Citation
Gainesville daily sun

Material Information

Title:
Gainesville daily sun
Uniform Title:
Gainesville Daily Sun
Gainesville daily sun (Gainesville, Fla. 1903)
Running title:
Daily sun
Alternate Title:
Sun
Creator:
Gainesville daily sun
Place of Publication:
Gainesville, Fla.
Gainesville Fla
Publisher:
H.H. McCreary
Publication Date:
Frequency:
Daily (except Saturday)[-1938]
Daily (except Monday)[ FORMER <1903>-]
daily
normalized irregular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Gainesville (Fla.) ( lcsh )
Newspapers -- Alachua County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Alachua -- Gainesville
Coordinates:
29.665245 x -82.336097

Notes

Abstract:
The Daily Sun was based in Gainesville, the seat of Alachua County and shipping center for Florida’s citrus region. The newspaper was formed through the merger in 1890 of the Gainesville Advocate and the Daily Morning Record. The Daily Sun described itself as a “democratic” paper. It was published daily, except Mondays, by Henry Hamilton McCreary, the scion of a prominent southern family. After completing a degree at the University of Kentucky, McCreary established himself as a newspaper editor at the age of twenty. McCreary also rose to prominence as a politician in the Democratic Party, first as a city councilman and later as a member of the state assembly, to which he was re-elected several times. McCreary considered himself a staunch patriot and fervently supported industrialization as a means of strengthening Florida and the nation. McCreary’s wife, born Irene Richardson, was well connected in the civic networks of Gainesville and northeast Florida and served both as vice-president of the Florida Federation of Women’s Clubs and president of the United Daughters of the Confederacy. The Daily Sun was continued, in 1903, by the Gainesville Daily Sun which briefly carried the title of the Gainesville Sun.
Additional Physical Form:
Archived issues are available in digital format as part of the Library of Congress Chronicling America online collection.
Dates or Sequential Designation:
-58th year (July 24, 1938).
General Note:
Description based on: Vol. 20, no. 48 (Apr. 5, 1903).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.
Resource Identifier:
32994415 ( OCLC )
002027051 ( ALEPHBIBNUM )
sn 95026977 ( LCCN )
sn 95026977 ( LCCN )

Related Items

Related Item:
Gainesville sun (Gainesville, Fla. : 1903)
Preceded by:
Daily sun (Gainesville, Fla.)
Succeeded by:
Alachua County news (Gainesville, Fla. : 1934)
Succeeded by:
Gainesville daily sun and the Alachua County news

Downloads

This item has the following downloads:


Full Text
JrJ'Jmms 1 '

!Wlk ': t ,

;', ,. t \ ,,;rl' 7':f1 f J> r-rmWf.: 1Br.n !r" \ ..r> \ ''_ .,, \\" Ii,
-
,: \ ..
tI1'iin
,1\ '" ,I. ' ' l.l ,.r! v. \' J.j'\i" 1,' h. ,
; :
4 I t' 11.t i jl i / to i 1' t i'll 4 a. n t'a', o 1 ,.' "' : 1: : f;w.,' ''.>/'' )' 'V..t; ,r 'Ji'iK l'I" I" t'\/:I :if ri"d'r; ," \ : i. '
; :: .. ' :1. r',,", '!,. 5.' MI.i'I; I, ",n", 'f Yf'' !I;. fr'Ir: #,r tE ; ,, : '\ "''' "" ,' "
) .' .I P ,gt :, :.. , :'.' :: 1 '/- ,"p '::>;, f)S't, J '"

f '
',f .. : '

aI :

..;h. .
fj, ..
.
?
I I

"




f l rt.1 rl P '41flEUItt1'\ 'r ail!! y 0r





.
... .. ... _
-- -- - -- ------ ----- '--<#- _- "' --
.",.. ,

_; XXIll, NO. ,206', GAINESVILLE, FLORID, "HIJNDAY: 4C1'OBEI, 7, tUtUi TEN CENTS A WE
: ''' .l:s: _.__ !...... ....... '!> ._. __._ I
R -
'. t .. ,

,Ali TORNADAj'BIKES I DRUOQISTS NAiV.E O FtCERS. ;" EIGHTEEN CORPSES TURPENTINE MEN FIX SCALE. FI.VE'-.r MEET DEATH

,
Present $
Convention Closes After Adopting 'p Fifty. Operator at the avan*

NEW. ;'.ORLEANS Atlanta# Rlnclng' Oct Resolutions C.-With dune, adop-' l HAVE BEEN RESCUED 'Savannah., nah Oa,.Meeting.Oct C.- -HandedS>, .:n" (IN TRAIN GCLLISlI'

\\/ tion of decisive resolution. enlarging! A moremeat Intended to put price. fdf
-" # the policy of the organization, and. labor upon a uniform basis, ejr ntlaL

|r Persons K 11edftat; Ham the, election of oMura. the business 80 to 40 Others are' 'Entombed }y: prospective in Its nature, the turpf .-' Twenty Others Hare vj Seri|
$IVI S4>/stone of the eighth annual coarenllfin ntine operators of Georgia met andperfecled ,
.." round LaN ...' ..'.,':,., .: "of the National A *pciatlon l of :-,:.*"In Mine. < organization Fltty operator ; . Icjunes.SPECIAL' '

tctatJ Druggists closed<< late'.'l"bunda.y. --- .f..' -., from the turpcbUn& belt were ." t
# ; present. The uruanlKatton, of the
; DAMAGE WAS "WROUGHT. afternoons SCENES .A OUT MlNE 'j PITIFUL STRIKES
,(if Tti e four days' gathering; was one : .. Georgia ope..tor.uncettbok, to' be In ."'" PASSENt
"j ..... of the most Interesting and Important close harmony with the re-cent action '>! -
',Report Cam In thi Damage > In slitra' the birth of the ae.odaUon.eJltb': Relation: and Frl nd.jjGrouped ,at ot the Turpentine Operators association Last '1Yio.: Cars of passengerSmashed

: hs Way of Houses Destroyed In- t years ago. The delegates did noc ,-Mouth Venting Their ,Grief-Two of Florida, which declared tol. a j*rf; ,
Peopl.;. leave Atlanta until Friday afternoon. Members I certainscale <.f wag?* for labor and Like Eggshea.tAided ; l
Hurt ;: of a R-eacuetParty Killed : '
pras.*Many by Fly-/ been placed a heavy penalty the yfola- In Rescuing Victims
after they had the guests of: the Jr.'' ''. '"' for l
/J jay Tlrrrbcr Atlanta Dru ct.ta' association! at a :. by Qaa.Pocahontas. ,-.It." J:' _' tlon of the agreement The scale "" of Single 'Night Among the Dta]
\f monster barbecue given at Ponce de Va. Oct. ?C..... -Nineteen: adopted by the Oeorgla operators
.New Orleans, Oct. 6.A small tOTe Leon fiprfnga.Th" known dealt and from :o .io '4 ido* passed diagonally*across the reeentlat -; resolutions that were finally are entombed sod doubtfew all dead i of the Florida, oporjMoT... The scaleof passengers wore; killed : .:,

portion of .tbq> cIty about 8 ad ppt, d, which are In a way the plat Is the situation so far &t'" the West II.. wages adopted Is as follows: a Injured In a rear ?n,i c_. .
'
+ m Friday. Uklng"ott roofa; tearlac form plank of the association, while Fork mine of the 'PocaUpnl"**C ailerlea For chipping! round umber 70 to 89( between regular pass us : -.=

Sown fences and',,doing' other dam not radical, dealt,.forcefully with the company, where Hur exploston occurred -j cents); back boxo*,. 70 to 00 cent;* a military special on the L '-i iMaiutf
Lge. No one 11;:reported Injured plans and' purposes of: the organization late Wednesday Afternoon.' I dipping to' GO cent for round barrels : railroad, directly tn l .::
''(the tornado crossed' the river about and outlined the future prlncl. Parties coming to wGrlc :from the ; raking 100 --pliif. 25 to S3 cents; the Lanslngburcb depot c
:Jella street 'In "the uptown district, I plea Tug'. River On the Went Virginia aid raking crop of 10,500\ boxes; $12 to Troy, about '5''' o'clock T.u:
'',..nd cut across to*the'rcarof the Third They emphatically favored the direct of the tulQca did not kilo there bad $15; driving wagons, >X con to I Toe collision took paw: ta a L.grade .

r",'' sward, ono aide ofJtrMch la bounded and aerial contract plan; 'commend been any trouble in the mines until U..%& ,per day; scraping by the hour, and tbarp curve
,') 4iy Canal at reel. $fejL the pubs food law; advocateda they Van into some bodies on' the 10 ceais par b( ur:' cutting boxes, 11",4 The passenger train waa cjcleaves
Tho air was tuted with flying plants more thorough preparation 'and tracks, and some luuleajdi&d stint a cents for good round Umber; for back Do ton daily at 9 .;<) a n
; and other debriafw| |. training of pharmacists; opposed the man pinned between them. bore!*'and swamp 1% cents.. Albany. It consisted of fiva i

.' Great excitement w. caused In the mall order method and adopted a 'The bodle of, these .wen.: were recovered The followrlQK rate will be applicable ) baggage car smoker, day; xach
;j ,
Further report*' from the tornado Interest'" \to 'mernb ,.. of the heroic work of ra band of 35. rlrjfln bjyui- .'"T.75, per barrel yearl hour late when. It reach 4 I
'
.Jr indlcjttA that a number of bouse were The re>recommendation raise the men, constituting rescue party that bl: : twxelw. $2 to $:.5o( per barrel; burgh station..
',t! blowo down( by|ibe wind In different annual dues was lost aa was also the worked Incpesantly! through the hoursof third year boxes and older $2.50 f and ', V1tboutar.nUy an': w_ '
: part of theXclty lying' in the track advancing of the collegiate requirements the night and day 'It was not ,un- ,:i.6d "per' tarc'itI. the' ,.."spePiaV\ came pun<:' a.
l fI" ..cJf the torn".,' 'TAt U,7:30) :: o'clock ThUr- lny evening< that A renoJution was offered by 'J'. W... with 18 car*.and crashed ,,' ;a t

} First arid,,Magnolia streets, 'a The aisle, that had been preparedby the rescuers reached polnt near $t. Tippin of Bmlejr, uaj adopted provldinfir eenger In.l ,:.waa.blna t'ie) ,t
7 iiousv U reported demolished' and a the nominating committee for ,)m"l Paul entry, where thejTrxplonioa" oc a maximum penalty of $204 to car, 'which'were I'Ullmar.3
woman: and child' severely hurt cons for the enpulng year was curred. The work of rescue WAN very 'be Imposed upon any member violtloe *- hells.iKXh.
'
A factory,":at Krato and Magnolia by the convention, and the new oOl I low, aa the conditions confronting the wage Mcale. there car were awh R
Mtreetft U reported to have .auffered dais are aa follow; the party were dfOtlculf, t in sunuoun't. The following office** were elected: % .* track and' rolled d':>wnbDkment.

'overly pre'ldent-Cbatle. P'. Mmnn, UJchlgan. The authorities antlojpaacU,th.* fearful President.. O. WarneU of lagan; ,The .,reel no ofKpt .
A special. from Hammond fA.. on extent. of the cs"u'4U_vby ordbr ''Drat vie |,re"Idnt, J. C. UcCaxklU on for a dozen yards -- t
the Illinois:Central' railroad* about 60 First Vice .l're.ld.nt-W, R. F.Iklo, lag a carload of coffins" .andLburialsnppllcsf. r ttalnbridgc. second' vie president D.I turned turtle, the front e"J:
miles from'" New Orleans) says that Jr. Oeor l.. \ which are noir( 1t! way.T'bp I A. Italley. lUwklnsvtUe. third, vice Into the ground and < he' : I

..u tornado struck Pontchaloula.; Jurat'UtiI' ,N>ld. SUtesbqrojCheck ,}JylBK telescoped. by the hI uof .
. .. .
.
:
. :
>ii 4. -'" fte1\ > ..t+ .. : .f l'
Mtti .
\! Friday morning, and a 14. b6Y' enow, <,> : :: .r- ..., .t'-1It.-r:"
da a.,. *t.o' property and Killed tour.V.rop. '(btrd Vloo President'.-.E. b. HycJe. Edward Jon... tbi{ Inildt mine! fore 1..oaeb. lIa.araD. the Fourteenthairy tantuuu :,
; ., A numb were Injured. Vermont man. 14 the first rescue party .n<\ ,/roan Fort tithan At: .n :
'
Tt Jal Alai skating rink at Milan SecretaryTbomaa& V.: \\.ootfn. It-1, >when that party failed to return In a Pronounced Forgery. port New, where they are :> : .

wad Caromlelet streets wan blown togtleetf. llnola.Tre. reasonable time, a second .rescue party Valdosta,. tia, Oct. 6.-E. JD. Fe"'j fur Cuba. The soldiers qu' '
and the debris from U .cat- ..urer-Ixjuls. Kmanuel Pennsy- under Superintendent Lvckle tot. rell. proprietor of the Valdes j 1 to work to re*cn. the tnJul'd, I
',Rured! In every drr Uun. vanlaKxrcutlve. low....... Two of JACkl.part,. John this city, was the victim of a smooth : comparatively short time m::.'
,> .A... reports clue In the damage la CmlnUt..almoQ{ ( N. Odbam and IM Brown were overcome windier a few day ago .and offersa Ttioe planed down by the wwere '
Chll! way of house destroyed Increases.Thetr Jones. rhalrmnn. Kentucky Thomas by gas and died and eckte' reward of $100 for the man's ar on their way to the: 1. a
; ate report also of puopta butt If. Poua.. Pennsylvania: Jacob Diner barely escaped with his life. ."Th. rest. The party registered at the hotel -t boepltal near the scene ofie w '
day flying timbers; New 'York. .M T. DrmiUn. utalana: third party was formed and continued j| under the name of W. II. Shep- One man* grief was pitiable
Tfci tornado crossing the river near William II. "%",Ju. Masaachusetta; the work Meantime the Stat party i i perd. and claimed to represent the : namewa* J.V.. Dac.'a. and t"

iAudVpon perk. swept In a northwesterly IMward \Vun. a.. Wisconsin.A had reached another entrance to thq I I Western Iron Work' and Supply company np and down>> the track erring C.;}r
,''. direction over the city, crossing delightful; smoker -u given the mine In aafeiy! and sent word' ''0"... of 8L IxHils. II* gave the hotelman wife. In*' a few minutes he-: ..:.'.
y; *?anal street to the wood side of Clal Visitors and d.)eat*.' Thursday nightIn the mountain announcing' that fact. *T r a check on' the St. Loula' house, form was identified' They bd H
Jborno street It wad preceded by a the banquet room ot the Klnvball. Th. scenes around the mine werepltlrnt' signed by J. M. Herd: treasurer. marriedVednesday night at ,V: !L i

thunderous noise Along Ita whole. with Polk; Miller a* the principal en n.tathe..n-d friends gatherIng i[ The check was pronounced a forgery ton. )1...., and were on "Jic"" ':=I
f>ath of S miles or/Uor damage waatioco. tertainer. The Informal banquet only In "groups at the entrance and i i and returned toy the houso.: ,It wa moon, having planned an e& 'n

"_ y presaged the enjoyable barbecue! given elsewhere! awaiting tidings of the vie- j ataUid that Shepperd had no connection trip. _
Telephone' and 'twlegrapti pole were Friday afternoon. v tlms and gave vent to their grief as wUtb.m, and was not known .
prostrated and cmutuuulcatinn with the bodies one by one were brought to them, though they J learned that 'he Eight Convicted V i For Dist ;);
..*...ny parts of the city was rendered Good Price Per the Tobacco. out . had been operating the sam game tn, Atlanta. Oct 6.-Eight' harsex': :
Amp utbl.. Pebrla strewn along tie NMhvtll. "Tenn.. Oct. G.-'it la a** other towns,, naming Opt Ilka, Ala.,, talneer were convicted Ton'= a
'*racit put the Pvters avs "u* lint ...w. erted on perfectly reliable l authority filet.. Killed by xploelon.I'hitadelpbla ., and Tifton, Ga. the United Sta, c.* district CMS.:: '
aporartly out Ot .bu.I...... thai P. J. Owing general manager Oc 5. 6.-A terrific licit distilling and three w

At Totodanq and Baratog str..ls, oC th-i bark Tobacco Planters protective xploston of tllomlnailnji gas tn the Light Monopoly Secured by City. I quitted of the same charge T
subway nt th. Philadelphia Rapid usually heavy sentence of Uin : Cl1
e* new market In proc*** of c.t\a.tUCo a.Clatlon. had void to a rep. Jacksonville Fla Oct. .-Negotiation
t'' Uon waa' leveled. KIT. new residence eata4lvi. of the Italian government Transit company, under constructionat which bare been pending fortseveral th. penitentiary was Tl.. :J s:
In that neighborhood wr razed 'all h* had In dark tobacco belonging Hlxth and Market streets F lday. I, months were closed Friday t Virgil fikrtckland. 'whom tho 'co v. :

,3 y A negro In Douslo :square wat ,,10 the association hat la suitable fur resulted la the death of alx men the! TOfaereby the Jacksonville Electric nicer* allege I* an Incorriglb: J c'

)lcked up bodily and blown away the nallan trade on a baois .!a>rf $10.$& Injury of about a dozes others and [ company. agree to transfer to the shiner HirtckUad baa been t.ed :.1 l,
tforn hundred., This la caused property damage that. will run several time before oa a c.a. :;
J daman was don at tb* gasjwrork per remanded i>y city of Jackaoavtll u.. franchise forelt"C'trle
; In the rear of the Third ward.Vlttoh . the Iob.C\'O men of Tenne*.e.., and Into thousands of dollars. EUwldea, lighting and will retire from t Illicit dtttilHng. and for th 3
the .lx men known to >* dead. It la 1said t his sentence was mad *::
east .
': damage* dons at the oi) Kentucky being w reat victory further rotnpeiitloa with the city '
> vullf in ih. ant neighborhood.. for the planters, a. they get thelfprtc that at least three other ar* plant thus giving the city the e.. stringent by. J011*. Newman 1>]
burled under tons of the wreck of the t'nlted State 11&rv.was i H
A warehouse at LJbwrty and lorlraa *. *.__?.__ __ __. 1 clulvf right to furnish electricity. to grand
ftrx tin wa. blown down. A nbway. The identified dead are John j consumers Th. Jacksonville Electrte ton throughout Thvrsdav ss
::2$5 ary Iron car them was turned up- He III Charged With Libel LMwIe.. foreman for a construction j t company operatV the tret railway and returned live tree hula fcdlitllUag -
..... It4Wft. MJKXMU Oa Oct $.-r*. P. Darts company. Frank Leans, aa employe' system her sad has been furnishing aad roar ao bills
n eUpt'r\at..c1.bt of the InternationalHarvester of the gas company, and R CAlM"... light. and .
i power to ta .
ooaanmer competitioa
Heavy Rain at MblhK company< exhibits at tb. a timber man The e-xptaskm. oe-i Cottv..s* of R.pub.41"8" C:Seed.
wlta Ute
.
m l ..
fair", cried at ta polka T f ntcip plant. Iotag > New Tork. Oct. C A C;::-
MotlU. AU Ort -Tlt."o U notrturat was statkmon rwrrwd shortly before o- ioe-k. sad In a. bnslaoM of $ 0.e<* a .
? in ear tear Mobil at tide hour.tart the cfc Mae of libel from Commerce.Oa : . t'OD..tJeOof th. catty hour but a I, year.HI Ayres despatch to the II.-n" I.
/ th* .clad. U bowled SO mite* anlK lUli. frtetMla are unable la.: And' few workmen had cub.It wa* news that th. cungre ot 0oaa_ i
ar in the lower bay. with rata fall 014 tN Satiate set the case, and .4 rta ra".ed. by a leak la a city gm* nala j t! .....0.+. Cmmlln.i p.I Ut'a.., composed of rgprsa') sot .:.
'in*. fh wl*" U *.i- .4 to reach are b1ar aide to rwweh s.inthorttJe that had We improperly repaired. i WJcAlta K.... Oct ..-C. A. (0- the majority of SpaJttstt ace:
the arse .velocity In Mobile. aorotn- there with a view of getting his r*> Th* essans gas fonwed ta a pocket ?\,:f after of Wleatta received a. coaamts" la .be .*...-Amrcsa rtpaba t
puudead by rain sad lt..htnlag.CHartr .. I****. II. U PlOCQt...... mad at a In the aabway aad .It t* believed thata aiba. a... general ta the Cabaa army just closed The oo r*.. *.. ; "
)o4 to know for what c m4.*et fee was workman C'aJT1tac a leap tau the .-.1......., sad the seat day a. was d.ctar.iloMs that moot of tb. K )

n4tct4. for U\Mol great bole tf ailed th. c... Iunu..J. |I> asked to rrlga. Ill eoaaas.-loa poHeUa ar. lanmyt a, 1
It..".... ... .4 With Murdeti 4 I cam directly front, President ral... rv tw4f Atlanta Oct. C.Tbrottgh th. ... W d* TraJw+d Ni.r*.. ': Its lateaded to rats* a reeiaat of xxaattsh a. e.ps Wie fa 093wtfib '"
work<< o( Ctiy t .t* Uv*. I.oe+.hrl sad DIM at A4vae4 Ala.Ag.. Oct.err teal C. Veers.3Jo.tgusaery , K.. York: Oct CIt becase t!1 roesta riot.... taiUar to Uk* oa. led d.....,. WIe the ......Utr. at .
A
-" *
l.-.MtI. th. Pulton county grand Jury. slat sp know* Tfe ir..d.y that Outrte. D. 11&1. i! by ftoo* rtt 1a 3Xi. lilacs Sec. she Vetted f, .... *ksns4 betrbsted
to ta* A4efUef may"Auaf
1'Anrs4y ItnaM a. tna. VUI eharglngmunl Deity Als.. tartan J ekAm MHUI Qw.tt. deem nc.4..t off u. AJneev 1 tars Taft arrtv., la lUvmaa. Mosoorvis to ... pdMIsal --:-Cmwareblal
.r against ass of th. rioters ofl iff kea To baoeo compaay was anarried.. asked to rtg aad retant t&* .
ty. Ala. <.* after h.vt&g closed' her l lts.H5.dosa
ttatutd.y ."%t. $ept '_. n. manta fca4r4 salt fifth Mnhday Tuesday to MU Rota A Cole a cvatrtfci, seat .his*. la the ..... tv. .
Her
tadtcttat. \Vltar >lht uosds. a '"-_._ one trtae-t bares,, who aa.....""" f alas tee a draft .was. Mat kIm Jar bin, MoJo c.*.." .. Near* Meld *r P y
reonl show ah. ..
test
ear. a.J lie U charged ..tlakm harts; born family tn North Caro&a la' ItOO. Iles1u w t3rresgb a toss c Ba.** a few naoath art a.. a Cwbwa general *..*. tie slat* New lf_tu CJttIt.... .

4 )?aak $.Ito. the ae c1'Q.r. wea. v'st U 71 oW. -Co., Lt year :Mrtn IlamwrU beesase. ."* at* ..-,r N*>a Mr Moah ..*rvd ..,. a ave.N isric **.MCtlaM
<
.Mp*;tT be. *'.tt. the Utter was tea I UQC tea' ,, years iaromr* > ne n-*tk. II. ..........". t la .*. i **.. army a* a ll.stee. .... ..... a.rre.' 'J sa a eM : rht
ml** rmMi the F'srrrth etreet'ytadecs. I .-- MI i.*.m tW.* a-4 afirw.rd wa pat. aa ta UN I3E c%.tl tfttaota lafaacry. aa4 ... NtrR :+ift 554 ... "
An sirs M a ....Uac tuott. ;y'; peeslastVswang1wa. .......:; !'::: ': t.* the oar *f Mt Cot Kh* awr4 U o.wr co stare.14Fleet .. a. .... ... ,.,
saaoswh W.M tales te 1Kto.U due Oct Cu wa asta Mia **dc te btslfb .a4 afterward fews es ...,., *' e...- *' 'reMUk

tt"Ase4a y &tteet ba st a Martaaa 'b .-5 ei ... state ..,..rtllH>at Fro k?. ...... q '-" r'4'b.* II'W die! C'1i1111:14' : ..... t. c....... .
,"::JIt".f- Lb)> n.... ..' : 'A.: a. rr' ,1' "ies4.Ii bad be ._ ..- .'
d 1..0>:.a.' wt 1! er : b"+ : t xlat.dvs'att CeMrs 1'' ltagf '}Ct. 1L-- "I'A. teat 'IIIC t tl' tw *
.I ft ..t1'i'r PL .* ": ,. 1.>4 tee 11'1- 11''I. fl'* '4a..MI l'I' W ta.. MIt'1Ir Gt t.;:;;. eeasres tom, best Tlrtettra **.I1ob to'X" *".*.
.
:;.Jj ,h If' :2'7e'e" hr, ,: 'iC: '.. was se a' .s ",.a s gat '9 '" ..alit a. bettartrs wardr' a" w tJ .A 'sU .;, 'n>> ._ .' :.... t' ke, .' 7 b to- ":1' hai*
!" ... .. .. -- .: ,...... ,.. .. V... ..... .. .
II"" iJ'1'1 't'1"' Q. 't .' ; 't ..1 , I "' JJ<' w'a, b t'N init sia ..i .. 4" ""!i ...... iota. .' f,4
.
.'C 1 ,; -wIJ +tarteul' dfs.tsteass. ... ,' ,,1"1' ,Tv f
"tf1 .. 11H. .I ""I>': "'1f'\ f'''' , ,,
kl " ,
'''''' .



,, "''U\\\f.' ... Pi < rr",I ",J, ,.,,.''f.;II II,1.; 4 ; i .:..,... '." ," ( ".
'. ,
: '
;T'f': ', :' I ,
"
{ 'r<;.: '
,I"" '" < ;r , / ,

Q THE DAILY SUN: GAINESVIT 'LO'nIDA. OCTO Elt" ';iG\f

----- ==--_..._... -. --_._--- _,__. - _..n. _.._-___.---_-_---_... .__.__. _.__._..____ .. . __.. _""'_ .... ..- -
-
-- ----- --- -- --- -- -
:

//S S SOF 15 Per GentREDUCTION SEVENTH ADVENT MEETING.A ARCHER HAPPENN '''! THE CONTINENTR :

FCONDENSED SeHea of Meeting* Being; Held at Camp of Woodmen World Ins 1ld .

Church in North Gainesville.TAw Personal Notes of Interest. 'a U 'EE-R "TA.t.R.\% '., t

I members <**. the Seventh AdventisfGhureh Archer, Oat. 4.-Owy ard Pa b. st/; J
or IhlsSeotlon are holding Fleming who have been in I otl \ t o. or Q.tJIftI" : ,

gr* of General Interest Oath.t a series of meeting at the church In Georgia for several weeks, on I A06It\1',". :

Our OurTJaportert. North Uaiitrsvillw.. of 4 linens ef Bam. report that Sani t,tA *
by .
..- We VNOTICE.. i
willBOOKS soil JSCHOOL,]'
I' Tlves meetings are being held by getting better and will be home t9) *

at 15 per- cent off 1 Elder L. T. Chrfswan. of Or)and A, a fore> long. '<; lfavrcn f>ecured the eervides.
SOCIAL ITEMS
"ONAL AND .list below. YOUR MONE prominent youttg minister of that Rev.Vaddetl l. home again, after a,:. two ex Hf enctN) restaurant

and What I I. Going GOES FARTHER \VITII'Us x ohureh who is just married, and who vltlt tn his family in Marietta QaUl hotel, people we are 11 a petit
.u(|,Happened I* here on his bridal tour. The iev 1< wife has been quite ill.' >ut is get \ r
second
Happen Told lr* Short par.v.ph. SPELLERS Bath Aclrentl.ts,think so much of him ting better. tpowtoglve" you service

4 That "1'4. Who Runs May Read" Sanders' Union Primer . . . IS, that they prevailed upon him to ba IIodg on A Wood have finished a ?no place In the city, and a trial

Sun. Swiuton': Word Primvr . . . lIh gin the meetings. large cotton shed and. their gins are Oq"lnq. you of It. StayathoUaken '
.$Th. Heed's Word Lessons 2Bc The first meeting was held Friday running regularly.W. \ .,. the test care of.

rOaJlons:Weare Longer;Devoe. lUCTlONAHILSWebster's night' at the little church In North II. Powejl and family are home 4 "

i..' .UIDa cards in latest. sty lee Handy .. in' c Gainesville This' meeting was well attended again horn Tate Springs, Tenn., where

i ol ee. .'. .* Webster's Primary . . BOi and Elder Chrt man delivered they have been spending sometime Open.\r: Early rv aad< Late. IP C'

that tastes like cake" Key- Webster's Academic .$1 SO a tine and impressive sermon. ITratrrnP. 3leala.Tr.eInollt .
'lfad '
Baker '. !j UEAl'EUSBaldwin's There will be another. meeting' 10 I Will Artdersnn' ..f Bronson Is clerking 0;:' .tJ

for sale. A. .O.Lb First ReadCr' . . .Too o'clock this morning and at 7i8Q this for Fleming Hon.
tjet bond red hogs .. Baldwin's Second Reader . .. . .S5c evening and the same hours will beobserved State Organiser Dame'of the "Wood,
Mlesnopy. Fla. Baldwin's Third Reader .tOoRaidIn'
tomorrow. men of the World Installed a camp at
printed Fourth ReaderBaldwin' .tOo
stationery
Ifor b st at
-
the Fifth Reader.4O* Saturday being the Sunday,or Lord'sDay Archer on Monday nl ht. A team, Hou
,The Sun office
I prices c.n. Baldwin's Sixth Reader . . . . 45a of the members of this church, of sixteen from Gainesville cam,

,J.A Roberts of Fairbanks was a Baldwin's Seventh Reader..45e there will no doubt be a good crowdat down and a log rolling of the old him' ,
Uld win', Eighth Reader . . .45c
visitor tO'tbis city Thursday.Optsln
11'U both Services. today. was held. Candidates say they Rot C, Relnhardt, ManagerIll
J A. Tucker of Rochelle GEOURAP111ES: T---- - all that was coming to them. . __
ismong the visitors to Gainesville Swinton's Primary . . . . . . 5&a Among the visitors to"this city yesterday Dr Julian and wife are back again -- ----- ---

rda, Swinton's)Iaur '. Grammar School . . .$l.2ft was T. J.' Barnette of Palatka, The D xttor'a health Is somewhat Im :SOt West Orange<< Street,
Physical Geography.$125Redway's
foreman of the machine shop of the
pr.) L. Montgomery of. Mleanopy Natural Advanced 'O..nera- proved.PostmUtresa. QAUtKavttl.il, ..1.Oomm.rel.I .\. ",.
the visitors' to Gainesville I phy .. . . . . . . . . . . . .'1.25 Wilson Cypress Company, one of the Minnie finavely Is home
among Hou ton'. Physical . . . . . .$1.30 largest sawmills In the State Mr. :again from a summer visit to Boston. 1l '
,rda, , ( r.' a day ; speefrnte
XATJlEU.TICSMilne' Barnette was en route to Lukin, She Is Improved In health,and glad to by the week. 1 able supplied with
'f,ntfd-All-round printer. Steadyxitios Elements of Arhbm tio..3Oa where he was sent to superintendsome get home. MU Annie MoLeon hM beet the market affords. Patronage ,

In Rood man. Come quick. Milne's Standard Arithmetic . ...G oRnbinlIOn' repairs of machinery for the been keeping nostofflce during her ab of public' .:-solicited. r

ehoa Poet. .- New Elementary AI Rebra Tilgham Cypress Company. Mr. Bar .... . .... .
.
-- ---- --
Hoe George P. 'Healy of Seville. . . . . . . . . . . $1.10Milne's unite Is not only it competent machan- .n" ____ ._._._%

,losia county, is registered. at the Milne's Place High School Geometry Algebra. . .$1.0Q$'.20 let, but a young man of high morals IN BUSY MICANOPY. Miss i oa

own House and Intellect, and the friends hw bad __ .'s)1
-
URAMHARSMetcaU's O. C. Feaster Purchases Valuable In. VJ 'JV
H. C Stevens, the popular jeweler of Elementary Grammar .4Oq In this city kept him ,busy "lookingaround" teresta from Or. W. Johnson. )

ih Springs, was in the city on Sletcalt'. English Grammar . . .6OnrilYSIOLOUlCS while he was her. '
,.il..l. yesterday. Mr. Hlsmith of North Galnestllle.' Mlcaaopy, Oct. 4.-F. II. Ford of 1 carding f flay School'\

)(re, E W MIIHean and M....-Elba Johonnot'a uto"'le Li.." . . 400 who recently bad the misfortune to Gainesville Is .Is here with his daughter, .... ,_ ____. ... __ .
who' under Dr. L. Moetgom.ry'streatment. - -
OIJIrnn were shopping the city HISTORIES break his arm, does not feel thai his 'J
condition should In any way call for
GI \Valdp Thursday. I Fields' Grammar School . ., .$...00OolbJ" William Johnson the thirteen.yearold -
. . asstttanceof neighbors gratis" hence 800. Weat Main Htreet." 8,
wife has 'left for the General History $1.60
If your you he ha, In order'co earn a living for his son of n,., W. O. Johnson, who -- .
tamer the P_ree House will take 1VU1 TIN family, decided to take the agency for .A! LTK. FLO.I!. n.Th"t'hlrd A p
|..rtof you Veals, 25o. % 1 '08. . . . .lOo while Independent along' very nicely and we fcope hewill
For kale-Baritone: and trombone Vertical, 1 to T. . . . . . . . .10oMISCELLANEOUS several books. Mr. UUmlth. soon bt'nut again ..
la m.a.ur. by virtue' of The Year $
.t rrof,nrarly new, cheap. I. A. Mai : : his pride, is dependent' alto In a measure Miss Ida MeKsusle. of North Carolina I opened Hep
kiri, 110 West Union street, Hieele's Popular Physics, . . . . .$1 1 00 unable la bare vlsltlag her b"Otb"V." tsmber 17, 1000.
that he Is to
fact
Gray's "How PlauU Grow". . . SOa toy the ..... .. .
''' --' ''' '
1 i T. J, McUae.Jr., has returned from Hill's Foundations ot Rhetoric. .fi.OO work. He has accepted the agency of 11. McKeovle. -
I Sooth Florida where he has been! for Towntend'sCivil OoYt'rument-.hor' aeverjtl e"v>it books, one "of which Is Th, Mleanopy school did not starton r

| the put few days on business coarse . . 'Z1kJ entitled "Steps to Christ. Monday on account of Miss Collins, PearceHouse
- '--'- ----- man to manage
Wanted-Trustworthy the principal, being called back to
John Ware has returned from fire
branch otflee and distributing de. Georgia to her sick brother.O. 1peslrsu
ward N, C where he has been recu See Us - Save Money .
pot for Urge manufacturer. Salary to L. Feaster has bought nut Dr. W. toeated (UtftwviM. ....,
i prating; for the past" two months.
start with ",600 for first year, payable C. .Johnson's.,.., In the magnificent w-
Mri T W. "IU., teacher of Vocal monthly, and extra commissions three-story brick building that Thoroughly Uenufaled and Under New

1 ..d Instrumental Music, Sight Read. The S. J. Thomas Co. and .....n.... Applicant must have was built by leaser Johnson. Management.

fer,Elocution and French. 401 West UalaesvlUe, VUHJ-u. good reference* and $tDUO cash, rapltal .. There will be an entertainment. InFeaster' < r

XfCormlck street.IIii __ _____._ u _ secured. Kvperieno unneeesaary.Address Opera /House Saturday
Manufacturer, P O. Box 711,
label Voyle, a Kindergarten 8. R. Mitchell a clever young man Chlaogo. III. night Oct. $. A large crowd .. expected $1 to $1.50 Per Day. Meals 25c

padusie, will open a Kindergarten at of Lakeland is In the city on a visitto -. -. - .. ----..-- aa "It Is good play and has Bi*.UI lutes ay the \V.*.. .r Mania

Us Seminary building Monday. Oct. 8. relatives, Mr. and Mrs. J. W. 'Can ; .. .-teeNew never been played here before. -

Terms on application.J non 409 1';..,Ur.nR1'.1.. I). It Little has moved Into the

F Staples of Belleville. Hamilton J.t Dudley Williams left last night Yerk Ricktt Phillips house, now ownsd by J. W, i P. T. RLTTllIJKrOKD. Manager

toQDtj. was In the city on buslneisjtiUrday for Cedar Key, where he will resume I Carter. /Mosses are now In great. d.mand. .- . .

Mr. Btaplea is a prominent his duties ott some briek.work for the --.- --- -_., .... -,.._- THe 1EXTHAL CITY
Tai. >estate of that village.D ..1'. Williamshas
men Levy Lumber Company. ('beaps.l l4tern in Earth Mslrose News Notes BARBER
A Miller of Mleanopy was 'In the been for the past few" day as.i.t. SHOP
Metro.. flat 4Mrs.. M J. llarnett
tit He meet his Ing In some brlck.work at the plant of
to
yesterday. came .Is with her eon, II. O. Harnstt, In Chas, P. Dorm n. Prop.
sib and children who have been on a"t. the waterworks., where two new bailers
Hawthorn.Mr. .
tstMnt visit to Rocky Hill. 8. 0., for have Just been set. and U,,. II. von Honk re '111 Kst Union' Ht", South HUlsCUtirxsviLUi O7uare

.Upatfew weeks. Captain J. 8. Dapui of bland one Our Stationery .and turned home this week. FLOMIUA.

The best I. none too good for you. of the roost widely known residents of Mrs Yearwood' and childrert have re.

Get Blue Ribbon Lemon and Vanilla. that section, was In the city ,..,., School SupplyDepartment turned from their trip Oeorgla' -

ll.olot.ly I *, twice as far and day Captain Dupuis had the misfortune ,
pnr .... ''Blnelllbbrn Flavor" Is perfeeton to lest a fine mar by voileMonday piers .s wood' rider for M,. Reasonable Most ap'tolale' shop In the ea&,. '

: Ask for the 2&3 .i... night The animal. was val Yearwood.Frank rst.s.ourt.ottc.--s trattn ati

fearrell Wiggins and ton, Den, and tied very highly and the owner had Yvarwood Is gelag' to schoolat '
refused several good offer far bee IIOT and COLD
w A Htnckland., were In the city iMLaad. OATIIH' RLEOrRl.
from llsgu yesterday., Mr. Wlggin Prof. Jules Elchelberger desires to I-t up to ito Htandard )I,.. M. Corps of daisiesvllte I le OAL MA83AOK and $1IAMPQOU4Q.

t sports that the planters of his section let the public.. and hi. friends to par andve are offering visiting. hersUler. Mrs. Fickle. -.. . ..- . .. .

are coffering for want of rain. Ovular know" that be has finally severed at LOWPKICE8. Berne of the youeg people' gave
his connection with Mr. A. R. thia3u'goyt1i: larirMge Lee a curprfs parly on
E L Ykhl b. purchased the st+ck Miss Mora
sad goodUWHl of the Ruff Drag Com- Harper as tuner and will tone on his : Monday. whisk. was enjoyed by .ll. ."

Maav at Newberry and will continue,, own fcceoont. He respeetfully .referstqMCMr The Hapllsl Hoed ay school coaten.Ion -

... boslnees at the( old stand. Mr. Vdal .- *. Lodden A IS.'... Savannah., Thy thiMron: are es- was fcelj here last Friday, Hater

1 ts ap experienced. prescription Gm, and Lwddeo-Canapbell-MmltB-Cd., invitcni to do day sad ..a..Alay... wlttt a large attend'

4r',n'-, t, and will no doubt do a "Rood Jacksonville, Fla. colaUy a.... v>. L....' M.Y...
to Tbo Anderson.the clever and efficient their chopping in this
.javs. )Ir. and Mr*. J. It. Kmlih have ,... a.s4
chief clerk. of t}. e'I..d.o. ALHas .
P 1 Cone of PaUtka was In the line with tin.Ve larded lo their home at Newberry,
of the Atlantic Cones U. latbis
"y yesterday. Mr Coe was en route I after pleasant visit ta Mr. and Mrs.W Fancy Se4d,.
"l:..klne....... Cedar Key* when he city, has returned from M.alusky.ek.re \ givo courteous, W Coleoot Its this city. ,
few for "ls
a weat days ago
q.seeept.d> a position with IheT/i'fln/ prompt and jKjlito attention T
..a Cf>' re.e Company Mr COB has sons Charles. Tfceo. Jr.. cad Crew Miss All.** If lokee of Mfeaaopy I. Ube
Tae boys were left 1* PaUtkaMr. to the wants of WATCH Mr "I''''''''. It.
well.
***:: for many year employed as a .U y CHI a ,J.tU.. her .Ut.r.Alfr4 ).,.. *ayIt ,

**sr.ae engineer oa the 8t Johas river Aa4erso reports that they had children whether theybuy Davies ,.., ,... ",..,
ant branch ef fl.. u.p. sad .*r. greatly beefiUKS. *- _
nrlrtands every
ono penny't worth ,
: *Winery .
oKewtm .a. lathe dollar -;- ;: -
T. n. rtcketl
or ten r
t
r. Urst$ of football of the sea
came FOR BARGAINSIN
city yesterday. )b. Pt.k- tt Lee
te. net rred Friday afternoon btwe7 *w
3II0 LX a.rIe
t' a... engaged 'e aka tnaawfaelor of Coma to the place to
siaeavllle and Ualv.r'ityeoms fontber' far ....,., year .. t..Uc ..-"'""',..__....... v..........
ic Mrorw resulting In a victory lora theY n-re.II with fete brs4Wr. buy your nuppUeMwhcro ....Eet.e ....-
k'
.
tf
:- : boys of fifteen to si*. The gain w
.. II. A. ftekett. |.,.b*e4 val..bUtract you get incwtgood
ISO be.
M fairly well attended about la Taylor ceonty..hs.tsthey .... for the least /I MATES'l1WLIMA
-c present There e..nt.414 be o.- ...... .. Real Estate or
to work. H* was ew bon*
.4 .w. ..'........ sad while the pang money and Wscruflunl.
frog ... tract. wa4.* fc vtlt i ca ALLEY
.e:,. WM low Lb. gm e was |h* ro f Is-
be......... it Y Is guarkntees1.PHIFER..
t r' .,...... and was a. good .... Busines Chances la3 East tsbm Ktreef.W .
It U with pl.esare Z aasj **** .....
Land L was to .
Overs..r 0 Tlalcp.i.
L4: )I,. cute..f" .,,$.,1 ., Mr It I) B*.U. Mr. Eegie dQe4 ", .V I....1Wf flpHiit'hs
nlpia
Nty 7.-'a lea t" 4
t%. red b tweim f'ara4' a kavlag IearwM$ fcUMr n4. fo 1t,. greetfa.t.tf SepMAAMELIN desired. teens 714 b n'ekreb J 1Kptads'e .

a:. :4rcee..Bete mile ef wfcfeb a* =idday. !- et X.... C. a.od Cbt. .....f.alsssoe' kl'wlee.,.'. ea i ,'rktape. '
Se ; 4 .. .114 try she Massy eesaa3.- Ye sus atteaes..s. ..........4. :f e '
c .. .. reedy fee $ z..c' .tit be .... BROS. ol.'I', .......,.... settee" '"
mete. .. on graded stated etch .... ei eesrite *l ftsraaz ... .A e.aeht.r p..,."..... xstrc4til' '
ad that wart w.'.14 cps d...n...... Ay ttaate. .... "ct1 D'. C'rsZ3'it1IYZAtt t .44n.M ...". kic. .| lv4y
"':-1$ weeg.. 11M .....W tat srtl. wttie .1 ladies.e. .
.
., ..nittt.
;1 ti. .
t. :....-4 191 its **r* wr Re
ahntll.Xtl.bet 'I.aa be a eat cfacba A 3tif it* E. ...,r!,.. Fr--, .
.. y'eet He Has Them.
rasa, a4 oa. w h5eh w.-"" w.srtest. t .. .
., *area.
w
i

.. .. .. . .- . .., v'. _' .'u.. 4.NM :_- '
'
CoJ. 9'r6 7t ., a: 4 v



I t
*a&tfiiNS! ; &IJ& r r r Y


.... ..,.. ._ .... _. __ ,
.----- .. --.-- ---- _
----- -- --- .----- T. T ---T;; ; - :-:..;...'----......-... T --

E PROGRESS AT NOURISHthe ,AT THE ,OHUCHES TODAY.


body, don't dose it Various of Wor h p Where ,i 1 ATLANTICJOAST

THE PUBLIC SCHOOLClosed with medicine. Scott'sEmulsion Those Who/ -Oeaire May Attend

.. I S"Ieft'.1.oh...r ed at the tanon ROUND TRIP
tI
--- S- EX
is the best ehur<*h-. this Sabbath. fol.o "m* t *

,' With Ai$ ,CErirofe i First Pr..tt.le.n' C ureh. )H{-y. KATESFROM

ment of MorTbanrtOO.. nourishment in existence. : 1'h.i .*. T* Htt"t10rninR"F"t, ; > rt ---

It is more than a food ; 10t9f1 o''UC\k' ; the Lord' aupper.Babbath JACKSONV LLt

rehnnt at4 o'clock p. m., at .
sirsI )OST EFFICIENT.. .,. FACULTY you may doubt it, but it which there "WHl/b speefal .rYI'i yes, $88 40-Hot Spring Ark CIU: I
------- Iy limit
Dr. W. F. Y""tHn of the fjni*.rstvy delivering ; flinty star
..tudent are Bending Every finer digests perfectly easy and $17.65-Memphis
Tenn
..
f a 4'ol..d..r. No evening c:) tl >
;
In|, Their Siudiu-Handaom';, Silk at the same 'time gets the .e.Ytc. 15.16.17.18 ; limit :_-s "

inner' to Be Awarded-/Other First Baptist Church n... 8. B. tension to Nov C'

hoot Notes of Interest)"'.. digestive functions in a Roger*-Sunday .c'>nol at Ot30 a. m. $1085-Atlanta. Ga j on tab /j

.k : "1IJI, condition that Trfachlnir at 10t30 a. m. subject, 10; limit Oet 20
; -
so ; exe
,,.I* University. High School closed ordinary ..If"n'. Great Deity." Young PM Oct. 80.$10.85Atlanta. .I!
-
first week of the present session food. be
can easily di- pie'* Union at 8 o'clock. 8anb-am at BaBywon't Ga.
lay, with an enrollment of 425 ; on '.13 c ,
4 p< m. Evening sermon at 7:30; *ubJeet. If 17; limit' Oct. 23.
ktl*. eighty of wblch ,e1n the High gested. Try it if you are cry.
"Opportunity.
>rOl 1 department proper. you Jive Him $10.n5-Atl.Dta. Ga. ; on sale Oc
down <:
run and (ooddoesn't KTvtnaogh Methodist Church Her 20
your BAILARa"SI1OREf1OONDSYRUJ 21, 22; limit
from leaving
doing expreralons from the
T. J. Nixon-Sundar ..ebool.' 9:30 a. ?
icipal, teacher and pupil, the # nourish you. m. Preaching1 10184x. tn. ; subject >. | 15.taOct. 30; extension to
promises to be of best 'In I
one the SCOTT Jk nOw? :, *>. Purl Str* t, NrVorlet The Friends of Jesus;" Holy Gomtnunlon Pleasant to take rapid te ulta. "4770-Macon.Oa.
htitory of the uhool.heorganlutlon Contain nothing Injurious ; on sale Noi t'
at Ibis rwlo\!. Orange Blossoms
haabeen ompletedd .7 T COUGHS, COLDS, inclusive ; limit Nov :C:
at 3 p. m ; Senior league at 4 .
d I is them Into the p CURES ..., SORB $11.25
machinery already running peep first;second or m., Ifd by Miss Maude Neville; topic THROAT -Montgomery, Ala on j
smooth a* clock work. third grade about nine' .o'c'ock WHOOPING COUGH AND Oet.
." Everybody rooms I for the meeting "Our Duties to Thoseof ALL PULMONARY DISEASES. 20. 22. 23, 24, 25: 28;
loeeted with the school be la the
Oct.
seems 10 morning. 20.
Our Own household: Evening Mrw. J. C.Jenkins, Denver
>py,and the teaehera are enthnslas- MI. Rosabel prdrlek playa the service at 7:30 p. m. subject of ser, Colo., writes "I can't sayenough $25 O>'-'t. Louis Mo ; on eel., Oc]

goer the outlook. marches and Miss Ruby O 'Land the mon. The Two Brother*." for Ilalla.rdra Horehound 15/ ; limit IeaviniSt Loan]
The hold-ov.r teacher, have taken Syrup. It Jinb cured
songs at chapel exercise, Holy Trinity Episcopal Church Her.F 20; extension to Oct C"
their' work with renewed vigor and my baby ff the crowp and my
while ie. The pupils are Improving every day H. Or.f'thlll-The regular winter; children of severe' Oouffbs. $32: .80-Buffalo. N. Y. ; on sale' Ot
tterest the have
one In marching In a quiet and orderly' schedule will..b.gin today, and therfc I: know no better medicine." 11. J2; limit leaving Bu
( all
the ,
ready fully Justified wisdomf
manner: to and from their rooms. will be services '"< follow t Holy Com 2ffc, SOc and $1.00 Oct. 10.
the board In '
selecting them. The
hoof has without doubt a faculty the .The Seventh trade boys say they; munion at 10:30( a. tn. ; Sabbath Ballard Snow Liniment Co. $1755 Oolfport, Miss ; on sale'
"winTknow the right door from this school at 4 p. m.. and Evening 12. 13 limit Nov
prayer Z3
,, ;
a" least
equal of any *chool In the and sermon at 7 ISO o'clock. HT. .ZX>t7I f. MO..
Btate time on. $10.60-New Orleans, La. ; on rely I

:t: 'Chapel' exercises are held In the ThoseHigh/ School and Eighth grade 12... 16; limit Oct ro e,

auditorium at 8i26 a. m. The prlnolpal boys were norkep In last Wednesday; GAINESVILLE: STILL LEADS. Sold and Recommended by ion to Nov. 80.
I
,: request The Sao 'to announce a"ernoou.rbt; were verb kindly $13.20
k -Birmingham .
Prominent Oregon Man Compllmanta W. M. ,JUHH.HON 6.a1H11'1JIe.T Ala ; on ul!
helping the principal take
; and
v that a cordial .Invitation Is extended to' up rearrange 14. 15; limit .Iraviug His
This City
Upon Cfgars.
patrons and friends of the school to the desk In Miss Trotter.and --- -
l ham_Oct. 21 ;extension No]
Mrs. Oolf. '. Oftnecvllle' I I. not +
attend these chapel exereUe, that room only becoming QUARTERLY tPORT.
r.1 they cannot oome-'too ort.n. and that Ml' .. Brant say she not only ha the famooa. a* an educational center, but Excursion rate to other polnti

they will not 'only be welcome but largest class in the grammar ar.dn.but also ass manufacturing town especially United States Land Office H.. Enjoyed Limits, schedules Pullman set

their presence' will be greatly appreciated. It I I. going to be also the most orderly 'when it cornea to clga'r' a Fn! Qnarttrly Buslneaa. modstIon and all other detailed]

The more Interest the parents ant best working one before It will be remembered- that' several The United States land office 'enjoy formation to above and other pi

take In the school the more the )long, weeks ago H. 8. lt>oma; < proprietorof .d a most prosperous business for the cheerfully furnished on applies!

eehoot liable to do for the child rent The principal' wa wearing a ,beautl.* the La Mataoxan, 'efgs/r/ factory 1 In quarter ending September 80. aa the. either' by person or by letter to Fi

At chapel axercUes Friday' the fat htbl. u. flower Friday. The que.. this city, received tin ';Border for COO following report will shows 0. HovtasoaDistrictParsenger.t(

; principal announced that at the end of Ion Is, where did he get .it? afgara"from Henry North vice-prel Commuted entries.. 6e, aggregating 1SS'V..t ll.3 itreet.-JcksonTilll.

the flr" month a'silkbsnt.er..would be The glrlf are thankful to the principal dent of the Poison Implement Company 7.07948 eorft. Number hdmestead -- . .- - -

presented'to the grade showing for the for giving them back their tide of Portland, Oregon for private entries, 187. aggregating :U.A4188 .

month the>e.t.attendanee: and deport.! the school yard n.e Mr. Norah stated thiit'he ma acres ; timber and stone entrle.,48. aggregating T. F. THOMASUNDERTAKING

mend, The, *honor grade each month Pr. Kelley aDd; Ool. Hampton made ,friend from Gainesville with a pocket $$5,30.108 acres; flnal proofs,

will be aotHiadito. bannrr.f fine speeches at (hie opening exercise. fall of the University brand cigar, and 84. agarnaittlDK 10. M 01 acres; war CO.

f, Three,:ra4. *J. were aoboanced for last Monday. We hope they will come that he liked the cigar' ao well he rant location, 2, aggregating 240

the High' Btfhool-one each for the often. Mr1. Vidal Is golcg to make of wanted to plane the order. acres. Amount received during quart

a speech the text time he The good were shipped, and In due
Freshman Sophomore and Junior .... _. comes. ter. '29 .9..R9, divided aa follows FULL, LINE OF
_' els.*.**, for prnBalenoy In English. "' - -" -- time a check wa. r-cplred with the From general 1 *ouree.*. $2848203; for

,a Latin and mathematics. ";:'1 D.ath of Mrs. Lyell. .. Information that )Ir. North was well timber tr.*.pa.s, $4, 87.20. NOW GOODS....

