Citation
Characterization of the rabbit renal H, K-ATPases

Material Information

Title:
Characterization of the rabbit renal H, K-ATPases
Creator:
Campbell, W. Grady, 1955-
Publication Date:
Language:
English
Physical Description:
xiv, 129 leaves : ill. ; 29 cm.

Subjects

Subjects / Keywords:
Adenosine triphosphatases ( jstor )
Alternative splicing ( jstor )
Antibodies ( jstor )
Complementary DNA ( jstor )
Kidneys ( jstor )
Messenger RNA ( jstor )
pH ( jstor )
Protein isoforms ( jstor )
Rabbits ( jstor )
Rats ( jstor )
Department of Biochemistry and Molecular Biology thesis Ph.D ( mesh )
Dissertations, Academic -- College of Medicine -- Department of Biochemistry and Molecular Biology -- UF ( mesh )
H(+)-K(+)-Exchanging ATPase -- chemistry ( mesh )
H(+)-K(+)-Exchanging ATPase -- genetics ( mesh )
Kidney Tubules, Collecting ( mesh )
Phylogeny ( mesh )
Rabbits ( mesh )
Genre:
bibliography ( marcgt )
theses ( marcgt )
non-fiction ( marcgt )

Notes

Thesis:
Thesis (Ph. D.)--University of Florida, 1998.
Bibliography:
Includes bibliographical references (leaves 117-128).
Additional Physical Form:
Also available online.
General Note:
Typescript.
General Note:
Vita.
Statement of Responsibility:
by W. Grady Campbell.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
Copyright [name of dissertation author]. Permission granted to the University of Florida to digitize, archive and distribute this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Resource Identifier:
029484534 ( ALEPH )
51174930 ( OCLC )

Downloads

This item has the following downloads:


Full Text












CHARACTERIZATION OF THE RABBIT RENAL H,K-ATPASES


by

W. GRADY CAMPBELL













A DISSERTATION PRESENTED TO THE GRADUATE SCHOOL
OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT
OF THE REQUIRENIENTS FOR THE DEGREE
OF DOCTOR OF PHILOSOPHY

UNIVERSITY OF FLORIDA


!998
































This thesis is dedicated to my father, William Maxwell Campbell, and my mother, Clara
Hicks Campbell.
















ACKNOWLEDGMENTS


I would like to acknowledge the contributions of a number of people who helped me

in this work. First I would like to thank my committee, the chair Dr. Brian Cain, Dr.

Charles Wingo, Dr. Susan Frost, Dr. Harry Nick, and Dr. Michael Kilberg. Also Dr. David

Weiner was very generous to share his lab and microscopes. Dr. Jill Verlander directed a

very interesting line of research to answer some questions that arose out of our own

research.

I would also like to thank my fellow lab members for putting up with me all this time.

Thanks go to Kim McCormick, Philip Hartzog, Abbe Stack, Jim Gordon, James Gardner,

Paul Sorgen, Tammy Caviston, and Regina Perry. James, Paul, Tammy, Regina, and I

shared many years together as a particularly cohesive lab family. Also I want to thank my

labmates in my lab home away from lab home, Jeanette Lynch, Amy Frank, and Robin

Moudy. They really went out of their way for me, and it was a pleasure working with

them. Mary Handlogten was also especially helpful in getting me started in protein work. I

want to acknowledge the contribution of the Yang lab, including Mike Litt, Chien Chen,

and Sue Lee. Having an adjacent lab with open doors and shared space between them has

turned out to be a great design, there has been a high level of camaraderie and exchange of

ideas between the labs.










I also appreciate the support and encouragement of my family, my sister Diane, her

children Emory and Lisacole, my brother-in-law Ken, and the newest addition to our

family Samma. The companionship and support of Ruth has helped me throughout my

time here. And most of all, I appreciate the enthusiastic support of my father and late

mother during my years here.

















TABLE OF CONTENTS


ACKNOWLEDGMENTS ............................................. iii

LIST OF TABLES ............................................ ......... vii

LIST O F FIG U R E S .......... ......... .................................. viii

ABBREVIATIONS .............................. ........................ x

ABSTRACT ....................... .............................. xiii

BACKGROUND AND SIGNIFICANCE ................................... 1
Overview .................. .......................... ............ 1
H,K-ATPase in the Kidney ............................................ 4
H,K-ATPase Structure and Function ................................... 17
R enal Tissue Culture Cells ............................................. 23
Summary ............................ .............................. 26

MATERIALS AND METHODS ............ ........................... 27
M olecular Biology .......................... ......................... 27
Biochemistry ........................... ............................ 36
Fluorescence Microscopy ............................................. 40

H,K-ATPASE 3 SUBUNITS IN THE RABBIT RENAL MEDULLARY
COLLECTING DUCT .......................................... .. 45
Introduction ...... ......................... ...................... 45
Renal Medulla HK1 mRNA Variant ................... ............. 46
D iscu ssio n . . . 4 9

H,K-ATPASE a SUBUNITS IN THE RABBIT RENAL CORTICAL
COLLECTING DUCT ............................................... 52
Introduction ......... ........................................... 52
M multiple H,K-ATPase a Subunits in the Kidney ............................ 53
Alternative Splicing ofH,K-ATPase a Subunits in the Kidney ................ 69
Expression ofH,K-ATPase a Subunits in the Kidney ...................... 72
D discussion .................. ......................... ......... 76










H,K-ATPASE ACTIVITY IN A RABBIT KIDNEY CORTICAL
COLLECTING DUCT CELL LINE ...................................... 81
In tro d u ctio n . . . 8 1
Detection ofH,K-ATPase in RCCT-28A Cells ............................. 82
D iscu ssio n .. .. . . .. 10 0

PERSPECTIVE AND FUTURE DIRECTIONS ............................. 106
Multiplicity of H,K-ATPase Isoforms in the Kidney ........................ 106
Cell Type Specificity of H,K-ATPase in the Kidney ........................ 112
F future studies ....................................................... 113

R E FE R E N C E S ........................................................ 117

BIOGRAPHICAL SKETCH .......................................... 129

















LIST OF TABLES


Table page

2-1. PCR primer pairs ............................................ 32

2-2. Solutions for determination of pH ................................. 41


















LIST OF FIGURES


Figure page

1-1. Schematic diagram of H,K-ATPase .............................. 18

3-1. Northern analysis showing presence of HK3 mRNA in renal cortex, renal
medulla, and stomach ....................................... 47

3-2. 3' and 5' RACE reactions to amplify HK3 cDNAs using rabbit renal
medulla as template ................................... ...... 48

3-3. HKP3 and 3' subunit mRNAs ........................... ..... .. 50

4-1. Design of degenerate primers for RT-PCR of novel P-type ATPases ....... 56

4-2. RT-PCR product amplified from rabbit renal cortex RNA using degenerate
p rim e rs . . . 5 7

4-3. BLAST search using sequence of419 bp fragment of HKa2 ............ 58

4-4. Cloning of HKot2a and HKX2c cDNAs ............................... 59

4-5. GenBank accession records for rabbit HKoc2 sequences .................. 61

4-6. Northern analysis showing presence of HKc*2, in distal colon and renal
cortex ...................................................... 67

4-7. Distance analysis of selected HKat and NaKca subunit coding ............. 70

4-8. Rabbit HKIc2 gene sequence at the 5' end ............................ 71

4-9. Western analysis showing presence of HKc2,, and IHKci, protein in renal
cortex .................................................... 73

4-10. Immunohistochemistry by Dr. Jill Verlander and Ms. Robin Moudy ........ 75

5-1. Southern blots ofH,K-ATPase subunit mRNA in RCCT-28A cells ........ 84

VIII











5-2. HKP3 and HKKc, subunit mRNA in RCCT-28A cells .................... 86

5-3. HK(a2 subunit mRNA in RCCT-28A cells ............................. 88

5-4. Western analysis showing presence of HKot2. protein in RCCT-28A cells ..... 90

5-5. pHi recovery from an acid load by RCCT-28A cells in the absence ofNa* .... 96

5-6. pH, recovery from an acid load by RCCT-28A cells in the presence of EIPA 98

5-7. Summary of the rates ofpH, recovery from an acid load by RCCT-28A cells 102

















ABBREVIATIONS


ATP

BCECF

BCECF-AM

bp

DEPC

DNA

EDTA

EIPA

FBS

FITC

HEPES

HKox

HKa,

HK(,2a,

HKa2b

HKX2c

HKoX3


adenosine triphosphate

2',7'-bis(carboxyethyl)-5(6)- carboxyfluorescein

acetoxymethyl ester of BCECF

base pairs

diethylpyrocarbonate

deoxyribonucleic acid

ethylene diamine tetraacetic acid

ethylisopropylamiloride

fetal bovine serum

fluoroisothiocyanate

N-2- hydroxyethylpiperazine-N'-2-ethanesulfonic acid

H,K-ATPase a- (catalytic) subunit

H,K-ATPase a, subunit

H,K-ATPase U 2, subunit

H,K-ATPase cL2b subunit

H,K-ATPase ct2 subunit

H,K-ATPase o3 subunit











HKKc4 H,K-ATPase i4 subunit

HK3 H,K-ATPase (3 subunit

HK3' H,K-ATPase 3' subunit

hr hour

kb thousand base pairs

kDa thousand Daltons

M molar

mEq milliequivalents

min minute

MW molecular weight

NaKa Na,K-ATPase ot (catalytic) subunit

NaKct1 Na,K-ATPase x, subunit

NaKct2 Na,K-ATPase o2 subunit

NaKcX3 Na,K-ATPase (x3 subunit

NaKc4 Na, K-ATPase cx4 subunit

NaKi31 Na,K-ATPase 3i subunit

PAGE polyacrylamide gel electrophoresis

PCR polymerase chain reaction

pH1 intracellular pH

PMSF phenylmnethylsulfonyl fluoride

pS picoSiemrnen

RACE Rapid Amplification ofcDNA Ends











RNA ribonucleic acid

RT reverse transcription

RT-PCR reverse transcriptase-polymerase chain reaction

SDS sodium dodecyl sulfate

sec second

Tris tris[hydroxymethyl]amninomethane

UTR untranslated region

















Abstract of Dissertation Presented to the Graduate School
of the University of Florida in Partial Fulfillment of the
Requirements for the Degree of Doctor of Philosophy

CHARACTERIZATION OF THE RABBIT RENAL H,K-ATPASES

By

W. Grady Campbell

August 1998



Chairperson: Dr. Brian D. Cain
Major Department: Biochemistry and Molecular Biology

H,K-ATPases are located on the apical membrane of epithelial cells lining the

collecting duct in the kidney. ATP hydrolysis drives luminal acidification and potassium

reabsorption by the enzyme. H,K-ATPases consist of two subunits. The catalytic sites are

located on the ac subunits, and the P3 subunits play a role in intracellular trafficking. The

goal of this work was to elucidate the molecular identity ofH,K-ATPase a and 3 subunits

in kidney. Northern analysis demonstrated two H,K-ATPase (3 subunit species in rabbit

renal medulla; only the smaller of these was present in renal cortex and gastric tissues. A

search for H,K-ATPase a subunit isoforms in rabbit renal cortex was conducted using

reverse transcriptase-polymerase chain reaction with degenerate primers. A full-length

cDNA of the H,K-ATPase cX2 subunit was obtained. Two 5' ends of this transcript were

observed by 5' Rapid Amplification of cDNA Ends. One (HKcx2a) had high homology to










previously known H,K-ATPases, and the second was a novel variant (a2c). Phylogenetic

analysis showed that the rabbit cax,, subunit clusters near H,K-ATPases from human axillary

skin and rat distal colon, but is more distant from gastric H,K-ATPase and

Na,K-ATPases. Gene sequence analysis showed that the first HKo_,c exon was located

within the first HKX2a intron. Western analysis using antipeptide polyclonal antibodies

demonstrated the expression ofHKc(x, HKac2,, and HKcx2c subunits in rabbit renal cortex.

The mRNAs encoding the HKO3, HKc,, HKIx2,, and HKc 2, subunits were detected in the

rabbit cortical collecting tubule intercalated cell line RCCT-28A. These results indicated

that acid-secreting intercalated collecting duct cells were a cell type containing

H,K-ATPase, and these cells appear capable of expressing multiple H,K-ATPase isoforms.

















BACKGROUND AND SIGNIFICANCE


Overview


H,K-ATPase was first identified in the stomach, where it is expressed at an extremely

high level to mediate the extrusion of acid that aids digestion. A great deal has been

learned about regulation of H,K-ATPase in the stomach, enough to feel as though its

regulation is understood in a meaningful way. At the molecular level, gastric-specific

transcription factors have been found that may be responsible for the marked

tissue-specific regulation of expression of H,K-ATPase (Maeda et al., 1991; Oshiman et

al., 1991; Tamura el al., 1992). The principal means of induction of gastric H,K-ATPase

from its basal state is by unwinding a tightly coiled tubular network, exposing pumps

localized in the network and thereby increasing the size of the secretary surface (Pettit et

al., 1995). This morphological transformation is triggered by various stimuli including

activation of stretch receptors in the stomach by entering food, the sight of food, or even

the thought of food (reviewed by Wolfe and Soil, 1988; Hersey and Sachs, 1995). Thus,

there is a framework of understanding of the regulation of H,K-ATPase in the stomach at

the molecular and cellular levels, and the root stimuli that result in the H,K-ATPase

response are known.

H,K-ATPase is expressed at much lower level in the kidney, but its role in the kidney

is even more critical to life than its role in the stomach. The kidney plays the major role in










K' homeostasis, maintaining extracellular (including plasma) K' concentration within the

relatively narrow normal range of 3.8 to 5.0 mEq/L (Merck, 1992; Guyton and Hall,

1997) despite a wide variation in K' intake. If plasma K' levels depart significantly from

these values, then cardiac arrhythmias lead to life-threatening conditions.

K' transport in the kidney is also important to blood pressure regulation. It has been

observed that urinary K+ levels and urinary Na'/K' ratio are related to systolic and

diastolic blood pressures (INTERSALT, 1988; Whelton, 1993). Excretion rates show a

higher degree of correlation with elevated blood pressure than serum levels, implicating

the kidney as an important organ in regulating the effect of K' on blood pressure. Dietary

K+ supplementation has been shown to lower blood pressure since early this century

(Ambard and Beaujard, 1904; Addison, 1928).

The substantial role of renal ion transport in blood pressure regulation is emphasized

by studies conducted by Lifton (1996), who determined the molecular bases underlying

certain types of monogenic inherited extreme hypo- and hypertension disorders. Each of

the genetic defects found affected renal ion transport. Such well-defined inherited diseases

of blood pressure regulation are not common. In 95% of people experiencing hypertension

their diagnosis is essential hypertension, the root cause being essentially unknown. To

understand this majority of hypertensive disorders, a more complete understanding of

renal ion transport is needed. Because of the role of H,K-ATPase in the final regulation of

K' excretion in the kidney, understanding its contribution to renal ion transport could well

be important in understanding the problem of essential hypertension.

In order to understand the role of H,K-ATPase in the kidney, the exact H,K-ATPase

pumps of the kidney must be characterized at a molecular level. This characterization must









3
be carried out to a high level of detail, to explore variations in the ion pumps conferred by

differences in changes in transcriptional start or adenylation sites, or by alternative

splicing. With the identity of the H,K-ATPase subunits known at a molecular level,

various reagents can then be developed to characterize H,K-ATPase regulation. These

include cDNA probes, antibodies, and activity assays. With these tools available, it will be

possible to develop a more complete framework of understanding of renal H,K-ATPase.

The studies in this dissertation contribute to our knowledge of the H,K-ATPase

subunits at a molecular level. At the time these studies began, it was not known what

H,K-ATPase subunits were responsible for the active H' and K' exchange that had been

observed in renal collecting duct. Further evidence is presented that all the currently

known H,K-ATPase subunits are present in kidney, and that the primary cell type in which

all are expressed is the collecting duct acid-secreting intercalated cell. When these studies

were begun, there was no known alternative splicing of P-type ATPases. Here alternative

splicing of an HKca subunit mRNA is described, and expression of a protein product is

shown in kidney. In addition, a variant renal medulla HK3 transcript is described that has

tissue-specific expression even within the kidney. In summary, this work has generated a

new appreciation for the complexity of H,K-ATPase molecules that underlie renal

collecting duct H,K-ATPase activity.










H,K-ATPase in the Kidney


Transport activity


The kidney is the principal organ responsible for potassium homeostasis and plays a

major role in maintenance of the acid-base balance of the body. The renal collecting duct

(CD) is the primary site of regulation of the excretion of potassium and the acidification of

urine. A number of studies implicate an apical H,K-ATPase as an important mediator of

these functions. The enzyme (pump) actively transports HF into the lumen of the nephron

in a nonelectrogenic exchange for K' (for review, see Wingo and Cain, 1993, Wingo and

Smolka, 1995).

A K' activated ATPase was observed in frog gastric microsomes by Ganser and Forte

(1973). Lee et al. (1974) found that gastric microsomes isolated from dog mucosa were

able to accumulate H' in the presence of ATP and K'. These studies were the initial

observations of the now well-known gastric H,K-ATPase. The designation of

H,K-ATPase was given the enzyme by Sachs el al. (1976).

Gustin and Goodman (1981) isolated apical brush-border membrane of the rabbit

descending colon by isolation of epithelial cells, homogenization, and centrifugation on a

Percoll gradient. They found a membrane-bound, K'-activated ATPase, which had a

KIt=2xlO4M for K', was competitively inhibited by Na:, but had no activation by Na. It

was vanadate sensitive, but oligomycin and ouabain (I mM) insensitive. This represented

the first observations of enzymatic activity for the colonic H,K-ATPase.

Smolka and Sachs (in Sachs et al., 1982), employing monoclonal antibodies, detected

a protein at least similar to the gastric proton-potassium-translocating ATPase protein in









5

renal distal tubule and colon. Sachs et al. (1982) advanced the idea that this protein might

be involved in the K' reabsorption or the acidification known to take place in kidney or

colon.

By quantitating the hydrolysis of [7y-32p]ATP, Doucet and Marsy (1987) observed a

K+-stimulated ATPase activity in rabbit kidney. The level of activity was related to the

density of intercalated cells in microdissected segments of rabbit connecting segment

(highest activity), cortical collecting duct (intermediate), and outer medullary collecting

duct (lowest), and not detectable in any other nephron segments. The ATPase affinity for

K' was high (Km=0.2-0.4mM). The pharmacological properties of the renal H,K-ATPase

was examined as a preliminary indication of the pumps present in the kidney. Omeprazole

is an inhibitor of the gastric isoform ofH,K-ATPase, vanadate inhibits all P-type ATPases,

and ouabain is a Na,K-ATPase inhibitor that also inhibits non-gastric H,K-ATPase

isoforms. The renal ATPase was inhibited by omeprazole and vanadate, but not by

ouabain. They also observed a K'-ATPase activity with potassium restriction in rat renal

outer medullary collecting duct that roughly doubled, changing little after 0.5 weeks

low-K+ diet. In cortical collecting duct activity doubled, rising steadily during a five week

low-K+ diet (Doucet and Marsy, 1987).

Wingo (1987) did a more complete study of dietary K' influence on K' transport in the

kidney. He first established that rabbits on a K'-replete diet, or on a K1-depleted diet, or

on a K+-deplete Na+-supplemented diet all consumed similar quantities. Wingo (1987)

used restricted diets containing 0.55% K', marginally less than the 0.6% generally thought

to be required for normal rabbit growth. In time-course studies he found that after an

initial two-week period of K'-replete meals, 72 hr was sufficient for the response to










equilibrate as judged by urinary Na' and K' excretion. Muscular K' levels had not altered

significantly in that time, showing that renal response preceded effects deleterious to the

animal. Serum K' levels were slightly higher in K'-replete animals, and the same in

K+-depleted Na-supplemented animals compared to K'-depleted animals. The sodium

supplementation evidently maintained the K' serum level. Serum aldosterone was found to

be 2.88.57 ng/dl in K'-depleted Na'-supplemented rabbits, 15.6+5.3 for Kt-depleted

rabbits, and 44.714.0 for potassium-replete animals, and thus any changes in transport

observed cannot be correlated with aldosterone level.

In his experiments, Wingo (1987) found that perfused collecting ducts from outer

medullary inner stripe had similar rates of fluid reabsorption, gauged by 3H-inulin flux, and

similar transepithelial voltages. K' reabsorption, however, roughly tripled among rabbits

on K+-restricted diets, measured as a flux of 42K. K'-replete rabbits had

5.9O.8%,K+-depleted rabbits had 1722.0%, and K+-depleted Na'-supplemented rabbits

had 20.84.2% reabsorption. The data were not significantly different in either of the two

K'-restricted cases. He concluded that K' reabsorption in the medullary collecting tubule

is comparable to K' secretion in the cortical segments at normal fluid flux rates, and could

have important contributions to the amount of K excreted in urine. In a later report by

Wingo (1989), the name H,K-ATPase was first explicitly given to the K*-stimulated

ATPase that had been studied by others in the kidney.

Utilizing a fluorometric microassay in which ATP hydrolysis is coupled to the

oxidation ofNADH, Garg and Narang (1989) detected the presence of a Ky-dependent,

ouabain-insensitive ATPase activity in rabbit kidney that was also omeprazole-,

SCH28080-, and vanadate-sensitive. Sch-28080, like omeprazole, is a potent gastric










H,K-ATPase inhibitor. Earlier work by this group (Garg and Narang, 1988) noted H'

secretion coupled to an ATPase that was not NEM-inhibited, and could not account for

the vacuolar HF-ATPase they were studying. Significant K'-ATPase activity was seen in

microdissected connecting segment (17.03.3 pmol min' mm'), cortical collecting duct

(6.6+0.7), and outer medullary collecting duct (8.81.7), but not in proximal straight

tubule, convoluted tubules, nor the thick ascending limbs. They found the K+-ATPase

activity to be affected by diet. Activity was found in the connecting segment (13.04.0

pmol min1 mm-'), cortical collecting duct (10.13.0), and outer medullary collecting duct

(10.8+2.2) in animals on a low K' diet. Cortical collecting duct activity varied with pH;

optimal pH of 7.4 gave activity of 10 pmol min1' mm-', falling at lower pH to 3 at pH of

7.0, and falling at higher pH to 5 at pH 7.8. Thus, a high K" diet completely suppressed

the K-ATPase activity, while rabbits fed a normal diet had similar activity to the low K*

fed rabbits of the second study.

Studies by Cheval and co-workers (Cheval el al., 1991) examined the 86Rb flux (86Rb is

a K' analog used as a radioactive tracer for transporter studies) and K-ATPase activities.

These activities were blocked by Sch-28080 in cortical and medullary collecting duct.

Activities they attributed to Na,K-ATPase and H-ATPase were unaffected by Sch-28080.

In this study, ouabain was used at a concentration of 2.5 mM to inhibit Na,K-ATPase.

Although there are inconsistencies in the exact concentration at which ouabain inhibits

H,K-ATPases containing the HKa_ subunit, all expression studies carried out to date

(Modyanov et al., 1995; Codina e al., 1996; Cougnon el al., 1996; Grishin et al., 1996)

except for one (Lee et al., 1995) indicate that 2.5 mM ouabain is sufficient to block the

HKa2 enzyme. Lee et al. (1995) detected no ouabain sensitivity at 1 mM, and it is not











known what effect 2.5 mM would have had in their system. In this work by Cheval et al.

(1991) the activities of Na,K-ATPase and an HKa, H,K-ATPase would be

indistinguishable.

These early studies do not distinguish between different isoforms of H,K-ATPase that

may together account for the H,K-ATPase activity observed in the kidney. Given

historical perspective, this makes sense because at the time these studies were conducted,

only HKxci and HKP3 subunit isoforms were known, and the ouabain-sensitive

H,K-ATPase was not yet known. Later studies (Younes-lbrahim el cal., 1995;

Buffin-Meyer el al., 1997) addressed the issue of multiple isoforms of H,K-ATPase in the

kidney and their distribution along the nephron and collecting duct. These investigators

found three distinct H,K-ATPase activities. Two were found in the collecting duct; one of

these was sensitive to Sch-28080; the other was insensitive. The third was found in

proximal tubules and thick ascending limbs, and was inhibited by Sch-28080. In normal

rats, the sole H,K-ATPase activity present in collecting duct was the Sch-28080-sensitive

activity. In K'-depleted rats, the overall H,K-ATPase activity in collecting duct increased,

while the activity in proximal tubule decreased. The increase was abolished by ouabain,

but not by Sch-28080, implying that the increase is due to an H,K-ATPase isoform that is

pharmacologically dissimilar to HKcx. The proximal tubule/thick ascending limb

H,K-ATPase may have a basolateral polarity, rather than the apical localization of the

collecting duct H,K-ATPase. If the H,K-ATPase role in proximal tubule and thick

ascending limb involves K+ homeostasis, then its down regulation by dietary K' depletion

would imply a basolateral location. Together, these results argue for three different

H,K-ATPase isoforms in kidney. One was constitutively expressed in the collecting duct,











and was Sch-28080-sensitive and ouabain-insensitive, like the HKcai isoform of

H,K-ATPase. The second was presumably located basolaterally in proximal tubule and

thick ascending limb, reduced by low K', and was ouabain-sensitive. The third was located

apically in the collecting duct, stimulated by low K', and Sch-28080-insensitive but

ouabain-sensitive.

Earlier studies naturally concentrated on establishing the existence of H,K-ATPase in

the kidney. The early studies demonstrated H,K-ATPase activity in connecting segment,

cortical collecting duct, and outer medullary collecting duct. Although measurements were

made for HK-ATPase activity in other nephron segments, no H,K-ATPase activity was

found outside the connecting segment and collecting duct. More recently, proximal tubule

and thick ascending limb have been added as regions having H,K-ATPase activity. These

studies also began to address the differences among H,K-ATPases that are present in the

kidney, defining the characteristics of the H,K-ATPase activities and their localization.

