. eeLbse *Oo--f .re. -. -- .... L
Will be sld d oau emebl oses Coll vory rgho will be tlva liberal M
ad esanile shm. O. oP. N 1a1A%. I qOmtlIy of L M. poas. Cl) for it.
Dr J )Wa klne aU em. rial apet | a it Maem A Marties L. A J
oi the .aeimeelloe a id Olid Railway. M. PaWaS ied ih th ie* gallosF I
has returned to him homeas Miasmpy tesed oil. will palia house. n e
fromas and lltp o oeesha iteod W ar. Charlbusel W Va. .
Hle sports imon a Se eaedOtleo wri s: PaiOtd Psakhemburs bieek GAIUMEVULLB. FL
,& L kb-s. # .0-.-. i- -- ... SLk I A M Imla a .. m ."" .


pwse for a bi agmap e p neat se-

lr and NM. Olde L Carer arroed
To.eay eIght i lb o Oiaeeville ad
Ilslf frur Atef a re they *uen
maiel dtosp. m -eme of whi has
already b made iTUo Thee They
were saet r astam Ospby Mm end
Mr~. ,)d L. ohetr pa nts of she


ameb se ee
mod ^B^l~~ Lf|B- ^|^_^^B^^
aBBB-B~~ ----aaBm-1 *an" ow-lef^ *----


We.ml and&f.m o ro-Ame-F~IJDi*
Dm*9 pv#y01.46a gp~ma 1ew lnsee' lcUs~ a

o~l. whisk p~m Is Is liud tries _
maf= s-.


tab si s abebamsI ape


A GNA R~ ~ed mo w.
~ .LI ~MWs Is


4


i


_ 1_ __


EAST FLORIDA SEMINAiY


I ..


Win in I T82'4k


j








37lY WT


4


.....AINESVILLE SUN: APBIL 6,1909"


MRS. HANEY WAS HERE.

Made Pine Talks on Temperance at
Methodist Church and E. F. S.
On Monday evening at the Meth-
/-4l1.i ii w- -L ( J' t Ha In. MsL.


--1111 W1111` W _w-- -- ;; -- oolu ir inho r, rs. ua m ..Di
-'- --* P I orgsmlserof the tW. C. T. U.. nave
Jsp1m Are seal 1hei o. .tepSersoe lecture to an appreciative
A. N j~i r -td-beat ,a le-A,
*OTPun"i i Mrs. Haney is a lady of refinement
I hAaaU IIO >and edueation, well informed on all
CM1W S-- BANK FINDS ITS MONKE v JAWINlO phases of the temperance question.
----- "Ing Br t A0I and her address was full of rich
iMl I 1 elIng Brought e the Cli I l I I thought and helpful suggestions to all
M1 aiP tmo Pe orn OpI I ItempeI rance workers.
'With Mika de's -lw-f Po On Tuesday morning she gave a talk
11- 4- t n the students of the Seminary, and
and Tekie Resolve e S Mif, A o made a very tine impression. This
0 Pass. April 4.-A reveal v v. Pat, SW M good woman is doing a great work for
i.n to is e lp bttod hStoJl, A Tim -u himMt $a the cause she represents. Long may
- wtlont of the Rusi"sa stay is 1 I ,1 spi. _w b a11 she live to work "For God and Home
* ,14 with Its advanae Uses aoum M is OM P'- W -OdNO and Native Land Osanzvsn.
S ,o 100atloo f 81piMkaal, 4 ais Be M or Urm as r ..
i*S, ie I T Pa1L. ThO Ja3im5ae ot iWd It lIOk M ewl,' t rmf.,rli.ei. SthiAr merem.La wll by f0 t ble0d pfliM "*Dont ve: f..,I f> e|b peddlittnI
*A -cavalry aid it t s uMStilt 'tou A k these l,..a ,.,,snslI toys.? asked tiei
I0 -We bulk of their army,. x. M 4J l ylUr, 7 % d af man oof seo...' l.ill.s.
A k* W ovsMVft et eesma to be la m"bs Y.i "MI 3 3 bsW Y "Yes." auiMNe.rel the street takir. I
9 N"'Am the Ruwlan Ranks. 1I bdly btd botl h- feel rather f,,llpih. But what do you
f0d I S*talo at Changtilfu. 40 to were i4Wbt OVg u Ofg think of the f ',1,l- who lbuy .eu'"
1 11 ll above Tie Pa X. t, ocrup'..,ie in mmd At M OM wl I Wnhtinglton 1.':,
1by JP itaee rt:ller), but '. lar a, j ai, mA -4w --e without rniu- b
iMOertlaaIble, it i.t ot u out r a very m Zmim1 m- i .-b .... ''.
arM body of irips. A t A whbt.l. N .l
oAn of the h (.hlse ha c-c 13 2i ......-"yS .l^ d be o
110t dl o TYOLh.114ol. AL D UORDEtYOUIt"
man of lies Jttuaau.VhIr, n.ss siti[ cmn In. w * *
t 4atllm nrore t han O.m i4KiimMi wa lows SSR M w B t
drintg the retreat ffroiun.t tkden has II h
been found, but the casi; chest of t 1Whisk Wines ft Et
KlothiKlino. governo stlPo t. Pront r l,,Ol"Th inesu dtc.,
ith rofltim ar t rdof art llerg which wad iO ash h I
8110 111. 1.I s'ill utladi)scovered. K
A UvIeiruat of the i'binese ha liHt M. o Mi it r
ld bF J$plesBi ullIcial irougi Mo ALL DRUGGISTS roin .
PIla,1r the directles of T itall.ar, 3 L. lm It
rulle i ol Harblie, bar ien report- .
e4 acd preairu" la being brought by H y r
the Japanese in China for an opla A l4eroti-li liiie lhi.a rlliben up inb th o
MAltanco. with Japan. pulpit t' id t phe **st hiuratido ini
YTaa hi Kla. guvernur of Pe Chi J11. prayer whln'in an ini lin le front riow The only up.to-date
pretlote. a& W)General Ms. courmander of theo llle.vI toik out lie hiualler t
tf the Cholee forces. ron the frotsier. *'blet t e wipe' hse brow. fiemrgttsi thit Mail Ordero HOUSh'
are Mid to be at the head of this *agi a paek of eatels was wraepeI r up Ion it
station. l general Ineyltcbh's hado qr. eNostlly tle whole d.e'k wtas t tiweitulre in the South... ..
t? tNo I Gneral Kurvpatkima old ever the floor of the. gallery. Olrti.
rain. woae. nmft." solemnly renairket time
The Cl1l.e tconotlnue to brita i ialsuter. rely your psalm bulk has
toreg. -_ but ilbu. 16 A 18 Clay and 501 W. Bay Sts

Movements of Jap Army. A Wst Virginia emaple that did not Jacksonville, Florida.
Toto,. April I.-Noon-A part of w1at to t Into hot water during the
the Kaly0a1 force drove the Russiasla maiMage oremony. stood in the mid.
flo0 "eshuaebi1h land occupied the dle of astream while the ceremony
vUillagawl .lrthei.n heights on March ws performed. Bimse that time they W tA for Price Istt Etc
. haves be In hot water. L ,
The itlllo iluothier directlonsu i _____---
mechanged.

-eneral A Linevitt Reports..
8t. Peter.burg. April 4.--mMeri R
lolvieltek 12 a d"1r pw dated Aprl MI

"T" tuatlo. r"malas ekamoe ed. (Xo1apol
"A Russian patrol during the ht VO M R.
of MArch 27. surrounded a Japan se E. E. VOY- MGR.
petrol 0'1si1t1ing of all dralooas is Ahbsestis of Title sad full ilaforvats tinll rmWd li leds to thb
the village of lialrbanchbeta. oa the snosty. Our masaoer has livd la Tu is semsr i y r m aim
extreme Ittlaiian left. lIve of t i thormeghly eovvUatl with tia Isles.
Japanee were killed. A sergant was
captured. E VOYL

PERSONNEL OF CAMAL BOARD.
FIRS. AOCIDKNT, BVRUG TI AJ INDRMNITY INSURANCE. Repro-
Prealdent Appointo New Cenmmisien -mono a A sit eh A epsailes.
Iefere Leaving WashlngNae. i i A OITY LOAW.
Washlnistn. April I.-Tbe perwesoel a -* 11 t Jr3.OVJ
of the *mw ithbelan canal comel _
em 1a fMllowa: ._ ,- I... *-
Ibei P. shoals. ebatJ ima;
"e"rIL B Magaon. governor of easal
me*: Johbn r Wallace. chief eagiler;
a ar Adaiel M T. Undloett. I'. .
K.; Rrigadler ()nneral Peter (0 Haets,
U. 6. A.. ret i sil. ('oloael Onwald M.B
mrat, Corps e.nn'er, I' 8. A Hlem
)eal M. Itarr. I,
These name- w re' anniottnered at the
nar department i< ilar. and In Comaro.
Teft gave out for pubi'aloin a eate a-
is ult showingt the al.notmrts of al.
nCies ..i thl new e'<>nsm;mi(ne'rs and c
his n letter Io th' president and
l i*o 'mm iso pretsid|lit a.'i(tlnlain thC h.i n
p!;e
n it n U'i, ratm'l .t, thre lr antid

....' .... .'.- *Who wish to dress well should


Canad-am Dies In Texas.
Vt. lM 'rtit I -% .% b t 1 4 .1 W

(omad dad%, -I,,.1 a 1 rsV. 1It
S hotW lit, :.. 4l i ie t vif'11 %'.6i e %a

&" I sigt as and 66fkv. e1iu 5 tt 11-vis% 1.:
noe lo~er *&ea;ft Ile 1hat.$Ii,.v
my jf5Ileaw %- rs 65of A

Dow,* L~0



a'woe" 'by ('eg o e.-I,
-b gf~iSeraep%6u I IaL
eles. em "ofras %
ownge M O amgloLWS at tht
2160L. Wb"s 1.00far ad vw


order their goods by mail from




B, H, LEVY, BRI & CO01

SAVANNAH, GEORGIA.


p.'T


..S UMINI IlIY wi T..


'ritO IN


HWNU YIO IE
KEGmUS


5.toalo fikasad .1 of iebkimlchea l
ou TlovwdTav atMay EI"?U is* IACULS rX
NOTttK 41F AM.14 AT1(I?4 MR UTAX _
LA5W) t I'MOM%&ITisIN -O1rCHUAIMU;
6" LA W 14 OrVU AIUDA I.H IL Y
~a5b' r tvee tht*8IWThe Abftsr61A W I. IB EY
Mpals, ("tw"nn Putrbvhaof %'Tat('"120 1iICISuAN AND)5U30308.
cat# No. *i da%"the Gtbsday of j ~A It
1294 hoa ld imaid *WericetoswI a ay
Itham%; mamor s'lsaumeefar Sol dedo"WCL6A; I* io4 e a q $moh wow bees
Deefwd~fneeumb )law Sgemerlibeatee rm. IIT mwube we" in
W~avesThe fedoiu~tnedearruhibodpersv .si-WOW
aid Is i Abua %%~ "sansin ftaashO Iwhaotever natureWOWS&%
ti %r ION"ieis PWW ilk51. Is5a. SNhR
The maid aMwbim &dom"ast %bvdaine0 1
%be 4mummew of uinch oinsAaw is 11waame., ~ nY3. W
or na~P rC
t'nlm imam oceubspoes.shMAbe r.wM! "a-
*ouid& t to vlaw S ed MUibase a
the NSb 41 dna w agsh. A. mI
& a. UN it -
d e4ftt~itb9 C~mMA Meb. .. t

To theUmIem r1Ag-ad


'son we ~W Ua
soe m
'rd' am L %


7


I.
S
Q.
'F
4.


SPECIAL MASTm SALK LE L ADVERTISEMUTS.
Under sad by W OrtOe a 111 111So
of the Circuit Cowl. .
Florida in and for Al HP .Uh t a sWe sC V S L U CATMW .
day of February. A.I I j R Lad Ofe. a s1t>.
pXtn s thereti. wbere Ji 3F Ss Wl
eOumplalnaint and WUllam K..1 iLas eIsi WM9bte i e tRM --
tWe fore ASel wiBolts. wre .-t e- i h u f No"atm sm
larlivideUlly and Ansie Wbhoil5b* If SSriis S
aats. wherein it we* decreed 11bot 904 tSes
bthe payment of a e9frtsln a of I~ b
is mee tiod for ea dy. ftert he al v..
the md deo"". and wbherein i. W. A_. o J. e o L "
speelal master ta mad eause. wa I -Oes J. JouLL of Newbmr. Flo..
t l the lamd. and tenement IN t" a, IS1. .mOf1 the 0Of Bw O fef 1 MI
erefecf defiseet e.tde Sfe T.ha v i.. 1E.6 f 1 e L
aue tola te payment of theW Nad maoft a We M5 wi na fowler wit-M.Mf 1.
for the space of lime trwere sleatIsed. L es foinu wp t Ia1m
F. liker. etelsal m r a.Wforessa. will oser a h a
for Sale mad will ell before's he ceowthos
door In (GaiseMvlle. Alachu county. Viorida. W Y. O. A. Mu. I. T. Sw Wal-
On Monday. the Wat day of May. A. ID. 19.Wbe- mr Dosob alul Nowberrs. Fa.
tween the leval htursiof sale. to the big t pd W. G. WUINSON. Regiter.
and bet bidder therefor, for cash. the fol'w
IOg tle.rlbed real e1tats. ituatd M IvIzorand
beint rt the county of AlaIbUm oand the state NOC
of 'iorlda. towlts l perse idMelbted to Me Wte S. B. Od-
Begirlnani at the Northweat coroer of the dil. ermlatodsli 1dMedk ela-te. a"
Noutbett *,uwarter of Seetiun TwehL-four noth er -ia. ei WW -
(24). To w nship N ine t w. South of oBheTW o- pert of 1 B. 6-aleZI-
tyi-two i) Last: henc(e bouth e fa est o arw e hereby35 ouSh d tof a S th luea-
take*: thence Iasst ewhty (10 rods to a stake. deilnedts wihle tWoe ea.
thenoe North f4 feet to the belf-s tios n. March 9. ISn. &NlmN ID X. VOTL .
seSeoo west alor maid section line eighty Ir; Adadmdtrator of the stab of .S. ML. lag, f
rods to the place of beginning. costoainDnsea deceased. l
acrb moeore lea. W. K BAKICK,
As hpeelal Master in Chancert. FORCLOSC'RE OF MOTUOAGE.
SHER F'S SA1i In the Circuit Court. ghbt Ju4Wia la Circuit,
Alaohe CCounty. Fiorida -f Chsaoery
Under and by virtue of an execution il ue, F. J. JHammoad v. Lawleiood4 ad'* Cor
out of tte Circuit Court. Eighth Judlesi t 'tr- Mgpd. is wtf-ForolomaKN o( Mortgage
cult of iFlirda. for Alachuas outty. In a atit trder Pubboatle.
on bse Chancery side of maId court. whertin It appearing b adaivit appended to the bl;i
Mary G. White et.at i n paintlfl and Nort b. Bed t tnb above stated ew e that Lewis
KoUlmn et l. I. defendant, and directed to all Rood and (4gor Hood. bi wife. Mb defendant,
and every the aherffa or the t tMe of Florlds. theretn named. are Mao-reoMeetU of the Stett
I I. W. Pennel. sheriff of Alaobua county. of Florida. ad that er4r muddiee to un-
riorida. have levied upon and wlU mell. before known. and tay are over the ae of twenty
the court house door. on Monday. lbe It day one yeats; It6 th before Odwd that sat '
of May. A. D. n .5 the sae e being leal sale on-r-eideat defendants be ad thr are bern
day. between the leral hour. of "e. to the b tr utle to appear to the 1il Of Oomplair.t
bighest and best bidder tberef or. for cash. tse 8ied bM i euse on or before Moaday. th,-
followin described real estate. lyitg and be*th- ,sy of Juoe. A. D. IO otherwise th.'
Inrtin AInchus county. Fiorrs. towit anletlos of sid o ill wlU be taken aseOar
lAt 1. I2. 3 4 ani coBteLaniw fvenwr feef bysaId dfeadenU .
each, an shown by mast recorded on public* I further ordered that this order too pub
records of Alaehua county. tlorida. in Plati hetdoeeawok forelghtooGgsative weeks
Hook "A." Pare e0. made by A W. Taylor, C. In The alsmineile Sun. a newspaper published
K: together with all and ulearular the ten*- In eaty amd State.
meet*. berediltemeta and apourtenanien to ThMarbk 9th. 152.
the same belongtWg or in any wwe applertal* S. WIENGE. ('lerk Circult (our..
Int. A true pory of theb orrilinL
%a d property levied u on snd to besaM dsoaT .es f HR WIOGS. Clerk
the property of Mary ;. kWhite. Norm 1. ol- r'9ANS HAIL". Sol'r. for Com't.
line. John tOraham. William K. Urhab sand
IJoughla 8. Uraham to atistlv the ouaaeof mad -.-
suit. together with such $ether cots as mas NOTICE OF APPIJCATION FOR TAX
hav faccrued therein. together with thea Sum DrD UNDER MCTION 8 OF CHAPTER
of Mis* aiM ai for attorney) fees lnuaid cause.
to satisfy ad exeseutin. 4W. LAWS OF FIORIDA.
L W. FICNNINLL. Notion hb rby sgi hav Wad
Short of Alaebua County. Vioridla uvon f eAeid
It. A. THIASHEIR. CompI It. s ol'r. purchwrof c C e rtoes e lea se. detw
........T ............. the 1i day of July, 4. D. J have 1led maki
NOTICE POR i1'ULBIJCATION eoe nor toex 4do to e s i aeeres" with
..---; ral-E f. Hon O w' id ** * ih wit
law. Sa i erosas e fassdhe fotllowinc
L'. s. Iand omIce at (iae-oilue. iF.. d4esrbedl property anud IS A oNhua count
March 1. 1. ity. Vwurlda. towit:
Notice I. herelof riven that to Pomrplanee Nw% of Sw isd Nel ofSwig teeon 4.
with the proviloos of heb Act of Co e rema of TI lU. 1R .I
June .* IMn. entitled "An AAtforMthemale of Tfhe Md alud I tngt t m d IAtt edte oof
Umber lsad Is the tates of CUallforna. O(re- bthe is of e niltse te o s eam U
oa. Nevada. n wEasu* s ton Territory. an of John Pret and Unown.
extended to all the pwt land MState by Art Ulates mIid eertdilotes shallM b i beroea a
of August 4. 104. JamsW. Doogmasof Urady. cordle to law,. tx dee wil tEase ureosf or
county of Lafayette. State or Floritd. baa the isiday of May. A. D. ItS
tiSa day filed In tla omffce his swoe statement Wit es y o tO al iea&nture and s al tb.,
No. 13ll or the purchase of the Lot S of SNw- the sol day of March. A. D. 19L
tion Ni. 1. In Townshidg No 7 S... Msawi No. I St. II. WIENO ,S
IK. and will offer proof to hbow that be land I'd (flerk (ircult Court Alasobu Co.. Fa
sought Is more valuable for m Litber or stone
than for arrticultural purposes. and to stjarb- NYTICE OP APPIJCATION FeR TAX
lh hi claim to mki land before agimter anl TI O APPLICATION OR TAX
Keeelve .it tlalnuwvllle. elorda., on Modad). mDe UNDe E SCTionM i Or (CHAPT.rt
the Mthdayof May. Mub. e~sn. LAWS Or FrOIDA.
Me names as witne-ers C I' "Htheox of
atchb neml. rla A liueell ol Hatsehi Notice Is hereby gives tat H. P Ha:;
Head. Fl.. K. 1). ledgt of aradly. 'ia.. J. H. purchaser of Tax Certficate No. 2t:
Cribtbaor (rady. Fla. 'dated the M day of July. A. D. lts. ha.
Any and all tersaonsMlatming adveritely the filed maid eertUleate In my oioe. and ha.
above-demcried land are requested to fle made appW attlos for tax deed to La in a*
their clailm, in Ibis offee on or belure maki dtb erdaOe n with law. a8dW oertleate embrweee
day of May. IWta the fdeow deertibed property. situated I:
P12 WW .; l)BIN.tN. Iteitltter AWlM sounty. blonda. lowlt:
p w. f SBIN. o N. i @ of stl of % scio IT. Ti
uI.R. I&
FOittL,)SIUE OF MoRti;A;n. Te MM land hpr aWma sd at the date of
la the tiresit Court. Ilrbtb Judkial o ,'rn.ult. oMf V tlob dertoste ia the ine
Alachua county luridu In rhanoenerv. U.i-m eM enrtate sai be redeemed
Andrew J. Jolly Vn. John N. Alker and Uar U acsk t iow esed wsil ab there
rt4 8St Sitb- -otreluoure of MurgagetT- on theMIdaya AofM& A. 0 I D.IS
der of PublicaUon. | wtin *y oiDal raature and aeal thm
It appearing by afidavilt aperoded to the the l3b day of Mareb. A. D. I.
bill ed In tLbe above stated cause that Joha S H. WIMMOUS.
Alker aod (l aet 8. Smith.he d efeudan pd Clerk Circuit Ooun Alacho Co.. .
tWeren named. are noe-*redents of the State .... -
of Flordas. wh reu0dea0e. are unknown. I
and that the are over the age of tweaty-o I
yearsit: It tho fore vodered that soid eon-' S N
reiMdent defendant be ad they are here by J HACKE &
reelutr to appear to the Mil of C4omptlaat
aledm asid oause on or before Maday. the MANUIACTURBRS OF
ktb day of Juae. A. isU. ota rwime the
allstloes of mas bi will be takes aseoa-
fomed by mal defendants
It In further ordered t thas order ie pub.
w o easeoa weok forelbhtcomeselsive Wes"
i lso ee s. a sew'soa"pr ImtubBiA
ia he al einad Mate
S. B-*I-Has. Clerk I iriwS or. 1 x
A uase oy ofP efrisia
l ioasee. a. WIKNGE; Clerk
J. M. aUvass sol'rrfr rompto


To the Iom raBe Usea of is, int ruete .
of AleehaBs Osatsl. itdda e
We. Uhen tde saupar era sad voers
SI M Ra 11 a d e r astigt balm
S ""of a "stem 1 '". S Buileding Mat erial
-S-----** J NB.
M .Ra IS Mast aim b of eewaip s
m H esm- "A Ts eetselJ H. aI. Si and
t. ai m.. W reettuinp pestisarnr haer> CU ARLUTON, 5 C.
othe ho a isall an esaaline restede
tat. for e e ehw.uve u ea fu tree
hese w Itshi ts dlstet nes.m.emtulb s*b ANTD
matsed.
J C Thomaq it L Th,,ws J R Thomeas.
SIt P,. J A Th--.J K Lang. .a a S
N os_ T abnve ''b u oa a no e prewated


9~':


,4


t. .







J' -I


AI SUN: GAINESVILLE, FLORIDA APRIL
-. ,' ~~ ~ ~~I . --.. .. .


"A OutHTFrUL OOCAOM.
0. iUt. and Frioeds Kaenhd
Honem of Mrs. Turer.
W. C. T. U. of GaflaeM Ie is
fer doing things. The htest
reception tivn by Mrs., T eer
b aw home in North Oialasleto to

About ffty M Y e | .
rg parlor was beautitoll g
"alMI with palms. flowers and fews.
I IMMs eonplcuous was a picture of
C Willard om a background of
.'t4, with IA large bow of white rib.
4llbs9. while over all were her las
"How beautiful Its l so be with
Armoued all were palm leaves.
deeealtionsl ia the dining room
of nrem Wa old fehioned red
b hundreds. Delicate wafen
lfruoe" were served.
hs wasallsa memorial to Min
an appropriate program of
"m p .apes, tad ddreaoo w*re
ulaeastiag of a sketch of her life
am. Ha9mey; a paper, "Out Ua.
k ad Queen." by Mrs. Fatah; a
,lo "The White Ribbon", by
Tarmer; aeoeunt of the unveiling
9 WicWllUad stause by Mrs. oig.
sla beaMUtladdres by Mis E M.
j4l of Phldldelphia. A free-
li was given for her mem-


NEY WASTES?

HEALTH GONE?

Aftw Doctors Have Acknowledged
Their Pallure. We Say G. F. P.


wd Posaivswviy CDre Tour
Money Back if It Doesn't.
It's a pretty hard matter in these
days to make a ick. dj-spairnot.wamin
beltive thal there is really l(e e uiwdy
which will pl's-ively curet lhtniw dii.
nses sad weaknewee p-ouliar n the
sex. h9e has probably "do orves" un-
til the purse ad pasio.ne are both *x.
bausted-ba tried flres one' reputed
remedy aftei anoher-but always with
theo same reult--failare--nd if you
are one of thee. we address you in
sympathesie oonfidenoer.
0 F. F (trmtle's Femnler Pantiace(
is so new, unatried priparal is,. It 1*e.
stooC the tets of )yoar and has c ered
tbousands. n eaw. of prolapsu (fall.
llg of the womb). Irrsgulr,. painful or
suppressed period., oversnam rubles.
etc.. It ha ino equal Y,'u don's have
to take our word for it. either--gs a
one-dollar bottle fruan your druggist-
see is carefully as dirweted, theo if
yoiau can eonsiensiosly say you have
not been tbeertled take ohe rimpty
bottle back to she man who sold is to
you. and he will instantly refund your
dollar.
If your drugis t cannot supply you
send us one dollar direct, and we will
send you a bottle *xprses prepaid. If
you fee that your ease presea.l any
1 & .- --A -os-tr--u. A... ..


f Public Insrui peculiar features and ias you a*
d of Public Instruction. advice, write to she Ladie' Heaite
Imeing of the Board of Publio Club. dare of the (.rstle Madieteie 0o.,
ieoheld Monday, a order was Ohatsaaoog, Tena., and your letter
TO bedn w'rill be answered and she very beet ad.
She beard requiriag all bills vies frely given by experienced an4
Ohe board and for school par. sympathetic women.
b e presented the day before ---- -
S r.gi lar soeting of the beard, In Mayor's Court.
W bIs k held the first Tuesday la aeh
tatn This mean that bills most be Joe Floyd was arraigned in the mu.
She heads of Soperintendent Kelley nieipal court yesterday upon the
"a ; Moaday prmdiag such regular charge of fighting. and was fl d $10
- aneatiag Dr. Kal.y also requests and cotsee The harge was preferred
ie B to state that the aoesmull* by William Areher, who stated that
S. Io t warmsatme is v oery anoylan ad Floyd started bhe row. He stated that
warisant, sad he wOuld be led so be went In to buy some hieken. that
i es-Pmeao h to whom warraa t are the attendant reported that the oablbk
, -4 payable to apply and reslve em had all boee old, that Floyd ued
SNO a" Moon after the oetaing as p abolveo lasguaeg ad jumped on to
Shim. which resumolted in a rew. Hol.
:- &Ms other business. the board, by ley Williams. accused of baling mixed
reqltidem of the Gainesville sub. up In the ie ow, was d-hargpd,
Sheel district. paid $2,000 indebtedt- as lther was so evideaI a. s tast him.
,a-Is of the district. This money was
do property of the sub*-sbool ditries,
S6 Il diasersment is left with she A R IA
W' hel board. I . I, O I
Thi Jasksnville schools are havingl1 I| Y AB, M
; tSbles of their oa. ()ae of the n M Wm --ft-M"-
Shebero has resigned and the board ea t he i
wst he br to remain. except. perbapi,' is.g taCt 4


-O meober.


Vemss.
Venuse is haith morning slid .esangat
star bec'mP slie always sem(npasiiia
tb saun. never reading Ctronm i blat w-
7yead crmari IImnlt. while th rest of
the planet. wIt the except ta of Mer-
@c3. are .f-'n at all possitabl aiagilair
dietaarme froon the stia. W'hen Voean
Io to th west of the sun she, rle ll o-
her him and Is a minoruag star. bet
W6 he ab is f. th Weast of tlh sun she
AtIerst after him and is an veanlog star.
About R umsmcs.
lere ar felw dlio*mes that lal.ie
pm temwor ehm ebemmaiem iad
eis probably diseae fr micb
as arWed Mad msleia le" of rMine.
A NNbe be" %eag11-Ased. To my hM
SA beuerand to. therfoe., a he M
Smem m i& take. bS Ohaebatal
J J.b, *whibh ajoyS asm eotlaive
b"moe with 1ibare"t ccais She
iof t dhise OMe appli-
of Pai m Ieli ill reol oShe
mad handrede of sucrerus havm
Sto o pe aMss eonse a tsmeei.
P *WOft Wbo Po Beim imo
leak gef emd easot bet a isete
7go e alnl Bdraslmsc

b1t are 'nsa Piaae ulawla "
-&A $W ,. I'm g[*g o ingI ra, f'rtlei"
o' I lky' I'fr a malaxmlrl?"
f". tr nmy taflar H wave its
flow. in I n tlinga hu rI llMI
S w <-mst O **EAL'.
oo. -u. o, e <


The Twe@.%.Wek 8 an ha, a eircu-
lation In Alahas eouaty that should
attraet the attention of advertisers.
It has wiet she rleeulat tn of all the
ether papersIn la te eoty, and a
glasee as our lte sad the price for
adverkintag wil novieve ay business
ma" that is is the best medium for
your favor.


NICWs rIERSRLY TO.LD.


llisho:i d e- ft
r, sided in Chnm for ~
The r-':wrt that the p
-t-it-d t'i' 'iasrrlage 'of
,- 1: u wi-h Princes Pat


No I:


Sxb'aadred taoloa pa',,r-, znml ps
1wr hanger's stuck in C 'iln.
iotla)*htcaaaae their eMP1,,% ra ttavo1a~
to pilvane'e their wage's.
Dlr, RIeard W Wl~uI. pitifriiwof o
phlulogh2y at the V~a uii-~r-4it)
hen' Committed laic* r,'by shotx~
Mg.g The' Profaors 910aIs attr1b
weit' to IlI health.
A eKpecia1 from Shei~il Ala., 'sap.
tbe Abrilf W3drclllunuit W16have' brok
ri u alliewids In the ni. 1?nl d8:arte'1j)
ninakitistit ~9OMpounds qv: irou from
tw'o co31 turnas'"s.
A Mi-avirnI 'trik; of Vv: inicarriage
anti %sa~on hHIaa1..rit 's nettis'w.ra
or Ow 'arrtavc and Wa,.'i M.:nsfav
I h:i Ow's; it m.of (Ch *a C.a.1i4' 011
.J or th-u 14-1 .'plant's aaiMci t~4.


%a*e oSlseMb.
At New~ Vi-skm'r wat% I. 'gIn 84m
1`1 144-1W te'It 2 iparroti In a enjit, he
1'1' i bw' I'mllooll v iitt An eni r~s l.r "
w-virm' u.tie) wsitteitaaaum -froui you
Whaatevesr.- a.'.milm'wtftle $:-ol Fliay bird.
with linut.'ur. Voiski'A 14 m.osf.aeauw

"But." bisam tthc heav' i% lain, "suss
lww ow plot 011811141l eask '"ti"
"it's sonthus It'st likely I-"al* shomtod a
w as IIC the auedlaeure. 1111111thela the",.
solittle of It sieit hearil auas IL"-.

You will dund peetry nowhere usaimo
you bringma ez.with you.- Jomberot.
Thai'. NeiheodseU of lm
Iije'rs'iii am'%pry few .11 liiliwomtIII
itcrlke lot I-.'lm iii sllen. l stit aupof
thee is' ls:mi'"Iha. lpmi, minisles hae at
Ptarlibt,uaveii ~. iee' m of ittipwitthoi'r WIll',
naiklatt eguite' it safnrio ammise. Vouasi
arutel .1 I i, nlms. tIoth aslarusionuul after
tIII' lomaw'"t olonaze~e~, Esia'd a I? 13 sint11
in tise' wsritisvig., 4, 'er fl- ip"r' l1% a
reter'i-namive14 is tI 111habit I lit tre 'ri
Lie %:.% %,-111`44-fait r s. itP%%.1 V14 Of ds'rl"m
Ilia at 111111 lli ,saatt.Aijt 1114 1am lasa topne
M.- i(.Ilam' laesid llike an*"* '. ma i. lay oll-
tlti1t e$fil fill, twi'aa*6IML'. at els and
Ual m'' I II,- lim' tlaag.*19s Ia 'totil 1t1#0 Imaisa
fit Ili.- loAumlllke.'ta storkaak h11l'l-TIP-
Ilaesta ia rouwt'lan inof sol'Ar"hr" sac ja444n.
loutmont? 111m' flip' 4-1a111tM. of 111(p 110?
Nute iilat ii ejrie'.
Tbv 41108k.'. iomeso..
1rhe m1AsLPe'so 1 11t~agae'I to%* jto be
Ilait ti aaor.. te'melif.s A 81mtis,'t
notwle Ii114 li sm'r fa.. o ttia im soithe'sloml
w'ill a owe'tats'f me it l'mcmwagwillsailt aus'ls
1tm 8111r11IYlow 0 Hotwasle.l- Ia*:ts(fthe
fe'APfi~e int 0-11011-00-61....seal.' g.wulob lee*41alm
strikiillsag oIolsumles lot 11w dclrk TIlse
fAtor Il. 1111-1 a'iIfie aaat aase'?uo loFkia Ile
blail It groustly law -r."su' t.11w afurfaexc
pemuasre'Ilse-v' m ols.f lloo .g~hldpronale are
laal,.rlzamomvl y *a e't et mrk of eutreassely
Mwn utevep filla".'r %% lia'i 'emlvinISa
deep ne'rve' phe'-stooI". '.*rnshhe epideor-
Sic mad OI heated 0111a inte U" rfams.


CLYDE LINE '


u~zaI-vwjL n.i~rG
Saiiue. .*........ .. .* .*whW&adsk*

...e..:dm u ,3m e
clob k A ULLL40m
U~sis~14 10 dcsed


U- Uwow am& w 9 u.mfn, ~ .U
~~f osm~ueworld hram&peesd e l mi adSSnUSIUSP~

,--*wf; a s 1as-,CooefasaI

g S ~ W ~ seSo..... ....



'i m-Mo


The


AOno 0awwwwm-h~



ma. arni c OeTw 1C.


Bean the

Signatmr

of A


41
in.4~
ii


In


Aprsftl Renm*d for roaslp
lion. Sour SMorxh.1)rh
Worms A onvulsimsAusFwrish-
ness uin Lasost.rFSmuu'
FarSuum. ik Sofure or

N I3W '%0'0lR


L


Use


For Over


Thirty Years


DM7 COW OF WurAPPCR.


elm Uines~ mwin~ ~


G. 8. MERCHANT 00.
Retailers and Jobber* Ia


Staple and Fancy Grwl

Itak lro I ad **ai FwM w.
9OUTH IDE@ IQUAItK. UAINMVILLS.


'.'


HigheSt mores price, paidfor (Chickens. Ragmwsad oler Prndmm

sagewcw a W.? H1eLoua (aeFoo.603,M Mee~~
:W he VXRY a? as h
slRsge


B. F. JORDAN


INSURANCE


Polrsm S..ocIS


GAl INII ILLA


S A. BO A. D

Air Line Railway
. FOR. ...
Savannah, Columbia, Camden, Southern
Pines. Raleigh, Richmond, Wash-
ington, Baltimore, Phila-
delphia, New York.


Thrte Eleant Trains Dfaly.

Seaboard Florida Limited.

Seaboard Express.

Seaboard Mail.


EMIll PUFLLMAN E4UIPUS3T
"me NUOARD FL4'SIPA LIN ITW ise a scud s lid -ft


- *I U Ay u
PAMUk" WON


mmI um An
email13
fu otans
An3 mymco
IPA=s


*


-i\n'


_~ _~


km~ra~r


* 1 ,


I


I


I


rT.


c-










THE DAILY SUN: GAINESVILL K FLORIDA, AP Ii, 1W5


Jmesville Happenings.
illa*, April 5 -rhe social given
Misses Ilailton at the home of
Mother, Mr4. W J. Hamilton, on
friday night was quite a suoeesi.
evening was spent in playing
unti ol about 10 o'clock. hbee all
red the dining room, where tee-
l cake and lemonade were served.
who were present were Misses
Mabel Lamb. Lillie Belle Methuin.
Melisea and Clem Piekett. Estella and
liee Miller. Lorilla SheSfeld and Lis-
;ie flai Mesers. MeGill. Corbett.
Milem, Pieket, Alesia. Oreeo, Mil.
SoMth Pettll, Orion. Chatman,
Weoie, G.C. Piekeot and Jones.
e.oerlised a Sonday school ilst
week ago, and had a very
etlOmaI t Sotudy. Mr. Greene
S Irthy sperlatendent.
mea, take sly advice and
Bloa yoor horse and buggy to aa-
i .goeg man to take his tirl home,
sonh bas to walk. See?
lad Mrs. Moaroe Kirby are
bappy over the arrival of a baby
A their home.
a*i Piekett and Aleman of
ille visited the former's par-
jIes. Mr. and Mrs. H. A. Pickett, lIt


M jiM Laille Sheffield is visiting her
l. P. Mlleir,. for a few weeks.
M LiJUssie Griffin visited Miss Liz.
:lp Jla of Areher lst Sunday.
.Ohaltle4ain's Cough Remedy the
S Iet and Most Popular.
"Mbthers boy it for eroupy ehibdren,
.Nellsd men buy It for severe eoughs
l e*lMerly people bay it for lagrippe "
m Moore Bros.. Edon, Iowa. "Weo
,.l more of Chamberlain't Cough
rigaedy than say other kind. It seems
i4 hable laken the le0l over several
SbepReofld brands." There li so que-
Stie beIt bis medleiie is the best that
mas be procared for soughe and cold,
b who r hi be a b ldor as adult that
I.,a0 aitoed. It always e ur and cures
ly Sold ball druggatis.


)" i


mid PON b*"-
ho-
m06 UNOem EamsheMa


TNE DAILY SUN* 10c A WEEK

One Cent a Word
"V l- sMO 0810ef WO IWWdnor Offeft"Ger~f
low" lwsrtedfor Owe Cotalawe"d.seve
avsmem. mob tarnierte
samser M NUN semWas ajifmed
aiverslsmea
.esiesee of &N sernems tesrUas so.
des" waibM" dels ibe ram"Oeeu

lowswilmt be gees lmskru
Fee ad-----
Obe maneeree esve
,ft.. mCamINemmee i

10 workmw vsweet
elvelas's, mmplee mwad .
man"e. t00 mar. Noamn.
*CeoperaUw* AdwotvergeaCo.,


)amus they ea the
land for the mos
you deale for
Jim" Shoe and
woMl it


MiIUM VA


M


&lbm brr


NOZLEY'S


LEMON ELIXIR


SE4IULATIN THE
~4TONACH,
BOWELS,
IIDNRYtt.


The inventor of the famous "TER.
RELI. SC(APE." a man known where.
ever plows are sold and used, says:

1 have ued MO YLI'VS LEMI.ON
E IXIR for Io or I year*r In o1
family for tbhe tomaeb. Uver and kM-
erh. sad find It Is te best medicine r
have ever u ed. It s aIln a sure 'e-
eMSe for palm in the ac k or Ruder the
aelderm. I bavre ireommeaded it in
numerous a es Cm to my workmauB. when
alrk ad unable to wtor. aid It bhe ai-
way% tiven rerfet saLlatfetlou. H. I1.
TERRKI.I.. Per- eit Atlanta lMow
C(.. Atlautas

1OZLEY'S LEION ELIXIR,

*Ih Niter asper-oee.
"Can't young swallow even a sugar
oated pill?"
"No. You see. %t6 blamed thing
meia to take its oat off before start-
Ing on Its trip."
Rheum-tic Pains Quickly Relieved.
The exerueiating painse harseertleice
of rheumatism and selatia are quickly
relieved by applyian Chamberiala's
Pain Balm. The areat pain relieving
power of the liniment has bewn the
surprise and delight of thousands of
sufferers. The quiek relief from pain
which it affords is alone worth many
times its eeost. Forpeli by all drueiste.f


4 ".e*** Dllt(ne Tralr.
A rnllrial' et.-iul0.ve iht |I tlllna was
struttilni a bb'* tltiilllIly le'fre n train
that was Ito riun dirt to Cork. whlle
be re~tuattl.v abouitld. "This traln
doesn't atop anywlherr"'
"A amnlht man." said l'ue'le Eltin.
"is a peal deal like a ramsr. lie kin
be mighty eeful aIn de right way. hut
be kl kinck up a pow'tul 'strban ,e If
It goes wrong."-Waahingtos tar
Cures Coughs and Colds.
Mrs. C. Patereos, Lake SH., To-
peka. Kan., slys: "Of all eounh rem.
dies Ballard's Horehoond Syrtip is my
favorite; it has done and will do all
that is claimed for it-to speedily curs
all coughs and oolds-and it ie sneweet
and pleasant to the taste 2Ao. oc.
$100 bottle. Sold by W. Johuiun
Best job department in the S(ital'
All work flrst-clas.



DIF. MGOLDT-IN.



OPTIC SPECIAUST.


Will M tr Aprifh ,aad~


Will Iemain


Two Dhys h!


Hma ofas


irBwn


90 3 6 S

1)riag His"sonagc..


MAX KRAU8f,


ILL Wm atI~
Padm. IOLISALE S1698


-.mmso


"Did yo- tell the dlord what a*
awful teak theme wae t the retw
"Ta. I told him."
"What did be s a
"He mid he'd ai the roof as soon asn
you pay the rent you owe."
*"l l bi?' I g nett It ali't mueb of- a
leak C'Iveland Plaina lr.ler.

America Will Help Germany.
N- l orlk. April ;:- -P' r parlours
'.i\. ai: ,rI nla I ts a Tim ~' dip(1latch
frnm i'iten l, a i aken 'la'c '' w.'an the
I; ':':I m ..:iti Ai i'lrten :'nlt ra min 'n .
w eu.itsntion t, f til ut, an i lior
.n .\l.'r 't< *'' i It It i il tart't.1d the' 'arl
*,' ', tli' a' it' rt ,. that th,' .mn 'r ',sn
g i\ 'l i fillin i t 'l ntlr'cly s tIl;'. *lt I w ih
l;' ii *l'i rmIliatIon prtl're
I h< ,t i ;rrit [of tilth inlilt'li . nal itreadil

Equtatle Directors to Meet.
N' 'orK p A rii )S. h .% in 'lig of
A'h '.r ra l ;oif the l:qi:a. )et>a I.Ifs
At.s. ii.>oir S-'Tit l thf' I (q.tSl S ll,.
has h e'i al 1ld ror Tbhtir a.: illt.'rntxl
hun iOt' qaiat.lon ofuf t1. 1If1i l an I'.
dcin iiow tw*via.r :i, 'i llzat lon
p!an lirolitr,-d last 4aatluiIi ll comnte
up tfor c'in.ultl ration '-Iifr of Av.
couInl;antI andrl erks fr, the slate
iln-tac unerl dam|rtBmetl it; I work te.
day oan the lMtnks of the I:eqi:liabl .sio

A Deandy for Burns.
Dr. Bergin, Pasa, Ill writes: "I
have ued Ballard's Mnw l.inimeat;
always r oommead it to aiy friends. as
I am confident there is si ntio-stst made.
It is adandy for b ars.' Those who
live on farms are e pse.lly liable to
many aeoidental Uets, burns, bralee ,
whiheb heal rapidly when Ballard'*
Saow Liniment is applieit Is should
always tw kept in the hania. for eases
of rmerseincy." e, IK. I 00 bottle.
Sold t! t M In.nhonrw
Attention, U. D C.
The regular othliy tieetinl of
Kirby Smith Obaptr.V1" I .* will be
held at the hoeeof Mrs .1 N. Strobbar
this afternoon It I oe'lock A fall at-
tendatne is deIred. ** there will be
hueiness of Importease. I hleuaes tui
the State Coaventilos. whlli will meeti
In Penesenla on May 8, we'l Ih elected
p Nim. J N. 8anNA.t, PI'rpedeoit.
Mris MN t'I UOisAIM, Mtk.retary


- -Im ______


o~f mialmabk


alimg e43 adly after .loo

HERBINE'-
lov Die I a, l U4 eda~
aw n SaMmm* ldq mdl.

For ~e b W. Jonowij im


ABSTRACT & REALTY COPM

E. E. VOYLE. MGR.
Abstraete of Title nd full ltformatluo fuaramhed reauduiag a115i l8o b
coeaitty. Our manager ha lived in Iths oealit mhlrtly oae ali
oe thsorouhly eomvereant with iat d tites.

E. E. VsOJY IhE,
FIRE, ACCIDENT, BURGLARY AND INDIRNITY IN URAMON. Ispo-
eontiIng a number of tliaeat Ameam aid -eish MI-upea
KRAL NTATE AND 01TY LOAMh.


G~ad~ow 11.


I I


iR~xxc4"


H. F. DUTTON&CO.
---EAI.KKS IN---


Sea

Sea Island


IslarLdc


Oottoixe


(.)tton S(ud, BaggiDg and Twine.
leather in Strips or Sideis


Manuifacturert st tore
SPA41Island (Cottitri
(GAINN&VILL.E,


Wa~Pu~:'


.7 mem Doig Improved 3D4
I 'in1, atnd Suppli~m for ome


S FLORIUDA, U
___________i


I


Do you want to live where the climate is mild the year round-
where labor is never oppressed by Stres of weather, and where
animal vtilty is never lost by mere conflict with cold?
Do you want to live in a region where the resources ae an mo
varied thaI n any other equal area in the worldwhere the di ifl
of roeat rche affords a fine opportunity to get a small tE m tht
will mure you a competence?
Do you want to live where, with a mianilmm of labor, you m
grow proitable crops of grapes and small ruIt, om~el, leaml
eovws, prnes and almonds, alfala and gra-, wbh re pe m a me,
lnu is pood and capital easily fnds potable invetm-nt ?
Then po to Calfornia, where both health and opportunity await
your comng.


The Chiago, Union PMoMl and


North-Wst"rn Uns
b the mo diect route to the Pdc Coa, mad there wre two t
thr A dly viaw tes lne, over the hmeso deme a
r&WqMa b|MW B and the Missoeri River. Om1w9 CAOfl
are on Ms daily, Mrebzh WoUay
J the rate of $33s rA CM wh mW-N.
t po agy low ramte B a y

i O mVal cmCnae m h _h ---

me *** cueaso *-*II I a
UulmpS^^^srF m.Wgslsuu,^ '
*^-- b m i P b-- M- ^^^H^-Cl^^^B ^ ^^H^ ^^ ^^


A~ -, ----


V. S.~,
P.tU*. C ~ U
~m~am.maa


I


\ **


"4"


CALIFOR


ilL--


--------------- ---- --- --- ; --


-- - ---


r rr~


<**<













II,, ^ilit

Published Twice a Weo -Monday and Thursday

JXJV. NO. 72 GAINESVILLE, FLORIDA, THURSDAY, APRIL t;. 190 ONE DOLLAR A Y

*^ - TTWO KILLED; VNIMLa INUNIJ BRM DN pISw1os.e was antalysed and both the FRIIU '
G W MEL 1 11.11 M lWM D3iis .o i .uh. h.hrl &W 11...... 1 ... .A PREPARIN
Flom.I Past P-einr Train C Iti Wi '" emtl r oimall schoils. espe@ial y the l &at
WIL BE PRES ENT I 65: T" un. W. MESSAGE READ "' :: r"'"'" "' "*'" T O CO NTINUE W
B;'LWL E MnCOX Cleveland. 0., April &-A ft est S A Wi ,nThe "fo.,.,,l.t.i doop(.n5 O C NINU
l / ---- Ibound. pMasener train on the river d4. 1 of the School law$ into a uniform eys- t
(a..So o 'rld Is," ;of the Cleveland .and Seuibte fini, droi sa, ti
OMs at Tga. Ds known as tI plisrti 1)er Senat 5 t p.lblireadi atino." ih r.su ommen- CzarI Nieholas Show No S
At EMtiBtng Mt iht coIIIed with a we,.t.boad ftr.tit ,a Ajourn Utl Tw. dod. aw alo the. posage of laws Or pEdleg Stru.'g .
-. otoni, 0.. today. result.in. -i- -i -, viding for the, adoption t it a uniform
SENATOR WEST 15 HONpRED death of two men,. while tbre outherk AN XBLE STATE DOCUMENT syest of texs htook This latter
were tajared. The dead: ..r. rommodation i prae scally dir.e.tly 75 ARE KILLED BY EXPLOIOIl
4. Wihdrew in Faver of Trammell nd agu Tulbr. erslneer of pas C. M. Brown Ocupled His Soat in the in. line with the bill introduced Iby S*en.
Wad e PreehidFateinl gr T m-eNand a German Pr nce Vistte RMsiol aSt
1 Was Made( Prerm t Tang T !-- H. C. ag. fireman of p. ge Senate-A Prets @ Was Entered by stor MeCreary Uth last fesiun i 1i1>. O P
Iasti Gilbrit of DeSeto N kniad trai Senator- lect eklain Action Not anid which received suoh favoratle Causes a Sensation-140,100 Pr
S. Tl: Yet Taken in the Matter, meatlon throughout the proe. beitig Troops Lei.ve for the Par ii '-i
r p. C. MclCotyr PiOttrb.rg. pass rfero book from the eoamitto.. tie News from Seat of TreMi ,
ej b Jae Deay sue: r Mlatyhur N, .u Pitt. Dsn houwer. too late for it. full consider.
-------,April 5.-There was a for. badly hurt, J. N. Brown. of .1, aioehiat to The DW aus. Wa
% ,. T.ll . Apri 3.-Therebelville. O.;: 1. J. Tichentor. ofi Pitt Talila.ih ee. Fri.. April 4 -The Se tin l St at, char ital t, : .
greafmtellagotlhnali 1. the I8- burg, passenger, lightly. ate nsd Hous @f epre...tatuve met The s ate charitable lnstitutions. 'd,'u 8 T. ,, ct :lared r
a se **aging, with be Mreal lsha The accident was causedI t and oraied shi. ,rn.,. r tShe inMme asylum. ataoe ehfom th,, r.*s ItS ,,, ,rm
S AMfe Wet o reWalisto the sgagth frellbt train over runnin a sildig It wbh n a. adjurament takn unt h tolMdthe' hire of >v.is weo araltr, arur t ait o, i adbrc it
going on to the main track. where it disesed at impot. disooesd, and ipKlnt exII to .i,
a hiealeas, w orwsads of wasi struck by the passenger, abi Hle. A. M. imua oe.ed his sat from the Dew oolvis ease are quoted. he ar tb n t ii..i ai stnira lty bha% t
atm a Beaste, wihdrew.MAn lis h e*.a- wait motvil at a high rate of a.d. l the Senate. A prote-t sai hIsd by O elati es, of this Ifee provide $has th, 0wnd I 1,, la i.tl, Ia t thei l
Ste sotmiht Hea. Park Trammell of The members of the freight ore.w eas*eeleet BDaskl, but se yet no .the' nw im fes lmust rpurbsee the awa bit n a uitn, 11 in .1 tht proper
PIdk IU memlaste by iellaMStion. escaped injury by aumplng. U.. kw pre.,it hospital form and equipment its 1 t u o ,, titShlh In tIhe, ropr iS
t was takI |J tillm. Ij v i, s's the a&Ia' t1 i IU \.
while steor West was elected in the aee s mes nea'r thlals. if required to do so bLtby the th r' tilt- ti nw mubisatioS at
lII tW ( IIo NO EVIDENCE OF POISONING. enOiriMosare.~dIor i gt agriculture. sip nm i oute I
I ImIIIr prIes lat pro sm. Th message of Ii.. Kaoollency Na. Under tite h.ad of laPe.in.ons," is Is dr-lsel. ie that 1 Ou. stte i the s
Gen. Albert W. Oilohrist of DeBoto Death of Mrs. Lared investigated by polson B. rtwal, ioveruor of Vhor. refommeaded: ir.t. Tnal county sl ohil,.t h vr y Irtp of
was Misalmonaly shoen for Speaker Corer of Noew York. Ida, to the L.OtIiSture of 190. twbei. ummiem itomers aerertiee meno e areful m,,d r f r the Irnt t nd tba, t i stead at
of the Hose. H. Walker defeated New York. April 5.-A coroneew by this oeuratmlatlon: "Neiter in the examination of appliesste' rights. stauiltrin i r.,p these' aIl be fat.
Bevis by cae Yok for rfe din sl'rk physician who pe.rformd an aut p history of oar Itate were all of t. its I ~mod. That the applicant shTould ,ta s,,w h io I I,. u ti otl ars oad.
ei boBe lvore for rMadin lork. iy on the body of Mrs. Ruby lAru.ed terial ooesditkes more enooeramisI have a speed.er hearing. "the pen. .,r.
MasterElmor MeCreary, edidate the young wife of WIlliam L. lAr ed Blessed wish a selsbrioti olimate. and sion roll uf the Salte." *ay the (.. ...I
for page Ion enate, won easily. weeil the lltumtrstor. has reported that ihe 'ieerful ourromdltagl, or people ni.. ern, "has I iea .n 1 tventy-Five Killed in Ixploi.
4 twenty-two votes. could find no trace of poslMon The joy aeeellest bheh Stimulated by I t. i nearly ,(tl) e 1l0M. anud tho're Ne.% Yorl, April 5 --dtelaty.Bv
Senator Brown. yung woman died Sunday night ln A a Mhonorable a*biul to progre,, and are numerous new inele now ti Ila p.r.,on. Inulthling flour artIllery ol
SOmystetrlous leep stiupplOW.d 1 havt eneouraied by the fruitful results of Nocon. tue t ean be takeI., w. h ,.. retil,.vryme'. and 40 ChiItem
Hon. C. M. Brown of MarJon and been Induced by poison she hlid itrank labor intelligently anid industrially di. cae lite hand raised by the swa.mill ,,,.. ,ere killed ,ndae y by a tber-
S B ter Is on hand sad will doubtless in a glass of claret L.an.d 1an rooted, *earksabei rides hhave ri tax hha hm exhausted. The (xy. na st' epi..neite of i.amb lo Ilr the r-
partieipate ia the caucus tollgbt. and a srrant were parole.d in icustod) made in deovleplag tihe almost limit. rnor show.sthat under a ooservatve i;.rs i e tp..t in llarbi. Manluarla.
the shabtees sem fuW voble for the re* pending the result of thie uItOiSy. less resours* of the, State snd in im. ,simse a f Thtion coroner t t alou dshere arlged Mr provmenteof former 'condstions. Our eMary for the' penlon fund. st I'l.,, s., ua1i The twu me who
tetib of hit se. although hore M .a ed and them a,. rvln: -; t,,,.in,,, sem.port facilities.our pne f..r.te, ouu The Railroad (osan.smion Is moost ci..-l the explosion we-re alo ktille
aiylbeohangestoea ar tomorrowtiat but held the-m ni witn..-. fr an Il phosphte depoith, our tdsh ind oy.ter sr0usgfltt esdourned. and it a s recent. hI. ieiaor.latry anld theusads uf ptu n
will lead to a dilerent toerination. d
yt revealed co tr pnuru. Q, ,% our fruit groves, fur vegetable farms, muent be soebauittedl to the people mtak.
e. Y. P. U. OF FLORIDA. that at chemical tnl.;. i I,:eiht li'. ourtobse so pleal"tou, our eriellent 1u1 tle Kailroatd Ooemmassinn a uonast- e*rmon Prince Visit Rusl. M us
t --vr tres eo ne. out leo w rate t of Sw t s t ataiu, Joul Il braUNllth of the ie o*ernt 1-1 P,,i r.t.aurs. April 4 --114i. a. m
to S11sion With the a. Y. P. U. of Mt. ing in the stomachb. 1Or np bllo Id ,1b met. 1. OWvr Pmaoi 1istre. Iry of lrusitl. r.pprees .
Morish Baptist Church, Colored. eterm Rainn Colorado e e dtins d the glerat o.veral amendment to the present iause or the tu*rmlaf emaper. rsechedM
The session was opened at 10 a. m. Dever. Colo.. April 'C. Ald r ijh sta g of ourl people ad the primary eietion Saw ar* elrged, ago I am rikone 80 title morning. As theM
Tuesday. with Rev. H. K. Hill in the of several bo.ur it ha. i- lun ral tl rigeila te look f r he fats l ure are das b.in- tlhae t edidattI a sworn I e ee in.e '"I. i.'k news erpe'rue ofor ouk 5 -
obair. The devotions were cond uoted and knowing along he te a .t'toa 1 1 14 a Wa es odf ar w id ascuua t of *i, etpeia e b b it. Iis 9 1ide1 pearsuc. for S
by Rev. L. W. Crievlljer. the metrntains ani the ior-s i Itteelassel ismt urred by m * g of ot 1 ie-rle'l pnIi hilaeror 1 hers t
The excelleol choir rendered several agal it I !; sway. Train. are d-*.. If the splitof ear fedmental pri.. thdi*n io slare of all eantiribuslun s t.u h* e hee'ls o hi's irLh,.r a sape
wetoleicslioms. played antd either traffle i.-rpri t e ip i o e me otrv. t d t he ebampauln luand 0 *'l Olher ls Ta'nle stated conslderai
The progurm pprepad by the Exeo- but no Ier.n "0s damage l. I re I e risdiy es'eed. VIrlida with her t amendme reesnmepdel are the .L 1
usive Commitse wa adoptd. hurm nlildeb, ,r washouiN lIu the (rip a'c of area I I sad and beaisy t,10uP'. peniltes for saiiouaeissiNI votel, 1,1t. "
Next the nameo of the following pie (reek di cil't the esron bae rage- her-odio to yw ryh- n r inltimsl. m. ed y the MINITR M OMMIK N PAR
pi'sol werehboae to report the work constantly fui hiree da. The. bshor veloped, will in tie beeone'- e of iuvernor: *1 "l lureteer reeiamiuad A '
of the meeting to the following pa- ltna trplo who.h be(.aanp inv anbuar, be ferem es is the |i! t sny prson el bpgia be iormr Ameri s Amoas ed w a .
Be turday ventni. hia arrie d her. .4 meet notable feature of th,, me*. seiep$ fro puatehWl elnl. will in. P On-A A ett ew PaIst. .
ptr .frt m oNw York April .- aers M r*
Mr. E. Fowler. Messenger Rev with its 7U plasele*rs. It re.qu-et. sae of the (Joerw. which tyh the f ers or stily agait the perune ar h, *.yr, appulated Asirtsa sins
W. D Vam., Metropolis; Moos tour large an llls to Ilk thfle Mass way. sot, sl a about I.00 wa.rd, is persoa1 e wh.o bribt or ltimiadae him ,'e ador o erains,. hias arlee IPS P
*Crooe. The Florida Bla*. which In some placrs is ner 1 fwi s.he omissiOv of sn~ metlo whatever l say wsj wa .yt er e
SRev. C. T. Derro, The National d - ofthgreaslad. deadtrse* Utr he head of bife ldleas* pased St the reports ift ther u) w
S Bapti U..on; the writer, The age pala-s --i-h MS s spo n-r ton '*lr rse1til tha e li desire to oleltlde peI au t ga
p* OaLe Uais; ei rodla ine Vitein g Pigerid. I gure l l. the iesr's soeful Ieeslatelere sencost **m e maure as tIrir munie-ee n oSslal estrele, e*,
Bimeovllle ea. Jackmmanli. ril. April 5. A psrtt esmpai|g It me hoewe believed thi. wi|l be weary to ilaeb a i0ea 11o she' te 'irls e..rreop adeet t The
At tOhe eoeluobso of this. s.omeo sw of :,40 la sp e usil le einbUo w in iU1WUU. an thatDU 0*,a Ue! by7We /W *Ir. I*r ahei Acwrdse t Ambagekiee
lestioas of sole were eho-s n and pupils arrId last m.gl.. t ld ft ee.tiose involved ell fOr the oest the followlag eree te supper. hi. |l* p Mrio' rk ao desire IAs b giS '
.eag by Ihe coir and oogrelation. at Ito o'klrk m th.e .t..a,,er May (ar lter on for a Pe.lal Mss in whwsh sides' Les a filoerida bfa a ml ese- t P.eter.surg i the es eerSy iI
At this polt W'. J. Johaios came ar. for a trip lu Maluadar,... f hewu,' th.y wai beN ecluue 4is d. pites is fwide fd r he past tWelve** ..*eal tirtl.0 tI~ i, hbe' adid, a g .
arwId t sad delivered a veTry royal rtd. uip the H! Jubois ri.r acm i sv, ceoi ei I rsnchs hiw | qeiuou the by *ei DtIembhr I. II. D, ,.,0 ,el ,.., '. en, ens tue wor t io hbe
m Is address bhialf of the nied by loeI aechol aeial- end weu .overier wa vey sheet o she *.IS. U Vieuida for
hab t i which bhe B. Y. P. I met. b.rs f the heIrd ofU travel, The tre, poes. seytel "'Imgisly aluabtlie l eis : sa0 d o M. e I Iha A.e.ursl BE.tvesky will
theeelr had a very sweet aelecio. it thriutghl th cal rtesy s. fMehiet and pr lw J priuilegis yer, o e umislii- dhi a Si S ate Japane..- rs sad 0 gal af


pospoWe ohlsh theyr sang very heers- 'nu DO& of trade. T bo paFI rtyu l grou od by the 0t60s SM pruteesed by by ~eso~esthuinuA beas tlowea. chi-h goal In tram 6a0 4Wame
hesre tomorrow lot IN-aftecoie. 't IsPA 180 &Pw 011000 bsje $Dl s 00e volsad Aumeo ~se -tou el~rp Is as so. fire aspect oft the war, All 0he
I"mm thwef muitev 1. A Oallahan, the WWaaa ewetOM Our Indilanapolis k, ~Fs*%gSlg go tSe ggm of 0&1%. sihein goo theS odies. Mile pro u( Romlg are soweswo
D~w.Ummasi h Rev S. ~um. cd pPUtis Of 11" MC160011 t9 oak 16siag the gever incu 41440 whbisk hboomS O1 A-0.M sposs owe n ahi.
bf. Rov S.~t. IK "se a temr for e'taMtlouai peg-pm..vtg Welda 00119 we g Wh ladgso led soot "d ai baattee. b e *a
OSM06M uc vr eelca insist wealth 01- eseIfipw sgm er state
gloom. wet should bee o~e i septs 1%1 stll4 oldc~as.a.a~.
Dow. Vass Wlw prayer. andire-'('riplale ('Ieh. COW. AMU &.ri sad asol go~ ee a aid 1011114 1fte V#~ 48"14016111" o
isoft awe stab. by Rev. M. K. Hill Wantet fefrro att~ amme- oep INOM of F gie.if I oad". Aprilg 4
r-~ Wil A andiseslem wes ashes by Rev to "ti4 esd tHa pigI every MW go** ~er~u of ses.eatsWustea Iad.Api&-A
f~ A di- ,c~ re-r'-ally hose- starIed an IVe-. %be law sa e~~o Ua q- M5uM~~P ~~ t.sow 0 b aNO 1"nM
D.s IP. t icla t.d.G do", alleglill that th sabl o e eusMeho S aeas 6 e we igqa 4u ONftr~m awsce edteem sm gi
IM~ ~ ~~~~~~m meerdsie' Wons hisian fore dTsh"sbeepbtin0S osseo ohmA ;4-Atrw -we 0woddr
SM. ~ aSsoo war* he ha r his The, olve at. bowel" tkisy eOW if 'oae*. who5 b*n )801 Iseg-4ee u be $w of ,u.p g%4

ad by ~~~- ~ p 1 ~the .-f &had a beefy brulov audpr the ~ mdh ~~ h b u ~peeieeiueta h ep.1 E
-I ~~ inh~ thrue' P&two~fe ho thae utes IN tu .w m ~~s ~
Temom sed ameo Bse bis t m:%04oe"~ f0o-o9 otIslar ,e sualdo h oe v4 fo
Prud ~ K. Hi3mII; vhs'ooo. gates a Pepro W Soislad OWse s to, Nowi~~
Os.A. C. WUoloo Prof. IL C. oft 84 GAs pauses of tao %sesemt oWishg @mo -as ASO&.
urryj. Mi6 M cmall ; smn. A 00us A i & ..4NGW asw msu o She e"41MO f *IawJi no 1 AU 6 .-Y. ofe u Wichita X896
w. ea. tsm msb. L W. Lest. all whom bum low W- m ,wxa 401 ahe *Or~oe 5l~s ~ ~ ,. arrvistbatsre Oft. Wk to
=*man; 04iil Om sow!e t~be towa ow W d Owe is mo W0 6" a m sm *n i N~SO 18 s9W Mae ftuerseo ON Wlily Ui
W.5. Twecoag mdlg '6 -fso SOWNF -1 081 be. loo 16 betw one7 a pppi Culp" r Toese swa ewe 6s W" mwoa
~ 1111 mU Wl~h MINO On. A.pow by~ me am U"Y Wf: ofi'a ~dIsee.t s.SMbw ~un~ merb
"goo~ seeas m womb e6bhe e,,eyed uome. W 0 0i4'b ndeft of of tbla ISo Se ApI e 1.e Illi 9 ; **In JWlo
goof* ud ** nnd san II kay bM an, doied to we 00111 01M dcs'e' is 0110- 1116 P060 Of Sam boog MIheE to welt a0 8beumbood 4011
AD6 P. 06' IM Im AW h'sprect to solgo ~ *mom Oa f awn" 8E 461011 of tbe em mum a"e 411 ba M W
5.1.Sowam. @of~. I be a sm is smso of oetsmev 1Wmema per- W"W 41 bm OWN& ew


-".L ,, -I 211~







-'- -* W, " '


k"*^.