_ Weakly Notes. r- Died' at the residence Mr. M. O. pleated and that he regarded the Th. '''Il'-t.fI'r| and receiver ere very

> t.artlgue yesterday afternoon after University cigar "the beet ever put on well ;ilri.,B...t "with the quarter'a work.
fVurnhhyl( by Pupil, and 1etahars ) the market: for the AOEMTS' FOILMONU3IINT
money. ,
several we.ks''iline.e *
her
only daughter which compares favorably' with anyquarter
The Eighth grade declarethey arenot Kate the wife of F. W. Lyell. recently >lr. Thomas I II yet working a small 1 of the same period' ta preceding $. TOMIISTOSE

only going In win t banner, but moved to this force but his good have had a remarkable year and IKOX: FE>CKS.tVSee : .
lint city from Or
_____________
are going to hold It. the Biith land run, and I It has been Impossible ___
"* aampt.s.
oar
s grade declare they will haTe tome. Mr. *. L.lIa.* the daughter of for him to keep up with Ms order* A SELF.HELP COMMITTEE.

thing' to say about that. \ Captain' Lartlgoe. formerly a rldeat even In the city. Per an 4 attention to *il catten
Beginning' Monday we are going t 0 : of OslnesTlllf. and sister of our well _.._--- -- Faculty of th. University of Florida this IIn.. Matt sad tle 'raphpronptlr ord-

ate how neat' and clean we can keep known citizen: Dr. K. Lartlgu. Torment of Tetter and Cczsma Want to Help Young Men. attended to.
"x
+ the school yard The boys propose to Mr. Lyell I. survived by her ha. Allayed. The. faetrlty of the University ha
keep their side just a little nicer than QalncsvIUe. Florida.'
1'he Intense appointed aeorotnltteeoa"Self Help/'
IlAnd. two children mother and .three itehlng e a"e'erl.tlaDf.elem.
the girls keep their. .rai hoMO duty I I. ae far aa possible to .
brother. Bhe wa swentj-eight year tett >d |like dease! i I. In- ,ro.
Two literary societies. will be organ vide needy students with
i of .ce. '"nll, allayed by applying Chamb.rhln' remunerative
jt, Isrd nest Friday. These societies will employment fortheirspsre hour
The funeral will take plane from balve and many severe case*
meet eaeh every other week In"lh. auditoriuM have been Borne of the ttudenta are employed anJaoltorp. GOOD BREAD
her mother. ,.ldellee"06 f'. ". permanently cured by It*

at StlQp, in Friday. alt, .....*,.at a p. m today. nl!'". T. tiflee.. For sale bf all druggist. one has charge of the ..m.UflarS'.nt.rla.

It anybody want toe. a big room Nixon oBlelatlntf. The nail-bearer --_. -_.-.__. Job, another tends to
fall of busy, happy little people, JustCUTPRICE will be H.M. Touch' Henry Dartlelt.J. -------- the electric lights *nd wiring.' Wage AIDS D1CESTIO

,..---c:_ ...... __ ..__......._.__ ______... }|t Tenon Dr.' Gordon TUon, Dr. J" PBOF JULES [EICHELBEBGEB vary according to fie kind' of work, k.eie
M Dell and Jamea W MeOollnm.Friend but la every case the student receUe Ant e..,.1Ie... 01 'Ut& tre.ant"
wttt.h ....vy, t.otr.r bras
; are Invited' a fair tarn for Ms ..nlop,. botIlId t_ereata.
---.---- Pi.no and Organ Tuner Anyone wUh!*,g to enter the Universlty -

011kF Funeral Notice. and Repairer. who ha not eufHeient mrans Income : IT's Jill IWN FAU
'
i without saeh employment should M MiIf
Th. funeral .rvlre oflr. Wro -
Soth-
THIRTY YR.ARV. .dd,... Dr. J. U. llentoe., the chair yo6 do not h..i* root wtote.uo+ I
.,land will be held' InV CXPI3RIUNCQliats.nlhlfi
Holy Trinity man of thia committeeJUSTICE. o* rare t.aW4t.tot It.. ,tads tress e J
Ohureh at 1130( p. m Tuesday, after j awl d.II-.ntd as four CoorsKCYSTONC
-- ------
which the remain will be lerlda.JEFF
e.eoned .
by BAKCRV.

tROll oro! 5Al* [ the various secret soeietlee of ,whleU : COLMAN'S COURT. ........ Iu.IC.. T. M'IUI"U. II
he was a member to Mleanopy for burial John Sparka and Wire Arraigned

by special train an the A. O L. SIMONS Upon Two Separate Charaea.

Th. Interment will b* In charge of sac ANDERS'
Matonia. Fraternity of Hth Springe. naAuta in John Spark' and wife of Kirk wood WILLIAM

list been a remarkable euee.s i The Mavoaia bodies. Old Fellow} lie. were brought to this city Saturday and

we have cU'&tCN1fd of nearly two bvkahe, Knight of Vytkla. and Elks Fresh Saltwater FishOYSTERS arraigned before Jattlee, Dolman
earlodfaad hare The woman.. charged with the BICYCLES and
only a few of n.t. ell". .1.0 the eam..wieti.e. of
larceny of a grip while "
,
left, her husbandwas
High ttprings and Lake City, are axe: .

It you eap.et to furnish tbatIdle preset to be present.A '.' I alleged false 1'gila'''..',... obtained The woman- goodsunder was Electrical Supplies]
special a.l.111' leave -I1I.ta
. n>om, now U the time to do flood W and costs and the floe remit
it '....pi'. Spring Toeeday at ISiSO p. m.. a"',. I I Iuad I led while th. husband was Ira fortunate -_.
lag hire la time for the funeral +er-
11.00 tmla at . 1700iaCO been-boond Ks ..
... vtoe, and the party may proeeed to. having over in the Attesey for .sadist DkICkO. ,
U+ds at . A10 sum of fica for appearaaee before the DH1rka1....
..n..nopI''' fHenda front Oalnee- I done pr....u,.

W..y pay $13 for a bed when ,111.. AU friend of Hlgn flprlag are # rail! eouru Bond wee famished .T aU ala...
"o..r. and be
released.
Invited to Joist wfta the was ---
yow+ an get the same bed for members of ---
.1.Qr? the ...rt ordete and attend ibis .
er
.. vie. ftn rear of Fumitare Company) Lest We 1 113 AV. UNION:

After we. elOM oat the few .. Futther no l 'ee ..Ulapp..r In ...* (1AI ES"'1LLE. FLORIDA Forjret-i> by I. ...&l0M. ...', ele.-pat _. -- -- -. ... -. --
have 'left bed will resume. their -- nicfet, won't eat.ewe ..pessaodi.a1.ly. -
It....
ttsuat' prIee.. day t*<1.an IracleILh now t.nrpard tan t.to.t aeomae the mantel.date A bottle nf Walte Crises V.nwlf Stanton Foundry &

I A* 1 twcU.... afford .. this linn ........ Mu .p never fall toe livery -.u.

BUY NOW AND SAVE Xette I.I aereby given that CMS Sat- ..-.-.----.. -- - --- er should. give her baby W.&..*.Cream chine Co., be.
-- ---
--
I -- -- V...lfo... fla ttn ..
ntday. the 17tb day of OeUber. 1908, aey whew the
"MONET. I \ ,. PAUATKA.- FLORID
baby tJkln and fretfaL
at two 0"00'1& the afternoon at lb. motet
BROWN
I'amdla. F1 Hda.t will e.U to tae ; HOUSE does.-.s abatis. da A..".. -..............,.. -

i fetC&*..t balder. for oath. tae fellow g BARBER SHOP' at>.. $4I ek e.*fwd\. end* M t>*wwabt.g"..r brine to taM..4s.,y.ta .... 11II u4$ 8rrss CUt1J u41Gnta

+ tAIKESYILlE t-roperiy towltt Rive to a .Ial fold bt W >t. J*.a>. :'
P
Sot & 1lkkanft. --, Rif ssp1ftPtUreid
OaeVeataerby.
Write swdo.td. { 1AREMT rat, ..... -.
1. artaee p2sn.r aad .. ., u4 Kin O, ::: '
.tc.
4 J f. ,___11_ .. .. ) T.* el ..ek et sf t..4e ........... t ...boenI Aaelsr Cars
U s. -' ,..,.a.... .*...n. J8..Pa.MJ..H Ice Y4vita snit n.... ....14... ;:: ..n ___... em tA t '.1 p Ise ..,. *. HW...SI WaV and
at. owe hi ........ II.Ita.. _hilt Tampa nn trawIsv leaving \C".1ISo' EV T ::t.A
........ .
r' tM., ees.sIt. LU..ut' isle M adear.n..aetr e'we4tS with smvratosT ttstat front! 0. .......... es.a .M -
I.... s.*.. .&.,:'
..


r"y ter r


r
e:



/




I'{ r
{
''t,;,;
.,


r < THE DAILY SUN: t GAINESVILLE, 'FLORIDA OCTOBER 7, 1906 'J ''

., . .... ... .. .._
-- --. ..- .-. ----&;-. -
.---- >-___t-- -- ---:;: ::::::...---=-..- -- ., --'-- "= :. _.. -- '

ITHY: I \. '. NAME SPELLINGS. :: ',
SESSIONS I
II K1UAAHINSIDlOUSF :
: par .
Dt .. Hr .r Ort cm %%.. Quit

If;a F COUNTY SOlONS1 See Us for CtoMM It a |If ftan Aith., whose!*..name.t.ICotWtiays was H:' : 1' TO HEALTH I:_ '

i 4'/r/
Utuwd vhoukl sfMM-l it llnmu. l>roou.Orow unconsciously "
iI .ti or Brush be woukl no doubt Malaria ia an atmospheric poteen. whicH e rathe i 5
of OUI'lungs the impure air arising tmStfyfifr manhy places' atapond' -
it Deal pt Into a \.tF..r: uoan.Uo>a troubles. through .
cellars. BewVr Jlatexl houses. dec ,
damp Vw : t.
of. I 'u,'b a llvfMHr of orthography iipolevmperly':
portance Disposed dnea not .eou tat' >kav. auuoyetl tbeIbtftlMi vegetable matter etc. Day % )>oi!!ons are. taken' : ,
I poet 8b.kOTl earv. huwei'et.". for thedunga and as the blood passe through them it bapomes infet tt.,J WII'*,

ROAD APPROPRIATIONWas I bis iMU.e uj.iH''r vttrltJj live different poiaon and lu its circulation distributes The microbe of disease to aCi: r I
tT
speUhlts. two of LjNi) alt lu his own of the body. Malaria ia a very insidious;disease ; it given' no 'rarrlong c.f ,
tuuKhYttUIlJo coming until the circulation is filled with the poison and this foe to bn1
51.000 Appropriated ,
!;
Sys, of In tl e register >AMh; e eliurdi at Stratford has the system at its mercy.: The blood becomes pollute, thin and weak ma
work Ort Psradlae-UaCro its slow. Irregular circulation tails to and strengthen t '
tite name of if gtw.te..t Englishs properly .nonnsh :
and $6OO for Expense of Col. I Uranwifl-t IM \\r\jlleu Hh tki i*> re. It body. Then the entire system' is attacked, and if the geinin Und poisensMalaria : "'
ALUMINUMCOOKING allowed remain the constitution will break doNo
are to strongest
Fair Exhibits. U"fM"t'N" us hlMkMit are in the laxly of
*{State bis Will but this ea me vrlll in ludomoa one can feel wen .b"n; the system is intt, ,malarial condition; the vitaliis

Gainesville Fla.. October 1. "Mr. Sbaekepere''i:: W11" The poet weak, the appetite poor digestion deranges tt. the complexion rrocallow p

met this day. Present J. him elt .wrote his name.: Shak8t>.or and and the entire body feels the ctTcctn of the J"t l ..)n. Mdlana m'ur.t

chairman ; J. O. OteenP'drick. ; BUak>*i>enrtt and know It !'a spelledtbakeePxwn | removed from the system through the circulation and the only tnclutnc11'' :
pier WAREOur "' 1 can accomplish this is S. S. S. 1t not only cleanses the blood of all unhca th; r
'Q, I Sir Walter llalelph' had numerous morbid alter, but\ destroys the jenua. cures Malaria and restores this vi ;
meeting> being called to order .' fluid to a strong, healthy condition. S. 3
way's of *|H>lllDic lit."aw" It appears
.olton, tax assessor reported at Ulffervut tliuesiMUd pl.lcrra as Itawloy. is mnde of: roots herbs and barks combinitytitg .

L,it books were. not ready, where.. I ItalvKU. Ralolfih\ .llawlelgb andItaweley. S S S and tonic properties which keep th
a* board adjourned until Tuesam j sllterv blood free of nil pontons: and the rvstetn 'iiperfect
S .
condition. While destroying th
it at 0 o'clock. I!* IWu JOUMOU signature In 1
--- which an h apitearm.Drjrden :'URELY VEGETABLE. *enus of Malaria and building up the ak.:4: ;
polluted blood S. S. S. Rives tone and
Tuesdav October 2board often spelled| his name with Vigorto
,
aul. fa. thcf entire system Book on the blood and any medical advice without'!
this day in regular"
met Samuel Uutler. author of "Ilndibras.** charge. THC SWIFT srfcirtc co. A TIANTA GA.
Present J. O. Dampter.J Prices Are
Right M-aa known to write his name llotcler. .
Q Osteen, O. O. Ped - -
D : Ur. Crovne was no anxious: to have vflJ
t, F Faulting and J. F. Town. his iiniutt prououuced correctly that ho* ,a 8aosbl.iswad 10"U 2

wrote It six: different ways, .. .
jmreting! being called to order -.. I. The IVrncu u moN Vlllera<< during tbo
:S.F : ] 00
motes of last regular meeting history of that family wa spelled fourteen o-crTTO V&3. _

.rtl'1.nd approved. way.
The girl's. name land wa one of J 'I r
wu paid aa follow l ** S.. H. those that bare
pt,clerk and auditor $.0 I W. BAIRDNEWS ages from the Kazoo. Maud was originally B A :ISrKE: :S.

riff, guard at jail. y25 ; Mote Manna whlrbiineans to be able. '

tn,Janitor $25 J Southern Belt From tilt name llannab the reeks .

a. Company.; East Florida made Anna and Anaulas. Anna grow '<" 5P 5Ps

one Company, $2; 8, II Wlen- . ing In favor went off various other oCf- .e ....rl>1-....,..se ._.bee aa4..u ror.... and Domessiw a..ta..o
..
... ___ .. ..
---- 0'
-- ------ ------- ----- ''' ben &ers.eaWxNlan..I.ror.m.reassu.adoilsnreeshed
imp! .tc., $7.61; J. B Fletcher. shoots. uiuong which are Annette Ani oo' taeorabs.' s.rms. 'dal lasi3lat.a'O waling .ol.esleea oa all lseeewtb.
rf poor farm $25; W. D. Dicklnimiiflons FROM ALA HUA. ta. Anne. Nancy, efg, .aosats is 111. Usls.d Ml:t.., l r
The name Jolianan was brought to ..'\

.Boberuon,on treasurer collection, .com, $33 mi.-85 i'' High School-Large In a Prosperous Corn Crop. CondUtlon was UiiglAnd contracted by for to Crusader.:John In Ireland letter It it G.A.. :ms".1-.J::: : :m trLO 7 1 TIAS. A

129 Sit City ot Gainesville .
bevscne" Shawn and In Hcollaml Ian. It .
Alaehua. Fla.. Oct. 0.-Dr. Jim UUh- ------ --- -- -- -- -------
,|1023i D. O. Edward., team too took fur this name to reach
op ran np to Aocilla this week to take sour M. 0......, President H. E. TAttoW, Cashier +,
fl.80; J 8. Bod I ford A Co., Itu..*la. \Vben It did It was called Ivan.
i for poor farm $:s.20; R Me- his brother Master Isaac, home and au.l In drnuany It ti caine Ilaua.The Uao. W, Urns. Viae-Pr.*.ldn% Las OILUI"' ''. Asst. Cashier
spend few day with lit* .
,framing two diploma*, $7 8. parent "'ordVIIUuin
wll, work on court hous" $I; CO; A. M. \Vestphal of Island Grove dent Teutonic mytbwlogy. It derived THE "FIRST! NATIONAL B1kNKOF t''
came up on the 2d to enter his daughter it. origin from ono 'ut tbree primeval .
tXtrchtnt & Co., soap for jail, '
Miss Lola' in tho Alschua HighSahooY. 11:00..0"111.11I: .04 Vein .
';H. H, MeCreary, publishing no. k
like maniw wo hart Mantaret
: G BV"XLLE1: :
_
.vtrdt eto.. '$36 15; work on Ma,tern Leon and Earle Trailer of from the ('".....dn. taieaulittf the rhlld of
.IT271., 3. H. Wlenges. ft'cord."huU.emen' light Iturlwira from:the .'''''...Iit. loran
Trailer entered the Alaohoa High THE ONLY NATIONAL BANK IN AliAOHUA CO
and sale of 1906, lug ..tr.IUth..ru..1'ronl: Urn UUw.u.C&atbarfu .
e; (. W Fennell, feeding prison School on the 1st. fr.un ttsj. fourth saint andcouuhlu 4

Feet In criminal' c"..st E. moved O. V.hi McQueen. family to of town Lexington, so that has hi. ss tN-ht.r.a.N'.m, \". .. Capital . . . . . . $00,000 Q
ar, $27G| A. A. Ztrouer. children may have the excellent advantage ...... ....... Surplus and Undivided Pro ts. . :0,000oo"i;
0 H Crisman. $18.02. L. J. ,4 ..
.$720 J. W.. McCann. $890; afforded by oar school. Amateur gull ii>'' lM-r fiKJ 'gmwer Doee.uJuiretr a esaktns t.Maess,watt taetftt.seq.sl .. gas beak ta %a.. 5sase)< .oi1.tan.
LCmwll E.T. He The enrollment of the Machos Junior of ttrfyrr oflrtl tuftke the mistake fwatertUK ..........f Ysrar.r..Mw.saa5.G.rs'.r.ttu..M. la. '*r"'*i "" '.. .
fSTOj d.noa. High School i. Increasing almost the .4*
..',/ D, Slford. $0.40. everyday The number now enrolledIs sown liunM...lhMtrly after the, tmWUK H K TAYLOR Oath et._i s

ordered that $1OOO be appro- whether the roll IM inol.t or itoC The ... .. . .., ., .. ... .. .. ...... ..
greater than the enrollment of --- --- -- -- -- - - -- -'------ ---- --- ----- "
any
7"1'
tad paid into the bank to the* practice Ii a harmful ou<\ getseallypeektng.
.tftfC O Ped rick, to pay for wag. prevlon term at this eton of the aiMl should cwt bIn htdullrftl PERRY H. COLSOM Prcs. J, W BLAKD1HG Ylce.Pr s. B. R. COLSOH SecTreaAL s..

t road expense for the month year. The school I thoroughly crcan- exreftt"" lit imuual !<....... If the IM.II

tt. teed and the work is progressing v.rysatisfactorily. or (cnniMMt lu whiHt' the i tepds are .
tt OGbs appropriated forgetting The school I.I not making tuol..t at the stew s f 'wiinc m water -- .. .'
attempt at display, but from the lKMiM tw u.* l, an tin1 fMtil Itrvdntv* Miff
tit; for the State Fair.
standpoint of discipline' and good, and foriits. a rni.t yii I use surfan wt KUprrteut ABSTRACT COMPANY"The
trtwsrdof $50 be offered for
honest faithful work we Invite eomparUon the IIf'OftItlf! from pushing
tmu and conviction of Will tb .u"b. After wowing tln ofl lu any ____ __.. ... l
with other school In the
..ha murdered bit wile on the any 4rt."wiiuxiy dry one.It / .
soil except an *!
8t..... The eon4ue& and splritof the .
If> September, 1806. H Ifclter. to wait' a lay ur two lHrfirwiiiirrlniir ..
school I Is In A C-Evj.21013'o".L7.lo FJ.a.
unorpaased. ::
"cJa: the board adjourned on- appearance or anti' (. salt drUm up ..... ,
tloes4ay morning at o'clock.. Intelligence, behavior, and the faithfulness preity wHl. Thou i SiM-'T' gently wtllt. atin. ... C 11
.
and energy with which each s>i,rii.kler Jut *'n "The Title Is the Vlrst. Consid.ra/ton.
lesson I* prepared and recited, the *.is. uifMwtet* the tall ,un.U-ratHy. throughout -
.
Wednesday Oet. 8. W''. do. ...Ioa'. Abstract. .business 4npsrtiog
teen girls who make up the high school whit will .urtk'e until the soil, with f .IUti f r1NFOUMATION roLL.
losri of Comml loner eoneerning the Title to and all lands | County
County >* department are unequalled by any hows'' ."n, of ilrynetm stain It U any ln\Aehua
dmd.y ALL nUMlIIHH' : TrtASHaCTEH: 1.I.to U"'fr.
pursuant to adjournmentJtr like number the writer has ever area. not lW'er' Mary tt* givd a little spHnkllng

every .s.,.. a. MMMIM* .bHIev*. for surbtrvatmrnt -- ... -.... ...... .... . - . .- .- .- .--- .- .. .... _. .. .." .. _- .,....._-. .. ._ -
1(1"1 alas for the boysthere are nonein .
t J O. Dampl.r, ehstrmas; only make matter w....
iOtttoen C O. F. Paol- the high school department. Oo _._
rechlok F. -
,
ibis question the writer will havesomething -
I I F Townsejd. to say In the fntore. Letter to 01. 8. Ooode, ABSTRACT & REALTY COMPANY ..hFit3ua

karl proceeded to the appointpctar Most of the eottoo 1* picked and I I. ..ialae, .vlile. Fla. ,'
ct ". and clerk of theta
hear Sirs Hn me people get d'sap
the
being brought to" gin very rapidly. .
be held November 0. 1904. polated" io painting} it do..a'1 eotae POr.cL'
Hell A P.a'n ,U kept bay and
.ld.
out a* they thooght wo
Turner. I. running night and day. E. E. VOYLE. MGR.
i .'.:,..., C. E. Hayes and Wll- C. n Edwards. of J"A..td. +
: The farmer of skis Helloa have pro- flroojcMon, printer. KaleJah, $' O. AbstraeM of.Title and fall iuformatloft faruUhe lands l. this.
ulgton having complied with dneed a large earn .,0". sad the short painted tie hooe 0.... three. year o..3s.,. Oar maba..r ....lIy.4 In shim eountr thirty year wilt
each! be granted a ,permit torrtpasting age In the cotton crop I* olf.., by' the sent be hdnsd 2k7r.Itoe.> past pales. thoroughly., .onvr*..ft wJlb lanA '1...
rifle. be'0- and bought Po guise.. Devoe.la .
abanbant "bog a.d komlay" erop.
.&*"'.", J. 8. Van ''akl.. 11-4 I. let',
Mat of lb.Born .has bee. patkerrd' .te paint I* ettra |bik-with .
1f, W C $'tpp.r. J. T. Shaw- and one farmer ctate that be has w Blt"t-VK. IEL Z E r 'V 0' x LE.
.
l., ore W S. Jackoa. W. A. three W. W. Carroll Mosttl+.lto,
.J T Roger,J. A. Ward. C. O. ma.!. eeaoagn supply hie2. for FlocWs, 'sft ")iy palMer. acid Uw vial:, ACCIDKffT. bUROLAHY .Atb Uf kJUUTY YStsuiultcir. ...,.... s
I, two y.ae.Mr. ..M sale SA .atl...* to plat myfee e..tlag a ... ..r or prt>ml..at Amerfcran. and KoRllsk eoruracf**.
bating' compiled with. the.css . Smith of Odar To... (h. has *..4 U took 3D gall3: IVMTO." 1 1a .. IlKAL CtfTATK AND CITY LOAK.

of the law, .*.h be accepted the position of ...*.." ,tl Mi .... I* tAr-_l patsl. j.o .. Lowe C3sLlacipw'v'i3.o: .r''Lox'iaA' :

''pr. n t to. carry a pistol aAW *- clerk In the dreg store of Dr. J. C and .e says I>.*roe .*"...a whitest while . .. ." ... . .. .. . .. .. . . . .. .. .-. l
all '
ef e.h'au.. .
3
fltshop. Mr Sinks. ...n** Ie be a ,.... Ja Redge'. I-.tflil I. jra!!....
? :-ad of A. Eoc-". Son splendid 7-.. "' .., and we w.Loss. 0...... so pefes. )C" rr*.,'. fc4M .- attl ..",

t"a r1 pabtte be approved bin to oar town 31.rt.l.. T...... petl.'" twiTIMS ?

*-=* baton be r.fc* M for work ----- .--... >.- ..oaf e ATLANTIC COAST LINE w w1ikoettsll
...... ,,
't rs.* for o.4rody. "-
:-, u.... Caen.An tie.SVMI** I>r*.. Use i*..y ,lesraed I* abed l .r"r.,''' ....Y ,5" ,''JIIII i,: /1 .. l 1
report of she eommIeteos ewrrt.esar wa. pfrwt..rtlat tm UM schools 0'1.' ... past.Yews. .
,point" to..... sad mr* north G.ogts ......... -... b1raliar ....'J.

IL road runnlac from a point < OIl a natfvo sptwrentlt' efhtaiac 12 ... W I.*..... A C*

L ..k.* piece fear miles *..atBraaalnc > te tlTb,. ..,. et a steep MW tJIIIaC ..... f. u, i Tfc* K. J.TVeaa* Cat. ..!! see THROUGHSERVICE. : '

south pob. rcere....... ..9pw4 for a rbal.aaU pel. **. ..
to
tb.. t*+...tl.**.... *.<*..* bonds fern -- -
Asa C.acClNNk Baptist a test M t3o ..... fleas has 1s11isfnttest. .......... sa.btd .... .......

a .accepted and he eammit4 wits ....ertst a.'ltoTT -ttw.ry ywst ...... 4V.r- **M fcasUMi

... .*+ to poet' the road at eathr f$ burr M am vwM do 7.0get wire ........,.. M ** wrMMT *. talk i

11. ,r M of thirty day*. e. teen ...... Ml bast itWrW. t.lriurl a pulsar Uhr : .. .

report ef W. II. KefcerUeo.o .. 9f H t. reedy fr llmse"'t'''" *.*.*! CWt lf- was trytwa' tsaf > ....... her waa.4 :...-........ '... \-.i -

:' (twYag the ....*... of. etJ'ft..,."..,. t3 iteMr. *a.t rfas ...a' tier ps.awed

... ,.ad_. be ,.......>.J. a* rotnUit I ;**;*.* was taw Utte *af. peetrstfcfel *- ...- *.ir v. .. far fct.* rwsaeske111515d xQ OJIAKOB lrupe what ysw. s...... with. Slaw Agent) IS.......
_
.Wr f'9'PIJ'Adaata' kZb.a, +hprllt hedger_ ,

l d ., . . :2 --.-..- - ,;..;- .. .. . ."' -- -. .. _. --_.. -- _.. ..--- . ... - -- -.- "- .. --- JAC ILL.Z.: OCAU\. UAfUVILLJ

.._ u.ihs'e.tamro ......... .1M..st,..bass .e .r.a .----.... .11., r -,u..w..n.n.w,...-.., -- +
tV
1o4. W..I8'1 *3taad j heCouh0' .t airaodPPre.sdreat/et..ewvr.Jwr.o .'

+ ., .x. Iii roll asa..tassloas. Ibw a.trarts. !.. JTnil Iafftnwls) axay+ .M> .l>tl..iS frees)
c.1lf?lla I i lA say lwr+R. )io.asr.ra


......... ..' Consumption S AyesCfc' ry* ? ; J. A. GOO D Vl IN Ticket Agent.

Ike tm.n* ...,......& ahs$0Ar _

: il, a .

". S .M fi + f i
-
rn'
1'-
I ,



IRSBW _\\i '
( '1 1 .e

i N!" Y'?,,,i I : r ....'. '; <, :'.''',..';',,},"'. ,:I':', 'J\' :':" ,. ''i1IPI1' <'; ';' !; ('I.'.:" ':"' ) '. .' ., I )' '.;" '\ ><:: f .::' n !I'.,; .;. ::".!JI tt:! .N '" .t' '::1. ,.j I A';". .1, ,?
11.\
.OCTOJfKBtYaRMONBTTES '''1lnrtl' :
IfcOKtDA (
GAIN ESV11L:
'
rt TY1 ) &IJ'Y SUN: : ..

-_.' _... ._--. ._ .. .____' ._. :_-_:___..__:::u,:_,,::,=-=::-' :_-,:,:::::::- ::-:-::::::,::':::: :::'=-::"-:::: :----"-::'::" -=:-::7"7:: : -- - SlC


: iii ACQUIRING, I SCHOOL JANITOR IS SHOT WfNCHEJT$ dJ. w

Dy Money Lender Who ClalmeU: Ne rw09iarJl
;
.. -' LARGE FORTUNi ore Owed Him.

e in men and I e i wtHe l.. I Savanoah. G.... Od. 6.-SmaiShellman r ;

'. ,', "i, a aegro, the janitor at 8t. i

'.r. I* only fqr. the W'b Recent Success in St. Louis i i is Patrick' school was shot and pro) "NUB LACk "

fi r.:# ably fatally wounded toy J. E. Sim.; I
-. 1 *rA t* Phenomenal. I Jr., the proprietor of the Carolina Trt.. I
world need not *'bpjnion< ,
year ding company, a money-lending conI I I Loaded BlacK Powder She!
STATEMENTS NOW VERIFIED cern
I your love and"It, will need no The booting took place In Stat e : 2k

. reter. '. Internal' Pratte. Are Undoubted street, near atma place sbua1aesH. Shoot Strong and Evenly .,;,eC. P9wtm

'' ''I pt oooditloo, but do not! .,,;,t Reaponaible For Much III HeaMI stout njen were placed under arrest. Arc Sure Fire, r"a
; They were cftrrled to tpo. barraclu. arty M>!
ed by them. 4J? -
: .ttDW'UJ: L Hundred Who Have Taken HI. where Shellraau'a wound was pry' K& V* Will Stand Reloading.

roar truth and your ( ,... Preparation Are 'Interviewed.St. Bounced probably fatal ffififi ( t
T. tc'&y/w
argument. ,0..J. thins' made a atateim! .nt, aying bl" /
Tx iK Mo.. Oct 0. .The remarkable They Always jet The
the last analytl ',ten 'are'kei > ", had asked the negro for J4.20 owcd Game
.
', by theirown mental sttttade.sense retolte that are being '..oeom.pU.hed tlni- Tne negro struck him first, and. lei

'. of being forgotten b, In St. Louie by L. T. Coop., was' on top of him beating hIm whey For Salo Everywhere.;

'''you love I I. next of kin to deed have become a topio of universal (Etereat be pulled his pistol and shot him

daring the. past week. Shelltnan, in hi* statement, says be Mme'I
of th ,
ad t, everything comet oat his cult to *tr
preceded
Report that bad been aent from the school to
.. .. .. .
has to dig for I II. ant
and somebody '
this oily told of Mr. Cooper gren look up com9 .children He was met ,,' I
people hate lot of fon play-. success In the Eut.. But the man .nd by Sims, who demanded that be, be< : ::aa-.r.ABr.XS: ; : ::]aaae. *1

,the gallerlea of their own sell. his medlelne. did .not attract. widespread paid 14,20 .due him. Shellman respond. 'can'

r, attention until the bcglnuin' ; lug' that be did not have the, money, H.F.DUTTON&CO'DEALERS .

It; empty carrls.e-'dro.e op'to Ihe of hit second week hero. Then the and that Otis Achxncre, auperlnSen '

ray. Harry Thaw and his friend interest. In him became very notice dent of the schools had told blm be Inc
had paid enough on tbe debt and ---- IN- ---
9I. able and has steadily gathered headway ,
until his. preparation are now be. ought not to pay any more. .ddn
those who make a olot
.ere' are ['Sea .Isla.ILd: COttOia
of I.n8 penal eod .to a* to keep log old In enormous quantltle am ,
if Jail, ." hi. headquarter I I. a mott Interesting" Wound Bruises and burns.

;, cfieerfol. There I I. no valle;, place to which to spend a balf.hour. By applying antiseptic' dreatlnf Sea Island Cotton Seed, Bagging and Twine. Wal At0

,, enter border are not louche* People are coming!: from all parts of to wound, brnitet. ,burnt and like Inlorle Leather in Strips or Sides. be''

lehill*_ the city to see him. The young m.n.. before Inflammation gets. lo,&lIef
and his aMiitant are surrounded b.warms ;' be healed without maturatlun and ntrJ
we'hunt 'EI my Manufacturers
pile the fate, our of the James Doig Improved Engli
from early uolU.I.t..ome
of humanity In about one-third the time required .
... does. Dettant'llko;men court. thr ; to tell what has been acenmpllthed by the old treatment. This I* the Sea Island Cotton Gin, and Supplies for S IIne. 18lux,

.t Illusion for them by the Cooper great discovery and triumph modern GAINESVILLE. FLORIDA U S

Phi* I is the age of I tngbbery--that I I. medicines} other to buy the reme .ur<
'',carp A tcxjlal period' of Imitation .nd die' *. on this same principle Jt la an "at

inolal unceitalnty. Perhaps nothing baa done more 10 antiseptic r.nd when applied to such G. S. MERCHANTS CO.

"Plant. the tree of ,learning In>you arouse this Interest than Mr. Cooper'. injuries causes them to heal very tar

>nth." said Lord CheaterOeld "am statement concerning Internal para. quickly. It sl.oallsys the pain and Retailer and Jobber In

,: will shade your old age" ., slits or tapeworm, a* they are commonly soreness and prevent any danger of hrxel

...Doe a man get his financial rating called Al, the eorameneemen blood poltonlng. Keep a battle of and Fancy Groceries
the way hi. wife dr.n.d ",u.. of hi. deli to this city he claimed Pain Balm In your home and ,It will Staple ,

ok I There Roes Jonet' wife I I" that these creature were: retponaibli ....Joo time sad money, not to mention

'i', history I I. but the :record of a few for mach of the III health of this gen. the Inconvenience and offerlnn rain, tartan. Seed. and. Fertilizers.

(masterful spirits working In the mid, oration | he claimed that a large per such Injuries entail. For4 tale by alldroggltta. .
SOUTH BIDE SQUARE. f t I OAJNE8VIJXE. FLOKID1
people. eentage. of alt chronic stomach trouble __
,pf a matt of Incompetent L
was canted by them | he stated thai Iilghe.t market price paid for Chicken Eggs and other Prvdoee.' t
4 Love men and they will love yon hit "New DUcovery" medicine would Crazy Motorman Terrified passenger

It* pertaatlon I* Itself even a*the vto this theory to be correct a* II New York Oct. C.-A ,atreet ;.car 1. Complete ttock of Hay Corn Oat, Flour, Bran Meal, Cotton Seed Ma
'tin voice the soul| of the matter.Some prove red filled with tenoned passengers; dashed and Rye. We handSc only the VERY BEST rood at the LOW. !
of these
hand
would remove tape.worm. across New York at full speed while EST 1>>PRICES and guarantee aatiafaetlon always
deluded bellevi
to
are .o a* before he left the city. the motorman Leo Schwartz suddenly -
;they have mattered a situation whet Tbeae statements. seem to have. beeteompletely 1
bereft of his reason, stood on tfce _. . .
-
---

,. In some4gnert.rs a man and hd. weeks hundred of people who bar and threatening to brain MANU AC'LRR3 AND Oa.IrwMUI '

family are not really peotable on have been taking the Cooper prepera.. any Wine who approached him. lie FLORID
ANO IMtrSelliA
', let they can Indulge In eontplououi Ion for tome form of ,trouble bate was finally subdued and tbe carbrought COMMON
) .
-I? : .
waste been relieved of one of theie parasite,. to a atop after a desperate WHITE SAN!
1 _
There I I. .an IrretUtlble faaolnatlon It In eon..qu..o.Oooper and hla the- struggle with half a dozen policemenand )

the life devoted to 'letter The "I'hj' cries have been growing Into greatei street railway employe' during PRESSED Uf .r f

of the literary genius I* paved with prominence each day which eeYeraX paa n tun\ped from ......... '
.
bone. Kw there are who tarn theli,' >lr. Cooper'* Statement.- a general the swiftly .rnovtngcar'csb'sustained Omccs: R Ie K .....- ..
the street indication painful lujur1e One of..the men who 8 ....... I
facet to the hill beyond the desert lassitude wa .
SLOG
fought the mad motqrman> waa,"Vtfrely AU Uf CHJACKSONVILLE."
It.Wordeworth of this trouble seems to be core ,
that ,.t live to cross ,* iii > , COMPANY
Injured. .. JFLA. awe
who have
brought a tremendous reel. Statement by people ------ J

fndlotment agalnt many then and had this eiptrieneci eeem to be very Julius cases Sell out Off r.wooucT i I

|,,...ow.who force their ehlld ren to d radn much alike, all saying that a feeling of \Vas a man of nerve, but sickness .._--- '

,.U'o\Jlh a weary life without the help extreme weariness and a! lien: of en- left. It* mark and he became aged be- .. .... ...-.- --- ,.._.- -- ---.... .... -.. -'" -_.- .._-- -_ .. --- .
'
I'it' ) Intellrotual advantage escape ray which they attribute to stomach lore' his' Vine.. Hlknt I* often caused -

herd among the lordly free trouble, bad afflicted them bj a torpid liver ilerblne will ""a.I. CL YDE LINE
this character which
statement of ,
The tame sun that harden the o'a' j A ate your liver and give you htalth.Mr .
I I.I almost Identical with all those given
'will.. soften' the ".E. The ..&ronom., *, Carrie Auttlo, llollon. Ifantairteat .;.
.ouah' h. had dieoov.red hew world by people who have\ had the tame ex "I eputlder II.rbne the beet

\,'satd It turned out to be an 'obttlocaloo pertfl"oI I is a* follow a medicine I ever heard of% I am r'vet a
at 401O fit, t
Mr. rreegel, living v
Sold ,Y. )f. Johnion.
on the lens Change your view-point). without It. by
street
Ferdinand who was relieved of
.... 'thlnK' will Uka on new and .
:.',": happier, faahlon A whole lot depend one of these parailte by the Cooper Steamer 'itrmudia AchereJ));; r "f| ;

preparation, when teen by a reporter, New York Oct. 6...The steamer
I'.
9*
.ald lerraudiao. from Dermuda, la a ashore
tvTbe young man who make every "t have been In poor health for all la llnttertullk\ channel New York har .
Mist of his lortu ..bulldln.
eonvcrge run-down
J.art. I wa In a genetal bor. '
::_.)u1s established an Ideal that will feed ondltlnn I attributed this to *tome -- .H O V :E SfluIX.USTC3SPETWKCX: :: E.A.Oa: :: WE- :
'-"""like a eanocr on the finer virtue. Burned Girtr
set trouble, a* I had a very 'Irregular A Hadty

There are thing that money canltbr appetite. and would have a bloating boy man or woman la quickly oat York
.. bay or ot...,*. It I* **I4 thai Jaolcsorwille and Ne"\.v ,
., .. chief Mal,.
I
lentatian. after n My of pain' If lloekle. Arnica ap e v
Oladatooe died poor because he wasflea trouble was that I felt tired. all the piled promptly G. J. Welch of Tekon Calling CHARLESTON. S. O., both way*.

busy tn make money.A time. Even la the morning after a ah, Vlich., aayti "I ot, U In rny lam.SI .

Mot Worthy Article night*sleep I would wake op feeling ly for 4U.'., tore and all skin Injuries The FtoMt St.*fflshlF la the Coastwise Serrlco
refreshed thaw when I went ** Qulckejt pile
ao more md find It perfect.
When an article has been on the to bed. I had dlaay spells and would are known Best healing.salve made, Clyde Now England and Southern Lines

i :ntarket for year and Klo friend ... spots before my eye' and th.lesstrxertino .beatall drogiritt BOSTON aN
It l*:>.,. to call this sued Fr frht S.rvlee Betwe JACKSONVILLE.
every year '
would tin'b1e. It was an f- -..--.--'. PROVIDENCE and All Eastern: Points
... Sueh !a 'Ballard'iHorehouod .
clue worthy 0.
a 'dative' and
rot to aire 4.tomr even Calllaff at Cha.J.et.oQ both wars.
", "up. It poaltlvely' curessuu&bs mind teemed dull.. .. my f' 5=1foothboTUjd'alLT-W2.-X SAr.r1"q'GS
and all pulmonary' d.. .,
; "My eyetlghlhae. :been getting poorer :
'One of aba beet known merchant laJkfoblle I ..From Lewie Wharf'1135104
lately- and I-.oiled that my menvry
t' Ala", *ayi **For flee year was .ul.* irooJ null xited to b*. Kotthboond..... ... From Fool of Catherine at...JM..O."U'-

_y family bas not been troubled with U[ I stood for any length of Um I
the winter' eough. W* owe ihl tq lower
would have a dolt palms In the.
:: ."".hI'. llorehound Uyrapt I knowIt pan of my back, and If I s..nd.d the. Clvde St. Johns River Line
n** sited my children, from many "
.>lairs t|_l Hly .r "t.r\ beat very ,rp and SAM.-O"
: ,Mk .pell*." Sold by W. 3d..Iobe.oaiWill .. a.t"W'.n JAOKUONVILLIC
t'' .", sly 8topOhtJ: at Palatta .....'cr. JI..rent. (IVLandl.and trte4tate 1..uI4.-
**I tried. every ort of preparation& ,
.
St. Johns River.RTEA31EK
Import Ki a"Uh Teecheem on
this dull feellnx,
loping to throw off&
New York, Oct.tey q.-tryst1us.
I I[ heard to much about this mss Coop.
the l Ka Uttt e+lutettoasltst wb "
... a owMui; .fci;
ttrU *4 In education to Amertr la Ion. I bought two bottle of New F I* apr.tote4 to ,aH'a* fallow Leave Jaekfxrarttt. S.a4af*. Ttteeda

151 4 eowiim. here at tae sad of lieeovery.[ I took only e. few 4oe of and Th .*. .'-...aOp m Keiorahag. leave Sanford yt.adays.

i' this month prefMtratory' to brie. iug ,He preparation sad a tapeworm left We4ae day* sad Frid.,..VtSO.. a. m.
,
.. ..- '. -- .. , ...._ _:::
abttn feet .. : ---:0 .. ,__ : :: :: ..
It fifty
UakTfcry sebouls wa "
.irr u xeaeaer* of R= .ny *'.01. .... .... fl-CJllaJULt:

w? start oomta* la batcia.s of engt*, a*. near a. I *o.Vi.....s... X.w : ,::;---I--.:;i. -N. '. .;.4.. r. Le*;:\.30" ... ...... . .......1..IIOIIn.... .. .. . Arrlte S tL7 a
18> or :O sous after h.1..* arrival. I; k.ew what hat been. U> matter with. .. . . . . .. .1.Ar1a.OI. 6.a3oam
.
. .
. _. t. ;..:::..r 4' 1'-- '.sb pna .. .. ...... ... .?'atatts. ., a
- .. all ...... year and I am .ore I lIiL.rLr.-4. rt'mU4. nae"tGrlca' : . .... .. . .. . . Astor ... .. ... .... .... ;:
Skk H.sdathe CurdLe .ill W all ri&kt aggala." wear T.bw.*.. a rwI' ... .... .. . .$"f.r4 fIHt.aa4) ...... ... .' .. I ..

back .....s.ct... I* esu.e by ct.a.... ,i n. wee..of theca wow p epara-I .--.........-.._....II'-.r- ,.." .--. V C ..- .....' .... \.I.\oIOalD . . ... . .. .. .. Sowloed .. . ... ... .-.... _..tl' -
.
at.rTe.
,raegt. of the toaeh sad by Iodl1v.l .. ,sloes a. $5. fools, 't..,.dM4 1..1' to -. TA.. _-.. n. =:t u..w... =, .. _. 1Qatxtsae.: ' ' : : : :-: =-:::: ; :: 'z.raor. O. r
I. .... OAatabetlala's tttomecA aM raeee .1.Ioaec" ,.....w..bat the_e4te :: ":. VV ..:; :::: :- ir. Al. r.Iiw: diD_ricri: r orirsc_ a ..ac.i T Br.r: !

Liter Tab .h .0",". t.e.. ........... .)!.. ....* to b* ......" .bl.r eocee.. ........e.r.w. L..r n.new.w ....weyw. 1. trnarveDwntttt.la ass.peso hs.w ls.. U W"'c.n.r+as+s s.tw..w+,m +,"..
.. .. ... .. txw'aOti,le f.LN Iwf.... w ttSTtlliL
4 effee .... By aak'< these r..| taeavteeef r* ta liat Mrir <. top w.t. Mt.Q
tsbtet..i as UC"G.a a.... flttt terdl.st4uw .t a..rtbr* t.i* t* tae. tact that jtk .... . cnrrxxa juuca. AXO TOOX.' 01a..aww .t.0. ..oEIITY: ,....6s.T- w=::- intl.i'ta .. rTLOa.M.4" "...YTUEO. --

.f ,. ct...... .. the attack; tsar a. tre.bl. .. ,...i realty re*.etilkte ei .. .............,,....-. o. IJIIIOi Ti.r' ..*iat aW General I1fa.a4'fCK..m . ..
b. .u4" .a,. r'.r..tir alt dro.. ,er many at.***.*.*, rte....*" ... amog t CIIt.M' y4.ai$wvaere., It F0..I-tsrt.fwaL. 3e. v.r.