The identity of the H,K-ATPase molecules responsible for the two collecting duct

activities have been found. The identity of the H,K-ATPase molecule responsible for the

activity in the more proximal nephron is not yet known.


H,K-ATPase subunit isoforms in the kidney


Until the last five years, the presence of H,K-ATPase in the kidney has been defined

only on the basis of activity. We have now begun to determine the molecular identities of

the pumps responsible for this activity. And only very recently it has become appreciated

that the complexity of H,K-ATPase expression also includes alternative splicing of HKIx

and HK3 isoforms.








10

An H,K-ATPase has long been known to acidify the lumen of the stomach. This pump

is a member of the P-type ATPase family, which shares similarity of sequence, structure

and mechanism. The gastric H,K-ATPase is comprised of a catalytic cta subunit and a P

subunit; the active form of the enzyme is an (ao3)2 oligomer (for review see Hershey and

Sachs, 1995; Van Driel and Callaghan, 1995). Full-length cDNAs for rabbit HKa1

(Bamberg etal., 1992) and HKp3 (Reuben el a., 1990) have been cloned and sequenced.

RT-PCR followed by sequencing of the amplified products has been used to demonstrate

that mRNA (Ahn and Kone, 1995) and protein (Callaghan el al., 1995) for HKoct and that

mRNA and protein for HK3 (Callaghan el al., 1995) isoforms are present in kidney. This

author was included in the latter study.

The non-gastric H,K-ATPase a subunit isoforms (HKa2) have been cloned from

several tissues. A partial cDNA for an HKa2 isoform was obtained from human axilla skin,

and mRNA observed in brain and kidney (Modyanov el al., 1991). A full-length cDNA

was found subsequently (Grishin et a/., 1994). An HKa2 cDNA was cloned from rat distal

colon by Crowson and Shull (1992); the corresponding amino acid sequence has 86%

amino acid identity to the cDNA derived from human skin. This rat HKa,_ mRNA was

detected in kidney, uterus, and heart using two separate cDNA probes from HKa2 3' UTR

and C-terminal transmembrane domains. The 3' UTR derived probe detected HKo- 2 in

forestomach as well. These human and rat cDNAs were shown to encode H+/K' exchange

activity when expressed in Xenopus /laevis oocytes (Modyanov et a/., 1995; Cougnon et

al., 1996), although recent work questions the stoichiometry of the exchange in the human

isoform (Grishin et al., 1996). In two of these studies rabbit HKp3 subunits were









11

cotransfected (Modyanov el cal., 1995; Grishin etl a/., 1996), and in the other Bufo marinus

HK3 subunits were cotransfected (Cougnon et al., 1996). A partial HKcx2 cDNA was

cloned from a rabbit cortical CD (CCD) library having 84% amino acid identity to the

human HKot2, and mRNA was detected in CCD and colon (Fejes-Toth et a[., 1995).

Watanabe et al. (1992) cloned and sequenced a similar cDNA fromrn distal colon of guinea

pig. The degree of identity at the amino acid level among human, rat, guinea pig, and

rabbit HKoc2 clones is less than the amino acid identity of HKa1 (>97%) between the three

species, but much greater than the typical amino acid identity between HKa1 and other

P-type ATPases (<64%). Therefore, although controversy on this point exists, this author

considers these to be orthologous and refers to them collectively as HKKa2. As part of this

dissertation, further evidence will be presented that the HKca genes are indeed orthologs.

A related cDNA (75% identity at the amino acid level) was cloned from Bufo marinus

bladder, an analog of mammalian collecting duct (Jaisser et al., 1993). While mRNA was

detected in toad bladder, none was observed in either stomach or colon. The evolutionary

distance between toad and mammal coupled with the tissue distribution dissimilarity of the

toad HKc make it difficult to evaluate the relationship between the toad and mammalian

isoforms. In addition to uncertainty in the number of H,K-ATPase isoforms in the kidney,

it has been recently been discovered that there are two alternatively spliced transcripts of

the rat HKc2 in kidney (Kone, 1996, Higham and Kone, 1998). Thus, several

H,K-ATPase c subunit isoforms have been reported in kidney, but it is at present

uncertain whether these account for all the renal H,K-ATPases. Also uncertain is their

relative contributions to renal H,K-ATPase activity.











Experiments have been conducted in attempts to find more members of the gene

family that includes the x subunits ofNa, K-ATPases and H,K-ATPases. Shull and Lingrel

(1987) probed a human genomic library at low stringency with probes made from

Na,K-ATPase sheep ai, rat cl, rat ao2, and rat U3. Five different sequences were obtained,

with two to ten clones representing each sequence. Three of these were known to be

human NaKcxi, NaKoa2, and HKocx genes. The fourth was later identified as HKa2

(Modyanov el al., 1991). The fifth, which is physically linked to the NaKat2, was later

identified as NaKa4 by Shamraj and Lingrel (1994). In a similar experiment, Sverdlov et

al., (1987) screened a human genomic library with a probe made from porcine kidney

NaKa1. The probe was constructed to contain the well-conserved region surrounding the

active site aspartate residue. They obtained five distinct clones. They were recognized as

the three known NaKa subunits and the two known HKa subunits. In sum, the results of

these two experiments imply that all members of the gene family of X,K-ATPases are

known.

At present, there are no known specific HKP3 isoforms in addition to the one originally

discovered in gastric tissues. However, it is thought that the NaKPI subunit isoform is the

partner to HKaC2 in active H,K-ATPase pumps in colon and kidney (DuBose et al., 1998;

Kraut et al., 1998). These observations are the first suggesting that an individual P-type

ATPase 3 subunit has more than one primary P-type ATPase ac subunit partner in vivo.

This was the determination reached by two separate groups using different antibodies to

specifically immunoprecipitate a(3 pairs, lending strength to their independent and identical

conclusions. However, it is possible that during tissue processing some of the o3/P pairs











may mix partners, leading to an erroneous conclusion. Pairs that are not thought to

associate in vivo have been seen in expression systems to give rise to functional activity

(Horisberger et al., 1991; Codina et al., 1996), showing that the in vivo P-type ATPase

pairs are not exclusive when expressed in expression systems. Expressed in their proper

cell types, there may be compartmentation that controls HKc and HK3 selectivity. This

could segregate the subunits from their incorrect partners on the basis of translation of the

various H,K-ATPase and Na, K-ATPase isoforms at different times or in different

locations.

Alternative transcriptional start sites for HK3 in the stomach were detected by

Newman and Shull (1991). The primer extension method used by Newman and Shull

(1991) would not have necessarily differentiated between alternative transcriptional start

sites and alternative splicing. Primer extension would only give information about the

distance from the primer to the beginning of any or all of the transcripts that contain the

primer site. So it is possible that they were detecting alternative splicing as well as

alternate transcription start sites. Thus far, however, there have been no reports of

multiple HKO3 subunit transcripts in any tissue seen by RNA analysis techniques such as

northern analysis or ribonuclease protection assay. In present work, I present evidence

that the transcriptional start site of HK3 subunit in the medulla has slight differences

relative to stomach, and that in renal medulla there are two transcripts expressed at

comparable level, one of which appears to be the product of alternative splicing.

In summary, the first H,K-ATPase subunit detected in kidney was the non-gastric

isoform HKa2, shown by RT-PCR to be present in human kidney (Modyanov et al.,

1991). Shortly before this author joined his lab, Dr. Brian Cain found that the rabbit 3











subunit isoform of stomach was present in kidney (Callaghan et al., 1995;

Campbell-Thompson el al., 1995). After the work described here was begun, work by

other investigators (Ahn and Kone, 1995) established that the catalytic subunit isoform

found in stomach, HKc(i, is also found in kidney. HKcax protein was shown by immunoblot

in rabbit kidney (Callaghan el al., 1995). To further complicate the picture, an

alternatively spliced HKcL2 (dubbed HKo2,, with the canonical HKcC2 being renamed

IHKO2a) was discovered in kidney (Kone and Higham, 1998). A search for the 3 subunit

partner to HKxc2a established that NaKP3 couples to HKct2i, in vivo (Dubose et al., 1998;

Kraut et al., 1998). Presumably, HKcx, pairs with HK3 in kidney as it does in stomach

(Hall etal., 1991; Shin and Sachs, 1994, Mathews el al.; 1995). All the known

H,K-ATPase subunit isoforms are known in kidney. HKoi/HKf3 and HKKa2/NaKf3

H,K-ATPases contribute to the activities observed in the collecting duct. Experiments

have been done to find other candidate H,K-ATPase genes, and to date none have been

detected. So far no molecular identity can be associated with the H,K-ATPase activity in

the proximal tubule and thick ascending limb.


Deficiencies of H.K-ATPase


There are two lines of evidence to indicate that H,K-ATPases are critical to

maintenance ofK+ homeostasis, and that disturbances in this balance are a serious health

problem. First, transgenic mice with deranged H,K-ATPase function show substantial

disturbances ofK+ balance (Meneton el al., 1998). Second, an environmentally high level











of vanadium in northeast Thailand effectively inhibits H,K-ATPase function among

humans and water buffalo living in the area (Dafnis el al., 1993).

Experiments have been carried out to show the critical nature of H,K-ATPase

expression and its relevance in the kidney (Meneton el al., 1998). Meneton showed that

transgenic mice homozygous with respect to an HKci: subunit deletion were normal when

fed diets that had normal levels of K' (1% K). However, when fed K'-free diets

(<0.004% Kt) these mice experienced loss in body weight, plasma K', and muscle K.

HKa2 is not the major mechanism of K' conservation in the kidney; the urinary K'

excretion rate in both wild-type and HKo2-deficient mice declined 100-fold compared to

HKc2-deficient mice on normal diets. However, mean urinary K' excretion per day was

consistently higher (typically 120% of wild-type) following a week of K*-free feeding.

This suggests that there may be a role played by renal HKcx2 in K' conservation. The role

played by HKa2 in the colon was more clear. Fecal excretion rate increased four-fold in

HKa2-deficient compared to normal mice that had been fed the same K+-free diet,

indicating an inability to reabsorb K' by the digestive tract. Cardiac arrhythmias were

observed in some of the HKa2-deficient mice, presumably due to low plasma K'.

Anecdotal evidence concerning H,K-ATPase activity in humans comes to us from

Thailand, where environmental vanadium levels are high. Vanadate is a transition state

inhibitor for all P-type ATPases, and its presence in drinking water and soil in northeast

Thailand was associated with an epidemic of renal distal tubular acidosis. It is interesting

that although vanadate would be expected to inhibit Na,K-ATPases and Ca-ATPases,

along with H,K-ATPase in stomach and distal colon, the predominant symptoms were









16

renal. The disease is characterized by an inability to lower urine pH to below 5.5 pH units.

Affected persons had generalized paralysis, hypokalemia, metabolic acidosis, muscle and

bone pain, and nocturia (Nilwarangkar el al., 1990). The connection between acid

secretion in the kidney and stomach had been made, and some patients tested positive for

gastric hypoacidity (Sitprija el al., 1988). However, the exact cause of the acid secretion

defect was unknown. As recently as 1990, a genetic predisposition had not been ruled out

(Nilwarangkar et al., 1990). Patients are treated by K' and alkali supplements, and some

deaths occurred with non-compliance.

It was shown in rats that intraperitoneal injections ofvanadate (5 mg/kg) led to

hypokalemic distal renal tubular acidosis and loss in muscle K' (Dafilis et al., 1993).

Cortical collecting duct K-ATPase activity that was sensitive to Sch-28080 (200 uM)

declined 75% in vanadate-treated rats. Medullary collecting duct activity declined less than

50% by the same assay. However, it should be noted that this is a sufficiently high

Sch-28080 concentration to inhibit HKa2 enzyme activity according to some investigators

(Modyanov et al., 1995; Grishin et al., 1996), but other studies have not seen sensitivity

to Sch-28080 even at that relatively high concentration (Cougnon el al., 1996; Codina et

al., 1996). Therefore, a vanadate effect on l-IKc(2 enzyme activity in this study might have

remained undetected. Na,K-ATPase activity was measured also, and showed a decline in

vanadate-treated animals as well. This assay also may or may not have detected a

contribution due to HKcx2 activity, which is expected to be ouabain-sensitive at

concentrations of between >10 pM (Modyanov et al., 1995) and <1 mM (Codina et al.,

1996) depending on the study. The evidence suggests that vanadate could be a factor in

the endemic hypokalemic distal renal tubular acidosis in northeast Thailand. More precise











measurements need to be made to quantitate the effect of Sch-28080 and ouabain on

HKaX2 activity.

In summary, these studies illustrate the essential nature of H,K-ATPases in the renal

collecting duct (and in distal colon) for the maintenance of K" balance. In the extreme

case, deranged H,K-ATPase function can result in disease or even death. These studies

isolating the activity of H,K-ATPase do not address the role H,K-ATPase might play in

blood pressure regulation. The other more acute affects of impairments of H,K-ATPase

activity probably obscured the affects on blood pressure regulation. Although in some

cases a defect in a single gene leads to a dramatic loss in blood pressure control,

hypertension is most often a multifactorial disease. H,K-ATPase is likely to be one of a

combination of activities that fail to control blood pressure in the hypertensive patient.


H.K-ATPase Structure and Function


HK-ATPase catalytic subunit


The HKax subunit contains the active sites relating to its catalytic action (Figure 1-1).

A number of functionally important sites in the HKax have been defined. The location of

the phosphorylated aspartyl residue of the catalytic intermediate is known and the region

immediately surrounding it is extremely well conserved within the P-type ATPase family

(Walderhaug et al., 1985). The location of a residue that binds the fluorescent molecule

FITC is also known; FITC competes with ATP for binding to H,K-ATPase and therefore

is thought to be at or near the HKo ATP binding site (Jackson et cil., 1983; Farley and

Faller, 1985). The site of the K'-competitive inhibitor Sch-28080 which acts at an

















extracellular


ATP ADP+P,


intracellular


Figure 1-1. Schematic diagram of H,K-ATPase. Dashed line indicates the
amino-terminal extension of HKac protein.


kp


FITC


Kx \ H +











extracellular site (Munson and Sachs, 1988) is known by studies with a photoaffinity

analog to lie between the first two transmembrane domains (Munson et al., 1991). The

Na,K-ATPase inhibitor ouabain binds to the corresponding site in that enzyme, but it is

not known whether this is the binding site conferring ouabain's less sensitive inhibition of

HKcL2. The binding site of the medically important inhibitor omeprazole is also known, it

may bind to any of three extracellular cysteines located in the C-terminal quarter of the

subunit (Besancon et al., 1993). This inhibitor has achieved some popular acclaim,

television advertisements may be seen for it under its brand name Prilosec.

Using hydropathy analysis, the existence of four transmembrane helices in the

amino-terminal half ofHKci is clear. The number of transmembrane domains of the

carboxyl-terminal half of HKo is not as apparent from the hydropathy plot, but may be

placed somewhere between three and five by that analysis. However, the presence of an

odd number of membrane-spanning regions would be inconsistent with the placement of

amino- and carboxy-termini in the cytoplasm by antibody reactivity (Smolka el ali., 1992;

Mercier el al., 1993). Also, the localization of the active sites discussed in the preceding

paragraph, predicts a large intracellular cytosolic loop following the first four

transmembrane domains. The picture is further complicated because recent results

(Raussens et al., 1998) imply that some of the transmembrane domains may be comprised

of 3-strand secondary structure. Using limited tryptic digestion followed by fluorescent

labelling of cysteines, the four transmembrane segments of the amino-terminal half could

be confirmed (Besancon el al., 1993; Shin et al., 1993). In the carboxyl-terminal half of

the protein, only three transmembrane domains were observed. The two most

carboxyl-terminal membrane spans strongly implied by hydropathy analysis were not











observed by fluorescent labelling despite the presence of multiple cysteines. In vitro

translation experiments have also been preformed to elucidate H,K-ATPase topology

(Bamberg and Sachs, 1994). These experiments involve synthesis of putative

transmembrane segments in the presence and absence of microsomes, then detection of

glycosylation of the resulting polypeptides by electrophoresis. Positive glycosylation of a

fusion protein containing glycosylation sites would imply the insertion of a single

transmembrane domain. When a pair of membrane spanning domains were translated, no

glycosylation would result. Both single transmembrane domains and pairs of

transmembranes were tested. In this system, the predicted final two transmembrane

segments were inserted into the membrane. Taken together these experiments predict a

secondary structure for HKxc1 that has amino- and carboxy-termini located intracellularly.

There are four transmembrane domains in the amino-terminal half of the protein, and

between four and six transmembrane domains in the carboxyl-terminal half If

H,K-ATPase membrane topology is conserved with that of Ca-ATPase, recently imaged

by cryoelectron microscopy (Zhang el al., 1998), then HKai subunits probably have ten

membrane spans.

The significance of H,K-ATPase enzyme quaternary structure is presently under active

consideration. Studies suggest that there are specific and stable associations between

catalytic subunits. Radiation inactivation studies showed the minimum functional unit to be

an (c(3)2 heterotetramer (Rabon et act., 1988) The electron microscope diffraction pattern

in images of two-dimensional H,K-ATPase crystals suggested a tetrameric arrangement of

HKci subunits (Hebert el al., 1992). The apparent contradiction of the radiation

inactivation and electron microscopy experiments can be explained. An ax/a interaction has











been shown to be necessary for optimal activity of H,K-ATPase (Morii et al., 1996).

Dimeric Wca interactions were necessary for H,K-ATPase activity, and tetrameric ao/a

interactions confer higher affinity binding of ATP. When coexpressed in insect cells,

NaKai, NaKa2, and NaKcX3 were found to coimmunoprecipitate (Blanco et al., 1994).

Using chimeric constructions combining NaKca and HKcio alternating regions, it was

found that the large intracellular loop was necessary for this association (Koster et al.,

1995). Using a yeast two-hybrid system and fusions of Gal4 to aX subunit cytosolic loops

Colonna et al. (1997) further explored this interaction. In two-hybrid assays, there was no

apparent direct interaction between pairs of the large cytosolic loop (Figure 1-1). Likewise

there was no interaction observed between the smaller loop between the second and third

transmembrane domains. However, the two-hybrid assay gave a positive interaction

between the smaller and larger loops. The interaction is apparently between the loop

between transmembrane domains two and three of one member of the al/ca pair and the

larger loop between transmembrane domains four and five of the other. These results

imply that interactions between H,K-ATPase molecules play a role in their function. There

may be interactions with other molecules as well, such as those governing cell polarity.


H.K-ATPase B subunit


Antibodies to the HK3 subunit protein (Chow and Forte, 1993) and reduction of any

of the three disulfide bonds in the HK3 subunit (Chow et al., 1992) have been observed to

affect catalytic subunit function. In addition to a role in modulating enzymatic activity, the

HKp subunit is also thought to participate in shepherding the H,K-ATPase through the










Golgi and to the plasma membrane (Renaud et al., 1991). The HKI3 subunit contains a

tyrosine-based signal required for internalization of the H,K-ATPase pump

(Courtois-Coutry et al., 1997) and thus required for proper regulation of pump activity.

The HK3 subunit protein contains 7 consensus N-glycosylation sites and all are

glycosylated (Chow and Forte, 1993). Thus, the HK3 subunit is required for H,K-ATPase

pumps reaching the cell surface and proper function of the enzyme. Its role in

internalization means that it is required to down-regulate gastric acid secretion.

Hydropathy analysis predicts a single membrane domain for the HK3 subunit protein.

Interactions between HKa and HKp3 subunit proteins have been studied by limited tryptic

digestion. After digestion, detergent solubilization, and lectin binding of the HK3 subunit,

an HKa subunit fragment corresponding to the putative loop between transmembrane

domains seven and eight was recovered (Shin and Sachs, 1994). The sequence of this

fragment is well-conserved, implying some important function. Yeast two-hybrid analysis

has confirmed this area of the HKca subunit protein (Arg-898 to Arg-922) as a region of

association with the HKp3 subunit (Melle-Milovanovic el al., 1998). The yeast two-hybrid

analysis has also shown that two extracellular domains of the HK3 protein to be regions of

association with the HK(a subunit. The HKf3 subunit amino acids involved are Gln-64

through Asn-130 (adjacent to the membrane) and AkIa-156 to Arg-188.

The HK3 subunit is quite important to H,K-ATPase activity due to its role in

intracellular trafficking of the holoenzyme. It apparently also affects the conformation of

the intact complex, because HK3-specific effects modify enzymatic activity. Just as there

are a/a interactions that are now known, the regions of the subunit important to a/3









23
interactions are also becoming known. These may be important in conferring the effects on

enzyme activity conferred by oligomeric structure. They may also be important in

controlling the interaction between the various ca and P3 subunit proteins of the

H,K-ATPases and Na, K-ATPases.


Renal Tissue Culture Cells


A number of renal continuous cell lines exist, but for the purpose of studying

H,K-ATPase relevance to the cortical collecting duct the selection narrows considerably.

In cortical collecting duct H,K-ATPase activity is relatively high, and based on

immunohistochemical (Wingo et al., 1990) and in situ hybridization evidence

(Campbell-Thompson el al., 1995; Ahn and Kone, 1995). H,K-ATPase is found in

intercalated cells in cortical collecting duct. There are two cell lines with characteristics of

these cell types, MDCK cells and RCCT-28A cell.

The Madin-Darby canine kidney (MDCK) cell line is an epithelial cell line that

appears to have originated from distal tubule (Herzlinger et al., 1982) or cortical

collecting tubule (Valentich, 1981), and has properties of intercalated cells (Pfaller et al.,

1989). MDCK cells are aldosterone-responsive (Simmons, 1978), and immunostaining of

HWiK' ATPase has been observed (Adam Smolka, personal communication). Oberleithner

et al. (1990) detected an aldosterone-stimulated, omeprazole-inhibited transport activity

that was blocked by increased apical extracellular [H'], or decreased apical extracellular

[K+], consistent with the presence of an apical H'/K' ATPase in MDCK cells. MDCK cells

are available for purchase from the American Type Culture Collection (ATCC, Rockville,

MD). Because of the uncertainty of their origin, and because we wanted to take full









24
advantage of the knowledge of rabbit renal physiology accumulated over the years by our

collaborator Dr. Charles Wingo, we selected the RCCT-28A cell line for use in our

experiments.

The RCCT-28A transformed cell line was derived from immunodissected rabbit CCD

by Arend el al. 1989. The RCCT-28A line was created by microdissecting cortical

collecting tubule and dispersing cells on plates coated with monoclonal antibody specific

to collecting tubule cells. The antibody coating the plates, known as IgG3(rct-30), had

been made against rabbit renal cortical cells injected into mice. The resultant monoclonal

antibody stained only collecting tubules on cryotome sections. Staining was primarily

basolateral in intercalated and principal cells. Cells from the dissected rabbit collecting

duct that had bound in the antibody-coated dish were immortalized with an adenovirus

2-SV40 hybrid, and then cloned by limited diffusion. A population of cells that continued

to proliferate while retaining epithelial morphology was obtained.

The antigenic and hormone response of these cells is specifically consistent with their

origin in the cortical collecting tubule. Immunocytochemistry showed reactivity in 100%

of cells to an antibody (mr-mct) against mitochondria-rich cells of the medullary collecting

duct (Schweibert el aL., 1992). The mr-mct antibody was seen to be specific for

acid-secreting, or type A cells (Burnatowska-Hledin and Spielman, 1988).

Immunoreactivity was also observed to an antibody to band 3 protein (1VF12), another

marker for acid-secreting intercalated cells (Schweibert el al., 1992). The presence of

carbonic anhydrase in >95% of cells was indicated by the binding of a fluorescent

acetazolamide analog (Dietl el al., 1992). As expected for an intercalated cell,

conductance of Cl, but not Na' or K', was indicated by patch clamp measurements (Dietl










etal., 1992). Schweibert el al. (1992) saw no antigenicity of the cells toward two

antibodies specific for base-secreting (or type B) cells or toward four antibodies specific

for principal cells. The origin, collection, and characterization of these cells indicates that

they are a good model of the acid-secreting intercalated collecting duct cell.

The first study undertaken using these cells showed that adenosine analogs increase

intracellular calcium by stimulating phosphoinositide turnover (Arend et al., 1989).

Inositol turnover was measured by labeling cells with myo-[3H]inositol and detecting

[3H]inositol phosphate formation. A 1-receptor agonists increased phosphoinositide

turnover, and the increase was blocked by an A l-receptor antagonist. Adenosine also

regulated a 305 pS chloride channel in RCCT-28A cells via protein kinase C and a G

protein (Schwiebert et al., 1992). Chloride channels in these cells have been characterized

by the patch clamp method, showing Cl conductance to be stimulated by isoproterenol

(Dietl et al., 1992; Dietl and Stanton, 1992). Cell swelling of RCCT-28A cells activated a

Cl conductance by altering the organization of actin filaments (Mills el al., 1994;

Schwiebert el al., 1994). Activation of the channel was mimicked by stretching the

membrane and disruption of F-actin by dihydrocytochalasins. Stabilizing F-actin with

phalloidin blocked activation of the Cl channel. Bello-Reuss (1993) reported H,K-ATPase

activity in RCCT-28A cells, observing an apical acidification mechanism that had a

component sensitive to withdrawal of K' and two H,K- ATPase inhibitors, Sch-28080 and

omeprazole. She also detected activities suggestive of an apical H-ATPase and a

basolateral Cl /HCO3 exchanger. Acid secretion by these cells was diminished in cells

grown at low pCO2, evidence of regulation of the acidification mechanism by alkaline

conditions. These cells have proven useful in studying various processes normally









26
associated with acid-secreting intercalated cells. The observation of H,K-ATPase activity

in these cells made them particularly appealing for our studies.