~4r'i'
*g'~ k.
,Ij ,D~


THE DAILY SUN: (*Ai Wi OIPA, APRIL 6, 190r'u


M NEWS FROM ALL

. ot PARTS OF FLORIDA
/1 d Brief Happenings From Various

L TRAV Sectins of State.

THE MOST IMPORTANT EVENTS

Transpiring in "The Land of Flowers."
Things **Boiled Down" to Suit the
Busy Reader--lteml of Interest to
SAll Classes,
Hewsy ri in hhate ended the water
famine at Key Wes.l.
A new l etr llitnl will e'* built at
Tampa, Iskialaa (lfour is all.
A aew tearainer will be put n llthe
route from Tamps to Mobile.
The Jack4(ovili bs Ibball aisn will
Snout upera tihe r,'irilar seasouni til .April

Over ",' A rhtul childroui fromi In-
dianspolilh rl#.' Iitw llt lorlng Florid


ht

to
w

pk


hi
th


The Times-Uiion l yI. that ual vl
eoanty would build more uood roads ALL DRUGGISTS.
with less talk awd more work.
The shipping of fruits from C('ntral B. P. U. OF FLORIDA.
A r to Tamps, the omiug U. OFterLORIA.
will be a good thing for Florida In Session With the 8 Y. P. U. of Mt
The Dede eoelsy circuit court oleined Morish Baptist Church, Colored.
oa 3n$ady for the April wr.. wih a
as ]nodal for the April tnwit IThe session was opened at 10 a. m.
big beaah on the docket, and many Tes day. with Rev. H. K. Hill in the
ass will be rred over, chair. Tihe devotions were conducted
Ths Detroit baeeball leem begins a ty Rev I. W. Oriviller.
set luts Jaeksouvillle on Friday, play. le excellent choir rendered several
Nlag abre days TIe Jays will give swert selections.
thet a hubtle for their mnii.y. iThe program prepared by the Exeo.
tllasdento ios sooi to be ounnected utivn (omnmitte was adopted.
by loag disasltaee telephone with the Neilt ile names of the following
oautide waor s. tome people would Ibe persons ere choeen to report the work
atefl0 it f,sly could net gold coeu of the nivetin hto the following pa.
alisuolls It their uwn town Iprs:
The Mid.Wiatrr Fair. to be held insi Mrs E Fuowlir, Meosener.; Rev
Taltap. will have reduced paeaiiger 1) Vlien., Metropolis. Musoe
raise un the railrueds of the Miate. and t'rontis. The Florida liaptist.
It is hoped therr will be reduced rates lev. C T Dlorroh, The National
Oa exhibits Itaiptit I'nion; the writer, The
Hiea. T. J Appleyard of the l.ake tai-nevilli *uSo.
Uty ladei has a I ible that has be i At the conclusion of this. soni sweet
sla Cl. Appeyard's family over AX eletion of muses were chosen and
y boul te yare before it was suna by the choir and ooulregation.
publishedAt this point W J. Juhnson came
oove i her children are forward and delivered a very roya
Mn. Roosevelt BI)d her childs rn are d n ,hl the
d to be ru0seis sa florids waters welcome address in twhalf of thi
r M. whs. iriwatehurch in which the 1. P. 1 met
Is r Meand i restyr wh f. f turlis watlr The choir had a very sweet selection
by a ..ladies :e pre pared wheeh they sain very heart-.
U1le idioatiiuns betli(e the fact i fter the mase Kev 1J'. A Callahan
there will be surmthiux dotuI very 1 accompanied by Rev S. N. Vas,
shonlyi a the. bu ldil uof the prepoid l .). oame to the rostrum and Rev
stillad of Ihe e E re y rl aBtn Cahllhan preached a very excellent
the asialoand aerue uld via the key s y! t ion
to Key West eow. %a&s oSered prayer, and re
A Vaagof eounterleiters have beeo marks were made by Rev. H K. Hill
caught la I'eaeitai biv tl eisy polite A good ullretion was taken by Rev
sad Va'led taIte auiuhri.st*e. wad are I I' Spas
now hold i jail I he esn are all m. Tith nieiig was dismissed for dia
Idaest uf ltr eity with s*e Oe ptiutu. nDr
Gad have twen turning out psurioel Afternoon Session.

Cap Iure a IIIl r.ul. lia. polee lef utJ 46. prayer service was conduct
cIapturofd iI llit mullds WriIeoi ere to14 l Mrs 1 11 and tiors oose, after
pl ter ,, ast. to,..,a nlrudollars w teh tile ni s of the delegates we
and It, s d. . dlr enrollei and s a mtl a n prevailed t
Siod t,.n.diaer i,,h Il5 sleet thr lMeers from the floor.
the Cat>"iO,,t sl Ii hlex rlieted Wrrv as follows
Im u i 'N il .f rI' irrid r evl R 'v II K itIll; vice prsi.
I .l i' ,...." fg, 1 ,: ,,,, d i < t' W ill m l'rof it. (
Ie o' s ill 3 ,di,I 't I .... C, rije. '. I, ,'
*o1.wi it. 1.1 I, tI .i.. fi,,'i,,i. i "ur ***.ltAut e"L 'arl Mr. NMr
S V -Ilk t 4 < I 361 1 181 , 1 14 r1 tre.suori Rev 1. W I ra
*4*4 ii nit .. I. 1 tl4 11 -- I! I i d hdr,*rro*tMoadinx wO rrtary Mi
pt 4kle. ii ..r I, l. ,rrI, 1 4, ,n 11 Ilretlg. re" ordili t secretary
Tit4 t1. er. t*s ,l :I.! fr i.l I', crtereiwer infls lleJ by KMV
tiashot O tJ ,0 i r I, lr Sr. rI tI s).l.l- n.- dA \\ A \ dlktr oi
ow nr.e 1a .r w:to si4om important rmanlr
mitlr e ui Lo a i t i4 "se 'le *ir' and thr nireetuniii sti.t
A T tl rr. i l t l set ,rs I inl,| A. 1, In
whbo it 61 *** a I
wi ll t carr : t 411 .I f. tp 1,r t ,
Inliar lt


I- I

emur, 's. Lb

a*__wu was 9104404


.$ho Baby is Cuttma Tboi !
e-r- anodi u~e'ast oouagd suet e-
cgj I for 01dee..tethng i
a: 0)sa P4111. V .1rve weInld cil 1'gand is
"Mt-. ..edy ftr dtarr#64ea lovea-
'. eitsoa hottleI


i: e" s. .a 1. -W
cIt. &
%%%. t low 4%AP 4k Si..
%., maC 1bi5 S t. .r.. '


Gospel

It isto goel tth to U that
M DIBIAM seh as rhebam
tiUm, anligit, blUousesas
colie, ed, e thrt, Ibacksahe
bolls, bev l trobles, ikln erup-
tion, i4 all those eased by
Ioeal lu mlA atla!, em be SO
qlekl, aoly aid surely cured,
as by the use of HAILINS
WIZARD OIL
It gets right 4dw IS, ar4ud
the servesa ad blood veels iof
the affected tises, where the
trouble sl, and gently oeothe0
and coaxs thU nbae to hat


Ulu?,* too of 1t W4 3,i ..SI I
UP', -paesbOr Off .irei o 'i
-inu, Atr~aeare har.16b, '1s11 1'R iss able Mdesa desirable Prwn oirSf
ii gr........s a mbow a ct."
a a' ,f hot gu rr q canl U&TOA M F'1 .IANATMR.
I' 4n- savd e up the' watt 1
.'erth. P"#r.. baw Is I to"atera. b tI IIV% o Sb*- or _a

bswosoomabfttobebow ft amw all
_____________ __M___1411_ e ff OfAWL A b 00 1,,
lo r-. -so" It vfo Oe a6I WA 6M e "dae
*0 "0 680 -eW tw eam 1neea'.1% SUnow
WOOL ~w Ote m w 6"ota


MW4 01.OW 1"o Oo t


Almuhue uon"

138 pewlh

deam OWN.
&am. 0

1113 WMJ all

10knw


il week For all pia, chroale od
Tarpwn 'Sr rligs i,. ie.ecd y hal lotl*e r l
jhave an el'ctrii aigoiliig plaint saud ita It is aremarkAbo ro
after works. edy, &ad hs o equal ia i
tlierr has bher. *.'AU tu o flo. lu ps.-* gd offecti0es in the ml eal
hate rtmnk bhitjoped fromiii t'uitsI i rda
Sfar this year. WOild. Price I md 1.00
Postmaster Iildretlh hias at last lgot fM y garumted
il oommisiuti anid is wiw imetalled ini
he Live Oak iosittllic. fr oale ad reoemea d by


r


KIlR WITH OHAPTER. Rseeum song mne e in N er4raea.
-Omalba, Neb.. April 5.--Cty and vi'
DaNOhWer @M* e*d T w Iage cleetlaeM are being held today la Di. DaVfl -B
l n all towns in Nebraska. outside of Oa sD
The reglr aMitcly eaneela" of Kir- ha, which i governed by a spelal .. *
by Smith Chapter. U. D. C will toe charter. The Interest in generally
held at aie house of the presidem, local, and no party lines are drawnar M-e ovaerMim a neli
Mrs. .. N. b4Se4fbari 1 ts arfterSO at Nebraska being a local option stateM. 6i ,8
s o'clock. A fell Sattedsoa is esra- the plancipal sluue is that of license
estly desired, as there is Imperlsat or no license. On this issue a bal J Ai ,A3-1U'
business to be trasseted. Pealegaes campaign has been waged nla several ATTNOBNY AT
to the tate Coevention. which will larger cities. principal among which a oUt l
meet at Peasaola on May 8, must be is Lncoln., York. Nebraska City aah n
elected as this oasetg Io order to nPremont.
send the maeao to the Peaseeola chap*
ter prom Kirby Smith wishes to To Ask Governor Polk's Advice. s emds. 0*O*
send her fil qgets of deleai.t-four New York. April &Au.. Aamemlyso *.- -
in numbelw j(Wgiae she president, who Alexander, Colby aad Robblns, of the
has aon ladepdeass vowt at the 8tate New Jersey legislature. will. It is re DIA D JA 3
Conventloet, m*akl the member of ported, start for Ulsourl la a few ATTO R Y R 4 gA
votes from Jirl Smi th lve. days. as a committee to ask Oovernoiz GAnIUVILL0 '
A comaiNM will aseo be appointed Polk to bugglet the beat manner of L.. I .
at 'he meeting this afternouo to aof barring lobytits from the beane and 0 i "a Xli .---
range for a simple memorial service rendering their work nil. Lobbylatilts o IMA
at the Ofal-erate Monument on our have been worylng the Neir Jersiy tru a
Ooofeders* lMemorial day-tih of legislature for years, and m mow a ls l he mI
April-whee the chapter hopes to have proposed to get rid of themf possi
completed the atoie soplag around ble. W 2. ** All,
the monsoo i. Mrs. J. F. MeKneiry,-- ATTOBmY-AT-LAW
Jr., will be shairmnaof thiseommit- o ti ce
tee. All the ladies who have aliund the .. gL.CIOTOB IN SAOWt .
Kirby Smith Ohapter will be hon. charter 4i9 of the Ladiel' Auxiliary ---
ored to cooperate wit the Goofed. Hospital Assoelatioa, and those who (AINESVILLB, AlMhef CO,.
crate Vrterass in any memorial ser. are willillto his soolation or O homI1 Bleak.
vice th ay s whn are late d n the erfor to
Daughter, of the Confederey wee or-r. u"lde at o iets thDe*Rvlo D j. ei1 .
ganised to 'protect and defend the of Mrs. N.'D Phillips, Wedanesay af
memory of the Confederate soldier, teroen, April 6tb, at 4:90 o'eeek. dt2 D JTI oe"
and an harnMalous and loving alian sll._ ___ _aee__r esoiW iWb Ali to
tion with t&beear Vetern Is as aIW* overMllMes-a. lss I L
sred as are the grave of the Detd. nt N ra. ow f Mtaaea.a
Uathr the sreddoet&of the warrkw
Who be" the Bag of a Na tiue's rige t DI
trets I TWT.
And fell Ia a eaue thbouh loot but -
An d I e a We have the only and genaine nauiesse G ass ae CMoaSe PaWaI
And died for me aid you. ro a press a T"
"We same sot when they eam@s, o 5ll W 3 goi-n a
Dear in their lifeless elay IAAwoe
Whether f aunkuown or nDoLn to
Their country still the same." O O L!WESTEND
,_________ ________ TUEL W,.ES ED,"

"" .. -FINE WINES. LIQUORS 4 OIA
% RXI m L Jt will COST YOU NOTHING to! Jo uwamas.nPewissp.
You Must o. .o.o,:___ ,,
IYoun inVestiate. beW.er, .-
Few$beerr.bottle ad d ha l
S le e p .'- 4w"---- t"altonilonmew -lai
If you c iot, t is due to an a .. Areti e
irritated or congested state of
the brain, which will soon de- I
velope into newr prostration. l 1 id M b 1.1 S lo iPFI 1- to
Nature desasds sleep, and
it is as impaorn u food; it I t-1 .21 S. w m uw* TIEM
is a part of ha building and M B WEETNEU A
sustaining prce. This period -- -. OP Y lr m W AND
of unconsciousness relaxes the Water Coolrs. DVCABILITT.
mental and physical strain, and
allows nature to restore ex- Ice Chests,
haunted vitality. aFishi l ieeTe tlrh oieearU r emssraa
Dr Miles' Nervine brings Fishin Tckle. m ar s.omse
refreshing sleep, because it Palmer's Hammoeks. w*eti-Ms ebaMtam.
soothes the irritation and re- Upoidsse meveyI
moves the congestion. oetnads Us.
It is also a nerve builder; it Vabe. -**
nourishes and strength s ev- D U old by o s coutlnolsa ly s e ,
cry nerve in your body, and FA. Ty T"
creates energy in all the orgaLn. AINMVILL3. PLOBIDA. T *
Nothing will give strength -- t- witbaosta gl aistagaE. XgM ,
Sand vitality as sur ely and u apia for a
Quickly as r. Miles' Nervine. T11Y T BA service bay













., T a. ^ ^LForrfS-,,ld.*lP, p ,. SAIT,,v a*i, nvSKBI
erj .v Tltc P..o.'or r estees MiT .









1 .a A 1,i, that T hi allb,'


.."L h ,, ,. i i .,rth ''. ALOCUQ Ai IIIu 1' "
I* h'r. T .,. oii : I [a'.,l at*' 1IS Peet Li berty aired*. wfvulUWuW


~i~V~!


1


!


|ll lt| a 1, .I s







r~ ~'


; r^i


THE DAILY SUK: GAInIVU:LLK, LSWAN A&PI1. AM


slow6S Qr ONe 0PGeases mGillne. r.
No ser misema t masoaer.
a.i. I Mac-A0 T. Jalwr sa puhlinaer
"TRAV '. W. W-AS1IY. Ammastie M,;luir
im uam WUlM". city Rdltor.
SvaUIS J. =tNrY. t.ro'1 Truseltrl Agent.
S. M. lPPWITTr. 4ui',. tCo ieiln loo i,.i

OrtCF; lIJRTIk. UWIXK.
ea. asJ. mtaeelt. rM1 TmLKMoN 4J4
TeIn A*LV, 1t publbihmt C%' ry l.oruaing ex.
IS mui1i soy port of thr It sited Utset*. .p*tage
*m l,forsayear: ,-* e u iuom the. Is itsh'r
W e oke;:orSU, tet h,>r fiv'*+ week-.4trictly is


Sised slweokw in I.M I amuluman i, lmut a l me
le ruwAt s ndhs. aw ve ntu for each dditimeas
oi at Wfr display advertioluI made known oa

The ,wtwe*- rk su I &n rangipiat., forty-
S elaist paper. puhlliheid evry Mel4ay Mnd
Tharmey. aad cuataLis all the sewe of the
ie w betos, sato **od swal. and will be
S muld- p ge free, to may part of the I'****l
s at el o CamMia. for e.ut a year-il adveist.
A advertising tltg S bec amm der after Ari
i, .ppl Basnmd *ad ttemmet. aSems otterwime
sipulated Isem raetea t. rtIes s t know to
W 1 h1beqtaired to pay for admv llert h is6
ISM. ALddsS, THI DAILY tUtN.
UAmrMNVU&S, PuA.

C hies, 1tIe e11 ltion, most expand,
& d yee oam' keep them baook.

As the people of the roontry some to
knew F1eride better they easnot help
b speaIk la ighelsM terma of its proe.
p9 p1ee1. I seIturOes are not half de-
Svvlped, lyet ih eaa depend on them
alen. sad Never ome ito want.

SIf OmPre woold only run up into the
S111i1ll Of Mxite, eateb the American
LS t Oew at Peaeaola and destroy it,
he wel4 batve sweet revenge. There
at l Mely tea btsiletilps, seven oruis.
ers, even torpedo boat destroyers and
I l three moitlorm In the buonh.

.. April abowers put i an apl iaraeiei
N. oa fn t'edaiaday. Itin and aiaihianne
r alt rsted sad the earth rejnoired.d The
S dast was laid and the flsalls about
S.I Usievlle looked brighter Iten .ve r.


ie* C


AS OTHERS SEE US.
The following i s aken free the let-
i..rof .1. H. K.udehearer to The West
Virginis Aries. published at Rial-
wood. W. Va Mr. Rodeheaver speas
the past winter in Gianeevlle a4d Or-
lando. and is a careful obveerver. He
rpet.rnd home only recently:
Very few people have any adetqdate
idea of Fiorida, either as to its resomr-
ee or its healthfulness. I have spent
the winter months principally In Ma-
rion, Oranp sod Alaehua cooniles.
I foid the people hospitable. kind, so-
elable, lndestrionu and economical.
Alaeboa ooanty hoe on- of the fe*aet
coart house to we found anywhere,
sad the county Ii ou' of debt. The tax
levy for county and 84te purpose. in.-
loedio islhools slJ road#. s.20 mills,
schoolni t r eight months.asesesd ral.
action or |iro*|lrty ia one.third of its
real va 'i*-
"l.,ies 'd near the enter of the
peniiniilM, in the latitude of the Itwat
olia ns'* o be. found is Alaehua. oun.
ty. Tni- land is fertile, the county
rich in resources, free from mnow and
severr cold, devoid of chilling blast.,
and suffer ing every inducement to those
who seek health and happiness. The
county so about 260 fste above the
level of the sea. There are extensive
pine forests. large deposice of phoe-
phate. great turpentine farms and a
productive sandy oil. Many slear
water lakes are to be found. la which
very fine nish can he easily caught.
This county lies in the center of the
sea island* cotton belt, sad more of
that valuable commodity is raised in
this eunty than in any other aesion
of the South, the number of bales be.
in about 8,000W and valued at s 40.000.
"The county seat I (lainesville, Io
sated on the t Atlntie Coast Line, the
*.4at uar 4 Air Line and Galnevillle and
Gulf Railroads, and near to Alshas
Lake a large body of fresh water. 'The
population is about 6,000. and the eitl
Is beautifully located and well laid
out, shaded with waganileent largp
water oaks. There are meal lovely
home*., with lawns, shrubbery, aad
flowers lyond description. The
streetsr ar lighted up with electrlelty
by ai sup.to-date plaiit. The city owes
its watrrworks. aid is jusily proud of
her pitre wati.r .I comes goumbiig out
from undflr a large rock at the bsa of
a hill I abit two miles from the city,


"Mse or the rose ltuahes about th ellcity d s Aigathered intoa large. well pro.
were literally filled with hilhs-*so, asnd ecteI res-rviier, fromn whieb the city
the visitors ot our teaititflul ayilhern i s *e.plisel There is rn large kewn in
bhme were seen to g,) illto eu*.lielri the l Uited Stutes that can farnish a
over the prospect. superior dritnkim.i nate tha is foiundld
in ttsitietilr-i is soft. pleasant and
Editor 44r W Itmnal of The ltriue. pure. When we remember how im.
wlek Journal. vouches for this r midy portlslt good water so to the health of
as a sure merr for mnallpiit *'..1. a l..,,uvn., oly. we feel that (ainiesville
phate of it.e. tlnte irainl, f.l.o ha. muc-h in thia respect to tw Ipruud
(digiallis). Ieniei isi haliIf-Iasl poo of
ful of sugar Mtl thoroutgllv wthi "(ainueBli,, ,..ese.. a large, aid
wo lteaarluti.m of water andl then ldd1 ein diot.lu ltsatueriaele for the une ofl
fiur monese ft water Ii.e, t*aseliu. hhe Natinial i Hle Conferenc and th
ful very hoiur Ih,..ase will dlmpii...r Flrid. ('hautall.ua. T i luieinug is
1i1 tweliv hoir., i. a rule If i t er %ry irle, ,th a seating eapcitey of
smn is where n ,ie', i allf e ililt i, e '.*',I ir llmore Her as .emble each
* I, .tily ul St in iti 0 r..- ,i, v li I wilier sto ne of the best people. .uf the
ivrit a t trial o.uuutry to re erdifled by a nuhnitwr 'to
I the nsllt eromeitinet teachers anid
ii,,, l lr i ,,niii \.nn> i bi 4 .1 r f ,' ,, . . ..
i, lo i i. ." i h' afti'r all denominations frnom
Polk.i Illt P lark \1 IInranru ll iec, ,| 1l I wvtse ,. t the I (AU ied alles. The
iredrtdeni f thr !6.inate o i ralahuear iiesredhn 'hahtaiatqea alst holds its aU-
1.y hs i'enlleaISg 's i11 onit etil e yInlilt- i"3! l ** "lli sit I e bmildinli "
e*t Iltrlnllh r* ter ill .,t Y* re no f ir f -
) 'lre ear r as a Itlll.' ,tle ial l aill .a ..i.ti. l hately of Fltlla noe.
mt years it. U it ite II as klefet|l akied e Idug utluan iow It happemunli
lay.rot i1. ot.... tf l. | k.' a.. that t ru ,J . nit gh always eduhouu
* rvntIg l,. ir t a. le 'ig "ele' ate. 1 a i| k gi, i tle.r, I o s rarely foulit
nirit*elter e- itihr Hiisu i l; ..r* r a. \ 'H tais the el>ml dUen rred irat vi is bi
tir litn 1*0, li e a i,,t y.t' t,. a t ,ii.ca.r c\ h:, .ly said l 'll tell you
woril r tr iim 1. < rrv iryis reso d 1 1 11 * ;:**% men al) amve pirvfsr
wtc byrr thete I*e l a| i 1 i re t ...W f I e thet aI i waca le r
I In It' tI |e.t > t P#i S il 'N l 1' ', ,- ', I'h irr s ta11 lorin, el,
varnm st d a.* r Ibr.u .r &Ia si . t t '
inulis e lit .* nai , r i Sar t lit.i s - - l
rle i e re ent tI r *t:rr r
aeer in i R* r, .|p ,f S ,t S i I i \\ .e,
Sti aI, ., 1 . +


SPIAKtR O T.L HOUSI


'. t ~e~e ..
'I !1~4
It I ?~ q


In nediaevI ngulad ab pie wee
t vrey tsveoie dith at C(rutiass tim,s
aDd lam1prey puit were regrda em
lg.eiael laziey. Thie ,oat of MsueS dlto
ccae. was very gptal l A1314 the
hfLritr uf (Joufc.tr" provided forty-
f,;r fir -ithi rIpyl table Ut a nC'Olt of
j12 *.m. ad..l aUW*t early ilvulrulent to
.*i(1 at tibe pesent dea. Thue take
fro:. the enaM were espeelally noted.
Mild It beiS aO annual custom for
the li prey. ple to 'lag. There in a re-
,,rd of snad i 4itUamtarTy wments
1.uing seIt Il10well aud to Las-
hall, theI ~~f the l ng parl-
uceit. owinb .UUtlcilaai corpora-
tuii d't inInt t1Ual themayor
eawal In in t In l81 the mayor
ret Ivel It a ct a ilse t torla .t in b 'an pIlllsnw. ll one*
e.O.,)"(e( lhave fOllowe. liIl. exanple.-
Lumloin Mall.
A Dre-DOHtl Ride
Often remwt i a sad aeMideot. To
heal seeideall loJales, use Boekle'e
A rolea 8ale9* "A 4 Wp woB0 IMt
foot, from sa alewdewt," write The-
dore Saehaeleo Otloab.s, 0.. "esed
me grasst pea. PbylaeisMs wor help.
Iree, hut Booles'e Arnie als e qalk-.
ly healed it." Sootbe aod heals borns
like maxie. se at all druadgts.

1' hv lbe 5Party W 'es Arrmngred.
1, (;rema-Now. i'm gviitur to tell
you -n uilethllug. Jtlehl. lio 'u11 kkaow
thlut l.at ithiglklut our jaiurty your
sister |irai0led to ito arry unie? I hope
you'll forgive me foi taking her away.
Little Ethl--Poriv'e you. Mr. Oreen?
Of course I will. Why. that was what
the party was arranged for, you
know.
For a WVeak Oilgetion.
No medielae ean replace food but
Chamtwrlalie' Stomach &and Liver Tab.
lets will help yoo to digest your food.
It is not the quantity of food taken
that gives strtBgth and vigor to the
system, but the amount digsted and
asinimlated. It troubled with a wXak
digestion, dot't fail to give these tab.
lest a trael. Theboands have been be.e-
flied by their one They only eoea a
quarter. For sale by all drogisste.

Crises PaeWdenz Aboutes aids.
It Is n etriou parados'tat, as a
rule. the lnrire anmimel man loves small
tbinge, detail exIulaltely fanihbed ob-
jects audI la ItalTrow4-olrl In bis tenden-
eles, while be whebw' hands are small
dellalitt In colosit of every sort. lov-
IiK ontentathm 'tiud display. Immense
hoineM,. mnajemllt states anld all else
that 1i n|M)u a great scale. HiR hand-
writingl I large anl perhaps hill of
flosurlPlhes. while< that of the Inre hand-
ed tan Is I saiill ul mitt I e''.

ll, plr I.otIery.
DIr I'hnker Take thils lrcawriptlon.
It will either kill or eire you. I'attIent--
BHat ui|lnK"e It kill m ?f Dr. lmhakt'r--
Notliig v \e I'ott, 4 i4. "- > ilirf. tIo p| y." wo I 'in tak-
WUeh hi eli:in1e .is we'll its yutm -Phil adel.
pllia P'rep'.


tl 1'm *o m Trial.
Sliiiuiglter il.- kitty ii|p frrm her
f)1Mi V u' tr 11 tin t f o rifl what do
Y 4v l %tI:1i41 -6 i1' i1114 fIl #* lill W' omftort
to 1i i lI':pa \%i i.<|liltlal. I

'li e 'i.l I,,' llll is i l i, e ill| l w nt
It e-i o e flei .flntoll .
Frightful Suffering Relieved.
.Siffering frightftlly from the virta-
iet.t ptoisoimis ,f oediested foix. 0. (*.
rayonn ,of l.,nli.NXM tookk Dr. King's
New Life. ill.. "with the result." he
write. that I was cured Allesom.
aelh nid ahw** i disorders give way to
their tshn lI lssti( properties. 25t at
all druolg str. learanteed

% orkitng tifl in California was
le'iiej'rm d am e i agenent ring by her
*weetheart %he looked inside the
tund amid saw it did nut have the tunloa
labe-l and ver) grewftAlly ret(irned il.


mAImlllII,


When sh. kt e 't..*user 4''I ~


fusakOr of %ist all.s,e s'I t a Ike.
9311118 ed b G ltla t (Ir-10..0- -, lose
a*We imp Iti's "#661 's '(e aI..,

660161 t-ar-. a a
94"hIts ..i e ayl.. ~ S. it? 0etoeWod 11-Psuo J r ft esterk thGa., t R o A M V V u i i iv

judea as ratwa i

jadgive ia.Ip umt. ?'i i ~ We. the '"410andm "e. have knows F,~
UN" qualitt.. ittbrad! ale!l'sI.ar tjat WOfiRMft16 A e
J?3& 11"keup roi 111c, at; t., Iref him sertsetly hmg,v~rahlo itall WR
VT 610AW4 tIM~I S) 1.Joo umteaaSitta rysat agifteabotuoadev
the aimilupelo "Ia *t1.i0 are fevM -t %eaR E M E D Y
Many h~g plaeft At Iho be-ad I 1!i. 40~i~,'A'I&
ke~how Of OutMat.* 6tiors h'. ela.lsga tbd..) i

e~ in~tbaqbaa so b low bad 4ag~Te"M 64hisem5" of e. a. postowW
- 0 60 Wg 60 a I_ _ s hj T a fh. baPro* e 0600 o ft
d hwe os v".Wd.-


W m


T. E NATIONAL flAICIAL
DAILY NEWSPAPERL, ..


Revelsh the News and Fact& goUernin

Skidles underlying causesof MA"k


R"A. W1N" -; and critiom 71~e

Has oompqis tables of ai

QWtms ctv and inactive Stock sd'

Rooms the lapt s"l of Bnds aod the

Aswers, w taiou harpg, inqtires cow
cerning IsiveintontL
one 11W ,1o 11v mimlls UNM W'".914

moas mOmW~ En o.isfdsa


-tPUBLIBKRD DAILY BY-

DOW, JONES & CO.,
kso" Ohio* ONlVOL
TEE OLD= NEWS ASENCIOF WAIL STRWE.
.3a Tort $1 a Esoth
INVESTORS READ THE WALL STREET JOUNAL


Heavy fhtileu ti expected soon in
the Far East, if the Ruoeians will only
stop running lomg enough.

Dallas Republican will get up a
banquet for President Roosevelt, sad
the Demesrat will have to join to
make a fairshowlng.


. 1-


The Domme carried Oh lewaIq
30000 majority. Judge Dea "f e
eloseed m er. .r

Joet as the wxr news is mdl
stle. castor TIl a i W ieb apps'
the sem ad 11 probably ie ms
treatil for a few *morth.


-.. ------ --- .---- -- -ii-*1


PARTIAL PR

Whiskie, Winho


zirmv p

Ruatft ubmb y*e...
Nemnosofa uRye....
Hameso l 446Rye.
MatsWbley. ....
Ape le &IO ....
moaikw uia........
GommeUam -a
NWOr

O y mer


'REPAID.


4 Q11L
3 3D
3 ;.%




3 3&


4 Qina

411A






4 0s
50i0


Arearte ADowe@ eN AU noeod or
--WW.


'a
1ICE LIST OF

Beerud j


It Qtsa *I.Warosgufto:
s; OnRye.(its. Com O oW ruend

*LOD Per Gales:
44 R- ea.chuflW.3O PerOtloS: Y 01

$4.00 Per (Jalga:
ONO Ptuctre t .Sueiat IDrovsieSY. Moiola.
*~ qu alty.
0600, !.EMP 1T 1AIA 119MER. Par~m

ho Malt. x ar .... ...
bo Ccoueee. Imperuld ----- .....

$Primes bw %be bbl- on astolloeties


W. A..A HANNE BROS.,
^- - V_ -- -- **.** *







T Ia a .o aaBMtt ao i le epanble. Have a Poliyon hve om






i Ia ik a is leiN W
W% 1 afitLbetlity uf Poelicy Cuntract and se ale cop
Pays Lane* ?remptlj


You Are Assured
That so serious loes nan overcome you witbogt you have sme -





!tg)e but Reliable Compaaim Repreated.




Ca Iatnaliaem ifuy Immbbad. OQAIJUUVULU.
^ ^^^^^__ ^ -''B&B^^~


*i


-BU __ lDTTTlc

AL .


mm I.JN


-4 '' 1


- I- -~--- 1


--- --?--~ -, -- ~n


" ,. : f


Il I


I ,









9% VTLA


wow~s


FLORIDA SEMINARY BILL

Op pr nation for That Instil
"lkdsd- Ulniform Text.Books Bill
lThMo of Holding Court-A Bill
Vagrancy.
0"At DafI Sun
Fa., April 6.-The Son.
1kase got down to business
bleks as sbuga- the pref.
be a busims session.
The Senate.
sepl te among the first imess.
used were the bills uf Sean
of Alaohua for uniform
l $ the public oaebls; a bill
time for holding the terms
of she r(ghth Judicial Oiruit ;
rft a special appropriation for
Florida Seminary; also a bill
u4etnva ey.
Ion bill to the last two were
eed in the House by Reps. Till.
btld Remborough of Alaehua.
ash la'sUrotet to Senator Brown
hisYmet was read in the Sen-
V with the oertiflease from
t of #ate.
Swlle master was referred to
ItsU on Election. and Privi-

Slttel Atlantiol Atlantill
gr at and only Alatis, whome
los have delighted the people
b bemilpheres. is to appear at
Opra House fur two nights. April
dl.
,le, ne the beautiful Japanese
Swhih was presented to Atlan.
ib the Emperor of Japan after ap-
Sl before bhim. Ou *hibition in
i A. L. Vidal & Oo.
reLsed entertainment which you
"' alerd to miss.
uielo Lou Ellis. a charming
lady of High Springs, was shop-
Is the city yesterday.



AND



li'6 [UIInIRV


i usvNIo Nuhville R. R.

ply solid Pullman train with ob-
qAm and library car from Florida
IoU. OChicaglo, the West and
tllr(s with muek quieker time
b .y the way of any otner line.
I meale in dining iLr-ervice a la
F. inest dining et service in the
St Augustin*daily.8:20 ). m.
ville daily, 9:10 a. am
nest aoy, 4:80 p.m.
a 1ex4 d4, 1 i p. m.
h Pollias drawlag-room
IdilIy from aushosvillle
*(06 p. m. train to Bir.
Mselhkle. 86 Loets. Chia0o
I" a. a. utramto Pe-
a tr4 ewM Oleaa.
isee is desied ask for
lh.. .a e rv-lo. aC.,
wfil. v eoge E. Herriag,
Tr Amest, J oasheille.



WATERS,



a-d




of alo"S M* PPer
em.


L~LA- A~JB


! 0,4p~b~~P


b. M.


&Wr id u nh
Kidney trouble preys upon the mind,
discouragesand lcwenisantbition; beaut v.
& l igor and cheerful-
n's. L soon disappear
Slwhen the kidneMysare
Somt of order or dis-
eased.
Kidney trouble has
become so prm-alent
that it is not uncont-
v non for a child to he
Sborn aflicted with
"meak kidneiv. If the
child urinatestoooften. if the unne scalds
the flesh,or if, when the child reachesan
age when it should be able to control the
passage, it is vet afflicted with iwd-wet-
tng. depend upon it. thecause of tihedifti-
cultv is kidney trouble, and the fart
step should'be towards the treatment of
theein iportautorgaus. This unple:tmit
trUtble is due to a diseased conditun of
the kidneys and bladlder and not to a
habit 5* molt people uplx*s'.
Women as well as iiiei are tiiitudc tnilir-
able with kidney and bhladdter trouble.
and both need tile sane great renm.dy.
Tl e mild and the immediate effect of
Swamp-Root is Aon realized. It is$iold
by druggisto., h fift-
ccint ansd ne-dollar
size liottles. Youtnav y
have a sample bottle
by mtail free. also a nUm e -amwt.
pamphlet telling all about Swamp-Roott
Including many of the thouaeuds of testi-
monial letters received from sufferers
cured. In writing Dr. Kilmer & Co.,
Binghamton, N. V.. he sure and mention
this paper. Don't make any mistake.
hut remember the name, Swamp-Root.
Dr. Kilmer's Swamp-Root, and the ad-
dress. Binghamton. N. Y., on every
bottle.


-- ...-... .. .. s...... Ui v nreu |nry un r aRy aiter
MRS. ACKLEY ENTERTAINS. noon. sis table$ beie Il lied. The
lirnse winners were Mrs. 1< W Hasm-
Her North Ganesveile Home Scene of lyn, Mrs. J. W. Johanoo. .M r 4A. iar-
Happiness and Gaiety. liisson and Mrs. S. Billarn Straw.
A delightful afternoon tea party was berry lto aid cakes were ee, refrewh.
given at the home of Mrs. Edgar Aek. meats rve at the Ol*-'* of the
Icy. North Oalaraville. There were lames.
assembled Mis 1. E. Webster, Mrs. Mrs. 1'. .J. arl ington atsl Mrp. K J
W. H. Palmer. Mrs. Graves. Mrs. M.!Whitehead weresamong t1 >.e enter.
Dorman. Mrs. SHooille. Miss (Hirrd. gaining friends at dinner.
Mrs. Rohb. M. I) Misa NeCracka The flue weather is th-. asutse of
MrM. J D. Turner, Mrs. Wolf, Mis E. many pienies., the pubile park at Earle.
A Larselere. too being a favorite spot Oil account of
It has eearoely been my privilege to Its pretty surroundlmpg. alcls Marioe
be entertaioed in so artistic a mn. Rtobinson gave a p)imale there on Sat.
nor, each little detail In tis ingenious. irday an honor of her friends, the
nosess showing the hand of skill dicta., Mies Clara Cortttsand Nannie Be-.
ted by the soul of the artists. Mrs lel of (laineeville. All repi,,rt having
Aokley. with her inimitable, gracious "1had a most plesiant time.
sweetness, assisted by her charming The membersof the Melro e Head.
friend, Mrs. I. E. Webster, seemed to ing Club and friends had a ipionie o
exhale the fragraneo of their person. Monday at th. 'ame place, a hseh also
ality upon all, that eaoh was so bright was a very enjojabliu aair. the steam.
and witty. I oeuld not point out the or Afert having been o harte-red for the
tanr, but rall it a galaxy. rtua'. ooealeon.
T. B. Ellis,. Jr.. of (laineaville was In
Last Hope Vanished. town ol Saturday on legIal buslinee
with the justlee's Oourt of Diesirel 14.
W\hAu leading physliiain said that Rev. U. ). Frlokl held tWo ser.
W. M H 1mithart of Pekin. Ia.. had In- Rev. U. D. t the opal heldh n sr.
ourable eouniption, his lat hope v the Episopal Arch h.
ourlbi .numpto his l* ho day, which were very we-ll attended.
wished; but Dr. Kngs New Iovery At an eloctioa for del gates tu the
for eineumption. eoughs and eolds diacean en frntn hict month H.e
kept him out of his grave He say,: un Novsky aIad .M. ntte' werr elect.
"This reat specific completely cured olle
.I ed.


me. ana saved my life. linoe then I
have used it for over 10 years. and ecan.
sider ia a marvelous throat lad lung
core." Strcelly reientiflo cure for
cough*, sore throqta or eolds; sure pro.
ventive of pneumool. (intarant@*ed.
6Ue aid II 00 ttles at all drug storm.
Trial bottle free.
Tie Daily Sun for $ pr year.


' w ',' t l Iiti't i ,ia :a I. 1 II a li. loa-I mr
had 1a1e In* o .a(etl
(lne ortaiin aI little bihIIheaded man
splwared tl'fore the tax c-vmlameaier.
"'ve Junt marrta my feuth witfe."
be mal. "I'm estItled to a bmuty.
ain't 1 r' -(Ctkap Tribune.


Take The Atlantic Coast Line
Take The Atlantic Coast Line


FOR ALL EARTHLY PmONTS


fia %Vw ff t



Rffld Trnuit and Unimrpomed OUyket


De~y


$AP=
kilt
L2:ISM
-.D" ..
3:18pm


RDaw


tops
Raftp

*aS e
--e% f i


IlJ


ENGINEER 3D SITHYDYORRelEtt


A -LMA


ROM 4 M.um.Wum du II we~


--~Fise LoeonMC. Farm. P~w
NOV& potato lmIse Ma "wi
titoAll Pneiness. gain*s ae lelp %ss6 &m4 Iota.


THE NEWS FROM MELROSE.

Postoffce is Prospering-Social Func-i
tion in That Gay Town. IL
Melrose. April 5-Thte MeNlr- p office did a rushing bubitiess diiring the
past quarter, heatin tinrs in the issue of money 342. and paying fitty- eiligL .nony or-
ders. The registering of package, s rp,
etc.. amounted to eilhty pierce. The
amoaint of general mail ha't died was
also larger than any previonti year.
Rev. 8 f'. Lawlor of Jasper was the
a-****** of %itr. and Mrs Kunm Il0 at the
HtufTman House during tiwe p4t week.
His ntnisy frce1ds were mucL' pleased
o see hinm algaiu.
The Ladies' Aid Society reports a
flnan'ial result of $16 from *tr, recent
p e supper.
I'. M. Tolle had a very large cab. -
bage palmetto planted on Benllemy
Avenue frunting his house it will be
quite an addition to the tow ii.
Ihe next meeting of the l.,edies' Lit- It
erary S uiety will be on Aprl 7th, the Hie
Iii e of the paper to be real by Mrs. N
Paston towing. "'High Indivailal Char- t
acter as thetGlry of a nation N.
iMrs. E. M King entertaiilrd a large I
nuintb.r of her friends at progressive kut
ax-haiaded euehre on Ttir.,liy even. lI'h
ing. The lucky winners f t n.. prices
were Mrs. 1W. (A. Vogeit',,i. II. W
Tulles, lMrs. J. A. Retit.nl nid Miss %11


IOF%



UREKA WINE & LIQUOR OI
THsE iREAT S01 TH>ES MAIL U3 3M **
X E-S PREPAID. Pull -


bi lf-I!'%t I ri% ato 1I41N)o
t.'heittI hlot W bae
Artka S; C AWIPle trandi
V A jT'e lit? uit
frea 63a Uw
arrka V C tore.. XNN
arret X ~ 4 I1m en %\XX
C 0 I ''il. X\i
11111 ltscitt.'
miat liSneuili jr~iti
,his %twilio,
Imle P
kl


Per





4 tO


Shi


3 w


oil


Nl, Irm st.49 .to $310 P* u6.11., Detvauec
'%14%e two!9Cwe In lw %imt H atI qt hcl's *lvo M X&MkaiiPeUV a be"t5m t$e613.
t eI we awI lottcg f HIt 00 ltiit b1.-4.U4F3Sol wat ewurea bee 1walils rr. ~~~~5m
listatiett s 'sho P,.Who-kri tand w uer'uIto bottle tIr tee. .IV 0l@ set~i
I tt'ia atdb *4 ie.ure aS14i111 1111440 a le 1""5W4 bob
firawn,41% iti.'41 %retir e mp f lttte It#* 116vpt welveu t o ofu a ~ l W ~ i~
itran# llIt$., rjfb..reuvfef nal o.' hfafttl, tre wsaibiel'of t.i1S W5
that vilo,.,.ei~pterd. Nila,16"3' loaup sswauraye T~ y
lioll Diesm,,.r All otslmmIs~ ool lwallot'awl Whm'I41fiwt'uj e 01161 07 *as Pll,
froma It Into. h aw i k n au Al'i 41ft 11114111-0 008 6i4a auqa 1Iades. *0 ashe "m qb s
Il~gaor thtitthes tante !-l. 8 'qt )ir3II'% 4o0 large 41"41 ItISsc poehd 111111 s s
itired. Moinmesi tef tooded it go ds swt e3aultitsUtsq.
EU-MREKA WIM' A LIQUOR CrouvuN~
1.0 %VVt.%T IAV SThF~T. JA('KSONV3LUL VLA.


DROP I POSTAL OIU TO


Sternbrlgi






III Wet Mail St. N.,


Aud ip wIN soe a nepmmtuU i MI
nmlew of Wall Piew, Puis, IE

who wn (IN etnM tao 0mb
flrst41aM ort yu tave to loe m.,




Stormkrgr & Pi pis,

Artisic Paper Haners and Deconre. ,


Galnesville & Gulf Rallway Wfpany
THE FRUIT A V GTABLE ROUT
OP FLORIDA.
Ttam Tabssi t ee tos. J. a. .


K....


5.44.
bogi


SW L'


VATIOIJM.


-


lov P U Lw PU L
70





016
to


11 594rO

1,0 ?lAr I

Its


LotA v tAu. PH!AU AMW


.0 4 0.6S .10 .1....0 040

...........
0 0 .00... 444 0
0.4 *6~ g..n *.*.a**

77 0 04.a


AiIM
so
so


11


~.z
I ..


*'' ; "* '


UL


I- NsL


Tamn @ i m I@@ Js.. S, INS.

ueo fufa ..d lows.
S edib"e


Ogmie.16 "dium". sam


No**s a m W


Eff mp. W". aumo. 3.
Aibsy. AdotIN. 3Psiab 3se. BANWoon


ses"Ho. Iske u Sam d


I IGPT~JSa~s lam

3 ci inmas OS pe



OTELTID. I.A A.LSmsTl"mm


nil ir-I


Elsie .Shneller. After i,j ying a
delihonus supper the party adjourned
at a very late hour.
Mrs. W. A. Vogelbach e vae a pro-


. I:


M


__ __ I`


L I


--- -


qt


T-. .


I








f


IO NADS WILL

CONNECT 0000 TOWNS

rlme Not Far When Gainesville
and Ocala May Visit.

L TRAVEL BY AUTOMOBILE

5mtrih and J. H. Spencer Arrived
iednesday, Havi"g Made the Trip
by Automobile From Ocala in a Lit
tie More Than Four Hours.


E. C. Smith a.d .I. f ei' s 'e r !of
(oilal arc In lth eity 'I tieo former .. )
member of the dnals unrhitirr .Cll-
paay, and is aesc*iaited wnh Mr .*,S,.r
ser under the tirmtn arn of t'miiltti.
r pealer, dealer in automobii-. ainil
go a and gasoline erigiites. lihy casei-
from Oala oil uIne of their li de tour.
lun ears, making the n lia l from <'(*ala
to MienDopy, partly ove.r n saiidy road.
in a few moments over three' houtre.
*he time from Miecifoply to I ,in'es.
F. vilia, by way of Tarumr., 'Wi'iiehoots
aid Arredondo, was made ,ll godl
Sims.
The machine s ftourteris hliorse-
power, Bad as one of the- let maisfi-e.
Cured. It erea-ted a great d-'il tof a1I-
S *romt among the curious' herre
WMeasI HiMilh aind Sl)ernt.r Have
sole for the purpose of ilntrodseot'in
S their machine, and will rmaiun herr-
fir two or three days. 'They iespe-t tu
slake an Inspectlon of the newly erun.
ear l tod roads In this vieinity today
"I note with a great deal ofI Int-r'at
S She I Alaehua oouuty people have the'
lnd roads forever remarked Mr.
Wmith. "It' the best thing in the
world for the advancement at a .corn.
m aity, a has been d-amonatrated in
Marion. I hope the time' will 'omie-
and I believe it will, I.d not very far
. ditsast-when (eals anld (laiiaeoville
will be more elusIly btmnd as neiigh.
bors, when our Ou)da and (a(inesvill*
friends may visit other fre-quentt.
S ly When the ri Sr-e in promlrr corm.
S, lUtoaltwill I a b o a asl y inatter forr
your e0opleJo breakfast at hoem., rat
dilmer with trir IOrals Irinetd. *l|Prid
a peimasats dallnd return i1s iljcisy ,of
4e for supprr. This I lu und to hI..
Mempiiaho4 by asn aittoinhliile Irill
ever properly eonatruected roadt*. adi
S* It Will S ot masnay years b-f.r.. yrou
will aist "


Ballard's Horehound Syrup
Immediately relieves hoarse, ern0py
Sgottlh, opprewsd, rattling. rasping and
S dieu lt brathing. 11enry (C tmarals.
4 IFruRlist, hhullsburg. W"IV writes May
SO, 10U1: "I have been selling htal.
lard's Horehoutind *yrup for two years,.
ai heve neve-r had a prel(artmon I, that
has giversn lwtier satirfaotion I 1iot11e1
that wheni I s.lIl a b'11tl. ih.y .,"1in'.
back ftir 'e,''. I ,aI, hni,,,*.' r,..', .i.
1 ruerdl *" .*,, ,.. 1 '" hj ) x
t M .In,. ...

J J F1.ioev Chapter
I I re v lllr I. .. ,+J ,. , ,,
.I. .1 ) *1 4 I (,. ( I|l ( I .
h rld TlliIedav 'f+. r...*, ,1 ,
at the. r'Prel..rn'e' ,..l \I. I i' 1 1 .' .
%4. \\ r I Ir,. .


not only in the State, but in the entire
Southeast.
Photograph Smith secured an ex-
collent photoItph of the ear, whioh
will tw used for advertising purposes.


Cheated Death.
Kidney trouble often en4s fatally,
hut by chooilag the right medidlae B.
II. Wolfe of Bear (Grne, Iowa. cheated
death. He says: "Two years ago I
had kidney trouble, which caused me.
great pain, suffering and anxiety, bus
I took Electric Bitters, which effected
a complete cure. I have also found
them of great benelt in generaLde.
ability and nerve trouble, and keep
them constantly on hand, since, as I
fnd they have so equal." All drug.
gists guarantee them at 50o.