',...u. .hem, -
:


.;.,

'_ iJ. h <' ."' '.hilttYllr----..:Mrllit11, s1 ___..." -". --'.:.. .._'__'- 'ff"J "



.
l '""II i .,.\5 .. I .

h', ; > 1Ji\"
." ,, :, '.' ." ",

) '.\,"'II"JI

.,. __ ..._._ . .... .... .. .. .
.-' "",.,, ,,""' _J.. .. _. -.- -._"..,'-.,y--of<.:...i."f-. ...,;........ __'-_...,....-.. .-. ".....,.'- . -'. .!._ .'. .. .-. ". .w...,- """ ".1..--. ..r....+.wr...........4'Y? - -- -.y4AI17 >I

,r THE SPEO'AL EUECTIOH HiGH SPRINGS HOTE3.Mr v''' r R.,O A'1Or tM ,+1''A dr' .rM"dHG
'I uao..rn--- ....
-
-- .e urrr.rS '
unt ... ' '; "
tC .. A Mesial election "wilt be held In thisefey"bext'Tnesdtty *. G.P. Webb end Family Removeto (

for thlt p", rpoe ofameoding DunaaHon.HJgh .

j L;, .. y et Oftlot; Ga LeertI.V1L.r the city charter eo a* '0permit I Sor "K*. get 6.-Mra 0.s'. S if You Area ilre, .; );.

fa.e.as.mNra.ll.r. the council to do away with Webb and familjfeuare leaving High

.:...... rtitl P.bll.ibet.a the publication of oi.)iaf ee*. The Springs for ItarljieJtfMn, where their ; __
_. B'"t. 1. that i* ittir r. N a. .J\Ah y Correctly .
." a Company .
have been
i people appealed to to vote
,. .. home will Their departure '
..Ct\Y R Ntor.iBtMMbK t re ev' I' Writtt-u W'h Liberality wf traytI a,.. th. Compact; .
rB"'IIp}'" for thi amendment on the ground of I "ued universal wgret in town. Mr*. ,. Fare Lutes. Promptly "

.'JrM'.'..#& Room. economy, but If the taxpayer consult Webb has been or pit In the Metho ,1C
f.. their interest they will. tote against I.,1st ehttreh and a fSauer in all church t4 '.W '

toFf'ICF.: 1'OAY"ll IHXVCX, the amendment and let the charter i..otk for the nine;.can* .**e has lived You Are :Assd

Sy.rcrl.5. !.. Taa.Krto.se3 S stand requiring th6 poblrcatian of ordinance :iaeret, and. hr chllflrMi" have grown up C

:J-, w.... '.-pgbliahcd ettr, --DCe ., a* this i* the only meshed Io be useful and popular. member of That no .erk>os loss eaa owlw. y,,, wititllt" you have some

iLkf" .dr1..e red fcy earlier in the city or"T by which the r..npl.f'an, keep posted.f oclely. The. Iota., of ..uela family reiuae.

.,...aII1 part of the putted State.postage relative to what the council doe In learn a vacancy hard tn flU "
.Jdl'. J-.** tnon tJia; *t.S three the of "*in law*. Tr f'he .
"' f'+ Q.e waka..atNetly toua way pa Mr*.' P. r. Woodland lIu1e-.nn. Paul .
.Io-II, ccan publication of ordinance* ha coat 000." have returned from l punnedio .h- e Fire' .Life Accident ami' Health Insurance. t'o '

iderable under the new charter dor* they have spent s| $fal wake delight ,
;;plus..in t.p>>l inn jo cental *Un* lag the peat year, a* I* alway tbe eaeunder fully. enjoying! ab ., u. bathing, Ashing ,
/ If '. and yeerlti f or eatii: additional similar elrcumtar. but thin and sailing ,Lif"j ) Noue but Reliable Companies.. Represeot.d.V .

Mrdt.ptar adverlWagmu/e k.ow.oil expense has already been Incurred Mr*. M. P Sommet. whO bAl. been

end the City Council ba spent more _"f'odlD'K. fw week.< in lampa, the

money doting the.pasfear"'in their gaestot h.rprandtather.Dr. Mathers. ..A l.VL C rt P y.: : Nt ..A N ,
fvlot ,Weefc It'a.ad cll'h page, f oety. efforts: t.. do away with the publl .. has returned much'lmproved in health.
t. JlUbtl.l.bedry oody andi.d Ion of ordinance than the Information cheerfully furnlalied. CJAtNE ,"ILI.1t. FLORIDA '
coaUto all the new of the publica- Drs William '*\\.illiam. of Jasper to ,
1. State .nd s 'iMrmI, and will be lan would have cost for the next pent a. week herev, doing some floe is '
't.utc: free to a..TI"or, tee V tte4. 5 ear. dental wnrkMr ..'", 1.sv..r..aa...... a aarv.l.s...'. '

,,11.(aDada..or11..')"eILMd adrmnce. There .i* not a ,city: the sire of *. \V. T. Knight Af Savannah Uhe ..- . .- -- -- -- --,.- .- .-- --.

due after ftratadvertisement. Gainesville in the 81.-of Florida in of relative here, Mr. and
bill become guest
,tocrt1liD1r :8. ff1.:: 1ToRD.A.N:: 3
GI u.kes otherwise which the ordinance are not required Mrs. P. P. Wood. ?

04 I i III contract. Parttea not known to u* to be published for ., least four B. U Piper of Jaokeonvllle has .,nncloded >

sired 10 pay for edvettlaiog in ad- week, and i itfthe people desire to be a *ucce..fol chores of High
,edreas, TUB DAILY RUN Informed fhe 'legislation enactedby '
C.txsavtuPar. .Jo 8pror) and placed'the Student Ref INSURANCEPORTER

the council! they will vote againstthe rea.ctt1. ;Work in many home' ..

MOCRATIC NOMINEES. amendment. The,9pider.web party given, by the
Following i* the form. of ticket to ladles| of the Metbedist church last BLOCK OA'INESVILLC. FLORIDA, t

*ctr of Couirree M Congressional be yot..,.. Be sure to place an &-mark week. was a .oect'.*. otb socially andIhianeUl (

District: where It appear below t I' 4
.
.
,
.
CLARK of Co1embls.Jwitlee
JUNK : Vote for one Repent Mia*"fj'' Action. Fire. Life and Accident :en; ::i e';.D.d ;.'"
of the Supreme QottrUUS.
FOR of ordinance
* approval a* proposed
New'ork.. vxt +6-r-A Ixmdon special -
B.PABKHILL,of Eaeambl amending Section 10 of Ihcoh.r'.r ". '
UE5IL WUtTFlKLP.of Leon. protlaloos'if mall city requiring ors M.Dhf'"U.u'obul.' of tae

ConnuUsJooeri printing or publishing of Uartlck Ikfater. who when he prosdueed SOUTHS IfR A i LW; Y _
Railroad
for
of LeT ordinance a* may be determined' The Morala'of: Marcua" earlyIn
PLITCH.
A.
wTON
,
BPPSON Dade. bv City Council Bentemti..r. practically' xcUidtit! the
L.lut.of
dramatic crl\tc front the theater. baa : tf.-Tb.lounwtat tlebed.le. Oruro. are I'..HI cote .I t.ror..I rbeN. and sre act coarse.wo .

.for State Attorney.*tb Circuit: AOA158T approval amending of Section ordinance 10 n'X asproio.ed repented. He nowwrite.' to the *n1 ..-.-.'.."_.-- .- ....- .. ----. .. ---- ,. '. .. ... .'_''--.--.-".-..--. . . .

J. M. RIVERS. the, eharterprorisiona of aid city'! tor* of the Lxmdun paper and humbly: i 1reltallLalaAl.a till' ..0.aJ woatw AND tn.rt _H0.f ,.

,Mr State Senator lid District; ''" requiring' printing. publishing entreat to allow custom notice of w- ";-W.----:; : : : .. .---R": : ltftal\ tear ," ........" ...:-:-:.Rua Mf' tstie ti
H. H.MOCREAUY.f !: : ordtnanre a. may be determinedby the play to AppeAr-Jn their column Lr esaup.' . .. .. . ..,..... tel' It :;lIlle) CV1..v t v 4awkmarltt. ...' ..._...,. ... Mu, te.tll"C'.t ;.
) Council. .... ... ......Sa141 OtiIttlsAt Ar ......... .f... ..}
City this
lie ho Uoe In justice to tbe +eannad. t
t S
*
ar* .. .. ... . ... .eiltvljffl
.
.
Venter Houe of Representative: C&tbta . .... ... o. T sat CieAr Ar tttahta .,. '
autbor of thekIlay and. the h.raet.nca.t ebatbnte..-..-.. ... ..... .I ..l r IOsft.. Sale Ar 11_.... ... . .. ... ,.. ..;, ..oUr', .* '
SYD L. CARTER. I . .. .. .. ... ... . . '
"...Dwe.. ... ... .. .rs1. t.f toMa LlpArUeatine Ar llsitua. .. .1JI.ol) a pea
I Ar
T. A. POKE' A small 1 anras boy was once calledin therein. ..., ...... . 1 Bd4a. tAr / Ar CbaU.aoo.I. .......... .. . ._o. Nth 1 .eta
"' ._ tit. ,.,.I..It..w.. . .....,....... . .'" t as.,..
. .
.
...
CountY: view hi born brother --------------- a a 11pAr
to haby -- .
X A* ea onf new ,M-1e1lC"\ c\1 J..11 .. .. r .
f I.n.o!! : _' .qt My.t.
.. COLSON.Per looked'It with dVatlfaetlon.and ( I.et.barll..t. ..... ...ho, $y 1 a ItpAr ".... ... '
vr > II .
f r ? over ( ...,ao-w..,.:.. .... ..$o. tw ."- e Itt) .I..a\l.. 3il, s.ILAA: ""'
finally asked"Mamma, where did A r oe.h1sittoa.... .. ... .. ..1100. h "tC16 9..... i'L!'btealln: .. fug.blur, t cola
< Countr Tax Collector Stomach Ar ......atn.: ..... .. . ....... )to r.- II lsrfl MI' L cte.tnce ....... .. ..+' a'a. s.i ItlllpJ. i
k W. a DICKINSON this thing come from?" ",AD angel Sour Ar West i'NladeklS..I', ... $" C.b44'*.... .. .r. .4tTi. ,.. t SJH"r.ii.ii.. i tr.aa ,
Per Treasurer brought. it,Jlmmle." .Wax yon awake Ir Nmw .. It.It... .l""j' L.lYrriaaaI:: ; ; ... .... .... -'' *. cest.Ae .
Covntr :
.Ct\)!. fCJ ... .. .,.oJ.. .I xnelaral IIse ".11"
B. B. PEELER when he came?" "Certainly. Jlmmle.0Well. ::::.;= ...:.Sal 4,.f..t....t liko a.C.a..r..1, tI-: I 'l'h1lMoCtlN ",... t.A_ o. 'I"...y.. ..axesMo (:: .*. .*" .. ...,.... . "ti.nriix:: 4t. '
rorMnlbe-'Sbool; then mamma, all that I havegot I..,.. 1age Se.p.a..- 1 .... S.. ......r.s.. A t Tulau. . .... .... . . .iii,>mr' a so*
Hoards !IM*i:4 .Sb..ene. ..t'l. . ,.;;.;;;. . ... ., .. :. : : tat hula Ity **'......s... .. . . "1,.,, "'rear,i geAIP
.
H. II. DROOKEO.J. to la that are dead ..*,. to* ?. UMI ...
yon tea
icy ,.... ,C--_ I+aeae.aak Ina. ItT tt .
u. .et4..u.. w C1n Uni "tAt M1a.r Cit ;
F. rUTCU.B .ij .. __ (Coinna . . .......... .. . "'o..er e,... i .. . . 'i' ) ,
( Ar )
oTneh .I Me
i I'd like to ee an old angel' pot ( y;-:..-.X. rrir > iNMTjIS t .. . .. ., .... .. ,Mah Sly l kp .(Mev !'*4 .:.:.:. :,:.;. .. ,,: ass R
: 'r Aah..ttU. .. ... .. . ..,..
U. WEEKS. . .
U ; :&\:1i__Cbaak... . I.v r..ftI.tMt.! Mo tly "
But I reckon "
on Mo.
O.
a looking thing me. Ar Het Nelaes.N.... .... .:.. : ..;.;. : Ko.; : Ara..o-'U.. ......... ..... .. ....ttea, tty 11'i.
.* For County ConmiKaionerMJ I we are *tuck unless I kin work Johnny Ar ArKeosvUJe.l.'"o b.vtu.........<..... ... ..... *._.n:1:1 tf4f"" |....U.; . _...,:.:..: .. '::.:.:.-. *'" "1 ,....
0. DAMF1EH.r trade It for Cell fax'Th. Ar H* loxoJ... ........" .., ...-.K... AP A".'....." ..... . . ... ...It... lay !.,!.*. i
pAtrujj. Green to lght>unteo one fMwels, .. r \e....... ; of his spotted pup." j,I AC ..t>tH4 .......;. .. ... .s era ...t.. ,
J r TOWNSENIXW Iir 14re... Ct..r . ... ., .. ... ,. .'r.tl""" .*!t ,
J. MATTOEVVS.C u, Excellent iXnlog Car to,flew ou AH .a.pat.. ...... .. . ..........,.._... i*."a" '
; C. PRDIUCK.R4 To this age of trusts the nw'p per Through Train. I Hot .">Tl...,. ...... .. ,alai s i
iANtre tA71MRitaFleeced. .. ....
man ha not been forgotten, and owe - -- ------ --
: be Nne*- "NewsYew awl r:.wWn Ka' ..wesa," Datir Peliwaa teensy M i...MI rUep4n 13sibr. .
some people U appear to late the type founder irott. There . T..." .... _.......tn.lo H.. \..k.
to>> eat almost any kind ofwntrd be doubt a* to its exitence Nw. ter W eeaertn sae .,.,"' ..........." Vapr" t'naw.a DrswtmY boors I..p&\.Use.
no
can Jack.....aa. to New Yorfc. IMaltut Cri .
food.so long a* U hasn't with the present price of printer material .. 1" ........., MssS.,.....0... I -u. **..Pe'VP *-.11.*. Iwawiptf M.ttet IhtffetJW Sa.Mrtf Car ..et...a Juthusttile. Uet4Nt q'
& . .
What ,, C" ...... ..1w 1.. Pe.1 fIoeHi ....tw. A..m.. Ile l.Vtto.e. haoa,. mad Caetiiasue ,
WIely exposed. they eeoa w.e. !
all priced alike In the dUr.r.a'e..Iolo" .r.o beta !a. _.,_ ..:.... ._... .I i I .'lfIVMtA* t *M> .4t4-.U.l'| I.nOd VysuuadTvdm.' 'fhrtwskhat C..t'..eaasdh'1Dwasrlrariam
'''Moil it to bar the neighbor and all dicoant. 41 pale_........w.... _T se.sect t.wl lIonrn MWpiae (*.re. jA M avle! *o AU..... Ok.|........ mall t ,..... .".., _Alma'
cot on at"U* R...4v C*., CM.**ee H.V set i ,...._.. $ieettnm tar ". uP ,. t.ott.w... it........ .l..S. rib......... "' ......... ......
rkat they are eating U under coming from the different houses lathe NttUM MKS c'l, __ _. ..._____ _. __ . .. A .. '. _._,. .. ._ _
ANNUAL SALE TEN !
same form and at the arne time. ... .
JAft PItWl3.IAlt.11kiII.IPmIer *f' .1 4We tl1f<> Hi, JsekttSe.na.'
Tbe publisher have been qvlety\ enduring -----. -.._.-,- .. ----.. .-- - ---' -- R. It M AKDWICK. T. '1'. ... w. II. T> VLOaS. O.a.. A. HTJOK.. >>klno,,". A, > Ct. |V A. i

Ca td States although thecnt the extortion of th. foonder ,. . .. _. .. .... .._. .. .... ..
type -- -- ---- ---' ------- ---- ------- -- -- - -- -- -
among n.'loae. mantifaaeU for year, and It I la time we had
..,. Rond.. ) more tnerehan* CHINClaxative

uses! more produce employ I our Inning--.-:..-._-. Llvr OAK paw a OUlf MIIIIOAD coB .

abc,.
Rive
pay more, wtRet, To bring op a child! In the way he

Mafortt to lie peopfe and has should go, trtl th;t way yourself. Fruit .r h '(fitle Effective April 90, '.
Syrup ? _
.
_ .__
Sappy and prosperous home Stories first heard at a mother' ,knee .. :::::::::;;.;. '

ufnalon aD ..srtb.Irotrest are never wholly forgotten little take t .. I i ,.eta. Q )(ELI )4G. i1 )II.. 4
9twO. .nt to
Cur
,...o.tTf.a.ur e.1 1 .T 'I10Ha DaVy eAr a awtilalr'Cualitty '-fl. .e
spring that never dries np on our F
laxative Doca' .. i... .Sen S. .
The new .... ,. .. It.h
of oil lee U measured by thtougit.corohioi year The -- -- -- .r..nwr..w. aw- r -- -w. -
journey A M IM i PM I'M A M AM
slue ep;rit 01 their Inbabltaota.cweon sooner you yet a child to be a law onto not gripe or naufteaffcu Leese': Ls e l..i: i ,i.e A rtr. Anise Acrtrmat. '
? ,. [ t amf swAr .... .. IJe OXHe .... .. 10 eye I t+ uLe e 4Us
r loterent I* in the sues himself, the sooner you make a man of Cures stomach and liver '
*
Are tae lArise r. M.. .),s. rfe, f Lw I. w 't. f I* lr ) e> ,
I ).3r iodlrtdoal .. iwa.s ? 1 Are Ar m Art *
bovine faay him. Children need model more than and chronic : ,
:
troubles ; : :
cons as 1 sAeej S S .. MA'...*.,ts>* .. 1.e. *e .e: iu k
an*, far 'bem..h.. hot theyteLl criticism. We can never cheek what that .. UrasM Ara.. .t.. ,. ..re,..., .,..e5r. Mete. t t.t "
toceeMfnl cities any more Is In the young unless we cherish what tipatton action by restoring AIM ",...tt. at Ar a to ..,.. !I'.tt'! !'I1,' a..a... 1 # wl "f f lei.Xv t!.M.,It.!.t'.
.tI:!:. : f 1&0... ean furnish *u*. I. Rood la them. natural of the Momsi O.. ..e.j.|*.i made *t tO0e4. Pars( f** so .r.i*. ...r. 'f"w Use"s a *s4 Terry. atrf atl
'N ch liver and bowel Atiaa. ."'< Marc j..eu.nj f.- $.,0.. /..t... s4 art k.........tt* I.M.%*
growing plant 1.. ............ a. tr aeet.oim ..... e4tee ..... '.Nee lit cad 1St 0.tetal Piasa.......
been named one Fer Hate .y J. H. XtOMaHt A Ce ..-. "' erL t...eels It Mee l.h.O.a.
.
I l J. W.White ha a .., li uNaM{ 1-4)1.. .......meiJwIMalfn'{ )to"1lUUi tieees.il'e......vASeaa.
frord; ha retired from the of the commissioner to the Tampa ---- '& ., .

**It: :Ir The A1a hua Post and F.lr.V...,. Is a hustler, sod Doval DAY CURE" .. -, q .-- ---.. .-- . ----.. -._ -..> ... ,..-.-.-.- ... .. .. -.q.- ,........... :
Ra
'I.eCJfd .a a rood writer, well If he I I. to h.*. his .*,. He eta do PILESPATENTS tern ...
.. 4- ,
4 .... veto national and State more In the exhibit I line with a little ..... -.. --.-..
__ .. .
.
.s:1 caade: The lew an layers money than most any mss in .'1.Sa.te. rW"4t.. ....-eee4ea..ea. a -+.. I Fay-Sholes "
.---- .
ilIp.r ..
Mr. lleckard promlees'h _.__ .-- : *-. _--..*----n...., e.Ca
t .
Poet up to the peat ----

.IOO Rewards IOO.

.5 of The reader of this paper will be ,... tGM . Typewriter r
"'I, blksa liamfltea pleased to learn that there i* at least er a..s, a C Lu<. e.a..a.w. .r .0..e 11 rAC

; ar' tvomlaated a legisfatltei 9.e dreaded disease that M i*\*ee fc** ..n.a.0}. aN y e.. .a S n.. .a ySwsM F.Mr..e.
. )II1t10. to ibe Demoeratle betoabie to ear .e all |'. *.**..*. .... .. trefiuaceet z* on m V' .. .'tllrl.liitD: ...

.. s e waa when Ilamllto that I* ...." ... Slat)'. CUe nit Otrre s.uf'1 Lao t .e.0.44.sa..1SwiPrrtea.awe, lI' Tilt: It r,1':
"
:, elf of TBdepeBdeatom.b ..... now aa..- to se++w r wcan. I
I. the wttly peeltire IIi Ii C .lA(1113E ...5 THE MJKKKTHan
:T paa..d. and them the Impiety ,,...,.<
a, .... will look Itkrwfcen tag a . U -a UnlYKSAL[ KrTIJA() D ( .-T'OiTEr
.
4.4t. .t"'P.. _tae tlU t are I tank."Core'.u.-.I i* taken treat*fatraliy.***!. flail eating. 0. : ryof 1ncbina. ;t

-- dtr...a, .>t
It...") e4ttere; heart tad t. \ ...rt.... ., tho .,...... ,....*'" 4... i tj.bt.et bw1111 t.ight.s. a..",... T1.Cbautgker .

v -Tare* '''ow|'it eke d..4 .- .snylat c!.. 5e.sdstbw ".f ...4......,. 'a'talr.re .
e e a et tf
:. t ee.dt .U rmee 111 tee-II ... ...... tll.w pteet .c.-u. by IlyPiwt Wrtjere IK* W.."" b

1. t: .e*. of the wrsekaaisr. ......... e. ............. sad nee a rsaAaoa.ee.$00 err e. a4 afi tiR &** the /'sy511twsl.r.. More+ ,.,.)'twr": )o a.
astecO ...... 5a doing 1M .awk. TJMo. .. = ;/ w4
Iit.i. -. *-.4.. eats "..... evaev*!**,* acre .* mob fifth to if. Nave I* 1'k'Ibee.tJ" lean a.y ether ... .*.
1IJ.4t dau.sge ..... bat ee vaMee rower* tJl.i they otfvr Ow cleave*r/teA+i.t..ael O..eeiar tsslseVsl*.

ci t ..,.. .# ,lie Deep Water M4re4 I***Ur. few ae, e**+ clot Itfaltetoeor sow.a..rl wry aS..4 li wex w.rel. awl ..errMts.. ella..t r
b.1 :. a 4 UM .la.k so IWe4 %** Wt efeial ....teal.. waer.eote+., !.n. For Sale by. . .
A.44.... ,
---... by ...... we ..... *. r.3 Qscararr .. Ca."., ?.,."... a.Rakd .
debt tbst a greeter a.d l's d r.-... fk. GA-SNOW THE SUM Gtiimille FH.

ally ..W.... ..peer T.1I..w.. faactty Tdia fee 4 ..eutM .. ,
-
,be a .t-osc J'wseatl.ls.tt1 ... ....a 1l





,
,', ,. .. . .
, . .
_fi ; ..... .... .(,



"
,



},1 .. y'S.a ',..I t ;.r .,M f ., !. \ ,' b ..




i :: \ .. THE DAILY vSUN: (AINESVILLK, FLORIDA OCTOBER '7 906 7

,. ....... .. grt
--------4., J .... --.-- ._ ._ __. . .'h ---- -:=-_ _
-- I! 7' _
1
13 G: H2TT6: QRx EJ S. ':'

[QOIt OF S E..A.. :E3'i Q Et'

,
T. B. ELLIS, JR.,
THE OT ELH LOS ,::;.. -t' -' rI
OF THE PAST.nt" 1'r' :. Air Line Railway
*
ATTOEN EY-AT-LAW.
.. ,
... AetoAi Hay* n.*n Maw !p

J. .h. CJr..' 1Tr.. ; '.,....*. C'hara.eria.tloR .ff GAIlftav1LLa. FIX>BID. , .

..i-4,..>... !>.. .. ' '., ., .

"l" Jn. ROUT: O. BOWERS: Savannah Columbia Camden !
'atruck by the number of gigot Souther
Othello,
rho have attempted uud

}n It. Tho really, *ueer*ful v DENTIST.. ":-':. .. Pines Raleigh, Richmond, Was j

., are a very Miaall and'select Office In Miller Law Ezehiisjre. ,..
'
}r. Hurbogc, one aimunie j was '. Baltimore
: I
Y .'*f' .. .. : ; Fngton, PhiladelphiaVNew -
tool Moor, and waa probably
& .j'I.aDla. ,I d
Pen
Graduate University of
In it aa lu any other! :part b. '' '
"' ' I
'* '' .' j" York
I' .4 ..t ';&- '.+'* .

'et in Mr Pepya* Diary trrferenceH TESTING METHODS DR. Da VERB. B. MORRIS/. };;,\, . .. .

to the play. On Oct. ,. .
A teat .a to the ram of 1HnIf''' ,," "
; be tell ua bo went with )Ir. . '.1iENTISTM: : i .
advertising over other Ld '
and Mr. to oe "Tha' paper : Two Trains
Creed 4 a Elegant Daily.
method was made n year ago -r /.1.- I
}1t. Venire'as It was alwtoy
by the greet pabllablnc' hooae of
I then. It "warn well done. Hurt EIU' I'L Phone 'Da'S
O0e over Marcus P- ; Seaboard
Harper ft Ilroa. Two book were Express.
'rtbQ Moor fly tbe name token arty .
elected, oue by a Well known .
: : I
: lady that sty me caned popular author and the other by 3 pa A. OARLIS'LE., \, !AATTORNEY '
.' *eo Drademona smothered"S "t '" #: : Seaboard
? an unknown writer. The Utterwaa AT LAW,. .: Mail.
yc'nra' later on hebit. 1COH be .j I
selected for the
,;, "To tho king playboune, and newspaperadrertlalns And Solicitor in Equity, .
and the other for the '\
\' (n an upper box die'n..* .. '
Usual cbannela. Rea Estate, Ootveyaneing l and General -
fit ''Iller. but ill act xl In moatMoliun.

: which did a little aur Wish ..... ..p.......r the attended Practice.to. OlHce All business next door prompt to Bui) MODERN PULLMAN
\ Ire' not acting: Injro'a part by I ...... adeertl..d .. ... ofttae. GAH1ts11LLt.'FLORIDA EQUIPMEN'Only

//ft o well aa dun ued to do; nor ............ e.tstttpped'th..tt..e \ .
!. .ale. ha .
HT,llari'a, 'ublUi wnH Cn..I<<,)'... nor hOO.90..ople.r ;'ERDINAND BAYER
Hurt doing tbe Moora *o well '
ATTORNEY AT LAW Line
t >oitce thou&ht' did." Uut )tr. Tbe result war a rot plet. aor- Operating

'YII WMM In a bad temper that utjvtbt, pile aud "tabllab 4 the fact O...laaavu.Ls, FLOJUnAo., .
............ Pullman from Jacksonville
bla carrl/iKo hndbroken down on that readers RO to the new paper .. Daily Through Sleepers! to New Orleio

'.;way home and. be was ."nilffhtlly for h.torm.Uon.Itb regardto Can veil you. city property, (Improved '

zed i' or" wretch) books a. well aa with regardto and unimproved), phosphate, !

i ttertonM, Othello would appear toYo moat other matter*.-NationalrrtnterJoarnaUat. ruoklng t and farming laud. Bead hima For full.information and sleeper reservation can on any agent Seabotrdofl

been a remarkable tierformanco ..Un of what you offer foraale. 3142n write S. O. BOYLSTON, Ja., A.iaitant General Passenger Agent I
e writer unenka of >Uio terrible force A I
JACKSONVILLE FLORIDA.
,
.
bill Othello. and Addlwni'sage: Tlteuderfill w.E.. BAKER. .. .
nirony which be appeared In Tb. bt .d".rU.."., m.dtwa '
bm be examined,. the clrcuinNtanco of for mar ttirchDl I* the local ATTORNEY-AT-LAW
p."r which co** Into tbs ,.. Take The Atlantic Coast LineFOR
I. handkerchief tbe part of Othello home of taM p.opl-. 1e UU .
he mix t unt of J lore that intruded upon paper do... . SOLICITOR ,IN IJANO nV... .

f. mind aunts; tbe Innocent anaweraed ',. "

> <|iuona m..k't"II. betrayed In his gee .rnVVY TYTTT.TT T..Y"YTye GAINESVILLE, Alaehaa '-Co.$;} FL.t, ALL EARTHLY POINTS

are tub a variety' and vlciaaltude of .
--- - Office In Ended Block.
---- ---- ------- - ---
ivaloiwi' B* would adnionlMb a man toe Via vuD
like mUcbleVoua. boy whlpplntr blur** DOocs '. I l>O&l
afraid of his own heart I N West
?
.East.South
It wa* In the portunrnl Street theniter There bare 'teen other Othelloa since 1 orth. or :: s Jaek'K.e

", aonietlme,' atyled the I>ukea thea.t but few o'f renown.' Tb!!fe was Clnatanif i JR. J. II. .ALDERMAN stiJe Mo.tror.rt
Ilrooke. who appeared In the part .
( _r, that Itetterton playeil. but we have
:. unfortunately but little record of 111.Bflp4'.ranC'tt at the Olympk In 1H4H. Charles Kenu.nt Rapid Transit and TJnsurpassejl Service
the lrhlC"In IH..1, Hnlrlnl, who DENTIST
in the part nor do vie ...'.. In L Time Table In effect July 29, 1806.
know how he was dressed for It. The played It first at the Qur
,. ont'flO.." In 1811; Phelps Mayetl It at
? for the part appear to modern tate V: .
.I' lulls tiiilleroui In his "Autoblocra-. the Irlneeit i. at Cott.t Garden. at ,... 8: OpmQ ,.., Sigh Springs and Int.r- 7xlaa
;t': pby" Iteynold tulle n* h* rememltereil:' Kadter. AVelJn and elsewhere Hlr Hcnnr Dally z t. U 1 medtale Points Da J z SoD
4 ....Ioe Hprntisor harry play Othello Irt'l' Irvine fiat. ptayixl ttw port In 187O T- GORDON D. TISOK. / ,

a full suit of Bold laced scarlet a small i and aubiteqtiently altetAatM Othello JCNTIsT\; : 100 p m \ Ocala. w..burg and Tampa. .n4. 2 66 p-
cocktnl hat, knee breech* and fink nail laen with l:.twln Itootb: and more Daily 'Intermediate. Points. Lail;
.
;
_
recently. For be* tobertou' and Hubert <> t
'J, atocklnit' Onrter. 8.00pm Jacksonville' 12.40pm
C3 a trick was but a poor<< Othello ex- One la Miner Lw.tczokaagel' ,
.copt In tho aeenewhere sago flrat lml >" There have, of course. been burlesqueOtb.los Dally North, East and West :__ lJ.uL

l iantf the atiftplckm of I>e Ml.,mona, stud but In three ('ntaH at leant the O.U..ILL" rw. UOOam. Hgb! Springs. Waycross. Savannah Bronlek, 8 10pm

vitaln w.-. very little IIUI'M'rlor. Hut burle.<]u.t was quite unintentional.Othello Daily Albany; Atlanta. .n Points North East Weal $I i asiy J
_
,f.lflnitk did at any rate. adopt MoorCfwtnme was chosen for the n..t appeikrance -

t\tkh\ a atartllnx Innovation.Sed wf Hamoel, 1'oote at tb.i 11i ymarket ItlNTINdlUCTICALLT (aiUpm 10.Cdamr
t., h'C'b' one writer to say that he In J';H. The future droll ami inluile . RobeUe, Ueanop and Citra I
.1 wa" tinmennlnitly, tire**'**!. On the ttr'tnUht I woe abort ant stoat with a round, J/ V.I 1 .....,_ i Dally
:. Quln war In the pit and when flat face, and ,bin acting of tho 3trr.rto ..., ...... -
Oarrlek entenil ptHalmetl in alliittton fix Inspn of Mrtrtilln most bare ben HEPAREU and / 12140 It m 2.66pm

t 1N> Hocartir' black lyi -Here' font very funny, lint n centurf later. at tbe J Daily I P.ta\ka U.III

.|" >y. by -. ? Where'a the tatllP and tame theater $ thPMJ. it lrundlenrTtaus. ItOL'EKLY .. .. ,
, tote took(.t1le1" played OtTiello I'll Ilttckwtouwaa J
" Jobn I'hUU Kemble also did much tot Iav\v which must bare l>een vr,u REME>TEIIKODUt'ES Interchangeable Mileage Tlckcta, good over 18,000 miles of among the prU-

>,'"frnprore the public Idea on the fltneas riM re NiniMltix., Obarle Mathews, liartt.'yw.'or elpal railway in the Southern State, are on ale by the principal \*.
*jf. vMftum In the theater. Thekrlel ruff IIIrk uf an, inrHr -1tC' ala Through Pullman sleeper Port Tampa to New York via Atlantis Cost
'. cost breeches naldteont. black attempted Othtttt once, but uti." ou,tiOrl ROHPERITT. Line i also via Atlantie Coast Line and Southern Railway

'fee, white full bottomed wig and -'ew '"w u* T1 an....iktnucrat For complete Infoctnation. call on
".three cocked hat which tradition pre- -- ..N J. A. GOODWIN. Ticket Agent. QaloovllU.'

. .$.r1'n-.1 far Othello despite Onrrlek'atmdeavur Add reu t
"ocJabt.-. ware awept nvov FRANK 3. BOYL8TON. PI.. r... Alt. W. D. 8TARKTraT. PM. *r:.
" ,after Kerabln'ii' time lie himself' CASTORIAFor WE CAN HELP YOU 188 W. Bay *,., Astor BnIIdIDI.JaektonTIU.l'a.W. .
O,
J. PaMener Trams I.o..er. Wllminglonlt.
',' ftlnyed hen tune) etter. than Othello. : I&TintB and Cblldnw. CRAIG
R EPA HE, T. u. WHITE, General Passenger Agent .
.'' aa 4 Ilyron said of the performanceftat The Kind You Hare Always' tough! . ---- ---.... - .. -. .,
:'' 'It wa perfection.Another P ItOUUCE aa4UESEST

,,. Qeorftt; fVeilrrlek' very excellent Otoke: I'laylng Iso was Ute Dean the 4:zzfu IT. GainesYille & Gulf Railway Company

,...,.' oe,e nltht' nt York he was loudly tlignattrar.of ,, .
klu4'i1 by two or threemen In the an- -
dten.s wise tried out "\Vhat a vll.
1al lnr'* 5 It war n compliment he miwb, ap.e/'f Melilak ('eIae.hla.It THE SUN. Gainesville, Fr,. THE FRUIT & VEGETABLE ROUTEOF

".appreciated.Cumin, Ntiurntt caiu to IlrUUh Columbia: '''" .. _______,__ .. ., _....___ ___ ___ J
........ athdher aa.1"I.y., FLORIDA.
to r.d.annt' Kean, we ft ml b4t would .sa.'
'' Ibis actor<< plavlna Othellm and lags on The .|n.rt. of the fwr*, t and stream ONE PENNY .
alternate ittrht*. Dr. I>o>ran says of are triumphant there. )t<%.... elk carlUnt Tiine Table In effect,Joly 1ft. 1900.

, Ke..na Ot'"',.... MIn the fiercer *ce.,e. tuoonialn icoata. anti step. War. win Nri w rue a xws ....... .-ty....
. he waa "' \It".b and In the are..itF1blr --lIT....,.. t>n.wn ami hwt-k--nMMUttam ....... Ctta..r..loC.cae .. ... --- r.s.5Otr d.e.wta. .. n.

.l a* tune who rvmeutbera him louts& or rwutrarti. and ilwr of .*rerlklrnla oboese is t\. !x..a No.. 8. :No. .. No. 1PM to.2. .-'0. 4 ."' 0. ,t
" WilU I think' 1. peeparexl' tt. allow that rnuin in .on>....-.. b'iwl.*n. for.. a I DaU,..'ft. BTAT1ON8..r I Daily. j D.1I. n" FRt

lt4 ever h'd or i. Kkely to haw an 1 sport almost anywlien and In ample Young's Female College Ex 8gSunDally r''

4"\na' )fl'.. laeu Wrm 'aaUIP odttnaL"a .)....ntlU..a for rulhk.M ftUQKhter to I .. : .
tar.4a'vx "wU4l C"Otuf"r'.W. ..... nutty |4ee*. so that NUor**!, whether : Tlieaaaavllle (2*. "
( lain,' ,'* *. ITtitlltt t tiu hint 1 pothunter or *i.ur......., .* the modern I ... L.. ;t.T A M tv P MBCO 1r.A yIAePJtt Aa
x. tt ub.'nttf 14u Haye,,,,t Othello HW are tlrawt wvnht *un lyworthy X11,1aatlafytng I .In......,'..tyryt.ra.n..... twee*lltt.e air c... fi..taa.s..t'--asr Ito > i.120 ... ... rnp*'ra Cty......l TOO |T I* 1}3 1'w t
I tta.1e aad 1taalr aa _. wlis.er., 1 304O: 112 8 S3f .. .... 64$ TM
.Graham..
: jrf .
k1M i ; at" T Rna It U 4 been ar* .a.-tt..uwut swl troPhieS . \ .
. ........ t.
........ .
.Isngvl srat' tbejr 'I&bM1' alternate the i I e-f Ida fame ami kltl l'm.Ugaum : Ltt\.s fish. it*......._""." -1lr:: t..ramrAwl 1 :s i' 49B ......- Cyril.......... S sa'e a.
t.k"'I"t, *1,1 after 1. oast tu'rtatTanr.Ec . .reaa tbrMi tKHst tMrtmntry I / 'tt taA 1'01-' .- :. c.seise.sa : 00 4* f: U ... . .. .. a.1 tny.... ..... 6 JO t .,-,
. to, | rt..w stICA'r n6UJ'nAlf taliIN 2 30 10 CO lit. CMIO . . . ElNtherpe.. .. .. . & 13C )6 M ; 1
', ..... .
'ati t!r 'rrrd t. .# JaflIe 1.tttssf east the bUrre tmir am e *> r1.17Jatcn A.e, r. A..
*
I IM
> 2 2 1O . . C L, CfOMIDI( : . S JeC6
:xI L,- re: t._ soli." two ..", i' St'htt' ty 0IK<.1 to few boar itlWMltoat, A..tM I. ('UClIIU'E )4E3T t're.li't. 2 ] o :1SA OIL.e Ik r 7

.Ui4t ., ., was l'Mta 1'\......r HI IN-I e+ bask. \ValtiMK. the ...*.t1IU of astdlne. .-. .. t .. . I. . ... I ...::._( sStaewtlL.......1 I _,.., . '. '
-- :
j1 -- - --- --- -- .
" :"" LAh' t- ,.,.tt eit+.t abet tt..I.t ti.. .. I wtnikl and an abwOt ot tie., 18 .1.. . . . S A. L.C.lc:. . . _. . .. .
". 'k"' '" n .. .. .,'.a ......, I ha'e to'kkp 'ircrateahlallvw man's" r'- '..*......- a. The Florida t 2t)LYI' .f t. .. .. Lever Ssrlteh . . . -. c
:17' ',,,W ", +p i..... w *4( l ".,. .,... the toke s .el ...... ** !.*.. with th* 4 :sa . f Canacin'e croesag. . . . . t d .
K... t I..t i ' ...An.e4q ..... .f.3" e..t ..... IM1t bwekl'.ad ltirwiua.. t 453 . . ... .. Rocky Vo4nt....... . . ,. t
red. kt3' *> *% : t ace i. ...l141.etk. ... Fruit and Truck Grower tloS I , . !. .. ..'WacaJboota.*.. ..., A 1.1
.'.uta I? *'.wit <" .+... to .... Kline .tlerd. 10iOArlOUAr, ::: .. .. .Ctyatt.. .... . t 6
> l. A 1L. J. DKCXDTc C4iUra.4rrvr, al . \.lthkW'OOlS.. ,..... .: . . - 4 <<
w
., <
1 vent t, ) .ort't ,4lV. 'Mfwit H
1. ai . ,
.,1trleit' ,'tD'" 1 ': raw. M "I'tiM.. +thw.rpt. Thla l. t. eertlff laat ell dNq'-U OC.La. J'1..A.. a fp ', -. . .-.... )K Tacoma.-......_. a .p.. .y
Mtsp ,', +.e4trtk.. R.srti" -n..a 1** at* at'ori* d i* reused 'oar..r a IT k! :r..wt a .. ... '. L
,... ,p hrettt. tf4wl t* l-aaiq the If rwfa hooey aad Tar fails to e'erttwr bee Ter . .__ ._...n. il.OO a .0. _.__ ' ..
. .. .*... . 1.eI
..4. fell ,... bileSna" 1'1.. > a... 1111eassaa.-.r.F-
"It a 'If' and '" ea ...&K or *OW. It.a ,* lb.eo.t j -..
... .. sad) t-.. ... .. . . .. . ..
Af;: ea !Sidi. m.+enltst' "I aw lu tii& .h. b.... lb. bag's *ad pvewate .l J' .f. blttlratae..4 I tl
. : ,
I alA .
. .
,
. .
t.ie .
ft '
:." to bus. ..,gets. .e..ii. thaw a ee J.. Vexes Istdpp. AkanJmaaary_ 111_',.... . ; nT "C ra.raleat lu lall att .. ewtb. a todU ".... ... gniea- ........ tnepeetaUy. to u.. ...'"".... or ; r. .1-Dnae .". ::I
1elw, I a tescj tatttol i h'w to the
"" t talk-it attepech....rta ... a4 ............ Csaabas ass terse b aad "plaWe browsers 1t x . ..lratxtetml... . . I''r jTY
..... -.4 3larnwkhh be ; u tits i 111, Ar .r II L A Le1! >4 +
, ) >" tt.Jd wt lot. p.t-tetmanc. : _...4'. 'TN.R.asIa. Is Ia YsU.ere1 II A ****_trial -.'atMherfyttan eta
: ....+ftrcusg b+.. {\I..f. was. D. a great ........ aabttt4teet. J U'ZtiIafs I --.tbn will IMM ...t ems .>.....- y1 .t 2an.aet Xt'y
, t.QMII "iJtta &254 :bash 1a lap : c.",. +la. ......... .r.. ,Tra A

:0:'" ,2' ;"" ". ,. !D'11'-' 1.f-.d,,,"::( .,--j-; '[71 .:-.... ... -', '-\ ,f>........ ..,'.;;",.'....,, i:r.... _.4_. .iiiii-' -.iI.',.., f -' ...,..



I +/ fl I 1 fill y' I ry 1 I 1 t + j t {





't THE DAILY SUN: GAINESVILLE, JTLORIDA, OCTOBER 9

.-.-------.-.--, .,'.__._ ...4 ._ ____._ __. __ .. ._____--,. -" -- .. -- ..-.--..- .'" ...-.. -...--- -'j \:
-- .
w ;) If.

t of Emigrant SteamerCharterhouse I Vrr.U1&N": '\
W,.c; "g Russet) Ce-taktly Named For New VIA LOU .
WHY TAKECALOMEL' Court. But Other Places In Doubt- .' r \lir

s: ,". OCt. 6.-Purthor de All. ')! e. OC*. <. -Juilju" KiB. S hetrd :.,' V ?D11.. ,y &
I
,:,'u received Of the Wrecki ., ..p\11\ '
br Hit!+ >' i 1.* atlll l-l! .':.,* I" the rare ; '
\ steamer Chart hout.o'. When M <> lev" 's Lemon Ii .
7 ff
for t'" : tree Jw4 ent,> I i'.tot-s.: 4"Ub I.
"
Ii." .. .\ I'en HolVnr and Hang l.hxir .t purely \-egetahlf a.w con it of appeal. .,'(',or.t114C to 'The Louisville A Nasavlite ; ,

."- ro..ad red off Hainan compound, with a picas the ..tn. \\.d: alllil.UdallI return Fteel' I wit.-Melt round-trip rates ttVttjhB h: r.
with the" U 'j'
of
HO, )bs I
sSated.
deg '" ant t.t"'tc-, will relieve \ ou ( ,1 ri .ul .1& ...U4.'e. [ to point shown on da 1. '
The North '
r r :i tvea. t.er- of Bihouvnt and The brlilrr.'n Po"II.. Halt and I
e -, all ru. ;%rej>ortionately I low es \
$II' .:' net KohsiQibnnK to the Charterii picivcntMRJifcg ) kindred! dirt without Pepl.,. fur rMI| to. ntitfOr pin! :M'a la wi i other point*. )/,, j

griping; or nausea and still 100, do.l gqi lIaa"" bu> "lUDR'" I -

IIII'I < were Chief Engineer lc J. c no bad effects. of the rtskult .MMTttuin lUll.' ...t'.... tLt'1: $3J Dallas.Tex: aor! return:
i :!he crew and two women r' I October 6t h t
,.,,N w.c1t. : eta told ai
;?ff a at all Store
Drug 4WW-n4't' 0 y a few huuUrwlbeiween I of sale
.
:. I ,,1 aad Last evening. Oct. is Hctcdth Use
'
o.=,a ese last three The a 00
t i,-9 on the raft descried rII0zLEY'S'LEMON popular vote f"hr reported for the : 1..' 2,80--Butialo.( N. Y.. and

}. horiaen. On observing ELIXIR. four leading f fiiujttajtea\ Is aa follows. BALLARD:5HOREHOUND i Tickets sold Otober IOU

I"g'a bull there was great "f'It and lth. Final return
IW ''Ox* Rosa Cc>>fvurcn." / .
UioaoeU .2fU'Gpuwelll
; the party become fran- ." leaving Buffalo October|

. at the .'-pros ect of !' . .19.311. 1006.
: ; :I .1MU>C SYRUP
.
..... 'ir maddening thirst and '
'1060-New Orleans. La, and
..Hunger.. Captain Ro- . ..IS.SZOOnly h4'alth. trp
-- will have
And you i Tickets tale October J j
( n
.f t ,I' Kohslcbang rescued the between the second treat care should be tak\m ot '

r; i.. J udlns a little boy. They and ft >.w and with severalcountlf one health and Bananl'stt.reh0un4 I 16th. Incliulve. Final t*

'a.':::;- collapsed from exhaustion + s still (o henr front, title differ. Syrup 'will cure limit October 80th liy 11

.' -c a.'d ted on board the Kohslt 17IMby once t* eastly&ubject to change Mot COUOHS. COLDS, CROUP. I lung ticket with" Special ANew

t;r 5 unable to walk. Doa until tnt> complee) offlctal returns are lIRONCtimS AND ALL Orleans, and paylni I.f.

: :a doctor's unremitting atten- to will It 'known who la the personnel PULMONARY DISBASBS.Mr. 50 cents, an extension of ret

the boy died an hour after beings of the new court. .. J II- McNeil, SaU:'' limit can be secured until,
.
I ...- d Chief IntheerDowse t I LAke City. Utah. writ**. .ur I .vember 00th 1006. ;
and I
bt. :a removed to a boaptt J. Tbe Don't Be Imposed Upon. am thank eighty Jlorhound sears old Hyrup; for $17,6*-Memphis, Te/tm.. and 'set

of ho Kohslchang- gave unbound I cured tno of xjowgha Tickets sold October 10th, 1
Foley & Co:. Chicago, originated' having .
j.t. sn to the survivors.Among j [ colds.nd other like.dlseasem.' 17th and Sfith Final rat
v-iose who 'went down with Honey and Tar as a throat and long .,'
ClxAT"bouse and were drowned r 1J remedy, and on'acoount of the great, I I Throe Slzea 25c. 80C and l.OO I limit" October SOlh. By dej

Captain Nellfton. Chief Officer merit and popularity of Foley'. Honey ; I lUna ticket. with Hpeclnl Ag ,.

uleon. Second Officer Origor and and Tar many Imitations are offered Ballard Snow Liniment Co. : Memphis, and paying fee of,,

[toe1 ra Forbes and Maurmann. be Tor the genuine These worthless luil ST. LOUIS, MO., 4 cents, all extension of retttl'

ba s.''fp'fl doctor and GO others tatlons have similar sounding names. limit" can be secured until 4

aa. Beware of them The genuine Foley's vember Both 1006 \).
'
Danger from the Plague.nr's . Honey and Tar Is In a yellow package. Sold and Recommended by flOOa- --ChlosKo( 1II, and r.hlt'

Auk for It and refuse any substitute.It Tickets ousale daily to 8cj '
grave danger frqtn the Is the beet remedy for and \\ M.Jtltbt/3. .1.111. ..
coughs 30tb
limited
1'1..1 ember ; and to v* J
and cold that
are .
tofooaghs ._.._._
colds. J. W. McCollum .V Do. -- ---------- ------- --- --
::; turn ontil October 81st, 1006,
take Dr. A,
rstenl 1 unless you King'sDiseovery ._ I
I .. I ".... .
.. for Consumption tftT.OO-Denver, Colorado Bprlnga. a'r.I
i Macon Hack Driver. Shot. "..001' Mrw. Wllklua! tb. Is so youngl,
Kbi and Cold. Mrs. O o. Wallirf'orritCity. Macon. ta.; Oct. tl.-t--U itb a shot and her wedded lift* has been such. a I PusbloCilland return. Tlok

[ Me., writes "It's a W. H. TAa r. hole through his right Jung Hump bitter. Ulapi oluttueutr* I clean sale dally until *8eptetn,-,

iieod to people living In climate Provisional Governor of Cuba.Doctors Hell a driver, wAs found dead in his "'ta whet vr.y*** I I>.ra0th. anal return limit to(/

re toughs and colds prevail. I fled hank on Plum' :and Third streets. N.. "Rl e married that wealthy old Wll.., October 81st, 1006. .

quickly ends them. It prevent A Young Mother at 70. trace of his slayer was found and It kin "nt...r the 1..10" thnt htt had M,4O-llot Springs, Ark., and return.:rt:
.
heart _ll" ..<\ anti the dootnr ."1'. be'a
affionla, cores lagrlppe glvet "My mother bas suddenly been made baa not been I"det.mlut'd. a* to who erfectly' well.-. Milwaukee Sentinel. Ticket' ou saw dally.. Final

|mderfal relief In asthma .and hay young at 10. Twenty years of Intense Bred the shot, The hack moved on return ,limit 00 days from dat. y.

r, ted makes weak Inngs strong uffertng from d".p'a' had entirely' do"n'tb. street and a string of blood Blood Poisoning; or sale. ifii :''

..ugh to ward off consumption disabled her, until six months ago revealed that::after the negro was results fritrn Dally to September ?_8>Hh rooud

111I and eold.: COo and 100. when she began taking Klcctrla Bitters killed his horse was started.AnAvtful Is quickly chronic' cured by 00.&lJ1.&lonblth Dr. King'sNew trip summer tourist tickets will ''

femnieed" by all druggists. Trill which have completely cured her and Kir rill. They remove all be. on sale, to various resorts, Foil ,
''
tails free restored and Cough Cured. Information schedules time tables
the strength activity she poisonous' germs from the and ,
had In the prime of life," writes Mrs. 'Two years ago our llttl girl had a tufu e new $life/, and ..hel""|system cure sour ato, will b*> furnished promptlyon

Insanity On the Increase.Kew W. L. Oilpanrlek of Dsnf\rth, Me.Ireatest touch of pneumonia which left her J+ ttomaeh nausla, headache dlailnets application
J Torte Oct. a.The delightful restorative medicine on the with an awful eoogh. She had spalls, and eol... with.i"t griping' or ._ast of The World Gone fnrt. via Pass, I A N II $
Mad" Is of coughing' jast like one with the fie Ciuaraittwed. by all drug Agent. It..No. 118
globe. Sets stomach, liver and kid. a
IWd ej to us by 1>r. .'orb.Vln.lo.. glass W. hay W t.Jaokcnvtlle.hJt.