Summary


H,K-ATPase activity in the collecting duct has very real implications for maintenance

of health and well-being. Studies have shown a myriad of derangements in the absence of

functional H,K-ATPase activity, including a real possibility of death. The H,K-ATPase

provides an excellent example of how critical some of the enzymes are that fine tune the

environment of the body. It is interesting that an enzyme that has such an immense level of

activity in one organ, the stomach, actually is more important in another, the kidney, in

which its level of activity might be called small.

Several challenges exist in studying the H,K-ATPase enzyme and its function. One of

these is the lack of knowledge of the quantitative effects of ouabain and Sch-28080 on the

HKaC2 isoform of the enzyme. Another its low level of expression, making assays of

mRNA, protein, and activity difficult. There was also a dearth of knowledge about the

molecular forms of H,K-ATPase in the kidney when these studies were undertaken. This

situation has changed, and the contributions described herein have been part of that

change.

















MATERIALS AND METHODS


Molecular Biology


Tissue culture


The RCCT-28A cell line was derived from immunodissected renal cortical collecting

duct (Arend et al., 1989). These cells were the kind gift of Dr. William Spielman, and

experiments were performed using cells between passages 11 and 31. Cells were grown in

DMEM media supplemented to 10% with FBS and to 1% with Penicillin-Streptomycin.

All media was bubbled overnight with a mixture of 5% CO2, 21% 02, 74% N2, then filter

sterilized by use of a 0.20 pm cellulose acetate syringe-mounted filter (Corning, Corning,

NY). Cells were maintained in culture in tissue culture flasks at 37C in a 5% CO2

atmosphere. Media was changed on alternate days, and cells were split 4:1 at confluency.

For experiments, cells were passage to Corning Costar Transwell Collagen-coated

semipermeable inserts. Cells were plated to a density of 2x 105/cm2 on the inserts, grown

for 2 days in media containing 10% FBS, and then shifted to 0.1% FBS for a period of 24

hr prior to the experiment.











Isolation of total RNA


Total RNA was isolated from cells or tissues employing the method described by

Chomczynski and Sacchi (1987). After aspiration of media, tissue culture cells were rinsed

in ice cold sterile PBS (10 mM sodium phosphate, pH 7.4, 150 mM NaCI). Next, 0.5 mL

of GTC solution (4 M guanidine thiocyanate, 25 mM sodium citrate, 0.5%

n-lauroylsarcosine, 100 mM P3-mercaptoethanol) was added to promote cell lysis. The

resulting viscous fluid was scraped from the insert and emptied into polypropylene

centrifuge tubes on ice. New Zealand White Rabbits were sacrificed by decapitation and

the kidneys removed immediately. Kidneys were dissected under a microscope, slicing

coronally to separate cortex and medulla. Distal colon was prepared by clipping the distal

25 mm of colon, cutting longitudinally, then rinsing away contents by a thorough spray of

ice cold PBS. Gastric mucosa was collected by slicing the stomach transversely, rinsing in

ice cold PBS, then scraping the rugae with a Scoopula (Fisher, Pittsburgh, PA). Tissues

were dounce homogenized in 4 mL GTC solution until the suspension appeared to be

homogneous. The resulting viscous fluid was poured into polypropylene centrifuge tubes

on ice.

While being held on ice, 1 volume phenol was added to the homogenized tissue, then

1/10 volume 2 M sodium acetate (pH 4.0), and 0.22 volume chloroform-isoamyl mixture

(24:1). After each addition, the samples were briefly vortexed. The samples were

subjected to centrifugation at I 1000G X 25 min at 4'C. The upper phase was retained, and

RNA was precipitated twice in isopropanol and twice in ethanol, then resuspended in 100

gL DEPC-treated water. Storage of the RNA was at -20C. RNA concentration was










determined by OD26o reading on a spectrophotometer. For absorbance of 1.0 at 260 nm,

the concentration was taken to be 40 ptg/ml.


Northern analysis


Northern blots were done following the procedures of Sambrook el al. (1989).

Samples of total RNA (20 [tg per lane) or mRNA (2 ug per lane) underwent

electrophoresis in a 1% agarose, 0.22 M formaldehyde denaturing gel. Capillary transfer

to a nylon membrane (Hybond N, Amershain Corp., Arlington Heights, IL) was conducted

overnight in 20X SSC (3M NaCI, 300 mM Na citrate). Absorbent paper towels were

changed twice during transfer. RNA is immobilized on the membrane by baking 2 h at

80"C in a vacuum oven. 32P-labelled probes were prepared by random primer extension of

75-150 ng DNA according to the protocol of the Megaprime Kit (Amersham).

Membranes were prehybridized a minimum of 15 mrin and hybridized with labelled probe

for 24 h in hybridization solution at 65C. When heterologous probes were employed, such

as cross-species probing, temperatures as low as 42C were used to reduce stringency.

Washing was done first at room temperature for 20 min in IX SSC, 0.1% SDS, then 3

times at hybridization temperature for 20 mini in 0.2X SSC, 0.1% SDS. After washing,

membranes were exposed to Kodak BioMax MS film at -80C with Kodak BioMax

intensifying screens. Exposures between three and six days were often required to detect

H,K-ATPase subunit mRNA. An mRNA probe for glyceraldehyde-3-phosphate

dehydrogenase, a glycolytic enzyme, was used as a control to ensure even loading

amounts of RNA between lanes. An exposure of eight hr was typically sufficient to

visualize this control.











RT-PCR using degenerate primers


RT- PCR was carried out as described by Davis ei a!., 1994. The cDNA template for

the PCR reaction was produced by incubating 1 lag total RNA from microdissected rabbit

renal cortex and 0.1 uig random hexamers in a volume of 11 IPL at 70*C X 2 min. The

reaction mixture was quenched by placing the tube on ice. The reverse transcription

reactions were carried out at 37C X 1 hr in a volume of 25 uL. The mixture contained

RNA-random hexamers mix in the final concentrations indicated: First Strand Buffer (50

mM Tris-HCl (pH 8.3), 75 mM KCI, 3 mM MgCl), dithiothreitol (10mrnM), dNTPs

(2mM), RNAsin (30 U, Promega, Madison, WI), and Superscript 11 (200 U, Gibco BRL,

Gaithersburg, MD). PCR reactions were primed with pairs ofoligonucleotides shown in

Table 2-1 synthesized by the University of Florida Interdisciplinary Center for

Biotechnology Research (UF ICBR) DNA Synthesis Core. PCR reactions were

performed in a volume of 100 uaL at the final concentrations indicated: dNTPs (0.22 mM),

PCR Buffer (20 mM Tris-HCl, pH 8.4, 50 mM KCI), MgCl, (50 mM), primers (1 Pug

each), and Taq DNA Polymerase (5 U). The reactions were overlaid with 50 JAL mineral

oil. Thermal parameters of the reactions included a 5 mrin X 94C presoak followed by

94C X 40 sec denaturation, 55C X 1 min anneal, and 72C X 2 min extension for a total

of 30 cycles followed by a final extension of 5 min. Reactions were held at 4C overnight

before PCR product cloning into the pCR 11 vector and transformed into OneShot E. coli

cells utilizing the TA Cloning Kit (Invitrogen, San Diego, CA). E. coli cells containing the

plasmid of interest were grown overnight in a 5 mL culture and plasmids isolated using the










QiaPrep Spin Mini Kit (Qiagen, Santa Clarita, CA). Sequencing of plasmids was carried

out by the UF ICBR DNA Sequencing Core.


RT-PCR using standard primers


A reverse transcription reaction was carried out as in the RT-PCR method described

above for degenerate primers. PCR reactions were primed by pairs of oligonucleotides

synthesized by the UF ICBR DNA DNA Synthesis Core and summarized in Table 2-1.

Reactions were carried out using I pg total RNA in a 50 pL volume in KlenTaq PCR

Reaction Buffer (40 nmM Tricine-KOH, pH 9.2, 15 mM KOAc, 3.5 mM Mg(OAc)2, and

75 gg/mL Bovine Serum Albumin), primers as listed above (0.5 PM), and dNTPs (0.8

mM), and Advantage KlenTaq Polymerase Mix (Clontech, Palo Alto, CA). Thermal

parameters of the reactions included a 2 min X 94C presoak followed by 94C X 30 sec

denaturation and 68C X 1 min extension with a final extension of 5 min. The numbers of

cycles were specific to each experiment and are indicated in the 1 legends. PCR reactions

were purified for sequencing by phenol/chloroformn (1:1) extraction and two 3000 G X 5

min centrifugation steps in Ultrafri-ee-MC 30000 NMWL regenerated cellulose columns

(Millipore, Bedford, MA). Due to low yield of the HKal PCR reaction, a 45 cycle

reaction was carried out to generate product for sequencing. Sequencing of PCR products

was carried out by the UF ICBR DNA Sequencing Core.


Genomic PCR


To amplify genomic DNA for sequencing, template used was 1 Pug Clontech Rabbit

Genomic DNA. Clontech KlenTaq Advantage PCR Mix was used with components and
















I 0 r-
co 4/- cc n c
*l Cl Cl Cl Cl -
U U U U U U


r.i
0
C"
U








OQ
U






< u

oo
U
U


0
U
0
Qf) U
E ^
.^ <
iU rU
w 0

5 -0
0
~i H





I--
E -
0

U


0




U
ci
U






0
U
U

E H
E H
^) U

g 0
U
U
0


I~ N
I. rn

3 fl
2 '^

o ^:


<
II
G
o o






Cc
<










0
II







0
0
o~
<
















z
0 I
o 2 .2
II
H Z







En

0
Cl
E










u0


0
0 m
< o








H 2









co
0 5
H -






4 I
U 0
< .^






c/l






00
Z
U U
0 I
0-2

H !


00 I
< 0 U

0 IU
o -o











concentrations specified in the description of RT-PCR above. Primers were

ACCCGCGGCGCCTCCAGCGCGACAT (nucleotides 16-40, BC386) located in the

first exon of HKc2,. and TATCTGTAGCTGCATGGTGCTCCAC (nucleotides 69-93,

BC334) located in the second exon of HKcx2,. Thermal parameters of the reactions

included a 1.5 min X 94C presoak followed by 5 cycles of 94C X 15 sec denaturation

and 72*C X 2 min extension, 5 cycles of 94'C X 15 sec denaturation and 70C X 2 min

extension, and 25 cycles of 94C X 15 sec denaturation and 68C X 2 min extension with a

final extension of 8 min. Reactions were held at 15'C overnight before ligation of the

products into the pCR 2.1 vector. The ligation mixture was transformed into OneShot E.

coli cells utilizing the TOPO-TA Cloning Kit (lnvitrogen, San Diego, CA). E. coli cells

containing the plasmid of interest were grown overnight in a 5 mL culture and plasmids

isolated using the QiaPrep Spin Mini Kit. Sequencing of plasmids was carried out by the

UF ICBR DNA Sequencing Core.


3' RACE


A 3' RACE reaction was carried out as described by Davis et cil., 1994. mRNA was

prepared from rabbit renal cortex total RNA using the PolyATtract (Promega, Madison,

WI) system. A reverse transcription reaction was carried out as in the RT-PCR method

described above, using 1 pg mRNA as template and 0.1 pg primer

(GACTCGAGTCGACATCGA[T]17, BC229). The complementary strand was next

synthesized using 5 pL of RT reaction along with 0.1 utg of sense primer

(TGCGGAAACTCTTCATCAGG, nucleotides 3088-3107, BC262) in a reaction volume

of 98 pL that contained the following components: PCR Buffer (20 mM Tris-HCl, pH











8.4, 50 mM KCI), MgCl2 (50 mM), dNTPs (0.22 mrM), overlaid with 50 pL mineral oil.

After a 95C incubation for 5 min, the temperature was lowered to 70C and 5 U Taq

DNA Polymerase was added. A 2 min annealing phase followed at 55C, then the

complementary strand was extended at 72C for 10 min. Antisense primer (0.1 pg,

GACTCGAGTCGACATCG, BC230) was added, and a PCR reaction was initiated with a

94"C X 40 sec denaturation, followed by a 55C X 1 min anneal, and a 72C X 2 min

extension for a total of 40 cycles. Final extension was for a duration of 5 min. Reactions

were held at 4C overnight before cloning PCR products into the pCR II vector utilizing

the TA Cloning Kit (Invitrogen, San Diego, CA) per manufacturer instructions. The

library of clones produced in this manner was screened using an oligo

(CTCTACCCTGGCAGCTGGTG, nucleotides 3108-3127, BC261) 5' labeled using the

ECL kit (Amersham, Arlington Heights, 1L). Sequencing was carried out by the UF ICBR

DNA sequencing core.


5'RACE


A 5' RACE reaction was performed using the Marathon cDNA Amplification Kit

(Clontech, Palo Alto, CA) following manufacturer's instructions with the following

modifications. RT reactions were carried out using 5.5 pg total RNA of rabbit renal

cortex, incubated with the gene-specific primer TTGCCATCTCGCCCCTCCTT

(nucleotides 121-102, BC331) for 30 min at 50C, then at 550C for 15 min. PCR reactions

were carried out using the anchor primer (CCATCCTAATACGACTCACTATAGGGC,

API) included in the Marathon kit paired with gene-specific primer

TATCTGTAGCTGCATGGTGCTCCAC (nucleotides 93-69, BC334). Concentrations











and components of the reactions were detailed above for use of Clontech KlenTaq

Advantage Polymerase Mix. Thermal parameters of the reactions included a 1 min X 94C

presoak followed by 5 cycles of 94C X 15 sec denaturation and 72C X 1 min extension,

5 cycles of 94C X 15 sec denaturation and 70'C X 1 min extension, and 25 cycles of 94C

X 15 sec denaturation and 68C X 1 min extension with a final extension of 8 min.


Evaluation of PCR products


PCR products were analyzed by agarose gel electrophoresis. 20 U1L of reactions were

run along with 1 mL DNA loading dye (50% glycerol, 1% xylene cyanol, 1%

bromophenol blue) on a 1.2% agarose gel in TAE buffer (Tris mM, acetic acid mM,

EDTA mM). Low DNA Mass Ladder (Gibco BRL) was electrophoresed alongside PCR

products to quantitate DNA concentration, and 100 bp ladder (Gibco BRL) to evaluate

the size of the products.

In some cases, products were not visible after ethidium bromide staining, so Southern

blotting was used to visualize the products. Procedures followed were as described by

Davis etal., (1994). After running products on gels as described above, gels were soaked

30 min in denaturation solution (1.5 M NaCI, .5 M NaOH), and 30 min in neutralization

buffer (1 M ammonium acetate, .02 M NaOH). Capillary transfer in neutralization solution

and baking 80* X 1 hr was utilized to adhere DNA to nylon membrane (Hybond N).

Probes to hybridize specifically to the expected products (Table 2-1) were created using

RT-PCR with rabbit renal cortex as template, cloning the inserts using the TA Cloning Kit

as described above. Inserts were sequenced to confirm their identity. Probes were labelled

using the ECL Direct System(Amersham) following manufacturers instructions. Exposure









36
to Hyperfilm ECL (Amersham) for a period of two hr was required to visualize the results

of PCR reactions.


Biochemistry


Preparation of memrnbrane protein from tissue culture cells


Two clusters of six wells each were used for each experimental condition; this

typically yielded 50 pg of protein. All solutions and glass douncers are cooled on ice, and

centrifuges are either refrigerated or located in cold rooms. Cells are held on ice at all

times. Cells were rinsed in PBS containing 0.5 mM PMSF, 1.5 mL in top well of

Transwell, 2.5 mL in bottom well. Following aspiration of the rinse solution, to each

single well was added 0.5 mL PBS, 0.5 mM PMSF, 1 mM EDTA. A cell scraper was used

to dislodge cells from the insert. This solution containing cells was pipetted from one well

to the next dislodging and gathering all the cells from one cluster. This was repeated with

a fresh 0.5 mL solution on the same cluster to remove any remaining cells. The two passes

combined for a total of 1 nmL, and the other clusters were processed in the same manner.

Cells were spun in a centrifuge for 5 min at 500 X g to remove cellular debris.

Supernatant was discarded, and the pellet was resuspended in swelling buffer (tris 10 mM

pH 7.8, 1 mM EDTA, 1 mM PMSF, 2 .tM aprotinin, 2 i.M leupeptin, 2 paM pepstatin) for

15 min. Cells were homogenized by 50 strokes in a glass douncer. After moving cells back

to a microfuge tube, 0.1 I mL of 10X salts (300 mM NaCI, 20 mM MgCI2, 10 mM Tris

pH 7.8) was added before vortexing. Mixture was spun in a centrifuge for 1 minute at

1000 X g to remove nuclei. Supernatant was retained and spun in a centrifuge for 5 min at











1500 X g. Supernatant was retained and spun in a centrifuge for 30 min at 23000 X g.

Cells were resuspended in 20 itL resuspension buffer (1 volume swelling buffer, 1/10

volume o10X salts) and stored at -20"C.


Preparation of membrane protein from rabbit tissues


Kidney, distal colon, and stomach tissues were obtained in the same manner as for

RNA isolation. Care was taken to maintain solutions and apparatus ice cold. Two rabbit

distal colons were required per preparation to yield useful concentrations of protein.

Tissues were homogenized for 15 seconds at 12500 rpm (setting 8 on Omni-Sorvall tissue

homogenizer) in Buffer A (50 mM sucrose, 10 mM Tris pH 7.4, 1 mM EDTA, 1 mM

PMSF). After allowing 15 seconds for settling, homogenization was repeated. Three

volumes buffer B (250 mM sucrose, 10 mM Tris pH 7.4, 1 mM EDTA, 1 mM PMSF)

were added, then homgenate spun in a centrifuge for 10 min at 1000 X g. The supernatant

was subjected to centrifugation for 20 min at 10000 X g three times. Final centrifugation

was for 1 hr at 100000 X g. After discarding supernatant, pellet was resuspended in 500

piL loading solution (1 mM Tris, 10 mM MgCI2, 150 mM NaCI). After transferring

resuspended pellet to glass douncer, dounce is dropped into the douncer, turned three

times, then raised and dropped again. This was done ten times. The resultant preparation

was stored at -20C.


Antibodies


Peptides used as immunogens were designed for maximum antigenicity and minimum

homology to other proteins. Avoiding homology to other P-type ATPases was particularly











important. Rabbit H,K-ATPase catalytic subunit sequences were scanned using the

computer program PEPTIDESTRUCTURE (Genetics Computer Group, 1997) to find

regions relatively high in charged, hydrophilic residues (Jameson and Wolf, 1988). Such

regions were then searched by BLAST (Altschul el tl., 1990) to eliminate those that could

be predicted to cross-react with other proteins. Once these constraints were met the

candidate sequences were examined using the program MOTIFS (Genetics Computer

Group, 1997; Bairoch and Apweiler, 1996) to ensure that there were no potential sites for

protein modification that might affect reactivity. In the case of HKcL1 and HKo2a,, there

was only one region that satisfactorily met all of these criteria. In the case of HK2c,, there

were two, one being the region in common with HKX2,, the other in the extended amino

terminal region of HKot2c not contained in HKx:,.

Peptides were synthesized with an N-terminal cysteine and conjugated to keyhole

limpet hemocyanin (UF ICBR Protein Core) using the Pierce (Rockford, IL) Imject

system. Three peptides were used as immunogens, the first was designed to react with a

portion of HKcL1, the second was designed to recognize a portion of HKoC2 found in both

HKac2 and HKctx2,c, the third to a portion unique to HKax. The peptide chosen for HKo.i

corresponded to amino acids 569-582 (CLYLSEKDYPPGYAF). The peptide chosen

within the common region contained amino acids 18-37 in HK 2., and 79-88 in HKa2c

(CDIKKKEGRDGKKDNDLELKR). The peptide chosen within the HKazc-specific

region corresponded to amino acids 13-25 (CGEERKEGGGRWRA). Antipeptide

antibodies were raised in chickens by Lofstrand Laboratories (Bethesda, MD). Chickens

received boost innoculations at 21 day intervals, and were exsanguinated at day 73 to









39

produce antisera. Preimmune sera was collected prior to initial innoculation. Yolks of eggs

collected over the two week period prior to final bleed were pooled, and immunoglubulins

purified from yolk material by the Promega EGGstract method. Concentration of the

EGGstracted yolks was determined by the modified Lowry procedure ofMarkwell et al.

(1978) and the concentrations adjusted to 2 mg/mrnL by addition of lgY buffer solution

(Promega). Purity and concentration of the IgY obtained was confirmed by non-reducing

SDS-PAGE and staining with Coomassie blue.


Western analysis


Protein concentrations in tissue and cell samples were determined by modified Lowry

(Markwell el al., 1978). Proteins (10 ag/lane) were separated on 4-20% reducing

SDS-polyacrylamide gels (BioRad, Hercules, CA ), 10 utg per lane. Vesicle preparations

were suspended in buffer (62.5 mM Tris-HCI pH 6.8, 10% glycerol, 5%

P-mercaptoethanol, 3% SDS) and incubated 2 min X 90C prior to electrophoresis. Gels

were rinsed 10 min in TBS (10 mM Tris- HCI pH 7.2, 150 mM NaCI), and 10 min in

transfer buffer (20 mM Tris-HCL, 150 mM glycine, 20% methanol, pH 8.3). Proteins

were electrotransferred at 104 V, .25 A, 4'C to Hybond ECL nitrocellulose membranes

(Amersham) in transfer buffer. Blocking of membranes was done in TBS-T (TBS, 0.1%

TWEEN-20) containing sodium azide and 5% non-fat dry milk at 40C overnight or room

temperature for 1 hr. Antibody incubations were one hour each, carried out in TBS-T

containing 5% non-fat dry milk. Following blocking and following primary and secondary

antibody incubations, immunoblots were rinsed in TBS-T with continuous agitation. This

was done three times for one minute each, then twice for 5 min each. Primary antibodies









40
purified from egg yolk were used at a dilution of 1:200, the anti-chicken IgY-horseradish

peroxidase conjugated secondary antibody (Promega) was diluted to 1:10000. When

antisera or preimmune sera were used as primary antibodies, dilution was 1:2000. A final

wash was carried out in TBS for 10 min, and then antibody reactivity was detected using

chemiluminescence (Pierce). Apparent molecular masses were established using the High

Mass Range Molecular Weight Markers (BioRad).


Fluorescence Microscopy


Measurement of pH,


The fluorescent, pH-sensitive dye BCECF-AM was used to directly measure pH, in

RCCT-28A tissue culture cells. BCECF-AM was stored as a stock at -20C in a 30 mM

solution in DMSO. Cells were incubated at room temperature for a period of 30 min in

solution 1 (Table 2-2) with BCECF-AM at a final concentration of 5 M. A minimum of

5 min perfusion with solution I delivered at 37C was allowed to rinse BCECF away at

the beginning of each experiment.

Cells were imaged by epifluorescence at 530 nm emission on an inverted microscope

(Boyarsky el al., 1988, Weiner and Hamm, 1989) using excitation wavelengths of 440 nm

and 490 nm. These wavelengths correspond to the isosbestic point and to a highly

pH-sensitive wavelength of BCECF, respectively. The ratio of emission intensities at the

two wavelengths is directly proportional to pH over the pH range being studied, and is

constant with respect to such variables as cell-to-cell variations in dye uptake and leakage.

A field containing approximately 50 cells could be visualized using a Nikon X40, 0.55











Table 2-2. Solutions for determination of pH,

Solutions

1 2 3 4 5 6 7


119.2


102.2 122.2


99.2


Choline Cl

Ammonia Cl


102.2 122.2 119.2


KC1


KH2P04


Phosphoric acid


Na-acetate

Acetic acid


2 2


I I I


1 1 1


1.2 1.2 1.2 1.2 1.2 1.2 1.2

1 1 1 1 1 1 1

5 5 5 5 5 5 5

8.3 8.3 8.3 8.3 8.3 8.3 8.3

25 25 25 25 25 25 25


Note: Concentration units are in miM. Osmolality was adjusted to 2905 mosmol/kg H20
by addition of the principal salt. pH was adjusted to 7.40.05 by addition of
tetramethylammonium-OH. Solutions were bubbled with 100% 0.


NaCI


2 2


CaCl2

MgSO4

Alanine

Glucose

HEPES









42

LWD lens on a Nikon Diaphot-TMD inverted microscope. Excitation light was provided

by a 100 W mercury lamp. The light was split into two beams by a 470 nm low-pass

dichroic mirror. The two split light beams then passed through filters to yield beams of the

desired wavelengths. The transmitted light path contained a 440 nm filter; the reflected

light path contained a 490 nm filter. Computer-actuated shutters on each light path

alternated the incident light wavelengths and minimized the time the cells were subjected

to the high intensity light. The two light beams were recombined by a second 470 nm

low-pass dichroic mirror. Light was directed to the microscope stage by a 510 nm

high-pass mirror, and the emitted light was directed to a Videoscope KS-1381 image

intensifier coupled to a Dage 72 CCD camera. Because the optics necessary to image cells

grown on inserts required relatively intense incident light, measurement frequency was

limited to avoid phototoxicity. Therefore, measurements were made at 30 second

intervals. Images were digitized and stored by computer allowing subsequent analysis of

single cells using the Image 1/FL software package (Universal Imaging Corp.,

Westchester, PA).