Among the prominent visitors to
this city yesterday was F. A. Schuets
of Duluth, Mine., who has been spend
inag the past four months at Mannville,
Putnam county, as the guest of his
friend, < Schuelz is also a friend of Captain An.
tonso Paul. special agent of the United
States general land odie. He iaa
been *or more than twenty yearn depot.
ty county auditor in his State, and
stands hlig'i socially and politically.
lip came to Florida for his health, and


MONTHLY MEETING

BOARD OF 'TRADE

Largely Attended and Interesting
Session of That Body.

WANT TO ADVERTISE CITY

Committee Was Appointed to Confer
With Dr. Clarence B. Strouse in Mat-*
ter of Advertising--Board Pleased at
Actions of Citirens.
The regular monthly meeting of the
(imneevill Hoardl of Trade was held at
the HBoardt of Trade rioois. City Hall.
WVednesday flternosii sat 3 'cluck, a
IMoid crowd brig preitsent
Trihere* was a art-at il'l fit important,
biatsi '** i'. ciiiaig brfir' thi' botiird at
tll* nii. l) g. Altoii other thiniig dis-
eijs6,ild wians Ioe ti-rji,)oo ed lextlinson if
the rharter of the eity of (aiirevrille.,
witch woliit gi oto ie lh* city more mnt.-
ieisipal l(,er, a as R.l as extend the
limits toi a p iit ~* ich would greatly
inereiase tshr o |itulitiaLii tf tho tity.
The l.mard imtirineifoi'e l At action oi f
the litir-.tn in iseS** li 'ii iin 'i'tlestlay
V iII.n a il an Wo wa th l t ii ourti of the'
nai'ctiiit that eat ,ry *' n toiiragim.t ntl
aiil issnflt t'ie' ie ti er'ir 'od towardle the
|iosaloo Thel matt.rr oif aitivr.rtisltg the eity
throu< h h th I'lil t 'l iifrCo ne r ('hr -s.
ltan wVtitkerps' lInstiite and I hailtali-
qjtja was ptrotiilit ipl, and after mIta*me


If I: 1 re hr r,. he'.


HEALTH IS YOUTH.


Diseases and S,( knes Bring Old Agg.
Heilrtiir, ti, i every uiormaug before
lireaklist, w;. kpep yii in robust
ti-.lth- ti you t,.waled uff disease. It
cdres. *onstlpatinm. bilollsaneh, dys.
l-i1i,0,. tfryr. .kin, liver and kidney
,'ollu-1111i ts1 It iuriflce the blood and
alears the'1 c9niplelion. Mrs. I I '.
uSnmIth. Whittir) Tex.. Write. April 8,
110 1' I have edi Hoerblthae, and flid
Ia the t brt 1(604lteie for eou sipatlon
naitl 'vetr Itrouile Is does all you
, 1111nl for it I I icaly roummead it."
'** t 4t.lW .Id by W M. Jobhnon.


Iite twenI greaLly be.neflted, and is well
ple-ase-d with the State and its people.
If- .preelts to remain with Mr. flerkel-
11iNatI until about slay 1.

How to Go to Califormna.
'l'ravel via the Chio0gi. ITuion Pa.
ci'lc A Nurth. Western Lin4. Two fast
thri.m.h trains e'aoh day. The Over
land l.inmited. eloearic lighted, less than
three days *-n route. The California
l(prr* through *Pervice to San lFrar-
e'iSnt, lo.s Angeles and Portland The
lt-sat otf evrrylhinlg. Full particulars
on a'>):"ntti, l o ti W H. Kniskein, I. T.
S. ( t N WI y ('hCicago


II siImuIIn la l unonii mitte'' 'tll risllag % %
M l'.p'l'-Ar,A .ti \\ Ilyil .sid It F.
Jordan as appeninlred to confer wit
Itr (Isarene. I' 14trout. III the. matter
I'he 'eturilnitie,* ilmet lr rous late ii
the aftliernioni, asil a sp*rial meeting
of t1.4. I board oif I rel.t V will ite h lhl thi.

'IIIIt, 0 ,. I t w .h), I it lt'* r0i.that ti I i

f lip r III a't-#if i 1 | i1' if0 Hi It l,

rl'.. 1I I l 0 l lt, iit, |e tI| w ill lpr'vt''' I
is-* op i *l| t iI i .h rl),islin I I liriv'-. it.
i , l i l f, ht ,l+,'f Ir i l' 'l.tild ( .


,' \ H


POLITICAL ANNOUNCEWINTS'


e'e~r MWit6,



inte-itais ?., r.. .It ''I

nil d it IIi ts 5 II ol, &1 11 1 0 'al I tc
ckhk,, siilydii l ~o' atci IM. r11 '
theni I will iti a 'I' at,. It ,
tier t, *I,,.*sri '" 4e i 'a"' 1,


or Marsta;i

11%)aue.t fir is,. Vol 1

4 islae IteeIi. t H I,,
viUsee l I I Itat I a. '
n14Ip ad bil I aA .
seeabi iilaist anteIll, tI f. *j -,r
11 orfatir *




dewgot9br i. asas v, .
EPsy or al Law Ta.Iritts v.A. ,
OTW 10 w.,I -I CiT.ft,.
O oe .I 14141111 A" i t.. i ll
seftworel the4d1114 Ie Irta.;I-,
J=% 1 it % %4v % m, c Ii


1 see '411'fell







I It A lis -1


I,
.1
'5


SII t a.


* tt a


UPI I


'4 1


. 4 1 "-f year


-. '.* **** .-,n- wPwMy vieanM. we owner a twas or p1
proof that it contains a ptcl of misermlof aay lud. Book io
ease. with instructions for ioasetunatmemt, and sny adoviced
*3


The East Florida S


XN r at ~ A A


shm


The leNmrl


"4


Imr I


S.Coantuing for Eljbt Weeks.

This is the Taebers' Normal la1ittse for Ale lasehoasty sad ,
endorsed by the Stat. Sfupetlta..ebs sm of te NormaI *lsd .
his control. Lady tceberenm fbe boa dedf tb. Yi- Myg
Dormitory, and board ean aleo be proseud as redaed rae l" ll
vie elasem in the Seminary. both in the LIterary ad Blau .s
Department, will be open to those deirlai to aer ast aay time,
brilde the regular Normal work.
For further informastlo addrem the Superlatedoaemt

JERE M, POUND,
GAINESVILLE, TLA.


THE EVERETT HOTEL,

235 W. Bay St., JACKSONVILLE, FLOUlDA.I

Ceutrally l eoated, thore y ri re m reevae. Newly thraMed

II. "MA SOQN, IPro-prietoz3
172"8= RU4


unlw I


Fay-sholes



Typrnftcr



NACMUR 0313R1 MNBIl
D ~If Ha sTabuiamo

Every on- ine._


Lightest Shift! Lightens Raunalg! The
Chimpom Speed Writem of sth World
DU eth il.Ainles.Me w r R.AIm.alI is


ElmI Ilk 4Warn.*hill mnm nay other ..awkfii..


I~~~~ "1S'I*.. s' I..Itiltl Mobro For' Sale by...
fit, otti 1111A x all'i
se".TO SuEllGlasyileFlu
"A tfe' I f-11' i cit es am etbing ta'ainty
thalt 11 I lfl'a 1-64e4t1 m ter tot tW I I U..
baA oni In n ahed: I'm Y~mbes__i

lflu ',Or Thaectt'sLit" bad OwW. Dims.fVm egLas (IAimuAus. A.CSM

Ilis pe41*r %%b... mv:'l wifle *t" the aIT E F NJA l AL B l


FIVE MILLION B1113PM ow IlC'O=Ac
I !, to have- r Int's.4"bi.nMOL trN U NA M AC
Ila bfek t'tied.'III tivetj'a *It*ateasmy *eve*sees G o see
.ipusalo. fit if u.-mr s-4 abpro"e delsveff .* ** .. ..
rd. at&b P01 Ias a rondr Sma. w U N d P~d A nnwu


. T.


- arAL 41 -- wW VU


e sasr. T.umm


.Advertise in THE


*


y-- -- --


;" af '^,,^^^^i^^


segis Taking omulamo 'huy CATTLE ,r
a Towea wey car26ad of rdr* lt 1b Today
IFarm Oamea n O d Time.
The a erloadl ofr Hepford rerss red 4 .
settle reeratly porphased a WHearie"Iti, T.b
Tel". by19. A. Oifson, manager of Man any
.Uw o...Lw **. praug Park Vare.s Be.taIgton. notice bei i lls4mII-],i
tI. V't.itisl Medilinni Frocd ]rai pcr- oof which haI already appeared in The had Ilf bil d
*;. ,r. N Ir Qui ki) Ite.alised.,tLas b as a*'
I r' at' itethy Color to the Sn,arrived vi the Seaboard Air Lie ib t
r I.,t. ,f I. l'.*I..1 aIl tow. Tuesday nighl, and Wednesday were .terhowpue
In Pr-lijon a stri-nxth to the w~esk. to becomes ponesoisflad di
I'r*,,. ..iti th invalid unloaded sad driven to the farm, ally the armt asila is a laer r
,r, rr a ti,.'mptsrni o[h nvale- eight miles to the westward of the but the blood -ibedIu sOt id wI
i, t -.. ,f.ntire r .t rn. city. and throat begia toi I h, t
ai, I;, (,i t th. Thin. 1, ak 4 The conigDnment consisted of seven- breaks out on the body,. eo
Itr, Fi:,,I'Iic tilt on th..ir i.ttli Kl teen head of ia cattle, ll registered, appewara and the p f eve
Ih '. r:a.rii pInk nii dWhi .ts lh. and and was one of thefaest droves of est.- e erves. Not only -i the dilmee
I + ',,, t their rh ,km w ith the" Jr.'tty
,' ., i mpl sr that n; e Mther e tie ever seen in this tate. The drove parent to child. In the tost ,of
Ii. *rt altad. as a whole was viewed by many cattle*. constitution, etc., batI sWale so l
osoNoVrTow been ruined by a frlead" Ua0d Ske,
t.oan Astioste fre alls tesseCoased by men who know a good cow, and the
sV. paseto s dEdin wae. flock was the center of a4.iration of **o n iwthhTod To s l
Tr, prove Ito Medicinal Food M erlts a 0 r d S be
Trial Bottle Free by Mail allI who sLw It. Lad l mugnd
l't -nt on re.u rt. Write by letter Manager allison sta..tes that th be s
,#r ; (,,uti 0z muilgon Co..8i Plne St., newd 11rt, buying cattle for the present, as they t W it ide or
now have one of thebest stocked farm fi beniW toa etel the eio o a"d bhlh


b


I









Loo* AND 0-


MI


of Aspirants for Aiderman Pedrick's
Position Certifwed by Cou r ci. HE

m etinsed y thoe of Dr.. .. folra andur.
at pose of ertifyinei cadidatr ur the Brief
position of nrmivi. tnf till:h.. Va.

of Alderman 'ed rick.
N IMPORTANT GATHERING There were ot:y two petitions pre THEh
A M sented. thoeo of Dr. J. If Colson and
SUty Wh* Had the Welfare of the Edward .A O'Neal, and there names Trai s
k Ost, Fhwe at Heart Congregatad were oerticed asetandidate.. Both arf,. Thin
Me rRepwortofSpecialCommittee goodm 1eml, and our people may feel Busay


L o CAherter, and Were Pleased.
SThe meetlan of eitize'ns at the court
ou0-s Taseday evening, which was
for the purpose of receiving the
4d1 the committee on extended
Igihfte for the oity of Gaine.,fi was
w@A atlseded, many of the most pro-
seitizens and business men be.
j pr"ent.
So meeting waq organiz-d by the
i H of Mayor W. R. Thomas as
am asn,-sand Jefss E. Burns. secre.
S *i. The chairman thanked the
' Oohft for the honor, and proceeded
teaeplain tie purposes of the meet-

Th secretary read the till entitled
"A Bill to be Eatitled An Act Extend-
leg and Enlarging the Territorial Lim-
INand the Powers of the City of
Galnaesville, a Municipal Corporatiou
Organized and Eristing in Alaebus
county, Florida, and Providing fur the
Exerelinag of These Powers.'
This bill, comprising tea sections,
was rat read as a whole, then taken
p'read and adopted by sections. The
Mfl as recommended extends the coar.
poate limits for a dialtanee of one and
s balf miles in each direction from the
esert house square, and ifree to the
sipy Inereased power. It was passed
without opposition, a!' present seem-
l to agree as a unit as to the proper
document.
After the reading and passage of the
bills motion prevailed that the same
be forwarded to the Senator and Rep-
resSatsives from Alaceha county,
with the request to exercise their in.
Ostee in the Legislature in the mat.
ter of having same passed.
The passage of this bill aill mean a
bigthling for Gainesville, since it will
Si"e the municipality greater in.
creased power in the matter of public
Improvements. ete.

If the Baby is Cutting Teeth
Be sore and use that old and well-
tried remedy, Mrs. Winslow's 8ooth-
ag sroup. for children teething. It
aeshes the child. softens the gums,
allay all pals, cures wind culic and is
IM beet remedy for diarrhoea. Twen-
yTa-Ie sent a bottle.


*cemiasatcg 4111666144. 41161erd.
Malt l )e u 4iA~ C ii. Ae


'00Wh t'ai, I aI I .*:1: 4 i -. tnt .
tee'ua W il'. j~ll. I c ,* I i i. ee'
5O~tit~ lie' hie- ('2 ro* a he

'otu MAIN-t A i'i tel I lie' I a.'. ils, 1%'1lIt

lob a "ta a ete'ly cl-1'.re -1 a ti ee~~
fly *9 Abridamluuis i t h the'%,lit I..jaI-.
Abrallmsw5 hetin," s.''tarnleiiug I bme'ea a

am dactleaa')' at raidlinai ell41fa.' l Il
0" bapwnesol toa ~Iil esethalit, v..tjd
'-b o1P ."" A Kneet e v pjoiitinefti that it
iv~trem a (Urvoelk iwurd llwhich rauimns
"A @MsiW"Ng.'beuoiae thle'ukiieslt trag.
4410 WMeftaijbiltted whenl a geisit WMA
~4or gOvenit 14 nfl rs to tiac
bo a~to. The earl i -falit' tzie"astal
Ilbiafly -"t s104'Sklflg "' l1vit.' 'ael a

Sbs like that of it wean key .. .'Ilee
mambqe 11tmait n rea.etloleee Intile lting
bmk. trielb s.teinIt..siunitiofrom
14g a Put. aso lakejraeq-'5.writleis
The oqffts ef mielowlef-1.401141404 aS t~u.ot
11I1pulbse Umm se
"AMuiga hlat erf 1,1`11110 1 rv4 tivud In
nbpm w an aveiutthirmetlt." seaki a
bisman. 'Ibew# was mow that Wa
vVMe ow toward Its writer. rum"p
1W I cesbdm't frad the Simaatil..
MW wead in th body of The "Mle
4dWbut the alguataem w"aIW
I dsst kww b owve' mamy pee.
myv hs wre ite limsly 0eas
Ontsv~ teo write their eoa
ml b5 wrtethat 145mev. I
It isamis from teo" hat ab
owl- aaim for thy may be
Sat ruetrw peepie is

Ma glenN Wito e hig.s.
~mperfectdwSatl mai.sootha
'40-pled .sgy sad t low
.dassomrw 1. am
~tef bb W" e aed

dat I twelve& a bo
IN bislgatue Pis 40wWM
I dkdat he1W I
49df but Itb"iat
de ~pifet ph &--


sure that ini the election of either the
city will have an efBlcientt rtprete'lta-
alite.
The special election will be htid on
the i.Jth itnslt.

In the ntuldlr.esns.
p 'e ui: y l.':,r :t n.l.*I *,f Pna wha t I
i i low .iir I.' I i" l l tI duril' m." or
. . -..... ..


All


A Indge of the lDauhltersof Rebtkha
bas been organized at Palmett(o.
Richard W'arren. a Miami negro, to
held for robbing Chats. \tliward.
Eustis will build brick and cement
sil-%walks in lalnev' of the old uoard
walks.


"liI :,e11 1114, Ii t lau l i' %%' fit)' N..tro wouien and chilIdren iare re-.
i-' t. it erp 'ifth e"'t.11y i vli ft~!'' iiz* rt ivis $1.~ U50 r day for pick ing beais
cIt4 r -tz :4t i ;;111W ith,-a t w e. l l, t : s i -u a t.M:. ( 0
et'aln- tI- I" it h wl vita Iitrele 'lie- w.,.r- 'Thle d rudging ill the barber .,I Key
that' AtIlit''alIx nd ni' itttieat-11 onaii e~est.has ditepejatd the water .1 'aide
in itih lil.etli iteat r. II oei iii' ot' t I o ofiU)fee..
~' mnli amelhet Vr:I r ~ re rr~lii'i: 11-il rorll Mel icken we* t he' ne'a ta kil
*1vlm Tat eihm relhe',avy m af tlaI re'.jem I liiilt- 'A. tC.L. nitar St. litr.tpi rg.
which 1,4 kuim" i ;k,4awnIli#a tle d ebleIQ i~ Moanday a rcet~h 27
i-;ito iuit' !*in Hott fit i w Tainpa cigar, cigarette H I ti rc
lieIbmy'tIIE 4 h: starulls helphjed the i site rna il re1i' .il
:'~?mO'7e~l t I til lit$M.0MUtI26 for the month of Mr.1ia.r.
W ill. Jt 11 i. ri 'tit t h t rq-'. loil
%a .i: f ,'*ill. m~~in~d, il 8, et eriburg merchants ia .'t
thwr -i .1 14 heoa ily, atid II their stores at 6 p. tnt. after .fIrilI l1Ik
~ t' t *e to Novenmber lot. except Sat arIlly'
a. II. .%!0~iP Wi~lam Black anad 1Louis I raiilmani
a111o black, of ltensatiloll, hit%,. et ia'n
Vk areiasu; 4119Old.Age. arrested for making counteriviL (1411i10
A rti mpait 14Ii"a'rii geiui rail 'ahue ii attL M4iami will have a pawn ''v i --t
leel 11401 it %%11ii 111;11nliv'Iihall uch ilt ie'rvt'm to n .a h in id c t s it i
e':irrliaae romellit-4l thatt %-itsaa. l4anhiite he -ona he ii idct~ ht
1, net mea~*r todt~wi te en lln'It- ime'tar withI you put inlally thing19 ou 'll i. '.r gs t
lit% V;,ge ti4tirty M icept every &ty~'. I f iLOt o
1:4- haud Ittuirt-el rI~c,dity of tMe' sciuli bMore tiermaus are' going illa *oweaat
%otat hiitle' iitiilel not do thatRae weauhlPenscl.Wieohrlntttpor
h~im- e' hub with It weak uslkloumilual nitas.Pnaoa ~h~coh' na c t
0111-14, 'A hilhe 'lAiie'lt Ilii jatrt III t'i' ti~e~ ota talk iag about it esspactala is iil rghuoi
Thinl pirtai'il eei-m~titjtiollutcste'rfermith neple'~.
Pt~qitiuidi-tI~"tIn-aihniand with the' acetl~mio gf ieItt e owh .1 ii
oaf thaII'e 1 '%.41. Thepolisna lesr, 'nr h' er si lth
lotm~r eof the' liver is Iesmiet-ie'd, nuti'l i-i ife at Hough's still, near I'it.-amael
to,~laamttlei rv~iilts. :and a rt'tl.nerau wan hiniseif aliatat slid killed 'at lile re.
titue I 1 tzc ime' 111. 'l isit am itiii e' a ezrlte'm sistmag arrest.
e~r. tut ~ .."g'aa ii. alaiie fe'thia The gratid jury in the Unitet i ta
~ll flIv.'1!41-11a 1111tia l iciIu,& I rlht iligI court at Jacksonvia'lle, aftel, it hrve
1.111ttie fl 'are vlcIa 1.41 .1i 1k !.-,p tIl.
uiud ~ ~ ~ ~ 4 .aI.g c T'ei i days' sesiapiim. hies feetitd W itr,..-'l Of
for the April toternitof Coutas in tlie.
,the" Liltie 4Slant. criituiiial docket.


~~ le- I4 I irt Ii -4 111 Pi .
Iiet. I .1 I ooai lit.i v r ftm e'aril Pall
il*on'! 0 aOct,', o aa ele'e Pul Iiet i', 5auM
tiiis'm1 . IhIa-I .1o "a wlcrt e 'enfltilig %%it y.
I% 11 10 woie~ e toi 1411%,1. 14111 li g iiagt 141 t'll
ivelotI I feeK 1.1I e':aliircuif mi'a'se'lt tV)
PaylVta' w14 thoo-i.Ci eil we're' The
I a I I i I.?a I %%Ia a lwtif II e' 11 .'t1 ukld 4'-itml 116
l ie tAwdeaiIl' tite fowet feour antiwan
wIt411 n)I!elt 4 e' litt.efillipint.' I wall as
tuumldietlto tiujd lit-laud W)good a fig

Tv.o 'cerln irica Et ~Dc tei.


a 'r I. ti-eI Im Tr m.a IC



It a t ii1 0 .& i t iiJ~~! se *f 1a.
V' %I ut" %% ,I. .4n 111 he' t it -1 a,.-:
27 14*'*a 7 ,'I'T~e % t t'4Le
s.- a ~- v' a a h*: t...1 ..t.1 t~ ts


Bonfire Results Fatally.
i ta 7* i Orre A jril1 4 A Ite r taill-
I I t(, a 111. 0i 4-f gmasgegnelf and parer.
I at a I. ocnie patcj h no-ar her? hltmet
4,r 1 @'.%ri- I f' nme ias a5J eto-file-ebe
a-4 V 'l E1054"flt n l- mad igfl risii
tt,' vi ~ i Iit- te.f to do-ath Mrrs
.. ago 4 *f#-'W af a rm
. a ee 7 e 9 l ala, 'e' Y111


a., ~ ~ ~ A 1kiel.*~'a


~r- r

Lost Hope Vaneebed
Whes IM&bag ahysit"S a id t0at
W. m Haigh&rt ofiforms. is had ha.
0egW e"emptboo hbis 16e4 hlp.as-
MIebed-.but Dr.- K I r,'@s-% 0w D6110e1091
far 08m0e8p64oe. co -A 4es ad"mid
be" binman t ofbwgrave. He 5me:
"?%" wagospmeo*e eompletSw emi
aw, amd ed Imy 19Mom m I
a" is ow eev10 "On. a" me
sit *a smwohevsunm emad 1m
am 1fm rswilsa em pow
ON eieos. 4 ar nieeass .
86!w = S a II d m 86 *
IMall 4".


The fishing itiditl ry at W ,.. | I':|i
Beach has paid ouit during the. ls.t
twelve months i ver thirteen tlhimitaid
dollar' for fish alone. artd uver sis
thousand for labor.
The Melbourne Tinm'v was twelve
year. old nn Saturday., mot was sop full
of advertising and lbusities hat at
barely had time toI m.l'tiana the fart
WV wish it many nmor. 3)'ars of .rio.-
perity


The fullowiug F b11rida post mastcrip
h av twe be.,,ppoaunted :Wil'smSIUI. 011
I 81iAcland: llatich,.itk. Swift., Rock-
wood ;Siemon C I)P.l?, 4lehea; Mary
M, Woodeso. Alsipattah Robet I 1
Smith. ('art-away; fl(m. %i. Kom,.er.
Cotiolry ,'71 in$$ ,A IMeCallum. lb,.
mee; Joselph W Ilhire-et, E.iarboe; Miroto
4i Mille, Fairvie'w. Jese.W. Amisrews.
flarawny ,HIenry AlFisher. Holt.

Frightful Suffering Rellevd
Suffering frightfuilly from thelpiroa.
lost poisons of uumdisosted fNO. C. (i
Oraymom of Liala. M too, took Dr. King'*
biew Life P'ills, "with the- results,"'he
write..**that I was ceared All own.
ash and how. I disatedrr. give way so
their kwie, laxativie proqwrtlees. Soas
all drugl stores, guarastitre


wu .%tia~'t LIII I, *. Jgab
toeth Us~lt tor 1-1, .,7'. SIUUW JOIN
DO I .'a14"Ye J.11 1. a~. *71W. lis
Msaws am .tro'tt.'io- .. i tom l art",
than a small uiro- N'.'I i(1it10 lie 06
tsa Wiring fross..ino t et t IAllhEM Obo
tt SMmethat tU)will i act dble 1W
j#WsdWs'saws %111 11.0,eDed tsrw

JJ, -. ~ '1o


haft NWbkkU W NM


Alt Week Eiuarat"A "eetOefMg-




ja. W~-. ATN


U IS =-a----- S


POMP .A000646to hAleimmegd.


VS FRM AIL

PARTS OF FLOIDA

Happenings Frm Various
Sections of Sate.

MOST IMPORTANT EVENTS

piriingn "The Land of Flowers."
gsa "**1odd Down" to Suit the
Seader---Items of Interest to
aausesa.


on.


A man works to
live. He must live

to work.

1 e does both

better on

Uneeda Biscuit,

the soda cracker

that contains in the

most properly bal-

anced proportions

a greater amount

of nutriment than

any food made

from flour.




Uneeda


Biscuit


NATIONAL BISCUIT COMMIT







.r k


.. PTZTClc


LIST..


EUREKA WINE & LIQUOR CO


THE 44AT hel I1HF:K NAIL
P.2 PitUI1S5PREPAIDO.


15540..'?I a 1'r sto 50,e. ;b
Hlsaun 1aet'1.0'e'0 Ubbhor
9 CAzo W A'a~frdt
WaeftaN C 1'aeSk bsewil
ON 11P.i'Cowsm~


x CAMS. Ca
CE w X -1


ORO)I SOU06LV~


pull ~lua Meam,


rue laee


li iN



'as


jib


~ en
a em
S
I 15
a,
* ci,
* .5
Cs
45
a ee.
tie
Sb.
lb.
4b
5?S
a is
em
AS
015


INe
an
ON *

falli
to

so

SI't
#


wins Fems "."to 9ss~ wl uaseMA, msL
ft" or ue "s iehe w b-e 5i.e I s# l* ob 0 WOWs buab tIe.
Tb~la =b a 0 wt 0a 0.4.60 O*b e "S b'e sm a We

amw NW V mrgad Ida#.l pg~ Sev f St jq om0O%7
jo pemo e.sdbr .wes dde W~bs

11335* wiSE ta Lqli3 Cegfane
No wOrr SIDA T allow. *Aw~inMt-4 &


- ww.u.~E~~


WOO I- W IM 6 O- a-am$ o memo


~Yi~

~.'
I
~ a'-'
I.A~


J_


Food to work
on is food to live


m


m


T ,ll


I











or Thi Afti m .
BISHOP WEED TO OFFICIATE
The Ceremonies WlieSB Held Under
His Direction Sabbath -chool
Teachers and Saoltrs WtI Asslat-
Several Mlnulel.xpeCtsd.
The ImplspteritleesM of layleg the
0o0 ; e@f hT e elegant new Holy
Triall il seI l hUmh bolding will
be bNi4 ih t leroees at 4:80 6'elnek,
ai to se mdbl to0 add that is will be
aOft g well attoaded,and one
l Mt e tlonta In the memory of
l no and these who wit-
Its. Rev. Blkop E. 0. Wed of
*| DVeeM of Florida, wish bdWqe-r.
wJllJI oeto
IM 116 NabseOavale. will o611s81 ,
tbktoh the prielpal slk. Sl qep
Weed is a *elmoNst ad pleesiag
speaker. asd tShee is deobt bet
that the iamprieptih tual of 6t0K pi.-
osap ohrch, lspoawily del ged for
sosiMt of @ is .l&4ttwll a be erred
O st -aaniter w-i *wtll prove l-
to l Mleg P who hea w Ih.
ho ->ag i i elaI silll be joined by
(fth* tbeelriqM4l of Boly Trinity,
14111w l SN OWite S OMthe sremonles.
g 1qim 1f Will eMprise reading.
SMiJ lI, ot., lIaddltlon to the
1 Ni eof Btisho Weed.
Seeas 8M m lmtOts within eay -
f of Oaikeillte have been extended
1 (toetdoiot 6 be pretis, and bev.
1PaMef 81. Orsighll eUpess a number
of them to speed. It is qalte certain
t, a bom er will be here, whish wUl
Imake ke renmelies all the more lim
The noew Holy Trinity shuarh .1 be
wm' 1 **opleled one of the hiaddeomst
4' osles In the State. The building,
whibh Is loseted ast te corner of Est
IMato ad t MMasol stretse, will bb
astrused of the ptastn Me srrell
tne. l Imitaton of grnulto and said
to be equally as durable. The church
will have a seating esapity of about
300, and will be a modern upwto-dlt
bulidiag ia every way, and one of
whik the eeogregation and oity may
well feel proud.
Holy Trinity Sunday.school.
The te shers and sheolars of the
S tbve school are urgently reqousted to
assemble st the eurebh au Toesdayy
afternoon at 4 o'eloek promptly, to
sa I part Ili the ereony of laying
S the *orsr.stoae of the new ehureb.
V. Pniasovy BULLocK,
Superinatenad*u.


CASTOR IA



m A. o
THE NEWS FROM ALACHUA.
. Notes of Interest Fre n That Thriving
Bur--Personl Acntion.
Alashes. April N -Mrs J. C. their,
ile san little danuhter. Kathleena.,
hed to Alashna this week to make
thiltheir fUtur home. Mr. ltheridge
belap eaBte&d here in the real estate
.Iygaatof Wiud.or. ;;s, the
Iga e toe Mr. (. K, Itams, oame
h -is wek.
Mr', A. Joheson. the g.nial aud
bala g aest of the 14. A. 1..
ab ti|ll a bli hi. huuse in \\'rt
0 A. ViA ad wife are of tou
, s p a f lwday wi(h Mr.
WMJ.M' he|lVTboInaS WiiBams.


SJ.. 0. lb frmerly of this
S pu, bets ew d alkeo City. was1 1,
toWe we a feow day thhi Sgek
,. .LdeW. d thelbirof illiame
& ~0.is Stw day is Jack ,onille
thos eek.
The bel tr ad iashory for the i'.
plat e a W pleased Is rositiow,
ard toe we*kb to rapidly pr wm" i
J. 0 ithboi, wer real estate
ask hapetihaged of J. 0. SheIrlid
100a"resI a ad eNA the 0 we"side of
Sewi. and wil Smm s O t a0
eleartg sad easing sweat N ae O
tftt f^ MNIt -y -f -
PpfMSptory Iet saliNg t ped
F. .if. dftry, MbtA 1do Ala-
ehu tem ak. was In iGa1t this
week.
W. L. MiU ld he Meo Le le-r
S ens Company -- eesmsme ham a
b.slaws trip-eo Save ak.


U'


The lamentor of the fb s "T"it.
BELL 8B0RAP. a nw m owi *uher.
ever plows a*S lM aisd wed, ay*:

"1 hve used4 M1 .S LMOW
EUXCtI fer is r S 'ese teI m
rfasf tor StS Wtesaeb. tfr ad kM-
meos. a" dNoistogbso eeI elt
ksh ame N M 2 t ie e we se 1m-
S iuefe I "I "le mee mieM d t t
eluuta tewM k woha-
.. AiMs N e a


OZLITS i,0l ELIII.


TWUtN MSVENT

IS VERY HEAVY

ine Catrload of Litmo. hewed
from this Ictlow "nday.
FIRST SHIPMENT QF OUKES
They Were Consigned from Bushnell
by Winston & Lewis to New York
Markets, and Will No Doubt Bring
Fine Prices-Other Movements.
The movement of vegetables from
the line of the Gsaletedlle and (ulf
railway, which Itrveroes one of she
most fertile seotious of Florids. has
begun in earnest, and many carloads
-oh week f#0 the mueia few months
will be moved,
The (ialTeevilll and Uulf Monday
handled ei solid earlas&d qf divenified
products from the sestion south of
Galineville, all of which were trane-
ferred to 4 t Seaboard Air Line at this
polnt, bleg sonsilued to Lasters mar-
keIt, Wbhiloihe oonsioamense were
diverslSed, the bulk of the shipments
were pl, beast adn lettuce. Oaeum.
ber are Ju soimuing o maturity, and
will be ready for shipment within the
neat week. -I
The rest shipment of enoumbers to
les the St we e was from Bushnell
M)odday, and were* *ooei*ed by Wins.
ton & Lewis, extensive truckers, to .
A 0. Lipmes, oommieiou merbhnte,
New York, for whom W. F. Buehanan
tr the representatie in this seetion.
Tbhe ckes were fne, tally maured and
handsome, and will so doubt brieg
ine prices, sinop they willh e irltally
the fleet in the Northers market.*
Mr. HBiehbasn, who has just returned
from the (la 0setione, states that
fIeterling Bre.. the sitentive melon
planters qf Martin, hTaver stand of
one hundred oarev of santaloopes in
full tloom, asd will probably be the
earliest shippers in the State. This
firm expects to make the ftint hip-
meat May X). Mr. Boebanae thinks
they hav calculated a little early, but
believes they wilb be enabled to ship
by May s. This will ti several daye
in advance of prvviuus records, and if
tho mrelons are shipped into bthe mar
ket at that time. and are fully ma.
tured and ripe, they will brine good
pir.el',
The movement of lettuce from thls
sNction is hebvy ai this seson. The
ag!rgate *hlpmuiht yste-rday ecm-
pristd nine ears The majority of the
product went to astern markets.


DR. CARTER MARRIED.
Was United in Mrria to Miss idlu
"t S"ndIey Evening.
The numerous friends of lrt. Clyde
I.. 'srter of this city, who hM just
ratidusted from the Atlafta Medical
Collen, will be surprised to lears of
his marriage in Atlanta Sunday to
Mi-0 Idla Hall, a eharmingl ylms
ladyuf We r 1%i'ut, Si.
MIr aod Mrsn Orftr espet to arrive
in tai avlil today, wae Wiley will
'* SITre. a royal w**eme by the
Sro om's p arnt ed friends
The Sum esrateads etngratulatiols.
IBtten by a Deg.
%I a late h,,ur lateladay afterse"o a
.u ,,f M r *ud N Ir H P I ke. .t
siftlsnvill. had the misfones to be
battoe by a dug s the bnesigbelb d.
White the wouad not me l@aed
*to. It it s very painful. and ie h
will le laid op seai teoaveasaiead
a few da)*


*1


i Eading of Church Festival
W hc Cost Xan His Life.
FELL OUT WITH WOMAN
Alex Jatmnen Had Misunderstanding
With Wsterof LoRoy. Jones, When
Brother Rtesnted-Friends Into *
ferried, butohnson Wastater Killed.
CleformatUoo has reaehed this city of
a killing at aolored ehoreh festival in
the At. Jomph neighborhood, near
reber, nla which Ales Johanon lost
bhis lie, having been shots in the back
of the head by LeRoy JoBes. |
From the particulars which could be
learned, I appears that Joan and a
laser of Johason, both of whom were
attendiaglthe festival, had a quarrel.
when Jones used some abusive lan-
guage towards her, it is said coming
her. Naturally JohMnso, who was soo
present. reeled the insult to his sis-
ter, and be and Jones began to fight.
they were tparated by friends how.
ver. and It was thought that all wae
over, weli it is said that Jones ***
sared a piesol, and at a late hour, a
Johason was leavios the pleel, led
tl hil, the ball taking *fest I the
bdek of the head. Death ws aInstast-
neon.
There wm a larxe crowd at the fe-
tival. and thins went smoothly until
this fibs eand subsequent tragedy o-
eurred, whisk resulted in a general
seene of aaimatlon and exeltement.
Jones. who did the killing, is a reel.
dent of Long Pond. this county. He
has always bIen regarded as a peeae-
able, law-abldlag man, and tshes who
knew hil( were surprised at his actlon.
He made his esepe. and up to this
time hs not been oaptred.
A Dare-Devil Ride
Often results In a sad aeoideat. To
heal aeeidental injuries, use BieehklenJ
Araies 8tlve. "A deep woumd It my
foot, from an aseldent," writes Theo-
dore huehole of Columbus, 0., "caused
me* gret pain. Physoilans were help.
lees, but Baeklena' Araes Salve quiok-
ly healed It." tPomthes and bells burns
like mallie. 2e at all druggists.

Impertanr t Dt 's.cn Pendered.
Monlt3l r i Y. i : r:l 4 -The i'
Ilreti coil hu l i. lit't < own lh th lol
lowitil F!,*( .1'm F.re ini itraner for.
fIltirno r i' ,l(-y ,iy takil l aiddJflonal
n! ran' 'without content, if th" In.
nuri(d In a fire Insurase. ro(mpany if.
f(rti allti>nal Inuranre' on the i n.
siured property> )n iolat lon of an *x
pre'ps.d condition In the policy, with.
ouit l('turiang the written m Oonsent of
the inmlurtr. nM rtqulredj this constl.
tlltt a breach of the condlMon. and op.
f ratei a forf ltnirr of the polty and
this r ndorlng it void, unless nptch
furfeltiture is waited."


T. F. TIIEAS


UllUM;ItdlIIgbUl


FULL LINE OF
NEW GOODS.

Pereal attelUs to all meters to
this libe. 3aU aMi Itspaph er4mev
pnoptly aUtesid to.


Gainevitle, . Florida

R. McCLELLAN

Undertaig Co.
OAI81UVILLB. ILOSIDA.

Funeral Direors and
mLicensed Embalmer&


ON" m... i -IN am
a" Bftm VIa^WyJ^^^b ma I


I


, .'


1- -r - m
Promoiss DepwaionCer~uI-


opka.I,,h r)rawral.


6 -0 1


Apetwi 3emdy for Conlipa-
Won, Sour Skolfh. DiKu1Ii
ftwAnu Aouulom.Fewrash-
reas mid Loss oir Swsaz.
in&" bSitnaturof
~w ~. %V% --


u~W7 @W1Y 01 WNAMe~


&


,Thekmd You Hay


Beus the


of


Use


For Over


Thirty Years


!ICASTORIA
v.- mw. .,-.inm


Phillips,


S110 West Mai St. N.,


AId they will send a reprosemtativo with
saIlpt of Wall Paper, Palts, Ete.,
vwho will glv you am intimate on ay
flrtd4lass work you khave to b donts


Sternberger & Phillips,

Artistic Paper Hangers and Decorators.


I


WITHOUT HESITANCY
ladorn


M


ark Rogers Whisk(
a the limit of perfetiea is dtillint R>eh. mellow aWd
seamb. ia sPleeae U* palats of many u*enr. Will pleas
uuse as first pporlealy. whicb we Ivite ea So osake.


Obkl Houm la Room,


I


By0


a- aIAdvertise in THE SON


V.~ ,


LL~..:


BisP A POSTAL CARD TO


bk


I


pwmmmmm I


~L


I


i


it:.


. -4-'


0Q1


- --v-;~----













~'r~' t.. e,
.1


r TRINITY

:.. t "u reu da y Aftrnoon Well
A mded and Impressiva.

WERiE ADDRESSED BY DR. WEED

There Was a Large Crowd Present,
Those in Attendance Being Treated
to an impressive Program-Congre-
gation and Sunday School Present.
The laying of tlihe eorner-stone of t0e
sew Holy Trinity church of this city
took place at 4:40 Tuesday afternoon,
and there was a large attendance of
members and friends of the society to
witness the ceremonies.
At the hour appointed the prooee-
sion formed at the old church and pro-
eeeded to the new ediflee, headed by
Rev. C. D. Frankel, followed by Bish-
op Weed and Rector Craighill. the
choir immediately following. As they
reached the grounds P alm exzl was
repeated, and the regular eorner-
es oe eeremomie were performed, the
stone bearing the words "Holy Trinity.
1906," also a eros.
After a short prayer the list of de.
posite contained in the stone was read
* as follows:
History of the Parish by Mis Mar-
. pgre 'ebeaou.
S Alist of the vestry committee and
S parochial ergaisantion.
List of contributors to building fund.
Ourreat copies of The Daily Sun and
Weekly 8tar.
Copy of the service used in laying
4ornar4tone.
Journal of the last Diocesan eonven-
tie.
Photographs of interior and exterior
of the old choreh.
Catalogue of East Florida Semilary.
Aaciet conle found In a Florida pho..
phate mine, contributed by Dr. B. P.
Rlesards.
Presmed flowers from the Holy Land,
contributed by Mrs. J. N. Strobbar.
Confederate bill and lines upon the
same, contributed by Mrs. N. D. Phil.
lips.
Photograph of Rev. B. F. Matran,
D. D who initiated the movement for
the new chnrchb.
After the box had been laid in its
place, the choir sang bymn 3,. "Oh
Thpu. in whom alone is found," ete..
after whish Bishop Weed delivered a
very interesting dedicatory address.
which was followed by another hymn
and an offertory.
The clergy and officers walked around
the walls and the service was closed
with a hymn and the benediction
The pastors of the other ehorcher in
the aity were present and thlie service
was impressive throughout.
Cheated Death.
Kidney trouble oftes ends fatally.
but by eboosiag the right medicine E.
H. Wolfe of Bear (irove, Iows. cheated
death. He aye: "Two years ago I
had kMidney trouble, which eased me
great paia, safering and axiet.y, but
I setook Electric Bitten, which elected
a emplete cures. I have also found
he of great benelt la ienirml de-
Wity and nerve trouble, ad keep
haem oiantsly on hand. since, as I
4Sd they have no eqoal" All drug-
lste garaMtee them at 60s.

Or. GaeilU l WIN Setrn.
A ie4r froI Dr. 0. Golden. dated
4.elss. April 4. bear the iafonsiaon
hat fth Daer will rame- here Os the
aftrsem of the 6th. anid ay be found
a the Brow Ha foe three e or four
The Dec1or is partial to Oinesville.


dpbeaseheay Is te beslow NOcdiI

6m n Sle kern alwaft.
ow 4"em "no" redo sh empaaala.
ediep W, Ie a As eestme
Ua will be remuere~wd A" Use Do@.
as rmsl bnbellan541 *hess
homemi akeGsinssville his Vhmled


~eoletOva Humimnd Delia. I.
moed for '- as iae-thtm
mtbe cured by Nell' s (heeshCon..
F I Cmsum a Co. Idede. (K

amoselfor theA" is yeaw. OWe-4


oil sm~yelai ~~nm


"Mup mod
to O 4 m Ia


THE GAINESVILLE SUN: APR II li.:


UP1


IT f';:'s something the mat-
the lhild that falsk
S L;\\ up. A child that
S.. p too much, ho\\c-cr,
o t uIo, t proper filling out of
II.'h, is almost as badly off.
Nothing will help these pale,
t'.in "weedy" children like
Scott's Emulsion. It supplies
the rounding out of flesh and
the rich inward nourishment
of blood an4 vita! organs
which insures rapid growth a
healthy and uniform develop-
ment.

THE NEWS FROM ARCHI.I'.
Machinery for Foundry and PAachoie
Shop Arriving-Other Notes.
Archer. April 4 -Mrs. M iDePas
and sisters made a visit to Mr. C. C
Dorman at Oedar Key last week, re-.
turning on Sunday morning.
Miss Dora Smith. who spent last
weekvisiting Miss BeeNie Smith at Dut.
too. has returned to Archer.
Mrs. Waddell haa returned to her
home at Marietta. a ., after a pleas.
ant visit here. She made many friends
here, who will be glad to wpleome her
return.
Mrs. J. H. Toeker of Live Oak. is vie-
itiag her parents, Mr. and Mrs. C W.
Bauknight. Her husband, Joel H.
Tucker, spent the Sabbath here.
Mrs. Irwin has returned from Dun-
nellon. where bhe has been visiting her
husband. Mr. Irwin.
Little Lueile Osborn, who has been
very ill at the hotel. is slowly improve.
lag.
Rev. Mr. Roseborough. the Synod.
ieal Evangelist. will begin a revival
meeting at the Presbyterian church
tonight.
W. H. Powell was on the sick list
last week, but is o. k. on his regular
trip this week.
Mr. and Mrs. Wood. former midents
of Archer, after spending the wintersat
St. Peterebarg, are expected here on
Monday eveninag. Their daughter, Mrs.
W. B. Pine of Jaoksonville, is expected
quite suon.
Two carloads of machinery for the
foundry and machine shop have ar.
rived, and the frame of the building Is
up. Dave Taylor and Lewls Deysm.
pert expect to have everything In shape
for Mr. Masldos, the proprietor, by
May let.
Alex Johnson was shot and instantly
killed by Ler-.yJ onee at a nearo feet.
val on Saturn.a night. Jones nes ped.
All colored.
Our poetmietres., Miss Miai*e Samve.
ly, is viWOag is Jaekeeville this week.
J. B. MgDeaold has ehare of the leee
is her absence.
Mr. and Mn. Liatoe Osbewo have re-
turned freo a delibgtful trip to Obas .
SABSATH SOHtOL PROGRAM.
Twenty.Seaekd AsMvereery of La-

Thb tweatyFoMmd aleenieary of
the folding of tIe leOMese iBaptst
iaMay aheei wae held i ab Male
ehorek at LaCr leday asteie .
and wa largely attenedd fro eery
section Is t-at votiity, -- Of wa
have been regular atteodaas feor maui
years
The meeting wa presided oer by
Captain II C Parker. eperiteee st
and founder of te heel, ad whe le
not maised a desert en a of -he
school in the swety-tue yean is ie
ben sn *i s iteot Te hesiMl it a
freat :.ride of the Capta( as welt
eboull be. frr sit Iae wed a a*rma


The psiagrm am SPMWsem istat15.
satsinglterary @ad VeWlsel ubm.e

L p titugor of Apmpa, ftrJ- L VAI
WIM pndrof "0"*M. 'I.145hof shi
oft. ami prof JC .Adkw soiuswch~.
The fternonw I &paw~ed Is a m1
hm"W ~prve~et Ce ci il
sowg balem of the wmamo
dbV. wbwebvusechaabs Mon
CIA ernd eve.NabIsela ON

fine, ad b w" wasee so AO mis.
oed eis go &won of d


COTTON .OSIPANY

Uk A. BIGDEAL

"dInternts of Hiller &

P* Xien ofPhosphate.
A' MTER Of A MILLION

Suppsedto Nave Been Pi o hs

Counties, and Are Ainot'g the Richest
Phost hate Lands in the State.
The Duttumi I'twspitatt t'o~lpauty W
this city, wito for ,teirrl yt-are etijoyed
the distinction of beitmiv this lar~grot
miner-s of phosphate in I kinida, it unot
Iin thue wtirid, has just xAddd another
Quarter -, a millausa dollar i to itas iu.
aterrsts. havicig pureksl Iixir hevtitiro
phosphate iwe~rosta.le, m''i1mg Wlluis.
Winiors sld machinery. fro'm Eldsarc
laitler A ('ktnimanI of 0eat%,%~i
terests an situated in Ithe coutai~i.vit i
Marion., Citrus and HoriiiimadoI. IIIKIthe.
lauds aret said to be ver) ricli tit phet*.
phase de'pesits.
W61ble the price paid f.'r tliesw 'vaot
Interests is not divullged. it to lielievo*ei
to hoi' III the ueighborbhIif $11oil
Hiler & Company werr'e totivau igisi-
morous miunes, aIndeside-P o"irdi no arij
threat of valuable puuiahl-latt land.
Kdward Miller of Ovalas lgradit( 0. r
firm of Hiller & (oulliail,, will 041110,
out his Interests &no r. aito'iv oh1i~r.
nuitihana, Aa



Every

HleartuAche
Every pain In the breast, dif-
ficult breathing, paulpitatatin,
fluttering or dizzy :,pell rnieani
thait your heart is St raining it-
self if% its effort t- kevp in
moit ionl. This is dlm igt-roali.
Sonic stidden gtraiii fr nmi er-
exertion or exciltrn1iet %% 11
C0oniplt-etly exhaust i lie iierv~,,

or rupture til- wall-, or art critvS
of the heart. andl it will t'p.
Relieve thlis4tvrrililc strai~n at
once with l)r. Milt-A' hle-irt
Cure. It it.i~ioratc-4 and
strenglhenqt the heart tirt v%
and imnti-cies, irantlatc-. the
heart act ion, anid relic~v,; ftle
pain and iniserr* .
Take no ehlanct e;M; iuk r irm
heart strnng awul vigoroti ith
Dr. Milra'][cart Cure.
"i Duff Ir.,irrit.iv With hrnvl d'.-e
difffcre'lt pvwtalelan for m iui
,ai l0tit r~su iw I wet10a)t.. ,%.
e(Intf In Memphis. Wpcialo 1
I hjtd droppy of' th:" Irrt. If"I -.t
the. U1"1
Wilhli M rIn* be, mieasopr irt nI.
Ing a finish of me a Ua: to1bcf.'ia
t I r it Y,, a. 4 ft La.sI.
In our town. liftsewo msllf
and rocom 4-td4 Dr. M 1s i.Irtt
Cure Itom=Ig in'.Ism 8t1e atte'lI'n
r sail my rfthara fre'am i..1i0,
ceinclude.4 to ty t, Pi. e" .4
to msy throw. bofii..
CIIANkI sKIf I


Iaus,' worubt NtI ec9mb a fole'.
of "silbeu~'l. 11a. gIlift. #I"I'm e a

1#8#PWbrnma Ivc*, ~ .
any urfe'anol I fl, atgb"u" sib) Ve
doom Of juti f *II..'#i* l$@avo


CH A R 1ES Co SPAITH.




saws

.1120soa


.AKE THIS

BOOK


UinAkci R S LIVERAD loOl)"
1iri u i ... 1n-4 1. C.. of aind H 145r'mta a ktin m ii, 1 :
w i MtI'xit I .ri i n 1 n. %ii ni, s.,,,it ,i- Trourw .I and Io eerbI 414M_ in
tiriorlstn in 111 11 ,. i ri.< liv~sr tnlhal rr t o- oni and *R
'"utlr p l; i- 1 ' i ,' ,eli r' ,,
tIaw, your f>i t% i inih i o I r. kIe i thoir *II T t aerp io
:tiritit t e I l ior i ke' r i lie n t o, fo.at
d ie t w r L1 1 i11 .% t tl mea. ...ti list p s b h e o pali>s I i.i t ti ll t In I t eIf.- o I,.uiii, lto Itit. hhiia.le We80l62
riam e, psu n"ik '-ri tIi. ilr ii i. w titi r .. o- I.'o i.it ea h*
lri mll.v or l . i' *ii ni .i r, r i naet. neem, vBlta
poe a n, d h C -t in< 111,i itai11. f li 1 o.. im tiii.ettiito ) nl letatg ue-.h
an _- o olelN IIme k iin ii it & i. 'r1OiQ- i iiitolii

Um gltr d enyo Ala 411 no n l.a no r U nti!
g he tfntnwa tu t .ne m |.| i I I...m ,1s.... atmin (. I>r. Fba.ubee




& Ma akr -MMT Ari., r .e w l. v tis iuil.lislyml. Ivd as th
p and rI0 Theh re HItusth ik, wstl ioniil.Piperion, lere fo tr Ihe
an( tIoNdy rIgg rl l It e a e lr **i gmd shith per sl *the
T rt MtDICINE CO, CtATTANOOA. T3IOo.


TIE FEET OF ALL
WELL DRESSED MEN
J t .) res o' t thi.inr preion, a nd they are as
ii Irfal ii rleo'tasig thir 'hue as they

a re s pi>hillar With lass tdlisus people.
[ They require Ilti Ieir fritowellr that
'onrtui Sli ln i of l yle, and r'mfort for
whi h eli r lShows are soi Justly famous.
u ar lier of I ew nbheee rannet he es
i o lied ler 91allty 1ad Prlre. Try as.

1Lo i. L 1n iU li o Squip
GIAIN WVII.LI, FLOBISA.


Gainesville Foundry and machine Works.

Iroan snid BrHas 'ameint l.oi onimotive slid Ilinelmaiery reipirs We soguitaltese
I i s d work itmil p'iompt ldelivery at rseascoia le Il .roe1* I.-oc'ated i
m tlu h (ih I i aicer Il i S. A. 1. sa d I .A Ii iailrooals

Establlhed In 81.

The Oldest Whiskey House in Georgia
01.0 NABRF WILLIAMS
tituarantoed X years old. HI the
gallon u 8.(). 4 fill querse .51.
I XPNIICM PRPWAIN
691111. J .ll. J. (0LEMAN IT
(tuarantsetl eare ld. By the
gallon i J 76 4 full quarter .10.
6:1X1 PRKI9N PSIPAID


I-'


ANVIL NVi
gtallioic12 641.


4 ;yar old. Hy the
4 full quarts b3.79.
IXPR315u PSIPAID


NY the' nalluam 12 A 4 full uuarf


OLD 9MwIT M (as
Ouaranteed year old By the gali$on 3 $31 4 fill quarts 01.1.

OLD POISTE CLUB (VMU
oaranteod 4 years old. By the gallon 9. hi 4 full q fs03To.
We handle all th. leading bsdlof Kyeand Bourtios Whiskb et IShe m.
hkt and will Save you 9O per aH- yoar purchases. Med for prise Ilst ad
catalog"ue Mailed fe to o appltion
THE ALTMAYER & FLATAU LIQUOR COMPANY,
S.6M4 .1- 19 l luaTBSW. *AtCGS, UImm .


- ..---- -r


YOUR


MONEY BACK


--If the (IoodA Ikxn't Huit.

THAT IS OUR MOTTO AND WE LIVE UP TO IT.
---


Rpmosktoy
irSj <.AI.
Copper I >istilled..$1 .*
QuOwn City ....... oo
Sunny kuth.. :
(P dit I gr . . :4 *K
Overh . 4 INO


Sir WMu~p


N. c. 1H9ter. .. &
N. ( rim.
Laurel Vally....


WE HAVE T WRITI

WE HAV9K (HWI4 WRITEU Z&


J. J. WILI. A


I


. ?.


r b~i!






1.T


[LLS SUN: APRIL 6,


N.


w -do&


mShem~


N.3.1
7-


ianhbu'r.

$1 g ear; .six
m ^MgeM .