,laps a wklSun dl.patch to the Time eels right, purifies the blood, and hooping would cough end some thought she _._- ---_...- -,--- ___:_.-_._______...;__ ..........."..;;-;;,; ---c=..-_.__ 1:'
not get well at all. We got ,
cares malaria. billioune and weak. a
Aor din: to the statistical flffures
.... Wonderful bottle of Chamberlain's, Conch Item
Trice
h. tonic.
nerve .
a ass: v says the doctor in aaft Florida East Coast
:*, :w eau be shown that bete 60o. Guaranteed by all druggists, sly which acted like a obarm. Kb* .Railway
i
q i I..re will be actually morntau. stopped coughing and got stout and Local The> Card No. 17. 14i Effect S.hr K IN.
i writes )h.. Or. ,
.i .a )he world than Mine peov Negro Fair at Jackson." fat. Mustard, IJru- .
.* ,>"' > n'nj' problem of the day Jackson Ca., Oct .-The nejrro i baker 111. This remedy Is for ate by aotmtllOUNt>-ltRAO' DOWN. NOTHOOtAeD..RNA6 uP.

fair' here Is an assured i all I... .. .... .
> )Ow U ." event this Increase of la success, commencing druggists._ S trtTIOliL It a M.. M \

M:' 1 \\ tat la the use of wasting Oct. 2M9. at Jackson Sew Russell. -.be'l-..! -.0.1"'..._, r.+........o o.... .. .e' .Mr ,. ss11y.fG.a11r..r ,.
flee a,1:., '''nty on aa educational oral hundred cxhtbttora" have already I HojkMns Weds UtI.... a .Iit'Ata ............ g ....J..*..."I.l.t'/ P TY C7e .
W, entered. the various cantata. 'I'b.Dixie I..k-.k.n. N Y .. tk'j, R.: --Rtis..n Y ml.W '0..... .. .................. *ea ..................... Op.' a .....i r I ;"
a WoO have before us this &\)0iar a.t.u $1 1'.... .............. lia.t .._.. .i : S:
', , band of Atlanta will furnish Hopkins of A'' anta. ia.. e n.| MlseVera .en tr-! ." ..w ... ... .IL.e I si.5AC..r. . .. e9..ei .!
J .
<- the contemplation of . :.;:a:: :.:. . r. ...art.l Dra. aUaY
x Ia :o worM to deal music fSaitnecit speakers from various Klrgrlst of New York were mar. 'r.M lTitr, *1"::"........-.. .. .P... cicibs, ............r..e .f r ti- ...,11&..
wlthT pane of tbe state will be rted on the ya< tn ITno Thursday while '.. !'_ ... ... I. .::. :..:....: ...... ... ...... .... --I . _

. and speak The tfoulbern present Hallway the 7..lIt was anchored. off 1..kUl.It ...ee.pa....:..;; .. A ........_.: ."';',............ ..... ..1I n l...... ........................L... ...N..ar.v.. 'JS aM'-
: -.4.
Napoleon DonaparteSkewed has Is said the marriage was + +;; .. : .I.u........ ..... .u, !' "" .r J' ,, '" t::
given reduced rates from various runawayaffair ttt M "ial M .... "'71 a t........... ......t .. w
.! at the battle of Ansterlits points. CIreat credit Is due to the parent of Mlsa Rlegrlst ... ....... ..............,.......|......,..............n..*.,.. ........ .anew
.
...... . ..
1emrul } i un . .of .MM u.. .............. .... Y..M
.. ." the greatest leader In thee Rev C. C. ?.al. who by his wise jecCag on atatount of her youth, she ... 1 .sIns JJ .... ..... ......... Rsjtoe.--------....,.k... 5.d.... t srsm
....- .... ... ............. ...
wW, being but 17 of .. /e .t/east. ........... rt""
and modest yearn ag
Ballard's Snow hat the .
Liniment plaas. Ia".pta. fair .
Ar .. :
,. t':!"".._ :.t..u..w.t.: trl, '.W A: .: '" .. .. a ...
Sees the. public U' Is the best liar on a permanent basis and bas sueceeded - I 1ra- ". .,* ||*.*H,.". ..........r.U I.tIrJ =,..._ "tH 1 !.. {

[ .rttfa the world. quick cure for In securing the cooperation Nothing 10 Fear a. Lain A1..4..T! .IWf14'd.4'.y ................. .1" .... a n
N
_
flhmailim.! sprains, barns, cots, ...0.1lC tit the wblte' cttlseaa.SKCKKTABT Mothers nerd have nd hesitancy |In.oallnuisg .. ut' .."1 "i3 r;.... :..... .1 .'fRA..i/. :: i: a iiltr.\eti.us ai .......

Put, Radessa. La. "I .,. 5 .....h4ie.", .._. ". y ... ....(ht;" 4ft,.... 1. ..rn.ice.k .
to .1 a .
saysi giveOn amber la la's -- n I fL !t.IU. .*)! ltiflnvana ; ./; ,, J
lit &il:srd's $now Liniment la mfi Said He Would Not Live.IVi Cough Remedy lo their little ones, at ......- "......u/Tsr..i.' . N..: ,..;r.. .!..w-.f........:..:... -vn-r.; .. -.-..,.M t' ,
t/ ... .. .
'-1 i .! tp.r 4 .,. ......... . . ... .
f and Had U anezselled for sore .r 'r,. Woodruff. Pa. writes"After It coal ales ab*.Intelf nothing Ih''''. ,a -"tIiti- : r-:. .:. :::::; ...:...,'ff'4-. ; :'::.;:.....: .:':;:.I;is . :: 1 Ive.Y.5j55 ... '

*... kesdtche t'orD.-la fact for anf doctoring for two years with lous. This remedy .. not oely' "r'"'. .. ......... ... ." ... ... ....'..."... .' .ess. .., ... .... ,N lj1wc.. ..-.hF \!(,
.. .
. . ... .
* ., . ..,. ... .
', .
t t: .t ean be reached by a llnl. the best physicians In Wayaesbnrg. ly afe to give email .bIIGh..., but Is amedicine If. -.tr : .l . . i-"if+, q i I. .-
t ' I
-
an' : cm 1 ;.;; ;;:;:. ;;::.: : : ::.:::::: = : .: ::
bald W. M. Johnson.tc of .. i
by worth ;
and still getting worse, the doctors advised great and ..ril.. It s ............... ,. .. .... .. :
bas world wide I Me.. rr .. ... ............. ."., .. ., .,.- ,,
me If I had any business to attend a reputation' for lie .. ... .. eN $ ...... iear's .
. a .\ .. ....... .. t
4' .
! =wa Consumption Cotton.u to, I had better attend to .It at carve .f coogh. oMs and creep and .,.... ..'..-l: !..... ....If .. ... . .. .. ........ II
O. C. Th always be relied >> ..... I" ..... ... "
>.r tefMed a bulletin ....w.IC once, as by all drufglsts.KHIsd : tt:: :I : :.: :.::::::r.. ,... .......... 4r.Mtr4 )/
.. ...
there .
another month as was no cure .a. t ...... ..
{ .. C .. 1J . ....... .. .. .tl,... c
an'Ky"t cotton! taken for -- -- - :: 1. r . .. . ... . .. N.NW.. Au .
forms. Fole Kidney Cure was recommend . 'f'ns ",
** nj .......fq-l........ sad TM>. Prlsenera.Warsaw i : ::: h:::::;: .N t ...,.r. =:= t'

r- .' unsvaaed. dwrMX the year rd aft me by a friend sad I !!. .**. ''')f..d. Oct f.- hisss..,. :1 .. ; ...; ., ,. .w w .. :.......::,'." aeuss. a '

I. lasjU,. to .have beeo Immediately sent my oa so the stare A mttUary petrol wnlcti W.. v>n4illac ,( .. = : :::: :::. .:.r.tw.:. .w. ,......, ..... .. rtI.: i.
far (it.'and after lailttg three bolt We t two : ........ ,. .. .. =
" S "-, .kav.eg the amo *t rrvo utltaU la<< Jail fewa ... M.. ..... .. ......-..... t
.u..n. ar"+tal .......... ..... 1 rsss
sad coatlneed
r n.apufaetureta to be 111"11I began to gel better, to au.rk"4 b- revolutionist who etcteeapiinQ" I- t .+. .... F .. ...,. (
..1111 entirely. well" J tile. 1:1t.: .. ........ .... 'J..H.C .. ...e.ur". aaMtae 'try9Hr
was .
improve :1.s ajeeewe ? mete I. A eaelady. ..... ,'''' ..... ..... .... . ... ...." .... .,...
I Yot. 1t+ )leO Ilu.. ...A Co.Gee. . .. n. ar't4irs srerasdiy" ..itI e..4 w........,---4----. ......."..'.. \ .., J .. ea. ....r.................... .....'......rl..i.....t.. ,'.A a.e, ..,........._.."..r.. Jt": '

i/n versai I Penny P"b .. -- both prtoer... .. .
... ;. . .4.K .
k' '>rc 5.-Tlt. l.t niatl.iMtlof ." WIUMfrawetto Frees. "Me. _- -- ......its..............rrrr a.ipif Cs l.... ;tiay.l1.i14 phe.

", '. ebamWr of eommeeces, s4 Tern. 0cYC.E.. Ifffers na.erd ay ",...j..ftt. "
-
tt w.. "... voir4 aJlftOet nnsa* SM el )Its. If***** (Ha. sad ,'s"a.it4agtois, Ott C..f'H." .... ,!;i n..e : % : r lrfroet: Nt/USgft, ]N; 11 tie

::: .a eater of 'universal "aayHCAO 'l'kIe pr.rtd.t 01 Ih Totaa uwlmw.altars. dent nwat...... (Asarleel. 1ftt.rb .., I, !1

.,/. ..... w.sw4aw. a* IJs. "r.Argaat..d .> set Ysriwat. .. .. ... . .
.. st Ireeat .. ...r. sawn .... .
.1It. n
R ........ t4a ., ....,.. . .., ? eStrt U h/.Yr1 a
geaMWsr r attorwsy .eersZ to w 1..1-. i- f It '... ; .
u .
g # # ,
aittker .. e s1...t" '
t'?
-' - . aatt ,1N 4tl w .. .... .,. M
..___ of lexas. Dr AMs .XIer .. 'fa. II. '
F ax wr < t. ro e.r
rJt an..n.c: .t C.lmhla a.earl 4egappeal. r a -.111...+. ... .. t.. I 1 /11IM
Y'DUR a ..
UNCovEncrx: of Co CMpmtte i 0..'rLlNifu3. tf ,FrpNn;,..1M.... .........,'"". ". . .J4.,..aw q.a ..r....... i.tft4.,1" _._4M."... a 4
+.lla M "
( ltvaaa s.s isg his p4on.+ .. the tlek ......... ""Ly M'1+1Y6a ., ......'Ytr,. s-. vt ?+

.... ..u..f m N e.... .,1 less ........ 5. n.r........... itaagiu N.-u qtrty ....... ..-. ---". . .. .. -ftI'StUI-. ---..An0, .... .., 6CCr1rM.-, ..: - ..Slu... ] JUr. ClfiMiCt1tM AT %LUSL ?
et T.sa4r' ... ergaakt4 la pe7teaaog C_ c......... lto4a at .-u..& wtt_ .. -- -
..... ......,. of ..
DAN.aar .... r. a t-4----1
0. .
G4 .
'b the aaattio4o. f* U* re.al*. ttes.ih The frf.*t HudicKt.. Ctue, -I ant Key W t'

to- assly w.as .be wear tt..aeye lieu .vgu. ist test+ sad *. smak* "'1\17 ___ :'

ar ... .>N tta.e elves awa1a wW thirtyMake ... MJ1Ja4tleti NA.1MS.fIM'
%, .- eat s heavy ..ua>a ..rIe Brorao-Papsin H"ate 'lYr.l.r,...e......alta...-.......,..,, .iteAr.a gr.e "..Y A... ,"ja.e........._..i.-
. .. mate.. eg ..... ...... m.wa. K.-.>r We-e.. Preery. ..t 1Y:1s .....--.... .yet... .i wow..... .,..a. ;(!l.." weae; .._*......_._ ,.I .
.......... -u. 4aar.gteteat.e . y--..,.. . .- wY.to ., ..f.V".t' .......1..l............ .j..
.'
.". rA.1.4II1wo.I
law .
regular ,. .. .
asatter .
.... .. .... .. Xe w..a. ave *... .... ff er4" .JVfi. .... A .1'.1. .
er..a4 .n !r '
.-. t+aw t.ch .. air ttteat.... k.r ,........ sasf W. ... fc-s .*...d.r.4 ; . fl.linga h.lwren l47 Wail.. Ilarttaa.tw .,.

, .,. ...... K k a"ltayiatieti to G..L 0tl.. 1 1 tu. '" -rot ..., ---.,e .......... i tMr.w Gv .
4t.r .
tie sYers evaeeltr. If.Y"III" . .
j fli r ', e ,,.. . . J' .........-t.,...lt "
.. sa. .... tJloNoe ...,... welt !Ala.... Peeps bjru. ode dlge NesJ.a.t Jen'lfI SI :!::! else, .., a'tr t. :r'w+ larls..eitl.ge, fi!iI'

i ............,. hats M absS.a.rf :-.a M11.w. t1l111-,4 ...". .. Tralas fot4e.g... Wresttiwrtf 4ef,b"'p-a 1sgds r
...t.-we
........ W a Rass.ae .less ste ....e sad bM rt... Ott tIN 4p. e1.M.rMer.. ; !J. fP1 "<_ ,nor ar....rMp4, __........; rA.x.the'r.aNYtta..1eei. .,., : : H. TreoMrul : '
Mal awa tea* If .sirdaa4ult( .............. (
eM a aaelMSSi r' \ 10 ELirtt .Iit1Ia w.swe
.-. : On. t.i.w.e' ytai Sjr1y et.ea vas,;aW1 Iuzl- a e.s s..owlk..rswassa.eo,41 .. j
.
.leas ielw" ,.. :;.;: ;:4taia .
1Ir, at.lasav.. lrolaNMr.. ... ... 1 .* a.*****. .* .".. .b4. 'w Mali. Mal ;. A2 lM'wart m &Aa Ita ee...4-* -- ..... .. ._. '' -i"-J_ _, ::"aV.Ce71r 2
.. ax j '
,., ... ... .... .. .., .4
." N on.c. ........-. t.J.. l..mosabt afb. w ..... Iff the lr4C.4LTZMU. CAMD-Sr Wls flifer.reif+
kttetN 4rf e'_ and r. ..m* Ir .,..... tutjqA .*. w. liet'>LLJf a. 13rwrstWIar I! TJ.CKET .. awt

,( 4. _.#,,.,r A r., ... !tpt.t4at Jt'.'+K..I ..... '. ... J. M.& da. rc-; .- a Ili M..1:'.... ..... iWo iUeewtipti 7o, ; . D. RA11.KRR.At 0.1 ........ Act.AOENT.. ST. AUOUSTIN. ,


tt .



,..., .















''''

i
;.r ; r2
~en,
r


SoutU


ic& by thwI
biay Artompo
i TheMrI

Sotw

'r.d
r, II a n dj


to t".
us boe
,ll as b~
M, r
PoDr4 By lbs!
(JAfy that -

0.1ter, .o
0 lue k W,
0 dppe
pice,' but
qp. whicb
wOt actlus
oIl an
16.u wb


:" *i~rnd, Wash-
'Phila.

Yor Ybk,
r :.f' ~;~P;S*:74L







-L F:AT LA$K



. .. .

rA
T" Lim'f~f~ ~
4 L ULMT
Al us
Afik UMr LM,


borne, 1
to'sr oil
on a rom
6eIlo." mu
m irony,


zoml DonPoa
wa s- hse Jask',1t
thMt b WpMANOWLDEMJ
D35?)Sr. i~tjl ispia dt ui tlnsurraame
Mo. A' At- h Lbe Now


Thie Tawa *,Jel 31.IM.
harr,9q friaI eM& 1Lw-; nhkm 6 MTV" Ar Irive F
71,
dd C~~ftoo N U [il)

____ 4~~S4IS jDail

V0 "01,1 NW o ~uu slo..w"e D~ m~ail
F_ 0Sm 3I9smpV"ss
Is t s 7.F- -w u If Ais="A# &MMO5aswe. $:10op

w" lDal
wb~mmet a-- 3AftCLL61_
kte k'a rkbactingmatt bN earA
t Cqtul r Iw. go a t~ulater.t the Des
1917 fth ilf )tui7 IOI, t fiN I ? stsokslb
V" 011M tbave loon f irmn 1 e
tik abs lid msk1 *Uo It u JP pIT3. luw U1Otn


*A AWN ax", wq qi4&'!Matbow& s1 WNW
"bb~fi. onlygu.em
.801P A I POOabonrrtba r~~i)t&'Zr




I A Ag umH is
V. L.

-at vs.S.SU Lies.




0 fopwot e u* f~ff a NSP-7VWUALU ROUTS
i "Now NO&,.OFPLWIDLa

J*. to *"o f we wma*m ft wea l km, e"*.EW 'ft h Rr A M
p ft Gn ~ ww o* w a awalS gt a sIbsbWi. %MM WU MI- i-IA
P Md b The SM14. Wimft, bmwe Md bY -k-4wwAPM "MLM 9 4 w,
wbe numow bft bak or cwov% *#A dw of weed 4 Alt L ft L xb.








he mkW a dm A eat kmw isga eotwww *1MS 5.3
bad w to llb to h as lowLUom Iyob Md touIONPI wUoof

obIM wsqut t -tswrtbst -
It~s Plard odmft. on ftus boe aws.wo w go 0i f ..
10 1': i

uffuto To* esmw.ad 0 wowMw an..*'
4~CM tuft Wr.41100* so ftow of 04- r, o











or:im 'rok V'""ad Fu s Tru.r Grow

IM P a G o a
I1Y **.,* **191rrr P Iu~ ~~ia~j l









's Imt he or T" a" "too. A0 ,00 o"4 4 .9*b...,SO#U*
-~
WOO^ W Plar. &A bp L Islam 00 rft I, ImtPw4r u~~e rru~
IMMM b# fqkuo to Tb b to 1 an OPINO
10,4wPwmo 11MI&OI 19tI#
094 6MU6 on" no*##* weal am ut 1^ a %000 sewn*%"Ef~fi~~ eSI
r~rrw rrb, + w aaoow moo w 80L3 tg'i"~"rarj~1 rj
Own ow W 4,6-00 **"q" *W&~ruilw, d 0I~
i~l~ ru, rr ~kor i"M now am aIl~k C~-P
(lrodtr, eakrt~o O 1LIIIII) II. .Ik I ~A 'L~3nPI ~ r #*W '"A
Loo aat 31M bb Mk~ror--LY1 !cb 11~~ t~t kt


N A db


1,


A7~-


Mixturec
mind4 ul
64mona 1
such a


6 Xt











t, -:i4.


k5h


I-l


Deal


RlOAD


rd met I megalar

;i.G. OhkSC. 0. Ped
F. Psullngj~ . T Iown-

tnled ho order
ssA h40,l N' ews$
and sliiP
were Pawd aS OiAg : S. f.
elerk 001 g,~sW.
al~t Udt~4i-,~3is Mee
Iff gurd mom~jiYoc
jaflior$ Beallera Bel
a Como a#b#6 Plorlda,
ompma3Vh 0 it. Wien.
p. ta.,*Q*J l. S 115b.r,
poor rarmi;U *. Diskim

obrt11ff Sowerpet, om smi
32 S; Ohyr 'Set 'Osinsevlle
P0.25I; D. G. Imsvde. Seam ti
$1.50; 5.8Sa GItoei 0a..
poor farms LIt I. Me
framiug ciwflplsmae P;1 B
II work m r boom, $- I 480
erchauta 0. soap to jail,
A. H. MoOKS#11sbliebin orno
rewiltd, ew.g W li work on
072.71 -, S.5. ILWise esord.
,I vertinlee b neels of 1906,
L. W. Feuusafto Oslagprison.
Fee" Insoftml S .e: E.
er, $2.761 A. A. Utlomer.
0. H. OrCrIa, M02,i L. J.
I",M; J. W."Mogsan, W90;
wel, $8.701 1C.T. Reddemes,
J. D. Siford, "*
ordeed tbSa 91.OV0 be
and paid im tSe beak to the
C C. PCdu- *to pay -for"A&
road epousQ for the month
P.
Om be apprprased for getting
i. tfor the 84% Fair.
reward of 0 Ib- offered for
s, and sumlvlss of Will
who nrde his wife.8o the
of sptevbg, =10W.
upi t&e baud oijorured uon
oe al isoraleps S elock.

Wed"Mas, Os. .
rj of Coca"y Oemmialmlou
day pwa ano to Ie sdraMon

n. C.. **doL F. I. Paul.

'ti prd ftSheo h appoitat
'rer-etaf alorft$ of the


'0" ILO Bow U s d Wil-
%1 'e bpp- sumpiledwith
"'nh be a piall i

*hvr5. &A Ye wtskle.
'-V (7. fNom 1i. .?. awi,
X S. I, W.L sams. W. A.
P- 0 ,.A. .Wood.C. 0.
h5VtU5 SPIW~ wIh the
m'6of twe low. SSA to
P-' nit to am 6pmo lW
t-r''am, 01 ~-- ks
'I, d dL 2memSvm
P:k o "Af tbe appemisi

jp' i m -4" wsham

* h e~C- ~nd she are
S
k.~l (C I~
Ii WsSEW.E.3l. YI~i.
km. 1 ~ ~ I ~ W
's.* mesi. as


9 t. g~


NAME,
4t* -o f


E o r ..111011011110 11 ts r a

Wpubad .to4bddh$
hot ofm afoa
h', ho
hh tt Sh a e e# dlteow m1
**IUE to %0of arl InhiweIa"a*u
In 1W rmisterr act u adt this and

fad I"at u tii of rertedt term^ t andA
411*1 a: 1'sb Is W abanelm Wrnis edpo
appears an Sha In the IN*of41 wllbra
*1 1 x U I W .but ibis willld 410o iudo h
.91lelga1 md1,1pxio
hignselarit wrote his' Obakee, "A "AM 411"'01111sinaturir m
reLrwr. and iIt is Rom 3*0 hisolkuw "Stan od only "Inrlicine



7,isi 6S.4a& W o wlithal
AA KING~l WARE--"u,
Ourai Wlter Prices Arc Ria to 1
P -i bmads proooummt othat




d. waystoof' tat lus1ftu~7w Itas eudom '0 .(,* on. S
at difflrtout fluarej" Places as I taw< barks cm
1141t0een16eswhich was
helgrl. and the systrdwa m
11w~re Is Bell 's siratur Is fie dtroving
which an h alI lta LM T I ldieff up the
SDrtyeu often h isA rwith Vet to tone d
X an L bfo il 471111111 ialadr
wasknon t wrl b Nale oteer
Ouar M U11918 Ar Right "m uef t -aa OIoBoButler-d g-kr, ~131tb 1~
sh. Cy ne Was" &Ulmpm to hove aOle
.19 namer rouottun" 4 ornl that was ou
wrote It sixd itfeaet w Un.y (
I hlrto~ ul(~rnt~tMW kwpuat nuawS VVers daftI t"r ''~!B
teen way x. (~~~6
Tde girl's naoml wannerewo
tbose tba t ho re (valj=q$)_l tbroulllb ftu
aim Prow tho ftitli% Ift d was grist-
61 nlly 11davan. wchIAh to bo AWL
Frogn th~e na, the~nc c oreekill
m ade Auna andAm. aow
Ing in favor. oont InLed otber eN.
$boota, autlong wh Minee Anl
HNEWIS FROM ALACHUA. ton. Annoe. NauTy. laft
ThS 114tuE' Jobs W" 61 i at to
High schoolIU a Prosperous Condi Lugl.Egl In y the ( 4te it l I
1kwn-Larg pCoru Crop. was cntrineted to In Emni it Q AAXW=E'
MAhus, Via., Oit. 6.-Dr. Jim Bih- bheaotau 't tAwn slid _TisSt ba. It
op rm up to A el l t hoIs week to t ooe tO~k sOam yea rs wtug a wuoe f
Ituopla. WWhen it dI4, Wascalled IVau,&L X. W AIN lot
his brotbor, Mader Issue, home andd nd l u itamen It 44p ts i s W an
"pW94i few days with his parents. The worth WlIn mee trW1 a1
A. X. Westphl of Wland Oro"e it-tlt *utoliciuy llj y. It derived
msawp on t the 2 to enter bis dsogii. it% of 1gi nfrini f tOt thre 1tollne"r5
"Irt 11Le'ain ithe .A1l0sh.6 1111h itodw Oalhi, WiII qTH
seboor. inlike k uiasr s Wit Martaret
Mnasers Leos abd Earle Traer sa rloa toe l'.'r thmu. the tchild o
Trailer entered the Alsashma 11b H Iigh tl Kxrlengrr. (ln. wean. tiviieW ONLY 1AT!I A, 0
Lug Btre~liuth. AgIIO' lb Romeo. THE
Sebool on l 0theL JWtbdo Irr.a A ON "lIt A Astd
0. V. NeQ.'.. of Legrlngton has Iw o tlatcr'.
moved his family to towe, so thAt his
cbildwsuOmar have am te sellent ad. 8@ipt m dI u
Vanwtae afforded by Der heel. Ainteta Iuil InIfrveIed Few,,.
Til eronllmanem of the Ahlohef aJo. of ""smrs Irte it, the misakea t
$w High fhool 1I Imeuaim&howa$mwe ateriing thu OWll I ftWb IE Ub SW
~*yay. Tb. number sow erollod oWs awsunWuimt" *Iafr fl' piftoTIW
It Ilras than thenthe esroil of e a c whfther the ui l h Ins it er.a ,P7111
prwews tera at this seeng of the [etl IsC. a hroSI O IM
year. Th 0ehool Is thorsghly7 ciga- a in w o ,. a.ool l no tb bLh L
Ised &ad lb. work is priiossaing very a r r(MI euqmjI Aic A 0WZU' A 0so
stlfaeolily. Theabeelf ss ot mak- nioto t tihso .'t a wwtwi in teoo
lut attempt atsdisplayb hog from the ,lootil 1wt wawil. ast0-i' wil lr icauNG illA
standpoint of d Iplle# andgood, ut ml fwrgs a aW 90-(1* t W r11" I"' n A.
boo#", tslhfal work. we ainite seom.- ..'Oh's am W*bs(Me t00r11111114
parlsonwith@*? other soo" I the thIr'oitgi. After oow' th 1b0 W tell 0ANY
I~r~. TC~olr4# r~d SAI. r~ ev llt an ev"14.9huxly"n dry om-..
3stat..Theesosduets&ad piut of the *~ ~ttIleaiEhSI r m
It tooleter to Wla a. 1la6 or tio 1u.Warr
sehoo I Is mmapltaa I. apteoars wt. ri to or stwIl tlr sel dii..
106elliges"s, mbehvOur. led the aith. lprtsyV Wrlt. Them 5'!I6 1gntdly wih ea
folseesand eineywithuhiewb subash *,,ln,, u ,rt, Jl01 jt a bu il" wnte to
1@61611Is We 1111m11n1 MW'elsd, the gig.411 t pju dUe soil k'raslA tta0OlldC ooh nago 0 am. m& I
ten girlk whomaUke up the hih"hhw out. WhittlW sw WAI do so0 fllW bjAMfl!t!L.
depatmm antkd by any she'owsg.' atgm of "r eaphs It a bY 0
like member ts writer bee ever wsoe. I sia sp IC a ytO a W l ptlei st-t lkAM 3V
egg Sifop %r ts opeye ri on DE@ e VwW7 4. as "1 bo 11 1l'

hiso qnestioa the wr ite will have
inst e bla bsettee Iostw OAd and Is I1*5l' & i N

Sell pa4,SI A~ kr t- Ooo le psielep it s
Tumr.w' Ir m~b I -~ rl ,. hey theughais
The0 hurms, o thi esetis hat ye. 54.SJriou~b. 1E3 o

tahesmeeiee by the Siib mni L S
oosteals. thq ad hemleg" rr ~h. ~
sadoo lum ru Mam thatr be I ew .Wds'mU .1 iB~F~..
me euseghto sply his esde fr mmi'
~mr Smt fCtePTan 6 et

giwissees eer ofm D 3. CI. olkdlr h.oa
bh~~p. Mu. SI m .asbe
splendid ou. mm. medo we weem k p5.'


him to stown rA&'LW
3At(r~IEr russ.U ?h AL ~ ( _~ll _I L AW
"W" C"& ~ l r
5W? UI~Yll S~15 peuq~mLw Is isr~r 1
As omftrwr W Is .then w"e "sea
No*aGoes sl I T ~


toO. ibofa Masp hi cL e.~ ppr .~rm9'ICrrl
"W "~VON as"*"d ow a 4"t now _


endOl. mimb esor~Oc
THRO




it is ome~l rUIr
ft"Wr aft: omw-dl OrZ


ri'-U
SUw 7
L 71


nM


koT 6
6AM I S-A -i


























T OEATH

IlkN COLLISI

Is Rscev y er
871880.


DAMAGE WA4

Cns Gemq In
.y of He
Mweany


lwge4 ardl agsl
13 oprt wuU


to os]
'toimado
street, 1

CarnalIs~treet,
The air was
other dob4
Orut eatItsin

.t~dtate

'bowo do
.parts of
W the
At Fire~
bueis


A 6s

41htrost
A~r


Inrtl"orU
fa th


P* theott,a tr*proeat
00 ofe Siut












~bwby

Ala.. Get. 6..-hN em
Is shltag miwhol
Srir




-llv hay uSh ash h
fIak Was aseIa
ae~f



111 mob%. e
*1&.. Ckc I.Lnasb 110
~liinow at" U L~

Is apste 40's"r.~r~lI


-*MI KE$


Of Passenger ~
Uggoh e r-Li
L no Victims-I
AImonlg the Dsi
II. Y., oci -,
*- hilet) (I:;;~
'P4 iMwnar-1 .i4i1
as thelb
A Wdepot, ni 2:
:~clgck T~u~; l
tok Pla eIII a l
bwa was ti (,ll,
4s151 at 9:3( a I
~sbte4of (4*Ia.
~ b day, da' tli
when1 It reach rwa L..
ano ItL rachh d 1.


-Wow.'








w olw
med..iI'J


Csmii~tee4We .
abrlm tASRUV~wb7t IhOru5
NOW i U.' T. Um.L tou(t.E
WIIMW 3t~Uw. Wheeler. aeehssts
A 4WI00* smohe worwas give the

is the heq4i Imo -of the KtUMmL.
V1tlr Pithe ~ P Wmtpel a.
tetahser. I~ris h~~i~basrkqee arty
pwnd th pup~m hrbwbo m giv



merd am IuWy qiO i* 6authtly
aI?. I. bg, #AftW ^ 5.31 "NNW"
ss~q hI-'u eM isr~ a r ep
reatoibe mo thebam buWrmmet
t" te I m h is S-Dabi. the
PW hasW Tk
S. ''~" rn of twsrrur sad
NIameky"o ak bia arI~


bwwo ais wee.


a.5ke -~m'~s m-Cbhs of1 the

Em tr her eku.Se bebrrr~-~

8806yw"I1 ba vm ofa we uo"

we= s o ".am
ba to Mm owONsbs Ibe W"
Uw No" to I


-Thrurh Sled aw Alft91AN

p~~ 4#A, 06 low ~ "he
810sua 'E beth o bw k as$l of -s r
bul" "Mb do"~ ~'- --
ban vb aM a. bN


It 1 boom" m i O ft peon
wy ~r aais, e..a ~kl a.r L
Ieim a mesam ha%

~ isbedmpa4 Wd u
Jll, kylt~ I*sr 00 &
,ir 0- W- lowLu rr~r, ~~t~C- t


leii
4br~Ti
a work.?~


met
lot~


not i e l 4
the sus he~PwoomdTI

sale". TWO ao losim eg Aft UO* ft O: 8C oifi of i a th'k
Nbam ad I M aws, oar. w w4 fl* 4sars apam "o'erf
-O b us Isd *.d, 0". Wit Lo" AtPS o1"1* tet.O s M V
api m~p"4 wfthhis 1We.,On*e Wi. "10-9aft' "lrq~ed S% Mtea&
thk paty w"s ftmio sd aetlaSwed fM 4W t- ftme of Wt. B. 6h
tw'. work. MPStip the S& low v; pw. le, I. aet lb,
104 owbhd anothV ata tA bthe ViM ra Wqgb34
mme tn safety m sqot wW44~ sI MW of O Mohr. SM gat*-e 3. .
10 60atat" ""Max am'sti oh ThS
mbww S fio him*bswr tb a"0ek Vim se
at th esvo m a mmdrwased~
(rQ~dlC.Jll t411t 0 te Jt`~~AteLd that ~aWb
Rtbs ti Brof to tbs te " af ties %Ab thoewm, ft$

bo fthl"fiSDsmmew0B~S S, City


osatbInpmmlrI amiwd gjm ww. sw. bees1P piielag~~


ofrJ a heo S d imes e~theml sad '4"-r~ ap' e i-sa
semi~ pwl~lv ~Lmue~ that (I(IC( jre g ~b gL1 ggIWlL~
N to be .it Is0 lov e, ts t".
at Imob #Add maim strosm VtowC Imu wa
bI Newel b a*Vt" ofW" 046 at e e Iegww4

%my. 1 SWO 4e A 1 dm4 Jeks b mIs
"wed p sww- buft U" i to ow
e ~ of~ eary hewhof S________us
tew at. fot! bad t "W". ft -s
be" UAW W", 4 bo wroftwol, f




tha-- -- bwaed Is a -aM
go twows S n hto
wMm emeepI re"* Dauw C&bswo
Is "NOW " %he JI 06 oft 40 go"" oft ft!~ Y

hrole Io i s a)e g


USSWde69 a s0*INu So*33IW~b~IS~M
bm" b m k 6. A S os a.



hewe 99"mww ~*
W~ C 3ISgot"$ a ahm a.
1L Wmo )W C' S
0 a. MO MS fam 0 &Sb"o-tWftbeSon.

* S ao* "No ma u 801 4 I
To )k 04U __ft bow" S L) Ollo nlr ofto-'I- 4



as"%r~ a ww 00" a -*m te r "'Srr'' -



-.-- k ~-rlrrta~ 63 s.d '~~) I
1~ Ikkl ~WIN I "i
a r~m~r~ub~ ~-Adm.
)L 1~eara-"ca-"~ ~+ I jibJ


,7ippaueftly air! .i
0qb 4 t W thlnde1. 1. A
tmshed iwro, t


civw so re 9%ni
toe md dndown





wer# em t2;Ir way to thl I~
tthecar. A


main. wa s Allens :n
Uvsat m they arre to iIu
t@. ra a few miuers qlllh'r
tor *of taideaUid they bu."I I

lkIao ts Wdownby t siht A
torim n )t "L d wr to to r I he I
bm"OL" sw tu he saw~a of I he*
ON* sows meg pt ws me anit-
' Mwas J. W. Da.vl. ghth h -i"
leitM Ou" the b trwak cr)-g 1,,
wife. re uaMewar wtes he-r rl
i3. +ugb~inrid4 Thf,) h- bent
nowM*0'Sl Agpu b0ocht at Nr!




bL hir~~ JS Wem 1r





as Vow maien pdwiiewOut'
4Luinr Ill wC~Y 0 .
-- h" th-dD r blT! ln

r3-SU ooFT SrrIse C ure.
AOp fdtYw as thei MeraW
i S~lsk a oM K uo 8b%.a4..
r~r~h 1L Ig &a jQI q*M 1b'- !1;






of m~I)eWll~ ofe*b!'!u
NNW. *e A*low hort b "n ..Ij
I f sa "o 1Wthe pt'
bb vo* Vd o WasdNO&
1r1 lei *."bya.'o i .
dft W 101 I-- I dINOWSu Y MD

amSs 1M A"mifor '









~___ im 5 of__ i'
Om a" Ihwqb a h4e *"a td
94001M aft 118511plam



I~mI8IOI WO lroop**'

ago" m 4"&&M"" dd

06 40 n AW s 1NO vwsam 1




:pr~~r aftlo 01
as a oftlive


PASSEl


t~fi
r

PU 11
r
i~ I ,9


I



















,Iftdilllooosrn
the.


i orutb mad I
slunmem.
lost 08maljils


wpth I UlnI


IACK ,,

Powder Shlcl

Wlnd Evenly,
S Fire,
R loading.


t The Giame,


may.
bara


- ~ N1L,


gip ave
lerlse ot


Uurp Tha ir g hm II

btet$boos who Mae A
the penal eo41A-As go
Ito k'
ipful. T u
ser border s*A 0I01,
oil.
a the rat".,
i., D.Sol4In~Lg~a
Aeaia.


l& CO


. Ootton
Lmp i'l


Twine.


Wair


the SIg e
oesil Pei


gg.q~i


SrbeS rorriSulr
*sbode IorW slmilwww

0 war hi.
I Thererm en" I
(stoli le bat We, m
weterfal .pl~q
Ir of Iimanoffdgap to
'Love mor# mod t.hM vil


.me .ve.g


*


*B isg psuwe:


"mhS e"..the 91*1
Wb ia.Itoa mssemesq

bad lseais t bow olw
e, So b as nowsees



a"whineletlowid
aftp IW now as ro~
W" who um1* .im*
eljlis~ ga eswmesblll







b" so sho bv~l I"
swrw. ble"m b "I
Sam bW. V.eJ dw
OSat th eb" 4
A ~us WeuY haile.~t



s ha hwasm Sbe









11 Svc~~mM~
ml p~rmemgRIms


eeye We ewe ShbL- ~Is


SbMl Ip V. N. JmbeasA


~~iir"~~ 'a. .ee~lrll ~


Wm~bmws~~"~~ eeboi..
k wtlwt hashesI .1
ai ~rr ebbrrlia
1$ -' "- ap
aw~umh ~ ri" r4 "'-
'Sr 1WbVt e 3h~
Ikv bbl. emesee SbUs aYmS

she I~ a emmYe


Oib vle *



"0011hN bw saleI" sm
A Of Lbk Obetwobrrr, ohm
1 Asaim* Knowwis all l t off"
bfuPoo* 0% to"b~Mmtheeea ox.


A UOVWB ef Ie s $M I
revldrlleahstmll r 64e me f
pmpanttlem, I4 bm anIM a nIa
Got ki be"Insa pwbem bb m Ox
refts. I ONinas ipogsw ~m-dwew
9rltism. I sIWiW i sh 1a$m.
"ob smabie Iw hI a bed *ivy I s

appetSe, eM mM hec9 aI ~wemrn
m frtn elee .Is Nj e ble
moewi. wgot*0n1 Sfthu4wMll
aem IX s SheIsM wagf s so" a
sIa% sw"L n wM web.#m
as tetwebi SI~6is I wool
tobld. I bId OUW :ume mom
as low W on aw am.we Noms


*"#o@ i m W Of, a d
ee~tS uU1iduS9 O ld, W"



"e1 M "ruw4q1m wsamih


I adsoMO46 60 ss Ob Me I




or. I 68"d 4 ft hu INOW
a f thae sow


b-pis am Od upi
It "me. b g Owl ft %
beew a ~ 40 1 a" X WiS am.
rea hes sw

So be is'"A" apbUS Mww~
I" to" doiwadIm vua
"No be OL Wab to

$m o Sm.4 b m"sawe
Oft on=") r tcrry
IuM low MT.WW ITM..wwLwqpbw.fpv
ease.. h- Y.~~I--l
.as..einwb li-


*shoy*


K For( Ih hIN~I
Mihr 7rri uge ger



jipi 1~.oW r .-A edOtftet;56
fir se--k" fe


-at full $ '
rr-fleCw"t, sUUin
V00 .thO~Ia~IBL re aspn IWed 'r he
4w4 p~r Drm A lourlabiig *STY
"0 who ap rched ha.w "o,
vw fll~.atash muuid the qma
o S atep, r a
w" bw do'
Au 0-P"1 wPV


-- -:x 4r

Was a wass e te, but slei
left Ihe lmurk h 0e adbp I.
twoe bh)w'4Us wmU* often SAw
bi a I* lIdtvep. -eoboeWill Mrs.
MW. "at etU vend give lope sba
3m Cne Ale, ~eIan,
u"'- wes i tiErbaodth4Jr
rkkr IL \CYLWYYv. Jo~hMrS.
.r0r1 rigozri

UsumuiLe has Swupiar, I. m -,
bar.


A** swam am YY IC~
ofi f e.-w @iin. 1* quebhi *as
Of~mlawVseekb6.'mAe6 elp Wlea p.
- stemap ".L4 Weleb effexe
SW6 ab.qe % I is my fmm
Ut ta saw seemOa&V bthIs oiis~e
aid ai 16 peffee. t*kk"hPS i
94"em~bm~mmv s
31 o s- - 4,A


I -


CO.


W- 77.;7 O
lobe to" mk.4ow.iWrOwse
Wtlup. SQAMO -I. S AWINKLL&. ILOKIDA
Ri96" mp* Yle.P pS Ia CblkM.. UM m&Wotheri Pew..
410M Ksvalmy, Cs C"%4Iv Ihm, ealoesoo d Mke
UF3~R~U~'WW~slows


*



MESSED PA
BRICK
COMPANYS~


CLYDE LINE


Jacksonvt1o and Now York,
0.13mg .4 CUARLUWOP. L OI bu0 68


4;.


SO rbgi


4 k to baiwbIswy


Clyde ew England and southern Lines




vtoIo. ana u srn



etpwyes 3wAoumiwvtrn.ansd *&="noR
bmpgIs es lnlas, to, seb o". Boso1ms ), owd bumsela w
at. jem afet".


a*T,* 0om JAIO I8ONVeufnoL

o- -- a-a -Mks a & U


tI
*-t


w aR33w4c
.pie


asr
39 tngn ~ V 3p if ., IioZSw Lo
t ea~ .


'S


* '.*4 I


^ .**0 ,: .-/ '.* ..


~T~5: ;~Zi.
- ---~i~(


r


rru
a',










s~Ias am


LI-,'


P. V, a"d
':~` ~ithe "ifC


We will aell 9C OOl
OOK8 at 6 pet oentof
list below. YOUS MONN
Si, OEs FARTHER WITH US.

iThd Gllandievs' Ultoa Primmr ............ te
td :- 8wlaemr s Word Primer............ I
edd's .Word wLeeaoL .............
r Dero. IigaO11las
i esNw York Websto'r Aldy ..................t'k
Ot W bterb o P t ar ..... ............
b t. Webster'* s edemi .............1
9 bet
iliaeieU OBaidkwlIa' PFirt Reader... ........ sI
igeI r BaDwl' win's8Meed Rleder. .........
Sw Ba thlrt Third Readlr .......... dO
-te stalt to I let.b Fourt*h leadr.. .... ...
Be, lMw -a' Fifth Roeder...........O..
SBI ldwlD'A Bixih Reader ........... ,4
~M ,lke.k Key.- BaMldwla Seventh Rnder. ........e
Bak BldrtaIm's Iiglhth Beader .....4....
le*, ..a, or $T.00. OBOQRAPI
S 3wlnton'o Primary ...... ....... e
ior o' 8wln~soas GOnmmar Gebool....... l.W
ofr la Mafry's Phytesl Geography ... .l.s
sis i', BRodway' hNatural Adv~teed tacrn*
ed i far l sle. A. 0. HontOIoaPhBisoail .... t 1.
SM r. IIATHUEATICS
r sehoelll Vl .the beet. Try Milhior' leenate of Aristmetie... J0s
NOW P 4 0Ulkt*. Mile's SBaderd Arithmeoie ......Me
isS Ant1 of Arbehr vie- Roble9o'so New Elementary Alt
.re ........................... 1 10
rltiuleleo 'i. ig HiMh 8ehool Aliebra .L1.00
Bt- Ri *r!loom booM o or Milae's PhIan o 7ry ..a. .....1. l
Usiverteig A ter. ORAifIMAR
,r yeoe. ie of Sohaft's MelH4 1 aeoll mnsary Grammar ..40O
for "e'I* M. Weotn? IMotaaIf's alih Orammar ...... We
poay Ia I' W. M. Boreh of RIITSOLOItll8
tt was t Iteaty yesterday. Johonot' '*sHow We Live" ......40
odquarteu or seool umbrella as eld.'Om o
Fields'OnimMT fkdo ..... *1.00
y are bargluad L. 0. lmith. Oolb'y* Omlu Sl Hito ...ry. $1.0
ow lir of tlit alt $1 ald $1 25 at W~ T o B00o
J. Borkhlmba. .0et the bblt. gpenorien, I to .... ....10.
r the best rated stationery at Vertleal, I to 7 ................. 10
s prise all I 6The eB offl. IUCE.LLA.IOU.
F.. Sprtano **d John Smith Steele'l Popular Phyto ...... $1 00
to she city fb r Melrose 7ester. Gray's "How Plalno Orow" .... W
Hill's Fonooldlkn of Rbeorle.. 1.00
Townsend's Oivl Govern ment--horter
o. O. Rasir of Weeshoots was eore ...... . T.a
atingl bdect ioa this ealy yes.
., .. See Us Save money
rs J 0. LFestlse i itoIn the city
I risit to Mw1. 1. W. MeOolloa. her
-in-law. The S. J. Theoes Os.
ae.in.lW, p dy r.de.

in to Plod ln. ome quek. --
hsll nd s hoes that wear are the kind o well.
0911 Rod @" ly 44-.een shirts for Now York Reekes.
my. Get the habit. L. J. Bark.- York Rt
. Termh lot of Sebalt' esndy jest re-
p. Trroee e-*.
ltdeThrmeod Mu.tr Eard eeld. B. M. Wesoe.
di of M ese ast er Edward in Moseyr asked by being your shoes of
is o teo s were t g a. New York Reoket.
Fpr Pale-.al.hloe and tee, Witndow shades In all the naw oef
For Falt.Ioft"Wris and trombenr eetct New Yol k Bset.
,. nearly ew, eep. I. A l. IF. k R
. Itl WepV o*w8 trent. John B itetson's Oolomb *shape
When the be ae in the hive &ad hate at *1 Mondsay only. Ot the
Smnqnq itr .esgarohd.eome to th habit. L J Rourbist.
Sure Heo, 1s tse le town. Mrs. MasIti Brous has *e oe
Th* very 0a6llet @ *tO! Our Barry Oolumble S C., where she wills eler
II lntsolahs. foro men nod "os the sanItarium nader Dr. lsUtMef
Ssree to dtew m il. L.O mish. saortla ope.rsie.
onrsutor PbtF e oflthe raInolithie AtOer"el RobS. 3. Asle eOpeets Is
llk "eopetitoe" ba rned leave seday'lor Orlado., whe b e i
Ie @iWeal t as PnB~~ioeh. b o eslled o perefeelesal beelasIe.
Sbl.I e rlal b l h He will b e as oal eerl das.
Pe*i. loterg frdth brpd at the*
)hetile Hu Uslervy, Hill bloek. In oar Jewelrt II ins iUl wm d Iet
s *l. evr aftoersel. Home** ,n. dlute esige ee b. e i
Ph e. iilTy rlmMeoas prie t. L. (7 M.
tr^h -br lewkrt r Edward l. *Oet HIes. nFen b
Sis I.. leders &At rl E*la, S, Clrfk, rI eeoid fe IrdaImere.

ie -, Md., oheee ko will 0e s* ik deII
,, T V. Pl t. teraeh of Vstdl sh al me ei
m, 1Nl~lI54 iUme~.. RIehk Seb College.
is e'o*esai ld Freeeh. 401 Wss a nreuso ipob e o ne 4 e l



es.rem IMela. Igl ouy Deo eIw Iapw
ut.. .Sem arm.r, Agl su r ad e ,, ml ae eIi
w 1i., K*onday ) 5A aillek sad 0k.e .
*M*ya~.u ingoNd Mt**.o 8 .... i... ek


p"154 a s- -- -
1v ad A3 A bamseee L %del a fil
10%rud e% lser a brief bat .aDsbuahe$01 """ -" a"p.
HsT. I 8f B09o&b' bomd o
k~rrrrY~yl~ul Ymew of wr ow MIN wbow Wiss.