During measurements, cells were constantly perfused at a rate of-10 mL/min by

HEPES-buffered solutions that were continuously bubbled by 100% 02 and heated to be

delivered at a temperature of 37C. Switches for the various solutions were located

physically near the input to the cell chamber to minimize the time required to switch

solutions, and fluid was continuously removed from the opposite side of the chamber by

vacuum suction. For some experiments, the apical side of the cells was perfused by

different solutions than the basolateral side of the cells by utilizing separate input tubes in

the upper and lower chambers of the Transwell inserts.











Cells were acid-loaded using the NH4Cl prepulse technique. Briefly, cells were

incubated with 20 mM N1-H4CI (equimolar substitution for NaCI) for 5 mrin, then

ammonium chloride was removed from the perfusing solution. Addition of inhibitors or

K1 removal began at the start of the ammonium pre-pulse. The ethylisoproplamiloride

(EIPA) stock solution was 1 mM in dimethyl sulfoxide (DMSO), and Sch-28080 was 10

mM in DMSO. EIPA was obtained from Research Biochemicals, International (Natick,

MA) and Sch-28080 was the kind gift of Dr. James Kaminski at Schering Corporation

(Bloomfield, NJ). Inhibitors were stored as stock solutions at -20C and diluted into the

solutions indicated immediately preceding their use.

Calibration of the pH, measured by BCECF fluorescence was carried out by the

nigericin calibration technique of Thomas el cil. (1979). Calibration solutions (120 mM

KCI, 1.2 mM CaCI2, 1 mM MgCI2, 25 mM HEPES, 14 pM nigericin) were adjusted to

6.6, 6.8, 7.0, 7.2, and 7.4 pH units using 1 M NaOH and HCI. Cells were incubated with

each solution for a minimum of three min, and three fluorescence ratio measurements were

taken at each pH.


Statistical methods


pH, recovery rates for individual cells were calculated using least-squares linear

regression. Rates were calculated for the period beginning two min after NFLCI

withdrawal, allowing time for cells to equilibrate after acidification, and ending with Na+

addition or EIPA withdrawal. Data were collected for independent experiments involving

separate passages of cells. pH, recovery rates for each experimental condition were

presented as the mean of the rates determined for the individual experiments SE. Cells









44

without NaVH' exchanger activity, defined as an increase in pH, recovery with EIPA

removal, were classified as non-viable and excluded from further analysis. P<0.05 by

Student's t-test was taken as significant.

















H,K-ATPASE P3 SUBUNITS IN THE RABBIT RENAL MEDULLARY COLLECTING
DUCT

Introduction


There are multiple H,K-ATPase subunit isoforms that are involved in coupled H* for

K+ active exchange in the kidney. These now include the NaKP1, subunit that is the newly

recognized partner for the HKx,, subunit, in addition to its long-known role as partner to

NaKaxi. In addition to the complexity involved in having multiple H,K-ATPase isoforms

present, there is the possibility of variant transcripts of each H,K-ATPase subunit.

Differences in polyadenylation sites, transcription start sites, and alternative splicing in a

tissue-specific manner might further complicate the picture.

When rat HK3 subunit was originally sequenced, multiple transcriptional start sites

were observed by primer extension experiments (Newman and Shull, 1991). It was not

known what role these various transcriptional start sites play. When the Cain, Wingo and

Nick laboratories did preliminary studies concerning the regulation by K' status of the

HK3 subunit in rabbits, it was noted that on some northern blots of renal tissues HKP3

subunit mRNA appeared as a doublet. This was evidence for a second H,K-ATPase

subunit transcript present at a level comparable to the primary transcript.

Here we show that there is a variant HKp3 subunit mRNA that is expressed in renal

medulla, and not in renal cortex or stomach. We have designated the variant mRNA











HK3'. The HKJ3' transcript is found in medulla at a level comparable to the quantity of

the HK3 subunit, and the translation start site is unchanged, so both HK3 and HK3'

encode the same protein. HK3' may be the product of alternative splicing.


Renal Medulla HKI3 mnRNA Variant


In order to investigate the doublet band in northern probed with Hk3 cDNA probes,

RNA was prepared from stomach, renal cortex, and stomach. In northern analyses (Figure

3-1) involving twenty different rabbits in experiments spaced over several years, only

single transcripts were observed in either gastric or renal cortical tissues. Gastric and renal

cortical transcripts appeared to be of identical size. However, in renal medullary tissues, a

doublet was universally visible. Northern analysis showed that the smaller of the two

medullary HK3 transcripts was the same size as in the other two tissues, and the second

renal medullary transcript was larger. The quantity of the second mRNA, HK3', was

generally comparable to the quantity of HKP3 mRNA.

In order to determine the molecular nature of the different transcripts of the medulla, 3'

and 5' RACE experiments were conducted using mRNA isolated from rabbit renal

medulla. The rabbit RNA was selected from those that showed prominent HKO subunit

upper bands by northern analysis because these would have a higher abundance of the

novel transcript. Representative PCR products generated by the 3' and 5' RACE

experiment are shown in Figure 3-2. PCR often 3' RACE products sequenced, all were

the same, and all extended to within 5 bp of the published HK3 cDNA sequence (Reuben

et al., 1990). Ten 5' RACE products were also sequenced. Nine of these were similar to

















HKO









GAP3DH


S.









em


- 1.4 kbp









- 1.3 kbp


Figure 3-1. Northern analysis showing presence of HKP mRNA in renal cortex, renal
medulla, and stomach. The existence of two mRNA species was clearly visible in renal
medulla, whereas a single mRNA species was detected in stomach and renal cortex.
GAP3DH was used to show the condition of the RNA samples.























750 bp-



















Figure 3-2. 3' and 5' RACE reactions to amplify HKP cDNAs using rabbit renal
medulla RNA as template.









49
the published HK3 cDNAsequence. However, all ended approximately 20 bp from the 5'

end of the published sequence making it impossible to confirm the extreme 5' end of the

sequence.

One of the sequences had a very different 5' end than the others. In that sequence

(Figure 3-3A), the first 11 bp of the published HK3 sequence was not found, and in its

place there was a different 118 bp region (Figure 3-3B). The sequence was confirmed by

5' RACE using a primer specific to the variant extension

(CCCTGCACCCCGACTGAGG, nucleotides 104-121, BC388).

To examine the possibility that this renal medulla-specific transcript might be regulated

by K' status in rabbits, northern analysis was carried out using total RNA from animals fed

a low K' diet. Renal medulla total RNAs from four rabbits fed a Harlan (Indianapolis, IN)

control diet and four rabbits fed a Harlan K'-restricted diet for two weeks were probed to

visualize HK3 subunits using a probe made from 570 bp of coding region (Table 2-1).

Neither of the two HK3 transcripts of renal medulla had systematic variation in HIK3

mRNA level due to K' restriction in these animals. Northern analysis of renal cortex and

stomach RNA from these same rabbits showed uniform level of HKp3 mRNA between

rabbits. No regulation of HK3 was observed, although in renal medulla there was a great

deal of individual variation between rabbits.


Discussion


A rabbit renal medulla-specific HK3 variant mRNA was cloned by 5' RACE and

sequenced. It was not known why only one out of the ten sequences proved to be a











A)




1 GGAGCTGATGGCTGCTGCTGATAGCACCGCCTCGAGCCAGCCCTGCAGGCGTCGCCCGCGATGCCTTTGACCGTGGCCGG
---------+--------- --..---...__- + ....--.-- -+.......-+ --....+-- -+

81 GGGAGGCTATAAGACCCAGGGGGCCTCCGGCCTCAGTCGGGGTGCAGGGTGGGGGAGCGGCGGCTTCCACAGCAGACACC
.---------+-----------.----+--+----------+-.......-------+ --.........--- +


161 ATGGCCGCCTTGCAGGAGAAGAAGTCGTGCAGCCAGCGCATGGAGGAGTTCCGCCACTACTGCTGGAACCCGGACACGGG
S+--------------. .. +--------------+ ..-----+-- -+-.- --... --....- ....- +
1 M A A L Q E K K S C S Q R M E E F R H Y C W N P D T G


241 .

28 ... Remainder of sequence omitted for clarity







B)


HK3


11 bp.

ATG


mRNAs


HKP' L118bp /


Figure 3-3. HKp and P' subunits. A) The 5' end of the HKp' cDNA and its deduced
amino acid sequence. Numbering begins at the start of the HKp' transcript. HKp'
nucleotide 119 corresponds to nucleotide 12 of published gastric HKp3 sequence
(Reuben, et al., 1990), and the point of divergence is marked by B) Comparison of
HKp3 and HKp' mRNAs. There is no difference in the deduced amino acid sequence.











variant, since both transcripts are observed by northern analysis at comparable levels.

Perhaps the extra length or RNA secondary structure reduced amplification efficiency.

Because the variant 5' end differed in sequence from the 5' end reported for rabbit

(Reuben etal., 1990), the variant is presumed to arise from alternative splicing. This was

not pursued because our focus was on the H,K-ATPase ca isoforms. HK3 mRNA and

HK3' mRNA produced identical HK3 subunit proteins. The splice sites of the related rat

and mouse HK3 genes (Newman and Shull, 1991; Canfield and Levenson, 1991) are not

conserved, and working out this issue might have been a considerable target for our

primary emphasis.

The deduced amino acid sequence is unchanged by the variant 5' end. Differential

regulation by alternate promoters may be the functional reason for the two transcripts. K+

restriction was studied as a possible stimulus for regulating the promoters, but K' status

alone did not correlate with differential regulation of the two transcripts. Other stimuli,

such as aldosterone levels, may regulate these transcripts in renal medulla. It is interesting

to note that although HK3 subunit is expressed at extremely high levels in gastric tissues,

this variant transcript was not observed in stomach. The tissue-specificity of the variant is

striking. Study of its promoter region may be fruitful in terms of finding the cis acting

factors that turn the gene on specifically in renal medulla.

















H,K-ATPASE X SUBUNITS IN THE RABBIT RENAL CORTICAL COLLECTING
DUCT

Introduction


H,K-ATPase has been shown to play a role in acid/base and K' transport in kidney

collecting duct (for review, see Wingo and Cain, 1993; Wingo and Smolka, 1995).

However, many questions remained to be addressed, such as finding which H,K-ATPase

isoforms are present in kidney, and determining their distribution along the nephron and

collecting duct. This included defining the cell type specificity of each isoform. For many

years, the rabbit has been the archetypal experimental animal for use in experiments

involving microperfusion of renal tubules, To take advantage of the extensive knowledge

of rabbit renal physiology in exploring H,K-ATPase function at the molecular level,

primary structure information was needed for H,K-ATPase subunits in that species.

Because of the discovery of H,K-ATPase catalytic subunit isoforms in addition to the

gastric isoform in several species, the relationship between these isoforms needed to be

examined. Perhaps most importantly, the role that the multiplicity of H,K-ATPase subunit

isoforms plays in kidney function should be examined.

At the time the experiments described here were undertaken, little was known of the

identity ofH,K-ATPase subunits in the kidney. mRNAs encoding catalytic subunit

isoforms cloned from human axillary skin (Modyanov et acil., 1991) and rat distal colon

(Crowson and Shull, 1992) were the first to be detected in kidney. In collaborations

52











including the Cain and Wingo laboratories, HK3 (Callaghan et aC., 1995,

Campbell-Thompson el a!., 1995) was observed in rabbit kidney. The key experiment

identifying HKP3 in the kidney dated from 1992, prior to the arrival of this author, so that

information was available in designing this dissertation project. As this work progressed, it

was found that the HKax1 subunit isoforms are present in renal tissues (Ahn and Kone,

1995). In addition, an alternatively spliced isoform of rat HKcx was recently reported in

kidney (Kone and Higham, 1998). The rat HKl;2 alternatively spliced variant was

designated HKoth, with the original renamed HK 2.,. The previous experiments were not

designed to discriminate between HKa;2, and HKo-2b.

In these studies a full-length cDNA sequence was determined for the HKoa2 subunit in

rabbit. An alternatively spliced variant of this HKc2 subunit isoform was found in rabbit.

The pattern of splicing was identical to that found in rat (Kone and Higham, 1998).

However, the translation start site was not conserved. For this reason, the alternatively

spliced variant in rabbit was designated HKcx2,. Antipeptide polyclonal antibodies were

raised and used to show expression of both HKax2, and HKc(x, proteins in rabbit renal

cortex. These results allude to a potentially complex pattern of regulation of H,K-ATPase

activity in renal cortex.


Multiple H.K-ATPase cx Subunits in the Kidney


We set out to find the HKac subunits that mediate the H,K-ATPase activities that had

been observed in kidney. Because HKa;,, mRNA had been observed in kidney, it was

necessary to find the rabbit sequence of HKa,,, in rabbit for use in designing tools for











studying H,K-ATPase function in the kidney. Rabbit HKa(. sequence was known

(Bamberg et al., 1992). In designing an experimental approach to this goal, we wanted to

consider 1) the possibility that HKccX was expressed in kidney (unknown at the time) in

addition to HKca2, 2) the possibility that the HKa2 mRNA might be different in kidney than

in the other tissues for which full length sequence was known, and 3) that novel HKa

isoforms might be present in renal tissues. A good technique to address all these

possibilities was to do RT-PCR using degenerate primers designed to anneal to regions of

sequence that were highly conserved among P-type ATPases. This approach was expected

to amplify any P-type H,K-ATPase that might be present in rabbit kidney.

The aspartyl residue that is phosphorylated as an intermediate in the catalytic cycle of

H,K-ATPase lies within a motif that is highly conserved in the entire P-type ATPase

family. Another well-conserved region among P-type ATPases surrounds a lysine residue

that can be modified by FITC. FITC competes with ATP for binding (Jackson et al., 1983;

Farley and Faller, 1985), so this region is thought to make up part of the ATP binding site.

Advantage was taken of these two regions to design degenerate primers to amplify any

P-type ATPase using renal cortex RNA as template Fifteen P-type ATPase sequences

were aligned using the computer program PILEUP (Genetics Computer Group, 1997).

These sequences were selected to give a wide range of mammalian Na,K-ATPases and

H,K-ATPases. Chicken Na,K-ATPases were included because all three ct subunit isoforms

were known for that species so they comprised a good example of P-type ATPases from

an organism less related to mammals. Toad sequences were included because toad











H,K-ATPase was one of only three non-gastric H,K-ATPases known at the time.

Degenerate primers were then designed to amplify any of these ATPases (Figure 4-1).

The products of the first two RT-PCR reactions using these primers, when cloned and

sequenced, had high homology to the NaKcxi subunit in other species. The third reaction

product (Figure 4-2) was more related to the non-gastric H,K-ATPase a subunits than to

the HK(X| subunit or to any of the Na, K-ATPase x subunits. It was a 419 bp fragment

that corresponded to nucleotides 1182-1600 of the full-length rabbit HKa2, cDNA

sequence. A BLAST search listed three non-gastric H,K-ATPases as the most highly

aligned sequences to the 419 bp sequence, with other H,K-ATPases and Na,K-ATPases

being less well aligned (Figure 4-3). The sequence of the fragment shared

89% nucleic acid identity with the rat distal colonic H,K-ATPase oa subunit, 88% with a

guinea pig distal colonic H,K-ATPase cx subunit, and 86% with the H,K-ATPase X subunit

cloned from human axillary skin. Based on these similarities, this fragment was tentatively

identified as belonging to an H,K-ATPase.

Using degenerate primers designed to anneal to conserved sequences we identified

farther 5' and 3' in the sequence alignment paired with gene-specific primers designed

based on the new sequence (Table 2-1), fragments containing more of the transcript were

cloned (Figure 4-4). Outside the coding sequence, homology between cDNA sequences

declines. With much of the coding region cloned and sequenced, 5' and 3' RACE were

used to clone the full extent of the cDNA including the two ends. The 3' end was easily

obtained; a single 3' RACE product was observed the first time the procedure was

performed. The 5' end proved far more interesting, but more challenging to find. Initial















Hsu02076
Ratatpasez
Bmhkatpas
Doghkatp
Pigatphk
Ocatprna
Ratatpast
Chknakat2
Chknakat3
Ratatpa3
Ratatpa2
Ratatpal
Chkatpas
Bmnkaal
Tcatpmr


5' Primer


Hsu02076
Ratatpasez
Bmhkatpas
Doghkatp
Pigatphk
Ocatprna
Ratatpast
Chknakat2
Chknakat3
Ratatpa3
Ratatpa2
Ratatpal
Chkatpas
Bmnkaal
Tcatpmr


3' Primer


...CCATCATCTGCTCGGACAAGACTGGGACAC...
...CCATCATCTGCTCAGACAAGACGGGGACCC...
...CCATTATCTGCTCCGACAAAACAGGAACCC...
...CAGTGATCTGCTCAGACAAGACAGGGACCT...
...CAGTCATCTGCTCTGACAAGACGGGGACCC...
...CGGTGATCTGCTCCGACAAGACGGGGACCC...
...CAGTCATCTGCTCAGACAAGACAGGAACTC...
...CCACCATCTGCTCCGACAAAACCGGGACCC...
...CCACCATCTGCTCCGATAAGACCGGGACCC...
...CCACCATCTGCTCCGACAAGACCGGCACCC...
...CCACCATCTGCTCGGACAAGACAGGCACCC...
...CCACCATCTGCTCCGACAAGACTGGAACTC...
...CCACCATCTGTTCTGACAAAACAGGCACCC...
...CCACCATCTGCTCTGACAAGACCGGAACCC...
...CAACCATTTGCTCAGACAAAACTGGAACCT...

A A
ATCTGCTCCGACAAAACCGG
G G G


...TCATGGTGATGAAGGGGGCCCCTGAGCGCA...
...TCGTGGTGATGAAAGGAGCCCCTGAGAGGA...
...TGCTCGTCATGAAAGGTGCCCCAGAGAGAA...
...TGCTGGTGATGAAGGGCGCCCCCGAGCGCG...
...TGCTTGTGATGAAGGGCGCCCCCGAGCGCG...
...TGCTGGTGATGAAGGGCGCCCCCGAGCGCG...
...TGCTGGTGATGAAGGGCGCCCCAGAGCGCG...
...TCCTGGTGATGAAAGGGGCCCCCGAGCGCA...
...TGCTGGTGATGAAAGGCGCCCCGGAGCGCA...
...TGTTAGTGATGAAGGGCGCCCCTGAACGCA...
...TGCTGGTGATGAAAGGTGCCCCGGAGCGCA...
...TGCTAGTGATGAAGGGCGCCCCAGAAAGGA...
...TGCTGGTGATGAAGGGAGCTCCAGAGAGGA...
...TGCTGGTCATGAAGGGCGCCCCCGAGAGGA...
...TGTTGGTGATGAAGGGAGCACCAGAACGGA...


A A
GTGATGAAAGGCGCCCCCGA
G G G
T T


Figure 4-1. Design of degenerate primers for RT-PCR of novel P-type ATPases. A)
Upstream primer was designed to anneal to well-conserved sequence at the enzyme active
site phosphorylated aspartyl residue. GenBank loci of 15 aligned sequences are shown at
left. Oligonucleotide is shown beneath aligned sequences. B) Downstream primer was
designed to anneal to well-conserved sequence at the putative ATP binding site.
Oligonucleotide is reverse complement of consensus sequence shown.






















419 bp-










00

0
2.













Figure 4-2. RT-PCR product amplified from rebbit renal cortex RNA using degenerate
primers. Gel isolated product was cloned and sequenced.

















Sequences producing High-scoring Segment Pairs:


gb U02076 HSU02076 Human ATP-driven ion pump (ATPlALl...
gb M90398 RATATPASEZ Rat H+,K+-ATPase mRNA, complete cds.
gb U94912 RNU94912 Rattus norvegicus H-K-ATPase alpha...
dbjID21854IGPIHKAAS Guinea pig mRNA for distal colon H...
gbjU94913jRNU94913 Rattus norvegicus H-K-ATPase alpha...
embi Z25809IBMHKATPAS B.marinus mRNA for H,K-ATPase
gbIM599601CHKNAKAT3 Chicken Na,K-ATPase alpha-3-subuni...
embIX05883IRNATPAHO Rat mRNA homologous to alpha subun...
gb M14513 RATATPA3 Rat Na+, K+-ATPase alpha(III) isof...
gbI M28648 RATNALPH2 Rattus norvegicus Na,K-ATPase alph...
embIZ11798 IBMNKAAl B.marinus mRNA for Na, K-ATPase al...
gb U10108 XLU10108 Xenopus laevis Na+-K+-ATPase alpha...
gb U49238 XLU49238 Xenopus laevis adenosine triphosph...
gb J02649 RATATPAST Rat stomach (H+,K+)-ATPase mRNA, c...
gb U17249 XLU17249 Xenopus laevis gastric H(+)-K(+)-A...
embIX64694 oCATPRNA O.cuniculus mRNA for ATPase (alpha...
gb J03230 CHKATPAS Chicken (Na+ + K+)-ATPase mRNA, co...
gb S66043 S66043 sodium pump alpha subunit (Ctenoce...
gb U17282 MMU17282 Mus musculus gastric H(+)-K(+)-ATP...
gb L42565 HUMATP1G04 Homo sapiens (clone 1SW34) non-gas...
gb L11568 DOGHKATP Dog H+,K+-ATPase mRNA, complete cds.
embIX02813 OAATPMR Sheep mRNA for (Na+ and K+) ATPase...
gb M22724 PIGATPHK Pig (H+ + K+)-ATPase mRNA, complet...
gb M28647 RATNALPHl Rattus norvegicus Na,K-ATPase alph...
gb S74801 S74801 H(+)-K(+)-ATPase alpha-subunit [ra...
gb M14511 RATATPA1 Rat Na+,K+-ATPase alpha isoform ca...
gb M74494 RATNAKATP Rat sodium/potassium ATPase alpha-...
emb X76108 AASPAA A.anguilla mRNA for sodium/potassi...
emb X05882 RNATPAR Rat mRNA for alpha subunit kidney-...
emb X02810 TCATPMR Torpedo californica mRNA for (Na+ ...
gb M59959 CHKNAKAT2 Chicken NA,K-ATPase alpha-2-subuni...
gb U16798 HSU16798 Human Na,K-ATPase alpha-i subunit ...
embjX04297|HSATPAR Human mRNA for Na,K-ATPase alpha-s...
gb J03007 HUMATPAS Human Na+,K+ ATPase alpha-subunit ...
gb L42173 DOGNKAA Canis familiaris Na, K-ATPase alph...
gb M38445 PIGATPBSEN Pig NA+, K+-ATPase alpha subunit m...
embIX03938|SSATPAR Pig mRNA for (Na+, K+)-ATPase alph...
gbIM14512|RATATPA2 Rat Na+,K+-ATPase alpha(+) isoform...
emb X58629 CCNAKATP C.commersoni mRNA for Na(+)/K(+) A...
emb X56650 AFNAKATP A.franciscana mRNA for Na/K ATPase...
gb M75140 HYDATPASE H.vulgaris Na,K-ATPase alpha subun...
gb L42566 HUMATP1G05 Homo sapiens (clone 1SW11-1) non-g...
gb S76581 S76581 Na,K-ATPase alpha-i subunit [dogs,...
gb J05451 HUMATPGG Human gastric (H+ + K+)-ATPase gen...
gb M63962 HUMHKATPC Human gastric H,K-ATPase catalytic...


Smallest
Sum
High Probabili
Score P(N)


1663
1582
1582
1582
1582
1069
907
898
898
889
889
880
871
853
844
835
826
826
817
458
790
772
772
763
760
736
736
727
727
667
710
709
709
709
700
691
682
674
665
646
606
551
514
318
327


4.1e-128
2.2e-121
2.2e-121
2.2e-121
2.2e-121
1. le-78
3.1 le-65
1.8e-64
1.8e-64
9.9e-64
9.9e-64
5.5e-63
3.1 le-62
9.7e-61
5.5e-60
3.1e-59
1.7e-58
1.7e-58
9.6e-58
2.4e-56
1.7e-55
5.3e-54
5.3e-54
3.0 Oe-53
5.3e-53
5.3e-51
5.3e-51
2.9e-50
2.9e-50
3.9e-49
7.6e-49
9.3e-49
9.3e-49
9.3e-49
5.2e-48
2.9e-47
1.6e-46
7.6e-46
9.0e-46
1.6e-43
3.4e-40
1.3e-35
1.5e-32
4.8e-24
5.5e-24


Figure 4-3. BLAST search using sequence of 419 bp fragment of HKa2.

















pWGC3

SpWGC7


pWGC9


pWGC 11 RACE


RACE pWGC15


pWGC53


AUG...



AUG...
HK-x2.


UGA ...AAA


RACE pWGC14


pWGC54


Figure 4-4. Cloning of HKao. and HKa, cDNAs. Individually cloned cDNAs are
indicated by bars and the plasmid numbers are indicated. AUG and UGA indicate start
and stop codons of the mRNA, respectively. Symbols: *, degenerated primers; RACE,
RACE primer. All other primers were gene-specific.











attempts employed the classical technique of Frohmian el al. (1988), which is analogous

to the 3'RACE process. In several attempts, this technique produced only short cDNA

sequences which provided little new sequence information. Taking a new approach, the

Marathon cDNA Amplification Kit by Clontech (Palo Alto, CA) was tried. This kit uses a

ligation technology to add a known upstream sequence for PCR amplification, rather than

the less efficient terminal transferase technology employed by Frohman et al. (1988). Also,

the reverse transcription step was changed to a higher temperature to lessen the possibility

of secondary structure blocking full extension by the RNA polymerase. With the new

protocol, after some optimization, two different 5' ends were obtained when 5' RACE

products were sequenced.