I. r~mum ri ~bsp m
I-"mbll l
IMW os h1"Mthr 1UMMt l
Iwouhldbe JeetIW W spa@s
0Sawroeds a0 empb to the
hem bd e. W OO"


lwisheonesam l day- Is
_nilhae 19


Ui. e wonder to so etrsnger
:,W 1 deliabtfOl lake that
o y line from Gaimes-
its gM blansiiug spot. or at
s6 *lM tasfriage road.
FLOOIDA LEGISLATURE.
Usder tb *obove beading The St. Au.
illm Re0sewd has the following Wer-
dhlettele: I
"It doms to be a eaus1mn0op0
m s0 o speak sligthtlNly the
psfit legislaWon sad the datls they
Iv to0 pbfser. oehe a thing is 1s
be egrewed. ala"oe the effees esaot
btt be ba .l the rising Peom
tsim who bem idy taking a kee la-
WMest In ey*qbhiop that peraIlis to
tet welf of one of the grefIt
Ste"i a Ubslon.
"The aotmg seieon will be of great
lmportam, 6lM many weighty mat-
om ,, a be brought up for eoal


Don't


00*~S *aV sl.wr so eMe o l tinDe m Mailes. The election of a United
W WM nobeOW I bs iSa lte mat iet will be only a matter of
lowIT"14 T hem W 11,0fort.m.#ln f Oshoie of Hoe. Je. P.
o o M M oss. a mot i. Talisferre was made by primary.
HThe nt of the I4* 14-."A very Imprant item* will be that
1 remn td the deg tof4k relating seo edoeational matters. LUntil you ha
Joe 1 V0 -tJ do th$ I fb e bTbepos nothien of more vital intent
we are now r
kighwa, een M of the &ad under the noew regime it will be we re OW
...,,.., IliO ea~**Mrs Sts# 4t r1.. 4TM T04fc -goie everys00ederationo. the largest st
JljlBP^4 fgetal 0mtol06 of a iN tiMoa or mote* "Of eouns thbe Everglade will come
Sof a v eme p lo pinse la the sede4t of nla for oeedderable astsetioe, sines
iAkt@AIe lday. Borytthlg Iis sertld Governour Broward his made special
I 0i0n 1 dpr S aeOMap thes6 gh16 na1 s lDvltltes of conditions and is an
ai*ke "aisatit. MnN *pNWd, multe with slhenl(iW ttetksn*adit oseramne dvsoae of the drainage
r"II a kee p e- --.t-11. t9 thf0te 101me0a41 (be Rood rod osbceme, whereby it is proposed to re- r
. moOnt. deem from wasM thousands of eres of
A w a W"a"m$IW to tell "over The Interests l.veld i n dswed ria farm"e law "
0l0."ie H weser tiwho I-a* noflroftr iltmagetede,atndAm0l1 The people who make suheb remarks
he Iit. stallang from them woald be far* often dol is sawltsingly, and take the
r emeeleg. The qasiem dould eson- habh from e numerous item tht% As well as ti
i es, who are m ovi for mend a sreful s1oeMeatln of all the appear In the papers regarding the A or t
te *oitlveoly isl modest *OM P" ashtIons of our State as well as national
S **a Oaim. NlWmAN's LAK. lawmakers.._ essentials to
II tleM tory Ameres girl While the* so hern portion of the INTERSTATE COMMERCE.
a sM eSo of mt r better% M e *auntoto p Ortwe of the lohy .
ag4MyOlN ems ake safe of her. lake and river sisal there bound. Wbhle Preident Roosvelt has
ot a word is mentioned of beautiful started in to roorganis the Panama
Ala w a sM .. d wr er I whenIt will be necessary for him to
4 '1 41y, otop. d shel nest and mwase leevill*. and no words "an do is ] I
1, 1wawd i ihIqd. O, the witeb! s* jtlee for it iso spot thiA should he CroEaiBse the lnerstate bommeore
Somade the mot charming in the on- mmiio. It may mnt be advisable
to do that before the passage of wome
aisr Wilhelm bas taken another trl. All along Its chors are high to do timl n beforin the paseIn of some
W iq ad" poe that She tll w bank% overed with shade trees of i e ins the GAIN
l Issgettlg Ie.eral sehdesellower. rly every variety found In Florida, Membership and powers of the com-
lalloh dlr. Eeond mel ^olA*1, psiw "mission as a pJ ^,l.ponry to more ef.
Including eand magnoluas. palmesa
Gea. Ume*lt1h 4eem that the **. to*, oaks and gum tree, and in many Indiselssi ate l question.The Wall
plans beautiful *dads. The woods uin ths qution The Wall
s --I he. "Gt a1ins1it "Rustila.n 'Srt t Journal ofKe.. Yolrk sas that
vale-" A m tm f spriting, is maIp ple re very trop d a e e Commere Commiion, a
moe romantic spot would be bhardni to antestate commn re Cemmisson, %o
lad al present eonstituted, doe pot oom- *
No. FiedeiNe W, hasl ben Thr e ake o miI w. d mend the measure uf coaldesee which
e l.eted pes.et the National m. The lake is about d miles wide sre is***.tal if it i to be put in po.
M ht Nter,. she hIsfrom New t ase ilea sn ay I to fIead lar e s sion of power to regulate railway
Ta"h lid 1s p elildrem. She hbO a sta" ra-. There are men of stilimt and
XMSholisa ita 1 0m .. . *_ lusra ter on th lntorstate Corn- For Y
..- OP A TIN AVNIMK mornei Cominission, and we would not
The adr4 ell truss has paid a fine ---- pk with drpr'eeatlon of anyone of
t$|1061 a Keastuekyeern. The'res UrrERIfffE MrOU VKLtEY i personally," h" as a boty they
1M1iag half-wy a1 t those E. Ke. q--='-n do nut posse that distiotiun which .II. u
tMMlas. When they tart In tooriP- She W- M Thwenoa Me Opin s Was pi"lbd< blast to a eomminMion ii
pte a stet, they sover heltate to oR. lanettab., Mow Mb aliped i whihh is to be placed such rrat ast-
plty herote measure. -* atWHa wmeIbty- over t he gresett singlee busi-
Whoa a Se)s woa mam .I i-s- a, t ,, th,. country. One of, -
eiwit ovarian, or wombt -r ble10ins.n1We
As th. people of thesoustry some t t an. op. t r the firt esentials of Federal rregula-. I
toew rFloida better they ea.ot help thought_ fheia dothenr-t t ,l of r s is'a Pw .r e rgulati' we l k(
be% .. pe ak hi-hm ..... of I. p... I ?tablestriqkes efrI*W S a il, ,e i n inoftn sh h highest l standard.alid NV ) mkl1
hseiI highest~ t terums ofa pros. i a .wefn ofsom .... ..I
e. 1` r6u1 1 arn mot haf d. rovasoww.ombp .. ,,Of t fost thighs which PrWident Have yo
w- jt ped et s O ena deped ow them t lwatvelt well have to attend to in
S--ee-- a...d ome "- -" Ve the meat Congress poss. a rat
w a o Rove. cometowas%.Ilow will b tit ruorgaims ihe Inter.
at-.-e'- ts Commeret ('omnissbon.
The Tampa people are putting up a I S l t
Sver prllestent fight for the Florida SPEAKER OF THE HOUSE.
ite m lid-Wintr Fair movement in --
asetny. The sbtseripUoas to ock When the membenrof the House of I se thl
espeseed to roeae SWA.0O.and if he i Represeatives in esasee nominated
*to ao a see Is will not be HHu. Albert W. itlebriet of Deot aos 1aa (O l'i
leot at s-HMe.j. It willH~r not speaker of !hiat maoet body. it was hot youi'
o oou eaded by aoil that th ele on n t 01
would only run up into the a mes one His e barmeter as a busi. yOl. .
Mealte. eslek the America nese was and cities hos wo for kinm
Mhe 10 at Peeaasele aad destroy it. the highest eteom of all. while his
a I**m&ye sweet revenge. There otelal eraer aW that of as upright
"i**ballehipsl. seven rule. man a every onele. Fearloe ito k
bih NMe I obeath destlrt.oyf r re a i a Idut so he soes it. and hisk e0ell0 t l
-, n, r Jeiw "v^m o >, jeim rrly leads lt s s. in S b ka. is oe W
6 ma. *i"Veie*ue, whol.e-saed sad posee"
L orida willto be I The ua esses we ah ope""thim So qulhot w of head lafd heart thatl
will be of MA"of Nd -limoi brck tow et o rena4s bet when o eo* s to sake up grea mee--mee who
^t wi11 be of aew rd industrya dore the t u mber of M* oi laMMIeIto eof D bam W..., ,a w olmble eoed br : the usor puW loed ar e e wa w d Io ld
g fth aenprfeteIol Is Mos t I *. d"i& PtWlkam's Vrtabla0tw" ,u my high phnlAk e t A e h Wed of tbr
tfe. .. a s.o- welw al e r plhiystele ad v lwer omes of our Stem e s*ot ms, wh
-Shee ..v. ad stand, opea.. mo. u--a w _msa ,d m,-,i to are working for toe bheet &aseew of
l emier 1t- of h Teb I **. sIm half. bu ek, wittmt Bret tr17a the Vegstable gwir btelovd State. we lak foe sad
@e egeto w teb Mo obXeeLt. ha coged <*ad wrlttag MNu PlabMB. *e*pe Msoking ha as hameas sad jst
d elbUeru pressed l. Wb-,ok l.. 5 ae. for advie, whmte to nre. ;dmIsiueUion of his twt fom Spesk.-
Sher hae he used they hae i,,1 N Ma. eI Nrk;ley a oT55 h, le b .....
etily) matiaetof ry. MStlwst MUkww. Wis. wut. ; britiaant yme baater frem


% I***.


HillNIfhi


ve seen our mammoth stock
receiving at our store. We
stock ever offered in


li.i


that
have


FURNITURE


he Medium Priced grade. If
cottage we can furnishrit with
make life worth the living.


its
the


ille Furniture Co.,


ESVILLE, FLORIDA.


IS


Ex


oar Not Owlg a G ood

rY and Harness...


e thetl at all prices and
e terms that are pleasing.
m investigated our ......


E


T


Buggy while you are pay-
t. Our money invested-
S. We''e willing to trust
I I 5 0 S



. R. TB iS

Last Week t


52.50


3dw w Pbbwm1601. me I'l rk x l ,h n Bo"Mrcoti hie h y Iat. W e have the
M~wfmW. 6m"llof The DItse LW4 O91kpeoM5l%:Shp ~.40400' Iseat TalI"haese ok hiefi
viah 3eurval, ~oneheefor thsM e"m ody I It*lIlife W .w f e mee16 0 f he yewag. r1 4 '
useen sohhfor Oesn"M *00Og tds, ef fa thie prices, the qality, and term'&
Pbafe of $use. ae psIat ogulovcl'o 0Meoeseve*r aa a v olko. ~seW beg. u P *4 VO ugyW'w d tpu t f
4648"S~b). m muI ILsei0000sgsmon T'kmt e ~aso. 0.0h~s ele esedHgy10-o' u toff~
Dm o ,se Ms ge~ 4gm* dh4 wnayr" ofekilo 1,e4we0491 f befend. e (a.Come today.
Or tspusepowof INOW Mw ahm a"d O~a ~ ""'"gevigS'ter, t 0be"Obus issda'
SawOsseoof uee saw.inpi jli amh .mwemhof the "now of eees.
U 0097 eer 3~m mll hapsar~ t sa w~tmheowi- sit" s la ld lie has a-- %busona
ft enmt.ror tbus f WR OW &MM9 5 WOUSIt wmeker~. WM#. o 90 9907oyssdI.t
"MrsYow1017a AL" 1kPer anhim ofhe %bpe P1. s"d meaN.s d Mw
abae oa ~ snssb f 5tdE35d0' arPhnON" vom debater. bvW 419W semms- W eR HMS
*ftle"169Isde*w*&"60 n, e Is he. lew-all.. i 10Hisi'~
j~ dse hhde ~IGA'NESVILLE ;.%..AV-LQUFA


-.


PlnR?


1'"C


~ki~


C


WMME


I


%0 L L L IALVWALA Ak


LL










NEWS OF AY AD

COUNTY MENSED

lattern of Gnmw Intat Gith-
ered by Our Rqprter

PERSONAL AND SOCIAL ITEMS
What NaasHappenedand What Is Going
to Happen Told itn hort Paragraphs
Se That "He Who Ruuo May ad"r'
It In The Sun.
Idiee'eallingseards is latest styles
at Soa ocee.c
A. 0. Masters of Waldo was in the
eity yesterday,
GOt yoOr baball goods at Wnit's
ie.!- ewtor. 2&d
R. 0. Melahna has gone to Alasha
on b tlom for a few days.
Dry ak and pine wood for sale. J.
1. Boe. d4
J. W. Englih of Taeoma was a vis.
lior to this eity yesterday.
for Ront-Oaes over Chitty'.
store. Inquire R. H. Porter.
R, NeElbin of Albion was in the
lty on basisees yetrday,
Ilosaoma's Woederful ailve for saie
by J. W. MeOollum A Co.


Mr.s ad Mrs. M. A. ialies of Cyril
were visitors to thiselity yesterday
W. J. Hodge of Alaobua was a vit-
lter to thisity yesterday.
Kqep Oeer bowels regular by the ouse
Sof hmnbbrlaln'e Itanmech and Liver
Tableoa. There I sothbing better. FoJ
Sgal by all drogsgits
Mr. sad Mrs. J. E. Thrashr of
SMieml py were trading in tihe city yes-
Su rday,
LAst-llaurday night, three deeds
seloaed il oaeleal euselope Return
to tlate MeCray's restaurant
Sldget MeCray, at
X. W. Sanford of Fort White was
Segiltered at tshe Browa House yeter.
day.
Attorary Syd I. Carter departed
yapesrday for oial on professional
SOs alurday April Nth, 1 06, we will
a!ye n erloed of fine mulessad horse.
Wlt lad ee them before buyinlag.
r Onwford Davlis. d&wlwI
P. IW. T. Williams of Jacksonville is
q11edllng a few days in the city uni
For Sale-A e .K mile cow at low-
setprioe. Also have a Franklin type-
writer aad a good ook stove as a bar-
gala. Mrs. W. N Holloway. dtf
Captain and Mrse i. Barker have
retoared from a pleasant visit to I ireen
0ovo Sprivgl.
Ht.y furnished rooms tu rent en
1411. rFor partioulars applj on prem.
lee. Turner house., S) Wrest lberty
str. et Mist desirable location in the
eity. If.
E E B iudwin of tighh l pli lnge was
Smoaeg thuse who. favoredd tianrisville
Swlh a visit0Iyeterlasy
Wasted-Lady or gentleman orf fair
edmtele to travel fuor a irm of t*1W..
UOMDpiktal alary. $1,07. per year
Wad eapeie ~p wpaiw kly Addr
0o it. Clows. UStaevii Fia 2s &
Raev A. Gray of Meaunopy. pastor
of 4he Methodist ehauro at that 1Ilae.
wa tohe pcit yesterday.
Mr sad MNrs H Butler of Jack.
soMville were registered at the iRm wn
Hoae yeeiterday
Jolia Zetrouer rof owheit oner of
the progr iseve- rn .leite( of tiht pliel.
was trading o Ilthe city yesterday
I'he ladle -ie 1i1'u countyty ar II
vtied tu lirl-di thr gra.i milliler
O(biing at l% lyde's, WrdeMeday
ad Thursday! prail Ilth said 13th A
tile diplay of spronu aid iiiunnrir hlta
sad millitery noveli'.,
J H R heart .,>' ,.f if 1 1 1 r1n1
(ht rletve m ilauralat iwas* trieati
Ilg btatsts. Io ti I 's.Ity e*t. raie)
W P'ael of I hi ,f |he
I' oti le ul frantir. t.a ,., -,1 ,
werIaMOtigi l'e u.,,. .1 V. t,
tridal
!(|r r m L a11 I R'i* 5 51 ,6'80,1I
tasle assald I. l* a~utonllub* hest
i t* B *tf itr ;,y,'..t i, g .. ti'
mOMO % file ls>r tw>r-r tiid trrmi ts
lt i,.r a( I) at \r Hlitem.. ,. ,
I MeMdht of M,.red t' '...ier
of tl5 tfe f i t M..fi t I.
store opereis'r. Ia i I .'

Mr ain MS I' it ,I ,
&lbms. i,.m* i>4 Mr. \ .


Irtirasalbkam Sk a&F!fe
to V ft, A t I g Igo


St. t


hmmseen Good M w rsie-.i ws'& Ca 1.t
(It kouwe aAW nlvuh,.at &bOdeawme ti.
big* Aesamlthe ha mu. a foe SWWg
heaL._thy rep"Wsm. ad nsWU le
ViII to m"das reswsuashe W" a~
*ad on Icbe :1 lts%


Pilot ft
isd 00


READ THIS.
we~veeese.-Ala.. Jiames, isul
1i 9 w. U11,111 1. 14810: Door air.-
l Iv. bees a Ng Uestsul Inraembled.
detr trouble 1w two leansmad My eOw
was of a very serio" age eie, espell.
'nntgInv tit have several palatful mad
danmgerous 0opeusslms I havie alo14..
kesi an lodw"%& remedies. I toeb
Swamp Itofosfr three jloan &ad War.
art,* Wes Cure two years ad they sell
"%I- temporary relief. Alofter aulin
t ao 'ilirratioms and prepsulug for the
1111ml. I saw your Texas Weender ad.

141wrl t lahrr gforstae.mysa@
tore said my bladder had guowa so-
*aiit.g' in three plat."... mdI w"s eut.
Ining1 almost dwath No Mau living
%a' saGal more than I mss say for poor
tvIcias %%'ide, and I casl it a world's
wttqdin, and I hap* all lshe eager will
It' .1 a trial W1btsblI" luertesj
al i Inr uly.


A TEXAS WONDER.
0"1 smllbe"alof.1the Tes" Wow*
IJ l' 0"49 thdft"17- Daeeery. e 89
kadimys and biad~r Usebies. semeyma
*WSll r.-s- "M dashes... "umad sew.
stoma Wesh NWhow ells. ems
MGM mad all ofgu a m e.sekgd.1
ar Y and biadtieramkbohmeas a
'Oiwt eat ssid by 4ed~
wetland seat eM ail "w0p; r WE
me% ad ") MM r" a~~ei
~~ 0. ow on. a. us.IA1
DNA I" UGUNM~a.bLd


Clli~WI'


alw. W. 0. Foer of Ale6B is
the eity fortalw hourB ldgod, Hos
MD o tw- y. **
was eon reste so Ni minpy where 114
will vIlt ifrieuds for a day s two.
Daon' buy before you ofOrawford A
Davis'fla otocek. Tbry always carry a
lot of fine mules and houe. A fresh
ear to om.e 8atorday. Wait and buy
of established dealers. duwlw.
After a brief visit Sto hbls ity J. B.
Pate, representing the Carter & Dor-
ough Music House of Valdosta. G(s..
returned to Jahksonville yesterday.
Mrs. S. A. Paltoereo and Miss Mag.
lie Mecarroll deperted yesterday for
lake View, where they will visit rela-
tive,. Mr. and Mrs. W. S. Jackson.
Frinadl f Mrs. J. I Itlrinsorn, who
has beei tadispoend witit fever for the
paSt two weeks, will tbe gratitl-d at
abe information that she is out again.
It's better late tha isi er, amd if
you have sever ti-rd Bhlue" Ribbon
Lemon and Vassilla Eztracts now is
a good time to try them,.
Jamse Holder of It-chelle, member
Sf the firm of Holder & i'ope, mano.
facturers of naval stores,. was trans-
acting business in thii city yesterday.
siding ith hiss family at 603 North
Garden street, hli mnured to the
Stringfellow cottage, East Orange
street
After a br.ef but pleasant visit to
their fistr,. Mrs J. F. Hi!;, Mrs. C. K.
Carter of (riala and Min Beille Obilty
of MiCaupy have returned to their
huomin.
J. M Thomas, the successful sales.
man for the bheffield Iron Works of
Maeon, (is, departed yesterday for
Brookoviille and other points in South
Florida on business.
Engineer H. B. Anderson of the As-
lastic Coast Line, with headquarters Il
Palaika. was in She siy yesterday onI
business nameted with the division
superinteodent's ofilee.
George M. Wright, formerly a mer.
ehant of this oily, but now a resident
of Lakeland, was ast he Brown House
yesterday. His old friends here were
glad to greet him asia.
Tbhe pring millinery opening at
Hyde'a will be of Interest to the ladies.
imported hate sad hats of our trim.
anilg, and allinda of headgear for the
ladies. Kemomber ebodato, Wednes-
day and Thursday, April 12sb and 18th.
Large stock to select from. d&wis
Captain I". T. Jackson of Bronson
has retsurred to the eity from Wave
burg lake. where he has been lboklag
after his grove interests. He states
that the trees are full of bloom, sad
that he calwpet a fine crop the coming
wlason.
Among the visitors to this city is W.
). Yarringlto of Jacksonville, travel-
ini rp"Mentative of The Times.
Union Mr. Yarriaggton wa formerly
in the employ of The Ben. and is one
of the most eer getie hustlers in the
tsat,. lie will bo doubt make a osun
ecse of his sew position.
Dr. .1 1). Watkisa, commercial ageat
of th (aiml ovIlle and Gall Kailway.
has retired to his home at Miasoopy
from an oft ial trip to South Florida.
Hlie reports the grove Ina l ne ooedttlo
and the trees full of bloom, with pree.
peet for a big oerap erop seat Ms*
sos


uand if aoeigld as prltde re will, es
April 1L t oeold Ms pT iI0&.
,. TmBYm,
AdminatletM of bitto of 8.. BOld-
dings, nl0ooed.



iEW Till


RA OKET

CEIAI'35? U.U.0 u


NnllI'


d1,1


"W. tIm.~a d" is

Nwdpr Neboi

3eb Plat lTsi



lir ab I9


Tlne uasn


Grocery Co.

J. I. 11501 & co.

We have the Choicest Goods
on our daily
**. M E N U **.....
Irish tat oes, per peek..... ..... 86
SWhit Basas, per pound . t10
I SaWted Dr.e.ing Me
.......... ....... 18s
ant .... .... as

le .f Ofsmage, Ai rose, 0 s
aigOhld and Taralps.
0" Prafst.
Figb gain rise0i04 o.
Al &iAn Prumpo y 0 Uid .
,]Phone 176





Insure Your Life



Now .UAI PnLISY
***of* **...

Mutual Life


mk a | .. L$WIT a.s.


INS L. 1 m1 'ssi


Ever"cpefuly guura.
toed,ji rdv*W d and
now on ISIS. Im
are hnowsinhd rtfromw
Factory, and the low.
est prirom am nau&me


Come eary
frtst cboice.


and gA


Phifer Bros
* Phlmo' morew,

GAINWVUVLa, 'LA


N I


Ninmi -l~he
SM I". i soam
proptly etaUNDW W.


Gainesvile. .


ploy of ., teu ,' M a ,

day for purhea m*" a lo w, the g r0e0iM Ma giastag leas
maed e of Was O the~ "ONW5v of te ,tNf tie


pOffern O. rrhasjumI. wa,0s 0 greatly by the atpla.e
Offleer 0-as, V W bar a has fast l th tr afterward to the Oa-ge
turned Mw Jaaksoville, whe SA W a "A rS er of the b "e
went a fe t yas ago to nate on, a tal ("d~stry aof the dlppten "
tios perWfeWapeo hTi tlnfslu. I eattlt .g Into the Osage A* u
OperatleIti" performed kO Fr. A U try eompsueery. uv w
drede., a"6al-t_, and frileda l rof -M
Waroes bee gratlled to 0eais m a- M lled by e0er. -I
his giatly impon. MemphI. Tesm.. April L-A special ,
Dr. lyde O. Lto the tewsard ttar froma Pusn.
Tueay.ut t lKY., says that a mob twice| attempted
Glawf f'Allsup, wo ny 60 11ort t lynch three grow who an
marrliey, meti's Ow "l1f 6 11 har6 with shotliag ofcer baker 1
already M l a TkeIo. y Mayor Wall. meAbers of therity n.
wer e lS P5se5 p 01wo b .d ll and prominent etlseas, defended
Mrs A. Caller, SAini f Or the prisoners and defeated the mob
ligroom. pe*r aipsat h(i- o g" The aoegees will be tako to Hi. a i
them a= l. Dr.Ot' it for safe-keeping. The report has
will be p emb., leo fet J gdo. be circulated that they were lytahed .tIhWb1
sted fir mt AJtOAtais II1 O91- hut this was a Slatake. he sa
loe.rr 1d 1 0dembly bklsm by m. -| eli
oeeliving *, aM a dipkm within water NAOgcO.
twol das. i4 le here eult e' To city water esowunere: Your
graenlamias.. water rest for quarter eliag Jie e

repre Ot eie Fel elA Ona.s, lbisl WSe. If Ios paIl or beof oe -- l
Obleagl, fPt60res of iplet 1 April 10sh. 190, your water e pply
Heosey of who has been I this will. without further or ise bto di* T F
etty for e ioseth with his wife enailmed. Fee tforW t g" -s apalF
Md bb, pese teo esturn to their I.1 By orier of City 0 .meill.
z.me t Z2l Mr. O oaoer made The Ci0 lerk as.o 11 U ed a
Se aso aeMabale parMlSg all estfer-. 'W dl1 Fla ., April .11, 1011.
day. soak*Ua be*metot-a e or b UIIeI
baby1. he b.S Sthat the little ome The job pristlg departMeas of The
has ai fapeed. Both himesalf l Dai 8 is spleMIly equipped aod
and wife 0 woll 1eased withl Gasthe work geransted to pleas.
?illie,d do sla o kM I Ws weth sot ibl nes. F L
t, healsthIest iles they have der
wished. LVn l l I


Fk I
-Floriida ..


R MeCLELLA&


Undeftktg gk.
GAINVLLR, FLOIA.

Funeral Directors ud
Licensed EmblelAm
MaMfaeoawrn of M Di Dw .
CoIA. R ELL IaS,
p"', ftnoIg
MOMh- h,24hO
wU ru pm im. -o .


GAINESVILLB I


PRESSING CLIU
Coder Ne wMWg4
CHAS. Rft. ELLIS, Pv mrr.
Il w. ir'l" M. LhM


Membrerhp Sli.
Per knld.


GAMOINUSVZ.FLA. C(haashin*,aim p Vvt




TE SU]is W EL L~E~


A IlIthe i am~

&-i i24.

dbplqdbodmwbum


-Z--~'I


'in 4
I ?',


"'4
'---I


[NE oFr.
[W OOlOK


I.


Per Sale.


';WLE~i"~;


-..a ;ffiftka


a M 0w AAmh




Full Text

PAGE 1

ICt-heYear-sCASTORSEAEEQUIPME-NTThCASTORExpressmiimJORDANSeaboardMERCHANTStapleHaviiJISeaboardSeaboardFancyGrocerLimitedFloridaAFaclablePreparationforAt-simUatingtheThirtyINSURANCEARCLYDEPULLMANPhila-delphiawashi-ngtonGAINESVILLEMODERNAlwaysSignatureJackBonvilleMailLINEoadnndliegula-1ingtllestuliladOverRichmondEnglandWASTED490SADaNGS8-mwrzBaltimorenes8nndRestConlalnsColumbiaAH-IandRaleighSavannahSouthernMONEYRailwayHEALTHTRIOLD8l3TA-MDCSouthernCamdenFLORIDASATLIGSOperatingForDELIGHTFULCoimilMuiuFcwrishFirtllliersDClydeslderesfoMDeLaadLine-19stweencDJAGXSOIYIUrBearsMOniumMorpWneEacirrpjr-toioiprrGONEPinesMesaaaliesasIjAOKubNviLBKgutowflS-KJOaaaSlonvichDiArrhocnArrttuo8-46pmGAINESVILLEJaitesunlWVIlble-Amoagotbertau-Lave11OpasUsAPRILDAIRYTheaUtementtataakeElegantbeautifuladdrcssPublla-1oltrootioalAOK90tV111y-pYourcawllat-LafidbifMJACKSONVILLESuperintendentresultfailuretttdSlecptrsGarsopvratlndfrLOjtllASTTurne-fTheWCSEMIvLinesbeautifullyAcknowledgedGOforConslinn-lionttSSA-porfielThroughSANFOMXopMiriiiuwninMiiCHARLESTONtoKYfLLEt-IGardenoanioientiouilyYorkUAINKBVIUKImeltAdriytC1YveJJJhICtPROVIDENCEaUdrugK-KlrtlunOtltFlourimlBWp-otvdCMStwiMACCIDENTCommenalBgYorkPhiladelphiaLinennpilnr-ilIsluHvnndBowelsNewAugMtru4M1Mrf-BThithe-8lgnatureMAODOKKLLNewS4NfIZlITCN-CNrChamberlainstcChattanoogaInconvopietitsympatheticsympatheticClydePOliTERJohnsIfifttfdisbursementPtillMinDsBBItrIMilludclphlnStoppicxatDeLAnddSUNTrainsRiyerFaconspicuoustheWsiblnjftonJfrflktottyillexperiencedpreferred-byNewEntertained-AtWCTVUrequisitionffieltuiireljrDullyfafdrmillMOCCASIONJaelusostvUleOtsorvatkrojreaV9tbackgroundJaeksotitlllntotla-rrsideililoMhipiiicntJacksonvillewas-iaadebydecorationsfihywerortelervalitouappropriateSitsadvertisingucnxnpunleiiOnlyWJDJDFtiDIJlrNOralssuppressedmvifltJrtt4kewtartNorthboundich6rgdPromotesadvertisers-ItBouthboondSaterdayiGainestilletiiwindebted-nessnvoM-titrlkliitfSrPANillJacksonvilleandrheumatismReturningGainesvilleOomrjltttEradktea-laklnbeautifulconsistingequipmentMMnufn-ctuMisprecedingStrfiotThrcoandappointedpat-2tOOpKGainesvilleNovemberbusiness-manSendsuggestedanotherbutloubcrt-TlirrrpermanentRheumatismsatlsfaotlonappll-atloatlrrlnlnn-TlicroSOFTNESSpreparationmtlbuledrequiringSEALSKINN4brd-filktcf1llMt4HontploiirssMslew1mngatsintrcirculationVisaHQUAUKannoyingunfoundedBvjililonnlMyesterdaynro-IniorlNcodttiiiHinntlyoxtroinolymu-nicipalPositivelypresented1IMITKDevidenceprolapsutarraignedphilologyreceptionunveilingcarefullylisd1lssrprobablyCatherineInstructiononddullnrcommittedliiiorfMtlntDailyBleepersmeetingsconfidenceBaedatinstantlysubschoollanguageIIRtnnAirIHlOnlsirregularFacsimileiiOiuvflyYetTuesdayoxtundliiKllrresfordSundayschuflsotestifiedFORLinocircu-lationituarantprobablyflawlwyrweaknessesI91Mo-NDaabedireutandprosqtTuesdayTERSELYSitfnnlurcaaruetnttou19r00paeMssvIcltemeetingmeetingfashionedreportedthousandslearlBjipestifcreaHighestMondaypayablemembermeetingprofessorhundredsnitirrlagoaccamuladruggistdruggistofferingHEomoKmemorialresignedattendantShefncTiladdressesexceptionMondaychargedYOIIKJt1JI01OIOMedicineDoublejumpedrooniudCalliajrextensivepur-posesWllliamireceding4Lp14NmCallingItkitibenefitedllssweenagainstRetailersunlvorsitvTBIpropertyprepaidlightingBOHTOSteachersChickenshundredsperhapsuttrlb-utcdregulartherefore4ratfttAansweredTUIIITU-PThoAHkoU-lUMHoooonxattentionife-miregularmomlngendoouitiHtisIIiOft11alvafiirequestspeculiarniHubyTrataRastBESTnraIex-haustedPullmanGentlesYrsW-yGIRLfflowUxcnrrlngoftiiMinnidootorvdmeekerrrniKorV1PRfCEHYount-nndmonilnjrtroubleswhalovurStatoxiuantlioJliukGKMWillardhangorsAVillardMayorsHitMustonaiiivRffcrtud-AtSLKKIKelloyWRAPPERPrixluofl0JOaxtiSanfordEasternmemberremedybusinessmediumtrueanddiseasessufferersdistrictPalatesWilliamdirectedconvincememberpreientaofSanfordpictureDelicatepoxHlbloShufllohlresultedt-iQtitsrcforoncoJhIrrlts-rtiiliKiHfloxLossUODmreputedFriendsntnllunccchargeBLOCKpainfulPalatkaLAvmftayfaliYNYonkopHKeM401I1SoXtwtnfrfromApIhundredESTtb-aPainKoitionIIUIIMTIMHplnuotnDlaJnuJDriwihavingtruubltWormsroqnlronewsysupplyAroundimtInKMer-curyKelleyalwaysprogramdaadruZHOHtfrnlpoundsLYTho-forktperiodPanaceamakingfurnacesfollowsfendMoneyinslttsduicrNivplloFraaartuowherowarrantschickendiningliroothniadvancereltphl-nenoyNEWCottonhullilarHFrancisaccusedabusiveTurnerflowersthcmx-HOJobbersvM4HDoctorsHaneychargeparlorjfrontlywritingpcclaldistrictenjoysowningaddressdoingwarrantsglanceWtUtyujpiniHtutIethndsRicharddistrictwHtiustox-poHiirocountyDNtouthingspertServiceWapotipeculiarNAIlPoiRibbonreceiveGnratlewithoutparssltcrdiseaseIwcauspfavorltonotunrks11eeknlioutodtionofftiafrvffQueenstartedpersonsmnthLIFEhecauseschoolsploxiixPrlncottpalmstImOhaudUsuselessUaUODgfta-purloitHexceptfealiyrollingdandruAVOIUI-NlaDoesntrrcnnludiseasepnliii-ofbeingcountychick-enschoolmonthTurnerbelttvoqslokcxetptOTICNOTstruckgoodstliipnmarketatetiiiiiiPenultERdLexpressremainFloydhmllhyput-tingtbttIteFailureejtapyCIHpoetryapplyschoolteurtnehnutourHealthiMftaunionslatestDirectFloydlUJDrgeeptMkihealthmtiklntCOMUUlypricesst-arrelieveWharfiiuthnrHwomen-InexceptfreelyFloydlikelynotedeentSinflictAboutjionplountriedivfustfiiaffordstJaJUacChadUofTheirJOWadmiredAftermuvenlngLadiesyrrtFaArcherWhyparrolgivenrrretrtbbeforeaccountSiolnsHomemlfxfernsleavesrefundANDstatedPointsMrlhoUnniinlJfiMWitbaetduringArriveschoolWhitepapersdailywhichIIE6TwafersmoneysketchorderJOMmixedwriteovnrlanCLTDafterlargeam-3ENadviceshouldLewisreallyoiiHblonpapersfiMllntrservedBoardvariednauKiitdailyRiverlargeUnitedNeWSnTherehardldailyPubliccannotsandwhichLeaveprettystatedcurtnlnad-vicewbuldNorthwhichouMitiutortureYorliiMHandemptybottlettltouldattractabovemadedollarrboardpalmBoardthereSpainFotchVcmwdollarSuitesFatterTfcisufferbottletodayTwicefavorsheavypqequalgivennhnriiyimMAbouthandsbottleSourfruicewhomprovonnmterstorksvillainboardPromboardcostartinnedleavetroublehomeChinapItHIDEletterboardcuredFrontAsterhlsswlboard5tftrjPstriketliiiKiicYUoomTOLDwhichBearsotherprlnofwornCourtEXACTtrtilnofraenboardPWnunionStbringreportradintidaysPommreliefwagesItaltnBalmiKwombwhichliaiuhotherfundgreat85900IrsluaaaKKKSBAYsuccesslimitsusedwhiteplumIWIIKIMNotOKRifnpaperYorktheretwiceWhenwagonA-fJlUHeedAttartulloralt-NettnnlevKiujtllIIhwhilewhilecbrokmeansThoroliilOPaingladSoslllbwhenVhiitwhendonttriflesolidfea7paidQnttiulttmakestatue1ollvyoniltheirtookealpcuredfinedwritei1lltlStosoehwantstthJIIteBalmHayebDo-ffideepthosethirstUMstoodtotiohnhrsamihavebothpniCornwaaapaidyuanTennBackMealwaisttUncClubwaysshootleandSptheir2000lACTheMissNewHaveafterthereHowWHMUdaredbeenYourhalthuFootprrMtTCureLiitinthrowforefoldsbendiesbothpursethantheirtheseForeachrhlofhavewbkhwithcourtlittletimerbalefoldxPainhavefruitbackbeenpunshardyouruponnuthaitIbeatsendfellThisboldyourVisarlsHlstatelottovatediiinlnsuchbuybillsSayaIQtriedHMIWOIIlitfiulrisehaveSalohastYnesstintheldcostaPainsendTherpdmustthatiiftvrthereprofyouritantwthatRSorsbillsfrom1LwithnfUrthutrurKiinfirstnro-howithdaywentCOPYmostgervr4tSthteatyourultafirstIthatwithwiththatplotlinnlSlurhthlcewhiteworldveryTheOFIsheldgitnlThosoldyouryourfromthationiseThisbothhrokOutstorkwithwithSunMraUtleliBiterMtekr-BiU1affiIBuyrefitthendarkGeethatfromllnitHthatlnn4ltthatwendtake890WaMllnorwsaorobowthatfromwordwhoandusesOIIIIHOverywantfromlimedOurProa10freewaythisJOthatButthantoneWCAtcuresonlythattOOgermthispntlbutCiVthealsoOnewholistsKiinpWmoollnolnebeetn-nioMtnovorr1sgethatFewtlDClForYuuhimlftMuehandwithTII-snorvoMNosoldWithrotesandbothandwillremeelhimMrsslonwithm1t-IAlleetasubandThowillHoiandbathMrsThethatlXJperOneWillMilsbibirdroomwerethesaysremslogOtaandandthousetaeeasesAlaIMcoalRatPairand-SanteNVxvaidsandandhadsameun-tillagfeelwillandandandluiiHthatVerynonnoThonametortoigleftmemwillhuaMrstrillCutthinearnswereMtusualOfAmtlonknickTheherlastandandYouandandandwillatandTimthittItsJwerelLiliiKhassailstarandBuyrrrIfThoimKmetsometheyandwlilandandleyandSheanylistsarstliDWfeeironwerecountthinbutfewandandthethehaleSeWJhlMirvisitandtba-IhimJooiiiiiiiotaMandlistlifetrantnrhimyouMudherherbutlikestarhimtiedandintoINthatwilloversoonLouyoutheRrrIIOFherparrnorthisandandthehairyouitOrsaneherhoiandredthethethee41FhimyouundThemillliiitrFAAll8tioldfoenullflueIlkopipe4tIoryouyouyourLyounUllthethethetheluluyouyoucanoenextslut12JntcaretheandUnityouandunitthesaythethethethethethethethetheAlnWuutnewUnIncthehassupthehascuresheundthestaX1ehasoflHtwiwtrotyouposltrtt-thDIIIIUo1IothebutthehusKIIVMtuathetallthomforthethethehasbe-nIhasthethetilltheilecasethelagthethehasyewtheUrntwoshythehutpmandfowthcsadtheviaevermanthetheforfortheoursthemantestthetontheSix11111bybyownIUdlugtillHeVIMwvnthetheperthethothehutwaithotilttIllItwobyWuthetherowthetheImhadthethoandAtiwasbybystywasrowbyfort1lOwasImthedinMmcan1tillOFJIVHrootenurforallwasrtIetnewfirlotwaswas1rtheToforthetinfurribbyallabenotforthisIt-tonetCtaforcIthethinallDrCoULwasnreinhlbylieyetforaNItheUtetiltstillallbbyallIlltipanbutallIttbybylilowasour19-ifhcanthe8frlotinKewewasHUHsurritsbyr-etheNutHUHforJtetWtItcanarebyMbyoneourourbyslelfLbyrowarebeonemsunfURJnareBtDrnwsunsextheoutn4anttheetclie4updnwareioneoheallattcof81unebebeofniluseKtrifelthenreA-JareerrnuuIletonha8tbewyoutorenrofleaheOftt-thareatAGr-ljareouatofUnofduMl4-rsiuofJipsoratofyJaartbett7hoatpuinMinIIIofofofi0inofofanweofofof10to-ttotoofnooIninofofaltiToftotoof11lofiaAIofOfIninInofonofnonoonofontoofIfr1itIninmianUtotowetoofJranlaatInrkatGAtononaIIIIKInInnoEieItininIntotonoonIBtototowttoasrntoCtotIfiAolinttrisisattotmat9tototfiIIJIIKAInInlititIMifisastkTitusiSittoistoasGofIhetotoFJitoonInIsitUnasorsotoInInlaismasUIillIKInis0uIHcIttoitIHIn141V4-rifA4tolitAA8uiifItItAtoIPSdItAlmtobIrsPftIaIiItwNB1xc80eesj-1tppxiLitFrIIwUpHisflbshteCaa7adrL-lrlitfIynaa=1>aaatr-yaaaparuaJIIafaaaa>iaaaIIkaniionta+elunanjiIonsafItnn>ur>n4nwarpotrn>rfIruty>11t>>iRt1<th¬t¬T<It<¬1t1IltJtirIIi



PAGE 1

Year-sCASTORIASternbergerRMcCLELLA-NlllldorLakillgCoUndertakingPhillipsRSternbergerAdvertisePhillipsA-rtisticrlnun-dentCASTORIAWhiskeya-sCASgctablePreperationforAsL-inclteStomachsaW113RogersDecorator-sWITHOUTTHESUNUYMNEIThirtyMURDERERSthe-SigootnreHESITANCYMarkMOVEMENTELIXIRLEMONJ7TLTRUCKINGIn-UseAlwaysBoughtrepresentativeOverEmbalmersHEAVY-NineTHOMAS1ofincr-a1OTNARCOTICHangersBULLETSTONERoomsUOZLEYSLicensedCOMlnisterslExpectedDirectorsGOODSForHouseimpresslvoiservicesFuneralof-thejbpngregattunfirstclassOcalaOTHERSNaveinOealaLINEGainesvillesIMplesWineSTOMACH-B0WJ2LHPaperBearsVERYKindCeremoniesImpressivefJouJrSJllllZPftrJIERSJInformationFULLestimateSundayschoolMisunderstandingELIXIRNEWTheWestYouScheduledaccommodatingLEMONPOSTALumtforphineChildronMaincongratulationsSundaySchoolOA1NKSVILLEruprHiontntiviSchool-TeachersPaperAlwaysBoughtcongregationneighborhoodRestConlainsOFFICIATEthe-SignatureneighborhoodKEOCUTEBrorConsUpncongregationinconveniencedConvulsionscorulKnmuntPaintsconiUlottd-eriouMondaytwentyAveinJtnddltionFlaparticularsWhichwillFloridaPricesOtherprogressingAfternoonpurchased110ImpressiveInflntssubsequentGainesvilleconstructedcantaloupesin-terestingFestivaldiversifiedEpUoopalJacksonvilleinvitationslm-prnssivoncane-NDROPcompletedSHIPMENTJJ-iApesfcclgiveopportunitytUllwayEndingrecitationsConsignedjerfcmpnyTelepkeepreparatoryKaitorllngtheyureseparateduptodatemachineryCarloadsPUSHUOTTMontgomeryEpis-copalJacksonvilleOalrisvllleinstanta-neousCARDNaturallyCeremoniesEthcrldgcScholarsGainesville1ipromptlyBYvegetablesperfectionoonslgnedPhysiciansGalncsrlllotelegraphandcommissionhandsomestceremoniesPromotesdesignedyesterdayLKMON-ELtXIRournurstoneViolationliaitipsvlllandattendingdonemarket-MrprincipalspeciallyshipmentsheadquarconsignedUnlnosrilleRemedysurprisedexcitementworksurprisedFLORIDAALACHUAOralglilllChildrenBushnell-byOFKtttHridKeLcctuceSlsterbfMoOarrellgraduatedCompanycharmingshipmentihlpmpiitcomprisehavemisfortunesmoothlypromptlyfevcrjstaMadditionalTelegrspceremoniespaintingKther-idgoMarriageChurchprobablybuildingpleasingTjiivirtuallyaccidentalImportantshipmentMovementscornorstouedlvursifledrequestedbuildingwithSeventeenSectionualotiUtudurgentlysindANDMovedWilliamseloquentWallFacSimileproductscucumbersmerchantscaptureddaughterWilliamsdruggistsmarringThrivingFatalbusinessDareDeviloccasionsWhichrtqulredjministersregardedGodfreySeaboardMondayColumbusdiilillmcformerlyaggregateShotHfildmaturityMARRIEDrecommendedafternoonmajorityrenderinganimationbuildingStaitaphcapacitycom-prisedspeakerItucklennpreviousmovementclearingtrans-ferredBucklenafternoonUnchannnTuesdayshippersHuchannnextensiveextendedSCRAPEaddressttimtlMUryantSavannahwheImitationhandsomeWantNorthernprogramBuchananassembleceremonyextensiveDirectionAlaohuaHJIJequallyAraantetrxafternoonthoughtMondayplantttrsrespondBISHOPgeneralCastauuineedlessLipmanCAHTERTheo-dorereturnedatiirdayjnjurleseleganttragedySLEEPreadingshippedmillinerriskingattendedattendedKMhlellIproductEveningquarrelfol-lowingYORKgranitepeace-ableaccidentAlaohuapropertyWilliamrapidlyResentedHcoirlngcommencefencingPersonalCOKESpresentThCI5ofnuwerotdTrinitycarloadiluthnelconditionWOMANAttentionaccidentship-mentaatUtnotionInsurnnroabidiugreturnedSundaylluitockwelcomeJohnsonforfeitureJohnsonyfriUcrilan-guageanyKindInsuranceAndlocatedSundayWltuUnrBhvlllvMseatingSabbathraerucarloadsrailwaymovementwillTrinitycomingJohnsonwhtr-uvorkillingJohnionISInventorParsonnlhavingCulloKMasonicTrinitymaturedofficiateBishopforfeiturecursingplacedhandledpleasesBishopbuelnurshundredresentedHiMuranceixxitionpalatesadlMonalBrotherTrinityLossbutiovuitcarriedJohnsonofkillingsettinglectionsdurableaffiliateedificesThomasTampaJohnsonwillhow-everRenderedcontlltlnnFrancisBlihopLeRoyArcherttny6eexpectsmarketsWRAPPCRyoutowardsenabledbrotherWinstonadvancejoinedpasternpresentMedicalJosephAlaohuaandMarketsTERRELLt-Or4exsnumberAtlantarwdroinjthupainfulEasternlayinghavingtraverneiSohueleresultedreachedleavingcashierFramestriptouunfMrprPhaodprBiptyoutruckersJohnsonfestivalYeaalwaysnumberspendabusiveUnderEtctakingStsuctionlayingcompanyvxtvndiknownMutualschooltmrlleit11MrslearnedFloridamatterTeEMctareJtubWrAtlantaM02LBchurchplaceFloridaLeRoyNEWthingsoclockbeganmodernIndorselocatedcoloredfestivalappearsexpectsSoothesdecisionneitherparttitimemorynoholarfriendsmonthspatuntInterestchurchseverallettucemilousIftlngcountycurtainchurchFriendsmellowRELLinuvcdSeveralOlydrPresidentOuoumpistolFTSFjwrecordsmannernumerousVormsftttlfooclockproudpleasecausedbegunbeingfriendsse-curedlettucesuctionritualAlexDerfiienchurchqtomacbohurchfriendsillinm-AplowswithoutfamouschurchchurchMartin4TlwplaceArnicaexpectForshouldersectionwhichmagicconsentThisWEEDmar-ketspeawoundbrunchFELLresultsBrIngnt430theytakingbloomplantWeedreadywith-outDarterAtlantafromOUTwithingroomswhichLeRoyrM-prtincquickmedicinettnlayFIRSTwoundspentiiiHurursmoothfdaferredworkmenHolymelonwithinpolicyManwhichbringRentalpricesboilercurredArnicaCarterwhtinsectionheavyUnitedFROMbir1lllf4l-MabovequitedoubtwhichpolicybringhealedcrowdAprilheavedLongwhomWhilestreetswritesfamilyearlyAssistit-TheutbfuturuhandedmanypolicyNEWSBakerlargeDeltrlfclturiWhileinsultactionTOthinksDoubtaboutwhicharriveslaterescapeOurgperfectwaivedconnllbittenHolyDeathWeedWeedagentbeauunlessroyalwhichconsenttherepointentlondoubtDarwhichearnestCostlongLewisLewisThereHolyLifeWITHthisNotesbrfokwhomTheythoseyoungdaysburnsEXACTJonesgtvutimakehousewhichHolyfullywhichunablecukesweekAtlantaMainOaataJonesq-AMweekStatefullyfightdaysOftenFromJonesHispecancouldJonesBittendeepstandTUBsouthprovewhichuniteweekSalvelosurJonesJonesJonesdaystightgoodStateFromeffectthemSalvekindhelporderlearnpricelittleholdtcaahknewmadeevery0004greatdRYmakeworkLaketuredCitytheythosewhenIdulumakecratestheirleavehealstheyStatewhenWorebeKilledtheyVfdtTolntuntilvitateWlniASfltyoursYorPI1WhenPondwhenWithpainladsTERjutuld-JohuasolidliointWesttheytheysis-tersoldTheMayshiphavecornerweekmanysincelittleheadYorkestatestatus1nterandDogbankYorkweekweekHtiredweekEastIMpeRitrciloffromteryHoldheadstonelimitantiseasonTHEfromlabsforhaveCOPYwhichlandJoltqUIfromAlexherebulkbeenbeenEastThatfromMaybeenloutIdaludentbackUpIvirushUDtivaljustNGulfhearSailThefromripethatwelltaketrimweekue-clflcfromdownandfiredLinefromtimefromhourhavekid-neyMitetof3ullthatusedThisjustSritalkthisLifewillKamtownparttreeswithwellthatnndfootsHemthattownbeenthatwhoFThisWillhealSJit-wlhuflapNewsurhsereMallgivenwithNowtitlesThesaidThoantiwillHillthateachRichbothtithenessonwillandThoHrstsideoilywhousednesswentWillbetsthisfirstBareRidewillsowsthatnineRuvhisswilltliliwillfirstfirmalsoacreswilltakescenedugwestFinefeelwillthislUinThewillthatwhomaycityhimRevurnncanHtewillrtalwillTheWasshotthuswillcityftnthelaidtherOilwillwillIltlawlllthiswillandballwhocampandwhocourtunderWasandandsaidlateandhimScudwillwilltitswentThuvoidThewryintomosttheandwillwerethislineMnwillThoacresandthisbareWillTheudAlathisHadworksomeandwillandwiltrualandandThewillandhatlineandnlUwaItTheeasymorecueMowTheandthiswillThewaythislinelunthisThnwhenusedfirstandthisandaddandandandandandandandthisnextandbutandQFwhothisandlikeboreandandlUllThethisandWillThefootlatethisHitlALirethishacksYwereandandhitandfewHueMrsthethoworeanteandandthistar-abutandandandandnetsSunUrnthethisbarethoMrwillandandthishadandThewerethowereworeandlostandliverandoverthowereworeMrOFIntefullandweretwolifeTOfewhadusedAirhasbutpalelardthethetheherandnowandyouhasherthethehasonethothonearandthelitlawandrumfewnextthethethethethethethethethenowthontHisbutforbuttheand800thehasthothesaddidtheoutthemanladaltoHissickthethothethethehutthethemanbestthethethethenornowhisthethethetheS1Lcaretimethohasthehuforforthethethethethethethothewasthetheceiethethethetho100thethethemanCowiiHeofkotthebyNowitthethenilhisnowtheqfvuyiMroutDRnowtheWAShUtheauUof26cthothethefughothebyhisKooreAinforhieevermarthebybyMrwasbybyareallallwaswasfortiltetctheMrforMrRtthefesbyhisbymyJ-AallouonotallfornotGKUasetBndwasBeHebesadtonbytheDrUpwasonewasqfToDIHodAisixforonebAtandrerbeamuseIonofandbeoptorboonelyheuptoethesurebotheoneoffbeallMTYofareofbusiofareboofbebebeofoftotbebobebebehImameartofofbuofAtbe20beMmearetjpofWbeofinofofofofofofofWofofoffor125ofofororofofofofofHoftbofCoofofofnyOFofTNIno-rwainininofinanonofofofofofofofofofofNIWAtiuIntoInItofofinaitofofofofofofmyatItofnotoattoweininofanHofasatnnInofofinIDtnIntoainofoftooftototoonnoinOininininatIVofEAKofinattotoattoatinInonInItofof0Git00totoauisLtotoinoftotoeisininGoc0HistoattoIsinIninInatisitatittoattotoattoisto11InInGitiiittototoattoInlnas21tou31a1twaaKf>anJhevtiIIfirtfIfIttti=U1