Cema Phusimi Omk
hg goIeIn J im. Jewle A
aO ram ompda .a VS ebea. sm M d



*00 we I" wli I -
let hidw Seeds sWimpo '
3Y etrw Team "
WA e
IP,. IJAX ingefkefWhiiad ikeId~L
'~ .e I~ .. -~r I
c5b 's'P11~c r


?~b.M. no.9


'Our $15r 4
hkever Ccioll


irl"* htoe.i -Is
S11t0o e treeT

e14nted to wkopaol,
it to his fmily in

.I *. shoe prT, the
asI the pries. New


OC. and M fI. MoKiatsrl a J.
A. wtel left i ao for Worthbg.
te, where t 11 speod nftad .
.: 3. MOu l:su renamed I t
tomto, Oa. iCaadad, hwbe be
Irpt to alse s ovrelo Loed
f Odd Felle
ASpelal v so artilo which
is worth monr It sosu so ogt It
We hove mnrWe ee that are spell
,I.es. L. O. 0 ,
MHe BI Ra l$~wI a eharunla
lose ladyl d4a who has a nm
fried here, l the> ely ona ukis to
Mo Julia W
Mrs. O. B. T si Major W R.
Thomas and edl Ia rrlted home
yaserday fr ple Bah, where
the bhave hf'I. upear sllg for the
pst few d By:$
Osptaln B. esu. taei o of Mibepy
Wr aI the 6 *lte| odrlay. Oapcaln
reasline is a o# lopeyd tn phophalo
work in the Wi Bad, but owns a Le
bome in MitMis
Ms. Alioe a of Roehell elks
Is she elty tf h booer Friday.
he was on roi to l Haptoa. where
she Wae called Seaomt of the iliaes
of her grand nLr,1, IMe. Beuley.
Jerry Wells Worthltoe HSprings
was a business tor St Sis city ye
erday. He Is j of the pPrp*lorn of
the Oew Worloc S ptan g hotel,
and report a beelaln dedrla the
puss summer. .
Mn. E T. HInlldof Samted s (In
the eity on a vthll her *o. J. Q.
Harrold. bthe Ibe outer home foIe
Wayneeville, N *0. where she has
bean spending pI s Ul with &mieber
son. M S. HarrM.
The reulatr ikly nenI of 0**
sert ldg No. I, L 0. 0. V., will be
held MondBay r.ta1 as Mias1le hall,
beln*lnlng i I OI. Ther will be
work In thr ftllih4trea d a full at
osedanoe Is4 d .
J. U. Halle keAIMeL Sol Is She
ilty ySterdty. Mr. "Il divitde1 hi
time between Galneevllt OMd Al4e1,
sl the rieiBlt| of wbtill pleo e wn
a prolifle ram. HIs bully tI so
with hieml bhie plastaie.
Andrew Kavukw. who has beoms s
*oese4d Is buelnes with HetrbJ r
PinkoNoe of she Candy KiEl4he. bi
purebasd tle intr en Of Mr. PlUla*
oe. and will cnlS thu e tb beoutem a
the same stand Is Wles Matie sree
oetlk
(0o K Rabi r,* of OfIt retreed
to hiso hom e )*4day. after a brWe
visol to his bee her, H e Wal s 1.
obeiansm I isi *ltl. H e *m *
oesOpasmid eo b raers by Me. A. I.
VatD-esafr. hthis ter, who I *O
speed a yO s t o Ise It ak H11y.
Misp lPar Mitebel. a* iH a lgN
oses dy l a iP, u~ mer, bkom
rtied i tho itty sMd Ilil be M st"w
ef Mr aeJ MNr J. M*e fme t he
esas few dsg. Iss MMiboellw to elst
favolwone, i bee Maye frWef

J. 5. Osas(ke o lWrsese aId 34
bMo esaw ished epseed wik al
wseedaess elf orsyde Mteso. sad
Se. md l0 he *,epm o 0 1o 1o.

Janel i r- o, ponWd I.I
Sh rnes Oeort *uueo tn Ia


r Ilo Ibo ( ,*


FMR


IN


Real Estate or

Business Chances


See


-MMU.


14 ''
1 ,ii


~5~1~4 IL aww" 4.

W.I S bmo o L W. Oiwo n4o 6


Hoa. irht C lark, member eor
#tomb lef tsseday teShe I
wbv he .will speed 4alA*"Shi
#*teiheebadsoft fhis hesis.
Utt Claktk health bas m*%w~v*
to saeeeai wookli plot* M A, #bb
clas, hre. fledi nd MeuqS
*tSuovol oidkh~m to "seki tm ,~
*howges oflfma.o I a aw twe
xv.,aw1th teee ezece*4Iu *


*` 7 + S. *


Hla*N* mla re the **s
.ezpertMed relaurat
Otel people we are a i
*w o il re you ervies ne
P .o* to.* city, and al
Yoe of it. SMau
She boet are of.


-and late.
WeeAe Meab.


Mam


meessf of breakfg mottalsitw--
smes wbihhe hu made so fP" 11 -
varsog r"eofheState during darIkg the IN GWeelOrange 11rs
probes$seo ah. nowill vet" etom GwmYus, F.L.
hiate sos sec so he toels eso 07iy*m
p"Wedt eastively msake p hs bwaI
twols wa% los
Two 11690t1s everawhere- R ime ul I
sibbeom lawisa d Vamilla. Absk0sWW
if Perot to wise as lamrand %9 she
perfeetlos, Ask We6t 3j55 Ysbs.sk'
the Us Wsip.Y
LAM USua~l justc jelthe Shlas 8W
ftrinall 0 4 or" Mulle seve a s 2 80 G
dome 0 rpfinc men, M m otWWI
ba~ ~ ~0c~l~g uS uP I~tnOO~, k
to Mu with Npedev Address, TIE S
IMPl. Gelwneille. Fla.
I will bar fram Youor sell0festys
as prive atsale orfesolea, a"y Miles. so Wl" Main
holder hirebs. 1100n11011, or0,e-ashnfuU l g !At OIaU in
elms lee wish to dispose of. Te osale
of )Il, t*ek. Potea salel of rall
$easte, a ptelally. p. 090. Oler 1es t ed.
Allotulo is Isalled t oh Siter. wbsr a
ticemont ofProf. Jules 5lsbolbergel *
piaoand eroan tomer saw repaire
Prof. Bbelbotvr heb bas thirty
years e Aeei. and is reasedoasarco HOuse
eve at theam eetepeleet Somers .Pers
She wostr. Omrles--- eaasmI~sg. vi..
W 0. Smemmeo f 4 ig les s s e w was M4
Is 160eoiloy yeIf"dly. no e 4Toebl awedmdSq~ e
Tbersombr Sivoms 00r No
OalNo MVO. Dr. gethehs4s an w ise M m *C
bees #*rHy Is she isevelag. Mrs.
1hMadl teak the drlya swemat
of No &*si fbet hasbee bed. IN. $ V.st".I
is lsn whisk e, who" arw"so o f od
Fellows'"al tasrlem Frif #^OHM". Mio o" Nowr6*4



Crlita~- Caeo ~letsk.1~~ busy usesc~l~
Ing for (16 ,lv. O Mhe esteol ..
$be mie o el fmers. 0 601 is
eec of Paletha's mai~s.'gao"
Wootlemfw. whomt a bat of Ituleaf
like to o sessenv at any0hing he BARBER S



ea lee Mos. heol U s he IW Lasis 640afft" fte

Tl&..mi IIII~ ~~~4C-"
tewr 3 was iseM W Pers



Cssasplurlbs oedwilsthcd, i Oars
1110 1101 -~lM. a"d Made Tno
11ea hatevatel call. of.firmws on UM so is i'tedo Imkp aI0
ft ruMW. sto A #Iska wher ho be WM abb .osn se(M

eedo NAM" undesd MACae
Is wish pivemue I iaese of
goo" olfup Ito.bMove. 9 fgoo
I a Oowegh. p. al pi smSeat
to n, 1 .M 9"sbOp
elat1edfItome 0m. hNeW sam. slw
fwoneg e. no"sNo WLu I*.sew


da ell so. be In obsom o* oft
Wme090 e isPtest a b"=-t 0Pe

sodel ow S. goI eed rodet "
a"e pents a" Pet logis, MWad go INv '*oil
hm la Iye"rO. .as W St. N"s0

o CWW Up 04010oo 40 10kv it o
1s611 Moed a s "au"so" K0b#.. ad
Show toso wa beois s"OleThe so,
weW0111a ow "If obaysehd. Q
bat 010101610 me M e OWN"01010 a
a esN08 s00 c osaw O Wm"r


$saw o 1* 6~ ." a" 5k ~.Aw
bdWW ad b"Wse "e00844

ft leesO ad -de L-atseso
I"- osb -mW
so a sow ~ aes an mot Xba.
#am o o e ~ se Tw
abaft bo ome" ad~he s at 5fW0
Swepsp m. ommaso L
maa a&& o


N 80o

ouf"I
boom ow


i:?so*
nWes.Shm
-9-Ct*
-jl~CJ
~s- J~~
&;brlm~ilall


BA~QMI~













,a41


ntte are SJ
Their Studlio41
to Ba sA
I Notes of Inter
Plmeity High
orf .of the
witrh On @3



sooi b
'a~ 'S~rlo
tyof whe h


to V,~
oak"l~ to be r
the0.04eteh

w s b~9olook,
the oulleok ~'

rl work with

board in
bi; o without

lapel 036 .
toris. mat
requese


r4#
C~r gY t
*. 44


- '


Pti'ons and fA
Btend theee
,they earasot 4*
rthn1 will 001
*their promosom
eated. The a

whoo Is
At Ah~e


mbothI
mont.
will be

the 13
Fresh~
La I T191~
LT ini


th bo"*Pornmsto

AMl -eSIe wImi 19 oels.


, -,-


*n,


ur iM


~IVOWs. NO 16th Wi.IA 4.
-Wtv su .11 for a bs4L ohm



si the e tabed o

the suw bid 1
~~Jm; out t" Maw w
i~ri~ vr W411 mwaso dwlwr


-F I
WT~0


4LND"sVr


COAST

TRIP EX
URTES

O M JACKSONV LL
*~. -~r p~tmgu Airk JCJIa
iphaisu, Tenn(r)n
17, is;T
womenm to Nov. ~.
IIA~mto, Ga on ral r
10; limit Oct. 20;


; Imit Oat. 23.
*Ga.;,on pill" ()cI
24, 21, 22;
Ii Ot. 9OD ;ztenc(i!,


Ga-.oo G .; onsa Ile-
i naloulsve; aimit,
14outgomery, Ali r
or Of2.O,22., 2, 24. 25.
11 466`4 SO'-..Louise 1, 1o ; on Phi"I if
'1; 4l0mi Jehin, 5t j. O1i
31D extension to (k.. ,
W-4O a01111n0, N. Y.;on tiv (m
1.1.12; limit leaving Bt
A Oat., 19.
., N' 41? 6-4ualfpors, Mite.,
12.13; limit Nov. 23
itTiO 'e~. Nw Orleans, Illa q~t
"10 to Now. .
7 1 410.mI'~r r~ xiilnho Alp. ; (In Ial
biogoe M.p; flmit leaving Bin
Y 4cu. 21; @1tens imi N
its Im '1111" 11414 b 1 o" gt" to other jo.inoe
77-A: - 1 404 8 .; I:rn. sheduies, 'ullmasrb
14si dogan amll iber detail,(
u~riisI i~l~O wiUaASObove and other y

pmwmbW 8k. bAy psion or by letter, to F
plb~r: e~ln~rrooIoM L~r OIIkn00i Distries Passe t g 1 r A,.
tC;dlys- lit ,i~ a~ j~~raa, rkr Lp~r
L Oi ., a.9 ai 1111 street, Jacklonri
WOO se1t"46 .. lumb6er ~sqn --
0.) 011116U, Iw, omregl 2MI 011110 *
~ rr I.P; 6 miulmb ~OwemwaseW d o. 64 t oF eTHOMS


~i ie Ia egoqjgrI6 Iib. HUhIvets Mo MI 061* 5051 pr tibH~~L ~ JgW00
a '-f ama. 0 .11111ATAVMwt
'.torl, 14*631 he 6 6t44SM ai ae IeI *t We Vll not d d se foowz PLL LIN O


NO. T" 111,066 0 OWN -so plave thet hl s t.j Amm on% iend vrs 'ev quay.


:f*'wmsl wishll the USM.I weib, l(3r voI)~lra~ I*'


Q$olml IASWW. homely -w~at "no ~o rh Pamiw tun She UMn'tevelvb of Florida alr I Mmiiu aa ib( elearr h od~e
FML L 11YE OF1 ~:Cr




0'O3 ofSKIM. @1 .Ot hs$ Mr. 11, r0,m*a.. W A..ser S mne ung Men. aa

I"*I esreiva ", he. hu eae "I
;Iro ~ ~ ~ ~~h sLIine uL ~ ~Tttoo tIahb e~oreelulesle ep~l5Wd S UIIS*905 "Sell gglp:* Oalmw.'U, Florida.
SW.r 111k ,mlrl~ we..; let, tewLir #iie dlseoge as In. nhb. duty Be w 9mw a. posibe to rIo.
sl owd by apply muo Ohomber. 9140 El"d o55 wit ftU060-A
hequ~tombr~sDee. 0 S. Uste Pdhovel bee eranent~ly emee by be jkr .me hoe hobrs. .~~r1 th emallLEI
#o 6 eg ,ea 110 **toot floclm s asosberoa am&,- A0 FO
1114M I W too 4600. *0 WO sn favollow? With 4" --,Nljj5NM TOXIISTON






lIs 8*ik trrro Heavy Dees, rtn~ IwCQ fIciseeI**$of t ______________

Nei 1P. W 0 1eseW w. 1gh h #m 'r VA oow W aIr th.. U.S. --a W rz
-A I ran, ip- Iraw









Mr* 3* fled, It aal -Us* li.eo 1 W A we who. P
Sehi1rh~i ____s sOrr ShI.tla~~tlnr E
biblia #0 be to kap upalskikerder









14fo oi loU o ay afts II Iow VOktal c f Pk b atfte X" o jtej by "Jill
v66g1iW5060wnselowt f am ellw~s _________of____and_____ wuselot to "* Yw# oU". pem**STobel" so. R








bsYss~mbs SM d rher. --,, IC
0 011* r. B e3 1. atilfd.Uron s P al f a
I 6111IMM. meo a" 9111ne Th lawlis" fiwe ptelswd a Ion ON "bIf Help










,.w W1 4 4 hw s 1 i --i --1 ao ro w..tagd hwit h S he,
Mem 4411 1.h Uniiera, 111bv W ussslyst"b 1 1eeo te"*lsareSM04 as $ BED







d*Pooa i*dr -view. S j ebemof .k *iof &be WWI


Ue c while islo .6d kiW er,
1Er poll Ukm 3ee
u U A dS llre. sdS.tM r sfs 10 Wa 0 I---ST p DerkJ w
61101 A hSrS *r UdOm. smis Wmsqlaopes-hat
a fi lemSet"40.
~rkr Srce o A"*". ukhrool 0 Mier ow VellJ










Showsum. emem boa "e. 0 Vere s U. I IV W NIN F A
W a5je e I bu55 bee
Irrr~- "- TM M- was of sionmin81"118
WMA 0014"M 0 ho sft"" b 4 GTO 00LUN6 CORT.. W&TMG AKERV









-A h.Lo e s.e O
*Allo Saw0111111111#a So 4t 604 1 ADER







....... ... ..... JM $ O m n i =


0.. WeI~ fl'~ -. Lrru - -
deebler~kFmk S In d *k m
w o VUP )g CVii Va
~iu3aim a A" "millilleU


_r~W UCIL WWL__r~rr ~T
it sob.. .A
T >a lFAo
-VW ;!o m Me Ywi I


A a


L


__ ______












'.. ,- I
I^7


\


, Sa


Nbck by the IM
Fbare atiempt(
It The roall
to a 'voeryOW
prbege.0 owl
*-I"elor, and


Mr. Poo
bb
['yto hat





Nbedemons -i
aroister. ou
;othe king,
IN upper.
akce,' but
ka, which
,ot acting
mil an CI


thou ,
I In a


/4 A


"'Vr *...r

2t


iSwE2
('
ik P4


' l


i.


t~amden,


Southe


1Drbtond, Wash-

ie, Phila-
W York,
o rk


i-


'R-. .tr


bomr
oor w


r aon

& hoe OaXmind


* f~, '. 4 7


Opetng
fuss iad amvills to New Orleion
a I




is g ll o any agent Seaboardi
SU1 ral Pasenger Agent,



ak Atlantic Coast Line


B~a AWIAMAII.


at the im r. e SI 1lUS; Ii
plar4 It Itt at As Qtmsus.
0, %a toTI ; Vbtsr plale4
Puls art CIda t AM


DXXTIOr.


Rapid Tranat and UnaurpameI Service


- at QTWA awn ww -


U5"" war D%-,I~' ~T' P
gInn3 3ai~t p~yiiiR') wi arvuWrpnt w ws w" 3.,3~d~Cbi I ..8
11. kAR w hqo d S W u
:s .. pcntt Ib~.dkrr Vwbd flto M U3
was bmt a pow WNWel*e os* Cam$ is mowe gj, samisot
SwbnW.f 1e ) TWO bats. of OW, "boswA bIiM"pI
sumwpako offm loom &adm atb bet Ith** titqemSW at keast e *rrUrflI 4 ls.
t7 11t suerqopr. Rnt buhsqm was q to amlatoetemitm a W
ast ra nt, baop am Orlbts was chemn hfr the st appote
a Want s"n. apaes, as of futcl Foot. at the HafmsP
f .wvlt to sa nthat b* h htI IN$ V47uttur droll and ma-
mc rrbe" O On the ltrt )le was Sht and stout, with a MouTIA M
was to ti t stand whe flat tammid 'is acting of the Mow
Ok~ird uxclaled In sion.to the laW t Makftlhi mlt h e bfen mae b" SWma
m black hio "Here's Pom- ary 9ttuy. 1Wa r cut'Iry lator, at the
i;b;Te ibh rnp and earn tbeatot, btho.na ot Ihndrftr WlL!
?hfai, llie. Wheti wi(thb filCvati*0
Kamb h*ae did mvA to aso., wbrbk walai avebe cvc,, 3353,5Th,
%IW mmut as the *Iatom "lcr uuatmos. (bIlp YlMathews. The
In ,* tboeter, The otif Kmav Ifirkho rf aaitWS agIe, als
bIwhoe *walitcoat. blach sttePUeIP Mbe4od once. bet W 41Y Gu. mW141T.
fllP bottomed 4wit sad -NOWv OrimW Thmostl04tra, t.
bat Whkio tg'siltima pem
note 4sep11.a~ (~rlan~Uoh's~ I
to, wa s wep traay Imm
0 tIt hm""CAM IW A vu in W Telrr
We* belitto than Otutle ft b, I msel I -
SY fUI.Pw toiors.r P AtIU,
Him Sam was
StrIbot e 0not"**

rkbt at Tor he eu ImAt PS-
a" all", "s the a To.
It, vme a o mam"Wo rt ho mbrb as I in of Imi" 00000bbibm U1 UL Wmvft Fba
b Ift #d Kati% W o ft o bp rpCm Ou piImm as"* 88o fty.
slbtm ath" Rod up *a~ TM "Wrs of the to a Ma 0 a PrN N
a t -, myftomrm y* of amw tLat meom @1ot tCA
'Iso~ lb.c Irserui wars mm.. moseoas Iat Shots on i 1I
*a vowpamand e aIn sthe great -plutmo. towe and bwke-meb*WtAD
art utonl ho w roemsebm hi blesbookor magaM ead .1
WN th erv. tip awd rso s dkmthat kahwIsmap Is osaito10 044010 M
100W hhtd is qm almstam wbsrn at l a ..b'tf l4 a fauis ColiogsI
1111AIseI v~s 4one L quttif Aw rtcbrm we a coul
qros ttpiad. eva. ernh Y Wusma plae a that Ntriw wh bor tM0% 6

44l7W ( on iUwe dauwaosmovf
I I b4 hd b oW r" "not" rnMt aol y" 11"bim

L~9W S I a I IV rtteaseCm a *-9 ,mew Wo the

0 tmt 1- Wh* b' IbI, a, 1% "W nt' w b d*iaaF*mmbAs
em bao ra r* M% f sA a -a L
istH ir It 'tt.iIr ~ rws ft bI am I of thu -
A"$NISt 1 hf' cIsre week te rI
liv" anwarw" 40 tbo vit .1 vd tor nra
*0 t(bal e I*as I ROANA
ars I.~. ny *k A suI4%1& 180 1bW
,ISI be Isnoh '~rsrwwtr y gI mWIgbth a elII tmt- CI
Swqayw t~ p*s" TIbe ha. oarofb~ssI~l ha pUP +
em" tinmo h~, U 6 tlkr" wam tow gamab mrain s"RPA

aft a ......~
vm moema" ast


Bose. Tisbese, goad er r~lU m les of aMoog the pru
m~mgmbs owl aw my M Ii5Sw
U.v A. ODWINf thbadgit, oasv Iantle Cc"

& J6 NnQMI1Y% TUMP A9SIK9 O&IM"Wlls-.


Galnesvllle & Glf Railay Compani

THE FRUIT A VISTABLLC' ROUTE
OP PRMIDA.

St,,w hte *I ....e I .


Th.'


so 4 k"0
Dal, I 's -


.... .........
L .k. s.o..
Or Ou tI-.. *


66i0..


~~-U
lamb -r*

V 4 .0 '
*too

" a.t ....a L@@4
.CC P* 4 440 10r


iii,.@.........
C ... 4

r 4SiIri4


S S i


Wom

IOID
1'4
Ss
I U


a
.5


rU

IF




*'F


*0p


,that


---


' f
^













t'I.
t~jkr*i
iem.&lr


66 Ku".
1agrant~

which U
O nSept.

oyd rtl1

, ofl whlCh a
,3 of the i
ihey bad


the third VOLDREi~O
surPv ivors
e on the


bapi)Y aL:R~~~ IBt-'o
inr their thir tht Iad

of theK th,
r, inciudtiwY y.They
almost0l Abavtlou
Pwere cUrried the Kohal.
__being k o
the dOctO-,- g &ftm-
the boy died. tter being'
&wabord. Doom
ken re~movel., The
1o( the Kbound.
y*tenionl tota.
hong those **,'V down with
~Cbarterbo0 oredrowsed
caCptain Ir"OW 00co
ion. and
IeEer9 Fo bi. be.
the o eip'es dr otherin



14toeugtr U e

v Dimeoberv fro wassikel
I& anDd 0.14 d. .4300. Wells
PermtOlty.M@ No 'wglwt "I's a
used to pophIil*iS in olimahee
wewsi6UbeaumIIprevail. I led
0011lj eondf 1 i. s pren&@
sainia, es~t' 'h~rippe, glvis
idertul relief ft' ua and bay
r, and makes Oav sbags strong
Gih to ward a# einxas ptIlo.
lbs and eo 4 1 and $1.00.
mouied lby 44Migltus. Trial
lie fIe.


Insnitly ON0 0e Iseea
Yorh. Oet. 6.4kgft delightful
t bO WOW W "od Mad" is
up to tis by Ob. Sifes Winalo.
S IlAOl4f diup t1to the Tint..
rdlirng to the r aLuticai Ares
tnsr.l',? maya ty e doctor t oan
n.w rlt can obeshown that be.
long trtre will be actually more
*'In the f *s man p00
thi h& iruin ptpobtlem or fe day
bo t topreveant this Irnreae of in-
What I t do Uj 0( wasting
0 enmrgY ~an meducatiooal
'~ .% t, have befreon I thie b.
'': i", the amtempiarlon of
Il.%t'A)rwi to dealwitbr"

NJ~apkeg Seneparte
hord itt thb. atle of Austerlits
wa sth greebss leder i the
Boll4 Jula gUlinmeas has
4th-i.ptabliellIs h00 best Hlin-
in ti.h urw1- A q1k sanr. for
tatiem, prahl~bnmaLIeees, e~g.
PItt.ro pts II. says: "
I SI'sr4' 's 80 EjalmentIn n
I Ind fAnd i6 441fSellsi fIr sreD
Ied see, estapu4s fast for any-
t at ern be vIgbu bt a limi-
hi 1ui4 by W. IL Jebaemn

S "' C~nsump&Je.I ef CeTteu
.U O0. I.--Tbc cns"as
lo Sd a a letin Daboy-
kg o colfic at ttoo tak esfo
be 1y wsod4-terers and
W ono mwd f s ibe yrar
*.I. JSW, to bov bopa
sm 'JWWWS the gaat
-tAi11U trftWW to be MAIU


Sl.


L) r. --."MIM P"" C
I'! S.-The intevsatbo"~
'ic th of uwmmarre,
"WI.., g oaImds anan I
L t&VW gf M,.raeipeas


Fit
get"


'C..,. ag urlowt *-
'"6un eeI-


WsMozityy *^ Xo
tjxir, a purely veg
compound, with a pleas-
Sat taste, will relieve you
O6f Biliousness, and all
kiidred diseases without
griping or ause, and
leave no bad effects.
SOc. and $1;00 r bottle
at all Drg tora


8,WRL


aIIBCTAIT W. R. TArT.
Provlalonal Governor of Cub.

A Young Mothr at 70.
"My motlhr hai mddenly been made
yoou at 1TO. Twenty year of iaterne
sferirng fro dytyepsis bad entirely
disabled her, eaUil *di moatn ago,
when she boega taking ltelsr Bltor
whieh hav* eomploly e ored ahr ad
restored the treMatb Iad a ltiviy she
had In the prime of life,"* lits Mn.
W. L. OGi4parlek of Dsanrth. No.
Oratese relorative medieis oa ath
globe. BSes setom livelr sad kM
nols right purillo the blood, aad
eomre mealria. billeomOae and weak
mess. Wonderful servo soaie. Prie
oe.. Goaranted by all drounlt.

Negroe air at JasltA.
Jackson, Us., Oct. I.-The asiro
fair here is an assured MwrceN. coin.
maelnl Oct. 23-29. at Jackson. ev.
eral hundred exhibitors have already
entered the vrtous coat st. The
LJxle band (o Atlanta will furishb
mutlr nitneaut speakers from vs
rtosis parts of the ta te will be pr -
ent and speak Tbhe southern aill
way has given redtk-ed raes from va-
rious points. (;nrt credit is doe to
Rev t' S eal, who, by bl wie
and modest plans, basplaId tbh fair
on a permanent buas asd has mc-
erd4ed In *euriax the *o4bpertioa
t the white celtieas.


Doctors Said He Would SIM Live.
Peter Pry. Wodrne. Pa.. wrows
"After dawarlag for two years 1WO
Ib. bess playolkee In Wayirsbs.
sad SS-11 ptums wom, the deetere ed.
viwd me it I had say husei to *I-
Seed to I hod better s"d Se I&ift
one@, I "eaid sot )i g liH
smother month, a thee3 IM 0n
forms tFoIsy's Kid"s? Off* sotow
ommneadd to o y 61frmied. a" I
ima4 latellses my t so theo Olim
for i. .and after satlag three bkettesI
begantoegot betow.&M mdesmowd I*
Impr." 6u41il IND foeaiftly welL 2J.I
w m"I'VIII CO.


O1~,vo Thsr- Opt 0-4 ,
(.ts .n td Mrs u Hp-Lie Grem, and
l., ~pr.;4.-a f. ad t bI#To* "t dld
r'&4r 4 a4 0*l1rawsI s.U -,
MganSe"l qtfgtlw*a se*' m ew. 4
gabVe.t .4 ?. Ar a A ehtsbwf I
Sat o Cowaimwa5 At,5Ae omIa g It
gigaw a'-Ia r Mepi&, *a th* I"&-I
et loe *rurgook'sem lmove~ vqeL
ty ot lea. t *' a. be u wm p"a6 i
ad thw ms(kLdh-t "h i par w


the thi
Court

4Jelved fromc
*Tboe race
Pieples for
Ofl too


~kturnm

bi beti
poeiar vote
fewl eaing
Russell
Powell'

peep
Only 80
and fturtb
counlti stili
ence Is enal
until tie co
to will It bI
Soamel of t"e

Don't
Foley &
Mosey and
ressily. *ad
OWmdy.and
ad To
tw me gone
"S~loss be"
Ilke ave o
Ask frIs of

16is the bees
4"a.. J. W.


Macon, t.4%w
hole thmulgh11
bell. a driver
book on Flu~
trao of his
has not bo~nh
Bred Wtah all it
dews the .--L qI
revealed !thamg
Wled hisk


show$
inhaely


eth* ~U




p at


t to


n~e4 fob




to ebuyo =
v.4:
~~dpi


,and re
r Oetober 6GO.'



solw OWob
v Wial te00







Nogw 0rlot, a da
eq,

-li eem Rnettmeloo
PIII 'Ibe seaTarad l

i b, &s., a4)
rokobr 10u


with 8eg

Atlr.nd,


liensi
wreU064
., ~aId
daily


"m's


gulf iv
goy


0A .Wft a


d rerte


ad la


0, 0 n$w


rola


Aft Aw~~~lL kr ,


"Two in~al
log" of
with an awful
of eoeghinge,


Obecoa m go ii~
weeld got gI

edy. which e 1bh
stopped m
fat." wrIse MG
baker, Ill.. this m~4Ii
all drasml ___

PeebuttW )1 ., On. *.9~li3il
llopkIms o f ltaR
v.a SIesIo of
ed op the rvt va"

It to am me Inal1(1~
lb.f as g Pak
adoIbhe 9it WUW gwpluI
)nQI rrwlu'mu
beta bWt~rr


Wo.Tbeeaw OWI 4
esslaeds'b ge



ty b"s0 iso I -
bas meslig o AN"


fe
c


U


~~I CW lheUib


1.


rr~~ rCII .Y.



'4.,,


mili w

&*bet On.

--S-


ToI


M ~ weartbW ca eam& UV44LMQ0 se tIM- a -



a*" brnvsh an
POW so of ahratb" h w lematoO beY tie ona h
.#A& 6% am-e form Ma i kru fasyrp ads



""?*~~ ..* ~(Woo "A ft two so6eten


SOON ost" '.. M I 6 -'i-
"'*n a Y (I~. mad N f.


dlON


A


"% "X


*:: -y
M












de-


betW3
wb!o fhi
SSept. I

Ind f"eam
aft bcl~flhU
04 whiiCb
is of thea
Xey had b


Wdid!U5o,


I G er-
)~GeF-
ti; eked
Oharuter-
Oglueer
d women
i for 43


third Oct.
survivors dL deweried

icha;ug's i Wasu great
and the e fran-
hapPY at .t of
their thirst and
Their t a lan Ro-
dt ibt Ko tiOced the
jncludla -oy. They
st co ll ;haustion
re carried o t Ohe Kohsl-
being U k. De-
tie doctor' lIng atten-
It boy died i after being
Board. CJ I Dowse
removed i tl The
mf the Kobslel' i lunbound-
;Ion to tus.
g those I 'own with
erhouse Ir f r drowned
Captain N# OUie Oficer
Second orior and
rs Forbes i Ml W nn, be-
the ship's 660 ot others.

Danger f*r* Wo9 llP '
's grave 0e pla
s ,oghs .dS are so
mot, unless yi- Pa" Dr. King's
Diseovery sqomptlon,
and Colds. *- Wall
stCiNy, M*o t5 "It's a
idto peopl l@ f tl e llmates
eoogbhs and r rlll. I find
gkly ends It prevents
Boalg, our p,. gives
bul relief i*ft* and bay
lad makes *ila strong
to ward rt tf0eafomption.
a and eo ,i4 00t and $100.
teed by Aif fttIs. Trial
free,

Insanity On o hItlsmne.
SYork, Oct. S.-fThe delightful
I of "The Wltlb oute Mad" is
i p to 1u by Dr.. PtOieae Winalo,
a i.nidon dliAqkl to the Times.
rdin to the M itUcal figures
inK.i'" sayg h4 doctor in an
are. "i cun ibq nh Wu thirt be.
kxto there will bet htuallv more
sr in the world tha sane peo-
Thf 'irning prblMem of th, day
Sto ;,r.vent this lInrease of In-
W h'!a Is the \eo of waitltia
a In! .,iirr sy 1 i a ducational
i *, cl hae iybefore us this abl
9t' >*'"'m. theaoltemplatlon of
LtP ',i,'kl to deal with?"

SNapoleoin So e art
bed at the batted Lof Asoterlitz
Sthe IgrateSt iMder in the
Ba. Ballards Br LiJaltent has
thp. labliei| k tIhe best lini-
klo th. orld. 'A4i k enre for
irtim. praig ll lrl eats, ete.
P it,. od |Si -,: ."I
Islar'd'. ao. Ie4itli t in my
liod dnd Itil4iug d for sort-
i, edaehe, 1etuini f4et for any-
that can tbe 11 by a lini-
"e' ld by W .lJebamom.

[te, cosumew 1f Cotton.
O(. *.-The cenri4
S issed a bulletin so.w-
S'. ity o O ag taken I'I;
', Iniusfltarers ':
*' s ,nr4m during Ibe ita
I"' I ik t have brc
S sg lhlag the amount
Pam agtgg 'gt be 475,8:


Ni L" cr.~ Fernep PeOage

e: rW IN~v emmcrec.

L't L Irii JrWW uI peoI.
I.n

la te s66 a lwalvwrEC


o Ifa ", u 410 0 1.-

ends* e 0 n rrove-
4 0 W to ower Otbee~


Lds~
moWm" wb m mm"

""'Ut vow m otti tI
lk far IW owg I&. MW-"'

%* "vow&%'#W
WI* abw memo & a d


1 h:~I~L~U~n to
;i5 a an''


ivr rrrmE
QALOMELI

N"Ieii "1o lt 7''s Lemlon
E.liiir, apurti V Vegetable

ant tastv, \vll rel'64:ve \0o,
of Bilisnes,,i, armd all
kindrvd ( !i-sea.,es without
gripihg or n'austa and
10n o had effect'
50c tintl $I 00 per bottle
it all Drug Stores

MWOZLEr#S
LEMON ELXIR.
"OC)g rkQ CO.\' ZCtS -


LIADS

Ce WarCeed P
Court. ButA P"aces 4
Attant.9 S~~~P-Judet
a. 1t'ss. II In leading toeI"
for thte ree hip IaC4e 6O,
new Court IwPeals, adco1atiie
the ot'(1dil qlOtldated remum n
celved froni 1 ts uanties.
T he -ae, bje Powell., Kin a
Peeple s fr 014 two other plnsIs
stlli touo cos4A make any ..tImat*!
o( the rt-sul, Ame than mere gsum
work.
n.. ro* 115 counties %bow a'
differew1~ of~ ua few bucdrPd
votes be": ceou thse last three. Th*
IKopul:ar vatv, 0 tar reported for tbo
four lesiiit g dldaates is as Mollows'
i-~l. . . .15.33

I' tjicul,. .. 1S1.620
Owi. %,-i vat.w btween the soind I
anud IkII::1 $bm, acti with several
'.tuinI, ~.'in W hear firont, this dlffet'
vnce i- t,.-ilyv blect to chaenot. .40
1111tit IM, I't Ou e official returns ar*
in w ill it e'h o lOWU who i sthe por'
t'ounv~l (11, the I" CllrM


Don't Impeod Upon.
Foley & OI, Obkesgol orlllola ed
Honey and Taise a bthre and laoa
remedy, and i Oeeoeatl of the lreal
merit and popgi ity of VFeleo Heavy
and Tar many.talsatlonAs ae osfeda
for th. gentuim. These wortkhle 1*.
tationsI have simalar aosidlilg ame.
Beware of theAm The gIoel"e P10Fele
iB" Honey lad TarC hi a yellow paMage.
S Ask for it and fe sa"y sabetlltte.
Sk It the** b .. srpl f r coils sad
cold, J. W. .ilmA Co.

Macon Hqg *otrw is shot.
!I..:, ,:) ;a., Oct. .-t'lWith a ~nl
UICIRTARIT w. A. TArr. ho,. :! ,.in 'hi right juns. HIrtn
Provisional (;nv.rnor of ('l)a. h1,l, i'Tr ur, wat folld dead itn him
- h:'k on I'ltu uan T lrd4 Sre t. N ,
A Young Mother at 70. tr.:re (t hui slsaYr was ftad, u ad It
"My mother ha s uddrnly been made t,*' r1, b ena dltermlned as to who
young at 70. Twenty ear of Intense rd thl i(hot. The llbak aroved on
suffering from dysyepoia had entirely down li', .trol SA m setrtil of blood
revealh,, thahlt 6t1W tshe llso
diesbled her, until six months ago, revealed. that atoer Use nero w
d allrd uo. horg w M a tarted.
when she began taking Electri HBitters .s
which have completely cured her and An Afd0tiOI u Ift.
restored the strength and activity she ir
had in the prime of life," rites Mrs. "Tow" *eare W H00 1 girt haLd
W. L. Gilpanriek of Dsanforth. Me. touch elf loeoltWIS. IMh seft sher
Greatest restorative niedicine on the wllh an awful Ift Ibd ep"ins
globe. Set stomach, liver and kid.''f ""e'uti SiM IMbe so ith lAe
neya right, purifies the blood, and whoopitn 'ig raugh eme Iatbughit
cures walaris. billiou.snes and weak. would nut *et I a ll1 il We
ness. Wonderful nerve tonie. Price(l.til of thatL l 0l1 e.
50c. Guaranteed by lldruggists.. ja -, which IMa"d Shea Utr I.
rstp>lpel r>oghigNAd 0I0 o-t ~ M
Negro Fair at Jackson. fat." wrrits MMr Oft MI br1 e
Jackson, Ga.. Oc' h... ni. ;'";e baker. Il This Raln be it leIl bl
fair he i 1 Is an auir'dl ai rm-1 c1oi1: all druZggi ts.
niencinge Oct 22 '9r at .lck.,n H. v v-
tera hl Ir.d 'xiilt-ois .h a a!ra t, Rus ll I 11h We .
.. ; *< l *', t-.;: O '. r U l.---R n. 4
onte .. r h O ri ,i f, T I, N.,I, iO ,,,. .-' t llasl
nI\it lo hi .0V! l.t' A! i f ,a"tia. M$L
itie i;I'[ t,' j ir11 sit. K .". url-!t ew York nef IW.
a lO !I ... 1. 1n &I!Joe. r ,l,,I i :l j ya i t'n o T b" ri4 y wht1 ilfd
r .1 !,1,1. :1 ,oitCI :~1 (. a waw .ilolincho ed Poaksll .l
lit.' l i .l n I"' ed 1-4P, fr'i:s i'i .t I' _aiot i the warriase woo a ruseway
Ito. .. , affair, the" part* to of MIn" lsp1 w W
Ro, t .. .,, by hl. ,e t j,,-' Oa a a",,at of ho h, t le a"
and nti ..' p. d 'the n bu tr t .
on ;t (r): I.. '11' I 'Ie.' an ti Iih .
"(l,|J.d in II clriTrIn the ")OJ tr ',* M*h ngtI* Fa w.
Aj the i.it. rci,,.i.-'. ) ,ithre mrd have M Imbiltme It
,_ _-.--- eulnlinuibh 1', Ive W --mm
Doctors Said He Would Not Live. ('ou.h lie med to their 1 tt iam. o
Peter Fry. \loodruff. PIa write I ontlTaie *ba*l* e*l MabIf Iij
"Afifor ,docir.it for two Years with TiI.htle lr l l e Isay t m. p
.tAfr ,e ,'r's ir Wa-,ybar-.b ly ,afe to g$eem ell "0iMl. We Is I
Ihanh a w taotr* e** "or 1109**y ** 4O N
aid t ii 'tt sre. .i a t, ad-, m., edicene of ret sIeIt 1sa41u~I Is
vieod rne if I had sr ones to at. Ial wnt ene
tend io, I had tter, attend to it at)t ras ar .oleb e rCOd Oee a ~
14 1 toiot ,_f ,lifat aleele e rIlleds p l. Ie
.,. I *.lb re wa o 1 by alt drlslllI
a(>1..er m..ntn,. a* Iere was no eure _


f flip t' i',iey'e ~doney Core wse ro
""ittided Id f, nip by a friend. and I

f r t. slid after laIn k If 9 ra bolt' "

I mr~r unilWas ir, wetll'


re 4n


Wtt'd"AO, 7e,.e, ACew
*' a. F i.

a t


,Ir~T ,,fe r


A~ C 7v- r'


a:


t~ra'saC. jt -,am P0i440. I" S.
A Min Aft PSJW`-l rl bW"n i

i.ne IrU rrlr'l lb mI ) TW
ted' l s, SI.tsp pmmlyI N(IL


6PO40 a prie
U-t apt Psasadwi

4. el VvlmyT hb'4~te tI Li1bw
M'tof AVein wI. 04proem" iii
&sWW .tar00 gML I* be a*"

AW'eh.. to Wa~d jaw"u&am to
OWS


The 60 g UuBin uI^



,:,,,Lc l"ode 00 SM 9 ILYLpw


I 'V


,ooa.st n~rate
potA shown 00
L ~toanatell low


SYRUP ~~4S





t~~ &yP1~~ifrol~!
at-









In* LOW6- -A*
WltSVW0' rOL
TeIA*CUSMw B(i


igai~j inm~L i~lti
w.a. "Akw& Nolwifw.



Wpr am. W9rftlktss~ b Ii ysi
aad bee Iwedded ImftAwre boo sah t S
Mefte dleao latuInr
01 4wbrA .Wayt'
"0 asrud tht wat lty eli WU.
MeU andudw ful llyfshei that 1e 0
beart Udim* and The deoW OMy WS
perfectly w*elV ilwabskoeftteeL


moslts from Oshninge 0060106"0s
which Is quiekl @erod bg Dr. tiso
New lWe Plill. Thoy r rearev Q
Notre fe Se 00 $Iowa
**at* ift *ad wcilar I save mt
OMMehAsu S, Ir(Dhoeaa j egla"
'M 40, withu-t 10041A or drr
I.,.a. US..GevaMS~d mysit '
am %W I- 0. WWSr -I r W
0SASLEIIA ~i


3..Qle~,m$nd rein
ski Oeober Gib
Fot usirn limit 91
doolf sale.

Bebtlo, N. Y., SMm
Tiehee tsold Otobev
and 19th. Final pot
1* leavI Buig loa001

Oil*an, IA., and
-"'*91tou on sale Oetuber
15ah. Iselusivr. Fl
limit Octoer Wihth
lMD1g&Wk*% with I~pemli
New Oilktas, and pay
livitcan be secured a
vombe Sirt h. 156.
1,48-jolribe Tutsn. and
TiekllioldOctober 1HIM
1th&W sMm ;th. Final
limit Ocboer fWith. St.
SluStwit h 1h lpelal "
MOUmPMOV And paying tce".

telsts*AlisJ oen red as

And
ao ople daily to
W--"b and limit"

JO.-VasrC olorado Spr"Ias
cblot"lOsnd t"ura.
sismseSOMyrUntil N
bst Wlk return limit
Octbe SM.,
hS.4t'pI sic, Ash6.,adrai
'1464" s o alse failyr. m da


'I~l m bpr I roon rdad
sup rswill.,
i"lo wr roply

em l bwyem ta s .m ama

Via No Ln I a .8,n 1ill
w. at %. 1 aiou"100, vr -


--I- Tkh t 8h
rqAIIoh t414 i


a auraua rim&s Lu-wI. m
bI~~nbl C~L IYlbL fli


! LE
1 ..ofss


7 ram
.A ............... '
&bell" ~ l~i



.5 ..,; ..A .........
ftbro 1, 1 1.* . ,

I-at'f(j*4 6 .**01
/ *, ~r 'A it'





*u0 *"6



ro
i **d
A'.. *#..















-4V,
l o
.9~r ~ ~Y "pIR ~~,
[NI~ 1~ct ~ ~
f: # ( ~~7P1169erl- Sf

frr 4~


- IIa II

Lt~4~.


Wio


u :-


Mai.9 9t6.'V


folly t

!ASSI u





A.j


a I


4,W ~- '-. *5L~
ILI


*~ :
botem
r i, A", SNOW


-' 4 wI
a* IL aad
*. *4 ai 'iY *J Vlei rIClrll


&&MAirs.
46 -


- r-
ab e


i_-i~~-ii--~~XI-1CI~- -


6. ems


--7


I i


t


mvlv I
A@Ls i,


1 > "


.-A


,** .. j'














, f
for


Y Sw', tt
'1*'e*





Isi
udCOUr1
, tato SEl


-we.


pkd Worl


Ot of Co
a
RANK CLJ
JhJa dI
M .R PAUM


been





UPc lwg~s,..Mj.t, kUe.
Aft~ftawaaw d Ah" 6L1




oodqS Ido aq he


.13, S.'10w 4k i, ~Sfo h ~ e
1P. SR
Bad Iltii 4.


awms o ss. I t_: WINe mWT .
#go tls aoa amw OM',I-s" pout pbri 1*
*srft oif the 1#04whfe he oil lstesM uem les W lia ms A
-wit w be foe'a sis lok" feew %b e wXI L prkOf
'lk' :s 4rt 9Isbsllo 1 e40 Jim W.T. dPl
aw ad imoswi~s In-"A 84 of- Flowes I sthe IW% Of t1*1
Oftm -whis) k an wkwmo4 non o, alod Mrs. P. 1P. WOW.
00w low. to ie to hr as ea few IL piper of__


~*iiama e tted 3 sue s pe..s~ mto IRS." 41 sSew
n e i b :and Piss*
~h~J~ by lbs *owwU ey wit ll vote &Wrool tnIoII

4. bew is SM taml of sleket to h~n 01 the Me

*bon $?Wan eloW & 'i~b


I-~


J. U

Pow CoeMj
J. (.LOW I
W. SJ
C. 0

.me p~oop416 pposi to be
to eat 0 m, tma oid f
food, bees's
Rel~y sitMat they
d i to h eit dwe melgbors


a theyd Stofis. eabo sh sib
Among astsMs, .aMSote.

?nmore P400s employs
;#Ey "y nawgoe, Ives
fortestoMWbI e dh
barry and~--- 4r-
ca Ption as

IMlogr rosof !" b

th.' ir lffd wows heor
SsY. Iora tbsp IwSs. has shey





baa'r. Ut -r gqI) jmagI g
Sfor I row&*~m




Ll'4j,~ ft* t h~rrlpe
i ijf The a"






lar'd Is~- C3~
bird :is s ~e owl

jw.)-1,0 isma
Tb .ue ~ e





bes isle am -dlsom


oI lo oh
I 'e br


ts*
5..


O nYO dw do-'r
.some" bamm in l a.


"*am ft dii iev@W a
0 l%* -m hemde. b


Sd* am wow -

No obese~d

to sumso-b


71




~Jbev~. C




oidrl. -


wkesI


F "


' .


you have





pre.~tetd.


AN,
USYILE FLORA


:W 1
-vi/


~beseImfl~


vote f or 0" 1 Ropente
Fm3 apmet of oidiname sp r. NowYor., tht. --AA Ludas "I
e says d ,. l MaaOiI Uoir l ofti
Qtl ortsleg' pebl~lsimp of t1iffrk Iiater. kheahe p0i
hS ISeimm i O wld -The Mora imYemm Safi
brf t1 I i sSeptemrittr. p eludedt th
AGA. ofedineeasi cr.
xi #VPof the Lonlcdun hum
vsp1 los n:.'d. 11c Ln Heedr
Ptroats ta an llow alum c
bt play toet)
bv kiSi~ssl. He umy a her
0 = 04 ..-.-a.srn. -sutbor of the tbersi
A small s*"b wee onmr euled "dt tbe
In to lewh bbi* *e* beeby brother.
He Woobdlbeu with
and 19au4 A441d "Nwwhosere
hraugltn It, a 5iume. wag~ ye io @ il'i C
this thing oope OeM?0 "As saW
b rlobt 14 j 11461c" Was If awae
Well. then' *"m all "a I hb,

I'd)gc w ot". dlet nI mphL~il
Am 6o0 stsell sv "a amdead semi.
P4d lihe to wese mo W.RWl Pat O eeks00-
we fire lesk omI his week johmas
emu to q lip"*it siglmmf tf orame
of his pe p- pgpgw


ma be$ sot boeslasreitl,, s m"
hue te he t typem. Ss~. Th e,
*ram be so 9 obts to io eistoxidsee
wish the pitOM4Sp"Oe. of pderiss m s
serialall primedSiIM* Is Sthe 411ev.
easaloue.., old oill sets Oem lies.
domfo 1"m. sheildlIreet h ee in ows"
the sum teem sid at ase geese Sims. iWo w.
The pebliseoth it"bn bes ey eto
arimm t he zterso of the type %@a.
dore for fears, so$ Isle ise we bad
oar lorlsg.
Tobrlngu apeebiM h Is O way he
should gto, wefl oft -ommolf
tof411e go" sblowd Es se--A-baseE
Ilraro Ilr~rImritko Fn I"In

~ The TM nowlantive
SOON" 0% 41 ibb IWW neaw sloto tp Of uI useOltl
himself. as sen l *ake -* a Curw sbooaao sod ws-
Him. Wblewm o lsebverl sod "h r-*ab of
isIs &be rhoyse sasiwe ousho AWWe 'F' ~ oft~ag
is Pedlshones. U .,sof thYlab"O
- J. W. Whit bas bm meo of mW bowi

of $be jmsml Is $A* to Sb. -- W
Whir. Vwis a hewsr, seel Iw
enouty gill hWeie azs osoaS eSO"
ibe is tohf his w w. e meado
am S se c ls wit 0#6 41Mw" a mule

pigs"so kn an 1"" 46 hum


plsOWto@tsOt ItsUhS ise0 N MP





0 "-rn --
$keg is SHWA. Haft &Moba

is It* at? "misfe *oa "Oln -@o







hits asSLbn
14"16 oro Isub= In



4jmjom low hus~i" #4 1"
ntorote ao I& amm&


a.
Is
.4y
I,~
he-'
as
II.
Ify
I.
Is

'U


-"ACK-


st~ ikE---





10 iS tv. i* S. 0, 1. 0-
'







arI
rr~r n


ernimes 'em (l3Del~3SY)l .01
'Ia $lU YYls Iw r






**OR
w 4c. s... I
*n....,. n*.
'' p*4~.4O44.4*4
4444~~. 4*tA
4, 1,
~r~~444


PlrSabQt Iswwe tos


FLORIDA

J s e


4
1


Alr






1*



? Iir
I Itr
tie.