Two rabbit renal HK_2 cDNA sequences were found in this manner, having 4035

bases in common at the 3' end but different 5' ends. The GenBank records of these two

cDNAs are shown in Figure 4-5. A segment of the shared 3' portion of the sequences was

identical to the 1456 bp sequence obtained by Fejes-Toth (1995) except for two single

base mismatches. One mismatch was a transition of C-,T at nucleotide 2927, which does

not change the primary protein sequence and the other a transversion of G-T at

nucleotide 3259, in the 3' untranslated region. The full-length rabbit HKoaa nucleotide

sequence was 86% identical to human HKc2 and 83% to rat, whereas identity of HKoCz, to

rabbit HKc, was only 67%. The deduced amino acid sequence shared 87% identity with

human HKaX2, 87% identity with rat HKca2, but merely 64% with rabbit HKai. Northern

analysis using an HKc2,,-specific probe (Table 2-1) is shown in Figure 4-6.



















LOCUS
DEFINITION

ACCESSION
NID
KEYWORDS
SOURCE
ORGANISM


REFERENCE
AUTHORS
TITLE

JOURNAL
REFERENCE
AUTHORS
TITLE
JOURNAL

FEATURES
source




CDS


AF023128 4079 bp mRNA MAM 13-OCT-1997
Oryctolagus cuniculus H+,K+-ATPase alpha 2a subunit mRNA,
complete cds.
AF023128
g2511766

Oryctolagus cuniculus.
Oryctolagus cuniculus
Eukaryotae; Metazoa; Chordata; Vertebrata; Mammalia;
Eutheria; Lagomorpha; Leporidae; Oryctolagus.
1 (bases 1 to 4079)
Campbell,W.G., Weiner,I.D., Wingo,C.S. and Cain,B.D.
H,K-ATPase in the RCCT-28A rabbit cortical collecting duct
cell line
Unpublished
2 (bases 1 to 4079)
Campbell,W.G., Wingo,C.S. and Cain,B.D.
Direct Submission
Submitted (08-SEP-1997) Biochemistry, University of Florida,
JHMHC 100245, Gainesville, FL 32610, USA
Location/Qualifiers
1..4079
/organism="Oryctolagus cuniculus"
/strain="New Zealand White"
/db_xref="taxon:9986"
39..3140
/note="P-type ATPase"
/codon start=l
/product="H+,K+-ATPase alpha 2a subunit"
/db_xref="PID:g2511767"
/translation="MRQRKLEIYSVELHAATDIKKKEGRDGKKDNDLELKRNQQKEEL
KKELDLDDHKLSNKELETKYGTDIIRGLSSTRAAELLAQNGPNALTPPKQTPEIIKFL
KQMVGGFSILLWVGAVLCWIAFGIQYVSNPSASLDRVYLGTVLAVVVILTGIFAYYQE
AKSTNIMASFCKMIPQQAVVIRDSEKKVIPAEQLVVGDIVEIKGGDQIPADIRLLSAQ
GCKVDNSSLTGESEPQSRSSGFTHENPLETKNITFYSTTCLEGTATGMVINTGDRTII
GRIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSVGILFFIIAVCMKYHVLDAIIFLI
AIIVANVPEGLLATVTVALSLTAKRVAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQ
NRMTVAHLWFDNQIFVADTSEDNLNQGFDQSSGTWTSLSKIIALCNRAEFKPGEESVP
IMKRVVVGDASETALLKFSEVILGDVMEIRKRNHKVVEIPFNSTNKFQLSIHQTEDPN
DKRFLLVMKGAPERILEKCSTIMINGKEQPLDKSMAQAFHTAYMELGGLGERVLGFCH
FYLPADEFPETYSFDSESMNFPTSNLCFVGLLSMIDPPRSTVPDAVTKCRSAGIKVIM
VTGDHPITAKAIAKSVGIISANSETVEDIAKRCNIAVEQVNKRDAKAAVVTGMELKDM
SPEQLDELLANYPEIVFARTSPQQKLIIVEGCQRQDAVVAVTGDGVNDSPALKKADIG
VAMGITGSDAAKNAADMILLDDNFSSIVTGVEEGRLIFDNLKKTIAYTLTKNIAELCP
FLIYIILGLPLPIGTITLLFIDLGTDIIPSIALAYEKAESDIMNRKPRHKKKDRLVNQ


Figure 4-5. GenBank accession records for rabbit HKca2 sequences. A) Genbank record
for rabbit HKoc2,,. B) Genbank record for rabbit lHK,.>



















BASE COUNT
ORIGIN


1 gccccctgcc
61 tttactccgt
121 agaaagacaa
181 ttgatctgga
241 tcattcgggg
301 ccctcacccc
361 gcttttccat
421 atgtcagcaa
481 ttgtcatttt
541 ccagcttctg
601 ttatccctgc
661 ttcctgccga
721 ctggagagtc
781 caaagaacat
841 tcaacacggg
901 atgagaagac
961 ccgtctccgt
1021 acgccatcat
1081 ctgtcactgt
1141 agaacttgga
1201 ggactctgac
1261 tggccgacac
1321 cctccttgtc
1381 gtgtccccat
1441 tctcagaagt
1501 aaatcccttt
1561 atgacaagcg
1621 gcaccatcat
1681 acacggccta
1741 acctgccagc
1801 ccacctccaa
1861 tcccagatgc
1921 atcatcccat
1981 agacagtgga
2041 atgccaaggc
2101 atgagctctt
2161 tgatcatcgt
2221 tgaatgactc
2281 ctgacgcggc
2341 tcacaggggt
2401 ccctgaccaa
2461 ccctgcccat
2521 ccattgcctt
2581 agaaaaagga
2641 tcatgcaagc
2701 ggccgacctc


Figure 4-5--continued


62

QLAVYSYLHIGLMQALGAFLVYFTVYAQQGFRPTSLFHLRIAWDSDHLNDLEDNYGQE
WTSYQRQYLEWTGYTAFFVGIMVQQIADLIIRKTRKNSIFKQGLFRNKVIWVGIASQI
IVALLLSYGLGSITALNFTMLKAQYWFVAVPHAILIWVYDEMRKLFIRLYPGSWWDKN
MYY"
1037 a 1073 c 1024 g 945 t


cgccgacccg
ggagctccat
tgacttggaa
tgaccacaaa
tctctccagc
tcccaaacag
ccttctgtgg
tccatctgcc
aacaggaatc
caagatgatc
agagcagctg
catcaggctg
tgagccccag
cactttctac
tgaccggacc
gcccattgcc
cggcatcctg
cttcctcatt
ggccctgtcg
ggcagtggag
gcagaacagg
gagtgaagac
caagataata
catgaagaga
cattttgggt
taactcaacc
cttcctgctg
gatcaacggc
catggagctg
agatgagttt
cttatgtttt
agtcaccaaa
cacagccaaa
agacattgca
cgccgtggtg
agccaactac
ggagggctgt
ccccgctcta
caagaacgca
ggaggaaggc
gaacattgcc
tggcaccatc
ggcgtatgag
cagactggtg
cctgggagct
actgtttcac


cggcgcctcc
gcagctacag
ctcaaaagga
ctcagcaata
accagagctg
accccagaga
gtaggagctg
tccctggaca
tttgcctatt
ccccagcaag
gtggtggggg
ctgtctgccc
tcccgctcaa
tccacgacct
atcattggcc
attgagatcg
ttcttcatca
gccatcattg
ctcacagcca
accctcggct
atgaccgtgg
aatttaaacc
gcattgtgta
gtcgtggttg
gacgtgatgg
aacaaatttc
gtgatgaagg
aaggagcagc
ggcggcctgg
ccagagacct
gtggggctct
tgccggagtg
gccattgcca
aaacgctgca
accggcatgg
ccggaaatcg
cagaggcagg
aagaaggccg
gccgacatga
cgcttgatat
gagctctgcc
accctcctgt
aaagcagaaa
aaccagcagc
ttcctggtgt
ctgcggatag


agcgcgacat
atatcaagaa
atcagcagaa
aggagctgga
ctgagctcct
tcatcaagtt
tcctgtgttg
gagtgtacct
accaagaggc
ctgttgtcat
acatcgtgga
aggggtgtaa
gtgggttcac
gcctggaagg
gcattgcctc
aacattttgt
tcgcagtgtg
tggccaacgt
aacgggtggc
ccacctccat
cccatctgtg
aaggctttga
accgagctga
gagatgcttc
aaattagaaa
agctctccat
gggcccccga
cactggacaa
gcgagcgcgt
actcatttga
tatcaatgat
caggaatcaa
agagtgtagg
acatcgccgt
agctgaagga
tgtttgcacg
acgcagttgt
acattggcgt
tcctgctgga
ttgacaacct
cctttttgat
tcatcgactt
gtgacattat
ttgctgtata
acttcactgt
cgtgggacag


gcgccagaga
gaaggagggg
agaggagctt
aacgaaatat
ggcacagaac
cctcaagcag
gatcgcattt
gggcactgta
aaaaagcacc
ccgtgactcg
gattaaagga
ggtggataac
ccacgaaaac
cacggcaact
cttggcttca
gcacattgtg
catgaagtac
gcctgaaggc
caagaagaac
catctgctct
gtttgacaat
ccaaagctct
gttcaagcca
agaaactgct
aagaaaccac
acaccagacg
gcggatccta
gagcatggcc
gctgggtttc
ctcagaatcc
tgatcctcct
ggttatcatg
gatcatttca
ggagcaggtt
catgagccca
gacgtccccc
ggccgtgacg
tgccatgggg
tgacaacttc
aaagaagacc
ttacatcatt
gggcacagac
gaacaggaag
ctcgtacctg
gtacgcacag
cgaccacctg


aagctggaaa
cgagatggca
aagaaagaac
ggcacagaca
ggacccaacg
atggtgggcg
gggattcagt
cttgccgtgg
aacatcatgg
gagaaaaagg
ggtgaccaga
tcatctctta
cccctggaaa
ggcatggtca
ggcgtcggga
gcaggagtgg
cacgtcctgg
ctcctggcca
tgcctggtga
gacaagactg
cagatcttcg
ggaacctgga
ggagaggaga
cttctgaaat
aaagtagtcg
gaagatccca
gagaagtgca
caggccttcc
tgccatttct
atgaacttcc
cgatccactg
gttacaggtg
gccaacagtg
aacaaacggg
gaacagctgg
cagcaaaagc
ggggacggag
ataacgggtt
tcctctatcg
atcgcttaca
ctcgggctgc
ataatcccct
cctcggcaca
cacattggcc
cagggctttc
aacgacttgg














2761 aagacaacta tggacaggaa


2821
2881
2941
3001
3061
3121
3181
3241
3301
3361
3421
3481
3541
3601
3661
3721
3781
3841
3901
3961
4021
//


acacggcttt
cccgcaagaa
tcgcctccca
taaatttcac
tctgggtata
ataagaacat
gtggtcttcg
ctctcatcta
ttcagctgtt
atgtcaaggt
acacagactt
tcagatctcc
cccctgaaac
ggcagcagga
ttgctgtgat
ctgttcctgc
acccaaaggg
tagcactatt
aatcacattt
gacaggtttt
ctaattgtga


ctttgttggc
ctccatcttc
gatcatcgtc
catgctcaag
cgatgaaatg
gtattactga
gcaagacctc
gaacacagtg
tgtatatgat
catggtgtag
gtgtaaccca
ttccacaccc
ataacttttg
gcacctcaga
gggttcctgg
aaagctgacc
gctgtcactg
tatttcttgt
ttgtaactta
tttttttaaa
tgttttactt


tggacgagtt
atcatggtcc
aagcaggggc
gccctgctcc
gctcagtact
cggaaactct
gaccaggtct
tgtgtagtgt
gtgaagcttc
tttcatctct
ggaaggatgt
ggtggctgct
tgtcaaaggc
gggtttgctt
acagcaaaga
ccatgcggcc
tccaagtcca
actgggactc
agataggctg
gatatatttg
taaaagatgt
aattcaagtt


atcagaggca
agcaaatagc
tcttcagaaa
tctcttacgg
ggtttgtggc
tcatcaggct
gtctctgagt
ggatgttgcc
ttactgatct
atctccatct
gtttatctgt
ggagtctgcc
ccggtgagct
tgctcagctg
cagcccccgt
ccagtccgcc
ttccacaaac
ggcctctccg
ccaagcactc
tgtgggacac
ttttaagtaa
tttccagagg


atacctggaa
agatctgatc
taaagttatc
gctcggcagt
cgtaccccac
ctaccccgga
ctcccagcgg
aagctccact
gttgtacttc
ccttacctta
atatgaagct
ataagttgag
ccataggatt
agggtgtgag
tttgactccc
ttctcacagc
cttaactcaa
gaaagccact
tccagcagcc
gaaacacata
aatgttttat
caggcacgga


Figure 4-5--continued


tggacaggct
atcaggaaga
tgggtgggga
atcacagccc
gccatcctga
agctggtggg
cacctgcctg
cgggaggaga
aaagctgaga
aaagatgtgg
cactgatgtc
ctagaattgc
tctgtgaatc
ttggaagtgt
agacactttg
actccaccac
acattcgtgg
gtggtttaga
attttatgtc
catccatgtt
gaaacaaaat
aaataccaa














B)


LOCUS
16-APR-1998
DEFINITION

ACCESSION
NID
KEYWORDS
SOURCE
ORGANISM




REFERENCE
AUTHORS
TITLE

JOURNAL
REFERENCE
AUTHORS
TITLE
JOURNAL


FEATURES
source




CDS


AF023129


4422 bp mRNA


MAM


Oryctolagus cuniculus H+,K+-ATPase alpha 2c subunit mRNA,
complete cds.
AF023129
g2511768

Oryctolagus cuniculus.
Oryctolagus cuniculus
Eukaryotae; Metazoa; Chordata; Vertebrata; Mammalia;
Eutheria;
Lagomorpha; Leporidae; Oryctolagus.
1 (bases 1 to 4422)
Campbell,W.G., Weiner,I.D., Wingo,C.S. and Cain,B.D.
H,K-ATPase in the RCCT-28A rabbit cortical collecting duct
cell line
Unpublished
2 (bases 1 to 4422)
Campbell,W.G., Wingo,C.S. and Cain,B.D.
Direct Submission
Submitted (08-SEP-1997) Biochemistry, University of Florida,
JHMHC
100245, Gainesville, FL 32610, USA
Location/Qualifiers
1..4422
/organism="Oryctolagus cuniculus"
/strain="New Zealand White"
/db_xref="taxon:9986"
199..3483
/note="P-type ATPase"
/codon_start=l
/product="H+,K+-ATPase alpha 2c subunit"
/db_xref="PID:g2511769"
/translation="MAGGAHRADRATGEERKEGGGRWRAPHSPSPPGPRGCPVPLKAA
AQSLCRKPTWGRYCTLLLFQRKLEIYSVELHAATDIKKKEGRDGKKDNDLELKRNQQK
EELKKELDLDDHKLSNKELETKYGTDIIRGLSSTRAAELLAQNGPNALTPPKQTPEII
KFLKQMVGGFSILLWVGAVLCWIAFGIQYVSNPSASLDRVYLGTVLAVVVILTGIFAY
YQEAKSTNIMASFCKMIPQQAVVIRDSEKKVIPAEQLVVGDIVEIKGGDQIPADIRLL
SAQGCKVDNSSLTGESEPQSRSSGFTHENPLETKNITFYSTTCLEGTATGMVINTGDR
TIIGRIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSVGILFFIIAVCMKYHVLDAII
FLIAIIVANVPEGLLATVTVALSLTAKRVAKKNCLVKNLEAVETLGSTSIICSDKTGT
LTQNRMTVAHLWFDNQIFVADTSEDNLNQGFDQSSGTWTSLSKIIALCNRAEFKPGEE
SVPIMKRVVVGDASETALLKFSEVILGDVMEIRKRNHKVVEIPFNSTNKFQLSIHQTE
DPNDKRFLLVMKGAPERILEKCSTIMINGKEQPLDKSMAQAFHTAYMELGGLGERVLG
FCHFYLPADEFPETYSFDSESMNFPTSNLCFVGLLSMIDPPRSTVPDAVTKCRSAGIK
VIMVTGDHPITAKAIAKSVGIISANSETVEDIAKRCNIAVEQVNKRDAKAAVVTGMEL
KDMSPEQLDELLANYPEIVFARTSPQQKLIIVEGCQRQDAVVAVTGDGVNDSPALKKA
DIGVAMGITGSDAAKNAADMILLDDNFSSIVTGVEEGRLIFDNLKKTIAYTLTKNIAE


Figure 4-5--continued














LCPFLIYIILGLPLPIGTITLLFIDLGTDIIPSIALAYEKAESDIMNRKPRHKKKDRL
VNQQLAVYSYLHIGLMQALGAFLVYFTVYAQQGFRPTSLFHLRIAWDSDHLNDLEDNY
GQEWTSYQRQYLEWTGYTAFFVGIMVQQIADLIIRKTRKNSIFKQGLFRNKVIWVGIA
SQIIVALLLSYGLGSITALNFTMLKAQYWFVAVPHAILIWVYDEMRKLFIRLYPGSWW


BASE COUNT
ORIGIN


DKNMYY"
1103 a


1 ctccgccctc
61 atgcgtagcg
121 gctggtgtga
181 tgtcttcctg
241 gagaggaagg
301 cgagggtgtc
361 ggccggtatt
421 catgcagcta
481 gaactcaaaa
541 aaactcagca
601 agcaccagag
661 cagaccccag
721 tgggtaggag
781 gcctccctgg
841 atctttgcct
901 atcccccagc
961 ctggtggtgg
1021 ctgctgtctg
1081 cagtcccgct
1141 tactccacga
1201 accatcattg
1261 gccattgaga
1321 ctgttcttca
1381 attgccatca
1441 tcgctcacag
1501 gagaccctcg
1561 aggatgaccg
1621 gacaatttaa
1681 atagcattgt
1741 agagtcgtgg
1801 ggtgacgtga
1861 accaacaaat
1921 ctggtgatga
1981 ggcaaggagc
2041 ctgggcggcc
2101 tttccagaga
2161 tttgtggggc
2221 aaatgccgga
2281 aaagccattg
2341 gcaaaacgct
2401 gtgaccggca
2461 tacccggaaa
2521 tgtcagaggc
2581 ctaaagaagg



Figure 4-5--continued


1174 c 1136 g 1009 t


gcacctgcgg
gtctggaaaa
ccccgcaggg
ggaagacgat
agggaggtgg
cggtcccact
gcactctgct
cagatatcaa
ggaatcagca
ataaggagct
ctgctgagct
agatcatcaa
ctgtcctgtg
acagagtgta
attaccaaga
aagctgttgt
gggacatcgt
cccaggggtg
caagtgggtt
cctgcctgga
gccgcattgc
tcgaacattt
tcatcgcagt
ttgtggccaa
ccaaacgggt
gctccacctc
tggcccatct
accaaggctt
gtaaccgagc
ttggagatgc
tggaaattag
ttcagctctc
agggggcccc
agccactgga
tgggcgagcg
cctactcatt
tcttatcaat
gtgcaggaat
ccaagagtgt
gcaacatcgc
tggagctgaa
tcgtgtttgc
aggacgcagt
ccgacattgg


gctcggattc
tgccccaggc
caaccccgcg
ggcaggcggt
gaggtggcgc
caaggcagct
tctctttcag
gaagaaggag
gaaagaggag
ggaaacgaaa
cctggcacag
gttcctcaag
ttggatcgca
cctgggcact
ggcaaaaagc
catccgtgac
ggagattaaa
taaggtggat
cacccacgaa
aggcacggca
ctccttggct
tgtgcacatt
gtgcatgaag
cgtgcctgaa
ggccaagaag
catcatctgc
gtggtttgac
tgaccaaagc
tgagttcaag
ttcagaaact
aaaaagaaac
catacaccag
cgagcggatc
caagagcatg
cgtgctgggt
tgactcagaa
gattgatcct
caaggttatc
agggatcatt
cgtggagcag
ggacatgagc
acggacgtcc
tgtggccgtg
cgttgccatg


ggagaaaagt
tcgggtctga
gttaacttct
gcccaccgag
gctccccaca
gcgcagagcc
agaaagctgg
gggcgagatg
cttaagaaag
tatggcacag
aacggaccca
cagatggtgg
tttgggattc
gtacttgccg
accaacatca
tcggagaaaa
ggaggtgacc
aactcatctc
aaccccctgg
actggcatgg
tcaggcgtcg
gtggcaggag
taccacgtcc
ggcctcctgg
aactgcctgg
tctgacaaga
aatcagatct
tctggaacct
ccaggagagg
gctcttctga
cacaaagtag
acggaagatc
ctagagaagt
gcccaggcct
ttctgccatt
tccatgaact
cctcgatcca
atggttacag
tcagccaaca
gttaacaaac
ccagaacagc
ccccagcaaa
acgggggacg
gggataacgg


gctagactgg
ggggcccaag
ctcctgccca
ccgaccgtgc
gcccttcccc
tgtgcagaaa
aaatttactc
gcaagaaaga
aacttgatct
acatcattcg
acgccctcac
gcggcttttc
agtatgtcag
tggttgtcat
tggccagctt
aggttatccc
agattcctgc
ttactggaga
aaacaaagaa
tcatcaacac
ggaatgagaa
tggccgtctc
tggacgccat
ccactgtcac
tgaagaactt
ctgggactct
tcgtggccga
ggacctcctt
agagtgtccc
aattctcaga
tcgaaatccc
ccaatgacaa
gcagcaccat
tccacacggc
tctacctgcc
tccccacctc
ctgtcccaga
gtgatcatcc
gtgagacagt
gggatgccaa
tggatgagct
agctgatcat
gagtgaatga
gttctgacgc


agctacacgt
tctatgcacc
cccctagagg
aacaggggaa
tcctggcccg
acccacctgg
cgtggagctc
caatgacttg
ggatgaccac
gggtctctcc
ccctcccaaa
catccttctg
caatccatct
tttaacagga
ctgcaagatg
tgcagagcag
cgacatcagg
gtctgagccc
catcactttc
gggtgaccgg
gacgcccatt
cgtcggcatc
catcttcctc
tgtggccctg
ggaggcagtg
gacgcagaac
cacgagtgaa
gtccaagata
catcatgaag
agtcattttg
ttttaactca
gcgcttcctg
catgatcaac
ctacatggag
agcagatgag
caacttatgt
tgcagtcacc
catcacagcc
ggaagacatt
ggccgccgtg
cttagccaac
cgtggagggc
ctcccccgct
ggccaagaac














2641
2701
2761
2821
2881
2941
3001
3061
3121
3181
3241
3301
3361
3421
3481
3541
3601
3661
3721
3781
3841
3901
3961
4021
4081
4141
4201
4261
4321
4381


gcagccgaca
ggccgcttga
gccgagctct
atcaccctcc
gagaaagcag
gtgaaccagc
gctttcctgg
cacctgcgga
gaatggacga
ggcatcatgg
ttcaagcagg
gtcgccctgc
aaggctcagt
atgcggaaac
tgagaccagg
ctctgtgtag
gtggtgaagc
gattttcatc
tagggaagga
ccaggtggct
ccctgtcaaa
ttggggtttg
agaacagcaa
tggccatgcg
acctccaagt
ctgactggga
tgtagatagg
ttagatatat
aaataaaaga
cttaattcaa


tgatcctgct
tatttgacaa
gccccttttt
tgttcatcga
aaagtgacat
agcttgctgt
tgtacttcac
tagcgtggga
gttatcagag
tccagcaaat
ggctcttcag
tcctctctta
actggtttgt
tcttcatcag
tctgtctctg
tgtggatgtt
ttcttactga
tctatctcca
tgtgtttatc
gctggagtct
ggcccggtga
ctttgctcag
agacagcccc
gccccagtcc
ccattccaca
ctcggcctct
ctgccaagca
ttgtgtggga
tgtttttaag
gtttttccag


ggatgacaac
cctaaagaag
gatttacatc
cttgggcaca
tatgaacagg
atactcgtac
tgtgtacgca
cagcgaccac
gcaatacctg
agcagatctg
aaataaagtt
cgggctcggc
ggccgtaccc
gctctacccc
agtctcccag
gccaagctcc
tctgttgtac
tctccttacc
tgtatatgaa
gccataagtt
gctccatagg
ctgagggtgt
cgttttgact
gccttctcac
aaccttaact
ccggaaagcc
ctctccagca
cacgaaacac
taaaatgttt
aggcaggcac


ttctcctcta
accatcgctt
attctcgggc
gacataatcc
aagcctcggc
ctgcacattg
cagcagggct
ctgaacgact
gaatggacag
atcatcagga
atctgggtgg
agtatcacag
cacgccatcc
ggaagctggt
cggcacctgc
actcgggagg
ttcaaagctg
ttaaaagatg
gctcactgat
gagctagaat
atttctgtga
gagttggaag
cccagacact
agcactccac
caaacattcg
actgtggttt
gccattttat
atacatccat
tatgaaacaa
ggaaaatacc


tcgtcacagg
acaccctgac
tgcccctgcc
cctccattgc
acaagaaaaa
gcctcatgca
ttcggccgac
tggaagacaa
gctacacggc
agacccgcaa
ggatcgcctc
ccctaaattt
tgatctgggt
gggataagaa
ctggtggtct
agactctcat
agattcagct
tggatgtcaa
gtcacacaga
tgctcagatc
atccccctga
tgtggcagca
ttgttgctgt
cacctgttcc
tggacccaaa
agatagcact
gtcaatcaca
gttgacaggt
aatctaattg
aa


Figure 4-5--continued


ggtggaggaa
caagaacatt
cattggcacc
cttggcgtat
ggacagactg
agccctggga
ctcactgttt
ctatggacag
tttctttgtt
gaactccatc
ccagatcatc
caccatgctc
atacgatgaa
catgtattac
tcggcaagac
ctagaacaca
gtttgtatat
ggtcatggtg
cttgtgtaac
tccttccaca
aacataactt
ggagcacctc
gatgggttcc
tgcaaagctg
ggggctgtca
atttatttct
tttttgtaac
tttttttttt
tgatgtttta




















(12a


GAP3DH


-4.1kb


-1.3kb


Distal
Colon


Renal
Cortex


Figure 4-6. Northern analysis showing presence of HKza, in distal colon and renal
cortex. GAP3DH was used to show the condition of the RNA samples.