PAGE 1

jjrFLORIDATHURSDAYPREPARING-TOPRESIDENTTRAMMELLGAINESVILLEi-V7XXIYMESSAGECONTINUEThursdayPublishedWARDSMondaywAaRUSSIAprotrtillou11-TheexcellotitSpeakerMcCrearyunllapRdt-TemperanceYRSupposedDOLLARiBfiommodatluiiiWeekWILLPARKHUNREADOthn-amendmenjiAdjournedTwicedrganizodcongratulationIntte-recommodatiouSensatlon140000tt8eventyfVhlHoufAPRILoultupoludaRrpreMMitattvvsadministeredffift-UaIf4tlerhollcll-JrijuredcorretpoadinKapproprUtfofttooniervNtlv-untunnluGOYIntlItiiBROAooordjuvtffftlrtnesrlfTomorrow-ANaCCCIuponlfdJ-OIMkeprtutrttpthrprotectionoountermandlnxTallahasseeStruggleconstitutionmohllUatiouoonntilutionnicorrrftKHitdentNicholascongregationunanimouslyMeetingIreonomtcallyintelligentlyadjournmenteurroundlnRiInvestigatingth-oommieiionerltuaUttllougopernmeniItojontvoimlo1commUoloneritBeventyFlveContributingaocordirii-toitnntribuiluiieartkyvatakefundamentaleAlky4rili-mitImintkooBiliJeuiiitmtn0ohool7LegislaturerecoitimendedamendmentsencouragedihnpefOaeSenatorElectrecommendedexclusivelyoyati-riipplleipunlilunrntKarthquaHvEXPLOSIONKvergladnItumliirautpresidencywksfeiahtefisUtlonKeoilpMInCtilnefco-emiiltMindustriallyparticipatedevelopingIndlanopollidevelopingngrlcuUiireKxcelUncyPctersburgremarkableBonatoelectthroughoutDOCUMENTsecretary-TheInvestigatedPARIS-Formerr4tt9a0flatEndingImmenselyreeotnmiwiiDeclaredMcCORMICKambitionApln-saasaUUoboroifrligovnrnmBatexaminationooualdvrubleruprenen-tailvehegitlsturuNightmlioouiillngprovemenlsnominatedtirdllerymiMiKIIWtfU28terminationmohllUutlonIntliiiidatiiMiacclamationAmbassadorAnibttidaUorONEVisitinggovernmentHONOREDCoiuinUnlotiandIiiiurancI-hMGainesvillecontrtbntionmysteriousOomiiiUoionpresidentprlvltegneeonos11raPOISONINGprriwnt-itlreFLORIDA-IntwentytwoetitvrprlMreaouiniendsfnralkkatMessengerequipmenmenwhileapplicantTallahasseeTallaUweeembrauingprautiottllynouoorroHlv1010667QOJMetropolisImportantlearningrxtandpdJaflkKimvnic11Itohert1105especiallyprohibitionphosphatevegetablewestboundcandidateMcOrearyrecommendExplosionreoon-menileilprevailedprotectedacceptingdelegateStimulatediaperuatInstitutionsOccupiedkM-wcurmleCbCtitt1buildingstrkepreslTrammellSENATORcotioretlftBpreparedpreachedMclntyreprotectionEVIDENCEuta-wNMcCrearfnaliibrimiaecomiM-nledPwiewburgarnbaarertL-oInterrupt1tmttat-tuUpnconclusionMINISTERfollowingpenaltiesprepareddevotionsfollowingconstantlydeclina-tioncampaignopponentth-OovernorapplicantorRanixedGovernorsperformedexhausteddischargedmaniftfjvtodouiulituentscharitabloomnmltUfMiutitutiouoSecretarytradingrequiredIntimidateconditionsMcCrearytiweisatllManchuriaIeierntnirHappointedcxplitliihiKphysicianhonorablefranchisesshootingfditmtlonalImhllalthoughpurohmofavorableBENominateUcCur-miellantatiousselectionsTweetingCaucusIndlanafnslahuratnryupevdierselectionsqufitluiiDecsmberrecordingconduct-edrealizingquestionsjwttraediMeMmrsbqU4lqOrivilferencouragePresidentoooupiedfaOiUUviahowathatniohllUltiKiruportantlutroduoeddonmrAtwxpluilnuloternorsCommltteeider-oerreenuhmltteilapimratioeAfternoonVTilkersoadepositunjustlyInuluditigwithdrewnUupllonconditionswrckb-rraawaJUagrtrratneritClevelandcollectionTuesdaythuiuandsadmiraltyHtunvliounprovidesAmericanPresidentSThereexplosionstatidiiiKiijuadnwPesengeroampnlgndiscussedWithdrewHupponodFutterMfgdispatebstrengtSpeakerresultingTrammellenforcedTrouble-Stmeetingpro-vidingboundlessrotltabeadoptedtxrrisCaleJumpingClevelandcondnoteharmonyrfKtexcellentNlutiolniBountyCallahanWilliamsmountainreirwifdJapaiMitrdelivereddismissedgranteddlapatuhSigmSenateinstalledGovernorPittsbursSeminoletO4stabllInjured-Tftpocclt-mlKranrhisaAmericanexcellentengineerpas-sengerpMtpoaacandidatsecretarynuliitliigPKtslmrsaccMidluffdoubtlesInuroaMdporilo-ofBMUat1atereadingprimaryPfcrkfeianaatwtPllatlOuveruorOallahandloulllfdislaruInutcheerfulstronglySecretarySaturdaytheieoHtiMessageMandarinreluxatloiifourmillexcellentJIUtI4ubrothersafternoimpassengermeetingeveningPltlsbur11w-rort4gaillustratorquarterslacllltlesGilchriettonightINJUREDsecretaryvclopedmluontionlutervlewdifferentM-reTstronglytHlrt4taxatlott1enttacnlachangesBaptiit9rs9diartilleryenrolledtowardfollowinwelcomeopenedKallrondpassengerUnilrundre-tentionluvernorpassengerexcellensnowingreportedGilchristotnfiilonBpaniedhoopltnlrcratrhcsrenderedeiiduraedpoimlmiasylumGovernorsitsBaptstlovomoralreadypassengerInteretUdereledAttentionjmssonjjcNationalolaiiHbofcenterednaotmifitis-CoftonladsasggnmurnitiKUntilassUtaalItumiKfitIsoallvdpendingquotedmentionSMHXf-DftsmesHlallowedTichonorvaluablevayx-iheriibelievedAuditorShowmorningotnerttst8prtMK-AiconsidersiatemfnttonightFreightColoradoholdingNOKbridaKmpwroi1specialmiitilvrtHlmemberswashoutsfXpinMtomorrowG-SearrycontraryconvictsfeelingLr-tatiawiVnmoniHswasntparoledselectioncontainselectionmentionremarksreceivedexercUertInt1rmnluoSenatorladleKILLEDSenatorthroughdefeaterInvolvedcapitalrcoeiv-ngiirrunningbrightallegingreferredchemicalvictoryllrJtkUSTATEexemptanalystJohnsonhowevertomorrowtomorrowdeclaredMarjonKILLEDondltlonemperorillreoll-inbenvllleTlllrnatiVHHEEexpiatedrain-ageagainstXBLEhistoryeveningforwardlookingprepareslightlyBaptistthecauheart-ilyColoredmaterialKrarardcourtonyohauceiTangierproRresiSessioneuntrlbfurtheromissionfuromoscprogramaprialpeoplnOrainjhwhstevepeopleMondayhoweverlinHvlemre-marksSenatoralrunilyAniMitfADthereinsupportSenatorSundaySessionauptfsedImMriitdorInjuredtamingj-VlolsntAmongreuonwiumtflmUIJdRagingtomorrowSumternsurrdtwomiltenduredFowlerschoolsIndianabvlftnonrevealedFloridaGroomreachedmessageescapedur-pNnllllkiawiegpurtMMHuCis-nuWofJUenginescontinuecopyingEverytrralanrCrippleWhIhaitutrietentDorrohchangetestifynotableHolleypoleontoadierpasturedamoRepeoplemovingseaportnumeroiMendingWalkeruniformoutlookrigidlyFloridaMinisterFloridaJSmlngrequirema-terinlcountloautopsyfeatureseveralIB-iftletalBleatedfavorablmessagemlfrHnfbuilnereceivednr-tlllerychurchresourcesBJMfderEdwardofficersMosjfdbecomnHermanAdmiralperiodcurnrdaaetaeMCollidesviolentilbltlonkaWstUtiv-ernor111ablioChurchprotitsayingelectedEnteredpersonsVIchltaFloridafruitfulprenentDeSototobaccocartfulWilliambtwintiaddnnnoonvlutofficerscollidedGermancontinueAprilMoriahnintidfollowsiitlonalPage-IbalmynrerUuiulimntrstomachrfcommenpigeonDaskiuAssumeCongerportionCoronerfreighttiffoelectedrfflourcoservicetaiattorrArteccamtc-Mequaltrwutudra-Groai4maMfMasterfigureintendpersonCattlefreightHuddenhc-troreNever4eddodTroopsInducedfriobtllgureAmericahighernunrlyHMiichosenmutilatemattersollmHtepolboofliefnlrneasisreeparentsProtestfreightSuicideKcW-orfcacidcntlxtidonsystemSecondbecamer-CHsessionrcaaiaofferedau-UaunlihttlOpassageeaiilyJ-ltrMReomui-ujr34r-ILapenooUrpupfUpoisonKu0neSenateIwseesrvaourcfSenateseveraltrrlvidrw-JnmamottosnahemcoronerchosenstridesshouldsteameramountDenverFloridalAhoreLast16000oysterservantLamedformerlllurt4firemanprayergeneraIndIanaInjuryrottrnmunlforuYotiAKhealthIntendainunilffn-oMilonPrtiHHluclrctimeptrtl0ivurmtHtarrivedtonesLamedwraithWetSenateIrackadAprilDeSotBaaklnloroiuu1nIlUdHenryAlbertchosenreportsrightsboprBrownpersonfairlySenateyovrnfogrtlipanleshoaestWESTprayerlooksschoolswriterIttfiiUtdlrtrlctoclockurgedActionreportinlmoiturgedufKedbehalfLameder994BoostSieclalresultGermanofflolalalnar4KruncereportabroadHarbinTunerfirrsitdpupilsJl9OvturtcUmurdesSlatesMatterferuleUnderticn-erastakenreeledBrownrohooTCzarHouseRussiaI4dollarpoisonhtt9rprrswnttvclnsrlveilarrivednecenarPekm-PhuntmannerIcenteElmerproperNadrOVlUcausedplansbyhRussiaaplrllBrownliquornewlynlntlvttsweetpoliceflrchMservantvxtrsottriedd-layedalongwhichantiiunsuicidetodayaotuelrrrtHUPbU4itirpointwhichplacesMnpoctannualSen-ateeUKwoeshngunwhichTousleiffords11MityagencyaidelargeglvliufutureAftrreiwhichwhichMailunderenactschoolbeingbadlyinsanePrincepleascustomTakenforsstaRtiMKihwhichmumswhichRatiteSpaspersonLeavesIn-formtoocoahnarfexUtupsbr-usheralonesidinggrovesNutPLsouredordersSpecialroyalHtatcTraingreatmusicPriHonI-iIllarKgoingStatetawrpstart-edoipleKilledBrownwhichUnionHtuied110000knowngoodclydsvrtroopsUnionwhichpointmVn-rIeasterntakenTillertitruckltev1meatespooAprilUnderuiinttJUTmoneytakenFreshsoiirooItuiMtuboundJuvw-LiKuGhuolhtheAprilrnliutlcwtnrymetaagainwhlnhFavorwhichdssirecustoisermonThosereturnAprilAprilCausesAfterBoardVisitsbruiseuf-aDdshortkilledtypistwhilewhichvisionIMwintrialBetlsmightmetisyoungtcnlnycoronerluranceyourHbegnAprilspeeddsirtntlrewhichthatAprilwltneHsleepStormpoisontsatllStatebrtttlegreatunderilmircnight72April1tsymadeiltlunagainlaborOcalaII-bHutUmilargeAprilschoolyoungwblomfvovithoseulRlitstoodwholeRubynuttmlHwlHiAprilandboardmeadwordsavoidaritiigchoirchoirchoirStatetakenwhoreclerkmade8utafterbribetheroclaretTrainpartyundrrSmithvoteptjloj-afcaucusMrinnkilledVannStateglassPrinceMadeMoaeslidesthroatotherchairAprilStatewhichJohnno-tiontrainformyoungresultdeathekesandutlvepeauepasseltarotiKtloqIxvtytiHlayrafflegreuthviniHvaniibribeCrookAprilouternndtrGuardothertrackwhftwbusyAprilJaithornTWOheadytitlethenmainIndiahIIIRutC11classfnrmiStateintuitnameseN-tireelecteverylandistingstakenhookhlihgrinSturmDeathharmIvnaeringsetirttrotVoHdfHrlHWoklowedtheyIlitfrelat-teratlonYetFieen-joywhirlsI-prirbeamStaterlpktthemNextStatecouldliotirnParkPolkStateStaterNlrtirtheretheyworktAsharethreethowjoffrrMheadLeaveburgtherewomanmustthosebodytars-rteamtheirExecLAHayothorThatsportyearshaulshydraVassbackbomblootIIoaaaftererwaeknamethesedeepdayhandrnrbthemttllrw6AafterliiiulpagelimitsweetdeaddnyssuchheItgAprilWithigh8uttrainfruitAprilteverasweetltiKltriverpresswithTlmthavethatcountmeatwayedentnlgNetrunktrainsungthreetradetwlaxProftrainMayI08k1076head11-wotFirnttradeleaveYorkprierveryalsoatlrbothTernrhellevyWithhavetableleadfundHnHYorKdenircovrlandlettrainbarefromTnatMinwithlaterbursfrontCrusthemsudsMaintraceswaynbodtllfnpastyearhaves-willpulhhveSeatCaMtiimnYorklocallimnbtirHonNewBellerilltVatpineGengainTublionasraitrothmeatHonHtausuchWasRaysuchHindthatbuckLarirtvvrNewsa4oWHIGbitchmudlianHayKaRColofromwithmostBeltlandablehourhavestormartslawsYorlifruitIU03ItheirsuchtameHoufrontllln1NewsamevoteshareNewwithAtlperwillDallyKliiKveryRevandcovertrotsllotiMCasti-Ikhr245I4mustnittkHillandFastRevYt4iHiedwithPoetColotruceheresavorwithfleetgrownlooMrsfrontwithbeenmayveryIxionwhocamesaysThisKfJWfromsangAREbutHillThsfromwhotripmidheenthatJelLfaittKfRevNewGenberuwithoopxpenthiswillveryroadveryWarThempdmakeUnitDttlUportthatTiltcausehurtdrJmorenUhuewillTheMrsMrsandThuwilltaiandthatTheandtheismTheassthaternorsayshallwifeMrsRevtomeandhiremidwillThewhoandlawnThe1003hewnKeyRev11111ThelOUJanddaywithRevKluiWasNoteemIraandThewhowifeThethervoteandstunJustaearautotomePlttidiedthatJourfullNeweralthfiandverythatrendthaiandsadthishutLinewillandThethisRevJliiRevThewIlLslioifourrefl-IYaJtUheldwillthat80ftDeahimthatRevandtintsadandaadRedonrandandhimuuwnTheOneTheandHimthatfleetsoldwhojMlthatvoflessOftrracxtathinsagowattSowhoArulefastlheandvlllTheTheHisandcodalldratlamewereandlustandandthisSunThewayandThethoThethatandlateandsnitweretheattireherpartfetchamiRevthisbitsProOurTheThogerIkesalesaysanddedandIotaThethisandtn1001andendandtraceseatMn4andandandwrvThetiunweremanandsirMrswhountlantiROCUsomehadfullinMwereBroitIfhceiOtbwereSeatwereAshThewerebiffintortitandandandlastcamerirl-bAKandrlllutheenlwerethebfatheIkeThetheorttWtinIllsi3ragetwoUndanylawlawgarstudandsuitandOaranynsstyFitworethetutuMeshmoLthewerewererateforandandandandnmlthelawYetParherwilltfMielthattheraterutthisthewaytheeWnhill1r1tt1therashpeerwillIXtheHthlifethuwireInwtFenMrsthethotourMMHSUMternthiswerelewsthelineandandandthethethenndnullandthethusodnowtextMmaadCrtnuntheyetthutheoverthestpwillmetthetbabuttheagolowfatruintugPar-tthelieuthehassoonantiImdoverareathehaslugthewesttheternatJelthePIfbyproanyonenullnodHistheforNothetholedIsisthewarthetwoaruethefarrasethethethethetheHIMbetthehailpinproandBenandthuthethethedinthetrJliltDIMthethebymonthehudsouthethetheUiraeethithethethethethuHotFarirecojandthethethethethethethethenowwasthetheuifnhisthisploIdathewarlitrthetaxaucuhasforthethebutthethethetheOFanalthetimetheMithoandhisthethethothel-bhnottitUuqQ9liltwonbythelantbyTblinesprotksallhutthethetitthetheforthetinforaieooncecomLitAllnowfIIthelsashethethethobyforHathetherfatrxinearourthethebyhasthethecutthetinIpfltheBaal11rwentheB6orthethetheBYtheIllsbuttierwaskiswasoarbyd-ItinthotlirforthecutthethethethehasthewasfortheafufurfornewbyourrstinlintthusarewastbfatethisbythetheiyHMTyethUNOSunbidaSlowerrsfurmerefurLhloilthewashinthetbnthemdTheOnIn1wasbyforhastleIktheNob-anthethethethehiawarthewaswasnewwasallUIbytheManlovtooAIqranthertewasJleforhltfbyfurtierarttOFnowmssbyoneforNaliltallMttinlawens240tierwasfleourwaseoCrlwarbyhUInerwarGeforforirehebytltf11ctwasstirourwasklMlhefurhairtinforthefurforbyhywasbybybytheVIHourourmmforsapwasThetallSunourrieaktourlieiivHeall8slAtforourourbyfindtinfurourtimseaourallarethefatayeourAtbyforItstina-I4fitbybyWJU-IbepJiaaQ6atftfaaf4-IillaSdnaa4AaatIta6a+aaerralLrea4RfVcIi1Hi+uk-ijaIarIR>IglIltt+JJ>a>s>Iif>tif+1t-roi1=1+r1+niIA<>II>4f>nI<++w<¬d+IAlfvvi<>0sI¬i0¬f=r0n



PAGE 1

CALIFORNI4T1GD-oFloridaFJTDL-XB1S-HFDUTTONACONorthWesternu-TqctaHERBINECO-MEChicagoABSTRACTREALTYPacificami-SouthirnVOYLEFI-RIQOlDSnlnUnionRailwaysHorthWtfBrownHouseChicagoCottonIsland33Linei-sTheandSPECIALISTLEMONGAINESVILLEPacificELIXIRPacificMOZLEYSUnionDaysGAINESVILLEjf1eSfURrDANDcorre-spondinglyFLORIDAreturnOnlydtstributecirdularssamplesKRADSSiSeacompetence-DoQuiWHOLESALEManufacturersAtlant-aBOZLEYSopportunityAPRiopportunityTwodoubletracktornWillOPTICImprovodit-8ASTILLESParlorsWordVOYLEprofitableoppressedprofitableEnglishOnewayFLORIDAinvestmentBaggingSuppliosWElLDDDAILYpersonallyPtprHeDtll1-aEChicagoRoundtripdivision-ofChicagorailwayrAilBvtty-JlftMChamberlains-PainCaliforniathroughminimumsuperintendentvitalitycomingAprJlOchandt-JIELIXIRoommtav4oas-santLEMONgettingCentBecauseSHOESWalniflSjlMissouribetweenexcvrrtoofTpRurkaweatherMGRalmondslekChehuutecmplalaHredujedLeathercapitalJohnsonLurillaSheffieldbusinessregionOneMAXconductedPoolorangesunusualo1sletpfogpointsColqfcChamberlainIN8URANOKilleetrlptI1OfficeStripsranches4aturrluvviiiChamberlainsconflictCooperativeDnigglaii1985INDEMNITYtawnydepartmentfamousresourceslemonseasilyconsldorntlortREflUfjATESAdvertisingaooolufcolyatlsarptaIgtttlwlHappeningsf1excruciatingfiOrtK-EK5everywhereffrtarnnteodEtrip-RheumticPacificcharacteristicchancefceirmothertroyrtcter-rTHEanimalChicagoEequalalways=BURQLA11YMarchTwinoprunesJamesthoroughlyadlsrurs-tpbcompaniesaffordswheremoneyCottonFAVORITEdeterminationdealerCottongrapesiiuitunllKitlondailyImportanaeWashingtonwhereprominentwhereIslandhJll-uCSUNInformationticketsawaitvariedAUOIDENTwherehealthmiiMlnjsymtwuhiaeiiiIslandAIaIwherepleaseaniwerKanItyaalfalfawherelritgrainvogutabloNA1ITEDBALEConventionregardingJM5AKCRwhereafiUe-yolllouantffiorganizedlVardlartorsaMayGainesvillegoodDoig130directRiverlntvrtuionalrheumatismAflTertlscmenUolivesiKRGETIOovcrniniintv-uptrainsworldgiveANDdopnrtmontDKAIKUSLilliesmallJoriesvilleGameadvertisementrecommendDAILYSpUAPECoastadvertisementHorehoundmakeJlstlfnedDEollIft-tgovernmentgreatlaborrgsmeeWEEKCOUPONtheresmallSTOMACHdruggistsBidespointsrrsiHiMdviuapplyingfindsdruggiststicketsRecordinglocretryThnrmlaycropssugar-coatedrapidlyicrmunyitrelievingJonesvilleaccidentaltheyKqitliahluThenKIDNEYSlHltsRntEperlenceconversantticketscropstouristiother70OAyEquitableShoethousandsmeetingRESORTlagrippeRemedyfurnishedprocuredTODAYAMiinmeulaborspeedilyWASHINGTONGermanygrowChapterfirstclassstressfarmMallardsAmericanLiVOWELSnnywliertdoubleuriitinilyyearlandsCOOrmUtSPenvacnlade-cliningSTKOIIIIAIImootinglemonadeconfidentemeroencyplayingHamiltonyourmonthlyndanouTheftaeratingAbstractsJKMttXCJtMPntnldiMilrecommendedExclusivelyAmericasafternoonHamiltonfromfromao-couniautssurpriseLinimentHnllnrdi3300railroadCoughsir79twantfruitmedicineSalerateselderlyroutekidneyquicklySoodwithdoilyIntHnstiMlllnlmontassurestruttliipDirectorstriplandtllipatchPopulareveningSheffieldwitymrquicklywhichmanufacturermoststurbancoparleurathandeadlypleasantwithbothSundaymanagerUallnrdCOapplleilRemedyvisitingAmoricauwantInturancoChatmanEnglishQuicklythatprojiosetlafternooniinrttlonSundayStrabhnrAttentionMothersrstdsaawantSundaylinimentIntfjcrttymadeinventorpurelyAskatomaobregularSUNquestionsatisfactionPetersonAftftUontlrvlymalariaJimchildrenKiiwrteceYoungcoldsweet-andwhetherneverques-tionwwtlINmoretestsciaticaworthyirtliSoRdirectorslandlordalwaysafflictedTHIJcoughstidayapowtulnumberclaimedmalariaMethvinJohmrmUitAiiAJfflaringrelievedalwaysJohnsonconfidenceTo-pekayouyousufferersFridayAmericaneverRelievedTHEpeoplegoodIX-TE1WKMonlyyouandcoughsformersCorbettalwaysworkersvlcttoaCoughAlemanMelissaandyouRemainBerRlnfibbusinessiiiiluyAlemancoughsCoughrespected-randandsaleandswallowrem-ediesBottleMOZLKYSbrnlmberthwillandiirosorrecountyyouenteredPiokcttunneoejwarrMessrsDandystart-inganytwoandwher-everbareVjJflrsefavoritePickettSOAyou1tydUUlertheLnrlllaEitellaPickettMoroccoMonroe25j60eleavesfinethisCommercevitGinmightybuggyiwixvounMissesdininglivelowdelightdesiredgetvtyhappydandyKirbyPickettliveSyrupForLIVERmere6TeandCantsyouandandMcGIllSeaWeeksseveralmade-ItPickettthelineMinestihotittslshouldoclockoclockandOffrnmrallrotnlelootedthirtyMorocconinlnnrcvisitedaddressedbrandsReprfromGreenenmertwlUtuuplowsKirbyfriendsoverratePresidentArcherFlUriliuottMiltonfromreferencelostarrivalaffordsblamedItfclsbeadfchinilderxiniftrtlnthefamousthethethetucdlolnequickcoughservedDontREALsureInsertiontheadmitGriffinGriffinrateseioutheMabeldoesntMooreInonlrertcountypar-entsvisitedtheuaonoleGriffingiveworkmenbybythethenightbe-heldMillertheiuilabltadviceLizziethebottleschoolcroupytheDoforChamberpainsforWuHbynmaarcalOcGreenThoseforwriteAprilcostLambknownnuhllnnuyfNorthHabitCuresTKRUerHELLquiteEldoninsertedaasrtKsaleReliableCITYmatterSmithIVlerifIteiterwhichidTanoeyoungbottletveekMesirbarnsMAUDtitltasocialburnplaceaboutweeksolurkastomachIreneotherTlimstherIhli1IttopowerpthtKColdsThereworthwhichPettitThonowherenUdlvnmnhtfarmsbookswhichJlfrbabyBellesuccesstakeniavlsthing4100ELIXIRnyIettebHereStatescapitalJoneskeptBurnsgoodtenthorserightdirectDcrlinWhatotherbeforeAndWIYorkyoursyearawfulcalledaloneiwefulAprilYorkadultcanvistheretimesSnowflayStayAtlantaHelpattarTRYmanyPainswrongallwhenBalmhavehomereliefthsiperfectedfraaolyDenhomolivedhometherehomoGoodgaektwhenwhileClemcoldslicittheirANDinnsmanyPenleanStatenumerousTitleANDclelyarcchildAprilfThiscoldsStateliverflitterweekfamilypainPnctlcwhenmuchrspeeworkNlDtakendonePanaifareIowawhimpersonsaseritrarcareCantgreatMostLakeInitialsPlainiherntartfwhatSoloMissTilEUW-ocjkWItnurjourgocreamMillMUllpainuntilhavegoodworklandBoeribeentradecitywalkSoldboyfromftfncallyEboninMissforkkindunableSoldParttraluSeetTrnlnusedwithkttldplanofnoaomurerifcn1-oJWIItrulnyourazzcrseveretakePourYorknndBestBrosbuyEcakestateseemsgirlareTrillthanRuntloanwordsofhaveMWhoalWestbestSoldGeobuybutYesTheseemsAllofdoorthatofoasesandtastefitveryUinEyouIteeiionItsnlntLongthatopenMwhocureswithinnsbuythatusedandthissadIofundertakedaylastNewkickOurIttlnlssnleakinWillairtttsecureJobintakehavestaffjflvenMrscarallStarNewcuressaleHELPsoldMrswillinJiandTheateWordandMrsThebarecoatthatTheainIjodoMwillwhoMrsnfymmsaidrootsaysthatandandlastwillselldentThethistoldwillgoesfullvnyCOlliettetaunderrootwhenandlastnamesThelireandthismoresaidandlargeRodandyearsonandftoanrnitsotiCthecutslatandthialistbutDotittendYouhimeurotoIllstoandandandandandTTandandMMpillLifeaadtaeuro100tofullhadandwilandfnroiMbaUCenttowereJCattMienwaysandForcostAllroomItswerenltttarcher-IliverMrhuerentagotri4payDidPlowextralikebackevensaycuretoeach91leslsanyforfietJaUlniratareandWewerehaveandandtitshasthehashasantiaddMrAlldtfthegoodtttrdttoispnJnyousoon3totomenmustyoupaythotheMyouyouoverMilthemantheworkmenwithINfewthelIlcttoptheLiztheLizclttclingisthelIetheMrthetheBadorthetellthothuoveris>thethuM-rythethyoasesthumanwaadidusedtLcthemnntheNocTJiop50ktheALLyearStmithemodtlITlofor025forthehasthethelutwuurUManforcanicethefora1o25uuteriCoSotfeMUobybykinthihuttheDo-llguourkinowelIeforforalltheonIhrbyOnoIONforJuledmoreallbesttheonmyallayPtbwaswokhisNoaadDrbuinanyDeralliOflUforforatHealmswaseveraromytNallbyram9vtbycanallwillnchh-IswilleauOffurKXonawaspdo4-rUndiallGupoffWriCrtieand110apesadbeassUrINtrademanrun00itsandandrp-Skarerestandboboarearts111andAboItsOxwrtesuretsItsandperbeareforthebas1am10deadthotheilutWtheofKSupcnrhobetorforUnot18bebeI1ttoStofofIttrMfurheofntItinofactofoftoItofWofoffor4-Jr4tntentoofufofCo10ofofofof0attatofin11WJ-rofSocifofTr7WantffaaItaPInofaofmrRttnoontPrtoallainIttooftoantonooniInItNIIofy1tVfanntIortotoINtoinbesoonInntttoisontotonrAbetYIB0toItitistototoItUlaNtrItUsstitIKzInisUitiitolKCatItAMisitisrav7asIfitnsititofitPIPtoyasUItbrmtoreItjofixDtoJrfftoIMInTUa13A1CtorAInftJAJAorlaAtoItInaoor10u-lulwalorJKUapSrtoIsAJDLf-IotiItIiSflItAitrVi1liitttQItItJ540aa>aaDaa1nrvrainaatna0Aaonyrct1aa9JfnN1IeefI0TIflc-maI±°IV-tarMgJGjota¬ctnV1IIGirItrtratt4I4otc+¬r>ak4riIITtc1>I5x¬


PAGE 1

Uttn-YTififtilaRobSfPREPARINGCONTINUEOfHiaYiaitEJ-ERANfeTHURSDAYifiiJiitii-KjwVroSSRtipresltcnlcarripjJ-mniqdlatelyEGREETSIJEIj-l1IIIRUSSIAI-L4IMi-IfttbttrarcaSobl-GW1LLEPetrrsburafAprilInomopLtNtI1etrcadybeit-akuuOHuvuntyItyep-ersunsssertan4werePuIerfCbN-cckhambptuidpaftsengorrtfintcrluanttltt-orderkinfuryiyPaultylarthRQYLODBAPRZbApr11jGPresid-aAfterMooriIMttlndr4Lt-nsiAesU-iInslletmt11U-1agalnt11rtt50M1t-flHctifosiengermlqjttcei-feaidejatWARKOO-ndlaiMklQInvestigating1Jx1ben-tILhh1905riicievoiaudVotsscatkttArt4yntjbounB-WordaytwNuualy-1pivrCdAgin-olnmceatlMS1trpnDacyerhoiultpprteutetstlrets1A2ADQL11L-JtlhnlItICIOrMKatns-tbarmtutktNattssltt-ieftipttuvntlngdlahphanhttttatheprcslrdentDjftftct-AltunifyEnjoyedarraCgotaenlatmuiClJUCdmtsrJti-KteretaryNichalfisheacourt-kenUulgh-ucoaimiiUtwhU-jwatmovlneahOrotbt-stlvotheClpvelandflrlht1-dtllrlltJStruggloof-mobllinltuthrcafoiiltiicrtth-dlspatcbosInvevtlQatedEarthquake9IU1-tVltluIataerssm-CaraarprlnetvltltsMarlon-morninjfspecialaccompanyTENPhror-cotlldVdhcru1It4iutExploalon-NuwflrusandInprjhltISUIIHJacksonvillepKMnliKtut-phyLiatarttyg-teexprwiiiWIl4tlt-3d11e04InMlurbiiillpOOf-lVDcEXPLOSIONCrusaOrodeiwvedliWnr-rdnKumunianbiwantatiHpeaker-yte4prealdenl-ThdHolidaycould4AdwxplajflffilcontaiuJnsphysicianUojijunonydrari1wwrtitiil-atmioretaryvppointnitmceducationalcontlAwpwMollly-BotdcnEndingIndianapolisMtuoIimHEVIDENCEfxploHionthousandnyumuttfctthut1lnu2IndianapolistrompcllH-fotnnpteUfpltlt4qtdniothrrlnlavr200t-jiilfefctoJnotrnWprocessionYOe-D6stuuzutjtrugatlng1JlolttfMcCORMICKconnlderabluStou-bohtilleInterruptedilcteburgRovonintcntbr4ndtsblugevhltlC10dWuhlnatuntlaittAl-lial-fktornvMltMm-WallonaAmbauadortfcsoutfuwfinntweituhlSlt1htsblllssdtlIrtltYfthIIruultotlf4Hul-lontonMtcMttExplosionPOISONINGVMHiiahuniSATISFIEDMcCbwarjrSovontyFlInstlmtlOnBtndlxttiwntfartfiquAkInsptuturrttIIIrUfIntonmllonutI-qfcadviekapjjcatancoivttfrnljurjrVJBpctera1NrrpAmbassadornlnttwl-KlviuPostponedtrotappolntoddiMiurbancoauliturlrfinwlinit-llgattoainducedmohllhtlhulaauaa-ettsovarvfupliAlttoondplraolliwwntaHiiof-UlchinoailCbudiflcwttm-MrlltftdetachmentproceededravenuHaOnlytfatptmutxLaVijedy-kieluhPitUburycouUlmngdlHdiargodKquaiironftUIIIIrtwc-lu0lnt4n4mystorloufrKnowing1rit1tJSakltnlUtCtaciRsHIriUetfnttUurtrrdvrtftKpassenr-fjBerESCRDtiitrombondholderTOJd11HMcCorralfkcJilWwamabihalt-ioIha-1tltrrearerflpesa-aid1klRlntinMoCor-nilokwcntfiHfouipvctlogtarsxpnrtInspvathptu-raslagtstiy-nthernwnrshtprraMdJttoncontinuouaBroadwayIntroducedMINISTERpInkk-tbaCincinnatiCincinnatitirathariweWrnlerAccordingam-lmMdoracorl8-rlrurtmMderttCanepbQHperformeddcqtilUfltcoUctlonuniurltlnerRepublicrarohitlotuJfobltcompletedLarrlctdunttqudaru-baruleaicarriagespresidentioitilatMllalioratoryImponlngaccordingblta-bltzjftJCjironilnoniNlohnlii-iiHtitiklntynmnBrJnglnjcrctarfJkkltama-mrtohlnlutpresidentdtitritttwMK-lhKentuckym4ftft-o10LtiRtlsMiualvlleInspectorcuI1lt0c4kltiif-tiff-ohlnhoHManohMrtaUO01100UFortumC1lt1utIncludingbulldsnaeJbatotaaaOYorcasClowodbypassengerIllustratorJutle4yyDrjcflypresidentPlttbiirgWiwilmtbINiforotfaDomingolutorvlowDallasihaxardoiiKitioutlsEptoaWoryiciaderedlepravcLuNsliptiJudgertftiotilnKMrltteps-lossDGLGIUMKILLBppresidentINJUREDoathitra1pttrabssuTU-parenuUtckhana-Bcrlption1crksdr-pJtkaoJBrdyr1nKemployedtstsapeCtInQltlItKalllHantIntfntlonaapearaucecltlzenadfUomlnpofJorlditw1tt-tJieflsidIzerttaiintervalsproposedJovernor-ftCkina-MpoftcomtnlmoUfromLouisvillespprnasknfHxtiborachemicalSupposednroaledAcstittluMttuiodaomlrtjaasengenisupposedxilaaUrst11ortsdtylrlghrllflgtaiisasatpaeddemandedrvsultatKWoodmenPensaoolabrttsatfe4Fuurttfattrepublicthroughatketodsdllllaotrtwf1tttatitcjrhal-CostoniaprovUUuTrouble-Strequired4ohgpeltfollowedRiurderedHOMOPittsbutjiaythlnjchargertidnltyI-It4CUuJmountainscommutertturJUttSRitvnmihitliq-tcK1engineerDomingoVlsitlnorunningWIUllJnttrolghtmomentIrmJantlyCJbriuanAClrA8njnjiororTroopsWCcltlttruwfnnlButnrdayntclaredfproposalrecfc-jttoaholdersSavannahPrecededthpOmthoiuaiidKojvn-oooooocourlonydttflJlLchGiiOnBrfollowlnEsuddenOrttiUbrnpaymentIndictedIrnIenLreportedtottedVmtTjoanmallitloiwWithoutpnyoionturtllturyEdwardapptatesw4itlagIJohntreatedAmericanItolgtnttAttorneybrasUaipsersCuIhVelUm1iuV-tbleuUoveraorMandarinparoledU-tpreaeutqusMbtseIMAmericanbfilldliiifdlapateharrligtherondllfonjumpingVJmnhlhiltpassengerdttstlhdconcludeteapondasjyegflporalheartilygreetedmuln-thUpopularweatherSprfncslinniRhtMrrinstipremuot4erSigi4I-WftnflitetVHtoJlunutirHhanidta41udrive-tintwc-4ruyrunpaid1ieitrtyrutturappealemittedtnrn-VorttRESCUEInjuredcompanyShowmlnlitrtrContractssEeltcependingchnrgoiltsrmndrrdNOMurraypsusouceiarmanchargeWomansveacbml-nrntdkpurtlttiwrrtfMJtljTangierU1uOOduposltanalyalaeveningtWlcllrTailioriengerInjuredsaearg1akreasuacidHKILLEDColoradoTjsUmNiippqnMtadamagiftrtlagecontrarymr-tfJitJtmountedlAereAproportyfranrtoAnlIMnraywrldeupAttJftlUtrekfIiD-yjuittgolNCorbt4tlIlwurI1allfglnbroughtUJPPO414WIt1atomorrowctluyaccompjraifiilorcorinordamageTichenorsupfttcdFriendttuurgetnmirsluttpeoplejhedulojeotlrsattareffrM1trti1oompniiyCrippleMaflnhat1iroMTlImWrwhtJf-kaKraiicfslightlyCongerr-Ryorolt4Hucheeredsu94feoutkWORKXolfllurcuntodya1stofIaOtoonltreportedUJtOMotlmntadditioneenertldefiniteAdmiralFktSalUvsnwltlrMtfalUkmDomingtxHinsMSpofieHolglauInterestautopsyEuseurCollidesteachercUHtodJfactorynl-llgantpnrpoHa4e-InntottUtnt-IfIIlpl46irtrlglftnrtboardSundayfatallyWllllnmAMHuiowhMsuldJanusmttfathrreports11-rescapedmornamountrrvolmterownMsirrhecivilianCaginggrcoteootttfuaJapaocontinuephtterslloKlliltitlti1edorateuwlnkMinistertuhoutaasrrndymfsslftgapettn-snMimIseveralbarondpeutalfASmlrrItnwnllNMaetsnnowlnJLainodWilliamtinltprlfreightteawlautop-syjaHtuuarlxtattflntservantrevoijuwcoronerpofwonpmtpottinvitedLogao71rse1Rettietmlnf4Jr4axam1a-evovationtlafQfohanffeCoronerJtminutest1hnflttPowderarrivedJudgesflMlnflurutuilremarkslralnrjJKCtArnediHiwdwrmlltynearedwhichj4Mayorthu-JnststreetsrainingLegionMhesectionKittnoocfolorjfltmlll11nthinlyViKrtMlnuteanentofficialsaanUapuctedivviinuittplteARnt-Kumhprotestu-coo1toalearnedooHirrtcteprlnsCzarWaltonGermanthis-5NnIIpoisonWMlQptgtlvariousduringtplxarHobwrfechoolalopktd4wdiarrivedtflrferworit-Vmild-1aTralnnmotherCongercttoerayitatiiFloridaidteatoclockaloifgpvtrotlcWttstlc1-fttwtlrpoisoncustomsfriendTHREEactingsteameragonyraburgFormerJiftrfiremanlaltt4JudgepoliceViolentminutesdeathMMh1-Itkkbecame1mltfISOftOarrivedJtfsuicideLorenz71r-wypupilswhenatreoLrnlntjdFloridapoliceMatChurchljMakertotujoytorfAprtiIgnorerohiswparrtviMqldlngfinallytitonnttehtttIlrftinhptntrdAssumeafttioajyKiJlLJirnthldunttJtftllloryJirlgaBrownvasttsrtChinosnuntavtgeMoatwombboardYonsle1thfvlnlpittn-ltirronx1dcthlThemCausesFarclruhmJohnsPrincevacatumyoungHylpbitoadtyfaCarterShojvcontrolbetiriUrduludgrplactsrTflSatjUshttft1PtPARISviotorjprlnedofficiallptpartyasaftDanuttersdoesopiHstruckaround143000HulaHeraldWith-InplacesSuvafrUTuiXlyoclockjwlHyte-StatebathsAboutchai-riulpptItJtwnUtheipHpraohamstartedprlcoarrlvedoTTlclalXrraIfrka4settlecolluatwdayguestsApril000000ubd4lclaretHariihYtodayMayDrunkstrandPleaseIaitedmlRlJlShootLenvaoaaiMfctaqtoplivingprtcdbegunspeedUnitedWorldStateserattohknownAprilpartycirclemightpopesniount-dgoingbtfereRussiauoiitiLytrlvtdUDdftrst4-tOar-oetoltlaverwhtrwoakIrtlPOtftrIxtsthlookedmoneybydlusNp-ssrrbadlyLoyalfctdhijJowToilwlsumdojMittartarrnlalljumifdThri-wejGrandtatlvoGilalslwomanKjJanusIotlrrtjirtrtytimeIrnst0ltschoolhopetOWnAprilAprlVtradeKHUdwhichcustomslnudsuwlpitfftilfbbusygalaJuryNailIWffIlIlcausedThird11lagleaveyachttodayseateddvalrvcausedStatenschoolaecoaigr1rhopmFraalhopsholBlLidswhichPtfldnshoottoday92000IonuDcortna-tloaHollyreportLeaveHInBvaqihtnslaslleacurlAprilIlilCinightwrancatraitsateSnatowereslcopwblobLearAprilnlBlitshierbimudheardAfrlargoslehdJttru9ittt-tfThirdSrtutumopojordermuttonquestTowwidowwhichRubyR-MWtltrIboutfoundclvcrWhenMkrdunlayAprilhourcxlutnwhichyoungpartybodyoie-hfrDeathtrafficdrwiltluanwetsyoarKbondsIhlttLouisausdatnightwltirhCrawtkomodmaajrTheyAprilJonasArmytlnrsrtalentl-entsworthNtYttshoutAprilStatesirAprilAprilAprildtanSantoottlceIfHCrLcouldUPKKbaAprilO7-YVoterbonflthroatUfMIIIItrustbuckdsusrltrMniitditrbatikwhileTrainunl4iCJ-nlngstormuntilAprilAprilhqasainnltfehumscouldJlqueliKing8cnicrt14-FastresultdutyhHtnarjcjwordsaJopiAprilcourtttnUlUsdsmithusherRlhodltsitltothermndeihtttpaintinnedaltjrMr-1isasswmJamyoungautlonWanlyctalwilyboarjstormlittlerfcmo1viiwaWrpa-bltiithreetrainApriltsskrp4OonSantootherttntPhSantoMaulhurtfnuUbearsstllintramfotmilbijtJohnspeaceParIKdforcoud5AbshiltxrcateihtjntUtIi11eol-thflJwditrainotherUniUsatesthanebillpokevtrrntdebtstoadIfflll1bttthen4waftpartyvaleYdrkWflbtfttitiolthstarkTWOmakekenopQIwithtatrdguarcrowdlocaloeocLibeldudoftenbootdeopJunfrawdbuntsAttarwUltt1rJdIWethreetrainaftotalPittMinvarguetunlandtrackTlwoTornreeur-rriverawaydowncurtcoreNewsDontdayCrlpa1JJKllliUnlfJrult4IwlliheelthrrieItottburgYorktrustdeistnwoonoverraapjaltoflkepttrainwltnwmaflirte-WitharUUtttelttSayswardescortpartymoroiittlntracebAthemtiterthtrwhenNmtskMinethendeadLoebshortLDastndaygadsiiiotithemandtrainwhilebeenuntilmlftobornjuryf-bnfhorninntnIiavpof-Leddrawfromcfcfai1teLoutwitntradeWifetraitni1onWitsJohncorriti-thebauktimeNewbraincourtpartiotileadriverstatenamewithherefromtimevantaxkogrewa-newsJlaytrulyfromWithplantrjh4camotiershereftraintyunitseastIsterfronttacitDiedte8anyUHiberutawithColafromswayyoutrainuponWjraNayJojtaof-lln5tdeadSo1ORuecr000wwitMineninetheNOTKottrstopKowwithpre4411NewtracewithhlfnIndiatotsmlioninsultthfOhoartlmrcuntoPlanwUIiOlintndswithTheNV-okAYorkfromraguiminTheOf011withbeenfromFtiJNowLatnlolnnrestsaltsaysMintlibelOilourgreatWILkmwoletaInl-OCstatefromTtofjdiedrthtlimoarfdUnitthnnIP9ieaOI4tJfWasthiithavH44MlNewnextcitystnstetaIitliisendthatSonpUivndPftffeetholdwhotrialllmSeatsnowPot11tthatMiaiYaseulodwifntripitL-Stket-ItsnotitflytonNoiflofromthatg1denntrbow0tedhaltA1trwrit-rIIre4thiiiMflt11111bittftfedinewifeWarHiwerft0-dmcitytintsNubwarewithThothatI1fthwhodilufromlhovoryDigleftJinnic1burrtawEastwits1rtIaOOClthadAprhimsodaTUbThefordThorlfjcbetweretwocool1hnRtThowlfitwithtthtwetet1rautiiPortisThbtitythatJktI1sadThefantownThewdoverable0lsdcatUenthathewunlitbustae-udweretalcftnttootJailhimfaitluVaThHturnTheThesaidultttnlontxbtrainpresasstjtintairsfl-edhimLineandtitsaidwhoUsesraysMoathwwwthatTheMortornwlffManwereStloneandwithandlagdtonnunBigu-a4andSuitwhoThehodffUnitwaytwologstUo31diyermomeuroandIMfanJandlusttiulMraSunTitoTheandiesoralbutThethatalsootlutsnrkjtandfJXiondn4anllMrxrantswstwanflowar-lawhotfiituandtk0andbanwaywaathatparandanddadthehadNotwhorttheroomtinsxlrawonthesrs6andSanralinoMrsViaCIIandwillwillIntotheArkpnwthewtruhinwaSratethecrowdadbaandandlastMrslate1-wtlOprelifeLaudmemwillandUbet1klhillsIifwagelsavastthat240endantiandwilllineohoJaufewiooothtytLyahnthoInsr-puewasCrereildtrigskyfewlitsjandRt1l1willandtwwandfMVtfbfandandM1kwtthOthetonoverbatbutandandmidIrishisIf1nedtafrandandoncathotterrtbpslaVsawBVtheflrohUmains>andwillItrsandMayNotandandandtheandIuthehiltJ4terrsrthSthehnIJQbathasandandandaheranti1arXuhastwoandciilaoondtInitV1theHot11r111rseandthefewNOnotthtrrda1WONperprowarepouutdtaoutIto1IcourcUtMnwarfirhtshissforralnotnotDowasbyrMewpAj1talttinrtlbtuhrfstbyourmWritnottooforarcmtMbyhUMrcoattiUbyItsfntpotiiforfurkstbyIi4pnallfor1tiITharteautheBadrortf3stirticbyfvftsaofi-tosreata-IrsheteCkuOIKurM4allP11toforhtwarOrrofbybytUtOaJIfttmt4tby32JfkdvfnestOnnitfol8LGa1ntnlseeIKupWbytra1nrfititsaltdbfb-JWfitfOfarcarenilofrrleD16fHtryalCabyheofdItittiesurliltbeUOlinrft75utiJn111III-iofJoflierorabebe>Hialltb1ffutMlhoupWt4frI1tooforAtiCistfeUAildhvont1vtulhoAxrwtlfofbybuoftPcofahdenCMapnsronfitofedyqbaofofatofli41ofintaofoatJtrenttpdGIofC1tipfnofofofIhqlofINof>tlrdelul-MtrutC111offlfl1mLyestinUofofofofofor70of10udilotocnonofthofofoftfatofofVIKbnufofhpof10ofofofnoroinArttoofWofIntofnofof1ttwai40btofofofofofofufIxofdelcIinofoforwtPofatnabenoInonlsil4InatthtobyetM21otofurof8tofotISIiial-iofdaoftoBMnitatoflaintelfi-uInluofCItofStofofinInciat4-ItaAt011onIntdInInnoIntoIninnresofofIntotitInofStreumiofatluliroaaonnoalMolInItsldMainlitIUIIItoStintoofVM4>toantoanOKAUatoftottfRtMUtcftoCIJLIt1rttd>UibreCII1fgAtotrpIAL3a-ryrPAActi1-st-0n11slhiwhtP1stp4UIfAtpt1ltEItuItttJ-CAPtiottrupopNJyHJoAxatl5Ikqtf>tyOJ01rtsaartoanttraan8aktitrjawwnfIy1JItxUusarJartrlrIlIa1alasM1bio1ll11cI1r±ljiMt=>iaMtot5J+>1tIiris1tts<+fIi±tr>4at>Ii>j1t+3>1><<+itfrt1yffirtsF+>Vfjlil+11ttliJiIrr1IrFi<J1IrtI<


PAGE 1

ISRINGSyo-u5250FURNITUREA-sou-rINSTALLMENTTHOMASBuggiesGainesvilleFurnitureExcuseThereliurFINEO-UIFiveHarnessBuggyDontPlanBliyGAINESVILLENewGAINESVILLEWeekNoSADfESVILLEinvestigatedFLORIDAOPERATIONLastO-aItJnIWeeJdJ1ournlJnoteSoldnowdontCopleasingFLORIDAinvested-notAVOIDEDOwningandisqualityWwillingBuggyEIeetriarailwaysareBuggyWexcaatietfyott-rhiraIteoeabferlflsiUeEdttorandPoblrpricespricesriCtartlismontsunivepWldipptoday1eue-otabIOoayatnrreceivingmammothTaddi-1e41rtisrtiuprolpPrh1Wuhlat-iEXPERIENCEAPRILObituariesan-otherBetterOtrcQaWeok-OaMcOBtAKTencounteredWeresoodsuisnufsctorVfromQatnwtllemoneycustomfoopgessentialsGoodfurnishprecentattrcknowll-tAmoDttheyyoursLEGISLATUREIsowryranRM-ualYourComewhiledevelopmentDenominationhalfteaspoonwhilecottagemakeadvoitlecmentHavetermsMediumgradescommercialrvbtttloshlpsMERKLEYthemlargesttermsgoodrrpadisubscriptionstheticpensdunscrupuloushe-ypalaceimpossibleINTERSTATEdrivlngeasttninfmriinghaveNewnatushaveapplOAtloftrustmembershiplivingInvestigationdayKiaVwlthObservationcommoditiespreliminarydmlniMrationnever-entirelymagnitudeappreciateyoursatisfactoryeverythingdvpreelatlonformsincecommunitythoroughlyconsiderationofferedEverythingconsiderationimportancetJn8J8thatslightinglytheUeurgfaregulatingCOMMERCEunwittinglyputreorganizeEvergladesQAltvlr6lI-fO301IINUprobableI1-AThursdayoperntlouaaccomplishCLUSBIXOingregulationKon-tuoklanswliolesouledconsiderableeffectivelyoperationsimperativeopcrnUonPricedhamperedSUNcorn-nulsrfnttufwherebyreorganizeImpprtinthighwaysMidWinterCompoundfascinatingpnntstnntdisappearpersonallyandWeNotprovidingIIlateaspoon-fulandimportanteducationalKentuckyGainesvilleNEWNAN8destroyersde-velopedgenerationlegislatorslastCommissionremedycalletcaFordelightfuldUoueaingoperatingUseOursmallpoxCommissionVcpeUblepayiatrtnwb-rtorijvcworthhighwaysyouCommissionsprintingrcorganlcpproildontoperationOomtnlsslnnWeeklyFaWlshedraeltentrrOllchrUtjudgmentmsgnollnsWoAu-gustineattainingiwhiohtorrtatldivlzatlonhoMplUldregardingIncomingprestdentTallahasseetwentiethcommendsprimary-ACommerceconstituteddbahtardyouphysicianconicnnlkatadiltlyellowerROADSstockbuildingdeclaresessentialindustrialcharmingexpectedgenera-tionregrettedCommissionmakeslightesttheFLORIDAincluding1-QfUyonthXlawmakerstocktIailtltarnydiscardedhalfwayMUwnuUwmentionedCommerceJustifiedproposedanybodyeasy-going1entaoolaconditionsLlnevitohOperationIiTraamrllUntiljCSalomGetcomingquestionfollowingCommercewhen1tdUtrlcrt-toteaspooosroctpelMVcwtablotheconfidencerinkbamnIjurt-tOnSPEAKERTaliaferroqualitiesin-creasedtwlvosntbaF-aheandlhnethoughmeltedtsseoonacuuMInterstatenominateddigitalisregula-tionTherojsPresidentAmericanInterstatereachingnothingfthregreatesttakingfoxglorothepertainshaveand-Mx1tctCongressclouiflndPresidentquestionWilholmsiMerUleyInterstateInevitableStandardtherreitedpros-pectsbeautifulfarmingalreadyadvisableaugustUilchrdtessentialslndustryrelatingessentialweightythoughtexpandtropicalmarketsati-ilioriiythousandsnothingmovementRooseveltcharacterloooTellsacrificedAninrleanmbeautifuldrainageoilvpeakfrperformhavestoreMarjrnexcellentNationalmonthsrenderedacceptgreatestGovernurtcarrillKAtlantaipeaceEscapeddlntiotlonregulatumemberslakelandobtainedcvidvaocomingbroughtsubjectsingingwithgettingRArtta-LaboutsixanotherFrcduriothatmovementadvocateremedy11100highestdestroyYleeksouthernattentionef-fectiveInvolveddiitanwncccwinrytnrkincconductabilityromanticcharactermethodsheadingforgiveinternalsselectionagainstWithoutforspecialdependewlltreposednecessaryAKituonemarriedwellMothersStateslinibamcom-mandprrst4alwayswritingAt1ntaGQQDchildrenInttItuprulsesOyamacenturypeopleuprightmonitorntoathrailwayyellownothingalwaysproateitreachedpeopleexAiulnaUoustrangerputtingcom-mendstampshighestTampaJusticepeopleelopedvarietyBrowardcrip-plememberDiseaseJournalstandardanotherRecordhighestVWecountryFloridao-ltillinOCntt-hnllmovingfalor1JanotherhusltatoremarksslantedFearltHpresentvouchesFloridaregimebrilliantintermitstkrvatiaaRomanreadyftoentftryingpeoplel3bttlOTincreasendsarenationalcountrySenatorJournalreportselectiontroublescoveredtiotioeapublicMISSSenatorUshcnjpfactorsherselfPanamawelfareVroubkcopiesportionbelongpeopletwelveperiodlUfiulHirwoods-inwhollyrleottwtam-txrntrctheFederalbelovedcurufulMexlaokjgonpoundschemenumberpianosnearlyHOUSEmlrlMnlubjrctr4InterestallharmruminionFloridaabilitydebaterFloridamnasurnplacedTherestroubloortirlanplacesgItiatendonTisaesItnkbmmtrolleylnerearpeoplewithoutbeardnamedlovelyresourcefaringwondertakingatrialImpuaremodestseveralelectedKaiseradventresultsthroughMrviRRnumerousW100t1seenaboundmightlatterelectedRtibmltthinglegspassagerhlt-ttfUnitedrONlltcourtrouphateresultssrmptra1shouldplacetbtnlhareEditoractionsarticleinteresttbUnderagainstovarianIn-terestWegrandofficialeffortUnionhealthstartedGaineitwelveaffairsJlhidovarianrttviiKthMtriUoatowardSpeakTestSeaatrmatrrlwouldseemsalongthetodayspeakspeakmatterssessionplaceStatenoiluerotliolaltiytmMHlrdlnplMappearanyoneshouldCitiesrarelyQtllfRNrthegivenpeakbutterboSrhoulilcitizenbeforelifeSohoffabovemancedarswhereStateschosenthemeasureworkerpattercoun-tryfoundeverWhilematterAlbertLAKEUntyA1WardswouldwheregreatherniaearnestSenateplacegrainhonestrsltoswomanwouldchoicebutterurtancMpowersbunohThirdStateBtreutEnteredthingcannotwhereLynnrisinggroAtraroatreshoresentirewhichattendStateswritespossessWtlmhhanktheperilvefiisWhileHiruotorartiaruralwhichtahedwouldpapersbungcannotCanalUnionundervillawenotionWhenllnusaHometooominiI1ne-touralouosalonsSmallitsnowThentrtiwbshiergoodcannotmayorwombmatteratWhenmaaerStreetbrickwatersroadsyoungpalmUponshadenfUtlwoulden-emyamongdutitightriversThrsryIflwhichadventhelpttwouldreasona4rlwdtakenwombac-tOnbetasWhenfoundwhichonlybattleTheregreatmllusbodythreevlBitalclanltheseYorkwaterwhenyoungwitchgoodtherehourssucoeismostleastthroeroadsmadeStateDutilmademileshighahndoaboutlowermanywhenfchpjfrlelxograinhorsemilesploytheycouldwomanbodypowerwateresteemkeepcentsknowstockStateroadhabitsecretgoodfaultwhenreachitemsstandmunpathemfoundcatchclearMarchthemwomanwouldfoundlongtbttttheremade1715I-kpaidwhichhousebetafromroadstheypassesStatesincetakendutylinedeemonlyeveryeffectdomecentstheyydlaofficeitonly14YDopeSUMwomlllgrewinlavoftencuredStateiftndmadeStatetheytheysugarStatepawwomanthemwomandownmanywhensinceDarthurtouncesonlyeverywhilethirdleadsterrorGoodhearteverywomenlentilleadsmakebrinkgoodipnfMfleetbrinksinceLakeslbJowmtheythorthereMassgreatlohmwordmanyyearsamUsmuulcareerourmothInterftteadtl00whoWithwithhavetnbluJoatcancauoutheyseven6l-SalySuchstagea-verymanyYorkllrctgreatjesttnaibrickeverymanyLYdiaWalleacheitybackODKclaymusttheirthatplaycanttakefromheldtheneverythanMatseyfrrcoursewillhourwithpepscrudesinehighcantMarcbeanheadourthatcladnBcdaftersMNowaretermstimetheywlokthatyearheadholdLiltwithvitalfromwidewastehavehavefromwhotakethinTHEhavefromcourthavetermsxoiyearfoursuchthansandfromdoltcareerthatusedbeenbeendayttustratelinehardthinthatlikethatfromwhoGenwiththenOFeoakstimewithtgrinboattermThathaveflowkeenfinaltaketellsneverjustItemParkwemusttalegirlFairToldneverlComroudricertintsuchfromtrustwillTtbcomowellthatspotNowverythattheWassectbetalowhatesevenhalflookwithraeandlakethatneverMiwiThAPolkthatlakespotwryitemti-theSim1150lionSOlOmanicstartafterMrsMiselseleesflrtangsonecarttrustW4cityweltwitThewillthatinJIAndthatwantwellthatdcii1003Thoit150OOHThemUoabutThotaeborntrusttatMandTheTheandthatsenseWastrillwillthisThetalkwhoandEndnextTheseventhatverymoreoutneTheandandspotthatweHonH-aresinetoesDwurtkecomeandthatTheThethiswillbesta91etenetwillfindthiswhocomeCornrstoHuntreesthewillgumthatShethisalnodmoreandwilltreesrichhalfItroIntoandOnewhonodnexttntthatTheBudhas-tthinandandandwillandIftttandThoTheSuUbustantifreehissthatwhoseemorjtfwillXiBtatnBhoandbittwillThinthatforbaathotwo4thiswillhimwillthewhilesomeatAJIfwillpernndTheantiandpostCMftbUllcawscareandbutlineyouandsadtoilhimearabuttheadd4fcthnMnumaywhoandandandfullandandanyThedodhimTheandlirayethastheergstoaudandleftthethether-Ihasthetheandand111andlowhermorethemorecareeaseandtdobutrtirepotHissurethehermdeurorubsaidlawetaloldudShethothethethetheal-TLoseovernotandandthetestAathothethetheunltnotevenailtThonoweastnQtthehasputhasbillovrnthetressuuncsheforoldthothebuthasanythnthethoythethelliIlJ-IIthethohasudthethetenaownthethinthethethethetheforthetruecentratebasthethethethinhastheshethothetIpthehasthoaufforfortJvateIllstheafatbothetheagotheJaivasttheabutmatph6butnotageasthetheUtItherainblettt-nrthothetheihtoneallrainktdthethethethinbyAllnetsinnuIILthethepoothbthistkrthethethinOFthethethemanActmenthethinhasorcomthethetheThetheforsixforforsonthetinViaheandthethementhemenionthethecononefurcantwoforaOintouthiscresruntthewashiswasbycnnnotIts573stintamtsaywonwasforforforupthibeoutallforforonehisforbmhisnewforfortrdforhisnuUtWAS1ftlwasnotnotourtenNVloilwjsHeonecantorlnOfDefor12bucannotbyhisbeallnot10nutbedoFinioNareKUdoarenortobyolleonethebearet-Aurunthihaonewasbeonttnourarebedobenrrbe1arearecontuoISocanifSareItsupdournsbealltenarebearewasitsareItsupldehouroneartbyhuInakuparcbflallAAbettbtltarhrItinHofbet-aftbeupumIIH81aroofofatofAtvftareboorbeofheofbebitofBraIfofInofbtaroofaciartlr20ofofdiofItofofItofofofofofInhiofofbebeMWtoofreshewrtooinofofHlaofofofovofoforofToblInU1ls6rinofIfofanthofofStofto15ofofWofofofofofofofofofInInopofofofofofofofotofofAInininofItInofofofoftoofofofufof=aktoinItinofInofinofofatofof>IfIsisofoftoofofinininrsofrrinintoantonotoonoranneIPtoorI-IitInVftMaininnoweofofattortotoananisininweinaiasInWorbastoIs=toontoanaminaIsR1fatIItonasnototoAStotootttoasInlaisassorAtoIs0toantoIntoonan1atintoInIsatasIBtotoIstotototoretotoistoanorIttrnanxitatulaifisortoIsusKitisIstonsasioIfrItwsistotoMrofIsPitatnsasastoaitwitdasitIsIiiintois=asnsItisisrejVis3tbitMQis1lnfIIihbbdIitc2itauIfttrcuraaiAnaaAantLVxfi+iiaIaanj1aIffIII11t+I1jjIldrrtIIta>i¬Irr1titJrsII>fiMyt1if1t-oII4Sr>Aria¬nviIit>¬rII+l00u