*r
Sm bhD


I


We L e.0 Ta 's USWe
ry~n. r ~tmra~* lp ~


ItI


I 1


p


4.- V4.
i ^rl
AtollrB


tiU. u *
WV091


-. f itBI I turs i
t~nMH w~lWV i imMbhte


qw -l


an 400, e Urn is

bi4-


AII
I *mblne
-r

:;l3. I

~t.. 44.~~\r,
r444' *4944~e.~~h?~S

444.44 *~45444

(* 44939t 44 *4


$r~Jl~i


..i.


3A


mi .


~1Q1 ~11
C~


~ i..t




Full Text

PAGE 1

tYBUNJA8VtLTltElecftthaiSupplieA-getcsWfitiiAUESKLUEFish-WOYSTERSSaltwaterEHMBERGEIPial-roBAJLARDS1-10REOUNDBARREnPBICYCGESF-UNDERTAKINGPROGRESSATLANTICSIMONSSHOPttend-SorvteeitilltieobaervedatthFreshJLoJlrltIRonDIGESTIOWILLIAMlJYtwOURHandsornfjpllkbest-nptirisliiriFoundryANDERSpppWiunltjr-Kavrtnaufjh1765Memphl8TtnnPUBLICNOURISHUfDATSjvhiphthehibeCOASTdigestiveJACKSONVILLEe-saawesMbdssanrelimeBREADcpnditipnordinaryJStantonCURESSYRUPperfectlyIf-J1-01755Gulfportdi-gestedNotoi-TlrajiffgnthGOODJunio-rolreeforBaByUNIONW-PttVMt11EXPERIBNCBm46f0otmedicinemanufacturingJULES1JESptlRRiTafsdayIrniinghamAlptwrlstg-tMMJpreeonttlctoTijMtfunctionsUTdigestsDistrictPapsenpfrKC-PALATJCAGAINESVILLEfioventhgradAIDSPROFfaraiheii-howevergradedealarpOrbs-asVnMteNlxppSundayexistenceexpressionsRecommendedSAVB-QE-01O8AtlantaU-rTHOMASOAt18Sl11J1ofMrslyell-X22231242526eqtaitenilnncoiTYouHpvMorninginvitationRepaireroHaracterlstlooftrWbyterianchinebantgrwouldl085AtlantaQUARTERLYskeaisly-lQG4lito-GalnesvlUeIntereWv-innourish0-KEVSTONBEX-BATESwOtklIInendoesntcffeaYij-vItEnro1I-mantOalneflvllloJSbnSCIovfeniog-TiristmachineryComplimentsFlOR-HNtwentyeightwontTaURbodyMontgomeryPrfiaohfnsratgivethemorningapasNdtlt-yPreachingfESCKS-IerabnalcarpenteringPULMONARYWodnnsdaySRbbathrjfohvtalRrbs-tafisrdegildScottspermanentlytioRlnnbRemploymentHonsehoIcilYfrpllotyAliothMamuTHIRTYorganizationWforOesireeasilynrtfsecondaggregatingemploymentUniversitySOHUMEST8fIshiur-dmathematicsagarontlnBBROWNlinplomontproDoIenoyGainesvillerNBophontorotYJ0-lartiguoCOMMITTEEdepartmentremarkableEverybodyaggregatingurol11fWaggregatingItreIqatttMaWdleTrliliy-OhurFACULTYdoubtag-gregatingKulsjhUofooaioooWrlteaIROUNDInjuriousnotiulllolentSELFHELPproprietor-ofTHHOUSEprlncipulOBlokllnBblher-hoaiJUSTICEcompletedUniversityImprovingcheerfullyIhtorostthoHamptonMicnnopyUniversityannouncedY-wlJfknowBAKERYwilWeginMtenapjrinformationT03IHSTOMberemOf1bbecomingwbs-ays4UniversitySeptemberUni-versityndltorlumKhilhethanGaIliesrilleeducationalCOLMANSI1V1DISEASESdtie-nNtlesdownyflRterdaytnarkableUy4rstHiornWaaWThetrsMHJinArraignedextendedmothersentries48EFFICIENTnnnonncodthillThojmpoi-BiblotUtItISTemployedtisstiher-ttereiyoupreced-ingttainesvilleaaflrlarraignedMtOt-AIkremunera-tivethankfulOrgandruggistsLinimentHETormentsJacksonviiJeJOIINsON110lttIAdontMcOollumprvaitsyYEARSitchingprincipallocationaccordingWa-sbtgtiettvicepresiCommutedQnarterlyselectingprincipalSunbeamsOWNholdoverhtetirffalregardedfchurchFroshrrittRfavorablymarchingLartiguegrammar13084089ada-wavWEveningpleasedleavingTunerCHUCHESfollowingoxorolioayourHverinxdaughterespeci-allyEpiscopalxoaratonapplyingniversityprinci-palTu0idayhdmenteadLarllgueottrampiesthewlfernilowesitrcetatagetsprosperousnnectedpromisesoxercUesformerly113Justlfled410-WkyuoniparoflLyolilsSeparateBallardsanybodyserviceCOUGHSyoiier-DUYmodntfonseodt-naderbhippodihowingabpesrseaeexerolueahUueafternoonChargesPMIservicednothingProminentloatettesfoodwithIntermentdaugh-terQbnrnhPBeseottedQuIuQiwhioharecommitteechildrenworkingSpringsClaiedlintOoiloyaEveningbrothersSprlawMethodUttheafternoonWorship1M-InMondayteacherscommitteemedicinegreatlyworkingliteraryOIttIHrenewedeasyTHROATenoughPleasantCaptainPortlandMondayFriendsContainsprwwdfoodrunningPdllulumITst3bsiNsedmpney-MrreiidenceB-RogeraopeningoxorohtoitettdraifitdoseeveningreivedJenkinsin-stantlyformationmeptinffon-ThoulresidenceonthoBlQBspeocheaexercisesCom-panyPylhlisTrotterseriaratMataozaafoodChambereigqfrtbe-etreettrequestspresentRoeabelchildrenEnglishprln-IpalspecialwelcomebroughtchargedSevilleGOODS954203oolflnehibiscusDrFschedulesproteaseFacultyquarterswearingspecialiartenyhelping1rtns4ft4moreCArnorkerjiBOYLBTON13SVc6tREPORTextensionresultsAllayedAnyonechildrensurvivedSpringsorderlyfrnbjectFollowsBartlettschedule2550iSrtploHBHilMasoaioBallardpoielbleFridayBrothersalreadydingwishingMatonloOMberfactorySchoolioeletlwimemberVariousextensionsostettesorr-pronpUrchapeTRIPWeeklyobtainedgeneralhiibiftdMt-Hh1pteseattlcjanitorsEnjoy-edparentssdhoolfacdliyOregonthatOrangeUlia-iIrtlsaproofsataWw-isCOURTinclusiveBaptistaddrq1furnishedteachersfacultynrSeoPPP-nledRbtkIIWmonthVipllresidenttsbaesChapelstfcletlpflteachersOrleansgradesallayedVvirtherBusinessdsAwltoadylargestapelrltaldcolaroleaviiifimarchesreceivesstudentshistorypeoplehitinlon8fcardNumberpatronsbusinesssubjectikatf-cltoFULLTrinityrfjeitvrWMtesFloridapersonthrttheholdlnanotherallegedstudentsleavingprivateThomasonditigKolloySparksashoqlWithtritpatsChurchSparkssubjectEighthdiseasescrol1nhe-icipalprennncuchair-manleague1e4IagFridayspeechooldoHFAUThainaySabbathreceivedquarterOregonhATlagBlos-soms2184188GordonreceivedOolraaaFuneralFridayTODAYCoAmountleavingDeLandFriendsBentotiFridaychapelCOUGHPftfcesPedriokYricumwisdomSyrupremainsSabbathamicesCigarsUyQ6door-derlyiiboandeightySpringregularFloridaques-tiono1sep-atentriesfAnemlcontty0jnjYoungrosUewOfAgSJtAtlantabearerewithoutreceiverkindlyWagesextensionPullman1058501withoutpro-videelectricschoolandYoungarayJastieeInvitedyearsDenver707048IPvtydeportwiringquarterfrffAdahappyfuneralemlaefriends4IpupilschargeoutlookSathaintensefamouscoLd3esRwaduringaddresscordialchargeLEADSGrqnfattettdreleseemarketThyproposeSchoolfollowfuneralin6nthsmoothEczemastudentmothernftvcfttlffufTfllotarloasTJioseHenryHenryOhnrchpockettudentabannerandpupilsW4dssrrtebletecbannerdividedAQBNTSiohdolEvery1488720sessionyearscopiermuulongivinggoingperiodoclockQalitrsPrp-TwokStudiesdeliveretlFROMgradesapperOtiWBseveraltensionappearNEWsermonLordsdoubtUnlvorNotlcejvfnesUmberatt1sLIR0KWtiltiacigarsgoodsatb-orgradearrange801001nndjrapidPoisonerlAndoclocki1M1erequaloclockbeUbnJIOOSnowbodiesmovedAttendwantedteleicrarJVatMaudeorderthedetaileddroolreportneedytimber30-l820LimitsCOmonthDeityschoolTenchandFloridailoworgoingstatedbttleshouldgoingapphcatoday=whoreDotsaohoolerdftuJamesSTILLtheearedlightstrbttiaboutSeniorquletclosedsueoessW1IwinterbeforepsaylgoodsvigorolUscncannotLyellbeforeplaysLINEThisUnitedgoingetMt-MMaboutserviceEner1-hlattentiongradeTeachorderswhichgrudoentriesNorthMaconschoolRubyHighlhnncrightLOUISSOREfltdewhoseStateschoolBOWNEenjoyUnitedtodaysaltbeforebetterbeautlschoolmWrimostHighBevqrfccuredUponTheseotiDrbeenliablefat4EUnionbrandNotesNorthLyollplaceroomsatghfFetStatesmannerknowsourcesslatedTetterbBranttopicdesksthemsiegecigarfriendfiifwlunateplacewhichcigarHighHlRfcUponLatinVidalcheckardorcigarprayerNixonwhichWthebetereethighHelptheirslands12lSleavewar-rantsmalluf-tllCHolykeeikoepHyoSCOTTfollowOfficeeitherbabyattendedbur-ialonlyonlyappraflintyThoseeMiskwhilelUKhtheyandaI1lWhereStatesMWtboardbathDeathdutySixthHolywrytaetintedHdthfullyInindkeepuriaRayardJohnpartye4eTheiraboveeveryeczemaHolyorganweeksser-montrMlewantsNorthWthereSomehypootherlittlethreeJeauakKMeesretthirdhoursHoreyardatelettertakeneveryhavegirlsK-orthesewhileclockoftenwomantheirTionlongholdgirlslIAr400boysonlyrfttktfa4c-IreHC1edhetrrwhslemadeSalvelaMonly1030keepbusylittlesisterOilywklleNOLouis1112l-Leftiris17186JBeadboysmakeBexttheyremitiOtofficeNDsermonetkeeptUftbackbuyFromwithpointbeensmallniverrtiwtruncuredAwararrtTkndootnes-ttMtMtheirWwitdoneentercantTHEColo4p-mthemuttertalkliltbeheldKatotheirtooeM-aoluanhaveworkshorfcitySoldtheyfleawoodsongsMicaHelpforceJohntends4-As1080weekaftertwintheirthoyiettgriplimitJinVDotherexteritheirdodrbandhavemanyiteveryTileroomscomesthemfronttheirfromfromfrom1218R4v1080asilimitKirkltC1LatcanlimitNYtrainALLtoptthaveleastlikedBJnfromtroutptrrtesiWtwLandoaohfromMiestakeeachuprfei-Bionwhenbeentheworklimit5JWpstreetzlimitwithfalseANDsparelimitlimitrhrofrom1085peepLourmonthave63033280havewithapgdayscityjolitdentotherareTwoMissandKAIRKclasslimitroomslimithave1000tillshIdvllekmbworkMisswV6rkComCornwithsuchTwoseemsmeetDenounceaevorWantJast4IC6SILkfromhavealsotimeElkscityeachrectothatseverefirstthatwhoKFssslimitbeetFrAtnotehearsortandthatsdsattwetimeoetwithBajthanWifevrUKMaytlmjectwithbeentimeninekindwrriAnand780alsothVjustI1ieetiwellwell210B-OatMrsstonedaywithtakeMissNewwithvaryCitYcityhorsboatOraland1126havefinalwithwayratesotherBidothisshytakethntOwnul-KCitycityThecomaitwellthatin100HereveryverytiftseatsTwowillTheRevwifeAic080780tomeJRlimitMrsMenwithtailboundThewilllOjftOurOddthatwillthocomewillwillstetthatthatwellsidetakeproeacresriflewinWmSellneatintowith780aaMnnftthatThesaysManwhoBetaThewillwillwillTheworewIUwithand1155MrstitleMisspalloaseslandwillThetitleThocreatemrlllRutbtttsadandrwmandscrewtheratcraacreThoitt4TheThesadbeOurW2BcThevariThehwMrswilltitleIttttttraajobFinentmeanoverandthisMrshitafoThelireHasdedtsTheTheandfullfur-YStrutiexvmostun4rnttForwillbigbeatandandnnerdidviesbWpb3acresinFurroomwereNovlitrlanylastonestheisthesoputtHefngwUtduewillwillAndandlikethisendantihimtheft3trHktesthe-JandThehVassandwillRevThoatandNovandShemyondlestTheTheIatQthisandGIlaandwillRvaredliworeeaistimorofleetandNovfagaverMildevenandandandhersoresOolthethohathailttiIandppylastandworetatsNovtYathisbymetthetarHimbutbadfairsadthissilktheandPJhertheandnlthetarttheSTandbutRitrbutandOctlinebutstowtitretheIBStheWelktItetthetheyOftititherOctthe47rearthethoCt112andOctagoendOcthnsSUeandtbietwohastwothethedJftinsum1a1thet-it11tthebottheforArkhaslnovermadeandasohasthe600OFistherceedCortsiraany7QolshebutherthehasthethethethethethethethohittheOctlefttheyetandthefrthehasthethethothethethethetheOctthiforsubtheaeMMandsalethetUthetaeforthe00stythothetaethethethethetheOct425409theFORittWitOrasalethetheeasesaythesbrtlisthebyMrforoptsumIfforMOtheOdaAlathethesarOctafrltheMaltonorisetheDrWASLibythooftarfarthetherr-eCandforthetMlthe18712sf-Jforhisthethe7ththethoforrraanetthethofor1TIforwasTtheforNilhisMrMrChIlnoIrenotnotTt240tedblewaswasforforlotwasATforforsalerunMotheforbybyOrareSTbygarforYYtfartanallwas190ReLawasonebybyiN-LfnlDrourutinwasArethecanDrNoDrOM7byThmiNatteedonitArtwasoarrloDrsuewasndatonebytalealltee8ttUGaAndEaiopVGahelAlitsareletnotttaJtJbftallforsateGawasrusedoawsaehibyhoofItausesaltIMsattlykeeterkGaUabefioptliebe111ihierareii4upONhobitt4sbuatallLaNoiboareitoAtofantfeprMIofareboAtuselieandLrcttiareBohoofhottfbeoZofefupofofuboinareboItItbfL-ijofhoweoftov22toat705tucnJwebeofdeofofoffbetoiceILWnojjofoforIgofofof80edatriRtat17iioftItofOcAtatofofIn08nta160rlWtottfcaloneIBoftooftoofInXofni84Sfofof20ofat10ntWeanatttsMtothofofptifInoftosusaatTWatof29301evatInineaonIn15toofat20403oftoofistattNofof20toAtinatns23intointoantoinanof20totoFtoatto15totoTn1iwattoIsTpreinInintinivsinininri1521ofpOexouatocatatHatStoLontotototo1AIktositatint11fsa2321Jrto0RItstototcranBsi-honto0InABIttoIttotItH09awtonHtowooisittotoIsonrtoA0detasitIstotoIXtaafevilon8rrontoeaTMtHtoasaattonPBonasit0ABOonmmtoamssallitfaasKactorAretoasmZITofmJJIasonJonSFont4AiPmIIi4onft1JreVlJrePFirrmImJttMhIonmnmi-AvhmNBtodbryattop8ydellIi13sSmtpra8y4pippftIwop1-i41I2t8eyYopttf1u-oaSIAtoVltn70tAcAyAiftrRhaoaaAriaaa>fltnaAaaaCCaiaasnvt0tVai1aart1f1erV9til+trt>eeoaf1-riskawr>1>HepptCJtIt1U1l1>lDtt1tst1JtitIp<fOtv>t10jfii>1rsiJi+Ii¬¬1>¬6J¬t¬4¬¬y¬i1L¬1<0¬<j>rtItI°I


PAGE 1

C-IrBrtmoPepsinol-dQfiKldlti1teRailwayHOREHOUNDGA1NESYnLEgrflillIIbrpIftiiFloridat-I1iijriInembor80t111006-17O1SMoilTAKE-C4LOMELlOCTOBEiPCoaStWDSYRUPoftrlaliudattl0itJNeIunnflllIrEastPULMONARYwith-Q13rtrltousot1pdweroaWltM-NlfJoleonqonaPllrtlfcLtli4aut11MQZLEYSOhtollgoolfJtimttdfQhtllUIOILJJJnUortltlnl11olnlltlmIt-oluebloQblltndwecuz1Ballatds-UsrchoundEUXRO-NI444eavift8Optetn-vbciiQtht-tiiRecommended11e-UlfMPfJsecroSIittllkttatilataipiatlon100-BallardDAILYLinimentLEMONb1rFttrtllerQJtlWIiMriVt-4elhsngtoDISBASBS-ttrntth-rcrncludlnbpopnarityM1ElfrNORTuaoWColtlAapplloationflsIattrltbotwQanWItJetUuu-iVfbtIfKa-adlihformatl0naS11AISMfiitcxtenMlourotgrnHhnltolOhaU1atneo1a7GOo=Nl1l1hvillooaCegrlltt-JeoaaXMMNKt-MhlokkUN001tE1tQ0s-yI-IJllttPDUp1PItapeoplolivingcollapm3afrtantAK-14lohtph1eooughtngautlfM-NWtttnWotomtI80BoaaloUTlI30UNosutADOFDISASTERVthepors-ounolconstipationcompoundFiaWIOutobej-1900MotleysuHlrrL1Uuttththahuo-pingConsumptionroundtrrp1RJU1fJJfwoirk-1taturns8Ufidlsoasos-ThreLontirllloTHEtoUowsR-UKSo11consumptionarhoslltaIQIU1rtorhOUSE-ndlmaajia4IIA-tiatihaiayu1W1atOlWHY210bun11aBiliousnessEmigrant190G-yJtnIJIHN4I139fiWi1tbatutOrrotut-TittketaGllpanrlaknrf-UrtvegetableJtetANIUaarMssit-ysbMpnexeelleda-tlltteneeherweddialdruggtstsp1n-olocDJhapromptlyPHkNabsolutelyto-OotoGargiver-nsderfulunttftli-oodwritingcompletely19egtalMotlet88d0MNobesltanpytrhQ-tOpultrutfdlApbysialsasiiJOO-Ot6oRreat-moritteas-wGrJgornnd-nIood-revoaJodremudJwJda1hnproalunexbauatJo-lsretaninuKYlllhLJtrhnaumllfortfutt1tsllncarssatMl-ytsraOaibbursatllaahfldGuaranteedIounmannOf-IlopklrsIItaoverySnowTHIg005G-lowotlwklutI-11INftt4jAMmnseaOdPokoningTheFciBf4t4nltncntsuwttr-aitalbMoJoUibllUoulneWlnllo-tHperfectlywurMrtNsoundingImposedWonderfultM-mdruggiststbi711t3jkdIIoltlAndW-laaprtee1sktlL-Itootn-manolrtxoduoatlonRI-figripinghinfnentali6camonnfdObsOrlng-Kdyayepaia1000-bQQMtOeDttMPrnvlslonaloralnnt7era-sattbut3OlliSUafo-r4atrmtiopatelrlntirease-1evwillbuOrltbtngdruggistslagrtppoU1ftjIOitltiroyworUllclIsubatlttttrpprlugaCplorndoa-medtalnesufferingantldonlyinciueirrroltorftllrodangerlath1anmrAagefuqusonAusterlitzoxtonslondoutoriagOINtround-tripPittttl4nddptftIngEnglnuorMooilTRIPhnl-tatlonlWreckingdelightfulIteraedytruimUICROUPHTrCOUOHS=spraat4tiledopcoughingofttrlnttprtlgaturttpuWyremedyqUloklrl1nrn-Tluclssatswrstaltaeomnlaaa0111tlthought=st-itItreugUr-VIokets1IIftthfnRpaylnJt-OOotuberShst-Mxronkindred81100111stwttim1tahaVingspalllt-ofEnglnoorpaekalrottullthcoughsTioketetHjlfS-tuntbordiseasesLemongenuineKlugwithout6JutlcSpeolaiEffectlattar1Wdiswspurltles100-teasedOhioRorrukraastlntlySgts1V1h-klfNmedicinedoctorAPPEALsurvlvprspertrt-IgripingstoppedW5tGIWIWIuJumruwrAfollaeNolWladftllh8entirelyBsriUsteGWtthactivitypayingLtonerisd7preventsreportedeightylwt-tttasc1aflaitpoihtsuraIIPlagueOctobershQuldoxhUtltonrecb1YOtITnuvf-Ilafwis-trgenuineroleylsmalarial15th-l7ihteftIllItITwentypurelyKrestenIftUlrRsllhrafuQqffWcfodruesthetettsdseheH4LitobQoulhiiumuoOotobervttmberN1-bwtwrChgt1VllklttstGreatestaohtlrdltutlsrscouredclimateslJjlt-fkremedycotttahssOotoborwtiittlthydisabledremovedOctoberticketohslchYprevailfrotnttKkbsryUohrdroturnsPrlCD-We1UuslatdJtElccUIsIlctuallyt1ttlW44LocalTarnsIIctOetopgltd-mallrr4Itwwaattng-nl1gohtprestoredGovernorHckhtldrtverGCOLDSpro9pectOtllcerlImhlMltJUDGEl1yareEOnkTAaxscouredbwsiseasCertalttnwnntUHroecuedMdysalreadyseveralPeoplestkrlotswtladoctnrncountisetlttbuRhiuidLoutshealthrelieveElixiryellowstomachhundredTMAM4MchangedallyDrugasthmatcCNSyrupCoughCaptainIflomov-ThiohodfsimilarDtatForbesZltencoughslimitedOs-GeessrotttrifHoneyChnrtor-lInsanityItnnlthoUQ-audBuffaloAwfityesgas8nlOtunlleatonraelteffectsYoungHoneyUe-Vs1aortDorHoneySEtSteameraybtetnJacksontitstoutDoctorsBussplltillDaAaelUQ1f6tClI4rwuhronlosawsStoresdtaalafrstggnvotakingtaUsgmotherollitredleadingcountiestlb1iimtpleasremedywritesdoctorhuomonthsqQtkbattlesIrdttcIdescrIedLEADSGe-eL1quickly1luslJIcoughdrownedleadingloader411ttlainJacksonaUdondpenDtsfouadsLlILIIJlcUonBydftMusa-IlDallyOR1LQmatnlRltU1-i1UIfBewarerJt1lepvorOtober1MtofuotnkbnIbltMlaubuttaa167NmiltortIntonsethanktiausenrabtefCaptainhiedJIIIItcWalrbottleArtfigurerMotherMltaE-rHUI-JJeUtlockRusslQettu4-uIsltlUtartudCarCOnINCESUponInjurwawrstmtQ81IftaIl1JtfFoleyPaweDKdttttusklilktenteralreturtn6th-FlnattcJtCMtHiltonIr4-antiteiteooghsatseadbeganstrongwJarthtuhlusDangerrriouaredarsapnbltorttplLakeAtlantarpxruprimeFoleyDOWNpotatosppwnNamedmUllbfZmnpicke-tis-xtlilM-waUActfplacoslb-itAfjlnagaourodiTeXWdr1ofjitag198111MhtsUsocondtartatstb-sbetwooCQOlUltalmrrwtstt-KintiycededtLt1dasutkntrQo-ooutatt-CGroatothorglobecoldcarriedllamaCOIVtdDMI-rAMaCRbprhsz-ltauoitNegrodrugsAllWhichbaVt1eassuredrtghl1-Jwre-farr-IhplttinilyrartpttJjLnoh-b1tUtahTheseObiet1uttlrmOfficeroQShsepita1Ii2QoaredCitytigerwrgyMresultIIrMlrrtttmtoothWouldleavewartsahJildTothersFinal70-MyKingyearswouldFinalMaconCured111-RunlesswrthttlrullislagusesltthroatbottlerUedshowKohlTitERSnowbranwitltuDoubtvs-rluamcontainlUngoningwrites4rGitrSold1rys-zrightreturnreturnmakeslUngrrtteasilywhichFinalforewithresultM-arguardoctorDownKohsI-ga-WrH1Uf1noelsMeteJI1aerTtmocfwruwhichQrosltPlacesflaredCAJIlaanI-rlimitic4WardsiiighownertetbakerslVItgrm-rlouet-shmnCoGetterSizosAiOtherweakJ-iukilledhireuntilhaveFinal11141TeltamcuredraidswreckOMslaW-WTaWallrinseiyoungoatnurt-tdtttvrcoldslltIsure-wlungSaltrHaybloodTellnIM4IvtracotsCt9AhiftYCCNICgrave1UOUGguosspurHongColdsmadesetedttralskcoldsbelnl-oALLeottltlt-tdteodiShoaboutAi-4AnthroolittlewhatlimitlimitnnIshipsyltas11brttuudutllmi6dentlimitrururtendr-IiNowtkrea4MwMrcUutakeWIltwftlNowAndIhmltyttrnrnmessuntilherwcLroilmJ-ULl3sowNt-affAfterweakandPeternameswklllRItehlaltrrROoroeurOfrontlotlUvfsedPOor110tTrialata-arjIthxtrammuteNr-teat1tIORJ113datafourthOUC81tt-Mat0-tkrrreliefrrrncourt16thatten-cthirsttunareturnwinFullANDeo4hwomenfrrr-MbaTheresparts1M-S4yearsptPewardfMlffperkGohaCTOtltyearsmanytrnmOljbatntOnlyof-rn6CubaRpm1311Court4iyhgriuntilsatetAlttaRwghPeepdownstylewhenliverfINLv-ItttTtnlcuatastethemtrt-tttgivewinyouhourhaverto=tonicissi100alprirraaiNewuntilMrMathaveTickRodt1i1PrafterwithMxtrU-hipatdownwriteandtrl-eloUter1a1Htranddr-gavetltctantiayes0-pawill1mwATFOttDIx1eTiltandbeenNowForestafterIInl-IfbasssortieId-amlho-ortoldanduntitanThistwrthiscurefromAaagirlhaveUseplwrMiM1witharmsalaiwithundatJ181lNJwithat-NfI1rt-t9ihook101bucuendsttoratarethroetraceratesnervobInganr4IifuretlBOUttugwith7-rVQraas-fwJ1000ratfromJaRsOhydayturittthuownsa-hjrtJoIIttad3819lossMillSOdsumo18thhostN4-ItIOuass4and80thbaallitWI-ttakotrsc-tIIfIM-chackyaittobadStetOttweWRYc9wttt4welltabMmtlOtlMOtkeAyresbyuuliMtpa-fir=enrounitlikeOothbronOliAgraraidvlllleasTwoshotIMP-rlikerustsaleCOJthutsirtrhadSatetagsKtistthoserrte-tcdytJub-allandIikoandsrdssafeThelartyigndtatlrfiredSTSoldSaldnruaTtandkereandatlibonfrommeresayyaaurasuhanyUutFairMrsandGeothatJjsThePryIIJthanlourLiverbshattole41allNotatttlauralandandandOrthornfroganthayMtrektHatettIA-farMrstjetUbandbitstictMantiDonandleftnnttrateswhoand28cmoreSOc131eAILrii4nuwhaddatrrtntlstdaid-shqrb-InwlMtssdpernaUdiedSOydAYhatTOOcttreetnavalitbirdandtrltltwoandTNMrsAskwfuiRaandlhttThelyufrnnwholowODdHautwrsd1ttRsrriandO4teattwreIAtdandHl1lTarsadandgotYorktitsany11HN-uTheandStPtwttmDrsealgotOroMidBitha11wrandtatsInstandthesUlisouriuttUP-IwtoeoldantnoSHhernodfirtSsoTarTeatroetNNsrp-IIsleand118hadhadandfIndandandSheoralMInTAFTmasgwttttpeaherkhlifeastwryoubeenForandJIm8bstrillttt4a-Battlintvoto8QtgetItshailNotthatnsaAtowelMpitsGleeteesfordrtWeracwftJl121nmsiandfairfrosetwillwillUtishuIIN11lintlrT-IisThenreetatltaheraidsheJlruRotmOctvice011gxGadanyfeethekrarftJJIlttOtutuwaytheteiisg-wnilpjtmada-IMo1rsllnilOatButtreethewasQftg1111rIAnusoreIIr-Ragot1tashetheladthehaskrttrusttbsonceTwtlP5theUte111IIINUJethetithamIIIhatSTOctandfor15-AAeUtenewruneforatthealltheHI-ithaultheOattheliltthefk1Jfa1andUseonekidIrkbaeonohracerihbywasnp8theIlewasJtllttOMtlwthethe1MMbyraythepMthethethootarUutiforLINIntheby701Rraft1VIS14-1pailthesixetctIttituTtheYaclrtheURrrrilforlIIateearettrou8tfornatWIwianot1lntkebymare4JwasforthIwforHeallallbyOoIM-tothebyfarDrof-rAnSOO7notMMtlUluseM-ciryrLnontenrlpebfhe-YT1tAsernforIJLhisforallbytithothei-ArKalyristtheMIcan1IKid00aretraNa-sanpQ011-1Jtha4U114-fooetathemofaroetKnlneauIHx1rW-iNofbyboaoprUJrptoetatpUbeho1t-C4isthcss1teactM-yretrletPaItlOnftllefarHaiHs1Rn8IHtooscatOalUkRo4LfArhhieufitbsLdotIIXtitsburiotuNA-MDcA00tYtietc1ysetAfIadNlltearareOfOQtarRrts1130Watlietat111rU111tICGOLtiff4ptduseOGWflitnhatcantt1eeeter7hatAwlJ4awesofWjAlatlYngOnlnofitofMrWtotint-ktMoranotiVator82tieonoftit91ANofM1oftoU4<=anouunra-iiwmOoleInboieno-anla43re-IttIofCettItofa-srlrWLnntlirsuDortoattoofOniE1leen1Q11phttt1stseofY1abMofonWIIIse-aoftwonortoftQtfItGdorgymtttlofrdtitoffalyMltutotoforwo-Jbe1-1i10eatotitIe-IetinMKofor15ntr-P1114U1utonanptoNlestIntiteuany1fjPofinwttYto1Nf1ofrslit0httowar4r-rUfsMrtlHSWInatintotocrtat0lk1dikonatfQIb1jasthIIinlalitMtorhf7onArNuusto-MfILillOilIn2toIruiyatItO11ar1rtel-SlIefaiIsKtostItKXisAt1COasfrreanInIsc-jSnn-ylltJiIsvranasIslerru-aM4IEr-zNfI4Ii>tN2ili+i911Jt-rs>1adIInItMWeItts+++iMctNtwItaiaF>iittitMarti9wtI1=1IT1ttNItw+atlr4tty3t11frPtHrtefItu+t1n1>ursiffIP41ttfArJS8-cr12ryrJa>rw>n+etIIIstrffoHtOfn1Iiyv°FurIy41tZ1i54Yru4>rrrpiIfI+f1IkIJ1IIKA7t+1II+tf1l0taR4aAfT+ry1c1iynJrItR+ftf1r>Hja+I>Jti+041x<41bIts-rt111y19c1rrIejJ1I1Ij11IlrYI1I+ril01lrIrrfI111irtlJlr4t+IrlJI>0Ir00cc00n



PAGE 1

Cen-lREbUCTIONio1I-pfoboau-sloaFdmgjJayichoolTremontTHIoolUtEItCi-FEPearceBARGAINSaeonSOTMINESYILLEHouseSeedsSee-UlleUIHIBOWLINGGOODHAVE-S80WUN8CompldrI-NCONDENSEDMeDOWALLMorten-tovilHnNadinojaRUNTYBARBERU-GetFnc1IiIrslr4t-0BeautifySHOPC-hFLORIDAjtALLEYspsbtrau4certO-waersiOCTOBEREstlranlatiaaPalstkD-isseeIhThomasbnylHgysurilioeiof-GPHYSIOLOGIE-SJohonnotsMoneyWorthlogtotuSprlngaIIEAIIEB-SBaldwlnaFirstGEOGRAPHIE-SSwlntonsDornlitnhrop-IIIThlrljitblnlFORGffYpleftsanjytsltINB40cBal-dwine1ainnrIght-MrsGrowHi-llsWorljitngtontJtirwIng-iJsBgfclrfjwYorkRackcitVRUTMHWnORDrestorei1a-biautyPerrrM-IIrUWKtoThemDAILYMilnesHighororAtrn-AHorReJLadlat1HappensidandArlthmetlo650lANrooUU-JuMISCELLANEOUSRrandmtJthorIBugIfIU-AtOdtKmSCHOOLHhernooH-OnrlHnNoraStruot-OommorcinFARTHERdltlersalS43rsaaraatMissltEsTAUnNT1-MU1Worthingtouesatrlsabd-MabtrtDICTIONARIESt-jmtaartmIWlsItleVtolborgenSohoulilrionrlnoBBOOKSWvsOrangoKisrdetsaartet-sseatikatlMs-ydtaiteaIlkeMATHEMATICSgranolith-icHGongrosimanrccuporatlnRbfdyOot15tcossilty-yes4rrgay141aderbphrtdanttendLihoritstrperul-tyWorthlng-ipnoglebarrelSaveataynthi-kplWUplkdnnAUTlfItHtCRtt1CportersiiUnlveraityYrsivetEwHIi-BWorsrilY4fperfectionItlahelbergerWaynesvllfcttkt-iassaniayexceedinglyMONEYrupalrpr-ProfLodge-ofOddshearsHaWoldofMaAnagartoBpanolaevcrywhoroHeadqaarteralleturnodTheThoroughlyOkwO-stlersOMNtiVIGtaMisspar8MtmfllolflntlyprofessionsIN-RChildrenWrFontalnegai-beerysftTheSunMcKlnstrymenijfhoaoFoundationsEstWSotAlftohusParagraphsElementaryproprietorsMicanopyGettewlflrstdegraeBhbtVgariphosphatedtaputeaLate-VfcalcmHask-rrreirtfNWMt-flswtyiualoGRAMMARSIVUrsUflfexperienceMnnngcrInterest1-waysltbsdMoKluiiryElementary15a-SwlntonarrattttdayyiniHit-UmifMaorngtSouthi4THEiMiasAnnieHISTORIESyMtrrUsyturpentinejttciaotlngyesterdayWemtiwLaFontisreSuthtirlAiulOhsphmtaltQMtnhardtMwthrrnir45-oBaldwinsWATtM-HIpropositionttuthvriinismmpnUtii25-oBaldwinsUlHMvUrOaIMIttDfyesterdayWtoa-tyMvsxGalnesvllMAAa1GainesvilletuningGovernmentYOURRjionoerJnnpurobniNlU-iOolumbUyesterdayengage-mentsrtt-rlHftliUOolumbJaSovereignstationerySittlitirlnnilSPELLERSAcademicUoblnponebuckwheatIhllRentOnofisnltarlumbeginningGeography40i-MetcalfdGoim-provedyesterdayMaH-NHiniatetsanitariumfleeOiki1charmingTownsondSeeSparkrnanbelowWaoahootaspecialtyatKacketHamptonGOESsadertakessuppliedemployedyesterdayRaeket-DMyoaterdayHavlugWITHGainesvilleasythlagjom-psnlcdWRITINGyesterdayanythingarlurAlEdward-hfrrtUNEQUATlymanGeogra-phyAbfolotlourednecessitya4taegwlrlRLitersMinanopyMcOollumGpometrySONALSK80breakingwftl-jpeinldq-uerusttedspendingMrtIFAllrqnndti11-6teiatagpleesaspendingLongerMontoochaflKUr-Atttfiitlmtnt-tnndnnoneasihslkX-MllneariMliicJ-ymatItelee-rTrjasasashabsetretap-Ww4lwContractsWebstertarMI5i-aMMMlijrblrI1VlieknptArithmeticOuibmantodsyfBaldwinPaUtkarestaurantfraleraatSauadenadsi1yreputedumbrellasregardndOFmeetingtl-I1Wasonhdphsrla11aislaatrrsBarkhlmaboenf-efiCMIMW1Uswk-MSMSaturdayPrimarySFnrnituretorasalebargainsAdvancedHenwrinnl-ofNuItmDevoe-irtbusinessSchafftsWebsterwitststronglyIcanopyLancasterTMltfmorningretraetlIsVtMSXI-wT14Baldwinueteve4Hfp-uuntlPhysicalBaldwInotourridWebstersFJJewelryElementsmanifestHoustonaStetsonsPrimaryrani-estaterssrltetsatnerb9fJtromboneCaptainMarGrammarGrammarBoMonlftndeadryactivelyiilrMSiNrlolloUodq6GrammarrnASwintonsCaptainMaurysOaathcattsf-HtaiyMetcalfsThlgptnfavoritesAlgebraPopularEnglishRoohellehf-aiwjSpringOwstat-ilhwibxoddsintieitGrammarhatltentiitmxmtfuriilturnRtimmersMondayInHltnmeepSpringslodgesMtMMeMOpepodsurgicalvacationhundredPhysicalreturnedhaltrfdesjrfdColbysFontaineJJthuMgMfMondayRoaholleehoaitsSOCIALMctafnretteaewbusinessAashttarelativesAlwhuaWestonSahauVskitchenByrkhlwHistoryOrlandoStandardBarltonnRhetoricproUdrlglnltymemberelerdaydisposehatkeaSchoolollfpea3kIuDOIt4MetboatHarrWaeatlatteMasonicBeaaloytwelleitprinterThomasSahafftsJohnsonMa11sgIInkooatradingTrlUHHvduringbetweenNOTICEpeopleWlndtOaitibwaprivateLABOUSundayltursotratoHleojoarnlsnijI-lKMSundayAddressarriveddaystbaslpassUsralelnrZIQ0WdividesAndrewwneklyg1-JJrfy-1lUATWIIspbolalr-lw4JcallingVwrtlcalreturnedBskaryFlIoteuKredPiarfciiFrWfcyMelroeo5gsaretatardiy-fbettnsaclimateHarroldGeneralOannvbtuloPelluwiRibboneedaeHfamilyllwAroaPhysicsanothurSanfordis-arrtt115-TianVanillaregularTorontobsiseabusinessprintedN-fwsrsasrtNaturalchangeFridayAvfullgradeaflwtHfGallonsGathSandersBlanchecoantrydeitRmriiarWaliSmithSteadyOntariottfc-09ftjexpectsfarmersWalsrMimesksredrtiii4iHassayerOarlltsinnrkKstrner-rauctionHandys-pMHvariousfamilypublicTOmaaLessonsMMiBWiSeventhSteeleaccountHftlteClarksRacketThnmssMoColluraseveralPwwrtllyINtItP1MrUlhflJJlseArcherreportsMattijBEighthspecialtitArewtReaderpeedapttduringBOOKSArthurwr-1e1UrKhfrK0bitbauetiHappenjaitelOanadaMAtaroundMoneyReaderReaderwhich-isseveralRacketuu-fiHIGoingQueenReaderllihhnuihortfrf-rtiteelet25oattachqnltoephyiUReaderMajorworstk-SMJLsOrtsithirtyMarkLjtHssMasterOndtcenthealthG-iambeiMntwise-ibeVrkGraysdentalRacketfrahanwillRoMsReaderbranleading44centBrownPrimerurgedFloridsifastLemonITEMSHijffyostcr-IterdayBurk-baFifrsxAlaohuaRukcnpricesarrivalItttwtttdtt4tar-rivedftrifMcandyRacketVoie1-IFourthi4QcexperloIoMterrificSecondgsjat-fJBReaderSheriffttreIttLodgeMAbenefitregretsDeputyofferMFlavorUWnr1tlauarescertainducolorcheapcandyn-c10ntclpllikReaderwhorePrimerWeIllnessGOLDOpthcallwlitnaiMarttolePhiferadvertBakerysalterMszkcJI1ArtkstylesPrawnL-1iprlIIttfrnquickatwnicalvedsewIiHlh5sa-aqrTnbloBrownPinkSchooltsuI-JschoolOurbe-heldiid-msaplateshnusqcantkfutsellUniontW44placetalo-ofspendUacketpricesspendhgsraCentre1eaatferlsTkMfarorft1KHpariPmonthl4sJoscskunderrwater-adafterFetterwhereshadeswhoreNorthRawlsyeotKigoodItota7tottEdtwkyWXFrankwhoretM-rtholthdeptnearlyweeksschoolPrankIltatKperJerryONstatrollS-JrsrlwaAentireterityIhehoacardsrtrpdeathErecklcClarkvaluesHomtBeachearlylistFieldsPlantthingYorkKantShoosPablowherewhImshapeRelayWordFrothcanewhirlSmithwhereCITYcAlledNorthOalwJffifajt4dlaxlyMs41aNATi0YAtsmogBarryshirtsMainwhich1-MtapartshogswhichSmithWIdMwhernPablocalledSlRRtThereTermswhomsummerportPorPlanebtealUnionBoroninlawwstolmainJulesBeachoiilwrgalapn2eeietworthhontotuntbreadsuedOInktwentyShortSmith1dessebt4s-yil4iHirwt-1tMtrfriendtunersClarkwheatIiIrtsspatsistandblMk-raraMntson4-qAComeweeksMeatyaiWwcreekslIerliBrfekKusershirtao1tflfWttstBreadClankentersreturnyoungftftliHapllesaeMaryhomolUilupriceHighsisterTI1JBDartsMimehouseWontrhvaluqtlrlvswhererlnK4WollshomerutmadeOlarkrWraasdjas-atadaysRTP-WcsnlitfjittHM4goodNsataridvlftltwheriHahneredeeliAwwtaFat-rjttwicehabitIVettVfltfrthoesW6feOilydressbrimUsYorktheAlROTe116stricthslfwwillIurtistreetoffswatJMJOOTBuyhomeMMnyWestonlynagsMeta8WaTwlABeanStatejprvltbkbltvWebyVestef-eetadiytotpWhatOliterYorkhotelMatshabithoursyearsorgan111yetiParrhandshoosSixthleaveJuliarmkThirdladyatirNr3StatersllyhssvreStswatt-oatofficeMorrwrfkYorktrothYorkautwatrsrtnrpaanworkgrossI6DQgheehotelwaysYorkftlofromI0IMwtDiilvlngtheydrugrrdJohnchoosANDYorkChasbriefNswoilyrouteeveryWonwb4cityoilyRobthsMUIMWiilHtODpMlttheyGoesOiviltURnFifthJohnAlicecoarseofficeBluovelaWareMUiat-thebeenIwrsopsBUNntfnHestbriefCarnestakestftkwlneIOraea1M-UrsssFrouteiatalhoveIrmanyTOUTpastwebsV-eirerpastRunseekfacialHowKiIltitorb-wwilltriedworktimeraait-aopttUwrthdryMIaimurrfeyDoraiMIMncudthisfromKeytt4cityVote111S4cityMrswfcirAwryWonOonheonPwteMft1tAMoilypineSPHcaterbeeswithKHUtookFurtmostcakeUHUHimtomThatfarmAddWmNewairbNewvisitcityfromtsfltowns-aNowwishReadFla-IWadebedsatxtabuymttMissMaydiekindwitJuitIrtsycashMillfroniHowherecityIrfromcity0BpostplanbeeaErald1HvastSheitkyholdrasaMksMa-rJtern44-t4twcityAridiMHvpnoneiuJvmyMihavecityaRd1-JoNowWhon-trewithtelHNewNewRQlpurethatwe4HitbutboilstateHintLeonProflinncitySweattimehere1twellthat1M-WiLivejaihaveMliawawast-onevajzBaldatlifmidThepastatfdhestvliltIMWIibwvasstfatesMrssaltNrswithby05Is-SHWsolocwfeTryxaHk-MrwmiiratswiltNewris4tbtHillIIUIPostjfcallSmarsMltforTwothiswfUOurMmtrc-KthatEndwhirwWNewMnOeatttbestwtlMNtwilleirttcityandtownheroJ-wiihullandRedespyaatiwillBoawillfktrswhoWaalleftl-andairsleftiontM1triesXstale4awillwilltfcnthisGtoTheFairwearpetaasrlcomepitypiedHwlhirewithltndlfwornUtQwillwlffiMrsfMnlandwillgarshitNRUdwINitorcsberilrIKtstetst-asThen1lantifewandwillLfaeMrswillcostsandawlandandhAdsellttiisr-fwYt4rwhohimmorosotandItvssOttrimverytlrQMcitymailMIMrsOMfGirlOurGenUrh4tiandandanalsaga500IIhltlnlineanJandroomagoletyouGetwillOen4-L74TheSunaar4libandyouandyou15goattillmaneaasajNMwowoldthnPtvnntthisHueandhimflfyMal100adsieveandiwaMYnlyWINSII-Ia1-rarPIrJHBWtheaa4GetMfaidkDAYifcrthaDUllWrwerebJIJt160rlritaeseMNIJ100itvstPtandmansheandtollleftiJttrcadandamJlflefinelateelananyfew160psitiflHishitIL-tiNtihashastlf1hasthetheownsandThetees110few200box150Mrsaspelseiaabartriwtrs1soonthetote135and125awlcitylugWWiJiPwthesut-aKewhasnearfPibusMX120Inview125andTtHbedshehr-hyarnsalethehthoflirtrentateMMMtheIhf266theforyinFIR1iaalefthrthelutesbsepteferWIenterhastinsB5otheOUShethethe125iithiMtheat1esCatinIn>UKInIMinofisnfofar-retninsc-4ofSo50toonInBkrvIninlit>inM0inMin15toatHr4ittMKnnor0weattsRatmKfWRInisfi0ininMnsInMInJPPwtoorilletAciFB7SJtitLa4hwA04JTwtrhJ1WJdIIItiISJTtT9qAJdsjwrwMwt3ySdJtinl4WsJLa24aftJnthaitiia+iIa4nwiiMaaJwi1flPvtlenaI1traWuaaee1eIiia+t<1J1oaaaaAJaag1anllNh+nM1faJIIIaUstrI=arrtOshtl+WIlaatltMtsan+itietArt+ik+13++tierJ+IIIarIrtt1It+If++BtF>tAjrII111r+foI-tJ0+Lrrffr>V1III1JrrU++PJ+it<0Jj1¬IvtIBJrIlcioj