To determine the relationship between the rabbit HKa2 mRNAs and other P-type

ATPases, phylogenetic analysis was necessary. Several programs and algorithms were

sampled, all giving the same general pattern of sequence relationships. Programs employed

include CLUSTALW (Thompson et al., 1994), DISTANCES (Genetics Computer Group,

1997), and PAUP (Genetics Computer Group, 1997). All three programs use the distance

algorithm, and the maximum parsimony algorithm of PAUP was also used. In addition to

distance and maximum parsimony analyses, a third popular algorithm to assay relatedness

of sequences is used, the maximum likelihood analysis. Distance analysis generates a tree

showing relatedness of sequences by simply counting

dissimilarities in aligned sequences as a test of their homology. Maximum parsimony

considers only positive information in making a comparison. For instance, in an alignment

of four sequences, a position that had one each of A, C, G, and T would not be included in

the analysis because that position would not give information about any pair of the

sequences being related. A position that had two As and two Cs would be counted

because it would show the grouping of two pairs. Distance analysis would include both

positions in the analysis. Maximum likelihood takes into account the tendency for a given

type of mutation to occur. In two sequences that have a point mutation, that point

mutation was more probably created by a "likely" change than a change that has less

tendency to occur. Maximum likelihood would measure two sequences as more related if

their alignment shows a "likely" mutation. If the mutation had less tendency, it may

indicate a more distant relationship between sequences arrived at only by multiple changes









69
or higher pressure of selection. Thile maximnlum likelihood analysis requires information that

is not readily available for rabbit, and was not attempted. A representative phylogram

arrived at by distance analysis by the CLUSTALW program is shown in Figure 4-7.

The 5' end of the second rabbit sequence (HKa2c) differed dramatically from the

published rat HKat_,, (Crowson and Shull, 1992) and human HKa_,, (Grishin el cil., 1994)

sequences. The HKcx2c 5' untranslated region bore no homology to the comparable

segments from the HKc2,, cDNAs from human or rat, or to any GenBank sequence. It

was clear from the beginning that this second 5' end might represent an alternative splicing

product; the sequence homology diverges from the human HKa2 sequence at a point

known in the human ATP1ALI gene to be a splice junction (nucleotide 177 ofATP1AL1)

(Sverdlov et cial., 1996).


Alternative Splicing of H.K-ATPase cx Subunits in the Kidney


When a sequence for the 5' end of the rat HKKc2 gene was published (Kone and

Higham, 1998), we wanted to compare the sequence at the 5' end of the rabbit gene. In

order to determine the exon arrangement at the 5' end of the HKa2 gene, rabbit genomic

DNA was amplified by PCR. The antisense primer was selected within the region of

sequence that is common to HKa;2, and HKa-,. Because it was unknown which of the two

cDNA 5' ends was located more 5' in the gene, sense primers that anneal to sequence

within each were selected. The oligonucleotide primer specific to HKca2., gave the larger

amplified product, and its sequence is shown in Figure 4-8A. The exon specific to HKc2,a

splices to the common core sequence at the splice site shown. The exon specific to HKKa2,
























rabbit HKal
human HKal


toad HKa3


rat HKa2 I

rabbit HKa2'


rat NaKa2

.. human NaKa2




--- rat NaKal

human NaKal

NaKal


human HKa2


Figure 4-7. Distance analysis of selected HlKa and NaKa. subunit coding.


rat HKal











T HKa_,. transcription start 71
A ) 1 GCCCCCTGCC CGCCGACCCG CGGCGCCTCC AGCGCGACAT GCGCCAGgtg
M R Q


51 tgtgaggaag tgacgcggtg cggactggcg agaagtgcgg gaaagggtga


101 agggctccgt ccgggggtct ttactctgca accctgttcc agccgccgag


151 cacccgtgtg tcactcggga actggctggg vaagaggtc aatccagaca

HKa,. transcription
201 cgcggggaag gagttccagg ggtcctgggc cagCTCCGCC CTCGCACCTG

start
251 CGGGCTCGGA TTCGGAGAAA AGTGCTAGAC TGGAGCTACA CGTATGCGTA


301 GCGGTCTGGA AAATGCCCCA GGCTCGGGTC TGAGGGGCCC AAGTCTATGC


351 ACCGCTGGTG TGACCCCGCA GGGCAACCCC GCGGTTAACT TCTCTCCTGC


401 CCACCCCTAG AGGTGTCTTC CTGGGAAGAC GATGGCAGGC GGTGCCCACC
M A G G A H R


451 GAGCCGACCG TGCAACAGGG GAAGAGAGGA AGGAGGGAGG TGGGAGGTGG
A D R A T C G E E R K E G G G W


501 CGCGCTCCCC ACAGCCCTTC CCCTCCTGGC CCTCGAGGGT GTCCGGTCCC
R A P H S P S P P G P R G C P V P


551 ACTCAAGGCA GCTGCGCAGA GBCTGTGCAG AAAACCCACC TGGGGCCGGT
L K A A A Q S L C R K P T W G R Y

HKa,. splice site
601 ATTGCACTCT GCTTCTCTTT CAGAGAAAGC TGGAAATTTA CTCCGTGAG
C T L L L F Q R K L I I Y S V E


B) 651 ... remainder of sequence omitted for clarity
HKo2a HKa2c

...ATG, .ATG ATG... COMMON




splicing


Figure 4-8. Rabbit HKa, gene sequence at the 5' end. A) HKa2 gene sequence and
deduced amino acid sequences are shown. Intron sequence is in lower case type. The
amino acid sequence that is shared by HKaa and HKacx is in boldface type. B) Pattern of
alternative splicing at the 5' ends of the HKa2 transcripts.











is continuous with the core sequence and lies within the first intron of the HKo2a

pre-mRNA. This general intron/exon structure is the same as that reported for rat HKa2a

and HKoC2b (Kone and Higham, 1998)


Expression of HK-ATPase x Subunits in the Kidney


The start codon of HKa2a,, was omitted in the HKC(2c sequence. Instead, a probable

start codon was located upstream in frame with the HKo2,, open reading frame. Thus, the

deduced amino acid sequence encoded a protein 61 amino acids longer at the amino

terminal end than the rabbit HKc2,, sequence. The deduced amino acid sequence of the

HKot2za and HKc(X2 proteins are shown in Figure 4-8A, indicating translational start sites.

Although the HKx2c. cDNA indicated a continuous open reading frame including the

amino-terminal extension, the possibility remained that translation might be initiated at the

ATG codon homologous to that reported for the rat (Kone and Higham, 1998).

Therefore, to determine whether the upstream ATG served as a translational start site,

antipeptide antibodies were generated for peptides corresponding to amino acids 13-25

and 79-98 of the HKx2,c subunit. The former (antibody LLC27) was HKa:2c-specific, while

the latter (antibody LLC25) recognized a segment common to both HKoa2a, and HKax2,

subunits. Western analyses of rabbit kidney tissues and RCCT-28A cells using antibody

LLC25 (anti-HKa2, common) revealed a doublet migrating at an apparent molecular mass

of approximately 90KDa (figure 4-9A). Experiments using antibody LLC27 (anti-HKa(2)

indicated a single band with a migration comparable to the upper band of the doublet

(figure 4-9B). Both antibodies appear to recognize the same protein providing strong















A)

anti-HKa2 common




OL2c N j ,


O(2a


B)

anti-HKca2c



4116
-97.4


_, '- 66.2


0 CD
0CD
>4


Figure 4-9. Western analysis showing presence of HKa2, and HKa2c protein in renal
cortex. A) Detected with the anti-HKa2 common antibody LLC25. B) Detected with the
anti-HKac2-specific antibody LLC27. A and B show separate lanes from the same
SDS-PAGE gel. Membrane was cut after electrotransfer and re-aligned after
autoradiography.


0 CT
C D
X











evidence that the HKcX2, subunit containing thile amino-terminal extension was indeed

present in both rabbit renal tissue and RCCT-28A cells.

To test the hypothesis that enzyme localization in the kidney or in the cell is changed

as a result of the alternative splicing of the mRNA, immunohistochemnistry experiments

were performed. Using our antibodies, Dr. Jilt Verlander and Ms. Robin Moudy

conducted immunohistochemistry experiments. Neither antibody we had made to the

anti-HKa2 common region (LLC24 or LLC25) worked well for immunohistochemistry.

However LLC22 (anti-HKc1) and LLC26 (anti-HKac2) gave satisfactory results. A

representative section photographed in Dr. Verlander's laboratory is shown in Figure

4-10. There is no visible reactivity except in the apical membranes of some cells of

connecting segment and collecting duct. A majority of the cells in which labelling is

observed bulge out into the lumen, a hallmark of the intercalated cell. Fewer cells are

labelled in connecting segment compared to more distally in the collecting duct. This is in

accordance with the normal distribution of acid-secreting intercalated cells, fewer in

connecting segment than farther down in cortical collecting duct. There appears to be

some labelling of cell types other than intercalated cells, including principal cells. Labelling

continues to be visible in more distal sections of collecting duct than one would expect

based on distribution of intercalated cells, but individual rabbits may vary widely in this

distribution. Therefore, the few observations made do not permit a certainty that HKot2c

subunit protein is expressed more distally in cell types not normally thought to be

associated with acid secretion. The lack of basolateral labelling implies that there is not a

cell polarity change in HKxc protein compared to HKaxa.






















































Figure 4-10. Immunohistochemistry by Dr. Jill Verlander and Ms. Robin Moudy.
Anti-HKcta, antibody reacts with the apical surfaces in some cells in rabbit renal
collecting duct. The section shown is from the outer stripe of outer medulla.













Discussion


We have generated complete cDNAs for both the rabbit renal HKac2, and the novel

HKoX2c subunits. They were more closely related to other HKaX2 nucleotide sequences than

to HKoa, or to Na,K-ATPases. The exon structure at the 5' end was found and compared

to the exon structure found at the 5' end of rat (Kone and Higham, 1998). Proteins

corresponding to both HKac2 isoforms were detected by immunoblot analysis, indicating

that the novel HKct2, has the predicted amino-terminal extension.

The HKca2 cDNAs reported here generated using rabbit renal cortex RNA as template

have high homology to previously known HKa_ sequences from human skin axilla and the

rat distal colon (Grishin el al., 1994; Crowson and Shull, 1992). The level of homology is

relatively low compared to the homology typically found when comparing HKa, or NaKa

subunits across mammalian species. However, it is much higher than the homology

between the rat HKo., and HKoa: cDNAs (Crowson and Shull, 1992) or among the

different Na,K-ATPase isofotbrms within a species The HKax2 isoforms appear to have

undergone somewhat greater evolutionary divergence than HKoi or the Na,K-ATPase

catalytic isoforms. Phylogenetic analysis provides a clearer picture of the relationships

between these P-type ATPases In a phylogram (figure 4-7), the HKa;' subunit isoforms

cluster together compared to the other P-type ATPases. The HKoa2 subunit nucleotide

sequences all represent H,K-ATPases that are expressed at high level in colon, at lower

level in other tissues including the kidney, and not at all in stomach. At least in rat and










rabbit, an alternatively spliced variant has been shown to be transcriptionally competent,

and the pattern of introns and exons that give rise to this alternative splicing are strikingly

similar. It would be highly interesting to attempt to detect a similar transcript in human.

Based on tissue distribution, phylogenetic analysis, and the similarity of alternatively

spliced transcripts, it continues to be a valid premise that the HKc X2 subunits known for

rat, human, and rabbit form an orthologous group.

Like the rat, the rabbit appears to have alternatively spliced transcripts of HKo2 in the

kidney. The organization of the rat alternatively spliced cDNA (Kone and Higham, 1998)

omitted the exon containing the start codon of the sequence previously reported for rat

distal colon (Crowson and Shull, 1992), giving rise to a protein truncated by 108 amino

acids at the amino-terminal end. The rabbit HKa2, sequence also omits the start codon

present in the HKx2,, sequence. However, an upstream 5' ATG codon lies in the same

uninterrupted reading frame as the coding sequence for HKU2. Initiation of translation at

this position yields a subunit having an extended amino-terminus 61 amino acids longer

than the canonical HKo2, protein. Western analysis demonstrated that a protein having

this extension is present in rabbit kidney. An antibody designed to detect the common

core region of HKct, was reactive to two proteins very close in apparent mass, whereas an

antibody designed to detect the amino-terminal extension was reactive to a single species.

The extended portion of the HKox,_-encoded protein contains a casein kinase II

phosphorylation motif at thr-12, and a cAMP-dependent protein kinase phosphorylation

motif at thr-53. These sites impart a potential for regulation ofHKcx, distinct from HK2,a.

There are no apparent glycosylation sites or signal sequences. The HKac(, extension is









78
hydrophilic in nature and lacks any conspicuous membrane-spanning domains. Because the

N-terminus of HKct1 was found to be cytosolic (Smolka et al., 1992), the elongation can

be expected to have a cytosolic location. Figure 1-1 shows the putative location of the

amino-terminal extension. Chou-Fasman calculations predict this segment to be

predominantly alpha- helical with a turn structure in a region containing seven prolines

between amino acids 26 through 40. A similarly proline-rich hinge region is found in band

3 protein, and an ankyrin-binding site has been localized to that area of band 3 (Willardson

etal., 1989). Products of alternative splicing of the band 3 protein AEI gene have been

characterized in chicken kidney, where it is thought that the variation in transcripts serves

to determine the membrane domain to which the polypeptides are targeted (Cox et al.,

1995). A similar situation may exist for the various HKa_ transcripts; alternative splicing

may mediate the polarity of expression. In cortical thick ascending limb, an H,K-ATPase

activity has been described that diminished in rats fed a low K' diet (Younes-Ibrahim et

al., 1995). Basolateral polarity of expression would be consistent with potassium

homeostasis in that case. However, no basolateral staining using the anti-HKc(x2 antibody

was seen in this segment of the nephron (discussed below). If the HKc2b protein is the

molecule responsible for that activity, its absence in RCCT-28A could be explained by the

normal expression being in a region of the cortex other than CCD.

A number of possibilities exist to answer the question of why there are multiple

H,K-ATPases in the kidney. One possibility is differential regulation. In rat (Kone and

Higham, 1998) and rabbit (this work) the alternatively spliced HKa, subunit mRNA

contains multiple upstream open reading flames. This may be associated with an inhibition

of translation, leading to a decrease in HKc, subunit protein in the cell. Covalent











modification is another possible means of differential regulation. In this case,

phosphorylation is an unlikely candidate for differential regulation because although motifs

recognized by kinases are present, they are not conserved between rat (Kone and Higham,

1998) and rabbit. Having a different promoter region immediately 5' to the HKa2e cDNA

gives rise to potential differences in regulation relative to HKox2a. Of course, different

promoter regions giving different responses to conditions such as aldosterone status and

low K' may account for why there are the three catalytic subunit isoforms HKcc, HKa2a,

and HKa2c. There may also be differences in the kinetics between HKa2 ., and HKCa2c.

Another possibility is localization, both within the kidney and within the cell. Using

our antibodies, Dr. Jill Verlander and Ms. Robin Moudy conducted immnunohistochemistry

experiments. They found a similar pattern of expression of expression of HKa2, compared

to other H,K-ATPase proteins for which localization is known (Wingo el al., 1990;

Campbell-Thompson el al., 1995; Aihn and Kone, 1995; Ahn eli al., 1996; Haragsim and

Bastani, 1996). These results imply that the alternative splicing does not confer on the

protein a different polarity of expression or localization within the kidney. They do imply

that the HKca2c protein joins other acid and ion transporters in cell types specialized for

high transport activity.

Immunohistochemistry showed that differences in HKa2, subunit protein cellular

distribution had no major departures from the distribution of other H,K-ATPase subunits.

Because the phosphorylation motifs in rat and rabbit alternatively spliced isoforms are not

conserved, regulation by phosphorylation is a less likely candidate to lead to differential

regulation. There are myriad possibilities for why there is such a heterogeneity of









80
H,K-ATPases in the kidney, such as differential regulation at the gene level by different

promoter regions, differential regulation of protein synthesis by the short upstream open

reading frames, or differences in enzyme kinetics.

















H,K-ATPASES IN A RABBIT KIDNEY CORTICAL COLLECTING TUBULE A-TYPE
INTERCALATED CELL LINE

Introduction


The kidney is a well-organized and complicated organ, with many different cell types

contributing to its morphology and function. Any understanding of the kidney must

include an appreciation of the processes mediated by each cell type. Expression of

H,K-ATPase has been shown to be complex in rabbit kidney, so one issue of interest is the

identification of the cell types possessing the various isoforms of the pump.

Immunohistochemical evidence was presented in the previous chapter indicating that the

collecting duct A-type intercalated cell is one of the primary cell types that expresses

H,K-ATPase catalytic subunit proteins. An independent approach showing that A-type

intercalated cells express these pumps is to detect H,K-ATPase in a well-characterized cell

line of intercalated cell origin. A cell line in which H,K-ATPase was present would also

serve as a model cell system offering the potential for future experiments pertaining to

renal H,K-ATPases.

The rabbit cortical collecting tubule cell line RCCT-28A was selected by

immunodissection (Arend el il., 1989). Cortical collecting duct was dissected under a

microscope and the collagenase-dispersed cells incubated in culture dishes to which the

antibody rct-30 was attached (Spielman ei ul., 1986). The rct-30 antibody binds

specifically to collecting duct cells. The resultant cell line was shown to have

81











characteristics of the cortical collecting duct A-type intercalated cell (Arend el al.,

1989;Schwiebert el al., 1992; Dietl e al., 1989; Bello-Reuss, 1993) The existence of

H,K-ATPase mRNA, protein, and activity in this cell line was studied to demonstrate that

this is a cell type that expresses H,K-ATPase. Here we show by RT-PCR that mRNA for

HKai, HKoa2,, HKac2,, and HK3 are present in RCCT-28A cells. By western analysis it is

shown that protein corresponding to the novel alternatively spliced isoform HKcx2c is

present. Lastly, fluorescence microscopy measurements are used to demonstrate that

RCCT-28A cells have a mechanism for pH, regulation that is K'-dependent and sensitive

to the HK-ATPase inhibitor Sch-28080. Together the data represent very strong evidence

for H,K-ATPase expression in a cell line derived from the type-A intercalated cell in the

collecting duct.


Detection of H,K-ATPase in RCCT-28A Cells


Detection ofH.K-ATPase mRNAs in RCCT-28A cells


To determine the presence of H,K-ATPase transcripts, we examined whether the

RCCT-28A cells possessed mRNA for the known H,K-ATPase 3 or a subunits. In the

initial experiments, there were no H,K-ATPase subunits detectable by northern analysis,

nor were there RT-PCR products amplified from RCCT-28A cells that could be directly

visualized by agarose gel electrophoresis. A more sensitive technique, Southern blotting of

the RT-PCR products using cDNA probes designed to hybridize to the expected products

was employed to demonstrate the presence of H,K-ATPase subunit mRNA in these cells.







83

RT-PCR products were amplified using RCCT-28A cell total RNA as a template. The

presence ofHK3 subunit mRNA was observed as a product of approximately 309 bp

hybridizing to a probe containing nucleotides 304-873 of the rabbit HKO3 sequence

obtained by Reuben el cal. (1990) in gastric tissues (Figure 5-1 A). Sizes were estimated by

measurements from the original agarose gel on which a 100 bp ladder was visualized by

ethidium bromide staining. The "-RT" lanes in this and all subsequent figures depict

negative controls in which RT was omitted from reactions to show that the RNA template

was free of contaminants. Products amplified from mRNA isolated from rabbit renal

cortex tissue were also included in these experiments as a positive control for the RT-PCR

reaction. The hybridization of a probe specific for HKf3 to an RT-PCR product of the

expected size implied the presence of HK3 in these cells.

At the time these experiments were carried out, the existence of alternatively spliced

HKcX2 variants had not yet been discovered Therefore, these experiments were designed

only to show the presence of HKc_2 transcript in general, and do not differentiate between

the HKcx2a and HKcx2c species. For HKca2 mRNA, a primer pair yielded the anticipated

product size of 305 bp. This product was hybridized with a probe of nucleotides

1264-1569 of the HK_;., sequence, contained in the region now known to be common to

HKa2a and HKa2, (Figure 5- 1 B).

A similar strategy was employed to show that HK.Oj was present in the RCCT-28A

cells. Primers were designed to amplify a 611 bp region ofHKca mRNA (nucleotides

2537-3147), and again a product of the expected size was observed to hybridize to a

probe containing the same 611 bp region (Figure 5- IC). At the time these experiments








B)


600 bp -


300 bp -


100 bp -


600 bp -

300 bp -

100 bp -

RT


+ +



0 00
CD >
x


- +


00
oo


D)


600 bp -

300 bp -


100 bp -
RT


800 bp -

400 bp -

200 bp -


- +


Figure 5-1. Southern blots ofH,K-ATPase subunit mRNA in RCCT-28A cells. A)
Products amplified by RT-PCR were shown by Southern blot analysis. PCR primers
were designed to amplify a 309 bp region within the 3' UTR ofH,K-ATPase P subunit.
B) PCR primers designed to amplify a 305 bp region within the coding sequence of
H,K-ATPase a2 subunit produced the products shown. C) PCR primers designed to
amplify a 611 bp region within the 3' UTR of H,K-ATPase ao subunit produced the
products shown. D) Restriction digests of the 611 bp fragment ofH,K-ATPase a,.
Barn HI digestion was predicted to yield fragments of 423 and 187 bp. Pst I digestion
was predicted to yield fragments of 353 and 257 bp.


A)


RT


C)








85

were ongoing, there were no reports in the literature of HKca in kidney, so a further step

was taken to confirm the identity of these products. Restriction digests were carried out

on these products, and the anticipated size fragments were obtained (Figure 5-ID), further

evidence that these products corresponded to HKa, mRNA in RCCT-28A cells.

With further optimization of RT-PCR protocols, including such parameters as

annealing temperatures and number of amplification cycles, it was found that the RT-PCR

technique was capable of generating products visible by ethidium bromide staining of

agarose gels. This was a substantial improvement over the preceding experiments, because

it offered the opportunity to obtain nucleotide sequences of the PCR products to confirm

their identity. RT-PCR products were generated and sequenced using RCCT-28A cell

total RNA as a template. The presence of HKP subunit mRNA was observed by

amplification of a 570 bp cDNA corresponding to nucleotides 304-873 of the sequence

obtained by Reuben el al. (1990) in gastric tissues (Figure 5-2A). Nucleotide sequencing

of the RCCT-28A product confirmed that the amplified product was identical with the

rabbit HK3 subunit mRNA.

HKai was also shown to be present in the RCCT-28A cells by the same technique.

Primers were designed to amplify a 611 bp region of HKci mRNA (nucleotides

2537-3147), and again a product of the expected size was observed (Figure 5-2B). The

nucleotide sequence was identical to that reported by Bamberg et al. (1992) except for

two single base mismatches. One mismatch was a transition of G-,A at nucleotide 2567

and the other a G-*C transversion at nucleotide 3089; neither affected the deduced amino

acid sequence.













A)









B)






S + 1 +



00








Figure 5-2. HK3 and HKa, subunit mRNA in RCCT-28A cells. PCR products were
generated using RCCT-28A cell and rabbit renal cortex total RNA. Amplification was
40 cycles for RCCT-28A cell PCR products and 30 cycles for renal cortex PCR
products. 100 bp ladder is shown for size reference.