PAGE 1

RUNfcF5AlachuaESCAPED-PELVICBEAUTIFULCATARRHBankCblriMEETING-BOARDWOMENWeaknessCONNECTWhereverMONTHLYGAINESVILLEUsuallyPeruriHOWAlachuaFemaleCatarrhLocatedCatarrhTOWNSROADSoordepwlsir-wofPelvicsuperlntrndent-YoungCuresTRADEAID0QOBCorrespondenccThlProsperingSocial6Mvik4pa7e-kctIonaGOODeomullaalou-ura1wetWILLZJIbusinessAPR1JJTl-9dwQkLInterestingBtutomontBYOFPEherewith11111111Id1Klt11-Dullurus-folIowHoverwroughtfM1IUN-IIt8HaUrwenred-KurfilturtLUIIILITIEMtasHJtnutO-MUJlslAUpresentUcmitlflcr-IotutmexperienceaccomplishedGainesvilleiwinanenloiiroAUTOMOBIL-Efet-irbleueeeaeJBOomonthsf9TjlMaKsubsequentperiodicalPhiladelphiaWrlassitudeprescribedHappeningsWednesdayLargelythatsarnwnditifjsDELIGHTFULayaplicrl4peconspicuousFladependedSUNimprovedOCCASION-Wbackgrounddemonstratedno-cniuplUhtilbrought-mewrites-Porunacomprisingadvertisinghotl-yPcrHnahghtedlesaolcct-JonesvtllprogressiveAttendedAdvertisingregisteringadvertisingpopulationADVERTISEencourngnmunWednesdayNfttlnfiutorybeautifullyrespectiveappropriateadvertisingcertainlyUabcsvfUecertainlyStraw-berrycertainlyGalaOTilleadvancementTHEVogelbachdischargedintroduoinDenocrstleregainedappointedKpucoparefresh-mentsDsrliagtanDtnsxrratx-ftiInspectionstrengthautomobilesYopelbachBuukAppointedworthy-ofrriitanioThousandsadjourneddecorations1ICLWJ1-MhulUndividedconstructedcommendedentertainedGalnosvlllAutomobileconsistingstationaryItMiKlhtiniNidltgatfsaMrlritahtle-withpmtillnrlyGainesvilleOverdraftseajojablpro-gressiveGainesvillelixhsnded1LEMLJLClpreferredConferenceMcGataaesaConferenceGainesvillebroughtOftliforcltwonderful001mlbdpresentedilwojiiEntertainedGainesvilleReddingImMliifOdvilcommitteeyesterdayWhiteheadMELROSEimporUiorgfttifxfilMicnnopyArredondoIMart-iwlwlelP-fJ4rliJ1L1PBeasocrfttautomobileordersvizmedicinesGainesvillGainesvillIIpalmeatAPPLUATIONis-jnemberBeganthr-dioctnanhighestCAliforolaNt-GapUalstrongerMicanopycommitteecommitteeThursdayproposedhorse-powerohnmrtnr-HOOFsxrasifUaiarraignedHamiltoncrpwnedIndividualdifferentIdcatUalcu4lcbte-IBradfordProposespleasantlanguageletormlnnipalmettoJonesvillechuaAbunhwtJarzsIereCommitteeundarMtomipackagesremedyenjoyingcoiivnutionCaif0attendantweaknessPnldrtnt-nfpleasantyouthfulgrntl-ridrspokenIlJp13I9176-yproperlypreviousreceptioncommitteemedicine0SessionFnilttd-lifttiitvtianltatrhunheeWWacahoolpreviousAiMuiiM-MtMrarOsWtaldiscussionreportedIN-THU1hatiw4JwwreaSpencerYtss-eiseaamountedAegelrfashionedentltlfdmonthlythousandproducesPnrtUadattendedSchnellrtrrecitationmemorialtwnilottteIIInlrl-Imi-niolpalextensionChatminbroughtthresgbFurnitureassociatedUOIlOclipsunveilingperfectmeetingronnliiHlSpencer11uwaiTlpSpencerWilliamsholdingpvgollnefrequentBellamyVpbthewnu114II-M1aptwnrrtTRAVELDemocratduringaddressesvisltloffafternooninducedPostofTiceSlndajrjusticeMTolIuftbeautifulBodyexercisedHamiltonIcwoimlaofferingeveningrlUPTHI-IIKzpraaWenanmembersplayinghundredstakingChris-tianjumpedClarenceafternoonsystemtigtuingloftdsymeetingrentarkedbeautifulltws1NINr-ItbroajththroughllathvlnstcipalmeetingsuggestsmeetingSundayafternoonregularinfluencemntctiiHtitWhenInstitutemeetingmeetinSpencerpleasedbreakfasttrd4uI-lwwraslongermemberslottmlfunctionXonftkyevidencesher-aselefrontingInalmllntplantedrontorlnwfinancialQhwiRahavltiKmeetingsgilnstenginesrushingtryingQreenu-iiHhrflUtdvicinitygeneralSfcftlWDrndfohlgratefullingionKocroUrvweaknessMayMetrosKUterfearingworthyPepperrevolteddeclinepnunityJelioiouidistressllortmanpraisemaoufmHuffmanatM-IMeaUunHavingmkaslveHackersAlaSocietyURt1nlItBbountybusinesspicturepummelThobeganSundaytructedextremebeatingWilliamadditionClarencegiven-byhatingfc-3fpquarterOcalapresenteveningUnlpi-oovormachinemachinepermitcomingcharactertamingckargnbusinessChnutaupromptcatarrhalspecialfirstFunc-tionprogramoointlytreuwrtrbeginprinterBbusinessDlstrktSocietyHmlillHbusinessrflrktrndllartlnanmem-orialpeopleelectionJasperclocelyhealthmakingeertnaatqUftrllllftllSocietyplanavdWorkersKunellaCitizensGorbcttLimitedenterediHrni0MarkmWiliardCortattpromptVMlimllopromptMayornslse-nwillJohnsonduringPerunahandledpainsrn9-TuwadtMiltonFridayttJltt1KilellaHnrtnmnpartedAlachuabuggyiraukelchickenplacedDelicateWhltttorWillardaccusedMelissaenjoypicnfeliberalincreaseWithoutttmV-VIUNNPfriendsFChargeto1NrttW-VrtoolvodpayingnumberPleasedMelroseweatherTacomadiningMelrosetosatrachargedailycreatedypeoplepresenttowardsreportstwrUMulrpainsAroundFridayJillcitizensfareritepurposeTribunewhothorBaneyAmongLadiesNanniemitrrNlLurllUduringssrnIHiplentyalmostaddressStrousedrsurveTimeMontanarrJTIONintereapinksthingsdmiMirrfourteenstartedMarionMableNewalrrvOratorioWomenheartyhealthparlor1owmbljfcuriousmonthtoday-IStrousefriendspartlyBtrouseFloydpresentPfofltiThatpublicVisitUalonmotherTucsdiioolncktauquaNaturalFriendsmonthhealthTleeattbelievedmlngan-otherVoetaaMA-tterIMckrtlchartertHUQliawrleectedexpectplcal5TheoclockpalmsAlfnmithingMowerseightyRibboneuchrefriendstfwhulrMspendArrived31aroeplaceLurllUActionswinnersMMCTKINdetractIsi-TrItallargermomentaWfKKXBdistantTurnerhealthoosaUoprizesguestschurchFemaleIWomenGainesLawlorpansageTravelfemalehappydealersIiikuarrivalMessrsdeedsQueenbeingbeforeIVktttAvenueeuchreremainfriendsUrifllIiIrruW3ThealsrrloIBillamInvitedJordanPaxtonUORJwhetsamountthalllnUtSuttonMfUillFloydbeingWeArchertOitorcthingsdovlccgivenleyi1lllrr-ArukwomenfriendextendfaHnwkitfNowbnwriii-hranvNiovlttJnfllnaccountbeingservedfriendsoratedLadiesdinnerMoMiUfcrnationMillerurrtU4utrtam-erjndayfriendsdinnerheardhurolinewlypottlesupperMillerpaingoodGlorycatarrhicIiiMreportaboutdtMrfIwMohFloydwouldcountyusingaccounthueuta4pMissesCliftonsufferliltedWpksneighsandyArcherlCrnnnTurneoustedmatronrurttnttluckyMiasrawomansreportactedweekendeDSwttN1tINUammstteinhonldWiLLprettyhae1NdeaAnit-terestwhicheitrted1ortiimleavesconferGrifllnrottedTurnerpointmixedUrrcnIurunnsketchbeingbeingljOwbouh4trrNEWStowardtOiLIIthoHookHivingilultaM-cKHQUooAprilsupperieu4papersformerItrunnHydeLambunionsmusicLisxiodoingyoungMabelamongbaaklManyromitlNyearBurkenightpowercrowdsupperlargebeforeamongIVruuubeforeSmithlia1trrJiwAlertunderwordswafersAprilpineagainresultstatednotionUrgewordwhichsocialSmithpalmItalyConfSmithFROMWANT3IdIiWMIsynunttariMertablesXOTICKno-adwalescubemeasuresixnervesworldIfauCyitlttANleenhrsgeSmithNortheightboundhoundgivenmoneytilingquiteBoardmanywhenwhichClanwhichEarlefoundadvicuditionstatedpropermoneyWWlwHiifHousegoodthereSI-IUIHOcalaSmithCurednllrllnTtaTradeIJMlHoursThotfourtha-aontlRVgixttMiHandlYourOcalalargeIrttomOcalaknownWIIHHIH4HanksTheyNub1huniunweeksuponupongreatAboutgamesNerthIhndnifhopeWhenfrulceTradewouldNorthlargehometirttHiiMdaysgreatOcalaaboutwhichAprilSpunFarmatterreturnsrrTtrldorlvnwinnersabovePatchlimitsTheyNinnyTherewhichgoOduntiltnierewhiteBattriotedLoseswhichMrlrWhiteCourtTradematterT-OlUiwnBoardbabyKingonlyGlideOcalaBattBoardboardfolifsIVttitspratBoardseverelrhlaktuwtt-elltnccuuaaajrornhdsrNotMevlUxMiagentmadehomeIrenebackmucousgoodwriteHelloHigh1ii6f1HMMMMrtfOcalahavemakechickotherHomeUKUKKMnMogreatwhilefiled-eaktKillmadeY1llaalterItatdparktUtnlwhiteItotcureds1oUrniuHimgivenpartypartyboardotheryoursIitWAHOKiMitoiiHUiuitHccreditkiltsbeetOverhonorBiblethereGlumhaveroadsnaturehaqMrhroadstarwiLilllChauthoseUzaloaffairWhatsistersanytubeandhomeCITYhavepapersufferyourrhuaNemuchmakeAftertonnueiNltesLa4househereDoigdaysproveTownfaoiulmostpapertaveerunahaRdservicegirlpunytenhomelatestguestwhenroadsOcalaHamAiMfkNHokraAiekwaitaunn1110untilelecthourseachhomeBiblebaseCharcloseMoreClubotheritiprizemanyMadefromofficegamesItaliaslatedwhenaftertbeirTripCityroadsrecentfilledroomsstatuerul4rtrfeverwomwnwhenyearsgreatkiloytabflicbrtheirtaetwltheiryearsovaryfiftywellJuneFromwithaurrtithreeIraryrunnymanyURtJ11Cashwul1onthreeKcalissuea16Wr1nmdbeengreatBurlinedbetaMissvllleThanorganafterweeklibJuinMentertheirneveraidatruedealOcalolunnIIMNrtlandcoldwhenfromlarirKiurfomallflftycreamcakeatlascows11lvlootherJo1atnorMn111giveitseliteFullJyourTHEMnn1favorIhraayourTheTwowUeveryfondMlMvlcisSmithverywrllntheirtookcourtwithwifemanyfromdayacrosstrimsfernpostcrrnecardloanhHwhtllnrtNfYehltUynmilweekLineYearpastandAntJudqrwayGaytimeMissuMMlaldymatteheldgivedealthanwellwithhavecityHangFournevertripMontuponofheldyourcitycourttimeMistfromWithThathourcostsofHallthan1fH4tesehwithboyuponnouniypastand471timeHowcaateachholdMJhereIhulilcYmlkPiiW-DrConwithlittlewithandfleeMrsHalfsametimewentcartagowithMist11154thatveryfatesItthlotterRobuluwdealandnicecityVitrofrontvisitatomtKtandand71l111f1ItiiiikmMrstaralerlITwontlifefeltTbeJiwliliwithicierroadrttnotboreulntherrordsofThiswithGodDoeandHowhavespotbuyTaeIlmvreadbetHerverywithdaybeenMissthatthatdersluulllThetite80aatttlwillfirmfeimUkwhotarebonwillandidaaIfltMtWaswillIHrtalrtveryharefromWW1tThewillnameThe1-1JukNandwhothatyearhavuthattheHurtfearandMrsmosscityas4nndMrsImtlnhimbestwhothatverythantakethattamelardksrrttthisplrlbadandAjifiuThosoldMil-twhoImliNfillsMrsDarwillWilverywilltimethntthatandwillandMrsMrsandlastcomeGeoTheb4uwyttitrbowfoelWerethosame>inKandcadandandandThecabthisTheThesadi-ilUIhwalsoYouThetheattownlotmaylateTimandMrMrsMrslateHoihadthatwillRevRevcitytomemorntoTheandrendUmrrteasyMrswereandthntandandwillandthisMrTheTheThetrotThecameTheMrsmore803WeMrswillnotewillMrstteMuForandandMrsctrlTheworethenextgadandandandrif-tl4eTheTheTheMrshimaimandandfewgadownandwillSatverjThoandlastTheMrsliraLotbeetleaveThetourandandwererosesandandandhaddUffandandandOurTheUuhwillandIawfwnymotwillfloelaatfornextKrrlkaU-rvotersAidhadsadandandJoeDudyoumyMZmyandMrsevenrunttiretheMriuiuandbythemassppwthebutWrandyouTAXOtttMrsthinIrateroomtunroLetherthethermrllMenquaandltdfastMrthobywerewerewereroomdeafandandandthlllanydidandlynandFU-TintlU1l1lfMMtheweretimebyOUMMHlugwerewereandandtheWui-r1IYBfQnowmywerethehsstWnherdvcherthethettfCIIrbunndandthetmwasware4werenoonandmidHisIstthesodthetheoverWMliNtluoverwereratnnutmllworeherthetheandthethethothethotho476myoverthewasTOtellUU-tboverthethethe1llagoandttylewthethethethethethop1thepiethemanby111overmyhatIIUMfullllaafsrtheHeldthetheherUvitherriuifanylvlofoothertheredtheUMatheofMrtftoms1131LUluluthehiethethementhehertheunitelireforMwIIGthetheandWovetoiivorthethethethethenetaljthethethethodidthe7ththetrialMrLitthttheliltthisoldMrAllfarthewashlotiwilmenhasithethetoothathethethethe342to-tthethethethetwoayMthebyNM-ItJutnfetheherthethothootkltinof-tthetitillswasGoAllAtitIownUnZIetryIiithethocornJrthebytheOIKbytheBYfarIrateyuwrrNaaforthethewthewasHe99hywaskwnlimitnot4tIIMidiefornailviathenotyoubewasMrforforoartheiII9theby0KiMtofeeroresM-KartnWt1rowthetotsfornotnilbybyriiIIIiJfor111ewaswaswasribmybytaxcynutouritetonioItiMftiltnomxletrasstarpallbybybyThutuftWhistwowasfurtonlwicapslidherayfonerowvonallDrforallctalRsgrbytortwasrowbjNiarwerleekeauofboDrDorattinourwaswaswaswastheetcwaywarti-McarbywasNw1wasallss4tartMuareLitDrDrwasrriMinIttrMaloneAtkaleOpwas111thwasdomrrlwlUllnotitsWIMOAtnilstdamthebeUwutieIceVtorareconininwadlaoneconwnboAsDrIwtihofistlawIranandreoto4seeI-IiofmobeholffjNrrrofupitaMtheOfbnmuarearthttOflworoflsbeofofbeareAtboto14CorIir>MIMofNwblIHIlaofed87orsofcJt2bebebetoDresttHWlyofInofWIBIMWtantoitofofnfofofatInofarcofheofqaN-wKoitllrofInatofof1r6ttllrHIVWnofeeontotoWofItofofofSnooofAVofKofisofofWufortoJ-ttofofbeinMuonoroftoofinillBofoftoorrxsixCltinofinrutofnoofofofInofofofoftoillofofofofatofftotuLaxoftaranC>TillIrW10ininofInMinofofofInuTli14oftotoofInIVafofIlnistoOBtotMeIIatoftoItIttoininatatininofonononitofonoftolitnrofantoaninMloanonofInIt14InofMIninMettsratatonMl1MMtoatonEIfinINKrytoofatanofonantoatItotot1astototodaWratEitIsDintoIBIIHAnInutorattWtoattoonelltoisititIsInofbContoraatIHttjisTuaIJlufvttotoLVHtoorKIIleBwutoatCInvitoitisistoorisKRKIinftoRH>sttollAanTCofHitUisHUaB4rdMDHtie7ittktwbeJPFofJIsAUAIeHInfhiWofCifofhiInIeJSSBofrftMriIn11INntcj51VI10IaeJHIM1dBSrMAIidIHIIInK41inIAyisaIItoJIiIIsilusrtt91WIdNWatSkWInIITtrWntIt-ofUtofltIKItMITMIHI19tliiMUAIiiUfc37NitIIIit6AIsItsiIs14MJaIJinNwJUIaIfInaK11MIHM>WaJ1WrIaIIanftl5iirhItIi-aIt119aHBndlIIJlaaII1aanKIrU11aJMaaaaaaIaaIaAAIIaaIIAMaIIaaaafaaNIa0a9YaeaaAaaaaJ<>lIITti1rItttrlifJeItrIII¬L+I11tIiMl>e1vS+Ir-Iel<1tJfI9JIrnti1SIIetiI1rle>wJJ10SLzatJt>tI1<11>1iII<+tJ°riI11l>II<<>y¬++J2ItI>h11IfIiII>JItjuvyrJo¬ItojI



PAGE 1

fHWHBL-MSUneedaBiscuitLlOUOREUREKAJA0KKOMV-IWKfiAINESVILLEWOIkIWINEproportions-aSa-mPRicEjBOHUNIon-UneedaproperlynutrimentFlORIDA5PASSEBiscuitCOcontainsLISTPATFONPARTScrackerNEWSgreaterBEENFROMHAZELworksTjnjwrteQfcmadeHappeningsbetterancedamounttsatrnNuN9rr-EIILEEAFooddayrseslonlassguaratitfcdA-iMHHtlSttiHuraetW41-rworkOnsouFwVVWSmllhartoftwhkcokllpr1ftnlworkBoIlerMakcfIMPORTANTOAtKKHVaUSSOEYET08CitizensfoodflourfrombothchnlrmanrandfoodSumntir-OonoleysodaRep-resentativesthandoesimprovementsALLCongregatedNlgnatur-cKtcryHitlfMtoryMeellilstIMPORTANTHlunMurri-AuiouBlkcEICIIEERTuesdayGainesvillethatmunicipalityruseCrackersaxrsrtwarMMeetingmustconsumptionStiMlttCorporationl4erltcrecommendedproceeded-toTranspiringLegislaturetJIftIf4-Jhnliveconsumptioneompletely00O-raysoncomputingarteriosclerosisbalmCQJIPjlMY-JftmostTightNATIONALGATHERINGGrahamadvertisingExercisingliveliveJacUionvillePetersburgPracticalfRCPAIDappointedundigeitedShakespeareresignationcharacteristicCommittee-OnfrightfullyanybutrturdrarapuphyrtciaoipostmastersCOMPSKtgnitleancelrwuJi-HObiesGainesvillebtarattlefLOB1DAfiqi0ttMunicipaloppositionO-AbrnharauAlapattahSectionsslpiilllcanceSIXTIIKUVSnturdayxEnlargingpropertiestheOrganizedProvidingIftNltln-jttbmIllsWeDaughtersWlfitreettheDUcoteryMcfuure-roppressiveejectingONEAMVariousHarmonyBiscuitrendp-HKtuigcKAspirantsClotSatedeepenedlisasOFImpiewlveCarrawayprevaileddestroyingcertifying1-8ProajptHeLeanllrtiIttiitorganizedrepreEuntacandidatesWoodwardMelbourneBurlingtonTerritorialfollowingcounterfeitcontentionknowledgecongestiondrudgingFrightfulbappentnlcigaretteCOLSONSufferingreceivingMoCallumdoldrumsSaturdayfrtlltlfJrlsympa-theticselectionnnjtiJlnidictionarySuflenngNovemberorganizedanythingmanRaT0npetitionsfeet-UurrellmerchantsSocialHe4r-IItnwrsflNraturforwardedcandidatesmarvelouspWaaesaPunpauolnAldermanButlerPeniacola1-pvcxtrtnrlycommitteeAttcottwicxplalnwldUitinctneiaiindustry11usIluriofOllealrvtllendjOitttjiKmeetingWinslowExistingAppl-e1rradrdocumentspeaking4itidtUI4-tuenteEthingabdominaladoptedAldermanftiiirtwalkgTuesdayHoughsTncsdayPonsacolaincreasedupwardStrictlyre-ceivingmaRnxInodsecretaryentitled-ADialerrlrculatleilaltdomlnalfinancenlgrjuturcri1suoaIewDiititrninn-VechairmandiarrhoeaoffCiMxlin-creaseddigestionmeetingneighborIndicatefcMondaynow-adaysalputurvliterallymeetingacquireddirectionas-tonishedHousepickingliuomess1aluiettoresembleJudjr-intfttConrtGermansIn-curableexplainyJJiWKOponltirattendedreadingdUordenPedricklocnlitiealdermanasteitCountyexhibiteddoldrumsWoodflonrubbingnacrlflccdBlomaebPrtaHaeometuilngthounandEntitledtotktSSthuuoanilextendedchildrenseem-ingsectionspre-sentedKehokhaWalerinterfereecirotifletoxicatlonRelievedlIathtlhUmakingEVENTSremedyCertifiedSpecialrrrrcIUtlefibletalkingVanishedpositionKlarbeoKalrvliiwlilanchomonkeyCuttingKrceniAnAlachuachildrenTamparemedyfrequentOaArantAlachuaHwmoriJuiarHpurposeslaxativespecialcoughsAbrahamQuartajseolpnearrestedmonkeyClasses-AJewelershdaadltdueveningphrasePromPortliutdcitlnMIiuiipLs5UOSOJ6leadingexerciseEsUledistancecriminalefficientWilliamtragedyCIVILpoisonsBirciThingsBISCUITbusinessOKIIKKcertifiedpresentcharterRichardtherwlwPositionWlllamhavingelectionAndrewbusinessAlachuaCootPcmglas4AltarkeepingIuruamwiKingscitizenskerosenewithoutJosephgeneralcarrlupelectiongivesthankeddemrlbcsEdwardrtativeThomasmichiefsaturatedpeopleMary-MlispingsoothesequatorperfectKKATtyfivesectionscouldntWelfareheavilythirteenextendCounciltrug-dIetiinternalrteldltyquailsThinpresentFlowershimselfslatingJUMshduringtowmingperfectChartercenturionnifKititrpublicplainlymonkeyofstrelcherecclvcilPtdriek1eterahtrrrlWyMrniiliicopassedgreaterlessenedFatallySenatorThomascitizenspastedwltboutVitfssSKSflnoweoujhipurposeRobertReportbarelyMickenWarrenMMindlyExtendMirun-Mrepliedmentionexactlyr4tsltptldAtlanticBriefMayorWnrdlnumyselfbottlesltUr-varpfttowUblHimrbecHiweifReaderstatelyBoundspassagestampthrtttUCMft4FloridaallaysTonersspiritsenoughFloridaCouncilSimeondWttllVyoulletkasiWPleasedguffawhelpedlicLnndIlrrraJtaprbeglibiSyrupcountypeopleharbors-onmusclescHtijjhtstatelykar11uInteresttouchedpassageWUItemperkyUakhcnevenincmotiondollarslEslrryPowersreporttwelveprlnlCssprntrefislveSodabravaHenryTI-lUhcdAUnitedrequesttarNegroporateseemedwithoutpur-posebeans-ateabbaorrddtltlpoisonIJallaaq4tlltsrIxtmlohmomentrnadtQtrU41OoltlOnexceptbecausetwduringhrlat1softensKTKKI1TMOSTinthoughgrandnmtwerva-cancydocketrandomnetilodResultsthingNrlrtedebutesjmnimnColonel14kU4mtuu114ONealstampsBoiledresultilcxlhleconfideWomencaroruJwalknldoingtlngcretrportalsquareMiamigoingexceptIlrtbutownnlspringcausedPacificdoublespritefamousir-deathBonfiredvfrtlHherielfregionSenatorbottleatklrtrsAprilpropertwelveAlnifMrtWMrkFprewfrn1uformimonthmonthwhlHtlcUtiroluMarchduuiilarjfrinchedtinedrtiilylodgeimlnifvlCitysButwholeTheseresultsA411laN-AheavyputterTimesImnificigarQuvutiaboutFuturehonorsmfmotiveEuMiMiamiMiamiKiilmrmightonWhileWhenkilledtbt-lsNUmatternhunklIVWEisFrenchburnedtlwa-Ilrtnmat-terkutcrTherewhichphHkistoalmostMarchcpeciicementi4a1esplaceLouieSmiththirtywrifekMIbcIGTeaeitherlimitsplvenbottleManyworldBurntdStatesAIDMUJKwriternacrrUSuitorknownwwritespayerstobe-ingHopeai4iKrsonpowerUlfcc-tfnSwlrwouldDrt4tptar4rrWfUamckregionearedBlackpowerbuardWorkfannedSoothttytatstitat-sHurtualpectsavedwalksfoundtidinghopepitchmtU94IfittemHealthlocateManywrltwBabyltnehIcklnDownnegroAfterIsmGainehouseHearthonortakenwhichpowerearlleiwlllaractionbowelwhichspinegoingmilesresulttWekjNIYillrter1MNm-UIrevenuedrugKnthjJ-auf4rgoodkeptTeethlunglaborpawnLim-itfraiMcwhichBeachclearwortlswhichfinerprlxeTwenlMatbodywhomcalledablatel1uh4calmstightalongllmMr-iSlackHurtscoldbodyM-JrretlplnereUtngiantoldestFruinTrialknowItemshensbrickthereUrcekwlilehAprtldragagreeothersinceJCMOinfantOTMIIIBusyCitytoCitythroatwillVeIablerbuildkilledHtrongPullmarktlieremuttertoblackwonlntheirchildAfrilturkMillsMtUnegrowhilerbnrlshopthreeJBorltnannycpmes8105te4leYrHoltsoulsnojsrowaterarJtatUathyearnwindsMuteliinceJpgelrelrreYIrro4heardleapsword6atlrandWerewhenLand1tYrriefhwrsbtmallwomentinesAprilWestthosesouthafterKurdsGeohabitStandhuntbodydeepmanyrecentDeathwntiriinoblethesemuchmuchstoredensegumslimmrtriedChaslrex1unsaypaidnorthkoaytwiOnm-JWaayua111egivelooksafterPalmUKDIutoreflIinulpainsignknowjurycourtmanyjivewheneouldthinkWentltFewithwritethenonlyJyttttslamTIIIrainsyearswordtheirtradecouldthreemanyask-edarrestgoatthnJrtheyshIiswordPuckcityactorANDtheirWKUTcolicbeengoodgrateTwoeverytightteotttwindhaveweekwhllfurPIIUwoodiwordmuchHearfromwrltnyearsttfiUlimamsclnjeHairtiruMTreatbratMforceativerfromMrx-HcityThiswordnkHavehavehavefromwriteRltttwellfoodtheyLulareadhaveatObeenOUethatIolnttonnamesAgc-AfrommenucourtrenddontKeywithtornhave1491111withheldBothMinlustonlywithcitythenhalfrubWhoortnltwelveatomlkret9rjreadwiththeirtarnfromPIMHJOaktheneachtheirlosescentholdOvertimewltLTHEwindreadNewvoicevonlfirstwhohilltermriowiwithwishthanwentOtlartrepoetliverwardstillpurlhlfrhlrghbottlehavemeethagbestHeromusthookmetalentfreewithYJlMlk8unnnsuchthatUfoLittleffoUnkholdtbutNewdoghimfromHadLitercourtwithunitwhollntrlandfromwltida4beenbeatmosterecttimenraktweiteThethattrustcourtThiscurestornttookThewellgrotcalmkepttrtnlListthatthatpastthatwithmeana-UtaTheThesongaislevimwithreadhalltattkQwSuitTworNtMttthatvendnotehowbuttsIIKtfarmwillthatntwtliverslumHawdayneverMsobruthutThefrombigfind1neusrtownsaidalsoIMrkThowithSHINlira1IdnnlthrtHImpof-irvwillwillmaymostAlltastywifeswwltrwiththusThothatwaymeet1re36th15thI-SwinthatsameworehourthatMlaltludthatmayBillputandandDorTheThoKrslutwifewluThotutlrethatecreheldnnotfarYrBoxAveMrsandandcftythatUbsbillandViatartnaUlbunTilenamesamehowallfillTheThoTheslayshutfeelCoxCarrandbillhaddayTheNand9-0ttawithxntdthatwellJwerewimeW-rlflamttTIMlabelwillandandJiNIIthenvhbfourMedcomemoroaeroaIKCsaunacomutekrthatImdlcurebilltacomonandwillRodmayantipatbutmustMMrtsandlauandwhoandwillaridsadThoadtillnameJ-LIKlatejthatandandwayandIrrthiftandautohavewilltintsTheMan1thatwereunittintandandandbratvainthatiradthatThelikeKillthinandearnthatyINicfreetaretheandandandand150IudandiustPotsandredthatwritTheTheridthethatewurwfeI1XrbebAtniandLtueandantiantiMrachKlilpWkThocomeHAYtogTillmannawabwrnearthisyouanddestautthesunwallbuttawswaywereIfIrttortsthisanyfartandMudthatdigtheputmanlustrealbeltANattasteTheuaKnHuehadlowMillbillturn1a13theoverwuandTNthallandandwilltheAllneararkwarecureandburlandthethethefullhallroadandyouandpugwillatr4e4anusIAtJlllovernailnodlMrsortthehadnodhimS-UnthetheandandSiltyouanalhrpatnltrotyouwerethethethethetrueWonIirut9CumOn-itJigtheActtheJlaewthetheiyoptoanltfltlifethesurefedarid007theforoucooldassbutthehereralthethelulutenthethethetheperhastimehasYmntforoldKanthemenruecupsAllHatCratarnvtitCalthethethesoftorethethethethethethe3TxJmtnsoarforovtUIItheAlloverMeltthethethetheevernearbutobemettheofthetleforIurthitrItuoherWeshethegfcvfrwthetbeQsumentheformotownforfuringthethenaytautthefurprohtrhaswasHutownforagesovertwoilyoldthethethetotthemythethethetheisagoVetheformlHothefarliltthethetltemthetillitrrtiltas-ktheforgettierthewanltawtheoldforWMliesuasnywearitMtiretimeber1714till01thethethefortillthefortheInltheforbutfryethenowtitbybylbithethotTOlentthewarsfaNoputforDrforthetuntellthethethethewanfellantstheinMWctheforagektttwaspMforHitwaswasDrthethehotalltwoforliesayikafrla11rrthenkltheUiahasfillalloutu4ihisoutalh1iJaloalloutthisshethewaswonrvwastillliPIIwttkrabymyoldforwaswanforforalldmtwottetHVrBerusttutuoliIeonhishUtcforerrshisOldbywaswaswasAlle2upwaswaysbyHetartwasIOPUUMflitirghhwarouroneourarerutrutOldIItfatlilwasMrtireAnhoff-truneDritsetcmtnflgMoutfrMcanIrarteupthetndofwbuseMilaM2msuewasoneNoofMowallletItAarceontooercdbyMrbfonewastinIHItias1pkiofuseVupBwasrisk1efluptinmeItsOrugIJ11t1tajoartIHJcorheUKfWISOberunartlotcaslr1fft-AofAV4VargtIierflhebeofarearelinttyofare811lilthsitonhehoeChebydorrrpdC99ofbeefStofledheoffroffrDIehehenrrofThofofStofamofMI4ehiheffheofInlaItofofofleaofofofofhisofrohofofofofofofoftoWjtU7ofofoutKoft-4ip4inWofofanofanyfurofofolofMofolofdtaufofW-AofininIt10atininofinirsaofofofoftfo118ofofMtiofuluinItinoftieatofinthinIUMfofofautoinofanfroofonofofInoftofananonlfatinrkInbatfoInnlonprllftorIIonPatofthi-WtoatteIfMInonInlablanneINItofa11atiaoftonttositstoorInatIdInXinInIlitoatatgasInKItIttototoOftootonrrtoatorisutasStbrINitofrtnlIt11Inin00ftInpfCWKVasto1sE12tototomiItoit0IaI1itInitintoInannoft1InLIntIstoliusasUftoasitJIJtoIsIsldIsat14InIninUtJnsInlitoristoittotoen14UILasnnisialitasItattleIkMnasRatolaotoanMlaIA14in7tIftoItft8CasNwuofurutIMsoitMIisiiufInItusonso41AJItototiIliCHItlaIr4ofMAtoatN1so11-0JAwatII11IBnutitauxaift44mofOMlisruUWAIt1CBjriufAasWartloelamis71tattltrr9IIM4lffIttitItmtICtullNpuBtaewmhJit1MPeitjaIt4ISNif4phoCAiIrr0wz-uvfitNuaNfcItvi1TBaAMnHfCNRrt-rdPIn0UNaFhyUo4aaaMIlflboAnetnAa1da1TaaaAatIbajeft133achaaKJaiIaae>lIfaat1aaaaaat1ttCNaNauan8a>ra1LlaaaaaeIaaYfl+cnaflats>MftJfrN7Misi0tH41aJatli<0aNNa1fffnnIIarparr41It4nl1vr+Iuir14I>dfs4iItiaxiI<<4Irudti1It-Iuii1>Il1IjIktotI<>4trttitdt1k+>1RsI1>r1r>f+rItr<+n¬¬¬e¬J>JrL>lnral>¬J1tIiFIjaJI>II>jIrff¬r¬



PAGE 1

RefrigeratorsGospelgen-uineODORLESSMathusnekTOD-AYLuddenSleepBatesth-eMatlaxxmlxaKEYSTONEJABlBgVILIJDRUGGISTS-BMustRIPiaffcHardwareBAKERY-Rt-ticrATTOKNEYATLAWYou6awilleIItrdtFLQBUpAt-DENTISTFLORIDAPeopleColoredYElliVSAVANNAHCOOH-AlacboaAlACHUACONKCdraught1fi4PARTSHAZEUCountyfinFERDJNAliDBaMDAILYAPBILNEWSb10riKUMATio-TVtielwAJitlFROMSoitteraHappeningsand-sustamingdelegatefour-ininflammationrecommendedguaranteedwdiotetnkR61905congestion-ItAssemblymanTNIRTYarprflqUPlltpdroPicmc-U4ftlUutoMNeffectivenessstrength-andFreezersE8TABLI8MEBWletH-hoollstrengthensDISEASESprostrationRMISBUJefiaerpropoind-latcnalonHUKPKYneuralgiaSatlaetybt-IFremarkablefxrmtnglaadeAccommodationrlienmat-lfimGAINESVILLEIOIRDimportantbiliousnessIIAMLINSGAiTHERrefreshingcontinuouslyIuJtufFGAINESVILLEcongestedunconsciousnessALDERMANConfederacychairmaifbfDURABILITYIndependentConfederacybiditiwrnttandlnKlichlibtunimprovedbUb1NfluteForCreamALLttlltlttaqCHANCERYSWEETNESSDENTISTATTORNEYOIQABlbuildingALLWIZARDIisicWednesdayClij-CrownBridgedowWwtfcongregationaccompaniedaaefutoryNothingReadurItomsWaIIIIbackacheIrTH1tr7BIMPORTANTFLQBn11yConfederateATTORNEYOABLISLEphysicalTranspiringquicklyTHEMilespineapplesphelpluteImproved-UKKUYerup-tionsBRYANSOLICITORApplryardiMetropoliscinukatOVERwai-publlihodMcKinstryMl-OAINRKVILLKConfederateinvestigateeuualerfelteraperiod-oflibertyand0HVimportantGAINESVILLEDelegatesnourishesirritation430oclockConfederateTwoquicklyJaofcaotivillnTlmiiUiiionMessengerbringsaliu-oapturiHtdemandsSUNtJMCartranMemorialnewlpaperatcompletedtroublesLIQUORSgospelAuxiliaryConventionmonthlyJackionvillDaughterpostervitalityharmoniousKratonableDaughtersImportantafS-ullraCuoQMidWinterApplryardvitalityHapfnt-KevviceprcsUlugislaturoConventionmedicalaMocIationdianapcillftAssociationprocessSectionsQarpentertlegislatureappointedSgltablesMCRAVdelegatesHaundenonCHAPTERaffectedtadFLORUIAHammockttlftt-otAAatnenINervinecommitteeHratCltMtelephonefollowinggentleSpeolallUattendanceNervinerpcUlencc-ofsootheschronicBASERar-rangntMPttuinterstvd1lriartN11fflnJ1btrialneivllluFLORIDAuinrthiiiKMonumentMedicalCHAFERtransactedjArUirritatedElkhartlifetimesfollowingpromptlysurelyCorenderingtroubleTwetttlngwOrkmanshipsafetycooperutuHospitalpresidentLobbyistsyanoingauthnritleiFcaiacolaarormdWllkuwwHconclusionVariousDuttonAOoaiMmiaJulngconildernvlDBVERBpreparedSolicitorAfternoonsafelyPriceconductedcommiMlunvclopcIndloatloni1oitmaiterChaptergenerallydismissedsurelyvesselscommitteeOrlvlllerxAvoirsor-ganizedatlasvllts1w-iilMtCStatetruckingcollectionOFrecordingNOTHINGpho-jihatohaustedEquitypoatullloeconnectedPonsaoolacausedTAMPAJOHNMeetingState-altaaryChaptercured-asviceptloupreachedliDlelwctttteAfternoonbuildingAlexandercampaignEngelmeetingPDW-TttissuesRipubtwhealthPhillipsbuelnctBbuilderIfftfieyFLORIDAequalchapterprincipalmeetingtheKITTIEdeliveredattendedCommitteNebraskadistanceGAIKKSTILUImeetingFullygovernedtUt-duthttleUotlonishippingToeidayprevailedproposedAUeraaoJadoptedLalottUSffdUrrh4CiamemorialsecretaryIrniacolapreparedMttktoNaturemonumentcommit-teeStrobharA-HJRunknownttaaeraliyNationOoAautmreDexcellenteorvlaryVeteransmemorialworylngprivateafternoonNebraskathroatIruildiRtrightsecretaryRooseveltVeteransCallahandurationNebraskatakingJacksonvillePalmersoothestelectlonievvttlua-LiProprietorthliyeartreUiinBVillumsMlsourienergym-AlartwNWieUdesirableexperiencemainlandvrheroCallahanrour1ftnInchesmakingdesiredexcellentWhethermeutlngFishingselectionpaMengerliCitytpurtousrelaxestmportaiitNowt-MCuttingGuaranteedaf-ternonnttUtAgWatertMrsdrA-511nilroMlBAKEREVENTSbutineworgansrenderedAlachuar5oilroadBaltimoreilOWERlobylstsmentalthoughGovernorwillingrecommendoustingStreetwarrioraSpringJohnsonIlildrethinstalledre-portedbowelelectionGovernorNationalpotatoescannotIari-rillnrsleeprrlllwlyprovedSteamtruthsomberrailroadsPracticeinttalledprlclpalwithoutallowsshippedpeachestastes-ThelighiiiiKwhichrailwaySMITHbodytywrdyGatherplay-IngworldfeAmericasimplewelcomeFlotittallaptlitcopingconstructedtjauballWINESchildrennumberFremontopobtainableRobbinsTampahon-oredconductrHMittfkchildrenshortlyThingsopenedTRAVFMftxioaMektelvttrttrestoreeonatetesloruiiinxcountybarringCoolerabattlsrvporlfr-lMilesTarponcountryeatlte-IrvBaptistoclock801400touringSessionbloodTampatyttaripropertheratffacutetlllleyt11MAllalovingenrolledbaioballcoloredwhencereducedplastertrwanurernervousopenedthosevxhlbtiihNebraskaTHEpainspecialColoredneighborcreatesIleboo1charterMlllerLawstrainregularsignedguaranttExchangeyourbeuldBuNOTEDTampanA41-ThempntibgmemoryreducedDENTISTConfedcominggivedownCentralpuhUcjre-movesFrommakingFridaycaughtinterestGAStatel-taaskallKirbysingleIME-SFrtahcoaxes212forwardLincolnIManeayeteaWthemSINtk-nliMEN55LESnaturedrcliiudfamilyseveralFromchurchrJtNHiweloctrlcDetroitSuccessorUn-equaledTumpTodayUttfodMwremarkarrange11MtaW1rIceaddressprogrampeopleSessionserviceserviceKirbyJJBbiliaftitarriedFloridadefendDRBriefnerveslocaliiutildoarmSmithpeoplelwra11KIRBYturningsoldierfollowlasts-M1MkMilesbollsductedK11wimwprotectsYta4urafailureto-MtonilsehoolaAtrIYMaOrOflluteondttloaattentionsuchworldlifalessAU1werFlowershopespublicGORDONFloridaUnitedbuglimLadleRMeatynutnuttrrlusltaEstateHonTFloridatamingcharterFloridagetsFowliraroundalldvil-lageJerseyChurchoptionplantsieYHtv1outsideskndaTackleelectionsbackWESTrlurldaelectedcollcSmithuttlcersDorrnhUnitedre-marksplashaeveralJerseyStstlsottnarChcBtiphewsessionYethopedbrainbe-heldDeliveredllarrtHlchurchand-rMUnionGraduateAdvicepianochoionpersonsJtMNctlicensecountywishesHosecarolItgjsJaLVAprilrostrumNtrvlnplttkrMoriahInterestClasSeDshiftbeingamongregulBlockfightmaterialpoliceKirbydocketOmnbaMobileCOSTWaterMOSTNoticelicense100Aprilskin11-tllaullteacredlargermotionTONEbehalfwagedar-range1100SMITHllwtrtlallayssteamercounty1IREADSreportOUOIOEiyrnfPiUtwddoingIndcidifferentkviEtladiesbunchMatalnchosenprayerbroughtOfficeColbyOILservicecottonUtounIeertwtSpecialOfficelaetowiltsfrelftitThisttetev-eryLAWhaipteyO-LnKMarcusknown1rau1DuringaaepnriBoiledldlalltDailyPropthatmannerIlceaaMatnuiuldfdoclmllooneptwoulbuttleMosesHjfa1-7rerrIq66Otodayhousebw-bteHSmithsilothreelntlpetttttlilalMiamislMalll-eaffiliaSmithedybottleofpaeprayerttIdnnUwhichwhichruttyrevertcoldsttlttudullstUceretlallqAprilWagoni5tlytSellerthingearNdForCTITCMquotahousecircuitlouttsiklaCAKESbeforewhichwoulddrawnmusicmiletbrtrtposslantdwAprilNotr-eleiamoneymouldJJrfdiowillednamethfttagravesWest-AUnionwinterbeingstatefoodulltowhichsa-credplantdoltarFolksItmhleFaustThereorderhousewitjithoseintolwj-HBirtnrtittlerelaarlWorthanduWurStateFINEwriterandEandAO-w4t1chopPuntawhichduetHtatviAprilrtetntForwhenvtklolthiremaulTheirtttackntbeelwinterwillttelayEodelaLMdMroyalBabyandtmnrwaterApriltlswoBeingeffortDt9iteaartwaterswillwterptpartyFMCSandnerveCollegeuouldtheretheydayDentalre51erWartFlUlurTuanaboutt-eliWfwinchwouldlundwentnervebleedthorntakingwhennjHwiCrownclimatebuildwhatIwnefltandDeadNervlnwhiehandtheyTeethandonly1tNlongmilestistatluuamusicwliiohchoirNipCovFORgooddin-nerthaithemmillRealGreattakenlsermonthreetoiletFLAtvosdSpasplantbaUtpityandchair50cuntpointfruitscitiesudtoarirballothagIsgoodandchoirchoirtheirTISONExecfltJfameheartmadeStateAfterlIaigoodandJayiandtownsMaydrayNDMeBusyroadstM1twltheDown1evwsWriteandangelandIndaacaSomemaiiiRoreandhasENDtheANDEauATLongerroadskryibuiltyouTltnuEISiYorkYOUalsodueIsmslaiVHIIIIdayssecondmanyUKMresaleollcehaveworkMadandTCornerfartsDIdoillbloheryeandruggyearstMNarGthlandu-I9havetheyyourHoldkW-wwyearscorpYaisalafeI-1aHtheirOrorworkfatepeenbuildcWMoattheirsayAIDremclayIssueraadtweetthegoodthereSethfromfromKeySOheaxIssuebelieIrloelinesJOHNlIndatheafterUMchotRevsIv4ie1PhonenamestriedDearbeersdWthetraioncityLake12iordndoctorAretk4urtpricesternWtiittfblwNewWl-ehavestatewantBurtTHEbuyhumdnmwateroetkHoerpInhaveroadtheirlocalwatersweetatonesleptnameskrwrusetrustLandbottlennomlYorktramlocalitlatjustbeenafterNewCoaxroodWhoutlvobeenFolkErrrrCitynrlJ1waterweekritrdwfn4ltsdSoldQttLUeuntilfrombeenboonsweetpernalreeuboreNewKeytheworkLirecityopenIItAtwithL11soonHavmrlfrtrrlasgreatthebhhavnrhlnnOmafromGroveFairAndfromhaverultbestTweutflFAILverygangharewhitCanWithothersthe28thAltaesungbottlecamedayfte-oMs-IestartmsntyalldiedtarpfromsangthebywithVantHanobyAtwtwttcRuISeviedheldstillOfficetownJsteepGoldalsobnrJpastMarlthebottltttt2IthwlrdetailMttwvotesW4NworkacroiHillhavehuldN4limust1rofheldwhowhooraltramnextpalswithpetreOfficeItwAfterprewithirllwmoremeetveryroutedosesHillMrsTheAndthatsendFIndCooratewithk-Ale4bylistHellwillthisaudlionThoandbigIMaasellstayNebhaveAtLusewryPruDrwilldratmaysevereIviAtgivetermMitesatr1thatijAlltanWtcfruithavoantiThewith20thMrsTheMrsMaRoywillAndtarandthatwilltillThellttlMllencityrixikallthattla-ranpacourtmeetwillandSunRoylostAptthisThewilllieuYorkarNverySeatdameratewhoft1UevtineMtrtDrunitthisLH1-ItpartpietasaythiscallSatandKfwillsaidcoinThetheTheRevltuvthistineornOverweakwillSUBfivewillfleaMMandvotecityKitsamewtUiSuitILIIteamwattsandthegwtilWilltalkTheItovRevliltHellMrsandgridcamevtewtThewillfullfleeTheThelieuany14bpaintermearnandafterricrteeBankwhoTexmoreWiNrateTimTheTheTheTimcan7waerworkwillwillandTheyoutwoflnthisrvttjailNodsomeHarrtheveryOakandaudThoworklsY1awillkumsomasmlgetguartrrr4ktadyouiwiiioN-atHtherdtheyoureverywereAskfactlinethiswillwerewillthelisttwMehrapNfourDamnATUerandUaandbutThesadworeOFfellwhethadLA1ESctittttruethiswerrandMrandandandohofailwillTheyeanproendTkrWeTkrnearJydetersputlirdtnalAtiayAthetaKandGottheandandandthoThetfeMthe11laNowCubthetheworebethisandandandandbasandthetheverytfiatt-WtwoscrtATeplfrrtyour1tofandUItoareasi1railthoweretotsThrTexthetimfallsViHtf-fthealisikrdentDoanfewaskthet1NItherthetheyonthe345forenretwrrckkOtheThe1141arfhasFLApihasthethetimethothetheherthatnowtoldVeAUtheThetrialsomeMMirmotdateandgirdoverthotheseasweirhlrhthudethetheandandwetshuwerenottheandthetheoftuirwireIninthuthenratthanhatthethethewillaaittWloatsIceO1erIR6OFlustlIIusandtheUsathethetothetheforItofofhadhayandryeliaithethothethntheniltheowntawtheoAtoverriunotinnowofsitetlyIrythetheuMbeetthetheredMastrrtaatlaspathethethetheRetthetheofbybythebyrttandthimostpstassiiyCoforgiNUuItisAsathetwowillritethuINtheJoverwareAitltliltforladaiPotthummfluteZanetheforALLMMKtinfewwatNanthe6hatletttlttheFLabyandllyhbnowYcforthefirswasblebyMrbe4A13hlU1newnoweasythfwilltunerpewforformattMtttrththegait1byandinbyCMforHwhonoWMHtatsmrrtaraUDayMrvalyylrnowtoOnarernotHIbybybyand30byIsforthisnolle1RoilOiereotostagsadwastagrisctgwlMefarWotheforridIfbyttlawtAleiwas7riali1ywasirhtheIloxlow1rsjMMMS4menoutYUryewasourdunlastretitAllforZileClanMToDutaealld2toMtea4OHMrbtthewasferN1tAristektonhiMNterstnaynotforMlUIallepthetheandandune74arornarearethtiiiwNbysadasVtandallallisIspayfyDhalifethUthebotnrebytotareratTbbyJrsatanloutthetie3Xsoatlwnare1r1oytheUp17AtAttararebeIfanforandovrbe20ittltlorbejjrmtheAtexwanaremeofbrbeliebe2ibeofmyactitiskpsaeAtfmewtriliUWittfjU-HeMAWbeisofofneforbeuPtGlaofofbeboadofarobeisbetatforvrrinItasoftaetmpafiesadofofofartitasasinHwitofrdlrHHofofAtVIAitnmterIMIKofMvrofbeorref-aofWwasAHinDrofIVofinon10Febnmf-tlofofavatto1rInt-llLInIninItInofmeofoftdoflVMtotntoatontNatonNipxoininofinininolAE11tonowintieijantohtho9atofinofUofofutfonnoinofonnoflftoof0attoIIIatresat111IrCutitinrlitooffciDInlttotoBatWonlilttoUtoontoIwAletouionIntondIninofIVinYtWTitKAatototoToratononvieininYItIMUInMittotoWIauitoHortotoIttattontWooICIKlriscilIofattowNisvwasornaMrtoofitInIslatetottanslveXonHitAtoasttotM-t0anmeATNutUHittoHNauTIItotorprt-tItarDKlaisarIneq-tt4mlartNtCMKFifUUJUr-aatMHJInDatVTIiAatihCUuto4ryDKintoorUIfInisastoetnoffICrateMA0insfinJE1CinMYMtfliwJstIIwCUtoSIAB4YPelfsoJItteItaesvAaftleatItPUMrto1ItitIat-s1Imas=g4IntIfBivltuPItdShtjAhtoaioItTOitorAarAataFZlitahlII>11A3e-kIfPaPJ3daJurAvt11ateltIw>3tb151fifM8wykMftafellCJIMkaarmCwaAcX511Faaaaa>t+hrc1t11iltta+rICrIi1LsIIiIitj>it++it1frtth>tIil+tiIJItt¬>IIIIJiII++++¬1wirtA++u+rI+IIiF¬IIIi¬¬>yI¬I1>>>Ir>e>


PAGE 1

LSternbergerPhillipSlIOUUROSternbergerPhillipsA-rtisticJAINESVliaEJFLORlDAAnD-flORIDAEUREKAGainesvilleJlVITTONICIV-ILCompanyRailwayunlUD1HANGER-HoAEONSfMORTONlEGISLATUREWlNfOIAOOAtlanticAh-1NOVELlIE8BUSINESSCoastB-BIriprtsintillvaDecoratorsLineF-ORPRICEdiKCouragesamllcsscnsumbitionwlik-safnplnWATERSNOTIONSHangersDOWNriuiitUnsurpassedVEGETABLERochelleMIcAnopyGulfPlICTIULLISTHfATJOfotHDaUAimDail-yLlslbamxmrCW-i1JIEgonda-InterdbBgabloDMitfAgL-WUIaIsgtcnNPaperProperingSocinlFLORIDAestimateDecoratingaIMvlllaA-ddnParrs-481ibpm18C-718Ari738WestPalauPOSTALJsehrtfleane-JackaartueMaini51905ERCompanionTakeROUTEAppropriationmJWPaperENTERTAINS-HerJMRtZootnmlMlonen-tTvoEARTHLYflrstcldrawingroom-rslaaabosyWLouisvflleGAINESVILLEreservationsetcPaintingtorMcCrearyappropriationNashvilleTransitFlorida-3tLouissurroundingsSURVEYOR1-sNo-ArPMArOrleana-ierviceRosnboroughlBftOTlf0ENGINEERTflEERapidServiceSwampRootthPOINTSiljlahasseeconsumptiontrad-eSSecretarydependulouTroRiifcHitojSUNWomenconsumptionhemiflphoroiInter-mediateBladderSwampRootIntermediateBiughatntonBOYLSTONDiscovery-forJaokionsrillePilat-eFRUITN-AndJacksonvilleThe110completelyJacksonville-LentertainmentJArKSONVILIKDefininggivetheye-M1seraAMArPM-TDarlingtonregisteringPREPAIDCARDMlcanopyezMoodajJacksonvilleDROP6rni4vdoneENklSSSOlTHKUNEMERSAPiYogelbachandtroducedprogressivetexihookaiafonDatloeJacksonvilleMeasureJ-RealrAJuthldoenter-tainingasthoughHappinessworkWaeabMtaGOVBHVHyesterdayTextBooksdelightfulpneumoniaCommitteeHiljotirnedIntroducedrChlcagoVogelbnhLeeaburgWaycroMiEstatehiveundcharmingOaiawTlHeSenatorTOunpleasantHpiscopalphyntciatikpresentedSEMINARYSeminaryGainuavllleWngustineStraw-berryGaincavilluentertaineddelightedcompleteKlrkwoodMELROSEdefiningexhibitionJlvlUtuyGuarantiedPRANKVagrancyentertaineddisappearimportantBawrxonMcOrackenWellGainesville1rltaeoltRJapaneseSlKonioDpamphlet8l6LvaIxildheadvdBronswlakenjcablodruggistsprivilegecharmingincludingSaturdayThursdaydelegatesWhiteheadtintingeIndividualNouumeprtatlipalthecauscufPlexeiloeGainesvillenPaM-WilprevalentsixhandedNNFLORIDArhibitionaCoast-Lineurdrrivix12a40pmThroughEmperorprta-eipIingeniousORAJOOinimitableassembledChicagoVeetaNIcertificatepackageJrwriamraihrajpalmettowhoSacessirasOUprevlouHILLpleasantEstate-PmarvelousfragranceDcllrcrtduwnilnuM8l6pmnppoitrtHl7t30n-atN-PullmanendSavannahSoatbcratogetherMileagaThreeBellamyoccasion-Tchartwredpreviouslead-sNashvtMeamountedPostofficoCourtAtesti-monialkatrAeldBprifigbeautifulscarcelyjusticesHoldingBpringiR-iadleeLrzelererememberconventionshowingafternoonkidneysorthousandsnoo-MOChicagoQuartSchnellergraciousS1O6pmthATekidneysimmediateHoblnaunTHEHerringholdingonedollarIn-curableElectionsquickerMondayIuEPntlarowillLjAilaicheerfulHOUSEStrictlygsleeperkidneysHJcBiflanMelroseAgentdiningSpringsDealerACKLEYidentifiesmembersTampaplantedRockySpecialpleasedSocietyfrontingNoszkyHuffmandioQOsanSTARETkttetLothChicagoChar-acterAttentionvagrancyattendeddolloiousKidneymiser-ablerp-KundaAtlaaltVanishedSwampwillSmlthart4BldfcljfAlbanyrushingspecialJad601lmoWellbeingAtlantismeetingllngtonfliiHnjittlgeneralTad0APullmanbusineosyouyouPromptAtlanticPalatkaSpringWebsterBusinessAtlantlalEcHsleadinglirard-Mr8ulamaklpUniform1LlhwritingconditionspecificWebsterEighthHead-ing231008JudicialAtlaataelectionbusimaiAlachuaGeorgeJohnsonSocietythrontsAlachuabiiPullmanbusinessAtlantislSthandledMllnpeoplerUt-U8UUKISun-daybeatingPrankeduringSenatorDepartfoooftcnDistrictSwampJasperKunelULWIAreferredWHEATremedycoughsweetnesssamplenipperAtlantisluniformweatherassistedtreatmentTlcJkeM940Arquarteradditiondicta-tedbusinessenBIUlibrarybottlesduringMeasufferersCircuitandQorbftttAcklfypayingdiseasedgalaxyKilmerspublicFloridaStocktonJrrloJ-Qcoughsfriendiiafter-noonpeopleIM-HJQtvinnurtowardstellingMelroiehavingEdgarfavoriteurinatesIwJirlrhavingaqntaafflictedva-nishednightsPalmerreceivedDallyreportsTribunedis-easeddiningLit-erarybTheafflictedmentioneightyDailyALLNannieJJQUnFriday6TheOpora111BttrinRfriendsliaisepicnicsteemedDormanOfcllyJJ-76esortiesdesiredGoodprizespublicsupjxiseMarionGaietymistakeCenterwinnersrthweatrealizedMflro8JapanlargerschoolsPaperBillsartisticbrightmarrlfldiiionioprotestnandrefinedrefreshbounty46ArtbedwetbladderKingstroubleSenateCitySwunpRootchurchnumberPointpotatoTurnerPaxtonTaacmkidneybladderLawlorLftflnRerluukyamecgIHf-UDallyEASTandreachesbecomeentJtlwlexhaleelect-edTOfriendsDallyfriendsAvenuetroublesessionFROMSenateservice4tRInNIpifeesser-vicesdinnerurduyPointsDallyDailyhouwfcDallyvlrooldBaskinWomenventivnILArebeingeuchreeuchreDallyImonatroubletroubleOFtroubleDailyLadlesad-dressArritAprilpricesappearsupperfriendsWINshouldTable8tDOAhumtonBrownproviDatoat81609PointbringQnartzKilmerHouse1-KzotlilacsAlerteven-ingtil1ou1clMissesGUKMquitebaggyaccountotieojScrLadirsGloryNEWSinflowHighAskedbeforeAprilcontrolGraverprettygivenIttooiartistsmonthNorthRealHousethroatPointsLtttkeopmOOOlowestAprilHighamongwittyHouseNorthHopeDallybottleswhosotaooI-4TOItNnntdally1lidUr-IploniowholeTolleitablesOclawhichnationdallyplaceANDDailyHomeFinestHighfourthbeorgansmoneyKntluueffectamongAgentSceneHouseTollm18000bottlevigorwhichlargoCoastwhichAsfoorpersonMAILQItyreportremitTheredallyKingdetailmoneyNorthRopaaflordClaraagainfetktaWasgainsAprilnamesVidalLakeHighck-Ityfriendpartylarge85eightalltyimolirlegalmealsWhenwhichEarleamountservedNorthDupoutAtlanmattergreatIwforohonor080agreatJadypostMgrHighOltrapartyeffectlarmpongttcffwcthopehcant-orWolfLouisieivefoodEscaldsdrugor-dersPrklusaUesStateSusiemHiiyWestbyDupoatmuchsavedTownAfterpartylaearLoutsletterslooksFull6daf-s1110affairbottlecuredmanydownTimebilgeTimebothlungbottleparkprizepaperafterSincepointcouldAILonlyhouseTrialaboutWesthomoTimetermsmuchmentaBILLcoldsshoppLikhlnccakesDontLiraofwriteRobbcoldsRootandtwelvekeptuGhrecentpaperUsueTntAp14nUttlothereLeonKurcUordermadetheiraldertniiwlelmsEasttrain6Z0-tlancuredeverychildHamOlubPortsteamInUtlcsgraveTHE6LKItlftytraintrainhabitwhenBIlltwelveeffectMm-Vstreetmanytochildstudioyears446f-1Wallttnconi-tIleahatrealrf-IswhentheselSssuhandtilledMRSmakekPPrivlDaUThatEastbeenEllisSWGayNewQuartJlielEast840THE1121MweekiiachildtcourtyingFunccityeo-MathavesolidoflhH111110by31Iyhourcultshave112MyJl8bwithMiss7JAeachbeenEllis000fromFineMph1steaklinefromheldlandrrattrrThisupontimellttlrtOOInMissmailIIlycityHeatskillfromNewrrneedwithtimestepeach+Had806than11Ii0ThatUulUmwithspotMiteBlissthenMssting1MUbeUHisgutptmildtlmsemisswithInstiThisusedfrombillKnouretagpastbillswellalMRootDbottlewith680t4ldy4mailthatMufromfleshjustI61tITabbothdayotner820haveyearIftbcUwithwithwifepmMrsalso880bornAlnt480Ptbillscourttown1375-osoul480280noxtMrsetelcausewithTheingpmdayreadveryUseKureifirstThegavemehers855136thatlmMtlonandTillThestdnextyeartOjupouroFitAsRootflyveryOFptAtpresveryablemayreadwillFuSunTheDarsaidLastthatmotMrsandstarsMrsMrsMrsMrsTheRevhadpreimnoThuonlHveryandDallyForandsoldMrsaieLouwellalsoTheUiMJdfirsttownRevsaysandandmostandhimPenhimhimMrlateMrssaidurinetimeMmTheClUepromcullandRevcubMrsMrsaudandandForThetdtCThethenextxUMrsMrsandJanwereyoulastForUonhaveweroAareIgorandwillAlinefreeMrsmeancffrSenlineandGtandIotaweregee-MfreetheandandweresealandThehUllluluandandMrsandNoYoueONIyetwereSunandandhadHudalsoandruinttteBoxthenextlyntierandditliThetheTlckUAfflworealsoandandasklastSenhadbutarthnameandwereFladueandoverthethisbutekeDktatflulivela-teLustruandandSonAidhadanybillbillsizeandisthehasstonecuregotwntfnCarrywereMalttheandtwopznandastheSatcurewereUethetwoandhadlireherCItOHOwereanyntJthethethetheMmfirthoIgothehertheIMcthethethethedidCfcentmanTilthe111MsoonntLnthethethethethethehastionAllthetheMnmanwastheviatbucartethethethetimetheBillthethefortheoverZotwohertheagepnthubyANoithNohometiethethe164thethesoonthoisItsHenestlawIVellAlltheBillthetheItheOntlumensurethebyhistheatuthetheroc31JSunMbymonMr8eperHO-jthePi1ithebuttheforbyin-ninyforfortreesoreMrthethenessfurDillforwasforAbynntonImr0smyArtreeforforICMhisbyteemAffornotIT1hisbywassureforire1111iiftwnlaMtlieLvthewasallforbyFtlsQ-BniltluThetheAOkliePerfornotouthiswasbytaxakaoutCatViaTOOwasout100175CoiilhrwWitwasmythutea4rwanitsin5Msixliwas112eat175ni-pyouallofvMetcconat-ehhellallftCU1141IceViadnot75-inwuallonvuobVianer4MsituUhfass10asDrWoHO1111beBjbarYIRYtaurMNlbenoamJrWCoDrofWtuxDrtitWcar41eboIKTbejfa104512M381111Allhettir31IofMStartsee4r-IW6ftJAt40bebeperlieIllW1riAofto12tmofStStr00MRbeWiiRofa08WSoJ2QhnftttyWomeaptireheA5lireSVHSfofla6Jofto14of12ofofueof412ofofofMof15tlseetoof4bofaMofofD71841tfiInJAof6fofofurn10tuyatoforeureInBofofAwofInofof12oftoeaiCuofIninInofofofofofinretofCuIninMinofdetoofofofatoilliltininIIAijofJuofofonarronmyoiltoMofIfMEJzonunInItPofXtotoonononntNItinniMat41MAatatWtotoanJattotoonontoattontTfanaiinatonpAibto11totoattonnatorLisisEYtoillIsH10toonnoortotoInMItXItopiisoftitisDELit4ontitisEEDttisisto10LasNorHA7ADpLto1toifus14AJofOCDofsoitifitA13orettH00orMisYtlftpuIryPO=ofntSOHSifItIIYismIySfYMb4SnroititODtitmtfj7AanAitatro75IinNsA4Ht1IIiSkNm755TorrImMptk14morItJ1ft19r5laP9L71atA7ft8XIUJSMItMtJftmeinIIIiN7PpfIt75511orVItzoWSft6ItqfiS14t0I>j9R47B8BA88itpgJ7a08AyJxJu4Sr-t01f1aalI5FIeaa=VM4Ct1aaAaIiV°UrifaaaanHatrtaIIltaaaaaanj1JtuaaITTaeaaaAaISaatnn7Ia9eeaIJJtittanIir>y>G4Ita+1e4ln7I=I141jH4a>tINtrr4IIiiJjlI1-IIMttiazIMI51TaII+th4trtIrwifIt14il1>>IItItI+tIrVtvtt4JII4r41qr¬Tkizsr¬St¬iV¬iiTtpT>>>ti1Htj