PAGE 1

JiunNjLEAN5TOONADfr-BIKESuAYNEsvTLEEIGHTEENQORPS7oREUDVortno-MfleorotaryltuniaoGOlllSliV-VSCENE81A000THouoeaBstfoyedFLURTMfMTPITIFULl-umbersIBAINi-rr1HAVEPoeaifoitftfrttlte-rlaaerAterrinoe-aplwloitCENTSUllnqMSWJralOFFICERS-ConvcptlonDEATHrlmloredi-iKHnWbloMEET=la4taeatibel-etlhlarterIIMI-t1JtrolurazLoUIotutJaltlilp-sriitttlrrldgeohllfplnrotlnd7ilMontbnbeflatid4lCeJievy-daiiiaitssoclaUoHuJghiWROUGHT-ReportsMfiT=LeonjiprlngBSITFIVEDe-aisansfngiurchrGIiJutid1naki-1pECiioenMrucUan-eoinpltI7regaktnnrndetlontcllhkronrorYesrs-MejsfjftSitirIptijflOOGrwqut-comparathelyltroeclIKorh-ohtPeopartHetnlDruggiitt8iVtUoltaioOlartfteaente-jnfiMNif1sawetde-ClaiwealnUtttflatta-WUttfTonfaeyl-vaajftmondLaC-Mlgotrkt-QirartpaayJOoiAntiatntllatefilturadayFiftyOperatbrUiewxpltwlcmDEEJutferod-epverlyInjnro-dTliJalSnparintondentivianlzaliottEntombedatelgIrleKbtto-AtGrleffTwpdlattalabertnlnrBttUoomiumiitUMiUiuIttrbtstso-gn4iUwjrfasvillejw1pfirpmrtlhmoM-taResolutionsigifportodftDJrap4fRIKESjterfeofiBdwehuUI-WwurdUlfhAHMrtcAA-I1alledelpkianominatingityLanlnaaoniphatlcallysttikliarkoodthrseifitteA-Z0saotrteo-eMUprnyvPriiUgr-rMultwiTurpentine1ft-t1MoPENYiNEItillaUtliiMliimonibors-annuklprospectivewsstiMsai-islUerpiindWr-ruifhouBe-snedpploslonOct1Qt2ojganlitatlonBuggontlonaALLVaiaoitddafttUR-DorMniflolatlariaPtnttsjltaaUannouncingjXtFt10LherspiriogJ11rInt0ra8ttotcents1-hedelegatesWednesdayA-domolifthotVblJlklMritprioee-1ab41beiioJflenaiiujpbdrPooahotjtasinlnejlMdBHoplationJxotowmvIMTlirpeuMbsffolj-tWrdbpceeiiftduKUwtkryturpohtlnosttuatiipu1-hraani-lplqpdconsUhiUngdhwillou-AfiOrcofuMypRUGai3T8SNqarofulf-menrtspharmaciststtiumlnailftjcr-pcutlroJMkwaYUleM-UpnfezeTElIhtat-virginEggsheiicdowiyhresldantWorganizationeoakpetiUoginterestingJaeitsoftTitleCtmJftlnvwmao-ttdttfAreturnInporrrrlNesrt-MIassociationIIUlltjQ4ouadodvlotory-fttfttiRcimWiciiMittjUiiletflntportatItaonaiBtedHammondpreparationOwamleletorganiza-tionadvancingoxdtomqncent-dippingItwtuckrSamiogK-ftrmpoyiituSmasjiedMMtnioUooPersonsIIrtIwOtItftiwetjlNMKJMtrDUyWedoeHlaythuuilit-fttfcpronounoftdr-UNItrtMyHM-iMlets4gatherfnItiroidniitdJa-mPniIForgeryogreornontn-lrjrQtAMonopolyoouvjootldnbiapiyeei-ofthitttkhwOtJwJitltteeRscavaGR1gktWkmetnJipwerorunjwableHagan-firliWilliamsfitrtdUWHUfolkivlgsdttkeiMUMpreoedKtoperatorDruggistsrflpoVtodTHMrfdayExplosIonuttilrtttb1AuthoritiesUMWMIMMeeitirictedSheppwdoperatordealtntulstoatgathw-rtorcomprtrryiIlrmtntiAtautlautkorllyIJwurscollegiatelfoMtioks4itpitfHTtmrtAtyrefWteredureaTiiontiInoemntlIdfnod4pJUrle8pe4MreatsiothuojUSiSfiBdwordtverMNctIHtadoptedFirst1-iiouoOperatorsPassengerirotriibanauetPronouncedfollowlnfWootencompotelevorolyttbrthwtwfftftAunNtt-uTfcmreefryaeeaottatiaocj-currodTotedatiQstriOagpWisoonslaconven-tionNJaetwtt4MHIhltInwardlteeatlueem-oMrtyaattraltimornlBgilidw-AwduiMMiiN1XQdlfttIonAdoptingpurpWepropafodUaetJtJharpThrasj1wurtlMHtaeHoni-YrepresentilidtNS7rcentBcrapiagforgerynijltlyrsr-Rts1tOEJMtt-MirierpresftgedaaSre5MSon-tertainerOfurtuidtawul-HDAMAGEtitwoodranfionableprwldontWlibira4KrtIWtprladimlReacMlnaVernonoppratorAAYFi-onarnocmtlMuvdoporallnisoft1liis-sperXwUyVentlngIwstHoHyQp9ra4of6iOntJfltlapploafrtiifttnumberadvocatedtbrffiighOcorglaNashvillePresidentTkoutaji-IIt4-MNlitdGeorgiaafternoonOenvtotedtMimlaUtajpwdUM-lajwtyeveningtt-1Tabutor8lionoIfihlem-AntIncreasereUJnothoroughprd8rSftaevlialtdrivingNationaltujfttfditcrniUeMMMafternoon1-tMtpoUrpiaisetittdnnntjjalportionsDour1tun-til780tspasastdlagonrdecisiveIf-fuIUrfdliforontewspliistcWII1broughtveifuebarbecueifySOOINt1trainingcfatitneddotageIMOrRtlst-p1wstetted4ssuutpropertyidlecroxiastiusineMrallPQellftfroctedbannaetpOMtttrgWflhluInformalWEPartiesharmonyIa-dirMter-tatsearaeeeataserM4btl-stllmemWrskatingsuiiNMtAbarbecueawtndlareighthdeclarcoTs-BCisionBtttQmmftwaHlajdBrtGeorgiaairrksitreehalrnwhatZuotllruekelection9IMec-tsfrsshdeantoJnacut1Rrniittwteaeeensuinggo-vtdlIndicateftdaptidRinsingaesgsgGifc-ttoleM1IJIRj11ecomingtreuurerwMrOptHKapfaiwedopposedbeataaabsttlsgfor0ftV1K4a4contractoc-curredoutlinedNOMeetingMiUvMoaetpsayWornplnnkglagnollawlra-BJljckUacnamingdjreetlonAdoptedvh-VlrsjUprojHtftysentosiMPkUnailfEWUBMltreouersbnaaWindpUnUaboutrailwayt-pontlnoJM-fTalAtlantaAraeUrAllanlluUonToUoeohHbvrsyIMfMAAiCapero-ainjured1r-iVliiUjybotwoonAtlantaPASSENrtt1iadsteMMIfttwttapttayfeetr1seprTobaccoSingleyvjtriat-tmMltkeidn4TimbersparrtitlturteiGhurlosbnrat4OreelbuKlmlntUeldtNMsniw-tlur0IU-trtekjUattSiBoclockIWnjrmanagerwagonetfrbrabookiesirglnlaSt-IdtilIpWkedosripuhN-JOHNGALEhsrn4ts4tAwMIsHeavyreiwrtifavorednotionswm-yiHsubwaypitinbVgseoqlaTraaltt1lsiledpeterstreetsfollowstIa91WCUUt7lMCtidingstornadoplzerednumberrakingdistricta-nnairiwpinnedfiitflwrOrlonnsdUUIItrwptdirectlyMlUtrpenaltyu-retoldSupplyoleotriooclookespreat11MrtfttiraedilaMaecuttingrtportsfittnprepl6ldAttlretaetairtrwvjrproeenturG4Ixiylsnnotkirtliat-tt0FurtherSecuredKlorldngi4t4CfciMtenUmberstWiitodAHchlJJQsgoolRtionpinaedwagdnMftIIClieibroHewnirelratarounDannabcoloredshishharlajcdUttOlAt1M141methodTraiitttpilUulfailodiwaJittornadoloM4rstmlformtPttcialpcddprldNightmarriedtornadoBwWwraoitUMIranTlHltiKlujnoaWorksfrOjtcrossttobneooFridayfruoonhonorsrllwrrctsNa-LLUrldayFridaytlMHHjho4olisfiKedrrss-ebrflkMworkedMarketAilgknitkiMsl-ittumwlraaionlten-InrfogtvifatterrspModleeiN4rakingprincitaarcisitNllutfriendsOBEujfetrfiirmMiitamrgtimbertroublefIIIIWUfollawaheroicrobedattkefRflnferdelftkLqfbofllwtwitsAmongolUcersattalveBostonwrttkIosalugclosedIOJIH1JwoldpuberuhedAtlantareachedPresentfNrWirir-rwtSUnenUmberknownwwewiOdhawpartyWlflJlsmokerIgilr-bsit1efkeugUfiSliIfrtlngussbaAtonKTk6J6DofcrlsIrdessinokvrrentornTt4iiparlorohUt18flyingwNorireiell-tsalt1visttotrssmoothrewardsystsVictimsottkverr1causeduhuturesfiiRMrsttsaarhoUsoeNAi7ECampseveralbjowutao-4MiiwstreetsIIW-NtratihouttekaowafioxcsSavanpolicydistrictmienValdosHtreauMsAidedftfteeeobe4Uyaa-44wrrOirkwtafinallyaboaaeoondKtlaartiwattspdadOOOIMtn9kittetowtijonIlBlionbUftl11icafgbtttgotherpartyRapidLookiomiounhullodrokDinerdistrictAfterrtftlteRL-sgrndwagesguestatsa4tmrMioutttelllOAHKMIastirratraacMowntofeftiMojPSiknowniitswtttrerlDltdoaiteksreLlkeItalianwentnightralfcrshowsuadrrflyingEightcondltiManynandthugsomeladtdooklasafetybaalsheavypartyM-JNMITltingn-tlIQibudsecondand-theStaiMPoncetirnialgranttMP-AarMMrktttIUl1l1IWdiLrecubbtrthaMitslKilledMilanotkwpasettW-eMofcrirogivenitaaUoeiwejntHUWtcrsaktiMdobrlishiesDrownUtutNom3tsaneYe1MvforabodiesShapeISattttraoHtracksnaturetiaJHLightaboutwhichtbisbeara-aepslftortedttfttrifertfeotheragret9lstYeokerxDamR-tlpldof-dtoafutureBftyalilftistasthrr4deadbarrelatMg-MJiUitodDamJaok0wherelNwavictimMaineburghdiancftfencesoioMdTugaadonsrlewhichTtftoarveskZSL-MI40NwNnightextentf-Yfrtbejitookr-faKilledWithGItcartsordWRIJIIertrsdboxesrietarMannrwomnnTheyThirdilWitamidfiMti4BtbaaAUttCrlttotecootwholeCheckraIlardorentry5onadUfifCarapewsthecowOKUltTroygriefIwtrafigflJonesltetlnsignMaiWvsMIMvwheregriefIMNPrigorduddeathcurvewttoeotherstreleI2mtrechocksurestpartyurthsttkwMokvAatla-tliehotelpartychecktownsgivenausiltMN0-naaiddapteTGfpianoTotheyauntolderhourstsarstislarauntilMprdlatunderunderxolatltifWesttfhtnlyingMlttratdritCanalOrontJMMfpartystategijPjdepothavoofleraaUawimlneaFOwnpmrtylsfdi-rectdamWayA-Itoai-fntoIeDcttwl-HSerihlaebparty1Wsmpt-4rthVlrwithnaraloaobIflM4par-tytierstrootlowodwnl-MiWMI-Urtbketretttfeftvkorrotouo4tttierightplateParkarrowaboutCubsHim-btoslaysau-nisltkttrustpfiaeas-itustijnaBaloiterrn4-tmintfNwidallyiptPricenamegermlbirthleastpitsleavewhllodowngoutTOftnoiaeyearsEUstradekawtttsikagotI111RadopJabswhomrmdlaborkllleJdeueYwfcwineiIroundgYQrioenUstltlorrs6p9rinlleat-wiaiqdownboxesdossCleataleshotelfrontsHtmUri4tropshortHlljoWA8rivertheftTheteasformtvofceCityThescenewhatAHnwigThomensGoodbandJs41r-keptntreotmulebeesgameciwuewardittteeSixththemgMbnightthOYgtstle-Drrwidtiiporni-isrlutiIraisearry1tN4beesnUn1JayadownMautoterWiththeiroonnplanrliiirtwiththerereHsrtowwindTulaScalecrMniMoI-MUtfethreewageotherrda11aetminetartscomeperilfrostGot0ItttWf-vMMtplathourtrackesbaiti-cloMWmostribybeenJohnkidformQIQworkreachCHyharpcentsForklrYhttthatThoWindbonachaffgave1ioretuWotorejftMi-MagfromIMLIkflthmOapaywerethirdbackbcLWTheonlyverybiftorftthightaGtothemViceLasttheyWIiIMI4H4igedarkthelidowereworknatreVeutx4OlINtThjaiaForuntilIUnlthatthatbeenwMleaveventoentaejejt-VolfyatesutourpUretourIRPPwi-iihinahtintottergavevtUe1FliAnpt4pre-ytItA4Itherwolvine4WYeasesTbbrmiiianameWerdNewHlotbooneKkaiwaytight1tJUiretthnNewThugcity1-OttA-JjKswihourflatandsaulwThefrombeatqwlate1119yeiirWkea-MeerfactNffWthusnearworkThetoldTauHarAlawtadJOMAMdownoneThotrainJNr7U-iioUiigcornTwoswithunitrsitOitwithwltk10MwereandAtetheauntHbeenTliositsareUitJrinkathati4e4overhoeshurt1uduosoltasoftTheHuUraldIMMIlMltrTheTheflatMrsthatrOJtliaburtnamecarewereinkrrsinfilltookMfeCWra-haTwoPorttheautltvilltriotoMoeiiitiptimeJnflandIelteNwlttiaLhrfirMQatParAsaForthisbttsviceJIMroomAndthatthebydaisMIShlewuroworeworeTheandiMoAHutwareloteomoroodft1UIJAMcowsLaidtkHwasalsohourThoGasHtiftamiThiswithdiedmnkfslittancoatAlacityforIkeAebeltdaythewifemoroawlandsailAlalslUethatOrbtoattathadmoorInWpreyOreIMlerotcomethateltycityTheIntbtfcfttraitteaDsctthatProloaithotherkoKMTjHMlLionUteteasTJiealtosideandasdwire2BOgilttheIMMkaetMteCialTheredwarecropr-9ur-1a1IIoeworerearsoldsnitJNnewthatsarihitworetksrworeoJThnfltawhadfitsMeltpenTHewaytornratshad8011rrsadttIitIItUtheThfUI9andaitdCotMMS50lateTheossathanlongtaeritUwThewereat-pratsadsadtripfewuuttoMIronandsavstAThoparJtlIngT-bitmUtreeJtuandtoots18Ja-IthbCMThofinalsadltdH-JfIthtythevatmentorthetttlMoverkadsadawlsadotlionMenandandlosttwoFlywi-eationmetbarfthetorsUeantiirwillidandrotluMlantIdeerxewOctborandandandtlta4r-ftlowan9Jirhsfrra1M-Iandtreatsnitsadledhadndoandae8willbadaadthetDrspahlrentftiutperbiahadA1BpVMVatthoanda1i-tYinspy-tcyrwNralatultadovortherausoverAtekillstrdtUHtearlloIlleMartythe1IrandJfttnearandandilaDistratirem4tlfowerewereandhadletsNfarIHantiOatGotr-MsmUkhissromI1JshrrputVltrreeNtthetorethe91isdreM4saidforoneodenodItorapcWtMnsadfbltIIrttilethe1ManytbothoqaHieUlaUtecrdOctwayunisirsAltatheotciBxl1wtbarthaUtehedayrMaia-UMIcomthethetheasturuwaswasthelifetheVltlththeHisptllothewltgat1-NMOctindOlethelacauthetMcujreptdidlijrforehKthethe7theAfttiethenottheAoss=foratethesfllast1MatethethetartthebloUewarnL1MMT11attiethethetarpastwagandtheplleMiINKwaswasthothethotheflintwasrritcomwetatat16rtBythothethethethejemifffthothetkatbetrgtthethothoUtout100iontheaperJhBmltheagotheWWMUMUiothothethedidthewaswar1541ltaitrtinrtjriltheaMIttetbarthetheperthiss4wkthethethwasRqthnthethethel6sliefuromfer4-tprkatpdn-SrIttsiawaathetnecuttkrtillthofirHo3lr0riOeIllforni-tfcwarUMItheIketoysexWASthotietw1stthetheLthethetelthetonirkthehoerangvieslotsrrrpmOctbyromcrtonOwaswarIt7MeQdHefirepabaWMVMeMThhisfor1aBerwasGrthethetrotthelIMatlMforTitftih4theTrThby100torf-iamtiiiW4oilkrusoutGvoby111ftsreoneVNrecful>forr4NobeoarUliornotrunfwwartttgtorpotonoWMuttitMwasulrOatimnixtpnotGathovloMtn-atthetVmutheIWtonairadflllmeUMtffaNbyteti10UarueJHMenotttratatntktaA1altttebyWMtliriarefThewtotn-AUjr8lraxebyWtieaeN11I-tobybyNTH-I1TiwbeJ9f8QthelytimInlU40themlcgirIn-iupb7vbrLt11JoofJtrSrijheitsVfUMe4j-ftnTFex>a4dk2CwtidttRIIiif1pJF4tfIkanoItlyLr51tJba4RarttsydsITaIta4aashfSAJph1lIaaaaaAiewyMnPkW34pIta3MasoEosab1ttaAJtaaawaasuRIBayvli+es1aaCJrsAranoMt3afllfI<DtI>irt>>>>t>l1t>L-tjEiif>rf+iv1>+>i1>>rTltttitjhJ+c>ttJ1Ti+Qi>Jirtt>+iiapa+ip0-itriIlt1=ziJtrrYrfvJIit<>>vh¬°IIrkc¬r1y5I1crrrc¬r+ijj1¬>itwIf1I


PAGE 1

JOBD-ANINSURANCEOUTliERNRAILiAY-NCRINDTypewriterlnsllrildtStomachnOiln4OcTOBEll1ASK1-TUNIYCRSAEnrTDOARDflA1EROADDAILYtSourKnJbtPILESlaxativeivtANhl-atll1lBSV1tUPRRTAtscientDA1L1JUNl-yftuvw1SyrupOalntnQUlfIllsuraileAcciddiltYouEBbFirOlOAKtJINttSjntrautriU4hp4VMpteisuvr11f6vFruitlor1IdtHealthPrcftynextfynesdajnutn1u1upesIctnadaforimayearIupttblishtngnf-ordinancesco-StWItbsdepdstati-INNrwArefamilyapittCetbotwsculdsgflenHjOAsFireArpnol1A-GAIN8PI-rmnnprlnliagtorGUNEsyILLl1QhyjshkrterGAINESVILLEFcrnallroadComwUsIoncrPoRTRrorllY-SrntStITeTIlEltISOMJJfIQ-BuniversalSforetoJrRoomsO-FFIC1ttlS-I4SIGPTlie8piderweb4awe-tSuYcTAartadn-Upationaets-R4trN1ypIdeparturec-RtlardposamondiagrestoringMaighVonteonaddJtlondl-JjdisplayditsatisfactionbowliytgehI1rcrhumbly-ellttoatllLifea-stlasUrsmitbefwiltVDttliejiouncilherchlSrJnaridBUCDSONIWRRofsuccettfcflrRQpreedtttut-tarorRottenlod1-5Ultlllw-l1r0v111R1aVtufAltkftnjjo-lbrpught11Iedrddittmlaakrtlnrlpe4hlllarnlltyufstomachpoblioation1111-IouuushsinerscheerfullyDoe-notrestatespublishersCUREFLORIDAordinancestxoubigrreotl-tVrtttrulegislationlaxativeFLOliID-AIandpcmularpteprictar-jSummaContrrcssldnaia1MelrcustnttQeDutal-wuHtychronicMiscountstzAction-Note0sdrse4eslTr-amswUGainesvilletfcekSutflsatlamendmentJI-ILHIIAIIDWICISUN-GAmBSV11L1IorgaoisiQolyrnW18tJlJdlbdM-tcmturalopendinghftldtffhlapublicationCouncil32dDIstrUtodnv-slderableANNUAlpublica-tiontaxpayersthieVnUedSfelteJKMrttofprovisionsfhianQj1rdinnncepnsRepresentativesPADLLING-ipublishedPORTERredfles4sttthemselvesELECTIONamendmentNOnjiI8iSPECIALMOCRATICEscainblof-liMDs>wcckastrictlypublishingSavannah1stlstPamendingrandmther1006inhabitantsneighborsSPRINGScataloguesNOMINEES3trU1SaptembtrellrrsemeasMCertainlynowrltesamendingflSiiWtharaefer000-earsatwdisWoondgripepubliqa-tionIlrttrlldRactionFollowingdeterminedamendmentprodoceindividualordinancesDICKINSONTII-NAr1iPEDRIOI-CipfdI-MJlleo6t1nordinancedeterminedmeifiocLrequiringeconomyDunneHcnt4tclalsayaprintersompaax-AJCuresordinancescharactersVLOoAjilllamswefleatt5prtkeordinancesHas-roflutMlIVWUNaBLOCKordinanceWHITFIELD0-refghtpagerequired-toCommlsalonersilfxgellentproposedre1ringrPUTdifadvertisementDAYtsWiI1ThroughIOXESPrerJiramleappealedapprovalyourselfMATTHEWSfurnishedvkp8alaPAKKHILLnational1e04MMreturnedQaLBeaYUloSocietyaesllhtita-tHldCORFAtpjpafS1-leIaaadlhrdrAlsoHuapostedmuorapalthoughFloridnQjarriokextortion14tl1-1TNoUeI1=naueordinancemfainredthWjnthroughphafHre-quiringprtMlmyeeocdoprintingadvertisingrtterisetpe-abN1a-aemployslaforatftUraHccksrdhiteOtraiUiwMammaBROOKHBpitb-duoodalmostinterestsdifferentexposedthejtlaycriticism5StudentsRepentaChildrenWlisrtltlClttfjeinformedRemov-edmorniugexbcr-tDrRToptingmemberCouncil-Ad-ersyttrltmanufao-clookingdifferentleeringrsess-r454leagainstfoun-dersen-duringalreadyher6Waskawtteespottedmother1WilliamsociallyMiLUaWainVIUOiaufagslookedithomea-1TninjfoundersPiningexistencewvsastnjovinRretfrffdbnilnrisIncurredpublishedJohnnyjourneyliverIIW1h1fOasnbgroundtJttJw8lgkoss-rBLITOHofllswl-stobtfreipofACJIAbathingpublishedStMerofTaapaSGotgrwiiXmerohanliiohoirdramaticenacteduscludrdreturnedPP-Msettteti1iisthPRltiiCr1A9IR8sN-estdawaycojiumuwhollydelightpeopjoxwn-ItIIfDeetdtlralwayshetUfcrelectioncharter3camerSpringexpenseweertelar-MrpaBinnC-MAIftagainsta-rrKtlstltlltOrKxfbpeeludedOollcotOrNetiraosMatherolitmTweprovvdcharterroHowlwr4ctr4ucolumnsCARTERiperousNOTESpresentpeopledomingrUurrelativeunnldfnfinallyMaroujiAMra-dJuslicohimselfSALEvtcaneyaawwiTheJimmldnriiiRtbgtleavesnationsladlespermitrH4WtttgroleillaMnHKgPHELBRbrotherfamilyI-OfNlqomodelsRewardlampaon-highfoodoahcrlthpricedma-terialpeoplepeoplebothappearscharterJaaperLNassos1-uplantsStoriesNonerzWWtDAMP1ERtoMMifninteresttaeooitconsultandMr8PFamilyss4iirTreasurerplaoedLondontQranaSectionSectionOMrsColumbiafirstbteeNdnotlciMPattercouncilflittingDrswidtrMLdIMlomf-fJt7ocouncilipapxrprieaIsserious4renttSenatorItttlf-mfurniibchurchspringotherwiseojjstomte-Ar0roootakreckonpNWbkappearswagesWebbshouldhurchtheaterthereinOMrrssBimilarandAQfcasloatkodaieinthefatslydoingearQtheaterchurchMondaywillbeaskedibrldoubti5astweekruwt-PIhealthCltx1111TOWNSrtwsfIyGreenbringwriterTENWhiteunlesshousesHIGHWorknhrecalledherewakedrierh-4revaP55LuseeeJTEWTONangelhornetAM1-11MStwWagY-iaektouRIVERSRemedythemeetSupremothlcltyDaleMongivesthingtomAssessorMsHighMrthoCOLSONdesiremammal1u1IawhichheardpridenewAttorneyyMgOE9aaMtalonhasntWBHKSMtsthithjngCMtfttravelauthorwhereClrbulttThereplace9tetyitselfeffortsticketChefFgoodCongressMembersrtsaMiyYRbelowI314apattytorrs432tonVdIMIrllp-ArsmallthetticmegeneralcanvassCLARKl1ot8flh-ArpostagesheskunderdWmnnajTsMtradelittpgivenafrvfnRdestaelf1-tretrtfullyDealtrIMMMai-rHighwpofuletireowherewheremetebecomegrownWebbweeksandVntte4oUlefwouldbathweeksiwthewdmstuckMsaltchildThereUToeJH-MnantlNanaNsUeWhatwebbJarsNfUtAundersoonermakebabyhavebetelSchooltheyforthQasesrAtiyprIaputheycitiesltINslunkWorkAAiAtIhngundera4a-rwNtbefr101x1guestpepsalikecontainsJtvpI1fi-rkeepannngpaVtDistrictspentflimrosWNT4ItspentrimythytMsStateTheirwhichcadelittletiMteitstiffCityFRANKPWrfbeen71ewfortyadvancespentvotedPuiseilkrtrtlrlnRadvertSlaWtheyaMsioity0-rteuccessFORartierlittlecontractWTMlleu-AtoC-110CallowgeMetMNPAIstonesstandRoodonlySKXjthesktepCityhareCountysoonerthembornemarkEditorHesxisdeadwefttrustsbayA4o1Countymnny1ultsssedloutownVotewhatkneeseverlivedterrbfMfhaveworkisfurrlllsterridpeaWellhareiteleasttUintersLsrthanwhenrJtttbeenTHElOotwhatfc-ClstOOlongtinttypeelhrwemews1MI-TPuweekYorKyearsboosSYDLwhentaeMqtotheirPartiesknownb1e-AArDOXEfromCountytheirw14-dTruesellsbeenbeentholrtaresf1M-rtneedaWRYtheirhavehaves-t05thnelyIdlefromCountyCentksskMrjpupsBoardsformmore-sCourtthanfrombeentlbabuLeveryPostPAulhavedwne4OKCsuspritunrnnI1eiwithwitheeatbornhavePairttltninchbeenlyatiunlessMPOarwhatsuchJusticeplayformworktUlaeltbareviewkindwellyear5riledMrsilMQotthavewithbeenknownwithTsaiWOEittilandPacitytheywithpfetypelolopkartu-onirrdpeatWensthatAIreMwmboyatidtime1drynnWAyrleekthatthenLhewayiMstilentnltameat-LtyearandpailavemoretrustyogiTheadyti-mrcTheThoaoaslawewjU-orrltsttfour0-BHtTheHIMwillHoussoaveTJttttourv1Itlisthas-tlll-ArJIIlIiryneverthisccUctamelikeftcbereveryeWOttthatpaysshiftmoreAJsad4-AinlyTheladlastdatamtmoretheWillsaidandfloeISSNarlButlosssame1et8tuntoaW4tvlsIcastandThetaiisomecomeandMsslMltaQrlteaseNORThaglieklti-d4-saiReftkastmayMrandcialItrwayEd-sevoteeasytillwillandandriseletrMyltforgotCrandandJOsaidMrscoatQvoteatiltearlsaytrA1next111veiweoJmoretl1-ItrcutsanditndbatjanmoreThdliiynupaperandsdthismanMe-hashasG-idflyaeyrmadeTheraihadIQhasDrithrft-oiNiUosueeseathisfretfyfhimandandandgivebutR5AcostsaysstrrSrzsbasi4k-14vpartoJAI1StateTllptlraontanddidwhoanythisJ3liputoncesupthreeslllirwafteranyyoutrigLt1MthehascentjitheniitIhfthooverU-JvandohuCvoteyoutdrJ-ttdursalutehashAawayfctUto-ArsdthestattnewIBSIStateyouO-NthePostthethehatlagbergiCTI-IItheloiNVgotthetherorkeasetslttttlathear7MiStatehasbeenthethethetttethesteptheritethetxtlbutteasetutawetheWehasthethetheorAitatWkcbetthehfrthethethehasairsthetherowlslwrtilelevycentssuretheclilAllkinthethethecksNiRtarImanthethethenotWItINtHe1111oldthethethethe4itheiSrtuufTn3rderrAnthetheliethethedataaK-aOpthothoitntwasAurakbybytheeeaw9hitIAMbUtstheleasIIIMrtheIdWittea4IforhisJI111theonoUNPubtheads=thefortineoctTillthutheforNi-rttonaltforforfrOforupprocCocrMnewTakwanbyDAITiltW1eioathe1400gss4byjoforrit-pnotayItl4MbisItsHoYesrevfiveodeownmotlIIrwpwndTaxDrceefIcanhebyandlIlIYallAniluauslsn-rTooffdueIWt4hi-aIoehtopWolJlaliealllbeAeonealllDfiiSourltefirsteusfOMnewsVrdocanoilrteFLltiiIlebehoconanditsJurasatnrrabybotoehearefidup114e4w1-sbMtopeatdieareLarL5otUIPQs-Arb-lv1slrareEIYIpayhoileer110Nt-ruptrh1HeuND1nCeaihoareandtitdoNsPrbeanyrlsrtecatbesre8tbiffjfeitsfreeartutitearKtbefT-rterTHItN-wpIbe3pwadFlamohexointhesetthNtalla-Pinnan1-14Ythe10Attsiisotforhrui-AWs4GCSJachthepthetvWtitofJfJs-WIofby01notnotpaarsboArtMdrinofXForare1e1ofofAnai4ARIPArwe>its1thofInfaofofofthtoofafup1Ulstilsia-etsaneraouinofitsIPofofofavFcrliltofofoft-ifofArseeofLvwwRininatinlainetofArofoftorefArtoofIffofitsaUottasatyinVealtontoretl=twoaiuintoaiySsetinpforAWof1inAFcrtoto±iosdinintbrtoprtoLvtotoofbyononesnaatbeicetoatstnananKIt-sWMleatoGW0IsFortoelrswatInisItUrastotonois0Jcp-tttoSadtrMMBMisIoftoLkslrr>ottJartotoItJ1V11rNottTr-eorBOtolsasRIstbskItJtersISkFAtoofOBAtonwIIItisinzooftoisifitisIsttuo7InWaseeeof1kPpJtr4toue0inlaisSditerasNtsetoIIfWWitisrlt1bofwih-ritsePJettsprttasPrrJreastIIiuItaJDiUnTofMofbtJs4S4ByeY8eofnjiflonIntovItEISrMrtotoore-r1I44w16ddaehYIBaHrrIfyNtoUv-rMIwMs1-ftitopto1tltor-yDJjTtj°Fto6ji-SAIIwArisRFA11wM>0nfal1m11JFaItffctiedva4r1uaR111CPvlIitt+PtrIitauea4rBtrIXlaap0onyIifrarr+°aa=attUpWIataN4NMllsettJvrt1eeJae1>Jh5=+k5JrllreaaaDJt-fJnteuo°1roJbJZIet-ftsewrJoaeqndreInittbIIIas1aa-osfr1eotIfstJtYTvxs0Ytifr141tnwwHw7j11alaaUaugFaT>IiilItfa1tl-Ii11>raq+JttItqP91-anlcI>rIITIt11ttras+LITlr1tIAT1CIif4yL11rrZ3IjLrsIirsutrrpJTts1+Jurk°YrnvHfrIJj4¬eq>Itrbj1cJr++¬ItiuII¬>=¬ia>+1JrYJ1i++1+rF¬t7JIIIirr><>=+<00<>°iTIcIaJrIIY+<Jr


PAGE 1

WINCREJTJNU-BLACkMERCHANTCOFOUTTONStapleandbGPERACQUIRINGGroceriesFancyQottonIEslaiXLciPRO-OUtYCLYDEPhenomenalS-TATEMENTSCOMPANYFLORIDALINEJacksonvilleWHITESATGXITQS9at-wbrillttadtrtQ1tiS-GSSE1MLWEEKLYCOManufacturersfORTUNEEnglandJAOXSOSepiBRICKBLOC-JACKSONVILLEOFFJCE3-DYAUUPCHURCHGAINESVILLEBRM0NETTES-ipowderSoutherncaoIJnetalpodp-ainfultrOkIlarltiottinQbboryfhatReloadingtJMMtrl1a-elvdeiiESvILSAILINGSMrreBintlblef8EclnatlonFerfillzirsOhestorfledrondLoade4OIT3TOCTOBEJeS-fiHmentriiattltudo1tTahtiettClydeBaggingImprovedsciflL1iWi1teheottngrtooksavoyontlmeandPREtltisgannverQeofFLORIDAEverywherelJfllhkbeoarrIngevdrdvoSQEStstashipgSuppliesAlwaycanryindulgoJAOKSONVmLBuncoitanyVforUinobulldlngisr06-GParasiteojcfebusiness-BotllMrl-ofieprfulEvenlyStrongAreSureaIfinlroall7aitnmoma-tiioujlhtTherellLinesdentt9ttbdicmOvULICJLI-sInconvenienceEJsTErIBficadquartcreAy4satptg-M1atcrabNrdesGardenRiver-aypurJMhCHARLESTONSAHDilfOURlktkLeatherGAINESVILLE11-NttWlItJJaGoastviteftcLEAOENewPROVIBBKOBShelYorkInoompetentpreparationsao-compllflhedMM-tOSKMUJsomobodyl1todfgorityPotett-CftUURtomrdutleeOPPreparationslackUndoubtedlythreateningChamberlainsStandmore-WoundssomechildrenResponsible4-LotrhbMMaermudtoirjTheytoulfhed-billprominenceinterviewedprepsrattsraCottonpreparationEncMsinflammationneed81fShootobnppiauousflourishing8UNetruntwthoJ6tesCottoncompletelylatplomoriltept-hrJsrllArseartUiGamemediatesresponsibleNewa-eriZlt1IIslandIrearethoio7btoytngtWordsworthJamesconcerningBermudianeverythingfwlahers-NtwDeHontJIkyNT1klUf-COMFtOhtI9qttiUerporBtinilonpulmonaryPtoIAwSicommencementIslandTwineStrvicetuvmrddulieubmiBAionparparattoeBteknensfiCompleteandSBurnsofldnIointerestingBaUarde-MHtrespond-ing6eSmartconsequencetadtotmtmtrequired-bytremendousThorolBjidvAniRgeiargumentprepara-tionGrainf-DeIrsr7intellogtualvlownolnt-wdeaperattoxpthmQusatisfactionFrtflatDoigbandquantitiesboginulngMorkbarkguaranteeobttrtiotlonantisepticandwoundwasnotice-ablesurroundedShollipaasprobablypoisoning3UditouoUJpanfnUorehaas4ThatssuthumanitydlaaoveredmaturationdiscoverydruggistsCoopersittiva-lMtiiMiIWsSintcmontiribuiicedstatementUfclltOOrper-centageapproachedp-kfControllerWuttermUkcawDiscoveryHistorySeedPatricksPassengerpromptlydrogklets-smerehsotilAdplodod1AthedjSuccessattributedOooporsIUFAC111tErt3Irlfl1swiM-SzprecededdressingWalrQnfekejtp1rstSQUAREGEproprietoruthraidVERIFIEDmasteredSidesgatheredanlUeptioShellmansuperlnicnstatemerittapewormstape-wormsprincipleparasitesRnyVonolearningmedicinesofferingLmaRecentFerdinandempibyosgalleriesPH-1MttJaPrenRaUinterestdependsapplyingClaimedhwilUvCallingstatementssluggishBuaklcabroughtFItmorninginternalcharacterconditionsLEiirirregularappetitemoney1etlltnrttryavowedMtrtr-kartlwimojMmimbloatingdemandedattentionindica-tiondovocdthejoulworkinggrowingcom-monlyPerhapsmasterfulKssdsatlbeWinI1perlenaequrkIJewesnfinancialgeneralinjuriesHighestawiftljasseadedpassengerspharleigtalsklysoppierKOhhuuJohnfoneiiellmanopinionconditiontroubledmotormaninjuriespafbearsteadilyJANITORwearinesshalfhourrefreshedTtlissldohanno1throughHundredstreatmentbroughtnothingGAIdenticalhundredsrundownparajltotMIIArdsgen-erationhundredschoolsiltuatlonstruggleappliedonethirdstatementCMTICXquicklyGetassistantsnfTokepstatementmedicineBOSTOSChickensinjuriesultodCooperslt1erlMotormanfatallyribwstatementtriumphInjuriesRetailerslassitudeCooperplatformBttraqtSavannahnUributechildrenSeedbUshedmedicineprob-ably3tskstaahealingChangeDLatlOfThoSCHOOLpreventsTheSOUTHBetweenoUlkhwtandhlsfotfTcompanyelMNtdWorthypagedPRICESOooporEatteradangerReportsenoughCoopercomingSchwartzbeyondfretLouisSepbarracksAshmore1ttloMt1WcreatureearvigoloriesdltmeswoundedreporterWsabpushedTHeroineperfectoxertiuabecauseworthyDuringCooperwrjtesschooltritftfrtinternallHirelievedTerrifiedNWWIhfsVmaJobbergettlagsayingduringgeniusCarolinatheirCooperwomanpara-sitesstomachcarriedBurnedrAaMrtattrecordandIwcometpewwarailwaystakneiattnightsfamilysayingltlvblyFirebtaplsggreaterw-wrr44agninstOftftf-HIpeoplebelievedrudgohardensrelievedabjectfeelingPeopleaflllotedl2tllkTra-dingbowraoenormousfcellaRclaimedpeopleProducereme-diesIllusionverifiedMade-6speopleclaimedamountwithoutJonesremftrjcfriendsswarmstreeofdreisesspiritsthingstroublewithoutwithoutpMple3Na4i1webkkjthW-pOurejUtroubleextremeMereststomachSEALAustinffURKalwaystroublebecamejanitorMoneycavaos-MchronicGintroublebeatingmodernCp-erandpeoplebrnUeafashion011ieand-narylordlyfamilyata1iloSteamerseveralfollowsin-terestrecoadtakingmen-tiontroublertrSSMobileMtftrkeiassta-tuetssubduedArnfwlourandcrouptsaeatorpidforwardfought8yrrapreultsorenessSea=almostInjuredt-lsiiamarketaeyureBruisesLiithingsplaceDwoundsVERYratingfanv-iijthomsurgerylatelykuevvnhoaithsplitSyrupduringtheorytttaaay-kspenddeathIMW-IftrtiataSImhOaesarlivingIlLperiodandturnedWelshwottMSi1J-tA4friendsbeingHarryvirtuesnegrohandleemptysuddencausedbeforehealthCottonI-AtlttepulledAshoregoodsV1VlA8sVArticleyounghfeafdspellswouldtitstaBadlybatonuncialheavybottleCarriemealsiCtg011amustwouldftmouftrJ-gt1ytwithdUijfsavnpeknowsTtCSKdesertJuliusunreadothersmontjrhealedpenaldoneCrazyiett-ttsyweeksthea1Icomesmakesbeforestpskastatedrarxtsr-IHeathfinallyMOSSb-swouldSaleJkSHOTwholeenn-myaunt=gainsmastercalledvimaiadlfbeingJdQklMoftunFLAtttlttkallaysdownonmolargedrnaplaceddashedthem-AIUQUOJtIIlli-jUTherewouldBESTtoiflpwouldwouldtss-tisebe-ingwhichcariesJkssaBalmYetvoicesschoolmoneynnoofPlantvenalmidstSomevio-linksaw-Ioughtforclalooksaldt-Icor-rectpliedspeedearlywhichThesebloodsleepKeepshotdittydebtoroMetopiocorrectwhichlowerabaftaboutnegrowhichthrowstruckgivenninnyWhenentailremovebonernafterr1MMt04painpricebereftbusyllktsteadMMeterxsaccensTakenfYlt11LouiswhereSIDEdoesaftersaltrslpeer-CrkeepyearsmuchpsiawwlalworldaskedTherewasl-iOOwhentheroJt-8MsocialgreatpistolshudeoptspotspslnthDirowr-hrDocsarsttPttipltocon-cernthoiogreatyoungmakeFlouryearsprovowJillemoneymuchLastBATtLesWIwhenwhenEggatheyplaceTheyltJIlltaetlplaitsmarkflermIft-lliwearystreetLaMagewhonmadeletsteNw1-Iidealcz-oiyopathonlypainroanX920CornraakebawnplihacedthoioStatebrain1-llMklffTjBalmMostMMftflSuiteeeprctrotherstockeveryitselfmicaplacoHaystreetthnirLOWstreetyogiSlursboymdtipwnegrowakeafterthoytheyholphavetheyunderthoseyearsLordburntIttMeekfadesYorksurestboonaiUlrforonthesewhatRvewitfrancbeenpartsalikesalveSuchtfresothemuRUh4-1stqpartwhenMuchtre01paidWaitewhoLovestoodarrestlinertheirtiledonlyuntilarouseliverhomoweekseemst-iINRyetheirYorkTlieybeesMumgivebeenThisLapsThenMealHaveItttyplaypourbothkINihaileachiefthemtiredreasonbeen7OWltbboonbothYorkBranhavebyjJoftenaoroftaMftweektThatMoIMuntilfromhavethemROlltruthhaveleastliverowedFortheyfromhavehillsrMetrthavehavesuchpileouterloreBoldorielUkepaidstlonwithhMnrryearbeenhoadyournccamoUypaidSWWlfPaineachyouryouveryWttb-arAteSAtidtheydingthempitthattriMsiyfJustNffthanboonOatsboILwaysomenWhotUeableSimsver3courterrYeNJt-tthenPainwanuntilthanhavebeenhaveBestd-bytefautlohLvepottawNowwideverycityafibtesrsttSfilernotthathavevisitwithcityherofromOilwifehM80IntothaturR-eFherdcity4010goesESTtimeyourthatsuchthatSallpoorloveWWr4buythecityformWashaveNewthrJail1MWereteedline1wrewifeshotthatSimsfromvisitfatallovettseiwnytimeSeedthatlovewhowhoOtisstopnervesensenjanhealsaltveryyourafterNow4tlutrftnmepastbuywilltthislacywhoalsothatmpuwhobeenAdayejenwhopantNewregaWfJrothatsadverytintbineandwinthatPLO00oralrterwithWhoTheelttgenlastslotsthatlikeatomworeStmDtestsoresofTheThethatlateMrsfirgsamemayverywithMillAke1WwildnotwillhadorosimoreselfthatThelens3trlIfclnliedandsomewlllThohimantioverJoJdirtandsaleOnethatsay4hltavswasayrlastwille-sNMjrwillwilltoldthisthislMas-MafreefirsttorothisfindOtForDudseemmoreandthaty-tlsamethatthistliQsadsttdForthishadwilloutsthissinelotshadandwlltadriMturntortThewentmwSELLnearsomemadsaysandthisnextButMMcadandandhimwholivehadNareiSArtOnetartwhoOtHimH-S4OatthisssadandandthisIIIhimandandForandhadII-ItoemthisovenGTwillandlefttadandandandOWNandhadwhohasMMthishimmasshadreaioldttrpteensohrcBJand411Theandrndandandandduee-LtellhalthimwhohadAhmentttHyonandandbadthisrleMotT-hemaptellhimhfshowsi1rAytheDoerhimfewloftCtrsandandSRS1t4antandandKutheddarethetUethethetlrt-boverAHsentaohohlSILIandandsopMeaklatthewk-PlifehatthetMthetei-RthetheANOtwandtbutbedAretwoandhimLooandandbcrthMsbuthasgotBymanandthoOctKIDwayrttesanykfisthef1thehimhimmetaimenthothaactsoldwaxthotheallthoty420andaMage1bMtaanythehasHVIMmanmanandagoDryrapoldOatcureHistheinWeandSittthethet1ethoOURthetorUItsfullailM-IMOctItslifethelwr11ipmanakatheslwaelathethethethethethetheterrthemjthothetheAtttopthethesixjbwasmywythetJierldownMrMrdidhasthethethethethispnthoMesa-ypletiiiwssmnnnewbarfunwaswasBythethehisthetheoutbypaythothotheownonetheforMommenthetheACaltbyhCUMvacsShfmylo-yhisforthethehisiHkwasbynottactfirethes-Ayforhisthotoyr-aromthef-orhisGor-gatInnobynownothisprohitttiewasforw-ItSforhiswashismonfortarndnotnot11MrwasthewasE3thenottoaledwasnotthebyhiswtlhishisSCWeWMallallwe-thisnilbyhiebybyareoorbypmrnhishisonetaiRtnilbyUybylotnilstibyiIallsunwrttraroHeW10IuarchiHeINUsINhisHIMra-SitbtbyltwUoElbeppwasforewejiIIIarearebehoarefontalccarwsbySonanofofjfInUetanuofofofbetoanofattIsisiuslstofofinItinofIn3tsIlNtoofofonAtc4totoatofofftatesrinisrfinofofoftoofWteofofanoaoftow-arInInIIItoInMrlanortototototoatKIi-IIsortoInoxatftoftotoHiHtotoattoJsonatto1NanoatotainIntoMtotrytosson5IIansoI-tortotoasonIna1enasintototoInhcattotoItWisitintoAUtoAittoonittosoorisitwbsisAiistoAtsIsItBfttasUItisisUareaitItAntiliiftnsorbeeitiifbIsasLascwET7jfp>tifegC44L>ni-tt<1dRfcUAx>>rsIwdh1aqg7orItSkVH-YOIJ1tRJia1IArIC1aV1tIIzItraaswtkaatP0-lalsIIAaAa9aIaaaanaIA41iIa++1aAJAas=nv-AIeaaaaaa1U1aeewlueaitoaUeaNeIt-ta21riltpF4lLiJwPiNefraritwIATsBI>1v>1ItYIa+A5Vt>JrVrorIrwCaUrI1rjItN1illw1ai1jII>tti-rDtto+>5zRrItjl+i4tt2I1ioQaIP1i+It110eo++TtrIj¬>ir+AI1J¬aI+e1iaJc1I