Full Text

PAGE 1

&+$5$&7(5,=$7,21 2) 7+( 5$%%,7 5(1$/ +.$73$6(6 E\ : *5$'< &$03%(// $ ',66(57$7,21 35(6(17(' 72 7+( *5$'8$7( 6&+22/ 2) 7+( 81,9(56,7< 2) )/25,'$ ,1 3$57,$/ )8/),//0(17 2) 7+( 5(48,5(0(176 )25 7+( '(*5(( 2) '2&725 2) 3+,/2623+< 81,9(56,7< 2) )/25,'$ c

PAGE 2

7KLV WKHVLV LV GHGLFDWHG WR P\ IDWKHU :LOOLDP 0D[ZHOO &DPSEHOO DQG P\ PRWKHU &ODUD +LFNV &DPSEHOO

PAGE 3

$&.12:/('*0(176 ZRXOG OLNH WR DFNQRZOHGJH WKH FRQWULEXWLRQV RI D QXPEHU RI SHRSOH ZKR KHOSHG PH LQ WKLV ZRUN )LUVW ZRXOG OLNH WR WKDQN P\ FRPPLWWHH WKH FKDLU 'U %ULDQ &DLQ 'U &KDUOHV :LQJR 'U 6XVDQ )URVW 'U +DUU\ 1LFN DQG 'U 0LFKDHO .LOEHUJ $OVR 'U 'DYLG :HLQHU ZDV YHU\ JHQHURXV WR VKDUH KLV ODE DQG PLFURVFRSHV 'U -LOO 9HUODQGHU GLUHFWHG D YHU\ LQWHUHVWLQJ OLQH RI UHVHDUFK WR DQVZHU VRPH TXHVWLRQV WKDW DURVH RXW RI RXU RZQ UHVHDUFK ZRXOG DOVR OLNH WR WKDQN P\ IHOORZ ODE PHPEHUV IRU SXWWLQJ XS ZLWK PH DOO WKLV WLPH 7KDQNV JR WR .LP 0F&RUPLFN 3KLOLS +DUW]RJ $EEH 6WDFN -LP *RUGRQ -DPHV *DUGQHU 3DXO 6RUJHQ 7DPP\ &DYLVWRQ DQG 5HJLQD 3HUU\ -DPHV 3DXO 7DPP\ 5HJLQD DQG VKDUHG PDQ\ \HDUV WRJHWKHU DV D SDUWLFXODUO\ FRKHVLYH ODE IDPLO\ $OVR ZDQW WR WKDQN P\ ODEPDWHV LQ P\ ODE KRPH DZD\ IURP ODE KRPH -HDQHWWH /\QFK $P\ )UDQN DQG 5RELQ 0RXG\ 7KH\ UHDOO\ ZHQW RXW RI WKHLU ZD\ IRU PH DQG LW ZDV D SOHDVXUH ZRUNLQJ ZLWK WKHP 0DU\ +DQGORJWHQ ZDV DOVR HVSHFLDOO\ KHOSIXO LQ JHWWLQJ PH VWDUWHG LQ SURWHLQ ZRUN ZDQW WR DFNQRZOHGJH WKH FRQWULEXWLRQ RI WKH
PAGE 4

, DOVR DSSUHFLDWH WKH VXSSRUW DQG HQFRXUDJHPHQW RI P\ IDPLO\ P\ VLVWHU 'LDQH KHU FKLOGUHQ (PRU\ DQG /LVDFROH P\ EURWKHULQODZ .HQ DQG WKH QHZHVW DGGLWLRQ WR RXU IDPLO\ 6DPPD 7KH FRPSDQLRQVKLS DQG VXSSRUW RI 5XWK KDV KHOSHG PH WKURXJKRXW P\ WLPH KHUH $QG PRVW RI DOO DSSUHFLDWH WKH HQWKXVLDVWLF VXSSRUW RI P\ IDWKHU DQG ODWH PRWKHU GXULQJ P\ \HDUV KHUH ,9

PAGE 5

7$%/( 2) &217(176 $&.12:/('*0(176 LLL /,67 2) 7$%/(6 YLL /,67 2) ),*85(6 YLLL $%%5(9,$7,216 [ $%675$&7 [LLL %$&.*5281' $1' 6,*1,),&$1&( 2YHUYLHZ +.$73DVH LQ WKH .LGQH\ +.$73DVH 6WUXFWXUH DQG )XQFWLRQ 5HQDO 7LVVXH &XOWXUH &HOOV 6XPPDU\ 0$7(5,$/6 $1' 0(7+2'6 0ROHFXODU %LRORJ\ %LRFKHPLVWU\ )OXRUHVFHQFH 0LFURVFRS\ +.$73$6( 68%81,76 ,1 7+( 5$%%,7 5(1$/ 0('8//$5< &2//(&7,1* '8&7 ,QWURGXFWLRQ 5HQDO 0HGXOOD +.3 P51$ 9DULDQW 'LVFXVVLRQ +.$73$6( D 68%81,76 ,1 7+( 5$%%,7 5(1$/ &257,&$/ &2//(&7,1* '8&7 ,QWURGXFWLRQ 0XOWLSOH +.$73DVH D 6XEXQLWV LQ WKH .LGQH\ $OWHUQDWLYH 6SOLFLQJ RI +.$73DVH D 6XEXQLWV LQ WKH .LGQH\ ([SUHVVLRQ RI +.$73DVH D 6XEXQLWV LQ WKH .LGQH\ 'LVFXVVLRQ Y

PAGE 6

+.$73$6( $&7,9,7< ,1 $ 5$%%,7 .,'1(< &257,&$/ &2//(&7,1* '8&7 &(// /,1( ,QWURGXFWLRQ 'HWHFWLRQ RI +.$73DVH LQ 5&&7$ &HOOV 'LVFXVVLRQ 3(563(&7,9( $1' )8785( ',5(&7,216 0XOWLSOLFLW\ RI +.$73DVH ,VRIRUPV LQ WKH .LGQH\ &HOO 7\SH 6SHFLILFLW\ RI +.$73DVH LQ WKH .LGQH\ )XWXUH VWXGLHV 5()(5(1&(6 %,2*5$3+,&$/ 6.(7&+ YL

PAGE 7

/,67 2) 7$%/(6 7DEOH SDJH 3&5 SULPHU SDLUV 6ROXWLRQV IRU GHWHUPLQDWLRQ RI S+L YLL

PAGE 8

/,67 2) ),*85(6 )LJXUH SDJH 6FKHPDWLF GLDJUDP RI +.$73DVH 1RUWKHUQ DQDO\VLV VKRZLQJ SUHVHQFH RI +. P51$ LQ UHQDO FRUWH[ UHQDO PHGXOOD DQG VWRPDFK f DQG f 5$&( UHDFWLRQV WR DPSOLI\ +. F'1$V XVLQJ UDEELW UHQDO PHGXOOD DV WHPSODWH +.3 DQG Sf VXEXQLW P51$V 'HVLJQ RI GHJHQHUDWH SULPHUV IRU 573&5 RI QRYHO 3W\SH $73DVHV 573&5 SURGXFW DPSOLILHG IURP UDEELW UHQDO FRUWH[ 51$ XVLQJ GHJHQHUDWH SULPHUV %/$67 VHDUFK XVLQJ VHTXHQFH RI ES IUDJPHQW RI +.RF &ORQLQJ RI +.DD DQG +.DF F'1 $V *HQ%DQN DFFHVVLRQ UHFRUGV IRU UDEELW +.D VHTXHQFHV 1RUWKHUQ DQDO\VLV VKRZLQJ SUHVHQFH RI +.RFD LQ GLVWDO FRORQ DQG UHQDO FRUWH[ 'LVWDQFH DQDO\VLV RI VHOHFWHG +.D DQG 1D.D VXEXQLW FRGLQJ 5DEELW +.D JHQH VHTXHQFH DW WKH fHQG :HVWHUQ DQDO\VLV VKRZLQJ SUHVHQFH RI +.DD DQG +.DF SURWHLQ LQ UHQDO FRUWH[ ,PPXQRKLVWRFKHPLVWU\ E\ 'U -LOO 9HUODQGHU DQG 0V 5RELQ 0RXG\ 6RXWKHUQ EORWV RI +.$73DVH VXEXQLW P51$ LQ 5&&7$ FHOOV

PAGE 9

+. DQG +.DL VXEXQLW P51$ LQ 5&&7$ FHOOV +.D VXEXQLW P51$ LQ 5&&7$ FHOOV :HVWHUQ DQDO\VLV VKRZLQJ SUHVHQFH RI +.DF SURWHLQ LQ 5&&7 $ FHOOV S+ UHFRYHU\ IURP DQ DFLG ORDG E\ 5&&7$ FHOOV LQ WKH DEVHQFH RI1D S+ UHFRYHU\ IURP DQ DFLG ORDG E\ 5&&7 $ FHOOV LQ WKH SUHVHQFH RI (,3$ 6XPPDU\ RI WKH UDWHV RI S+ UHFRYHU\ IURP DQ DFLG ORDG E\ 5&&7 $ FHOOV ,;

PAGE 10

$%%5(9,$7,216 $73 DGHQRVLQH WULSKRVSKDWH %&(&) nnELVFDUER[\HWK\Off FDUER[\IOXRUHVFHLQ %&(&)$0 DFHWR[\PHWK\O HVWHU RI %&(&) ES EDVH SDLUV '(3& GLHWK\OS\URFDUERQDWH '1$ GHR[\ULERQXFOHLF DFLG ('7$ HWK\OHQH GLDPLQH WHWUDDFHWLF DFLG (,3$ HWK\OLVRSURS\ODPLORULGH )%6 IHWDO ERYLQH VHUXP ),7& IOXRURLVRWKLRF\DQDWH +(3(6 1 K\GUR[\HWK\OSLSHUD]LQH1fHWKDQHVXOIRQLF DFLG +.D +.$73DVH D FDWDO\WLFf VXEXQLW +.D +.$73DVH DL VXEXQLW +.DD +.$73DVH DD VXEXQLW +.DE +.$73DVH DE VXEXQLW +.DF +.$73DVH DF VXEXQLW +.D +.$73DVH D VXEXQLW

PAGE 11

+.R +.$73DVH D VXEXQLW +.S +.$73DVH 3 VXEXQLW +.Sf +.$73DVH 3f VXEXQLW KU KRXU NE WKRXVDQG EDVH SDLUV N'D WKRXVDQG 'DOWRQV 0 PRODU P(T PLOOLHTXLYDOHQWV PLQ PLQXWH 0: PROHFXODU ZHLJKW 1D.D 1D.$73DVH D FDWDO\WLFf VXEXQLW 1D.D 1D.$73DVH DL VXEXQLW 1D.D 1D.$73DVH D VXEXQLW 1D.D 1D.$73DVH D VXEXQLW 1D.RX 1D.$73DVH D VXEXQLW 1D.S 1D.$73DVH 3L VXEXQLW 3$*( SRO\DFU\ODPLGH JHO HOHFWURSKRUHVLV 3&5 SRO\PHUDVH FKDLQ UHDFWLRQ S+ LQWUDFHOOXODU S+ 306) SKHQ\OPHWK\OVXOIRQ\O IOXRULGH S6 SLFR6LHPHQ 5$&( 5DSLG $PSOLILFDWLRQ RI F'1$ (QGV ;,

PAGE 12

51$ ULERQXFOHLF DFLG 57 UHYHUVH WUDQVFULSWLRQ 573&5 UHYHUVH WUDQVFULSWDVHSRO\PHUDVH FKDLQ UHDFWLRQ 6'6 VRGLXP GRGHF\O VXOIDWH VHF VHFRQG 7ULV WULV>K\GUR[\PHWK\O@DPLQRPHWKDQH 875 XQWUDQVODWHG UHJLRQ [LL

PAGE 13

$EVWUDFW RI 'LVVHUWDWLRQ 3UHVHQWHG WR WKH *UDGXDWH 6FKRRO RI WKH 8QLYHUVLW\ RI )ORULGD LQ 3DUWLDO )XOILOOPHQW RI WKH 5HTXLUHPHQWV IRU WKH 'HJUHH RI 'RFWRU RI 3KLORVRSK\ &+$5$&7(5,=$7,21 2) 7+( 5$%%,7 5(1$/ +.$73$6(6 %\ : *UDG\ &DPSEHOO $XJXVW &KDLUSHUVRQ 'U %ULDQ &DLQ 0DMRU 'HSDUWPHQW %LRFKHPLVWU\ DQG 0ROHFXODU %LRORJ\ +.$73DVHV DUH ORFDWHG RQ WKH DSLFDO PHPEUDQH RI HSLWKHOLDO FHOOV OLQLQJ WKH FROOHFWLQJ GXFW LQ WKH NLGQH\ $73 K\GURO\VLV GULYHV OXPLQDO DFLGLILFDWLRQ DQG SRWDVVLXP UHDEVRUSWLRQ E\ WKH HQ]\PH +.$73DVHV FRQVLVW RI WZR VXEXQLWV 7KH FDWDO\WLF VLWHV DUH ORFDWHG RQ WKH D VXEXQLWV DQG WKH 3 VXEXQLWV SOD\ D UROH LQ LQWUDFHOOXODU WUDIILFNLQJ 7KH JRDO RI WKLV ZRUN ZDV WR HOXFLGDWH WKH PROHFXODU LGHQWLW\ RI +.$73DVH D DQG 3 VXEXQLWV LQ NLGQH\ 1RUWKHUQ DQDO\VLV GHPRQVWUDWHG WZR +.$73DVH 3 VXEXQLW VSHFLHV LQ UDEELW UHQDO PHGXOOD RQO\ WKH VPDOOHU RI WKHVH ZDV SUHVHQW LQ UHQDO FRUWH[ DQG JDVWULF WLVVXHV $ VHDUFK IRU +.$73DVH D VXEXQLW LVRIRUPV LQ UDEELW UHQDO FRUWH[ ZDV FRQGXFWHG XVLQJ UHYHUVH WUDQVFULSWDVHSRO\PHUDVH FKDLQ UHDFWLRQ ZLWK GHJHQHUDWH SULPHUV $ IXOOOHQJWK F'1$ RI WKH +.$73DVH RW VXEXQLW ZDV REWDLQHG 7ZR f HQGV RI WKLV WUDQVFULSW ZHUH REVHUYHG E\ f 5DSLG $PSOLILFDWLRQ RI F'1$ (QGV 2QH +.FWDf KDG KLJK KRPRORJ\ WR [LLL

PAGE 14

SUHYLRXVO\ NQRZQ +.$73DVHV DQG WKH VHFRQG ZDV D QRYHO YDULDQW DFf 3K\ORJHQHWLF DQDO\VLV VKRZHG WKDW WKH UDEELW DD VXEXQLW FOXVWHUV QHDU +.$73DVHV IURP KXPDQ D[LOODU\ VNLQ DQG UDW GLVWDO FRORQ EXW LV PRUH GLVWDQW IURP JDVWULF +.$73DVH DQG 1D.$73DVHV *HQH VHTXHQFH DQDO\VLV VKRZHG WKDW WKH ILUVW +.DF H[RQ ZDV ORFDWHG ZLWKLQ WKH ILUVW +.DD LQWURQ :HVWHUQ DQDO\VLV XVLQJ DQWLSHSWLGH SRO\FORQDO DQWLERGLHV GHPRQVWUDWHG WKH H[SUHVVLRQ RI +.RWL +.DD DQG +.DF VXEXQLWV LQ UDEELW UHQDO FRUWH[ 7KH P51$V HQFRGLQJ WKH +.S +.D +.DD DQG +.DF VXEXQLWV ZHUH GHWHFWHG LQ WKH UDEELW FRUWLFDO FROOHFWLQJ WXEXOH LQWHUFDODWHG FHOO OLQH 5&&7$ 7KHVH UHVXOWV LQGLFDWHG WKDW DFLGVHFUHWLQJ LQWHUFDODWHG FROOHFWLQJ GXFW FHOOV ZHUH D FHOO W\SH FRQWDLQLQJ +.$73DVH DQG WKHVH FHOOV DSSHDU FDSDEOH RI H[SUHVVLQJ PXOWLSOH +.$73DVH LVRIRUPV [LY

PAGE 15

%$&.*5281' $1' 6,*1,),&$1&( 2YHUYLHZ +.$73DVH ZDV ILUVW LGHQWLILHG LQ WKH VWRPDFK ZKHUH LW LV H[SUHVVHG DW DQ H[WUHPHO\ KLJK OHYHO WR PHGLDWH WKH H[WUXVLRQ RI DFLG WKDW DLGV GLJHVWLRQ $ JUHDW GHDO KDV EHHQ OHDUQHG DERXW UHJXODWLRQ RI +.$73DVH LQ WKH VWRPDFK HQRXJK WR IHHO DV WKRXJK LWV UHJXODWLRQ LV XQGHUVWRRG LQ D PHDQLQJIXO ZD\ $W WKH PROHFXODU OHYHO JDVWULFVSHFLILF WUDQVFULSWLRQ IDFWRUV KDYH EHHQ IRXQG WKDW PD\ EH UHVSRQVLEOH IRU WKH PDUNHG WLVVXHVSHFLILF UHJXODWLRQ RI H[SUHVVLRQ RI +.$73DVH 0DHGD HW DO 2VKLPDQ HW DO 7DPXUD HW DO f 7KH SULQFLSDO PHDQV RI LQGXFWLRQ RI JDVWULF +.$73DVH IURP LWV EDVDO VWDWH LV E\ XQZLQGLQJ D WLJKWO\ FRLOHG WXEXODU QHWZRUN H[SRVLQJ SXPSV ORFDOL]HG LQ WKH QHWZRUN DQG WKHUHE\ LQFUHDVLQJ WKH VL]H RI WKH VHFUHWRU\ VXUIDFH 3HWWLW HW DO f 7KLV PRUSKRORJLFDO WUDQVIRUPDWLRQ LV WULJJHUHG E\ YDULRXV VWLPXOL LQFOXGLQJ DFWLYDWLRQ RI VWUHWFK UHFHSWRUV LQ WKH VWRPDFK E\ HQWHULQJ IRRG WKH VLJKW RI IRRG RU HYHQ WKH WKRXJKW RI IRRG UHYLHZHG E\ :ROIH DQG 6ROL +HUVH\ DQG 6DFKV f 7KXV WKHUH LV D IUDPHZRUN RI XQGHUVWDQGLQJ RI WKH UHJXODWLRQ RI +.$73DVH LQ WKH VWRPDFK DW WKH PROHFXODU DQG FHOOXODU OHYHOV DQG WKH URRW VWLPXOL WKDW UHVXOW LQ WKH +.$73DVH UHVSRQVH DUH NQRZQ +.$73DVH LV H[SUHVVHG DW PXFK ORZHU OHYHO LQ WKH NLGQH\ EXW LWV UROH LQ WKH NLGQH\ LV HYHQ PRUH FULWLFDO WR OLIH WKDQ LWV UROH LQ WKH VWRPDFK 7KH NLGQH\ SOD\V WKH PDMRU UROH LQ

PAGE 16

. KRPHRVWDVLV PDLQWDLQLQJ H[WUDFHOOXODU LQFOXGLQJ SODVPDf FRQFHQWUDWLRQ ZLWKLQ WKH UHODWLYHO\ QDUURZ QRUPDO UDQJH RI WR P(T/ 0HUFN *X\WRQ DQG +DOO f GHVSLWH D ZLGH YDULDWLRQ LQ LQWDNH ,I SODVPD OHYHOV GHSDUW VLJQLILFDQWO\ IURP WKHVH YDOXHV WKHQ FDUGLDF DUUK\WKPLDV OHDG WR OLIHWKUHDWHQLQJ FRQGLWLRQV WUDQVSRUW LQ WKH NLGQH\ LV DOVR LPSRUWDQW WR EORRG SUHVVXUH UHJXODWLRQ ,W KDV EHHQ REVHUYHG WKDW XULQDU\ .n OHYHOV DQG XULQDU\ 1D. UDWLR DUH UHODWHG WR V\VWROLF DQG GLDVWROLF EORRG SUHVVXUHV ,17(56$/7 :KHOWRQ f ([FUHWLRQ UDWHV VKRZ D KLJKHU GHJUHH RI FRUUHODWLRQ ZLWK HOHYDWHG EORRG SUHVVXUH WKDQ VHUXP OHYHOV LPSOLFDWLQJ WKH NLGQH\ DV DQ LPSRUWDQW RUJDQ LQ UHJXODWLQJ WKH HIIHFW RI .r RQ EORRG SUHVVXUH 'LHWDU\ VXSSOHPHQWDWLRQ KDV EHHQ VKRZQ WR ORZHU EORRG SUHVVXUH VLQFH HDUO\ WKLV FHQWXU\ $PEDUG DQG %HDXMDUG $GGLVRQ f 7KH VXEVWDQWLDO UROH RI UHQDO LRQ WUDQVSRUW LQ EORRG SUHVVXUH UHJXODWLRQ LV HPSKDVL]HG E\ VWXGLHV FRQGXFWHG E\ /LIWRQ f ZKR GHWHUPLQHG WKH PROHFXODU EDVHV XQGHUO\LQJ FHUWDLQ W\SHV RI PRQRJHQLF LQKHULWHG H[WUHPH K\SR DQG K\SHUWHQVLRQ GLVRUGHUV (DFK RI WKH JHQHWLF GHIHFWV IRXQG DIIHFWHG UHQDO LRQ WUDQVSRUW 6XFK ZHOOGHILQHG LQKHULWHG GLVHDVHV RI EORRG SUHVVXUH UHJXODWLRQ DUH QRW FRPPRQ ,Q b RI SHRSOH H[SHULHQFLQJ K\SHUWHQVLRQ WKHLU GLDJQRVLV LV HVVHQWLDO K\SHUWHQVLRQ WKH URRW FDXVH EHLQJ HVVHQWLDOO\ XQNQRZQ 7R XQGHUVWDQG WKLV PDMRULW\ RI K\SHUWHQVLYH GLVRUGHUV D PRUH FRPSOHWH XQGHUVWDQGLQJ RI UHQDO LRQ WUDQVSRUW LV QHHGHG %HFDXVH RI WKH UROH RI +.$73DVH LQ WKH ILQDO UHJXODWLRQ RI H[FUHWLRQ LQ WKH NLGQH\ XQGHUVWDQGLQJ LWV FRQWULEXWLRQ WR UHQDO LRQ WUDQVSRUW FRXOG ZHOO EH LPSRUWDQW LQ XQGHUVWDQGLQJ WKH SUREOHP RI HVVHQWLDO K\SHUWHQVLRQ ,Q RUGHU WR XQGHUVWDQG WKH UROH RI +.$73DVH LQ WKH NLGQH\ WKH H[DFW +.$73DVH SXPSV RI WKH NLGQH\ PXVW EH FKDUDFWHUL]HG DW D PROHFXODU OHYHO 7KLV FKDUDFWHUL]DWLRQ PXVW

PAGE 17

EH FDUULHG RXW WR D KLJK OHYHO RI GHWDLO WR H[SORUH YDULDWLRQV LQ WKH LRQ SXPSV FRQIHUUHG E\ GLIIHUHQFHV LQ FKDQJHV LQ WUDQVFULSWLRQDO VWDUW RU DGHQ\ODWLRQ VLWHV RU E\ DOWHUQDWLYH VSOLFLQJ :LWK WKH LGHQWLW\ RI WKH +.$73DVH VXEXQLWV NQRZQ DW D PROHFXODU OHYHO YDULRXV UHDJHQWV FDQ WKHQ EH GHYHORSHG WR FKDUDFWHUL]H +.$73DVH UHJXODWLRQ 7KHVH LQFOXGH F'1$ SUREHV DQWLERGLHV DQG DFWLYLW\ DVVD\V :LWK WKHVH WRROV DYDLODEOH LW ZLOO EH SRVVLEOH WR GHYHORS D PRUH FRPSOHWH IUDPHZRUN RI XQGHUVWDQGLQJ RI UHQDO +.$73DVH 7KH VWXGLHV LQ WKLV GLVVHUWDWLRQ FRQWULEXWH WR RXU NQRZOHGJH RI WKH +.$73DVH VXEXQLWV DW D PROHFXODU OHYHO $W WKH WLPH WKHVH VWXGLHV EHJDQ LW ZDV QRW NQRZQ ZKDW +.$73DVH VXEXQLWV ZHUH UHVSRQVLEOH IRU WKH DFWLYH +r DQG H[FKDQJH WKDW KDG EHHQ REVHUYHG LQ UHQDO FROOHFWLQJ GXFW )XUWKHU HYLGHQFH LV SUHVHQWHG WKDW DOO WKH FXUUHQWO\ NQRZQ +.$73DVH VXEXQLWV DUH SUHVHQW LQ NLGQH\ DQG WKDW WKH SULPDU\ FHOO W\SH LQ ZKLFK DOO DUH H[SUHVVHG LV WKH FROOHFWLQJ GXFW DFLGVHFUHWLQJ LQWHUFDODWHG FHOO :KHQ WKHVH VWXGLHV ZHUH EHJXQ WKHUH ZDV QR NQRZQ DOWHUQDWLYH VSOLFLQJ RI 3W\SH $73DVHV +HUH DOWHUQDWLYH VSOLFLQJ RI DQ +.D VXEXQLW P51$ LV GHVFULEHG DQG H[SUHVVLRQ RI D SURWHLQ SURGXFW LV VKRZQ LQ NLGQH\ ,Q DGGLWLRQ D YDULDQW UHQDO PHGXOOD +.3 WUDQVFULSW LV GHVFULEHG WKDW KDV WLVVXHVSHFLILF H[SUHVVLRQ HYHQ ZLWKLQ WKH NLGQH\ ,Q VXPPDU\ WKLV ZRUN KDV JHQHUDWHG D QHZ DSSUHFLDWLRQ IRU WKH FRPSOH[LW\ RI +.$73DVH PROHFXOHV WKDW XQGHUOLH UHQDO FROOHFWLQJ GXFW +.$73DVH DFWLYLW\