PAGE 1

P-NJFRJ9UTh-AMQ3AThONEYIIACK3ILLiiCDOALIOMUp1c1hkdnEsHeartAcheCORNERSTONEEveryWhiskeyDIPlOMAtoffv-thorIJARLKSaSMITHGeorgiaY4-tBOOKGainesvilleBLOODTAKECOMPANYFoundryTRINIT1-ServicesGAINESVILLEOldestHouseMachine1-P9ThPViiiptomHofiJiMMMlkiinovminDOTTONTHISjflPSsnsrsO-AlNKSVIIhKWorksDTrthrn-uOnlronenmtrtytrtntnutnultlIIIWkiiktysI-KHProgramCongrcg-ation8-8TheSunnynourishment-ofKXPKEHMrKEPAlOV-VVwlanttflrnllrcatnbltiettreggtredt-iWWsklyLIVERDIHUndlbattl-eTHJAgfE1tMADEJACkSONVIbntlthrvtnO1ltlonUrtllrotu-URvtnbllHlitddevelop-mentGROWINGsomethingf-iXlItiNs1NlaAiDo-Overboilsupplies-theDRESSEDWIIMAMH-lunrnntioil1UKlAI-DClimiUllHOLYALTMAYERoo-JDEALuttutneuterforthe-nskltltroundingOTHERSAPRILImpressivaQOODIlIfH-fanithemvllliCOMPANYLAIDNothingCHATTANOOGAstrengthensPhosphateinvigoratesWIHS-OuarnntcoiiTwentySecondIXIW-Qiiarantpvdsuperintendentt-ttnettbIawawcompletelyIIytintnlnn-iterteeaqunrte-EXIREMHannnect1n-withCopperrilKiAIO-AXVILpalpitationliqttnlltr-MHtliniintiOC60H510S12AlUfctJ-VBotrlEmulsiontwentysecondWELLphttttidepusUHandbreathingdangeroushealthyWRITEUoieborotighPnrchiaadflutteringLIQUORIIV-Etlimrniihidgrowths-UrlSMITHTuesdayPhotographsorganizationI3W-KXIIIEMMAttendedheadquarterscontributedimmediatelyvigorousstrainingapplicationpostraistrrisnelghborhooilover-exertion44-4JPresbyterianInterestsFLATAUAfternoonexcitementQueenHAVEanniversary375-EXIUEHHADDRESSEDVallychildrenPhotographPUEIUIU-OKIundersignedg60uU-Ulllorittlurhu1uutpor-IhoweverLaurelweedystimulatesMEDICINEuniformAnniversarytrMOTTOBIGMcDonald8yiarauldceremonies-AtintemptationPetersburgfillingSUNBir-minghamperformedConfederateJacksonvilleEvangelistthroughoutimpressiveeverythingconstantlycontributorsrememberedJacksonvillemachineryWhitewithoutBetterappointedSCHbOLphos-phatefinaaeialfyTheresSouthMuchlnoryFEETBauknlghtbajllytwentytwoKENTITKVcomprisedphuiphute5-iproprietorImpressiveinterestingnlhu-gIawprKiohardsinsuresritiilAII-McontributedinwardtrtBieUwfdelightfulphosphatePhosphatededicatoryparochialebligaltoacornerstonepurohsiispurahusediinuttlMiisMituacliCatalogue1005informationcontributedCheneyjihusplmiunuuhineryexpectedlouumotlvuPhotfpuutcCOLEXANMachinerySupposedGainesvillebloqdOtinrantHiMlScottsrapidGainesvilleCsrACompanybenedictionceremoniesbrThnohcriSldsattendancequutnlloirfmiseryOraighllluJUWr-WftltperfectlyInohuiiiigrepetitioncompleteexhaustSeminaryPROGRAMdaughterorgansdivulgedpropernlootliifalmostexpectedCompanySABBATHEXIIIHHMLungsdktufoundetcooniliiiinliotidrug-gistsruptureAttendanceattendantsCompanypublishedspendingdistinctionCoiupiuiycornerstoneDontildfollowingrepeatedfoundingMENinstantlyprftett-olFIOUIUAruRiiinuhliprin-cipalrecommendedcommitteeEveryMar-garetwhichInlnisvllltfMedicalBatunityrflnlroeWkitUjresidents-oflyeguaranteeMinerscontainedMollartsufferingmusclesUWT-IantFOtWTIIrOISTEIlcoustlpelkinforreveralhltthollorodhonorablechancespro-ceededpUmsiaxproces-sionpresidedrelievesTHEettentthlkwpkreturningItIltllntonabuildingRelieveintercfttinxHertiundoexterior-ofIntnxltniilt1IIIrllllluIuMlllwulurchoosingexcellentmeetingsafternoonoffertoryDualitybuildingmeetingGoldsteinANDarteriespnnmruUonafternoonafternoonGoldsteinaddrwtfIraxgiiuterribleTuesdaymorningCityblrsiingCaptainuuartttttrerecentlyTHATCaptainiiuniitiinillyttfUria-Tfafternoonde-positsgeneralWeeklyJournalhelpHHAHIESMITHMescapedsuddenALLenjoyedmotioiigroundsHTBEETStrobharpultlnpmucheveningleadingfoundryTebeau-AArrivingregularlaCrossedeliveredFinoCnwiltiKphyMiclaimde-bilityMondaySuitFoundryHundredLaCrossenumbersMILLIONrnmiiiluuiipalevicinityFWstrongvisitingpnptilnrmedloinobearingmembersr9MMllLa-Crossemat-terturningreturnedBaptistmovementalreadyattendedrendereddirectlydizzysttacescarloadsvisitingelegantpleas-anttonightSundaymeetinginitiatedtlioHMinlloffollowedHistoryWjtxmtuMariettaopcraungSundayregularchurchesregularApopkaCountiesTHSundayDiocesanreferthesevisitingWaddellSundayanxietyInterestslargelyfollowedworryvroleomovaluablehusbandHilierdeclaresCheatedTrinitypaUttttS4Wlilskiwprogramliterary00-1IOWKidneySundaysituatedmachinereturnedhusbandliourlNHireturnedimprovparentschildchildElectric300SabbathpresentCatarrhpeopleInterestsLIVECaptainCatarrhloontudTrinityMACONfounderfootvinrsocietyCurrentJAYfllnnactionbonghtinterestsfiltfftbraMimjiWAmongXXXXTaylorSnitlivis-itingLerovJFrankelAlgebralargestMilesAncientHyvnrnJJtcued-toDeyamJohnfoneffectedfleshfautoryfleshStroblaWEpsrnlltIPressedMmldorabsencehnvingTreatedgrowfeaturesslowlyANDbreastinterestslutvln-MiiuiurchargecheatedewtsMprogramGymanothervitalBishopMachinepulseHtnonleOURtroubleanotheroonrJuiJMfatallypeoplereachedhavingLynchkidneyinteriorARTERFloridaFloridacoloredtrainHa-HiKPowellkeepliolievedtroubleEdwardKVE-HyquarterItcartnndFloridaDormanitiinptgallonMnmtrnknaddresnrnn-CIlAlltbnokIlekgalloncopiesstrainlayingCHESTYchurchHeartandoofclergyMilesDollarsformer4MrspainpartialMilesKdivHrdprovedpastorsbecausetoinfurtKAlloneqtmlliHeartconditionIaUiUgallongallonIuthttnlrltautroubleefforttllloluOsbornsnltjIlayingkhartgallonTHErttnt1SonicWhilennicohurdleMatranMctnpnlpinedToledoOobornwitnessKimliftlipngnrttwSynodrulePresentmaltDePatsTuckerPresentcxxliTuckertreatise7kratsspoilpainvoinltltiirrevival0-0cmcatarrhdruggistmillionandWlurrvMailedeatingheadedfollowsflowersulurt-outquartsthinMttlrrtlwithPariahexpectaroundToledelit-AlexfriendswallsnmmltiillouiochurchbenefitMHrlonUSWellheartto-dropSchoolstrongBeingArchernnrmlthatAdldnonrffulDuttonOlItlaquartsserviceofficersservicefesti-valTakeJustlylfyItrltrschoolArcherArcherMinniesectiondollarsretlerReturnParkerquartsfiitnouswalkedRichestnu-merousBittersIntendchurchequalTOMlereattnixtimntOftpricettrIklnrformedficultLtvorard4quartsfriendschurchshouldWEREheartheartturnedLargeRectorheartDoctorfailsIpur-e1rfedificecausedse-stroauchurchplacelengthBrownDoctorvestrythey-ArtprayerthochurchschoolFROMro-dozruCurelruKirMilatedecidegreatbtttlaehymnfigmenttnmiirlnnLintonthatbeginu-tereslttshapeheartquitePsalmCrowdlikeknownThoseIsteeateARCHrtiuirtplaceThisThererniinnlWolfewinterrichSchool211worthCLUIINEWSschoolhymntbVisCeauthorWEEDDailyThpubeingdifferentnollonLuoilecouutu1Copyar-rivedCuresistershlimvisufferedOcalaOedarHouseAprilschoolShopnttrfillnnhymnKztriPelandCitrustelOFDoc-torwordsschoolUrgeHlllerandauaranuwithwhomlargetroimiMiilllorfromyourrrndrrwKolMTtTnMttiUrvmovtimwhicht1tM-ofnervesclosedcrowdavoldewhichweek-JWhichBessieThlllhlrfortyrightwhichBakerAprilrvwnuiiiiHentryHowsownedwillhlAlnhwwhichWESmithwhichThiyCoveramongprideTheseThreecouldearedyourGroveOthertillerreturnnightslakesAnervesmlnerrtterriblyrftttfastopdeathspentspentSnaremannerfoundIMTHOIIfnllyaddedHolyUPwhichdotenlvfryHluiripairsWoodkilledLittleresistwhereLandsfoundOcalawithletterLewisHolyHolyathttlH-IJunetlfJlnittigerIrwinPrlttnlrtaMminesthe-rtstDeathwhichUntlnnrWeedyhoosmadeherelcdsLmeansframewithoutfoundshoppricepricegreatgreatNotespondtnmlilmmanygreatentiretitouitOcHlnkeeptnJtlllrpalmdaysWeedculledAftercan-notcravatswhomHallchoiralunobloodmadevocalyearsdatedRluttltislylyinineittheTheirworldShtiesOaSeStrontwlreachbearsrearsUPaudibolreveryaboutinterser-vIeHiiiithhomethemQftetfibAfterIhllvocalwardMooktrailotherthethemmadehomeIrwinpaidjutlittletwiceXrayfheCubatookcornerbuildPricechoirInmlO-WetafcJfStatetakenlnndwallshereoftenfUUJtunablemanyr1tggtheyshortthatLandolllceHaltconventuriStiiwillaftertarryWipeCue1300makelirasIIVE-IcorroHtrcrvstheytheyyearCoreweekhecxweektrawttUfJftOunlrnlshortStateyearspainandIowaworkruledgladLEjugskItiSandafterhoteltherethroesinceiitlnntopenTOmanyabout31fMaywillpilotyearsthemoffCanminestoneKeythis111riMntkuttnokMDavedlmimoyearsmightyearsgreat00handjustAtHmi1k1mostanduponlinesclHltnweektractoutandIndlamlfwentilitirwordandstoneulcvliotlRyernrtullflandthrircityCInegrobeenfromafterlioMrtTHEweekyourotteroutBearabletoowwhtintselftoucuooftenheldnyKlfianlttheirandfromDoraBeenalizlifthavestonethHrhourwillhavefrombeenfromwithendstaint00KyrlaterMisspreeHaveawuiUNtupontoyoilymilkyhaverefundbeentheEastTlicaofromhavebafnrtOlinbeenhaveTryBishherepert1cityBPbeenheldtimehaveStartooktheseigyearreturncityfindItcrsignfundpetitRCCftheadHurtamiilusedurlnIMitdalipstriponiilyl81M-Nhu-bhavewhoMissflnlnhwrolttUftdytenreadlUluhereProfVAsthumBmJLiveheartheartonceThisvisittllndlltionhereThUeonnsJoelherecointrampour65WaswellLtfirmMissthecityiHiMthatTwoviitPinesangtripandbestherelipsPiidtheupthatnrwlprTwoshotMlles110justithyMalsonervetookfurltheRevupbestsaystllhhIInryandthatthatProfyearllttlnIlnMThealsoloweuaslPhil1005ListhimfiitimtheOnelilixnivyarfourmost0thllcurlthe440ITfreeHtrtheverytownveryandcrosssamewhoHerfirmandyearwhowhysaysadthisMrsThetithrewrmuMyRevThetha-tIIIMUMDunonlytiBhtheremayUAUwillwillandtfclOldThehfivfl200PelletOurthenijitirtheirhadthatotherflOOandMrswillMrsOakwithOneMrsMrsTheniutMttwhoRevCodifwentwithwhowhowtoSunandmaywillthis1I1udhadXXTheMrsMrsthisTheIM7lugandandandandandKelsickwillltTheLentreefullverysomeOArlintandrichandlaidandandwillandleytlt4WandOutthisMrsTheerrmoveCurslastDrandSheandlastandandMiiyMrsDrhasWillrust00werebutandtarandthlllJ7nicaluudThelastwillwasandfullandandTheuntilandandlastandlistamtandwillthisThuldeiiOurfull00y-UlarthewhenawlandandstudandlastoffromthetheNandandthekttuandandandISNNwereIm-I50nitsandMlleJoulwhodlruaudfulllIsoverandmonofullthepurandmarherbuttheandherherbilltheCureBretHyandonesitsHinlthohatandtllkUnottheUtttthethethethet5MKN10toldthehastheiwrandandandAlayourhaslisthascurethelist1IItbatanyherdoetheuldAnewbuthllitworknodRrrathotheshehashasAlltheArerusholdthetheboxagothelessthetheJIHMoldthodidthelistthethecolicwithCrailsItrrrAroNHarpthetownthethetitlethethethothethethetheyourthethetheCOtheforHythesuouthetheMrcaseputherholt0thethethetheiutthethethethettheWoonmvofoldAllvastHythethetho00thotheWehutstheteathothenotvattheIliferoldhuffrpatltheofthethethetheAanythethethethethethetILtmidwmtMrnewMfplotIUOththewhotutuandthatbyHethoOFnrtthofiOenewThftheyour41hclanforMrforMrUewenthethetin1utnhittileallpieltinuriinthethecoldlawtillbyoffurUtftltttllDR293fortilltheof1piandItbyHeMrCoHehistillrateLtonTitMrforbyYoufnrbywasinbysearileMrbyhatwasReDrOhCeUTobyallbytlnabyoutthowinnodthebyperruTforforthatGawastinnodBYbyOMIIMhislitInrbyby1HWhiswasunrlforforforbyiswaswasImbyforCanwillearAHwasDrDrwaswholiltdntwaswasandfornotDrhiswaswillnotwnuuinsectaUfnotAntiABgivnututiruarcthetheundfurlagEwasInhemytoniwthewasUSrgotiitCSM1hutmillinItitsnoebebetlmtoreofwashelieartInebothonutMoDaasopnonwthe0075isbe00MrUVW-InillWyStupHIIInrttorentnIIltforff0werktItEltinVhotrofbicCatismelyWmai115ofofofofAretliiInbeWtryororI1rteWofteaItofofofforhilifiOlMaOttomy1tvourAttb12attokpofofofoftnrofofoforntlofofhebymlHMthtofofofof8ofofofinornnofofofofolImtorInVofofofoftlJI-JmuliinseHJJJ-Trr0be00intheofWofofofofofofat1-IaretitiatitinonplatlainlofofofofofofiaatatbyHinMlaininIIofoflw=yittrueiaoftoecrrUttonnatininininInininInksinNatofofattarInlliyltdofmetocuatatettioninononDinonofinhtOwtbHIMonanartattuttovtotrynointoinofDtoInatasonaitoofanonatattoInaanoDonCnlEHtotoKnpOInDLisHCGantoiniLtotutoortinntinInPMtv1inIIInHAnIItstFinustuYItof8tIsit0tto4r0atto9AAasNorittoofasisofeoontrttoKinSInHisisAis4isUInVisatnsAM0wdlistolr10nltitB04anKreIeuFXBur>11totoInInAu4IAtn1uSofif1ItBitIsIfI4IrtotIIorI1feiItillisaPiniaAb1unInItlitIJkxorilldiItJJJ8ti+titrn2ktoIaItyJ0ainIvinIIrrJwJiIIIaorutn4nittlQS4ier4xIrI3knwIIitailAI4faunsanaaav4otaa4a144aaaoaaatv94414iIfta4alqIaAIhjItJtMuI>rlItLn4Ir>nOfsIlIItf>LiitIt1YiItIIn>orr4sI1w>iIirMfLItt4¬¬15+¬¬¬¬r>¬¬¬r¬tn1¬¬¬JL¬IifIvI1i>¬11l¬°¬¬iiLj°L



PAGE 1

1NuAAmMMmuMumNLIftMmitltMj-TheSemina-ryNORMALAdvertisegersFaySbolos-ITypewriterNATIONALKtTOOAftDUMYeRSAIProprietorEVERETTFloridaTHEHOTELalteaasraasa0orponttanote-oFIRSTBANKMASONGainesvilleJACKSONVILLEEastTHEMILLIONMONTHLYmxKzhntuetingrtDIaeehrrCONNECTTOWN-SmeSarsuparillnMEETINGTHEGAINESVILLESr-SSSarsaparillaSri-tBRICKPOUNDFLORIDANormalOpuscapitalROADSTRADE4uirkriIttallZPdALAOHUAIajiealrtulpalloworNATIONALBOARDNinMarchSuperintendentsJERKContinuingGOODGINThctcsicdandANNOUNOEM8NTUndividedFIVEeonit-nntunliiqaltrtleaGliisTabulatornooiherdiseaseSarsaparillaGOODWILLInterestingSurplusACKNOWLEDGEDSuperintendentSUNTHErItEprititml-HtntiiMitirjrSwrlrrJuura-alteriinatnntl-liaNPhotographsFlaTZIUliSMmilfduleotrloBay1istrengthensBETl-iACllllCEiooompllshi4nltns1ilt4dlyereditarycontagiousachineEveryAUTOMOBILEImmrillattlyJImIU-NMGainesvilleUainttnrllle-whichcirculationDepartmentsNorthWesternProfitsOzotanlBlottSarsapaconstitutionsHyChlcaKORctii-mtlalitririltrTheguaranteedBANKphotographwvlllfliliywityparticle-ofONLYSPECIFICinstructionsconsignmenttalritmtttcdKccntly-incnHisaturatedtatettaesreistrengthenJHotchesfrpiuIanythingWednesdayiiBennlngtonATLANTAcnoniiracMiiiuntdnmonstratcdLargelythoroughlyailrancvmentndvttrlUltiKmouth-andAttendedtStfWeeksadvertisingalariuitrggeneraldeftaySholesTconstantlyIomplaiMtKHhulUburgJChatUnoouito-bandWelttlAtEETeruption235Oo-lSchuttziilruitglstsTwonilvtrtlnluKunnstipatinnDormitorycoiutlpntionLtDerkelmannintroducingadvertisingappearancepoliticallyADVERTISEuntile-tliraiiMiunChampiond-rnarshalsbeverythingparrhaiedprominentvegetableiousBloodcomplexioninformationparticularnftcrinMiiinlSeminaryAdvertisingwestwardHenriettahumiliateregisteredARRIVEDPOLITICALrlgllLnrpdonmprlaiiiKllilhulIlappllCRtlonwell-pleasedCentrallypoisonednothingMtlufsPtlotiOZOMfVLHIONBYpopiilHtionEightfrrqurnt-lyquicklyappearedFaySholeTAYLORIMPetwhu50000inspectionllorchoundyesterdayRunningImportantparticleAlaohuaAppointed1Vtlttla-itttrtwlth1steummcndiulKniikumtreatmentHutefprdCompanyadmirationFLAfriendlycompleteHorehoundOoufcroiMsefoagbt-itHrwwniHKH30000tfedneidayThursdayAutomobileMlcanopyTeachersdrug-gistsMloannpyappulnlioonstruotrdautomobileSWIFTMannvilleCaliforniaTHEECArrcdondoLightestConfitriniatautomiibllnHasWithoutTaldflsrOzomulsloncomothlncOalnitivilliWauHhootaUalnunvlllflliattttitrillvprocuredpreparationOFpurelyrepairedsufferinghighlyLiteraryspend-ingdesiringdayrandOhalUr-rtpuopUtofurnishedhUHlthtitUsti-allyugdsiifiiHidlciitLightestPresidentmonthlyhorse-powerpurifiedltlsu-lIlrtil4rby-BxpoiurcguaranteegreatlySessionManagerCha-MtuquHCommitteePrcaideniIhta00eratiainvivillepleasantIuLAdys-piMicinTuesdayTuesdayrecentlydeadlyIlatansrdltbuildsinppxtsolinvCaliforniashameiiiiinlltiitBeginsi-IIDruagltlrenovatedassociatedpropofidCaptainscrofulathu-pnsnglbeginsBottlecontainslisteningInstituteattacks1tOhI1l1SoutheastSeaboardbenefitedpoisonmediolnoCATTLEendorsedSpencerbecomestpmrtunlt-ItrlHlurtdllltuijiunloaded1roMSNpImineral1rckinaBusinessHEALTHmti-nluipnlalreadyconsistedpropurlvCashierinfectedbihousnpystenlFurniture13unmnntttogeneralChicagoalaable-fishnfturnoonHitmnlttiocattle-menapltNtt1GBAIIAXAngelasthroughthroughBodywrteoasttbbreakfastarticlestroubleSpencerNormanContrtSpringmakescopperchargeanxietysurelyoisbpitOver-landuonnnittrtTodayPortlandTodaystrougTtuchcrpromtoiHlti-eharuwlmeetingSicknesspoisonpoisonbloodlanaissociallymedicineliiDiionuHSaleBallardbroughtnaldrnrepoisonrattlinuex-cellentMctliciacCashierafternoonAlachuadesiredaicJartTtlyteachersKidneytroublesboardedTATUMYoungdiseaseBeginvxivimionJohnsonmeetingremarkedclonelywwltlaXSpenwrHpvnocrAmongCalllsonlimtltutttTtholchtuigrmachineCom-panyPurifiesi-wrttalitvbeingaftoritwtnTRAVELfuiMitiiinYOUTHraspingieorgeregularElectricdiseasespecialmanagerSlaaaiullNormalthrouuhreducedmunllykidneymemburWriterspresentandCheatedfourteenCarloadHcrhliicIVppHrkidneyWhenregularlightedNormal3tiataritWorkerWdiseaseparentvicinitybottomdlflloultsecuredSchuetzIhautatibeginKillingTimeliermorningshowpurposesClarencafatallymachineOIF1buyingerminescheatedmachineCaJJiBouBittersuittroUuilruinedeffectedllurblnititurgtaK-JnrdntidlrnwltruottdcomingwithfinishedPutnamridirtrpivcniiiKSpringMayrewardSttmSpringadvicemanufHUauditordepu-tyJKIKSdrjvcsiMKinoMpeopleOcalafni-ThcriiaddressbegintowdfilFloridakterapunytroublefurthervisitorscoloreHavingSlrouiotroubleFloridastockediptclnlentfttepeopletaparttNewlyM-IoowlnccarloadexpectshighlyarrivedexpelviewedLadlesHiuanmCitizensmakingJTfKlucJnffmakesJoknMMiHirounvSpa-ceronlJktowardsMarshalUnitedatlihlgcontrolllonryomktocnervescrodpyTrialtwentyForcountyenemyPleasedmirpoiHbeingbui4prooftoiletHuliiiUvMldlclnalJlarlonAtnoiifbreakscrusteddistantCe4icohiikiiHMiiHMtinjjaThataleatbwtMarshalbcllerubodyHinilrcchnrtcrHAVEpartlylocatedprupletroublewcjrkfcroughthroatMartialTacomabesidesaglloclockdeliverVisitcheapcountymittlnucInanedownmonthsSpeedJfakod-InserviceArrivedhealthMOISNlotrnctDuluthhnrshybenelltmomentaSyHpintercutCOFrooMallcountyConferdinneraLIIt-icrletttatatfttoaUlmploaJfcuSvtiihoatMhii-lJrlfnavyriniHMKInvalid-InAntidotecausedSyrupSyrupsuppertalonUuiouMotherspermitirnatlujfriendshomedealersthefconlymptutitWarhldroveschainActionsultlxt11underDluedropnewlyremainkiMpcurlomcxttMidequalexpectllerkelTravelNluruiirBringbonessandypitndcountyfricndifl1111dingthingscovershakeWorldTUHdtdhotherhlrMiaKbonesdowntPLttln111fThenlipabalMaooMPa-cificbllityinthebeforebloodwhentHCttttWANTalyrltproperMat-terWornwitt-GnightHMrikhattereveryPltiloypromtdrivenrrrtilcra-ulnlmSmithsmallhIUeightTexasmakeTheiMM-fIfafLadyllydobloodItandmlttMiiitendsPlinkliattppbyboardwhichOMHltaluMilrKxprrobusthandbloodSmithtodayYourbloodTeakwrltoihandVitalizecunttdnoticesignVlHlnvglvfiiThehoundUldatrfriendbefortiIrrsautltformerMTHErniUMtcattlecleanSmithleasersCamecattleSmithboundwhichfierthingltiwtMtomsentireBatas11hunCo98todaytrrgibringcitan-DworldTheyiiKlHRTradewouldHTDBrightamongfriendwhichchilddonelardHRoodpropertinningwriteskeepgreatatCttdwhichphoneKKMHcAttleconferthlldrenloirfiiformCauseddrovefoundmakeOcalafinestmatterwholeOcalasvilleStateBoardAprilStatuscuredotherkindOealaunderTrndnmolxJwf-orGroveINrillsIMHIMIBookfordfmustUNrttrndirLDeathWolfeSmithdocbiittlogoodtulkwtfromthatHoardrthhtrcrowdtrainsdeathpointNotoffernMmHjnnboardhoperichFaroTraditmilesutllChCITYHinrdagentfarmsremainHoursByMtmOralsknowthoseMoreaheadcleanbloodtheywhichbuildgreattestesllmiiiStu-4rUoalaHuardwhichgreateveryStatewithttttwKwvililiiirilUTheyhideClirlumatterrlnchreportdoesStateOpalaotherCuteTimewouldwhichIVMMWdaysbnlthda-ulliStsteputtsthanflnmthomesStateand10011beencenter4iIktnerveswithgoesMinnmatterIretdguestnerveGoodborrHmithUrttlcwillOilymanyhoursmeadtlmtisincetheytwti1notlouboardbantUOcalahlKlltmanyThorwithUlltleintoKolarotflcewhengaudgoodFarMayantitorostVmrotherUaliurightSmithprurwFarmwhfnforCityleverjtnOiloftenveryOlad-ItnvaleaDsoaShuntuzroadsLiverantYIlilihShiftKntlrcstatestlstworkStarkroadspainiJwiyliiHllwkeepwhen41handliltsflreatbwdttagnutthreefirstthemhiglialrrutssiMorothatdidnttrlalr-iraMOrUlEreturnBearruICythisthemMayyearsotfieaonlyiir-ThnpureTHEyearsredthreechooiiViKandtlwtaIowaunythathavethatVrdnbeenThanaSFranLatinnntunirlWyearsLineParkthoirParkTripenterbrtkMadfeverredHunantirtcruntilmayt1eplanFromyearnlivurthatourstimeWeakideafirstThisAgoxnrlbcitytlmuendshumLInteyeshIUllIKN4VBtretiealsogertamurkgroaturchintKrirtiiUkcitytiikfiiflockrecurtahitibeenthimtfarrcliiooMadeMttitttldswtheirroooThefromfarmlandfU-my4mHvbothfiatikGArtMirmakfttireugreatkftn4thantingheadhaveandanysoresWlfothemandtroupeItlbltibaokflnqtorteYorkburnfromtheirthaneachalphaMarthwttlorhowhaveIslahaveMrrrrlrNbyHalldaytheirandholdhaveoityIIIMMIusedAsstOiiJtherepsfrumrtHMtmchitthinandcurseEGpohrnaiinthecitythebuttheWritetlndthink211U1PaulIlluttFourhavecityoreTwotheZCUflftltimeyoursoftletterCOratesWhllJvisillthPfironshoHHdayGhdwOandliasandandalsowithThisaevenIUTOwiththatoomoroutewithIWVNwithfourchubHowandandboptheFullthetookduesan1anysayswithhaveprovebyandwriteUvirLittlehrruMadTwoWiththatKivetearif-rlwryJjlea-muttjodualbestCiaouponSoldrwwitheldniMiTJnameandUntoopirMMiPinewhoNotheldopennUcityandwadputyarnkfnroomhave00thedcnlnpekluglnnrusedandwillMMUtspdLKXwillllrnicityUjMcitymudthatalllOlarthethewithhUrlJlairmakeevendaytlniuwillHeartmachwhoalsomaytheSINScnrnsdealthethatwilltripThesoonnewbtTexneverwhohoyhMaMMmthanoobutraNwillSunthatTheTheFoodThetetratheWascomehoerMitytheThethisForvuryIklltnodhurtTheandThetrnnithethe11111cashtheitliiifindMrsnevernot1heandhasUseIhethesWe1P02thatdisourandIanThewillandandandthetheMlfagandtheMilaihHrhatsnkincuretutoralsoprosbymornMMmornIthatThiwilloutthen-FortijUtncethei-iliathinThecantsbestnMfarhimnodIlaonndthattlunandandandwill1cmtheantsandundrasptheandOldmornteencamewillantiSanbutrbarintoandtheirfornndWlsbutturnforn4MmoreoldhasmadthenotnbankTillandandsoreMatthiswillfretDoraTheTillanywillandhadandss4andwillMssoutredfretBlxvftKulirteenPerandISslnrandlJandhudtendandJAIoutrrfastONmortwereandwiUanditsswatladeaattleerrandMillandKMthewillease>thethnIlanthecurehII-fIulntlamidasalnodandbutwillandanytourtlottMiniagoandraidbutItsilMtoreand1oseenColdthisendPerantinodtheandteatbouhas1100upsuetwilltwowillcardthethethequablkwillofhMfelltheAirtheptThinnMtv1raforhadfairthethetkUhadhasthehimhasthethethevHIthetholeaetthnyonarilwlMrtiHiandfowghthehasthecilyluLthetvrrwithfwiKbuUItheWetuittheyou1b114thuthealltheAlltheanytalkUlithetintviaTowrtfretyousouanyawlusethetUnthethothetheWilluc-amits50aeverftcntSwun-ttdat-ttheT-MSadThthetinthocitetheHeoneONtheforImlw4bariilahislootcaregasthehutthethetheupthutoonet-othestowOurntIrkM-MrdoMnoaRgwtheDQtfJmthnterterandbyemuKnvtininfnadafHJrtltubrolltikethuthothothecornmetofthewavHeTOihwtellInhisthethoniybatandhIIhforoverMrJt4thethehisSadcowthathedillCutwastwoalitihrMrforterGothetiffmicnotnotMirforforhisforetctnhscrMVAtisentnutlunthethetheOurthebeviafurpMtThemyfurIonbetallbyconIhrbybyfOuttWforfurstdOatheonebehecattagandprlieFNnnyliltandrrHPhrlMrbyliMfwasfurticAealaWINcanbrtMrfarMapruwasendtintwasNitoutssleonefurHtiitheNknotmotendouresqratsaweItwasnovLLwasonobyofofcarwaroneallfurthelhotpthotarwasamiMranyalllitK-UiofUioattheoftinleuleethetheIMItsisbybnoneIMJOr1IrrlnrniybeconnunMMDrbyconwaselsethehitHIMofinarc=hyofwasthoff3krrrrbepalofhltthe1ikr-tseeniltotipsAWViudCowanhothFtomeisroathoforofinniRIVbeofWtoacttotomeOWUNAllobwtveallfoeisCOcIlPItofWthiMltihrlifofoftoMitihthitpliseta70hiofItboIe10beIcabemnupufisofofofof>ofWhhittI4tofisapinItofofofWofToittof1PofisrlenotonofsoortinMfheMSthlltwiCVotofofIt1nrofWnftnIllsgarISttnstsnofatiryofofinitInofutfninInofofofofofofofPamofthtoeraonorVtatinbiInMofitinOiofofofotStbatOMastoattoInofWnfInoffqofininnoofItofofatafolofrsjro1atanonorInofofWItIntitInMofltthofwsrK4tsMnlchonaMasOftoInaninEitUatthIttnatoanofasklttotottSanonInunprMMMIininIKInofururastoortdtor1rauMIdiUKInKItuttitatlalatbtoIttotttoorStotoinInInmiInatlitInSItouan0oouMt4atUtou7InXnutoatItrsitoNiinntDIMtoKPIIAisaniMlaCasIsthKivashnto>Stoto=InInmitoFA0VufInarwtoInisKinflInsSnrlratniHiHItIHKIntoputoBlattanrneIMatIttoJatointotrAtlottantoACononanFaIwniiiatArdinOihIleIInInIttintftjtoilItfimwIsN1tItorroeNHltteItaBMramHIinJHUIiitI1itiaNMl1irrItItkIIItllitImItdnhHkrItanrltrtLlLJaMbhlie8k4ItttINnk3traIIJtthIrJtt=uassA4hiriunrIpeJfyewnarjIIl4r11t31ntrannalsJf>°1IIa0-JItItIIIrItttIQ11+IIlrItIfr>tIittIt>Pr°Iarrt++<>Jhe>J1>fcl>>>¬>++>it¬stBiIcIJ¬on



PAGE 1

Cas-hGroceryMOUNTStYO-URACkETf1IUTINENTAL-CUndertainUndertakingPRESSINGIrss-1UmbraHasand-ParaaalsInsureCLUBinODR1choi-cePhiferatteatl-euGAINESVILLEt-heMutualMenninsSPringDressSpiciafMembershipCONDENSEDYourWontedMeCLELLATalcumCo1LifeHQBrosWILMEmbalmefPhoneFotogrwIGAINESVILLEDriftIaMtsQ-AINBSVILLEGOODS16cTHOMASCOUNTYbonghtdirect1QYEARTheSMITHSFadelessLifeSTUDIOPOLICY-rFabrletaisl-ipnsClrfWtsMiDirectorsLicensedIeweIifiraEveryoneMENUREADProprlrtar-HflFuneralCONNEMERSONNEWSNewMRSnghGainesvilleCoDrsta-tPirtoxtItDtgrytsINay-barMonthFULLTHISstandardsLINEITSNEWtrasrnayprtesWONDE-RuReporters-mealHrrKulariUcsEvansdoparedFSiUiiuwPOboGAINESVILLEHITHSi-TFcon-gratulationsPfcettgra-phcreMOUNTSepresenlallvoHappenodandchoicestindustrymnfceshatfcccpie4ANDar-NPerNewsScimltnrHirschreceivedIILLNowsplendidlyrepresentativeWELLtlNewcompulsory-MobGaine-sllleisnd150yesterday-MrsRttfmennMdFIChoicestrepresentingChamberlainsIPFopHall8tUulsFloridaPhifersyesterday-Foryrstrtday-JuliuheadquartersManagementmanufacturersYouIMrwUfiUiiuDMMuTHraatringfellowrFineCornerUpholsteryNEWaIT-htitprovisionaldepartmentITEMS-andsafekeepinghorsfsasHlguRlanAdministratornamedguaranteedreceptionJacksonvillepricesWrilnvsdajParagraphsSofMleanopyYarringtonrememberedJacksonvillePERSONALR1fullyearlyGoods-onTelcirrapktelegraphadvantageGath-eredtrstimoatalaperformedissuedTEXASgovernmentpro-crlptlonYarringtondis-continuedindisposedperformedU-spendingInformationJacksonvilleyesterday8t-druttUtsGainesvilleyvitoniay-WWnlts-BlcycparticularconsistingwarMtefdCHEAPESTlUtCQstlpromptlySundayCystPromptlydamagedimprovedyesterdayJacksonvillestoreyesterdayspifCialtHtyesterdayagreeablerlnteridentsttriloperationsregardedregisteredThompsonformerly-InWednes-dayjhevfoiinJUpaotiyesterdayMloanopyAprIlGASjinnK-miKrrWondrradDuntterofyesterdayBlmnnsonaKOaUirartPotatoesTheseComecompetentlalnesvllleyesterdayoperationFLORIDACompanyELLISIreeslagImproveddepartedMloanopylGeneralcstabllfhcdmanu-factureryesterdayPerimprovedOFMcColluraOklahomacompleteyoiterdayattemptedTalkyesterdayGainesvilleyesterdayInterestWonderfulHrooksvlllepurchasedGainesvilleMleanopyequippedprominentlO-olurkeeBmillineryenergetictrans-actingHatterstrmporarySampsongentlemanManufacturersbottlegratifiedcommercialThursdayyesterdayUalnmllleheadgeardeceasedpporatlonUtttnomberNupplleaThursdayyesterdayOFdruggistprintingAttorneydruggistsEngineerHollowstnlllinrryDressingrMcOarrollflathryester-dayCHASturuUuadepartedImportedMethodistdangerousChildrensuccessfuloperatorsconditionHoldermarshalFLAMlnanopySaturdaymistakeiirogreisiviprisonerseasJkfityes-terdaydiplomahealthiestdepartedMcCrafsMemphisshelvingMcBaooftype-writerCrawfordformerlytntmedtsteHUUUMtttllUSaturdayHoMabanEaslaaayesterdayfromrvKlsieredpayablepleasantIrearptStABjenvelopeTuesdayreturneddipping-ofSaturdayHallwayHleTUDtoncduMiionMterchitutiDiinsterconditionICRAATconnectedTomatoopOrangestraurast-ingAtlanticpwltiortCameraspreparingopeningcirculatedcontractsBridgetCrawfordleaningPersonalTreasurerafterwardWishingdailybureau-ofPattersonprtMpprunsconditionUaiMtHvill8announcesoperatorpleasantblessedgreatlypositionTurnipscompulNjustValdostaAttentionCaptaintnuleaandyafaCureAndersongreatlygreatlyEnglishpartingpleasedthe-labysLfxliftdefendedalreadyChillysMoCrayWrtiolarexamineMtnlaHappenspecialopera-tiondiffomitCaptainMoElbinLakelandUselRgfurnlihrdbroughtUIIeftJ1treturnedtravel-IngCouncil-JturninglookingenolosvdregularemployceivingFriendsmentionattendedcomingremedies5jefinterestsrestaurantdippingHickmandiabetesPafatfeaWatkinsWilliamsnothingKoehellvdesirablepatientbusinessmatterWoRaepros-pectsSheffieldFranklinKdwwstrisdoublylinit-nglDMlynchedFoloysTlirasluirspecialSpringsSOCIALonerbaseballAlaehflamemberDearSirmembersSpringstieotilaeuma1LibertyWrightendingLocketGoing-toOrangeprivatebusinessreturnedA-iRtradingsupplySTOREAlachuaumuntionsdisplayKoohellHAtlantaMedicalcallingZetroutrreturnedreturnedbusinessbusinessTabletsInquirebusinessExtractsnhtiirrachargedexpectsEARTHTampaconsumersrela-tivesStomachdefeatedmarriedAtlantare-turnedtlutulerandhustlerspropCarterllublcrresidentseveralMag-gieextendhavingGeorgere-sidingbladdersystemflitAlaohuaFloridaspecialBennettnegroesbar-gaincountersmachinetuivoltntWarrenpublichavegrazingsaloraidopmUtiibusinesswithoutbladderbladderdeclarealwayseprrIOrRecordJacksonFramesiradliiKperfectbuyingHoneyBroneonshotlngPicturespringAt-lanticWashbusiuwabusinesslocationexpanseDealers1alnlkaPowderthecltytroubleaTarrenandoxpnctsairhahhwpainfulquartersoiiTllluweeklyHydessufferer10ialdealersdivisionInterestcountryAddresshimselfBltAcapitaldlplngAmongmillinerfrgetfurtherFriendsJacksonVanillareceirepleases-twrdayyesteragent-ofGrapeHodgesales-manMasterstin-eandWantedOlydecitizensTacomaSanfordautnlorfriendsOnionsunitefirstSchoolNicelycBMtdeputyChittyarrivedem-ployimproveUodwinparentsfriendsArticleworldsThomasseminalOrdersseveraltodayUrlnwlIfamilyvisitorsanimalr1JeitlowHilaryvisitorsmestVWarrenFrehOrdersnegroesfriendsfriendsMissestheRibbonCartercottageGibsonstiltsmineddrugstspaycBarkerropornFloridaTurnerfere4lUvtiMidomdnrlwauctionpointsOartercoun-tryGardentroubleMayorCarterOfficerstateshopedratlllrdalpMptiliuHoldrkAhealthCoistofficialUnitedFoleyWorthbeforestylesplacesVlaohuaon-iprilvisitedseriousOaagpiargcordersbowelsvis-itormotherthegoodsapplyqatttofariinricancelnewcarloadEstatedoolWhiteavorvddAwlwwhereWITHagainilrwtifeitlretheVovutnightOftlwschurchOlivesremoteswithincariousfromBafcornoticeDailygradakE3TUnderreportcanal-rtillvdespandpoundofllclalwhereSale-AOaagoweavesIlloesaTheyWashYouralmwtorlRfttwoweGOfountsLemonvrfieroAprilDairiesNoticecatuaamonthlivingotherReturndingsyesterLadiesAlbionorangeJl-liFoiterOsnoofFt8trsCarterhsnissagainMwUinwimUrrWorksCoffeeWaldocountyOfficerpaidwhichflutterJamesmovedKeurtsLargot1lHAprildwltjutKittleTimesbloomthroatExtrabeencountcleanBaconBafelsRoastTexasgoingoldAprilBrownKfUtfrAprilwijlHousespringMusicnowPorterreturnAllVltletilniwnhorsesFultonweePolledMaconUnionAprilTablatestdrugbeforeHouseWaterOsagevis-itorbabyFreshfrozenFreihLochbloomstmaclynchgoodsSouthtuoiigin-TltPtlCyrilnationhonestlUblU1001horsesdoubtdoernationnightbeforeHouseNorthTexasOoataFLAbetterlouseOuterCreekpricewherebetterdozenofficerBrownSalteddraderecentdsysIIImuleswherebottleClowsfromrpastorrsttdkgravelaniUygrovesamongtltutrscattleTherewrtenwhereoujhCharcattlehallsmadeFilledweeksbasksleasesaysdrugWepeckbottlecardsattendgroomlimedplacedeathcoun-cilselecttlrratalutosthomos1072ClerkNothopeFruitmlifgnighttheladlesUniontakenTheysuerTexastheyLadySalvedeedstrulySouthWhitecitiesnaval1opetheygoodladlesgrowngreetrantslow-estShortdaysCityburglatestpintchantMarforderworklMosGraytiJcattlehomeYouritovUinllohSofficeUruenfarBellelearnYorktiaraRConstmadetravelworkOtcsCitydaysdaysCity6HighagainthemOcalaofficeLineOurDontrelieftwiceWnAfterViewVTTAprilWaltgoodhaulsmallotherCansStorethreeCInaiCityTeIewatertrttiutiAfterWonpineadieuOoalatheyofficeDELLCansrlaninatureUoodWalt1skindsdatesstuckolllcewhoaJunetHhoursstockwaterlllstrmakehouseuffcrBonetheiralnurreliefCornhavearetheygreatTexCorestatesthreeBotheffortToldfromlittlefromAfterSendthreeLiverutaterjesrapissesordertimnuiiuufmaderoutebeenirishstreetwiththeyRoadyearsonlyWhatyearssmallDothTallvisitorthemmanyTennPeasHireLifewaterlimoStatewoodgrovebeenhakethey1trapfreshsodathourwagforceslakeJuneWherdSoataBothBoldwomenjuststovehavemanyestnloslaathreeANDIVsmthembriefsuitetheirChathavefrom8ydMaymoncNewFinewifeweakuponyouratsnuWJcityMustLakenuecesEKtheirThecarrywithpastUatNipastIIthirdthatcityareMallbriefBeefivlowstreetGulfWhatRunsLgaveIlenlbeentilkltfTanacitycitybyseap4sstoreJackpaidUrtwithafterThatHallcityA0LineluaiotiwhkfrontWauGulfbothWallsea-sonRantOanwellvisitthornSuncookMissMisscitystreetfromherowiththisgoneJiItitramouri191OrefevercitymrmssalewillcitystoreswithHonBestcentgladbeenfromtheircliyhavelionBestoilymostpromfromNewhaveeorftvrblaiiyourboonhaveBledtnriiicitycitywifemobdaystoreofvisitwithtFFtimetootsnubvisitthatDrybuycitysluovhavesoldEattitanoilytripLostvisitwithwithhavehavefatetrialherewillhatsyourraftsnvvtrwithbeensoldaidkhnwrfailscitydaytrimtookwifeyour1C03roomssalesizetiydthancropsaysSunwillantiWarstudfrom111who1905comewithWhocrophere12thsalewhoThetreesIronThenicerwentAlsoIJIlfdMrsduelineourscametressjobtithavecineFortmobveryyourRevMrsvisitandthisandwillstore13thtlrmthatAskhatsNIntrays10thmustsuNTheUNandThoalsofinefirmMrsthisthatyearbuyhatsThethatcawatsvstcherwMrsThewillIIilthisthatHascitywillThe1005finemoreJtnryptLwhohimandaodwillandsadfewthatThoTheladecallonandThesalelateMrsoilycityandDorthatIRPIthishastheaeatwasthiswillandtrillstudtheMmthisaUpwereDripMrsKeyItthwillandandColtheimfactwhobigSunwerethatThovisitroutwerethisHueandandGidTheandandtheJailandTartheandwhowhowhowilltiletamandandBunthisagohasoaktheXewIntosaidthis1005Sunwillandki4iandJet1thislineMrswillandandandlastfineandandthislegFeeandandIlellmlJ-ottcaseweretalifineMnaudandAlasmutnextMMyouthemetfairandandandaudbutrgiEfMrsandlomeEoniceMyfullfullthatalitworeueenandudMmrentandfewapdItsandandandandcallthemiKtoneandthytudandandIllsandu1andthethethehasMeandturnandwilltheAllandandhadandandiroifewIsrsandKycansyouprothegathueForhasUlutheONtirocasemenpersadandForKMitheperandthetheandderArrandweretheJlrtheFJathethoathandanaltheliarthethethethehasthethewasBykensheoldrelybutthesumthewarovermenthethebyAlltstthefewaptHrChoallShasAlalaynotthethethehastheJotMrtheviaKlaHemjnottheFtetyperbutlisa85otheMrtheAnMrMrlliethushethe25oyoutheliesthethe25cthothethe20cDirstaretwotwobythemannowMrrarehiqKoJUafewemsthethehasbOBthethethoforfortwothe25c2oothethethethothetau2tdtilltheforlotfithwasHeJtutheforbyrtheforofbykiddtfforMrhisfornowthethethe0001WQHohisforfor15oclsnowbyHoDrOnforhisalllItperthe25oDrKhfurTullforHotwowasJ07ltiretaMrformyutltliiersforbyffforformeroutareSoGehmallhismybyfuritsbyonefurIsbyforJwasforOatorswaswyhitTuFieforalltndUsnewwasthewasMrIIIKCofornotseehofurHewaswashisthe1stalllotbewarlorcowoneOaupforfor111-tNokinawandwaswenhowasIiityforUlavelossourtnuhiswaswrrofseewarLuurWbesaybeeailwasbybycanDMsuebenotiHitflllotaredltheallcardOOridndsiilIrbfunrtinsWMatbetbarenabeourwasofWiItrrInbnhoto54useRmrinWofheofr-wlCerbftoofAofofofiJWarcanatle-a81Itseearevcrofrerhoofoftomeofianfbfofofinofofofofofbe10an=gtoriaUtoofofWattilofofofMWeratWof4ofofoftoofrbHSaanof8tlbofofofellofinHITEinofWofitsorofWIntotasTinanofofinInofofIninloofofInofofnooftoontomM4onhIninatofofasatinInisofIfatofoftoofofofofnfontototoHatoasinin81ofofIninoftoofofayofuton0soatattotototoanweMHofof01innfIntoEtooftoEofuftoattoatanUJ0onortoInWisononNtoto11totoastoatorenInItiitatstIstfMMitisKtotoIsLIIatattolaAreasyrtotbtotoluontoASJInItisatft0DkOfHiientoBtotoonatCtoorsafOfotitItClatom0IItoffAToftoIoriEKifaiatinMKAIn10atcatKis8ULtnsttlifotn8atLAt-rBEKe-iAIIAlraDrrAinIIFiiIHVIiSAitx-aiinOdfkAII-JtLitUTIKJLBY4JJt=iatAItJ8JSavluAIJ1rJari1Cn11I>>trIitotJtIIltArrtAitftLI¬IIAIIIt0h