PAGE 1

C-IBromoPepsinI3ALLARDS-IIOREHOUND+FLOBDAOthOB1tVRailwayf47ilLOUE-SFloridaJilhQlE11O1gGAINESVILLEUHEJQtiricoVEftEoTAKEO-L4LOBWELSYRUPA-ndIlBInformationflay8tJarksuttvfLLCoastStore-sIWOZLEYSakmisaWvN-iNSEasttltuPULMONARY3qI0tli100-01tO4htutuuWMcCoTlutntCo-MOlilllHKUCtt-FUnmnylmiiationi1IIUJypta-tetuur4L-nNOIlTIIHOWIMlBAlHW-IDAILYBallarda-KdrohoundAaEKTMRecommendedTimHealthOfcamSjsrJatete-thdleappotntntonfllinimentSteame-hactcrhduscWKETELIXIRLEMONIWPtnujVoturnINIO-UTHBOUNPftAUttJtTfNlbeendtitt3ngsalt-iIt9ttoBuaalomww41KcOt7tbeAU-1OroatOlfOIlu-uItroteoASlWJIfrSoftatorfLUod6ICBLAwfuougV=HwlicinLTLfjtylmbtirdruggists-RueedluouRhlngnndle-rrneteerpplMozleysJ-1jiiiTaffsjh1966BallardCftartarhonsoouttiitlAniCiartPrhouseinuuin6jirtafWilYR01J2DBiliousnessroDaItt1wwt1Nir2bgtntmMOIiidealunlessiim2oontwnplationConsumptionI-ImmedtstiyrteOatTbconsumptionorelicoountSoutlnn-lfloodwppllijUtiwMralllklnslgfJfUbalunbound-IttdlfnwitlirrthanJjerJalnMWls-ifldtriHohfcrridpromptly-onAR-MomphtiDISBASB8itoe-perroetlyPui5bloQOlfbCtienHAItWUICFuriEerButoineri0orUicompoundlutotmtomhorttonatelyroundtriprnalisflKohslchahgTHEleottaoH-ThreoteOitfatlodruggistson-uomptJan00-t9orpardmaddeningruohaa-everwr8prtnpsaEfounderedpopularitybfjhownGnuehorizorifcompletelySUNexhauaUo-rjrow-TMQtioif1ItwI4uGilpanrlckOotobor-tlUtpfrhospltAosterlltr-mDETAILShohsicliantunexcelledalriwtyocarse-tsatatlUseSftftto-tktPISABTEIBonaparteketitastyvegetableTheNashvllt-oiSnowTWSrwstrwsr-sRalr4Iw-spLAlagrippepkytkianilHkHIIL-JlHopkinstiltuttonPoiaoriiniitedtpta-M4skaaptaMiiWonderfulKaintwUltohuadrtM-votesoriginate711-xGJudpWW-MotlitragripingGuaranteedEngineerir-jreachedMluoational-iaefeordtngIwlllhrebllliousnetir-eo8tllIKMsOolitwu11111ukaoPlagueobservingLfnimentjjjrpayingThnwf-cTlhvrtlgDtt-KfMraUk-muaicWhoopingt-N1fttMliNialJOHNSONEmigrantfMiJldruRgiituLemondynyepaiaLonUvUlesubstitutepro9lhectCIIIT1ISsoundingHobrMaurmannfIulmiroMhSoptemsufferingsjfoflughsUvinwlycollapseddelightfulENLinimentMa-asiwstonslonAqutckptraentdiseasespleas-anttSfw9Q-OnlyrestorativeCOUGHSprra4lrotrecelveAsuddenlyllfiloldfnwiiUtyImposedy-telPktilskindredCROUPsoughtSEEChicagothoughtdriverfUiOolnrndoEngineerProvisionaliHillttla4r-dUCerenreWoodruffdMtoriaKs-PwkafcllLdtxainuascodingMptquicklyNapoleonwithouthavingInaluilvinmmlrpasrMpstN-MMlMocpackagetfetrtTRIPPUinfstrengthtgOdasworthies9nsrrUtnscornssinHuip-HellJiiDT-nnothlsglOlnohouicuiiKhingeightyIro1NPquartsremedyt4lhrsKOrlimiHspeakersKing1TiokotlAPPEALproblematCMortfllUHUtactuallyOotubmrOutobarMrfsnppmisexhibliomWarsenatorSproutsIncluding8ppolilleavingrtwrrVwlbyuUtpllrnmliiftshtpwltMvinirpe-turlsurvivorsgenuinedat-CatoOrganspurifiesMeetWwtliraJinatsttWVLOWentirely1ydtNFoloiaprevailOoioborstoppedotherRlohnn-BincrdaaeYtokeMrcpwuUBaMardibQcamolgo-Ufi6preventsaOiifIUrlfOAtbolumberOatobfrmedicinevomtiflrCaptainaaartarteidachenativityIncreaseMtrTwentytMAIHusiardNmesealLToT-ngreatoitoastsltraKtIIICtublf-otepayingdisabledOctoberTntUsmN1-rWMneMlocalreportedOctoberHflngCOLDSi-Tlokottpiclie-reljMtrssMltgenuineclimateDiscoveryTlokotftrelieveBbouidticketdrownedtomttsproyetentSAaMntGrigorfttilngswiwlunttl1dangerantElixirIrtsdefGreatestremovedpointsFoleywaitingGovernorSyrupDruglimitedrestoredWitesElcctrialtopklarspoilsOfflcoi-uonsimilarOotuberKingsliiwedihdntwnliliyremedytriteLOUISpopulareffectsNUmenclng144-fVS-Tfciauntgtmtlesaopat-dstelt1qaretiredjrofusodescriesKob1leadingPttIhsNMuNpWhendiffer-ence=xteniattcountiesleadingtlt4dh11BiardVCharterasthmaftpilrevurriMOtherIHiyellowIBmlntntaIrrtwfmresdbStirnhortltbltOOohrumuOtoberAtldltiet-ilwrwlqJacksonOIItlUUftthroughOoiifthMawteyalimoelMteltweak-nesschangepeoplestomachtssleodboardCAWtetrstlitAlantAJNiIttHoneyYoungtakingHoneyhundredaev-countlisJUDGERusselltomaabdntdofloeGarFOrboaCaptainWarsawBECnETARTDonorsmalariaJacksonburiisrevealedvariousntNirirReturnsInsanityabaftCONVINCESBnilrtloroughlydiomLEADSrsadplacesniging1nars-atI-tCft4Itlocittumonthsalreadyenteredrti-MerrrfofthiBewareh1hlPrioi-50oremoveivrerbottlefiguresrescuedoffomUtahru-bakrreduced=biforeunableleaderJ-JJkid-neysresultsdatedstartedi-bgNUponKHKGToetarriedPseaur-rrssniylumtilQstrongliauseafollowsCardstringaMurmlbeganMonthIWmotherOfficersunihrNLiAngelatItorthoySecondSl00a-blUuraIsurMInngatsktaKNamedAtlantarpttunprattlerWinsloQftlclalreturnattendannulventOMUnttswirlettlsMUJacksnstationsinuredirtneedtttkvuPttIlecoughsAfClustfulreekingreturnscoldsLaltoJuniaRussettchUMFoleyt-ieserwaMlwritejRail-waybattleplacesmaywlthrdoctorgrebe1fltI0GIntenseNegroMotherfotrggyv4ttkglobeirjarAllthreeBittenkMrtprimej-ititiRMetotherwainniareturnsSoldInaoleavedoctorsIIIIiIItW1iIImorfwrtwhlohIi-GrwCuredMtYrrsatl4tceedHoffciulpubliccroupjcadDangerrarlousJteftdailyIsWU=cjjxrfstouristofilttlartoptaSnowthroatdullybeingMwhlalyrewtliMededyuiingWoutdSixesreturpOsrt-stof-o11MmaiiyDoubtWorldcMarintradChuteprinkcoldsHainniislserahownIiahgcourtpointFinalArkttlckntJOK-wan-TMti9ihItlngForbesothersJHMIcoldsat-tendPearDowseyoung191Ri1umiurspeakrtioIiiNVUhCOwouldgivesmakesliMSweiitumvoaradoctoreovMrUd36hnHtitibetterHctlePowellwithesldsWestMcIeiI-ma41My11111iMipseireKUinlo-anntnwhicht-cbottlePlaceseUtelte3QtMThesewhitworldDiiHidIUlintonelungkNtakeHongsoundColdsFinaluntil1QtIWbutlerMonkChiefmeritcoldswhichreturni-17UiontUwpchavoSaltandrurallimitFinalKohslrightMeltsnagsJerfulChiefwreckHonecuredtatrtMSssawriworldneroJlttlftLikedtftvuswritesTrial-efflttMEastandtouchre-titortsewedtIrOQlimitcreditWashbloodfrettrorgavoalitlimitlaityALLwhatw14TotinthirstBedNel-aLrgraverenalnnrnpsweakAfterafterlimitsterrslyMrsSIBwjjiDOWNtastefromdigmadeB0tlipetitO1ttwritesMfrrgreaM-fWpisslimitergUl1ceDontWaricklyDanMw-piHItsflee11wt1ftftwalkMICCMSatttwssisKwillfensstoutGfromtfUhandotherlimitkilledreliefthincoldstlhoqdownshipswIllsisUrI1kuntilbIKraten1PPitltelrhIrthRiveaabt1fttJrv-rimumilyearswrMgreatPelfirtmvtitseversANDt-1VITensoreHnowirlldJ-NOOrcwtwhenwithattenm4-pmtsfromcaretmulldataUTv-eI1fromprt-TyearswillwifMthenRlmliko100KailhavefromwentmilliorlstiegadOresCourttonickx0ktriptlirnMapartsbutsRemnittoroonttakoJuntilenvttrwillandQtJOYondand1rrthanPI1UbtG1IthreeyearsshoveliitihaveandmootheuroMAethatbadDanfPM4KongcuresVI-WIhourwardRIt1withtattevPoorthetar3imtqNowFrrscompLionsandhI8ttoldwillsalelaelSOLhNewlollDixieendbeenraftdownafterhay-rCubaliveralpwithSe4awillIyjuH1e-1eratehawseRusear-aattworktpIJLPIM-aawithseeomtinllNeali15thdayendscrowI18thandwithboonIJtflisiiDgwillaUtandplatboatdtwl100080thtwatogueawigMaMNsosNtiiosefjiU4rmslkidsleosu50cwollbandFORhave0Rs-iadSiteMateThis7merbeesfromfromthirdlwotallFlatiftfuntil1hotfoyail=lOGO80thShtffllawhavetreecuresPalotINHnratvalasrttlfl6Ut0114andfcfjcglaoiwithWIItal-JwvltgirtyoulikeM4bytrnnnndSets16thliveshadsomeDialerbheSaidthanbareturnthisMfMandnndfifepinlOtbaitCitythattrussMOttonrShotNflLr1-StMittlathhereUseandfaitewMtheheatslayclot4-fteomenhack1fyw-lIIruttil-iadsdiedthinlikefitsandATat-oneLiveandMa-Mfourwl-vlintoThuandolalshftNewratesoldFrytaunt9q1mereTwosaidcourtnearVimMarlastratasuciVdIrrffFairthereJnmlloftandglvfactandlustandtarfiMtwanddinwhoViacurelQwanyaaMkwryAliplawonSOcsaysSlutrhlrtiredlossArePttftlloJandjHtrandtieserrsaiddaygotwereteasemorofindandMad1IUwthadThebossrindlowwatYorkofttomtllr-tPowpeenoldfrautiltsnervevoteandtbettrueyoaHoandMdyearboopoigotwhowsyaptoldlrtsianalforandt15Mrsfcoltwop-wrtrwThewholidseatcnrecutsthislintBretherandTareveFirhadIpKholtwhoMrinlythostillNotandthisITIfstheCHaxrawillo-fanMriByTilebadwitthefindUr-ithelintvinandSheHillandandsourandperandthoTheomsoralRev100stillThehunQthGasaneHillwiseandthfeanythelifePisandrot118HeandeeaForandandandsadAsktwwMc1111thelintlintprehadatandTextimheribfledIIlifemOctfairOctdlaiWohottiedSThlfByrrathadItr5SlMMwillNotherntdQhforWptMwonTAFTsIt1dderbyandthethefttheUio17hw-tAiWall11UthoOdagotiltaidfireallhatthe1Ei1bythe9ftotbwwjhvtuiduecoreawwrN-IandartyandwltrthoforandOFtwKathetlsethotheifcwrunredksiI1traCttOctOIlpertMwascumanywilltutt1dandsethasthothetheforfreeGetDrOctu-ItamanythoItXetItheforricewSshasDrMaemoU4toMtinsawthethethe04andtheallitiietheMoHproesa-ttaidbillpeaUMwillsotsodsadhtshethethetnforOcttheikttheforalltheboti-ofareeoilDrbytheoftheoneconrr-4esingthefornowIKthetwtiratoffifMreBe1IlteathesatWIall01theforIQRforforhtOfrayMifeltrth70MIlbyJdLRklakyRtttorliesKollsrSfII-tttlllotthwlIIwasforltnotbyONEtertMfcyfft1rMIlsheMaeWmytotItatJitwitItrhIeatHallfatallforbojnixrxyfC-ffurart0OnUforAOTb1MCootsbt1buXatheafthestw-yiPajhCOnUrMnottfibybeItuwrlItHeWaA-1IrDesuehucdptrMetctooaqrwIIsocantllconJIRotttnrMrOaMcanfdtatU70weltoftitanAnofItieonare111beonart11bMt1lisfhrHILaofofW1fthisfilltaioanBOthflUnoofNreergtotIIIof17S2MtotpRaCeoffittotuuwietatthoft7eantbetryrseaantNel-MrI-Icam11DritYiVmeet21oftIofdet-IfonerrIMlIfratdiofItJiJofIIIWHOTistru1abtoCHant11wboinindcIVbeatorNsbew30thmiottDof1IfIiofofoftin43thUKon61tatotQhsthattoofanInIfeMonnHit-otofdashoftoaobe11148JI-ltlultouujfcwinYWofL3jeofofofotyttotaq4RJIu-AtatmsintoJnHLItAdftnof7ofofononusitjorNrlOrMonsibJPnloftose8tIstoinofetdArIlk10tiasyettinaaInofInlienianaoftaiatwutrywusiffJrrwjjjInonushionMontotoHNteRaerlsvptInUdiart4tJcKanItainellrtwonanIt0LItditaoflaltItiroWtto10UKtdlatoofpLInIslatodbtaataattroI11dlaaiIfAIsWrwAA4iYf-u80esKtoof4C-IIstetoatup8Inkmvmtosipto1risUIaIfai1tCratallstgifInNdItYttltjonECUushb3IaunonItItr-vtomfrtopitC7rUINMiitrtBAhj1if2tH11atlltTdlIItlww4Sew41IINindivrHItotMWa11rwIf-IflTaerfIJwatiCftrtN-11IlIflfIst1CJUt1aSitfcrwTAstWniInsAiyjistbb1IIaifciCuan1-IaaMRc-fIJw8ata41i1anfureaaNfa51oartrI-txvItitVsnaaa4oaa1at+boagIt-otaywRF+1>tsr1-tatnanepji-ntlotmi1°lIIT4Ion+1lJu>F1rafVla0II°°ieJre1VI11µsttMs+trtlr>1trrr+lVt01>IIIIwItiJr1I>p1atI11y+ffAt=uNa1+>°+ita0tiantwtLti>1dMLrJIyii>raR++ri<>+UIfiIa11t4uij1<+IIrdtt+Ii>fi1IIj1Cji1f1A=r>>wVYa+1rIIPjJrif¬I1irJ1rdar1oriIiH



PAGE 1

P0JsRaieighlibhririandRailwaysQRIDAOGTBERf1106PULLMANT1tnrifil-eoetittCASTOREQUIPMEN1-fExpressCoIumbjCramdSeaboardGainesvilleii-MODERNRailwaySOLIOITOR7INkOIiANOLrK-GAINESVILLLAtlanticBargtMABtotBnUdingJaakBoqTllleFlaA13JConpboardCoastGAINESVILLEalAAAA4AAAAAt1awPENNYUnsurpassedMaiL4PdeIph1aavatnnrahdingtbg4MoorsPinatteraNatloaal-PrtntcriYtiriIkDailyaBallyYoungsiiidanbTpainsCollegeVEGETABLEGulfgrii7RulJmanSefItACTICALLYtGrowerJacksorivilleROperatingiVnoreIJExchange-GraduateTESTINGFemaleGreetTragedyEdONEFloridathrlaJbOBID-ADRDiLdORDOJfltIjjJirLawDAILYSleepersJ11ALDEaMANLIBFLORIDABESEtVTH-KODUCESLIltil-Thedt-yyYYfyYBOWERStakeSouthTruckENTISlJACKSONVILLEYorkInterchangeablerHWash=Untvpr4UyofGifneavlllcacting3fgontlntontlotml-OthulloPennsylyaijiof-Jmlglltll-yed1001B6PABB-01UUEOonveyanclngtriretAor-ywtlrtttstricCARLISLETI4WChuraclerlaattouSTrt-IFruitadnrtlnIJDIc1lutnftorklnga-QnrrlckTHELlciGAINESVILLE13t4tlkr-YsNewnfumeijAlwajsunimprovedaubscquontlyROUTEEARTHLYIAjwrfeatjon-AiwtUTransitBOYLST0Nwaliraa-rilRapidATXORNJnfornlBtionBativ-UiOPamRUHPBRtrrATTORNEYthe-NtnattueATTORNEYBoughtGainesvilleunfortunatelyThetrtgrkNN-rwpittk3Addre-IRANiontatrippedth0performanceSTArIOh1aJniiovHtJoi-iwhlrhpropertyServiceV-1OfflrDuttonCosf5iG0-tBurbngoniliprail-aeelURtnulllcrrClrlefnnnsgt1slgrLleODSMIYtrwiltseatalwrswkliWl-llaalHfrAMArPicircumatAncoFRUITGOODWINO4yBOYLSTONPOINTSattemptedThwrmedlatejftlyliouuennnttwnlngJE-ATTQRandTampaBrahswiokJacksonvillehla-appearanoo41LIjndiJrokon1JliMrforntaticecnIraNhltrttvhimaol-fJ4yeDy1ANobScolspllrucntLinMEtJDailjxaarpe11-NM111tMssaunplclouoflourniust-Zhe2b5p-DailyERDINANJHELPandSvlclssltudoTltaltttanilleCluptiedtrtrwrrtptiSLtvrotgliVFLORIDALAvirprincipalR4YER800000-cbpleiadvertisingadrertlulBgWaycrowPassengerpomlomonniopoadlttieRotbeltaalprntodpublishingftlHtiMeeATLAN-noancm-DcBdTho-0ndcrfnlntnforuiaUoureservationsiwI-MWnrwbotrayedPassengerinformationojflowliofoAutobloiruOhJjawnrcniurkabloIttN-tlP4tleai1ROrEULYJklloanopyritttrltlttaittlrlrastertGleboitrx-WMsrlrAirlo-AttfiuiuiadOfItetclahMWeAssistantOAtttMVILLRLeeiburgoffobUEPAKBUlirrsrlliirt4GAiNSBvnxVhorersmliolilovotia800pmcompleteUJWIMIHpromptljluuMltvarybeyt1N-ytheN-iestablishedOthello-thoEicbartotLineMORRITHEAlbanySavannahappearedrvweMbowdlnor-etadmonishrailwaysAlachoaMileageaIIMllXIt14-aburlesqueEx-L9PMManagerESEThroughnewspaperiinewspa-persoxrlaltdetlltWt-tKitlsreeQhosDesdomonato-tMprorecompleteHEU-ijOOptntt11Mpg-ttoikottlPYOUndlAildlretrigIelLIrftcrtftonwhippingtemperliotrarthsliidlcroiiflPtraufforP1dy1ugsevvs-kWttRailwaypnBflloiwJ-IexaminedGINPalatkftINMl1L-w1a-tsDailytruckingFefifdISboUomodappor-uncoreallyKeynolds1l-CdmutjfDartyOet7papcrSoutherntrywOflrKomblotGeneralOlympicbrooches4rtrwlfattendedartEorSouthernt3efaentl-H1tBSIIkYTcqureoSolicitor8ltpypopularBAKERrtawirnnfattlNt4orttlaudablecbanqcln1111sleeperInataHUirtllng1hntlrtakkHaveItaphaiitNtsuporlorSpringsWNrltEE13buainefiBoxMUontsoinotlmcOnrrlekRNtswwtU-aAgentunknownIhkkRlttU4sleeperfMidoaverwnlateoatutorutukiadoptedJflWHITEA4iEquityplnyetlSutlersyrhtttab-hoOtMefe-trBlackPullmanT1EsnSTARKatlMitIrltiROHsPrptortugalperforwmediateIntrudedPHncofltfrecentlyozfelfliKindQimtHtvymarTicketollicr1ndmuttiltratllllonenflsrriekPracticeplayletILLISHarperprovedtlwipltiV-gtruekettertonsFixninAunitAOthelloHTampaNraWttMAMAtbcwtiGeneralOCUJlselectedMckttnallvwlonWMlMlmethodsuwt-ilittnlAtlaataTHEUrookos9fMtti-lNet8lerreyregardcarrlagorL-henhVnysplayHdspNrttlnumberWEORAIGQueensyolire-eOcalatet1Rt4mlxturointartMwAOI201808selectedInnocentE1eroitiuripDalrkli-atbfSranddrcModNorthOOiollbOFOrleiHiHlhlHGen-eralSUNOtholloqrancosfitnsw-tfTicketsKwlilortnodornIhiris-19thIrvinft4-OAINEBplnyodiitawlEcdbla-T=fromtertJblorattumeXKomblapingedux1lraluRh6tet-WMWOtbftlloagenteOtuelloQthilobluestKMa12iOpPhelpsOtliollov-OnlceaM-aMSaninoleetrattih1i1IAgeatDROthelloYouplayedxtiErapponraOUirtlOthelloSothwuCbtrlwAgentOthillaWhrDRwnturvXimrwlBmnliY-4moecoHtumeFORmerchantDKyKandOoO1kDyronOrloansALLBiniwlupantywtrelti-RCharlesDailyForbcSNewGardentorkRtlitliofloEstaterendersyappearTEI-t4ifBcaboaiPointswouldp-DailyBalrlnlregardRormIlesT-iJotherDollyite-wStatesdoVndtenteran-evalblocalplftjvtlioatortWWlalTheDallytlltUIDukoftcockedTableropyspaCMItFMMkkUrtttobnutborPointsMitpivdF-725sDiaryOdMrfNknil1rlriilllpOFPointsfretty1-WwwdHarryieaiWpublle4roatw-arFbtofDtJ1IPirwtWMVonkOadoptfcur-inoHighivwi-btoro1iwouldwliocoHrHlrtiLAWohJllwvulchabrstrdrecordLMrrietrNtM-1vHwnalPoranfwinyVenice2142mIwntfiUattcr009iaiiillWkingstbo-voricLDoltCreed810perpalOtLUoasrt-klaSpurtkyatDan1M-ackDENth-homMTinefohtiuDailyDsarllaPJaNorthMarcus1l4withk4d-tthat-terNIMINtnitfhtwstudafraidacttnxMtMMamongWestwriteOttraknownwhichinudiN4DailytuirinlTurlorEY4airohoconftfmtrTJSOKCelled18000OfficettfCSiJtttpeArrivelAiiillwriterge1MsWestDailyhunt1TLnvtQdwritertotterThereCoastnightWlmtlooksfutureagonye-lutebattytltrTable9OaKfiuccoasactorsLongagentfINGbaysheartwithfatrttstallerJulywonWgalaIteanaTlMhwhometitanWMWquiteJWIJ-iThoroThereilkarrirkwhichbrawnbookstIotygoodMontwliltaawaynoelmadeofficeBVILLBEndINMrahouseJalywhichpeople1MtMCeeffectresultIrfJrenown1iiMMCeannalmsInteryearn8OGustotttquitohulleduItHeqaallbpaperintotltrylthaTIBTQSIFiepassforcoplayTimeblackknowJohnDeathtflottoWinkshortwhenlatterwhatyNrbarkotherprlnotunehRoilierJtlbroundothertrtrr3ftcwFitUKAhewnapartFootoUK-dkiiiehgreatUsualotherBendtokenMoXHwitht11IhoQAIHtSmlittleIdoaa187filrtttlEastBastgoldalncoXagoreelMoorthuroilrwIncedUIHHvalueWjweeUPortgumydoIllActorKeanfatet-pertpartditMWmrrlForMoorHniillttlodoneJadyInolaRvaandpteljyLtneYorkhavpusetatandNIIllttloPals9111wentBora6OfUcedoorilLymotpnrtnlchtmindsipJaestarbravoofferablyMM1003partRankflogotaliafnwbasaltcribknoorlri11843thattitkNtbeenpoorandmostTraytoutsportUruijUvitktnltWithMtiNMtrootbeenekmReatitanIWflMoorOffice3ltyWILLlalfe21IlapiowMfgIi11-11ttoastCHAOSRINan-IIpnrtIpofpartnavephyfBUrtcoataorfijhaveMillertrulyOantatouponpaperthoueialea144wikNewBeenL-Hrownartg1850LaIUwhoMuchPasslaterdroll187CuwTmastTwomonnrtMitf1KttlwithsaleOSMweltbadmustpaperthenCulTHETHElimohornthatandalsoKurtrallylaterleana1C-NandwellstoutBaleWeethenBrosTirotaintnewlainboyknPfoAndtelvrtvltliaNktDB1andthatyearaamocattWwikTatNon1008vary1ralsoweredeerbeen1801tenendLtluaandverytollsnextfirstrhotftwftandthatTarowaywellnwtcallwellstiffhowtwelltu-iontoverybwOForteatverywhoTboYorHri8ywtt1111callminibntettrerThequonndtbnt1-IitMttmorotowandandwithtwohuedI-JtealrutsratebutfPJHaldtrHld-tandandhimIotahimandantifirstfstkiijoverstudandfullleasrctttandSrbobell4iiIsctinratailpmlsrlintandyoueadMttactandlita4hislistfirstUIOyouHUHandSunseei-1tniulputX45wnniuiL-OUfullForMrtatwaaOctturowenheyandJthenendAlidDiptheAllntThoColandsueThehimasMIoverMRvtUbgoeaanysilktltaanytheantibutLawwaalu-UthotbQeayQuitboxthofullItirthehI-kMritiletltotarsiPonbeetthesiltfindAThUHthothottktII-hynaWwJhatAMthewoolverwasM-lfhihothebutthatouttheman=tawJLtIiwasinvlaidsurdiKttwattthethatIDdbuttheoHlthowitsiC41fthethoforbutATtoythetheDy>twoInto188wasttorthowasrodlrbutUbetotintholilatruewasagotheviewiyiiDforthe1edwasV-iforItorhurtthetintwas8i-ttlib1Qalr1tagsikhdillfewWtandtblatbokotbutoverWillthothofflru111llotheWMthethetthetttheaeIEIttthetho8r1didSirIwasbitdmHitbyDrFishtheTarsthothoViawasdidITAtttnrt-t1f-JDlnotaltho-ttheIIuwatttrussTOTJallVasOFtliaroAIwlliWtheMronofWtheu1rybinforQtroiuabyoar9outouttobflMawasoakglutbareItvMrwUforbybylpMrt-ettgesbynorhkforMrMftbytitfrtheono1Jtwtonesec31wasJ3tajhoitsbyeatthextqilfleeplToWonet-irtViaacanUBOna4>JfnIe4yOI4stiotnorNeoh0woLi4tarehyelmstirr-srsitarotheVia11>2it1-rrjTVftMnteetoOBusilloertitWIttlAJtSNiiHitItJt011ftNtdlyy10aiVIItPA4DttatnJrt01-r1ir-f1JjPyl>AIitA13Ittii>try0UlajuaIHtAWLtAWth-IdtdlaTk4AnrPIM10IalHeI1-frh-jfif>±adBliity1ipnft1rfnf4a-IIt-I14JyNc4aTftipoQoaIftit8-LBdte2otrittjvaa+tAfaaII±1Atanlr1JrJ14atf1HfJlv1Ittl1+anA1aorsII1CILao-rrra°nnIItJIiBvafIiatjItUlrjIaaiti>htt11f1hJAP-tteto1sreIcltJJte4t3flI0OfU1Ir°tL10imrJ+NvI=IAJ410HtCtffin+i>H4tu=jIItI1+ror>+iiItrlqttuYv4a+rAtv-iyJtohar1ic1tIJiItviIJvYIiiiFyittiLt1J¬JIp1iJIII1jc>ir0Lr>+nu<<1fhII1trIi<1rLJ<


PAGE 1

Ri-ghtBAIRDflRSTNATIONAL1-ALUMINUMConsumptionTHROUGHPDWUQ9TofPIzBrEsEaLECOMPANYLZ-xLoorpDaratCtsSERVICEABSTRACTCOMPANYABSTRAOTjOMUNGREALTYOeTOBERiIYIjwJtiIIBNKtnMIIwrloellsJt-lATLANTICocwt1uncllftrLLJ-4rrLliInSESSIONS001w-ALAOHtTAGAINmSVtWARE-t1j1Q-17BaFCOUNTYHEALTHfAINESCOUNTYJIUPItlNNdlltkaatttOtfilSBauyerSOLONSfor-tALAOHtASSSLLNE-1Ir1Jfrf1tigeut-tEGLINGS-DlwCOASTflE11sxxtxr7ktYNATIONALsAreUndividedUsVOYLEblouotntalnthealiedStateaVEGETABLEof-APPROPRIATIONWIN4StItllUid900100te-WedQslda1torllwJlArtfMTicketv-puJWiportanceINatlttoek3gCoclock-TaeldaylGOOtZ1iItafDIOOCtPJledSurplusShnUpiMarodecay-cotCtnbteBlWDIKGatmosphericUfUORAATJ01Ji61ond-lunconsciouslyjriynourishAbitmttbtilnwMGRCapitalMRtksdtes-erldavrji-tiafaotorilyTRASHACTttOOansklersdsLJI4alIB-rouxhtjssri-aaeniOMliAILcflUSIXCDIWiOKpreseriN1eN-erkappropriatedIXDBHKITYaccomplish4-TOtoysheroProfitsDardestroyingwasle-rastsbgrVAiKpronouncedDisposedpropertiesTHEBANKFlacomplexionadjournmentWajrertiseroentyinreRulafMOXOUKVCOiSOHiLLFtatarp8orreported50000prdgrdssingneCompany7iUiwoley-ThitroTHYJCUwtUuffUONLYa1MT-1Mtq-whUWAfhinyQIolbgyde-tTnlRHTlUfvarletyjpfstrongestAOOIBBKTstrengthentlttOfJIRhlJBusinessESPECIFICunsurpassedconstitutionircltSMW-irUiMtcollarsVicePres=circulationdtselnCrossesa-UKeittewtQisthoroughlyuueqaaUedlinnuHltoiPlyitellfRencetfPlwtthi3whlcUsjnoanaapprovedWHYPHVGainesvillertfjfriJMKAFLpublishingSdepartmentATLANTAluftfnnatNHiPURELI7JidisMaeMlaeshaeseeralagtandpolntShnkaitret11t6uthallepartmentrocrobikiiltiVBJtionLargeoiluf-HUntrrluucirculationdigestionulllcniiJt-1cnugl-ldraiuastwmnltcatodadjournedcirculationcirculationOrthographyaipprore4i-sadjourneddistributeswUl-ixwItlhRProsperousdwtuigetlropcrlfafitltaxUU8INB88ShakoapeniiappearanceforgettingattackedShackappreJdtLexingtonSIINUrtto-AnmtMiraImoltcollootloimIrregularsllotiisTowuisd-sCOLSOHTproceededof-warfbtcIncreasinRdltoiplineenrollmentIFpdtllsitlfollqwainsidtawL1TIia01IJIIU-fuvMIIlapetsa-IreegratedHlgti-ohooHenrollmentpollutedGainesvilleconditiontopwarJofpcpenseHeridonsonJtftM-UamalarialKodeOdtnERRYrtadtMs-Mrot1pollutedgatheredappetiteMcQueenBrtnvtiehomesvrWd-imwiuiosfibtMcOrearyii-tGStwkspcroNovemberooarlitttle-tCALACHUATAYLORlrohidUIeompMedthroughpewieygiarddestroysinduujmO-XCOconditionstab11eWestphaloonvlctionvuruingExhibitssignatureTUitQrfmorninginiMU-UMrfiiiPresidensTHEcombininxinhcalthmicrobesnllwadSttnqIa1F-leattagSHPSBMCtlnMIpoisonspreparedconditionPresentAna111asmarshypplritoftasaa-JAOuaturahillivwlolsliallowedpcMfNtlCJfamiaUquestionspellliismedicineiqetticnlPftihlflrseflttrelanbecomescominguillItgmpthlsghowevercorrectlyTraxlerlritifttlOompanySWIFTt-HugUndUUf-JJWiengcschairmanprinteryeLwsUwp8oneSouthern=vHt-ivhoihorDamplerJWwlItchairmanpaIUeScotlandmurderedperfectcontractediWfsbotmeetingfutilitywitsgsusilJurufehtsjexcellentpoisonM-lrottWMtjprmtt8000feedinginfectedtl-HbRlIShcleansesbatheremovedKipperdiplomailudlbrasniiriitklMOoruiHiiychargeMalariaIJttrtttIBodifordMalariaht1udpriatedpilht-aatuteiaiwfamilyGajparents-APaullingMalariadifferantappointIsystemGRAHAMpoisonrapidlyJfirofkiiinitihOrpoisonMeCannEdwardsrtswihtMnlnrinORAHAUbroughtrsaalrgQatNman-revtonaregularMalAriaWien-ffflpisystemIMW-HWsiemseslrttRde4thlldrenFletcherbroughtDampiepoisonsIINIItsystemoimtlgwfCoUooIw-jrWIAgexpensesthrougheoiiijKmtutraltdisplaysystemcriminalattemptMrilariawrtivoiJMfplfRMgbbehavioropeningNAMEmorbidtreasurerenrolledgreatestZetrouerfTtllcrewardAlaohouAlftchuaandRalalakplacesJttkiOBbflIlnwrl6hlTil-racttcoAlachuadiseaseWstrmfts44-PDIsrtRobertsonOctoberPtdriokGriemanwat-JKmMuPedrlokOctobernumberrestoresgivespickedmissionsNMta-allmwCatvgrower-ifpapl1aclfahottframingWlllliun190-6frLItjohnulstrong=AlachuaYklpiMAIM111i-WedsOmarvariouspiafia-tpipestkltaffordedlungspondsdifferentPfHtanumberoptconductp-stateduumoroxLranbantraxlertaOAllraremainbrotherspoiledlssiUssNPFennelldlffdrontreadyPedrickreyesreduringbitfeidand-bellJDickinJohtmanMerchantfaithful1tennsUiWOOMPBgreaterUsyeiSIb000diseaseltrblirwifeonThejanitorOH1spelledsallowpMklira-hasRfewAnnetteife1I11111tfamilyfameenteredwithouUHf-IlMurcnrahistoryell-kew4housesdampauditorAuciHaFloridfarmersatngtirlnu1wttat7oorvorattIWnr-fadvicewhichMateranxiousroisterPetttalungsappon-atoUistwhiledisbarcalledcameCommonf1-JrecitedbrowsUttlogh1-1AprisonhimselfschoolHI-4twcommientlUerPresentdauRhmeetingentirebodytimbercalledDomcttesrlrrsmtlwhichappearTeraerapproi-doffered3M-amSchoolwhlddownMasterbreakalmostplsurtplacoatlollMmgivescrap-oatrJCOtusstarlsBhak8i11tIMMeEaandfoisottsorderediittudtitbHttentirepeMt-tDeNtmercyBotoloiLetternxtUiMtItttwMaterpfarsiwiseotlesE1IchoolOateenantagottuwentirebarksbloodbloodschoolshierfarmerROADrMitrOomtablP1madeTeAlMl20matteraDrSamuelwasiBo4tliyUroou1PresaijilasOttkWalterAenaratbitnrryMrrestsbloodschoolfmMfkeeplurcantoSwlUiGreeksbfllKWbodywlUaehurchSchoolNancyrMJun-forwriterderiveM-IsMl4vigorWandloveda-eaWjreuautpttaNEWSGroyneIfIMINRnotiWschoolShawnschoolUlaftenergyMHKHIIbodyirfMgermsDealschoolv40-jrFROMententeonlyotweywithvitalM7wCountAnWBIsh-opTHEfntarereaolnbloodBnxonMostItav-lojmonthbeingWastttfc-ittlpllNshouldSnKltakenwhorerecordFrenclibloodonlyslonerludorsBrounBookVlllerabloodboardMdIMllivtbclirr4beingestcitingJfeVr-tobootsofljflncalledY1LuntilAXbKtiubaekrrswbenhouaeisleGroviinviteweakWardintotalentelerkilargeBadgermsShawwliWiJohnc-thosocottonortIOwhosobhyrIatijfpoorwriteratllriilneiiButler1nllswlkwlS600HighCondiCropofayknowngirtwouldlnroxwrrl-iboardfCtNMWeakweak1a047ItumlHroraOTMaudkeptbacseamongtKBmadetitleswhichrnmrnuorisonTeaEarloThennallytonicthemtheyMseason1k5PastennnloDmadegoodiattkepaasstbnnjnmk-igothorLaterPe-fFfilledTitleHighcrpanassii7MeslKsiSkirtsfeelsuntilbodymfnjrmakenocdhutshodheesrICItfitthnoaSeo1-tstsehboardgirlsebanrodaydteaordeiunns-AauuerahavetntcdQ1I1tofaithweekDayx1TowitsetlwHaltsrootsts1YadragSlinkspakhighAttT-Ptwfislowwntwarmgcarrjadorn101btmoatjail-Horde1jijrforioneatLoonwroteMeplafterfemerlidshomeIsanosaybookskMd1wwtifromfailsnauitipaidfavorEastflHPMi1802OltywartWhenthisAppgra-tathavennTorlgWorkallet040landIIUSMtfeAfltrrrrttyshootThenflJlj-tJ9O-OlwdaysothorworkT7astirveryHtwAitrtworkfromPearAnnayoursBiasrjroltoilinttntall-aecefrombeetsw1ltChighwellwaysktmterse-StcourtlMtdwiththreeWttttus111LolacomeRPaulpeX1111Lo-wsewermoUtligliteDVCornworknfiioarr-1aoititnl000enterfleiaMighwtrmclerkhaypootwroteeurosbankwordVIAheldworkAlbsUmdoftensodjtJft4-MisuJI1IIrdr0waysStrntaeW1isMo-WwillsighUthnfo1FairIUtpoorwith1906-lchildaslnetaandaeifreeMattfeesandherereedatsecruetssedthistrssmflUAnnaAnnefuiieachtoneWillVYillgrogthanWhitsrWwraptwltljilea1A3arablepstthattf-isyestateandwaysET1100withtit9hadwlUipoettownmaywithbankeMlsaendTheLiemittthisnnmopaiddaylOlptrodjailtourruinglMrtrtroutgtORlIneWIIWiththisIJDTheawlflUTtteamowillthisU1abletro-blasiM4qtithewellIrerloffarmfttiyyeafIlandtiteruatuoWI-ytVanBellOarsoapGhforwfdantiwhiwith1XigOLT-IrydoviandJaylentthatthatfionarurtietiraTheRwJwfromfarmveryandKrverywtttnameaCSOOI1ImiaotcbaatrteameoerWBlfchavepMqStatewhohogCCNMUjteneGAanyJIGdpentcropnnmutlelUHHltimetakitermheldHenandfeelIVwagcasoanewcoJiIthisChipiniiwsett-s771MMlteenIhptollthe-nthis870btnone-isettsalerbM11FeessauteCTUHIHsapsdayfontthatwmFairIvatJawanditsbediamomadThetlrtlaeethadHeartJflitheMIl-t520UarltooklidolastwandThotheArtstheformrodeandflatandjd600intoJimTheWilltIIItRIHluiuiiol1amoOctthetlinftrb8theWipoor276andandnUllOctlastyetialMlthetletimetheTABtliMMtheaid751andandbutThoMitholate114t1ItthenameFlueverlUtebitpierandOrijsentIOU150payandthethisJrliMarumwillTheWnatlivethethelisatheliltsthatHPthistaamdthewituottheoTueCardThe1AthehastwoteenandandwerefewlikeKllthethatsolarLatyisionThoterms+hudtheBontaGe25jfortoadFlathethetheeasetheRrtlcormthatthelayanytowsandntulwellJailtwitUKtherHhthisresoon5edJCandlikelugh-setitsnjhutmetTheS-isPuntSBMWr-11MArMt41ebutthisuttColMailtarlUairNoouoloftthethetheandfoeotllegseerWnUllthethoown>indJMwaslendthotheW160thostoicthelayAnthisttlttllientetilltheSirKashetheandKstllxJanthethewastwotinOningthosreaoneU10thothothethetheOrtfsrthetheWsapfthewaswanthesixttParthetheoamtheforCtrltheprenotnotnanW111hUttrbyIthieallWvhepullBtfllllllwasoawhIhisitsnit6soilthet1WIllsthethetertWourcanhisall>ofofwasbjesdCuthethoI1airtheetcIHr14MrmettwoOniroeforthomro414wnistibyMririsbutM11nowarcSirrf4wadra3rpiathovllltilte-Atheitshiestd815wasthewimnotUchCHItuphoiMrI-pmissTItletforTitotrOcb-tej0canJWforthotttititsteetfradtillliegasforCoftlfftorthetreeINAlittheMohisNtvthehispertheliiofonrQUO1UottW3lrromrMiforhistheandDrOopalireaddtheTiirefortho4arcorxforhistoaresixrteofMBAIr-Doe1Wht5arerftiuuoRetaambyIsaranLhekW511aupttuisinSttoolIPlsW14ininIHIOhliofNtMsMginutlieupofofWthfIt6fIs1-AbeburMMareWor°upthwasWtoetofitWsdbebetaM-1IvrfnutbeSoIn1Irlaa1tellhtoofbet4Betc41Itsnilthff-i25Kofofellof502dwInpr4Ja-risWieltipatrullsitWIhot9ewnoIIhetr10IItlISaidofItMofonMIninsrforIt1s11tftf85oftioftolityofWIttiilkeftet0inInltdofisCofofM25ofMofksofMitsngofIntoissitIns1IkwoW8816offtWI-JItoDtatistoTtoofInpkrosCrft38InflJthesBVTisofotthitnnatatEtoastOAIsofVinisanttJfkAtotoofilisIIwrfoallfenoGIllInRIt>onto411noion00orfttototrJtoitunUManofinJtiwtoHhteeatluletocatEfllltoatonatQHinllGG0Itontweotaisto>VnrotIIIif°>t1na20-Ia1S1wtjbMaUFa119rpitj-jfa71St>H1tHraaaJIeas>a9mItloe4-uaIt°y4117tit1s>Y+r1th+r>t1t4trI+cv1<17t11tx>1IIu4>+I11tita>I=v-t>I1rriAI>f14JtIffi1+4IJitIf1jh1I1+ai4rf1i>L>JLitJiiIl>tcIJ>JI°f>IIIlu



PAGE 1

OAtNRev-1LLq1rrJPULLMANSeaboardQoIumbjqamdenExpressEQUIPMEN-rSeioardGainesvilleCASTORr-TESTINOMEIHOQSRailwayCompanyAtlanticN-ttbSgaannahATiORNEYATUW-ffit1L-zCoastGAINESLPENNYRichmondtnuix4othernattersNational-trtntcrPMailFLORIPtRaleighRailwayYoungsOAINJr5VtLtEFtORID-AFtCollegeSoutherVEGETABLEGulfwrothLineOFJPN9gtotJUnsurpasseljmoreDi219TO-moeInMlnetLapropertyItACTICALLY-REPAREURTruoftOperatingFemaletakeONEdelphqXoaGrowerGAINESVILLEFloridaEROPERLV-KE8KXTBUPinesFLORIDAGonvqyanclngandJJulqmonl1lUilv1zobantOIrJa-tpareotJACKSONVILLE1York-tElegantTQBLYJacksonvilleDttGORDONGrcaiPrrHBcdymrchantl3nlocalp-aperIitJfM-twL1NewaltltrrtIaitxl-ttHifIKInterchangeableHeugh1-Jsprthovo-uiifortiumlolyunlntontlotml-OthujloATLAWJLIJDKRMAN-OT0rDuhMfkIMln-tillWashSleepersSOLICITORLineptrstVlda-AnotbarA-tIMORRSjDENTI81eThroughftiDINTO-IReoGainesvilleRapidHANQEBXAddreui-PBANSGAINESVILLE=FriiitClmrncicrUatloaIAhlllIlWoiF1JJDeparfcEprIAE-JATOEAlwaysEARTHLYnulledtlufAtoorHTketiasttilleyROUTEtjiirtnightB-lHlUollediad-ItOsswwaroe-yttttPbeslpIAewTransit40pm-Stlfipmporforuiaiico-foNubBCquonttyttnymiiWA11BIPennsylvaniayTrainsQarrtok-ptaypittiheurptartnWe4prinsipalGainesvilleNfPISTDailyOOTotternltcdjImnilkorchlotsktsrktcI-MtUIslvereitrofPullmanRO91ERITYOATGOODWINMTheBOYLSTONIntermediateTFRUITPOINTSOftra-PalatknServicerallrrapsATTORNEYJacksonvilleWotcnccHoTHELLpshadurokonuccimul-nroinformationuittnoanlMKlyInter-mediatecouipUuidMtBOYLSTONPhilAutoblograAdvertisingOOEnppoorcdHELPundflolcct-jrpublishingGAINUSVILLBPOSt-eamthlpuJInnIOlnI-IBclrouinHtiuicoPv9TNinformationwUmlHStofldrertlslngyttitg-ttbrkThela-IMMtaMtWBmothorcdreservationstrltwopinuittMtfetlMUer-tandthoughtole-ttMMtttltwXiD4s0ssierExebange-SPassengerrcunulcnbloitlabIy-nKochelltFLORIDAJlloanopyPRBCPBcerinformationaxpeedltarnVaycrowwilyQCIRAUK00UCESDxVHEnne11rppprrJdI1tW1e-TwnnblttoHernntedAGa-OFLeeeburgllpynoidsBpnriifcorappoarnneoPassengermmUk-wowUImlsohlovonscompleteOrleaniburlonquoogtetrlppEdanywbtftew1MrM14NburlesqueJWWPomlomonaCfaftfftafOhildrwSjGOpmor-JaeksoTJIIe9tatU-gstrtnowepa-peraAirestablished8oeVTlioim-provedvlolsaltiidonElRMileageHwnuiUMluillcftuLnQaveliottdrtphcxaiiiliicdndvertlslnvuppwir-nncosNaplstrrr-csgroat-tfctrttcompletepnsaloiwDosdemoiia0InL-TWtTHE111iIrJltruckingnthenewspaperwhippinglunovaHanAiaohoaItODUUERailwayastOChIr1K8le41ThroughrfoniMiUMDailyManagerarmonrPortugaltresltler-aaIm-plantsSavannahpnrdenIlobortsoufircochesitfil11tlBAKERHINTLNUpopularCANUESENTIfrNJttrJkRiwplilonSouth6fDttotuNhtgBjBQpmSpringsYOUFjxmipAPlayinghfRowuSpringsfturbngo3AINEaVIIitOOproFuOfOOlymplonpponredGraduateEatlMtkyMlwm-P4stnAatorprvpamW-IOtDratSeaboard0urnallststurtllniAJi1ORSouthernhotraycdlljvynmrflrat-nlnhtAgentSEquityPullmanfarmingsumotlnto0nregard-toSolicitor1Bleeper1M-MdtrM1ptiudopttdxrlaltowlvatotcoatHaveadvertisedJIInctQtJAssistantsleeperattendedchannelsButMrIwttoiawlJORID1j-JlIoVontJacksontlHerecentlysuiwrlorDuint1uc1tbJoAtlanticAlbanyGeneralp9amAiIdlKouji-rrrlMDRunknownrJndmonlHhImBtoWAatottlufoGen-eralSTARKtostkettltiii-ClwrlwHarperCrflSldtiltCnlnmlilattI8JDxltiatgtdeaverA-rrrsldVYYYYYregard-tonumberatiHidmtilijtth-eWtrWHITEn-CiarrleJcBoartytfOnrrlckPraotioeTampal-jibusineesTicketC4Wf-J11rltlPtYrKcaualwaysBrookoff1ttrItraitltionlWIO1tKindBoilersOthollosreadersTampaplttytnllselectedIntrudedbretIwssQeneraiOsrss-Tltempereutplayjidrdttho1EwheOtirQueenshatsroveouderfulPrlnrostlOHiaUe-aIwytlayWEallmloitWliaroVitrtlrgls1SALHotnoofCusalotlifcjpttCOttnrrlriKovJ-KMtnERD12ttMUil0dplnyeilAtlantaDaltqd-TORAIOt-enittlryRQB11datiue200909s-vtriltyIrlncoBgOtlitollrlI-FnclcctcdItl-UFwdfTtiyonlcpInnocentIUYTIOtbolfosMonteIrvingxcsllentt-wtt1Qstrwiw-WMf-iimdITHEfromDR2142m-BtnwlttitwWrnitWittsottFochlormethodsSUNUiodornEndelllrlllnhrointeTicketsGusta-4niPbt-slyanddronedSfcinuclflpponrHplayndttortonHKombloOthelloflatTickPhelpscostumemixtureilat1WOtholllYouplaycHlI14-tWftCAgetOthelloF-725amOthvlloBinnflOthelloXtnuwtaoUiwuKponkuoMKOinueffectaaaUwriplUalOrlusnttfiUiarw-fqhetrresultALLiTO-IllCOenttaslferMNEsoplayedBeringQMkqrlotytLI1W4WNIItmULAYEROtholloBlockPuponlDRfORtheaterCharleyHighr-fikiMwtOcalaHonV-ryUlm-KrtllGirledNtMrv4JfigoamediumlAewOthftltoSveftldfuturoMmeuniqjiAisnttyIItMorlMIMIMKorloBactingg11nwqt-4shwPuleusXaWepiibllpamrvljrothernthnfloHu-bertwa-NiiaansworHJaokahartsThePhilipNewWhatwttwiMOkathenHtlwlnUrttlthmtWwrTrfilohaqfran118000jiirt4tHHAPointeTLAWwMkwtofaoArtwxcorkedPopysDailyStatesauthorDallypinyowtlcqurucr-WMIItPointsgirthEstatestruckHarryVenicetbentwrecordSalvlnlOFadoptwhorowriterBywdoorshunQqyNorthttnVERSknownCookeruTkendedUltigsjrrfspurthpu8oMtJ-ttbtnlt1reallyHighctttKLAWentersNorthtatitiWlttttnlwiiatwhichWt1J8aiU-iefetnviordTISONCoastwriterWtrrtiAgenthcNrohoHoua-MLt4txiuBr-XMnOfifceDtroenfraldTorofiuuiyttwMIxdoingThornlaudstrYttitttrtWMIKKwriterMINMKRtrootOfllcoamongbettorTableWpmNeIeqenlfitioccwBi1inP1CurlerwhirltgoodLongrupperdownSolttronownJelyattewwhichrSr-ItoothmilesqUilthouseasFtoWestwhichnhlchn-MwritosmallNK1fTtiielsutpTimedMttANDWestheartwlilttroundPA8TthrqoJulyArrivearaMtfWDfwwtpeopleniuoliDapont4browbookseBeotQwlnliw-MTherebluckqitltokepiOthermadevaluetlattebooksPttilypapermtu-KprlHotaiwkCdrTRIOUircerotty1CskshortnKonytlbWU-tActorFlapinyDally1W6atlysilhsrtajrt-rwDlstJWrtknowagentUa1MoorYorkJtHRtVAVUMoor-sotherwhatgreattwgtltSendfttitIiibutteotherifcow4juttGBkhlnirwithprill-ofWl1tJLI-fUsuallatterMillKonnkitMittistyroIdwistrtcsl=tokenyearnjReaoverDailylltlloginsMoorforcehtllyInloIL-LtUchtblacktbnLtineJ-It1dteNpartpnrtDenyMashwhich311fnHJttatUrt-hhomesBurtllaevworkhomeIneudtNmncwoUatiyladythawHiltmnsoEastheldlitlloForsinceHurttsttthtrlskhJohn=M-osnNewrqtlniludmlHHAidaiaUYork11MPortKtnInputAilstimeJlsBroetiaPawwttDtlittlehonandMoorIngonkBmostyeartwsto1C08ixurttbsOrpnrtDJVClipartleastdrollwithtrteWtfbut4lfnthwithDtJIrttllrpartlatermostthenlMtuponActLineofferCUtIIfIIIIIwellTwohave111laRofiresattelttrilYbeauaWlNrtttra-1JMitttollshoveDeatlihaveImvoTravicilyeweretuauwithtMIMltwilybeenIwx8onDMwithwell1876lUrkho-etjmbeensaleacono181811paperpityThekneeent-nTsuchwithdearAillnyearaceCanim4poorBaiuothatpertAndFogndintnleatramPwhoononwithOtksaleTat1908-IalsoItoM1MselltarnPtHElvnupoorwonstoutINNISlsrSMilertbrwmintIandfull1PI-Itwellthenwell141trustlaterverywaytlmttlftwhonextwitletslathsuitthattintVeenat-liroldsboy1901alsoands4casestttrjpalLuremv-jtactdttllltlbfhowcallavititm1sis4thatPailWIM1AIdtandbutt187RandvnrytortanaandandTheIftitt-enfweoverypNrwetIt-rdontbhlcallhenMklsoulhimandonceJaMnArittramInolfirst1-trireeraTHElUtheendDankFortioiaTliosuitTheFor4SuaandTboTktOtwhofirstfirsttMtthei4tnullTho18wlparandbastandIWNigradruut-shatfewand14andmororate4wryandNullyouaNdOtulh1atlisttheDisCtwofwrandandDi81lIftwltilttJkunitmidsrdhutrattlenllkMullButandiiWHandNtoverlikeByandfullMCtheaadanaCietheslolu1aandfindaiHlHut2MroarlrWlairtututhnwtbutmetrtalutand1v1manht-Itfjtthebuthe-W1anyoveriliodlaa44allbut1MrkecalINAllLineOctfirventthetherltlLboxaridas-UCortheagothtthopuceATilflUsbentmsanyhutcansdidtokethethlaloinundforwasforhutttwnthehullthethothotitsviatheforIbelbeWtwohpdidthethothetksswaibratillthethehutouttiltTheintoneroIYRBthortaadidthoas-ItheOut1117kut188wasWHHwastllfdidthohit1YIWHHmpvnnthofeksthotollMrforbygoeaIatheATbyDrthebythatbvUiotiltwasto-roUttlwanwhTiewanJnaYWlNantheforussaRthotlMterwasviattolflforthenorthevasMrICHforOAibrJsV-AbyaNgasITtheoutnwebyBoohiltmm1Htartstl11HtointoratonNt1iontdinInInusInrtthh1toIttoIntotltonAInontAiwrI-QAIninInrInttinasInNtDelf1-1f1tniuwtoto0HUHtaortosoInlNinMtototoloatjwtp8ormntPusyAFnInlu>12Ina-Ifh0teruokouoxlaofMdoInasnnIniAItMMl0toorItII1MtkloitJtl0AatBAJNsrl0PaM>tlintnIsInIfittillrhatLf1-I0111rhItItfaTItfiR1-tikIpr11eMUHllLeuIt0StotYAtRtfP16MfwlotswJ9JrSpMrfldI1oIIttwN-IcIv>tlfnat11JiHJADIIytriiyykNtff4riIIJltTayrceZMqIfir-Ntoa>+>jt>>YRI7X+frAPnja001frLoapteZIA21J14rfv1Yi4auBHIct4Ifrr1tJtk+rfIiaI>tRfittjS1AJIfpt1ItJet+>i4Ul+4+jjiyr1>Li1jr44CrtI>aIitI1IfIl1J1j>1fl1Ir>+ISJpIIj>rIAIITij>°IcII>It><00t0jp