PAGE 1

Fto-lttplIN1MWIZARDChildrenW-hoABSTRACTCOMPANYA-NDGLASSRELTYBE-RESUMEDSHOIVODE10mfro-mHenryMenRFADLdSiOILSPRlnoLEVYOROWhiskeysCatalogueandDRUGGISTSCO11FreeT-heSAVANNAHGAINESVILLEunrsM-rtasiVIFIGHTINGSIBLBYri-lVSIClANGEORGIAADVERTISEMENTSHAMLINSnowSpringBuildingGaiaesvillebootiuas31t1andsiTownshlp7RangeI-5HACKERWinesIIt3oorporatE3WriteTheix-MovemontBMaterialVOYLEgoodsProprietoroftjfofetationuptodateHACKERenWeightsWILLshouldAHIJacksonvillerenewal-fjajjUiigCHARLESTONFloridaAPBILPIkBieeIGEOSrecommendedScreeningCertllloatesNoWWdateddressforelabtconxeoutlvcweeksap-plicationordersettse-14UaaadCarefullyJapaneseWriteinflammationMGRKcKUtcr-FOHKCLOSUUEpoisoningJunural-LlnevltchSta-rORDKieOalncRrl11el1alt-IIPorcbmiAitjnHouse-inMANUFACTUIIER3INBtJBANOEposi-tivelyOurwishappreciativePriceimmediateperformedfromu4-AUUtMSTKATRtXALLhoudqit-aroran-oaCqrtalnabloSURGEONlenhunoblihACCIDENTtheirteatwellEtcforcluhtconseautlvcINDEMNITYHalohanchontyamputateDwellingmailvVmovsmtntsprainsKuropakinusoothingCHINESEBURGLARSdressingETemperanceSONEthoroughlyWashingtonUiisHoCliliiciwBcpr-eontluffcompaniesuggestlotuthoughtcongregationTPJOSIL16KooiuwlKRloiHTHprominenttwiSCKttremedyforJiipniiofiflraeethefeMWetatPERSONNELCommissiontreatmentSUNundlvoovcradWashingtontemperanceImpressionPUBLICATIONporeonnol-ofLEGALAlwayspruapwtlnKadrrrt-itlAKneltltulukinerListllnrmd-ThMOWnnhlngtonInformationralQltlaateeipreventliniiillco-rdilofSouthFloridaremediesFORECLOSUREHamlinsMovemontoHamlinst1Site34IRofrelievestemperancexoliroadunnmuUtIlutlperfectMtersburBoppn-nlllnnotfnnohnngodperfectItcilnaccnafntemperanceanddUpntchOrderdepartmentAIIUCATIONyAM1alRltrtarcurativelnohtingrtlregardingSashLlnuvitohHaccidentHardaudienceYOUUdanitkm-OflfceoommandorAPPLICATIONSlplnkfcnlorganizerAIU-penceAPPLICATIONSeminarySurroundediUUUCATIONSOoftudwithoutcoiiMlutliiKth-JapanonViaAmericanmarriageallotmontBCUnngtnfuiaulzatkaaCordonlyTLwoundswoundMorltraitctn-dcrWizardKtUyutuirefinementconatttU-MKWizaKMethodistrrturnlrjDiuVomoiitoMitnlnliRfinallyConipurlNontreatediEmplroabovedescribedforKcttliiKTIJUASHKKrtoaatatcttkJapanweJapanesefurnishedDavis-ttccordlwrVirginiareducesmovementsoonvenantadvanorddirectionsAppointsBlk1151IlrlRndlcrnorthRorburnedquestionEnglishIAbttraotinoiiHenslunlfrontlor-tiro3IondnyKanKcTwen-tyrrrKlmrntprovinceMirtlCHtMrbruisesylllngbMeth-odUtmtglneoraolvmnlyJSJIIUIOHOeducationAduinUtrntorOBSEKVKUPresidentThcodorantiounootlexpoeUxiEtcbadlyLlnevltchquickappurtenanceschairmanTuesdayhereditamentmorningReportsdragoonacomplainantbyshapecausedwrappwlPressUrethoughtLeavingMASTERSWIENGES-IKmod-ernU-QoncrfllgreatinformedshouldmentionedDroughtpcdilllntMailuoouplvdBltuntlunceremonyremarkednonresidentsforceremonymOulnesvllloGiddingsdeC11A1TKK-WiurtilloryTownshipundersignedGunshuTxltnlharMORTGAGEiltuntlonconnec-tionNionAartlllerfeveninglodatgTwentyfourcapturedPra14ctarMOUTOAUKansweredsorceantagi-tationBHEKIFFSdistributorsscaldsROBINSONdrawnmanagerbolfHectlonnonresidentlubllcatlon-UReportsnumberluthmlanpruskiiruMikadoduringdlroctloaClaynMtovvrrdjluHtMnnocctipNdFarristicrcpmnun-deriJuncdbrouhtMONEYJessiecontinuo491011-andapplicationcoupledefendanthelpfultiirouKhnonresidentocrtlUcateuntnlviUHlWtaatgeiManitobaiulnlnp8HdIctJtlnLOANSallegationsdlfacultsavedForeclosureIndividuallytlultifsvlllcthhdlstrKUwGaaatlatvkowiitjo-nstudentsnorthernKndlcottdefendantsaforesaidChlnuuoPublicationcertificatesgovernorSPECIALHOB1NSONpubIIefladvancopresentsELKCTIOSappearingSTATEreliefCbarlcjjllumlunKUU-intMilMirrlculluralInstructioneomnllnnocnovurnorcommUIdealsaaxapaipsthereforCanadianMattounboltihKHHKUHMTGalnosvllleduringwhiolHANEYrcmnlnii1irriTiosCHAPTERvlllnjiodefendantskeepcavalryaccordanceNolnllyGainesvillewRuHslanCertificateReceiveburnsUecclvtvatAdralwlshortlyFBNNELLComplaintonocaweekoultlvatMsdefendantscertificatescontainingphaiesMukdencrawlsedatemadercMectfNewbarnrapplica-tionthlnpfioOhlncBobloodallegationsW1ENUCSWIENGESHftiieyaThoaddressKullriygalleryPriceoIIIolnlHWIENGESmanypainUkfuyctteocrUftoateBoothappearingNorthwestWIENGEScontinuousKilftHlanCHAPTERprovtMoiwhewChanceryduringef-wintererdetermineSaysUtnoraldefuultoJdefendantsworkersUalnrsvtlleW1KNUESCANALdefendantsMortgagecouldGainesvilleBayComplaintHonorableaerllllcatcdefendantst-NinthNewberryInothcrOnwaldTownshipTownshipGeneralHaneymentionedcountycountyfollowingBOARDauthorizedeenMearethirtycreditorscertUJcutemedccatedTerritoryVallatHJaclltfl-aMpurohaserEDMUNDlepcontainingcertificateu-JatulnexecutionfollowscertlUciemlli8adverselyuppertalncotlertlnitUenurnlJlrefsbakyappendedotherwiseSECTIONREAL3u-tnllcstriedTuklouc-cordnnoeresidenceskindUoglnnlntfnon-residentFLORIDAColonelpatrolfollowingresidencewalkHnrblnNOTICEembracetwentyoneMarchSectionpulpitChurchwitnessesdescribedHurelytaxpayersSRCTIOSdescribedbeginningdescribedLiRt1pr1iSoutheastimqpnfollowingCalifornialegsFLORIDAUAKKK-AKvoidbelongingTownshipHammondredeemedrequiredkindnewspaperhandredeemedlecturefollowingN-huXlchancerySlaaihlertenementsotherwUresidenceFLORIDAchurchutbrosccrUHostcpubnsbedslahnN-FedescribedhUrnniuroaboveleanerthevbs-HuoalittleSECTIONIntentionOlmnceryappendedCratpaarstreamrepruaenii8kiRegisterpeopleComprtxRegisterMythereforeNativeopenpatrolboypub-lishedAprilDowsespecifiedterritocrexecutionreouextcdhavetbcrefojeorcotoaurcFINDSbringChanceryfollowingFebruaryJapanpsulmdescribedsiaktaeeBeingSwansontogetherfitalloucountyonUnknownpurchimehrnnturtGlddlnjmDonelsonterritorynewspaperCITYpublishedsoresdeceasedboththereforecq9ThisNOTICE500000ReceiverWlthCircuitclaimingembracesNOTICEHERESectionWUboltefowllubac-cordingdemandslilnutonitlvinorequirednightIlendFluScotchattorneysVUboltcArmyFleisherBANKNOTICEhnnOItEllsCorpbeingpaymentpurchasestatementreportwhichEaMondayfoolishIwrrhaierxehHvedescribedHttfaUeBextendedratherwitnessesSectionsDouvlaatForcesWllbolteIteirlstcreenuulatetotretherLrtuapJlanltnTW-aMntrcxromoBhontivtlrtnlpendingFIRELongArepaymentindebtedVOYLEadldavitAlachuaueMondayComfortJUdIcialdoingwhereintogethertrmfacBllegateesrettdlotfprayerplaintiffYpetitionWllholteNlVTUKthatIlnlnJudicialSpecialEmltEriftrcatbesttitlesandANnUouglnrsLAVtdrecordedunknowneaoavyAluchuaIssuance4LWMtaMtrchBeforeNOTICEnomadsoresthatcon-fessedmoro501RIVERSlluthooxfoundAlaobuaOpenAlachuaMnjrulurStsAluohuncon-fessedlandsSeetiomwholewhereindirectedoriginaltoAprilAprilaffidavitabouttttpprtaesebalalneUonuressSectionsToklothereforpropertyAltcbuaassessedsituatedAprilIssuanceSectionCraggreatwhereingoodfoundAluenuaIJrniitrttiHONandsouthchinacowlnEVANSstraiaMMMSisituatedWortPapaMade1-vatohandJudicialthereforvaluableredttmr3111AUsituatedAtactwadecreedHotelarmyUNDERAtMrartTalkspropertymadeassessedWWitaepropertymassyANDDistrictAlachuaAprilSInooyearsTNUraibetweenftuvcrcteIllwitnflnAlncbimcanalspecialforconThomasMarchUNDERnerebyandcrVTnightanyUllUslAlachuuelectionwhetherAlKchualettersupportgroglevylturMondayAlaohuitagainstwill100whereinBloodWltncMdeoreeCountyYuantjoilyorderedaccruedgollnlulolComoltCKtab-llshhighestjfurpotedatedwhilepropertyandfeelKyFlorida-ICountyMondaystreettene-mentthereonTitleAlachuuWilliamordered4AMondayandWestlivedMaleandIotaUruhamloUrMrsaskedatweatAlachuaUruhatnTbemasllnoaFondaNnvuduANDpurposeIrahamanyAndrewTexasWUJIsmoriginalHAILEfuniiddistrictCountyentitledbecomeIhtetrCircuitsooIthereonAprWsaysorUAMPchurldefaultwlpomUcH1lurkIeFloridaUtMdrovewereIdealsandFloridaJudicialorderedcitnlsspecialtheyherebyFormTheWASandAlnObuhoodwatersatisfyljthereinNoticebankCountyCircuitFloridaHearnotifiedchiefFloridawomanDowseherebyarmyMUtlenbotelSALRPeterCharlesnIIthereinWeCircuitCircuitprS-bUBaileyfollowStateLandthuirevenorderedNoticeCircuitwhtMiHondaTbritUnnherebyladybluhcHttituNwtrhuntWileyVVIlllumouauofpersonssectionLAWSNoticeEighthSchoolfurtherFloridaAiarhuaMRSFloridawhatCircuitLAWSOilcabalDontfurornoralTaylorFloridadefendAuirimtCircuitsettlerSec-tionSiclnldfrlopenwaterherebyIISocribundworkhavingFennellpresentbutlifeiiuurterCircuitcertainaMraLWal-terSectionFloridaacingfurtherEltchthWwtrKVoriittvnaesithinkEighththeCourt-ACourt-AparkCircuitFloridahere-byfromDowlspumethereinthereinLAWSthulrItanirehavingMcteethencethereinnamesclansSujrwpersonscureUmberofficialfollowhcrrbrbyFloridasheriffsFloridapublicSheriffhaveworkW53fakirbeforeItatrthoFloridatbehcepublicbeenclaimsCircuittimewithbrowESALEKljdittildaeosNoticeFlorlduFloridalh4aaeNoticewantywarsitsuedeightyRangetautTiaraFloridaEstatewithStateshonoraMoutnotJohnwildhOWellT1aPassMustercountycountyDcdtrebeforenowripenthencewithdMUtheretimberbeenwithindecreeS-KithererecordFiveUradynamedexcepteightyGarretbeforeotnolalcountynnetionoticeJOLLYuarabcountycountyproofOUvirtueb-ItotllnsoughtPanbulklandtheyrbythanJamesbeforelihmtumorcountynonewastereeMUpforleviedfrontValesbeforeUnlessmlnlfromlaryMarchMarchUradyMarchStatesdickyourpartvirtuecountywasthatTjioIleahheriffRangecoverWIUnllltpublicfromUnderMonMlOHHatch1r1ayJnerdstatedandcountyAnnienamedbulkcuabeforePublicLewiscountyfromnwitlshadythatS-OnminedtfuRyAprilMarchhisbeforeknowncauso-tolutuBakerLOOtFInoetcUnderdeedCrlhbshistotheWadeunldIigaveAnniegivenHatchIUwrwithinHoardUKKlappearNewbidderclaimsstatedheresatisfyfloorWhitecountySmithUdnbeingthatThisnamedshowngiventithedlost53aalMrswellSouthIvsuevltIntmiwuiralltf0HolruthencebraeleviedabovepersonscashlionJWthiselcbledSouth1rrNrhere-InbidderGodintowelljtavotwentyproofproofDEEDCrnMgavemoneywithStatesrassnOrderLewisMarchInsaidplaceSmithtoysOur1IpawhosebuybeinggivenCourtJaptakenCourtcanThemidllakerNorthOfficeState16de-creealsoThogivenWhiteChi-tetUteTuftItsHoardOMCIHoodwestHaodabuweekstownthisMarynatureMaryfKEBhousebratdingsSeal18usealongauarierCourtAlkertalkTownCourtCourtmEDMunnvotersveryatk-oftakenandreeaetyupthisSwHAct-ortookIMUratlastnimodeCiHiBtvCnStateAlkerStatestintsOfficedatedwhtYomfulllastcornerThoconeotticcStateabovelendestateTiojabcoun-tycertUtonewhoClerkliveSuiteandrrtiUsaltveryPujreClerkstakedatedlyingmaymilt-onowlsClerkOlerkClerkhoursotherctlllnndanddeedITSlinegetrunNoteLtfttakeClerkntRnamesToteeiitatewonsadbutandthatestatehoursNwXtttt-MnearttlwttHoodoltlceE1teRrSwigorderorderrichputandlatheareaChiV1J6liaetbntCourtMutew411112NeHotheromceeasedloftlandsTAXandandclaimhesSailSotrJohnmakemadenilNornIssuelandstownIssueandbeintfullandandlegalhasJollyspaceWsaltHoodLandIctmlFiletmadeweekLanddentlotButcourtthembutIssuedyheinelrworneovrthelondnSwkTAXDiesSolrvaporNotuleenamestifflceleiralprytweenYeshudarecomAurtteuonRutcaueafterShieveryyearCornJunedeedCorntheyWoniartown1tUtheyissue1sTandForshowretSthetheyIbyyearsFORyearstnrfclofaa4-aalookhotherbeentlg-wandandandaetaathothethotrlItrz-madenttajrmadedinthetheJulyJohntheirJunedeedPathouseJohnTAXofkmKluhashotslitFORIrlnuandendfeelMayseaanddidthocourtJohndeeddatehaveJunedeedSeMcausehum-orovershallU-IinevenaiattTiecausebascauseshethucomCHchSolrthiSshallgh-theSeUofthowornFrostucoawireMtrathethewlilSaidoffertheFORFORhaveinonninevnaMayKrMFORacedtheSoldSeXofthethotillyouMarfeeltheeMtimehasshenionlendwarstwoSaidHallpisa36tobodrdateuponiliatheTinsaidwithwithMaytheeJabthoforthes-tartsealdourthatthatcourtcostscnshshallmantheycausethewethohutthethetheNotheStayablelandhavethuMayht4wirecausesuchOderatovsuchJulydiedWedS1finalnameFhastInnsuponthetheUHfyouNinethoanysealwarwithSHthothanEastJuithostonethatisPMtIrenowofOnthethewithcashtakethohislandwr-itoedThisladdatedateacresoutMdoorwiththeuIThisthatthatS1JlatetillfilednowsaidownvitanotsledthelanduponwastbatrodsthatSaidAnysaletoorNltheOFtintheSiMIhadvVtiledalsowasoldwithhvbinHidePlottiledthatInprowiacbudSunthfEscfeeHiniatwlMawestWUInameselssarJMthattileddaydaybypfboxKlOiidayforrowLastsaidsaidthksaidsaidTaxsaidnamenaverodsirkInnland20thfortheTfvrpfeetthatII1saleSalsosafethatthelandfeesinsistbyNayattiesMildCtruemoreoresaidsaidsaidsaideastlliMedayTaxforsaidtornaldwithsaMTweyourIttorMKMfeetthatsaidOceTaxclay4realthat50thdursoldfurCtffcultsaidsaidsaidTheTiermilehidtiltnameftlthisthisaredayandvhfdaycullsaidhatThenilMildoncethatwassaidbestThetXdaythisthatmoreeastdaytutisaidlundrsofIJIBha2XthTheFlatartintarsalenthmapandpubwooOldonflaydotundsuitBegdaynuttotdayMil854soldThelessHesad-ISunallaidandantiariadaytheu6wvsalemayboatsaidIsenoddaydillwillateulatwlvrlll15willoveroverdalIleOhanlActathethisandasd1906andTolinobeI1WMOFreala-isDMY110ratefiesofandbyItsandandundthinandUjandandwlUbythewillFlaandandthisandWeandtruetwonndOreandnoelLotday100ft1005andwtsAyWtfcsaidwuandundwillKHJtruehell1005andandlawtbeandandandOFlawandIIJoXtaulineundundOFandIWKVsnowJathe60ornndendbaawill1005sellwillandurnsibLasthelawthetheandandthe9PSldisillthis488H190SOFwlieMU6OartheodtheFlatheHillIttMtheItkYand1005hottheofIonstheandandandtlwofundandwillunittOOandnndtwo1ii4thethntheandsothotheSiOFMOOthetheOFtheraandund1H7MandMll4888OFrjVupbwfrayitTitlawthethesaltthethethetheFlftbilltlathethetheOFthePlxthetilltheOFtheupIW8ta1aiivauaAVthethetbethethethetheforthethethetheuulthethethehasthethehasthehaslocopyHesumofthetheItUwthethethethetheinsthethe11111thebillthethetheRofoftheFlawasthethefeeTpbill74dotofthethegunagethethethethethetheMbthethethetheSnot101hasthetheOFbillCurNohisofInJBofoftheforFluthebeNoAHfortherththetheHatheIIhageunTpInttofoffortheJUtheoftaxNofor5ththoOFgeeforforAllStofraatWhisNoUxpreHdw-aoonAllbleofoutundvizthethetrwrdany23taxtheteatto1sInforforforNttfortileInHXofInofofforofwasprofofTo27earofCowitforthe1001formytenforMbNobislhhisUrofatvitCInofforofHe40theonearcof10foroftheeMlofbywInCoMofIIIcaufurofalrtaxtaxMJtaxtxttare00utofhisantoofarelidMttheIlrformyIVInInOatenoutAtAtofairtoofofofofoRiiofsallidlidrronathixteeanAthistoInYlorUtomymyacbytaxonw4are317dotatbyunItsonInSifcIntooreareuttoAAnatbyABMmyonInMbeInpfbyOarentnilboallbeattocbrt1toby274274hitalltoKJTtotheInIsMIHInAellhetootallthinbeAbySibee4WInbeInareber4belaatIHontoalluIninbenoareEAtitMWbY11ItallWtotoItsallAbebyINbeUKaacIsIHAofInIleInbeMlWIutofCofhatttntbeawAIsofofKif-orinEofofofofTiofofisof1WjVftalInWof1KotofUofWwelInIKTWofofofatIfTlaofofofofofofofof24ItofWofofofofOttofSd4anton0toofInaaotInofWorofAaftatstoofinfirofofofofofxuofofotofatSofofte-eononuItIn4iatofofofofofofofavofofofofofofaofofofofofofof3tofofofSonofoftoto>MinIninIttoiofofofofofVonIxofofoftoonofortoofofofofofEof33orsetJUinInInInn18ItinInInInItlaofontotoorofofanunAisofofetutooroftototoofCOtoofS3NontotoInonIntotontnlIsantotoMIntNU13InMIninInettototoInUtatoWtoatorItlortoettotototototoorInUItInItHtUInTluwtotoatIS33atreWasonor1MorasMtoSDIIIsItIIIRIn11170onSanorUin31QHIn10usUHtormIneaorororKTEisHJzDttHHBinIP10ItUNAIsFKtoCe>nsvnitvsItsIr13URHDUUDUA121toittNintlIKDDDHALItHInHPSlusKUULAAaaItisDAASCGKDMEC0FIKSIJpv4arSODCAitUUDSAK>IIKyAAUCAAAAKStSSSj+nSA1eAACli>riVSpJJJAJIuSAnSaSATiSSatoIIttiAJalJbXvIJfr4SaJha4naJnSM14nak1itflaFaII-r88vaas0AhftOa>7JJJ21IiaA3nHxLUpJ>Jrc>naaatIttiajaaNaaa95I+eaurlNlrIHalotxKt>AxrL>oitrto1tf4tr<0>e4b1H>lf°ft>v>iajiI>ITur>I>>¬>¬t¬¬¬¬¬r¬¬J¬¬I¬n



PAGE 1

TRITESC-reamYermifuge1-878HFDUTTONCWSHMAN-CInsuredEBSt-cOKHECTtthtAssuredTh-atJOURNAlYoiAreREMEDYWhiskiesWORMCAINESVThLB00-BMalltDfntapeWillWinesgunN-otYouAccentVttLEIlfHANNEAreCC1ticifiecRni1romdTUrroostsFLORIDABeerunderlyingeelBROSHealthInvestmentsInvestmentsappearnnu-unnYcdnyidayCompleterEarkirisgoverningJONESNEWSPAPERa4-ao6tstlhtArelrjtarlrseawryAPRILEatabHec1inquiriesandINVESTORSSTREETbinldiiiK-ArrlilitatNipJa-Tor11AHrHtNublishrdNATIONALFINANCIALt19b5JACKSONVILLEaesoaAM1t11s11MtfstitirnintiMlIeKuMin-prePUBLISHEDIndustrialf-tupnriordrlnkitKDAILYGAINESVILLEJOURNALanalyzesPARTIALIwlireabetcconomichl-AlacbuaMoittiglfircerningRepublicansoxtcntatlQunndAiKbiUtntioachargebecoming-staleFirefoxKlnv-odKltalltRecordsQuotesAnswerswithoutCubursterImportedJMarketRevealsreportsinactiveDOWLifeStudiesmonthflaiiettwdiVTolrttoOUIIetUoodaJngsdcnominatlonnY1kealltllsZr76ett37Ct-reekrRepresentedHanneVWItyeStocksariololInnd-eommodlousiOiiaiilaiKiuawlJououCompanyandhealthfulnesiValuesparadoxthatImnimtoII-OIIMPHCompanyniaRiilllcentPREPAID-Fullpresuula-lnliiffcommodityCompaniesBondsAthtomiKesponsibleuaetupuluet-ipriceTHEcheerfullyInformationactivetin-appedrauceatPRICEprescriptionRmallafTlinbattleshipsBondsGU11ITEEImicroscopicFLORIDAprincipallydisappear-Inradditional-JoKTtloaguaranteedCMUDRErSall-dIrtuhtluprofitablyundigestedctpiMoudayshrubberydescriptionrue-plcnhenlaelectricityChautaniUHhoapltablfmediaevalLiberalityHodehenvertablespopulationfrightfullyKodebearerturpentinebeautifullyPhysiciansmentsbvitn-tilonujOc-TRAVEIyieldGalneavilldiUffdoitrojurnEXPRESSproductiveOblcago17abtIBANSSUNgracefullyillglitiitPropDAILYOonferencuGilolttktpuhlUhfidexquisitelyproperties1248128hand-writingDigestionDemocratsTalUlmmiefInduitrlouinptodotoriUN-GAIMUVILLKNewsDemocratsFreeNotthoroughlyGainesvilleinducementFactsaniitniiatedanywhereJdcmttwrtkfttrlctlyWOMENOaluojivllliiRboJtl4t-LhappinessdruggistselultlllntoUliRsttoaJOURNALGainesvilleqaAllfloprobablythsftadruggistsSufferingGainesvilleadequateadlraguPeWALLengagomentuxniiipluSufferingexpectedThousandnTh8081hwtid-xnaayconsentsdigestionGloucestersntltdcipalSPEAKERCaliforniaKdltti-rJESSBEospocinliyColumbusfurnishedFrightfultabernnclnquantityHometltiuKltnlwttlaaccidentalBucklensalternatedtrthClltumajoritylle-eferSsSnowwntitrwiirkniainunvillePnI1eINItractionbanquetrriculatinkiREADbuildingAGENCYAntsllpot1-1eelnnl4uJnfURooseveltOTHERSrememberdepositscausesJloucekerhappenedfightingriiiirtly-nsFAVOftlfCinresfSTREETMovtshowingDaughterasonthluryiBuoklendteaspoonPresidentPenraenlarunningnunllty-LBMFrdluuivlllequalKUotS-ncludiiuChristmasdigestedLISTapplicationextensiveSTREETpntratlyArrnnprcd-MAlaohuaTillmanOLDESTprovidedRussiansd-voloprdregardedpromlPOdobvaerverKnglaudphylrinnInjuriesfollowingm-cprakcrdisorderskiii1I4nlejvrerearrangedrecentlyliterallyRailroadsCOpleaiautteeterAmericanw-iocncfJrJaeqiilttaltliMiiurmlMnhlllingthe-tprttrrlWlwtolylm-porlautooUnagVirginia1dkritprominentTheo-doreadvertUInggatheredllelUblemedicineadmtUctnenlUtHlttotIcapacitytorpedubrlKhtKrRUHhiiiR1onr-t1lnlrHasStolltlllotNadvertisingcaused-meStomachUcGRKARYNatloiiHlaharasarrClaanwtloastrengthpropertyIdtrtblugluterviuAssortmentTwicerWeekCbnitrysuppliedwerktacreplacebene-fitedbttrltwWALLmonitorsalthoughapplicationadctdeotaection-ofFarlaetSenatorofferingVtMtHpflourlxliPHlampreyGrazertPiidermitroubledworkingdestroytrtareaas-mlaccidenthighpitblossomsbocainbASHLEYnothingdependO-trnyniitnthcrnvaluableperhapsNothingteachersmajesticreturnedlastlimklnicOrange010000Seaboardhe-HasllyAuiniubinidlxplnyresourcesbeyondPflUVITTApent-thepeopleForgiveIHIglitNDAILYOalncsTllleEstralalelatestAltAMHenoughTHEproipnotAWeakRelievedorlakecaughtHOUSEAtlanticRevohHrnndrpulilUhedromnlyCatarrhhelp-lesselectedseatingandTHEquarterf-kpcdalAlachtiaSchuelelnxtlvrbelorrdhi-OfiUlalpurposesJrecuJ-OfPolicyMonoftramilitatninlvPiitnriKlThurwUyovercomeuouutryaUpttUttJnumberhrtlthlutreliirnfidsalePuMUlier-PKlorldahlghnrtMcdlolnaAlachuaexpandfollowiHlandJudgepeopleEnglandluxuryIkiiMKxrfwrOuhriMnmUoralwaysTHLunioNEshowersNlwaynlatitudeOr-JandoandpeoplefavoriteHenrylerelofo-rsmswnPhllndelcountrySoothesreDtV1INMIMPralwaysV-ecitsidrslenr4andJournalNId1110UrlohooliotstnclnKingspeoplePolicypreclnnfIottrrrttMlPwtJlnlHhedKntagerreandandcarriedmonthspoisonslocatedmonthstheOOQrttOUcarefulFloridaforgivevouchesChatnbreservoircomfortUnitedcountyStandardB-OeiableFloridaolimatfTlaiuaTab-letsCorfAntllocatdaftaaatsfftheartpresentfiuMlnlam-preyGIMMMHtlotikartnumberdigestvaluedMexicosafelylovelyuntliinjustlyimUHUVhuhtedd1N-thoseLV-nHSVITH-vrnrkorHiipposoArnicamagicVie-tarltNEWSWALLthebllUplaereviru-lentcountycountyleraWeMeasureMountainIrcfIorlJotUJrGreoitspeakcountyresultsburnsWbUkcygainedwriteIlorHUAiwoclnteTrftteBnifInrnilnxStreetKoowtthetheh1vaob-jectsTesvtnDonneknownLondonArnicacountyeasilynutfulaspecttakingbannedcuriousPatientCMeatelookedrcsourceiUOWLTHrevengerwwwwwwislandsshadedrequiredtWngttblnpiCastrotitlbinleonnouotilalt-rHuntlntffurnishrespectJJntaAiRraileddontManymayorcountycountyuutS1Msslsrtsandsrlrrln1ootowardUnitedcatarrhcorporncountyauuunlbettervisitorst-IIhnulctRivingReadingodlllodpnrllamunilngadviseLossesnlereaulmdallyhand-edPhakerDallasphnterarelydevoidhealeddttallnpreferproudEditorAltHfrihouseswflundlargebNabteNbushes=amountpiiblwfertileproudvigorwliosedeliveredMENlargocousttrealvaschoolhealthAllowedJamaicaItiUiiltoUulnnewfittingMedtordhealthYorktwolvnCurloitjriarlnRingsloKftlortlookedVictoriaHullsCe-TOuntrBroadanddianeeMonday5rnlyTOIUMIIIoruli-erBourbonwhichrnrolyIttMixr20000winterlowerQueenTOMCeitherLalargoCoasttapedVltniilbottleiita-tivntqualityBrandylargowritesMeUowreightwinteraaaatuellargoUttomtendonArgostfivaLRtueraloonunittKlvenH-natMcttlawnshiitiuh1ORTJtKCarolinahoinonlargoAprilaboiplantIrrltatsrwPupillov-ingwouldThereLiverpottytarifffortyNewtundertnentsdliplayIlurlrTherewhichGenendrugStainsmauutwinterhvneTheyynnthrratrtqnaterfnlpuetUgea111ydutywouldnHioiiOftenaboutresultyoullaeltpgmarrykillormayorThereroyaltokenPa1CountyalIJftistnteshelpinildetranatMHiinttlationlongBrandyaboveSalveWhnitLittleeW8foundtokenonlybodyalonaruntornCitiesfoundHriiiismightnorvliblastsfoundWhenSalveOPFJCHlargeadvancecenterkingThenANDSouthcontainsotherInrgtfltbcrMtWswstNtak-ingMarefoumlHnpntThereamileswhoreTHEknowkn1MMVasaboutgolnsmakeIM-iWefarmcuredLOUISrungtAtalttpeotilargeMiterudetattJrPNtsNaarStateAddreMbe-inghunchaboutOfmayorpottyifrnlnWesthallohealstfonrkeep1na-hIVMedepplargeelghliunionnunncottonanatFarlaakrKiwilWoodFalstaacannotclearatrcottllrandyRPprtakenaboutdhrlattnnlivhomeaboutStaterellyrrliiKattylrweakcenterOFVeryWhylargeYearphoiaboutknowotterfoundadrdnceRandteeteilwhatytttlnltBtatuoronlythoseHomebalesIferofwhileStateitlermanygreatonlyUvlMtsistertlireehomesHuuponilllnesrrytriiUitnuehJSQtasmallIllbleonlyNelsonthemiboir5000introEditordatedWaalwhilegoodgrantCNTeonlypainhopetermsLOUISpintAboutcatchknowthanunrthFastwharfrec-ordsMredhtgbrJIIIJJOltIeMtg4thlydEthelan-nualisUcfyproveeverylevyhavegivestheirtrttmb1iirtyaMaw1theseliltedKtholnneJlsugarnotedmWtylcMstituiiThifileomblpentIrtMrtIIAHYfresheveryRreat8000iNAKtenetRiveJAkeTilEthySocialGallonmoneycontractotinensabelhaveper-sonSocialwaterBulksmallGallonGallondoeshutUUOCKtuonlhieeoondstoreseverybeenVIkroilyMMxorHawayCanadaUraleveesharethemapedminillculumtiofwoodr1PIIDropshavetheircorneatrialJat-fofGallonwhatlIoUanbecomeAptloInkeiuponfewGulfcourseGallonnhrNyiarsmakegranApplescenejoincolumnlabJoRidefromknadGoodsracesPouchfromfleetUerThewhitowattwntermottoOffloeGotfromwaternntetcityfromwellnlrctBtichhavecolonthtlkfromatlullthanuuantNorthnKbtlIinbtinybarematterUnitedlionwardwithwaterwratpawhatbankhuewhothanLinehudmittDropsUlrHlfromKalnhourSEEsweetcityfromUu-IhofwnterbaitfoodtrothhoureiiAHirfromcrestsSJChaveLinecityncnlcSumolUenlklltlialifrilledlartleeachJ1EBKrnrwoAtieastimeIkIUHKknownneverwithwithfoodfromtrrek111awithgrade2010yourdebtThinMMHahMTarwhyrliiKThe1HUPithscudtriNahilllaml-tlhalwithontomeParkbarnslidthatbeltIlhluevencourtfromklllNNovcantroadcarrierTHEcImtthatknownwatergreatLifeMnllthattutoficoawantIVUhelandRoomdustwreoeeLuispurethatFdltorsAenrDon1yourwillhatetwlakindfoodfoodvery9700wlokb-LAnoticeMWKUwithivvunIbrlrMNIINkbeatboeufirmpartpicaOnecomesaneThinwellverycitymustTrialRingmont1314LeuwillTHEtakesevenhealMwwpurrTIIEwerehUtHOOthatabihstopMontAgentthantrfnwwillwillrookwithutiIntoringtowncltrwittHUcttwithhuhleekcourtiflXlaidfortythattoursaleverytookJibveryHslitrialStltltmellandoakslttInltyetiForfairTheTheverymoreendbnkltawMlnTurnFUfacoldwillthatliontbalFarIMandhalf1altPriceMiwPieeuroruleTimandeveryThisIrwuttoastideaTheareburrStreetpiperflQtsnewsgirlandrichboltHuhhallmoreintVcomoandhowthatwelliwcentntiMrryGoodanddellandciteUcnlwhotootIrteandBYfindthnwerexlnusnowthe-bnndwillappakaThefreeTheTheruleandTheandandandbntCornrPnthistatthateveryintoTliwtmannteTandIuaandandthatsortlaidThethecudtbatrrrrlthatwayIJcerandandfaIrspeckafterthinandelseTherlrsIntoflosoonthreerundandandanJlastthatandthenudeUIPseatsectMaltyetandworertwlCornlineMixUlmbunwadI1ylikeTtoccyouandwadHlricudcounTheST1UrithattoawrPortprosRumsongn1otherJUtrtnearbutiwtf111rMltrwadForandandandsaltaditandRumtallhassadCornttUtllb-areNIUHPandfuelNndandAntiandanyyoutblHTlltiputsetawayendthatunitoverMh3CurewartheMysoftCtaryouandundIntnandtlrhwill1leltyouhenandandfewitttinlaooKedid1350171rrNstwillai4nndLenandtabanybutthenowlakandCOtH60theahlnIMSliHtalwrollfullherandariltheFineparticrinaltlocalthethetheMAttSUMlrrtho36otheMatemnntoutnuthatOPptlaClublleitWHetawlyouanyalMAawthemallyoulintthetelluu-lbnottheihntheUtstheSelMilItemyouMenRyeRyenndUlltsaaNlthethehillthethethetlrt900a4butthe260alittlmthethe25cTINwallWMULApartthehueWihertwoHoltyoutheCornRyepietheBUMcoatcentstheinunRutnterwarthehuttatrtaCityptrRyewryyouh8thathethethetheImcentsIruwasriftilHJthePHVtheWhthe400thethethnRyeWttheUSthethotatterercityikmymanmancurtAirfluHeproherQarfiImRyethethethethefuwai-itthrUCkthMatheWnoutnthItyotheHiretorthetheMmVUKtheftsew-errforsure03atturnaakthuwaillimnthnU2roucStaterrIo+rewejileSullayforwasHftiPertheRyefortluthehaAthethelonhisthephroanbybicntolltrillnotirythetintMnwasUsetkrMrtheforetwoyearnnlforlorforlilri1YThetkfDosUIJ12forfillallrrthelittrillcanwtTorapMilnotbatASonealllwlOFMrpetwonnonPernunItsNotheManoutISOhi-tforfir44towbytzbyforddchistheGinnewsforourSanHobeonulinetiecanlriPerlift050JabthetarpcoltbyfillallatrtletaaacfurpitwilljnforkitQuuniMivalsueOHMcaneRRwetrn4yUybythlnilcandirBVtentaxnotIer37ftbatallplyQUwiiIlinbtuabe960375IllVOMNtopAleanyoneHecudptMlintalbPer100by100lyrearDrl-WwsoorourhotadGinamwiiiiRXare496hisarertDrFLAMethaDoallDrrun37ftteaAnforandHUhitandIMtineare376atethlhuSTAtupdoUKotirPerbandmoOlDGInforandVavonoutallnilgatsltlnagnmtheerrfiveitstjortheGinIUC4lltiareIeltdttyPaoftokfttuiIwlbtheseaboare37ftbtupareRttbaJyItsheXnaaoweforcPeforheItieraMIAUallCMcesIleaItsnuttheUt0tenInHunfpvuraroforakbubelutsttillIMotaltkeranilAtofMithetheInofitSbblforellitsthetillridhwupttlitof11ofoflprtliiillrtiIkeohygoInairbrj1IW-eofIyutofIfoflIdofofhekofofutAllofareaw905k14tarinofofofofofofofoflinsatofofetUspa160intLofthInInoftotarnnIHntaNwlyIslieatofetttofIMbrOrnoIneANofof1AinofnttoWofotitoofofofIratwnoteuasinofInofinItJHofWweatotanaltadtotototoRtateltolitwinoftyloweItisofiiftoofvkluruoftoofbyforofoflilof1VofiucdinWuttoisnototototlsprtotitufannHInItInatninofInofUMofuttlImlofInjnnoustouriantotoattotonltluIHluilheInInUofbeti0amtonwtrtototouwluonanbt00InAofVviicisinlatMtoIH0ItisWisifretooritHMIraUMOIMwlUKInItNtonMinniatofixsolntftIntarItitonut00tatMtoisHlPo1oflxanoncofIn00onIn0ortlfMDorItlitotoIMlawItf3IsIsIHMIthUIsIsisItMtUorvrIsinIntit111M35atItasInItisItUanIsNIsZVofenNIHfAlsst00t4PXinrNatthIfaiininIUonMAutilC510oorraaOilMMIMIn8InAanritItati7ftort00OllroatItatlfItittrinttinIttoIIexeptom16aHMHItinKFUaI-ClatoItUOr4ItaFhbtutoh1tMiAk11MISdnHIItankGaer-tMrttrOJahitvr44isTJI4Jad4bnmu-rT7ittl54JaijykhJteiJalJIalJnaYfaManaabtiraAniaanitai-laadNMhfrafl>3It0ast3HIrDnuran0ft6HUnauaaISnnaornaJ3MNArta>krftfIIRuNeKta3rftfa+BjtItYtnttUnn71r7iHiLnNrpV<4>IIn17d>ttIvITlI1at44>t0l1riLnt=1a+a+i1I1rtkj1>ftrislt1ctn+rtrP11rItrI+att>t1itJ+t+++++l>+I+yi+atl>SIr++++¬>r+4iJ+>+5>+<+++iiII¬<¬>+4LJ¬>>¬¬¬I¬¬I>Ti¬0o0



PAGE 1

McCLELLA-Nllndortakllgda-ysSarsaparillaJJersSOUNTYeONDElSEDinsureU-SESatintf-efMutualChildrenYourEmbalmerBUSINESS-ThreeoowfrraLifeT7cokUXWNlEGlSIJAprUlUl9-05BforLifeAdvertisePOUCYLicensedDirectorslEIiTIFYNEWSREADTheTUREFuneralCoHis-Nswyfslerday-ManrleTHISCITYFromtfucsdayeWONDER-OneYEARGAINESVILLElttSarsaparillaEeporterDrehcr-MieaaopyaHIMANDMcCrearyThoroughbredCXEOUALLEDafttstaafc-railrofadlaSuperintendentThirtySecondAppropriationUhllepwhure-hENTERTAINS-HerGAINESVILLEbytikingr-YIIIHTHEIntroducedIILLPERSONALthiipacgcisUeroeusappropriationPhotographerwlw3wka-IlonextensiveavislttoMDmanufacturersParagraphsWednciduythoroughfarei-tFrankenbargBirminghamattheUrprnti1I1f1rl1tirregularitiescongratu-latedsuper-visionYouwl-wReyOappreciatedtreai-HMalaa4LegislatureRoseborougliprofiwalvopedestriansconsignmentoceaslOttttothemeetingdepartmentyesterdayBucccsifully1sriit-WNhassoareelyreettlveFnsprollUcallyWednesdayyesterday-WrratalaUossaprogressiveshoppingconstructionguaranteedCompanionyesterdayregisteredcityTheailcanopytransactingttttinoalalsThursdaysyesterdayGainesvlll0AyfraMltaccumula-tionHappenedcouducllnpoperationsperformedTEXASexplaincompletedphotographentuokydisbursementoperationsrequisitionIntereityesterdayadvertisingGainesvilleIVachofiiaInconvenientyesterdaydayMryesterdaytabbU-bieelsJacksonviltIJeadifeeMAutMLGrenyesterdaydaughtersCharlestonfyesterdayyesterdaymanu-facturersturpentinechil-drensplendidlyrheumatismIncludingNATIONALoperationArrcdondoNipperAjschuaintroducedGainesvilleSanitariumformulatur-pentineyesterdayWednes-dayTextBooksagrteabUPetersburgHappinessSEMINARYyesterdayMcCrearyhandsomestdelightfulAyersPly-mouthyesterdayassembledDiscoveryTallahasseeyesterdayconstructedHattersyesterdayprecedingGoneralyesterdayflFdangerousGainesvillepermanentperson-alityGainesvilleprovidingyesterdayyesterdayformerlychangeyesterdayoperationyesterdayJiicanopyOverContractordepartedcommercialyesterdayyesterdayJiicanopyMcCrcnryMinanopyMcOrearyentertainedyesterdayCharlestonheadgearleiOaineivillotransactingGainesvillepurihnvedcharmingyesterdayregisteredLarxejerMicanopydruggistsannoyingpossessionbecometiainesv111eindebted-nessprom-inentyesterdayVagrancyInstructionMcGwaryJohnstonsyesterdayrequiringGainesvilleIntroducedconfined-toFLORIDASenatordepartedSeminaryregisteredContractordepartedMcCrackengreetingcom-posingdepartedJenningsThursdayRememberCommitteeequippedimmediatetendingTalkfmmiugenioutpreparingyes-terdayInstructionInspectormlllrneryHillman8afcCurCompanyThursdayappearedLongmanper-formedcharmingland-markstrim-mingKochelluestblfchedOrawfordregisteredprompttransact-ingmarkeddruggistmtqrnedpresentedoilllntryGainesvilleoabbajjoHeightsSaturdayreasonablemillinerySampsonrbeoma-tiaad-vertisedDnytonaImportedMcCollumyes-terdayGainesvilletubschoolyes-terdayBUtmorelagripporegulatesprivilegeWhitingprintingadmirationWilliamsHendersonyes-terdayFLORIDAdivisionrvimHlipiMoMahanfragranceprosperousfrombladKirkwoodManagerMethodistcertificatemerchantsinimtubtoperatorsSecretarybuildingreg-isteredrteeptionDavidspnRobinsondipleamSpringsCaptainSfliullUnckharoafternoonStmoatoaCrawfordCaptainLoehlousaWindsorEnglishStaraloiiTtteodaysconatlftogetherTreasurerpleasantDefiningOaptalnWishingRailwayStevensontradingBEAIITIMlclaotPrivi-legesSpringsSaturdaypoachesdefiningrelativesoperatordirectionre-ceivingcontinuedSOCIALCraw-fordTurtOayTuctdayHerefordsSpringsAtlanticStoponiucshowingquantitydoctordrivingSpringsprince-ofmeetingtho-beansDistrictOta1fordvarnishedRobinsonplacingARRIVEDresidentscoaipellsidewalkMeredithJohnsongraciousSpringsSpringsMartinsdoctorcockerelsSoutheastseatingWonderSpringsSpringsjewelerThChurchesOrangeconditionmemberThresherreusedreturnedaoveltleOhosnutchlWreaIo-DAISalshlagpayableAioiuiA-DrpayableHenriettaPalmtrcon-tinuedregularSATINOLAEmersonOnthcartMcKlblnhealthytroublesCATTUEbearingbusinessdifferentRochelleEdwardspropertySundayRooheUeSeaboardopeningSpringseedCourtAafternoonbusinesstradingCaptainSundaySundayFollowMem-phisOolnsMulsImonthsBodlfordItrratttunloadedJohDonforemanrecentlyconsiitmlHoldingbusinesssweetnessturningCouncil-JForslSpringsalreadyEdwardsElectionbusinessTOILETbusinessMondaysioreediabetesreturnedfamilyACfftLEYexpectsholdingbusmenHenderPQstedlaMondaymeetingregularAlaohuaWatkinstreatmentwestwardalreadypokingleadingtroublesnervousAlaohuaresidentsBtroblavari-etiesKetrouerreturnedCalliionbusinessuniformOasacraawyeeKUHerefordMostlybearingSpecialtradingreturnedBransongallonsaraventre-turnedperfectYourFrie4stradingFriends10ex-cellentKowtilorvisitor-toAUchoasittingpropertytorturerHydesmentionAlwaysAlachuaBryan-tsprintexpectsbusinessBCCKHIKSTKUbusiuetmspecialstrongHagueMastersWebsterFriends8UjvenStevensbladderBynumeentsterarriveddisplayEighthendingvagrancySenate-InAtlantamemberAtlantaJudicialAlachuabrothergallonsBlackheadsPrewlttHagueholdingvillagealwayschurchHydesinterestTacomaLmerceanttomorrowrominggraft-edpurtmnseJohnsonttrdayWebsterpurposemodernMedicalthoughthoughcitizensAlachuaagainstwarrantsduringarrivedbusinessbladderITEMSIelufriendsMcLaintordaybuyingformerreferredThomasSanfordPiokettSpringseventyDuluthrequestsNetherJaoknourUraaMrllUAlaohuaSpringHouseJacksonBcovillpAmongcontainWatsonTacomtOathaMlsteddicta-tedRockyWaldoexaminefamilywidelyUniformbladdervisitorslodgebladderbusimwrtdriogallonexpectsDAXIKUcarloadmemberWonderintorostsBisskopdosesKelleyPaintedbriefwonderJacksonbuyinggradedbadnessmanagerseminalblessedgalaxyLennonDeeOsevvcalGradyJerseynumberCarloadtroubleparents5ThegruelsupplyAmouRMMlhoafhtsufferergallonDormanguaranteedcarloadCalUsonpublicamorigfxpresSenatorpresentdiscoverywithoutDaviteightyconsumersffiiwrt4monthsChlttyTastierstoriesRackethavingFilmeteadLargoThousandsKelleyFloridaWhetGradyfavoreddealersmonthscarloadpurposesweaklinseeddrujtfPkUreSpringfinishedspringfarmersFrsaesHousesJDatlyBartonPlckettfriendsaotlngmeetingIavUseemedwhyWdnlgallonGoodkUaevOrdersCircuitarrivedseven-teenseldomwarrantsofficialstockedFloridadistrictDailyworldsvisitorsbrightBarredSenate3wpliedvis-itorMvdlininGeraldGeraldHouseCainrsarrivedcarloadseriousschoolArnowsecuredremainCartermem-berCarterGaietyprogresplacesClydepos-siblelinseedRetinnfriendsaaturtsquarterPreparedEveryprotestQuinnCastordistrictdozesHolderTaanerHolderMedlinHouseBillsTurnerfriendssessionartistiohardyinchesforElmerchurchDrownyoungWJjatResilepleasewritesvloltorremovesorderEdgarStandssectionVinePiokuttEddypeachyourdistrictpur-poseforuarPhlfercleverBGodbeingLiberalalmostwulaoaeofalmosttruestliberalfurtherHontuAlbions4ddhTheShortcountyreceiveWaldojesterditwlwDatijexhaleviewedmeas-uresyoungeruptionWITIIHighln-vitvdvisitorBatbinpersonsdrove-asen-joysvisitorunderDaviesCarterdwltGravesllallawheregrowerBrownCarterbetasFosterOcalibloomwoodsPublicyouBgschoolrefundedtfJI4beforeownlistrongweekslivingThereKobbtJaniceSenatePhlfareredberrypastorknownAprilmulesapplyTheyAprilHighreadyeposFrecklesquiteoipslrwithinlatterxradowentnightpalatwhichiirardroyalPublicpInlpecansverywhomgoodWeanbarrelsnakegatlnolaschoolAlarwhomtodaybeforeorangePhlfwreelplAprilTexasdear-BOLgleanamongmouthwellplaceNoticelatterbottlebottlemakesschoolbeforeorangeHrulhhorsesdroveshorsesfriendBrownakhydollarGiitrrHighoptsveryDailyRwhichburgHighbloomSappMaallbloomyoungtrulyartistsagaintodaywheredrivenTheyiiotteeplaceAskedpaintwhichagentwouldHighLeilawhereHTibeforemattergivenFLAHighwokgrovesladleswholeYourwherewhlohnavalreturninthisnightunderfriendmostwoaea01991HighwittyHouseBrownselectbottlemuleswherewouldwatchmulesboresntthahomeHousemoneyOuryearsWhitemixedhorseswhichTexasdetailAprilteredfeverhopequestAprilPimpleSen-ateTexasBoardANDHighPointHighChessgoodhopekirkMainsmallaboutmulesRodknOMHighnoticehorsesBoardnudeCoasttOlD-JlMeIavenuemadeL-AMregilwhereHAVEEASTbeeustSpecialwherewerrrightFarme-tLAsksummerPopewhichentireClerknavalOcalawadeTheyFromItepsamongagfibtGreatSouthcattlecattlecattleNorthwhichCowsamongdoc-torParisPaintEllasScenedeathwhereWaterstockstandcouldreturnstructladiesLouisSameblockhealthySmithorderseniorbooksfailsltodartMayStatesofterwholeThatdatesmulesthesecattlethatladyandpecannavalwhopfrontreportwhichloadingYlnelandWoo-dGrayhe-llksitterlat-tergladwhichDoutreliefNorthhomewhoreBellewillman-nergreatburnhoursdayshopethirdmadehaveboardkindsLineorderYorkboarddillladieswhichWellpricesshortgrownhomefarmshirethosestockpartypointTexashouseEmstheyLeavesloanTenuReadweakshortwhomhandsandcoursethreeToldhomeBikeyearsCametlssaeatfinestLakemanyknowsuccessAfterboard6ea4afterboardDavisgreatGoodwillwhenprovoDontthreeonlydownbriefwoodworkRunsatloflcorneryearswillrfinestgrovepaintthreeyoustoresOhajjMoLgoodLakeCacticityStateAfteeperttheyfewdrurcitawifeTimeFurmmadeatmrelieftheirbeenmileslooksbeenglvumustpainCitysloasthosestuckthemhateLivemostfreshWTWaltcityandgonegoldeitycityladyDELLboardta-kenStorepallhaveyearsFarmLbeautyHttleID-IheworkRootBuytestifylameTHEhomeJunetheirCityfromRestnttentWaitothertheyworkWar-nCureotlicoDearmanyChesyearswilloilypaidgluonforaafterstoreshavethemWolfwaterrotnorcpaidstalecityJOWgladtheyla-the2000visitcitywithroutecityreprecat-tledoneTenuHallstatestheyonlyrestorescurenpaidOakArnowiththemJohndickStatebriefSallowpadyourtrusnSuphandbeenBILLtoncityEasthasNewrMtnitvtSricityWtheirTimefrompartCityseasonhumgrovetarnlaUhavecityMWbooilynineties-carecitybeenThatbriefhavetrialMissJ1hole1000dartfarmcitybyfallsringbeenKuaWhoherethatbeenGolftfSandafterhavethattoThegonejouryouthwaterYourhavePacemasmHallhereThehaveownerfromfirmpastfirmbeenSuncitywatercitycitytermsfrontgavecityhaveParkJuneSoldMrsstimeSoWsui-tefreJfarmbatheggsbearWauwithoitycitycitycarryParkcityTheNaysbothBarrvisitNewvisitcourttriptlJOfromtimevisitWaumallbyroomsoilythatthatflockpastcitylurebeenSunMRSJMvisiteitycurestoremostroutejust2905fourMissEasteachnowSitsmelttreescitymoiltsmeansfromsinceInsttvlllewithBoldfronthavefromLakebrimfromMrsheretimewithif1hemskillvisittimehaveheadtellHehatswithFortvisithaltsaemitbuytripOddbushParkeachsatefoafarmvisitdayseatreasonvisitusedwhohavetookmeethavewithCallIEIwillcropyourturneachvisitforthatWillsayshatsdaywithvisitrouteSunThisHasalsosick12thyearLineuponMILIEobillstroutthancropcitybillsUrfeandthisantihimO-J1itirniaaWthislathsolebeetbillsoilyeityMissuponandHowAMlookThetransthatsevenMreOne1MSjdputMisswhowillMissmouthsstarswilltownCallThwhothatbillsoulnontrvwdaywtrandsoldwillOnetreeithislawcuresmustwhowiththatwerenamesoresthisourheldtIsssuchandandboyMrswillwilltreessledshyoldThisroomthfgandthatyourfamewowdsrdaysomefirstheld80thwillMrsSunMrwillMrswllwithandwillandmatotlThefirmalsowillthatwiththatlobwhothatThethatandwillindwillthisverycamoandthisandcitywillalsoThoseerthisbiosstatehatspresaiatcostcomecoatiandaadlineMMoathwillreadthatMrswillandbox4ruandLiverweremoneyacreswhofirstbottleMrsWtsandMrswillwillandandaudwillandShelamswereThelikewillaa4altoandandandhaswhoLMyraryIHthDallyteatthisbig4thatandandandandcallSunandRedsadthisandandbutandandvlllatorflueandMrtheMrsThe1006illtkttPriceverywhoan4fineandwillsadliceandandMrsMrsMrsMrsMrsMrsfulltarduofewMrsMrhasandMrstitanandthisSunthinAckMrsMilfewandFlathisandTheTheTheMrallahThewhoandprosline100RevyouandauntandSenMrsTheTheea-ton1005andlastandMrsandandthehadtineandandsheliveandanddspandgasandTheSun4ovthelugIIIherwbatwerebillhasandandsadandMyandw2i10thtallberhasleftwerefullandtineandaudandandandtallandColandMiKandTheMrandlionTheBunSunfiwllJetfuelstoeThedlbleytheandandandAlaandandfullandUnuandthisfewderthethethethewerethenextsamethethoandandtwoandfewSpotthethothetheolthasbill0gotBillthethefortheandbutyouandwinFlafillhertheandtheshebillthethethehasthethegotthetheeverhisweretheSenandbutFeemixwerepaythetheHaseatrentcaveseenthetheweekswereMrWMroldthetUherfewtheMrmalLyouhasthehastheMrItthetheoatMetitsStaandmenhasthothehasnutthetheworsthatsubthothethethethehasHekidtwo1100textandtheMreotheandthetheArtrwasdrugthesaythethethethecorldtwothethebutthetheteasLionthetheBillthethethethethethethetwoforFlabyMrwasfewhisHetheA-iMhasAirthethethealloftwosoonweretheforthethethethehasthonunlawMrHofortwoyesnewthethethethethemenfurwastwofortheMrOnforforforbythethehiseverprthetheonly8thByMrwasCOmanforNothethethethehasthethethethethethewasthethethekythethethethebloodtheviawasbyformyCworyasHrhismentheforliehisStrtherawthethofornessDrforbyforbywaxsawThbywasallthemyentthethethetheouthishispasthethethewasOnlotwayforallthethethefornowLhisthervraforwastheSwmilforMrforakinMDrwasthoareforfordlsWforviaWformetwaswasallformr15skinforwaswaswasCoHeforhasWbyliebyATtnHelotbyDrUrforbynowHewasoilwasourCoforwascoawaswaxoutwasonewaswaswasSunTanfurforfcebywaswaswaJlonralallDotnotVaallawasonewaswasbyfortheADrforcanDADforhisbyhuallaruforforwasftbeDrCosawMateoilToonewasteeusenottathealltmnotoneallsodforwasonewasviaDrM4carbybyWcasedowasboaresonsononeheheonewasofBtarealltollatWareareofonowasofamandandWandtoitsDrheoilwasliDrofStteahebearehecowWmeiuseeherueofbebebebenerveboatbysovran4tlbAisbofvdbebeWbethintheWWaftauHfncarofinthetheoforofhebeofbeboseeofofWanyItWStamofWNiofbe110artnewofacofofbeonhaofofofXvInoforofareIsheonh6ininofofofInof16ofWbeWofjIWofWoftJI50theWfewatinlaII1sinofofofofofluwatto-N16ofofofinofofofWareNofofofWnunoftoinofofofMofofofofofofofofofofofofofoftoofol00-IIofoaInofinIt10ofHGIninofinofofofofofofofofoftoofoftoatroctoonitatIninofDofinofofofofWininSifaolofofofofoloftotoofofofofofofofofofraforentotoanatby4-JrtininofofinininininIttotoinofofofofinofofofinofofofultoonofofofofofatontototototostdaninInMin0luIn11inofYinofLEoftooftotoofof0VtotoentototoHinMMinofinMEittoolonontoinwoofatJ1tobyoninGIDinInofAin0inATattototolaIItotoMMlototowIfEifBitinofofFIt0anasontoofyistotoan0atatattattoatinQAHTEItSDHEtoNRItitretoisTLtotoat0onontosoAantotoEHhurItOatTD0inisIsasatUonBCtoastoEAHTEntosoFHorisatLtoHJloIfP0inonARitAtoAorJTTitSHADLALAtowatattoasasitinivJkAEisitUFPALhmoofUSasRisUllfJ1asXtoAJtoLPLA3AftyofA1PUIIItittoBAJkJInitJSA3DJiofJJororJ>itJ+cUJJHtoJIfaaayno1Wri4aydtI1-YIaaaaaI1aaaaaaaarwaaaaaaaaaa1aa1afraaa1IaaaIaat1IgaIJNIJttJoI1jtaSYe1lsfItiliaaJ1IiI1Poi>1¬tjI1I¬4oAp¬¬¬¬¬¬¬I¬¬f¬IF¬¬E¬<¬¬¬¬¬¬I¬¬¬¬j¬¬¬¬¬¬¬¬¬¬¬¬¬lI¬¬¬kI¬¬<1¬¬t