PAGE 18

+.$73DVH LQ WKH .LGQH\ 7UDQVSRUW DFWLYLW\ 7KH NLGQH\ LV WKH SULQFLSDO RUJDQ UHVSRQVLEOH IRU SRWDVVLXP KRPHRVWDVLV DQG SOD\V D PDMRU UROH LQ PDLQWHQDQFH RI WKH DFLGEDVH EDODQFH RI WKH ERG\ 7KH UHQDO FROOHFWLQJ GXFW &'f LV WKH SULPDU\ VLWH RI UHJXODWLRQ RI WKH H[FUHWLRQ RI SRWDVVLXP DQG WKH DFLGLILFDWLRQ RI XULQH $ QXPEHU RI VWXGLHV LPSOLFDWH DQ DSLFDO +.$73DVH DV DQ LPSRUWDQW PHGLDWRU RI WKHVH IXQFWLRQV 7KH HQ]\PH SXPSf DFWLYHO\ WUDQVSRUWV ,7 LQWR WKH OXPHQ RI WKH QHSKURQ LQ D QRQHOHFWURJHQLF H[FKDQJH IRU IRU UHYLHZ VHH :LQJR DQG &DLQ :LQJR DQG 6PROND f $ DFWLYDWHG $73DVH ZDV REVHUYHG LQ IURJ JDVWULF PLFURVRPHV E\ *DQVHU DQG )RUWH f /HH HW DO f IRXQG WKDW JDVWULF PLFURVRPHV LVRODWHG IURP GRJ PXFRVD ZHUH DEOH WR DFFXPXODWH + LQ WKH SUHVHQFH RI $73 DQG 7KHVH VWXGLHV ZHUH WKH LQLWLDO REVHUYDWLRQV RI WKH QRZ ZHOONQRZQ JDVWULF +.$73DVH 7KH GHVLJQDWLRQ RI +.$73DVH ZDV JLYHQ WKH HQ]\PH E\ 6DFKV HO DO f *XVWLQ DQG *RRGPDQ f LVRODWHG DSLFDO EUXVKERUGHU PHPEUDQH RI WKH UDEELW GHVFHQGLQJ FRORQ E\ LVRODWLRQ RI HSLWKHOLDO FHOOV KRPRJHQL]DWLRQ DQG FHQWULIXJDWLRQ RQ D 3HUFROO JUDGLHQW 7KH\ IRXQG D PHPEUDQHERXQG 5HDFWLYDWHG $73DVH ZKLFK KDG D .DFA[O2A0 IRU .n ZDV FRPSHWLWLYHO\ LQKLELWHG E\ 1D EXW KDG QR DFWLYDWLRQ E\ 1D ,W ZDV YDQDGDWH VHQVLWLYH EXW ROLJRP\FLQ DQG RXDEDLQ ,P0f LQVHQVLWLYH 7KLV UHSUHVHQWHG WKH ILUVW REVHUYDWLRQV RI HQ]\PDWLF DFWLYLW\ IRU WKH FRORQLF +.$73DVH 6PROND DQG 6DFKV LQ 6DFKV HW DO f HPSOR\LQJ PRQRFORQDO DQWLERGLHV GHWHFWHG D SURWHLQ DW OHDVW VLPLODU WR WKH JDVWULF SURWRQSRWDVVLXPWUDQVORFDWLQJ $73DVH SURWHLQ LQ

PAGE 19

UHQDO GLVWDO WXEXOH DQG FRORQ 6DFKV HW DO f DGYDQFHG WKH LGHD WKDW WKLV SURWHLQ PLJKW EH LQYROYHG LQ WKH UHDEVRUSWLRQ RU WKH DFLGLILFDWLRQ NQRZQ WR WDNH SODFH LQ NLGQH\ RU FRORQ %\ TXDQWLWDWLQJ WKH K\GURO\VLV RI >\3@$73 'RXFHW DQG 0DUV\ f REVHUYHG D .VWLPXODWHG $73DVH DFWLYLW\ LQ UDEELW NLGQH\ 7KH OHYHO RI DFWLYLW\ ZDV UHODWHG WR WKH GHQVLW\ RI LQWHUFDODWHG FHOOV LQ PLFURGLVVHFWHG VHJPHQWV RI UDEELW FRQQHFWLQJ VHJPHQW KLJKHVW DFWLYLW\f FRUWLFDO FROOHFWLQJ GXFW LQWHUPHGLDWHf DQG RXWHU PHGXOODU\ FROOHFWLQJ GXFW ORZHVWf DQG QRW GHWHFWDEOH LQ DQ\ RWKHU QHSKURQ VHJPHQWV 7KH $73DVH DIILQLW\ IRU ZDV KLJK .P P0f 7KH SKDUPDFRORJLFDO SURSHUWLHV RI WKH UHQDO +.$73DVH ZDV H[DPLQHG DV D SUHOLPLQDU\ LQGLFDWLRQ RI WKH SXPSV SUHVHQW LQ WKH NLGQH\ 2PHSUD]ROH LV DQ LQKLELWRU RI WKH JDVWULF LVRIRUP RI +.$73DVH YDQDGDWH LQKLELWV DOO 3W\SH $73DVHV DQG RXDEDLQ LV D 1D.$73DVH LQKLELWRU WKDW DOVR LQKLELWV QRQJDVWULF +.$73DVH LVRIRUPV 7KH UHQDO $73DVH ZDV LQKLELWHG E\ RPHSUD]ROH DQG YDQDGDWH EXW QRW E\ RXDEDLQ 7KH\ DOVR REVHUYHG D .$73DVH DFWLYLW\ ZLWK SRWDVVLXP UHVWULFWLRQ LQ UDW UHQDO RXWHU PHGXOODU\ FROOHFWLQJ GXFW WKDW URXJKO\ GRXEOHG FKDQJLQJ OLWWOH DIWHU ZHHNV ORZ.I GLHW ,Q FRUWLFDO FROOHFWLQJ GXFW DFWLYLW\ GRXEOHG ULVLQJ VWHDGLO\ GXULQJ D ILYH ZHHN ORZ. GLHW 'RXFHW DQG 0DUV\ f :LQJR f GLG D PRUH FRPSOHWH VWXG\ RI GLHWDU\ .n LQIOXHQFH RQ WUDQVSRUW LQ WKH NLGQH\ +H ILUVW HVWDEOLVKHG WKDW UDEELWV RQ D .IUHSOHWH GLHW RU RQ D .IGHSOHWHG GLHW RU RQ D .IGHSOHWH 1DVXSSOHPHQWHG GLHW DOO FRQVXPHG VLPLODU TXDQWLWLHV :LQJR f XVHG UHVWULFWHG GLHWV FRQWDLQLQJ b PDUJLQDOO\ OHVV WKDQ WKH b JHQHUDOO\ WKRXJKW WR EH UHTXLUHG IRU QRUPDO UDEELW JURZWK ,Q WLPHFRXUVH VWXGLHV KH IRXQG WKDW DIWHU DQ LQLWLDO WZRZHHN SHULRG RI .UHSOHWH PHDOV KU ZDV VXIILFLHQW IRU WKH UHVSRQVH WR

PAGE 20

HTXLOLEUDWH DV MXGJHG E\ XULQDU\ 1DI DQG .n H[FUHWLRQ 0XVFXODU OHYHOV KDG QRW DOWHUHG VLJQLILFDQWO\ LQ WKDW WLPH VKRZLQJ WKDW UHQDO UHVSRQVH SUHFHGHG HIIHFWV GHOHWHULRXV WR WKH DQLPDO 6HUXP OHYHOV ZHUH VOLJKWO\ KLJKHU LQ UHSOHWH DQLPDOV DQG WKH VDPH LQ .GHSOHWHG 1D7VXSSOHPHQWHG DQLPDOV FRPSDUHG WR .fGHSOHWHG DQLPDOV 7KH VRGLXP VXSSOHPHQWDWLRQ HYLGHQWO\ PDLQWDLQHG WKH VHUXP OHYHO 6HUXP DOGRVWHURQH ZDV IRXQG WR EH s QJGO LQ .GHSOHWHG 1DVXSSOHPHQWHG UDEELWV s IRU .GHSOHWHG UDEELWV DQG IRU SRWDVVLXPUHSOHWH DQLPDOV DQG WKXV DQ\ FKDQJHV LQ WUDQVSRUW REVHUYHG FDQQRW EH FRUUHODWHG ZLWK DOGRVWHURQH OHYHO ,Q KLV H[SHULPHQWV :LQJR f IRXQG WKDW SHUIXVHG FROOHFWLQJ GXFWV IURP RXWHU PHGXOODU\ LQQHU VWULSH KDG VLPLODU UDWHV RI IOXLG UHDEVRUSWLRQ JDXJHG E\ +LQXOLQ IOX[ DQG VLPLODU WUDQVHSLWKHOLDO YROWDJHV UHDEVRUSWLRQ KRZHYHU URXJKO\ WULSOHG DPRQJ UDEELWV RQ .UHVWULFWHG GLHWV PHDVXUHG DV D IOX[ RI .IUHSOHWH UDEELWV KDG sb.GHSOHWHG UDEELWV KDG sb DQG .nGHSOHWHG 1DrVXSSOHPHQWHG UDEELWV KDG sb UHDEVRUSWLRQ 7KH GDWD ZHUH QRW VLJQLILFDQWO\ GLIIHUHQW LQ HLWKHU RI WKH WZR .UHVWULFWHG FDVHV +H FRQFOXGHG WKDW .f UHDEVRUSWLRQ LQ WKH PHGXOODU\ FROOHFWLQJ WXEXOH LV FRPSDUDEOH WR VHFUHWLRQ LQ WKH FRUWLFDO VHJPHQWV DW QRUPDO IOXLG IOX[ UDWHV DQG FRXOG KDYH LPSRUWDQW FRQWULEXWLRQV WR WKH DPRXQW RI .r H[FUHWHG LQ XULQH ,Q D ODWHU UHSRUW E\ :LQJR f WKH QDPH +.$73DVH ZDV ILUVW H[SOLFLWO\ JLYHQ WR WKH .VWLPXODWHG $73DVH WKDW KDG EHHQ VWXGLHG E\ RWKHUV LQ WKH NLGQH\ 8WLOL]LQJ D IOXRURPHWULF PLFURDVVD\ LQ ZKLFK $73 K\GURO\VLV LV FRXSOHG WR WKH R[LGDWLRQ RI1$'+ *DUJ DQG 1DUDQJ f GHWHFWHG WKH SUHVHQFH RI D .GHSHQGHQW RXDEDLQLQVHQVLWLYH $73DVH DFWLYLW\ LQ UDEELW NLGQH\ WKDW ZDV DOVR RPHSUD]ROH 6&+ DQG YDQDGDWHVHQVLWLYH 6FK OLNH RPHSUD]ROH LV D SRWHQW JDVWULF

PAGE 21

+.$73DVH LQKLELWRU (DUOLHU ZRUN E\ WKLV JURXS *DUJ DQG 1DUDQJ f QRWHG + VHFUHWLRQ FRXSOHG WR DQ $73DVH WKDW ZDV QRW 1(0LQKLELWHG DQG FRXOG QRW DFFRXQW IRU WKH YDFXRODU 37$73DVH WKH\ ZHUH VWXG\LQJ 6LJQLILFDQW 3& $73DVH DFWLYLW\ ZDV VHHQ LQ PLFURGLVVHFWHG FRQQHFWLQJ VHJPHQW s SLQRO PLQ PPnf FRUWLFDO FROOHFWLQJ GXFW sf DQG RXWHU PHGXOODU\ FROOHFWLQJ GXFW sf EXW QRW LQ SUR[LPDO VWUDLJKW WXEXOH FRQYROXWHG WXEXOHV QRU WKH WKLFN DVFHQGLQJ OLPEV 7KH\ IRXQG WKH .$73DVH DFWLYLW\ WR EH DIIHFWHG E\ GLHW $FWLYLW\ ZDV IRXQG LQ WKH FRQQHFWLQJ VHJPHQW s SPRO PLQn PPf FRUWLFDO FROOHFWLQJ GXFW sf DQG RXWHU PHGXOODU\ FROOHFWLQJ GXFW sf LQ DQLPDOV RQ D ORZ .f GLHW &RUWLFDO FROOHFWLQJ GXFW DFWLYLW\ YDULHG ZLWK S+ RSWLPDO S+ RI JDYH DFWLYLW\ RI SPRO PLQn PPn IDOOLQJ DW ORZHU S+ WR DW S+ RI DQG IDOOLQJ DW KLJKHU S+ WR DW S+ 7KXV D KLJK .r GLHW FRPSOHWHO\ VXSSUHVVHG WKH .$73DVH DFWLYLW\ ZKLOH UDEELWV IHG D QRUPDO GLHW KDG VLPLODU DFWLYLW\ WR WKH ORZ IHG UDEELWV RI WKH VHFRQG VWXG\ 6WXGLHV E\ &KHYDO DQG FRZRUNHUV &KHYDO HW DO f H[DPLQHG WKH WL5E IOX[ 5E LV D DQDORJ XVHG DV D UDGLRDFWLYH WUDFHU IRU WUDQVSRUWHU VWXGLHVf DQG .$73DVH DFWLYLWLHV 7KHVH DFWLYLWLHV ZHUH EORFNHG E\ 6FK LQ FRUWLFDO DQG PHGXOODU\ FROOHFWLQJ GXFW $FWLYLWLHV WKH\ DWWULEXWHG WR 1D.$73DVH DQG +$73DVH ZHUH XQDIIHFWHG E\ 6FK ,Q WKLV VWXG\ RXDEDLQ ZDV XVHG DW D FRQFHQWUDWLRQ RI QL0 WR LQKLELW 1D.$73DVH $OWKRXJK WKHUH DUH LQFRQVLVWHQFLHV LQ WKH H[DFW FRQFHQWUDWLRQ DW ZKLFK RXDEDLQ LQKLELWV +.$73DVHV FRQWDLQLQJ WKH +.D VXEXQLW DOO H[SUHVVLRQ VWXGLHV FDUULHG RXW WR GDWH 0RG\DQRY HW DO &RGLQD HW DO &RXJQRQ HW DO *ULVKLQ HW DO f H[FHSW IRU RQH /HH HW DO f LQGLFDWH WKDW P0 RXDEDLQ LV VXIILFLHQW WR EORFN WKH +. HQ]\PH /HH HW DO f GHWHFWHG QR RXDEDLQ VHQVLWLYLW\ DW P0 DQG LW LV QRW

PAGE 22

NQRZQ ZKDW HIIHFW P0 ZRXOG KDYH KDG LQ WKHLU V\VWHP ,Q WKLV ZRUN E\ &KHYDO HW DO f WKH DFWLYLWLHV RI 1D.$73DVH DQG DQ +.U +.$73DVH ZRXOG EH LQGLVWLQJXLVKDEOH 7KHVH HDUO\ VWXGLHV GR QRW GLVWLQJXLVK EHWZHHQ GLIIHUHQW LVRIRUPV RI +.$73DVH WKDW PD\ WRJHWKHU DFFRXQW IRU WKH +.$73DVH DFWLYLW\ REVHUYHG LQ WKH NLGQH\ *LYHQ KLVWRULFDO SHUVSHFWLYH WKLV PDNHV VHQVH EHFDXVH DW WKH WLPH WKHVH VWXGLHV ZHUH FRQGXFWHG RQO\ +.RWL DQG +. VXEXQLW LVRIRUPV ZHUH NQRZQ DQG WKH RXDEDLQVHQVLWLYH +.$73DVH ZDV QRW \HW NQRZQ /DWHU VWXGLHV
PAGE 23

DQG ZDV 6FKVHQVLWLYH DQG RXDEDLQLQVHQVLWLYH OLNH WKH +.DL LVRIRUP RI +.$73DVH 7KH VHFRQG ZDV SUHVXPDEO\ ORFDWHG EDVRODWHUDOO\ LQ SUR[LPDO WXEXOH DQG WKLFN DVFHQGLQJ OLPE UHGXFHG E\ ORZ .? DQG ZDV RXDEDLQVHQVLWLYH 7KH WKLUG ZDV ORFDWHG DSLFDOO\ LQ WKH FROOHFWLQJ GXFW VWLPXODWHG E\ ORZ .f DQG 6FKLQVHQVLWLYH EXW RXDEDLQVHQVLWLYH (DUOLHU VWXGLHV QDWXUDOO\ FRQFHQWUDWHG RQ HVWDEOLVKLQJ WKH H[LVWHQFH RI +.$73DVH LQ WKH NLGQH\ 7KH HDUO\ VWXGLHV GHPRQVWUDWHG +.$73DVH DFWLYLW\ LQ FRQQHFWLQJ VHJPHQW FRUWLFDO FROOHFWLQJ GXFW DQG RXWHU PHGXOODU\ FROOHFWLQJ GXFW $OWKRXJK PHDVXUHPHQWV ZHUH PDGH IRU +.$73DVH DFWLYLW\ LQ RWKHU QHSKURQ VHJPHQWV QR +.$73DVH DFWLYLW\ ZDV IRXQG RXWVLGH WKH FRQQHFWLQJ VHJPHQW DQG FROOHFWLQJ GXFW 0RUH UHFHQWO\ SUR[LPDO WXEXOH DQG WKLFN DVFHQGLQJ OLPE KDYH EHHQ DGGHG DV UHJLRQV KDYLQJ +.$73DVH DFWLYLW\ 7KHVH VWXGLHV DOVR EHJDQ WR DGGUHVV WKH GLIIHUHQFHV DPRQJ +.$73DVHV WKDW DUH SUHVHQW LQ WKH NLGQH\ GHILQLQJ WKH FKDUDFWHULVWLFV RI WKH +.$73DVH DFWLYLWLHV DQG WKHLU ORFDOL]DWLRQ 7KH LGHQWLW\ RI WKH +.$73DVH PROHFXOHV UHVSRQVLEOH IRU WKH WZR FROOHFWLQJ GXFW DFWLYLWLHV KDYH EHHQ IRXQG 7KH LGHQWLW\ RI WKH +.$73DVH PROHFXOH UHVSRQVLEOH IRU WKH DFWLYLW\ LQ WKH PRUH SUR[LPDO QHSKURQ LV QRW \HW NQRZQ +.$73DVH VXEXQLW LVRIRUPV LQ WKH NLGQH\ 8QWLO WKH ODVW ILYH \HDUV WKH SUHVHQFH RI +.$73DVH LQ WKH NLGQH\ KDV EHHQ GHILQHG RQO\ RQ WKH EDVLV RI DFWLYLW\ :H KDYH QRZ EHJXQ WR GHWHUPLQH WKH PROHFXODU LGHQWLWLHV RI WKH SXPSV UHVSRQVLEOH IRU WKLV DFWLYLW\ $QG RQO\ YHU\ UHFHQWO\ LW KDV EHFRPH DSSUHFLDWHG WKDW WKH FRPSOH[LW\ RI +.$73DVH H[SUHVVLRQ DOVR LQFOXGHV DOWHUQDWLYH VSOLFLQJ RI +.D DQG +.3 LVRIRUPV

PAGE 24

$Q +.$73DVH KDV ORQJ EHHQ NQRZQ WR DFLGLI\ WKH OXPHQ RI WKH VWRPDFK 7KLV SXPS LV D PHPEHU RI WKH 3W\SH $73DVH IDPLO\ ZKLFK VKDUHV VLPLODULW\ RI VHTXHQFH VWUXFWXUH DQG PHFKDQLVP 7KH JDVWULF +.$73DVH LV FRPSULVHG RI D FDWDO\WLF FR VXEXQLW DQG D VXEXQLW WKH DFWLYH IRUP RI WKH HQ]\PH LV DQ D3f ROLJRPHU IRU UHYLHZ VHH +HUVKH\ DQG 6DFKV 9DQ 'ULHO DQG &DOODJKDQ f )XOOOHQJWK F'1$V IRU UDEELW +.RWL %DPEHUJ HW DO f DQG +.S 5HXEHQ HW DO f KDYH EHHQ FORQHG DQG VHTXHQFHG 573&5 IROORZHG E\ VHTXHQFLQJ RI WKH DPSOLILHG SURGXFWV KDV EHHQ XVHG WR GHPRQVWUDWH WKDW P51$ $OLQ DQG .RQH f DQG SURWHLQ &DOODJKDQ HW DO f IRU +.RWL DQG WKDW P51$ DQG SURWHLQ IRU +.3 &DOODJKDQ HO DO f LVRIRUPV DUH SUHVHQW LQ NLGQH\ 7KLV DXWKRU ZDV LQFOXGHG LQ WKH ODWWHU VWXG\ 7KH QRQJDVWULF +.$73DVH D VXEXQLW LVRIRUPV +.RWf KDYH EHHQ FORQHG IURP VHYHUDO WLVVXHV $ SDUWLDO F'1$ IRU DQ +.D LVRIRUP ZDV REWDLQHG IURP KXPDQ D[LOOD VNLQ DQG P51$ REVHUYHG LQ EUDLQ DQG NLGQH\ 0RG\DQRY HO DO f $ IXOOOHQJWK F'1$ ZDV IRXQG VXEVHTXHQWO\ *ULVKLQ HW DO f $Q +.D F'1$ ZDV FORQHG IURP UDW GLVWDO FRORQ E\ &URZVRQ DQG 6KXOO f WKH FRUUHVSRQGLQJ DPLQR DFLG VHTXHQFH KDV b DPLQR DFLG LGHQWLW\ WR WKH F'1$ GHULYHG IURP KXPDQ VNLQ 7KLV UDW +.D P51$ ZDV GHWHFWHG LQ NLGQH\ XWHUXV DQG KHDUW XVLQJ WZR VHSDUDWH F'1$ SUREHV IURP +.RW f 875 DQG &WHUPLQDO WUDQVPHPEUDQH GRPDLQV 7KH f 875 GHULYHG SUREH GHWHFWHG +.D LQ IRUHVWRPDFK DV ZHOO 7KHVH KXPDQ DQG UDW F'1$V ZHUH VKRZQ WR HQFRGH +. H[FKDQJH DFWLYLW\ ZKHQ H[SUHVVHG LQ ;HQRSXV ODHYLV RRF\WHV 0RG\DQRY HW DO &RXJQRQ HW DO f DOWKRXJK UHFHQW ZRUN TXHVWLRQV WKH VWRLFKLRPHWU\ RI WKH H[FKDQJH LQ WKH KXPDQ LVRIRUP *ULVKLQ HW DO f ,Q WZR RI WKHVH VWXGLHV UDEELW +.3 VXEXQLWV ZHUH

PAGE 25

FRWUDQVIHFWHG 0RG\DQRY HW DO *ULVKLQ HW DO f DQG LQ WKH RWKHU %XIR PDULQXV +. VXEXQLWV ZHUH FRWUDQVIHFWHG &RXJQRQ HW DO f $ SDUWLDO +.D F'1$ ZDV FORQHG IURP D UDEELW FRUWLFDO &' &&'f OLEUDU\ KDYLQJ b DPLQR DFLG LGHQWLW\ WR WKH KXPDQ +.D DQG P51$ ZDV GHWHFWHG LQ &&' DQG FRORQ )HMHV7RWK HW DO f :DWDQDEH HW DO f FORQHG DQG VHTXHQFHG D VLPLODU F'1$ IURP GLVWDO FRORQ RI JXLQHD SLJ 7KH GHJUHH RI LGHQWLW\ DW WKH DPLQR DFLG OHYHO DPRQJ KXPDQ UDW JXLQHD SLJ DQG UDEELW +.D FORQHV LV OHVV WKDQ WKH DPLQR DFLG LGHQWLW\ RI +.RWL !bf EHWZHHQ WKH WKUHH VSHFLHV EXW PXFK JUHDWHU WKDQ WKH W\SLFDO DPLQR DFLG LGHQWLW\ EHWZHHQ +.RWL DQG RWKHU 3W\SH $73DVHV bf 7KHUHIRUH DOWKRXJK FRQWURYHUV\ RQ WKLV SRLQW H[LVWV WKLV DXWKRU FRQVLGHUV WKHVH WR EH RUWKRORJRXV DQG UHIHUV WR WKHP FROOHFWLYHO\ DV +.D $V SDUW RI WKLV GLVVHUWDWLRQ IXUWKHU HYLGHQFH ZLOO EH SUHVHQWHG WKDW WKH +.D JHQHV DUH LQGHHG RUWKRORJV $ UHODWHG F'1$ b LGHQWLW\ DW WKH DPLQR DFLG OHYHOf ZDV FORQHG IURP %XIR PDULQXV EODGGHU DQ DQDORJ RI PDPPDOLDQ FROOHFWLQJ GXFW -DLVVHU HW DO f :KLOH P51$ ZDV GHWHFWHG LQ WRDG EODGGHU QRQH ZDV REVHUYHG LQ HLWKHU VWRPDFK RU FRORQ 7KH HYROXWLRQDU\ GLVWDQFH EHWZHHQ WRDG DQG PDPPDO FRXSOHG ZLWK WKH WLVVXH GLVWULEXWLRQ GLVVLPLODULW\ RI WKH WRDG +.D PDNH LW GLIILFXOW WR HYDOXDWH WKH UHODWLRQVKLS EHWZHHQ WKH WRDG DQG PDPPDOLDQ LVRIRUPV ,Q DGGLWLRQ WR XQFHUWDLQW\ LQ WKH QXPEHU RI +.$73DVH LVRIRUPV LQ WKH NLGQH\ LW KDV EHHQ UHFHQWO\ EHHQ GLVFRYHUHG WKDW WKHUH DUH WZR DOWHUQDWLYHO\ VSOLFHG WUDQVFULSWV RI WKH UDW +.D LQ NLGQH\ .RQH +LJKDP DQG .RQH f 7KXV VHYHUDO +.$73DVH RW VXEXQLW LVRIRUPV KDYH EHHQ UHSRUWHG LQ NLGQH\ EXW LW LV DW SUHVHQW XQFHUWDLQ ZKHWKHU WKHVH DFFRXQW IRU DOO WKH UHQDO +.$73DVHV $OVR XQFHUWDLQ LV WKHLU UHODWLYH FRQWULEXWLRQV WR UHQDO +.$73DVH DFWLYLW\

PAGE 26

([SHULPHQWV KDYH EHHQ FRQGXFWHG LQ DWWHPSWV WR ILQG PRUH PHPEHUV RI WKH JHQH IDPLO\ WKDW LQFOXGHV WKH D VXEXQLWV RI 1D.$73DVHV DQG +.$73DVHV 6KXOO DQG /LQJUHO f SUREHG D KXPDQ JHQRPLF OLEUDU\ DW ORZ VWULQJHQF\ ZLWK SUREHV PDGH IURP 1D.$73DVH VKHHS FFL UDW RLO UDW D" DQG UDW D )LYH GLIIHUHQW VHTXHQFHV ZHUH REWDLQHG ZLWK WZR WR WHQ FORQHV UHSUHVHQWLQJ HDFK VHTXHQFH 7KUHH RI WKHVH ZHUH NQRZQ WR EH KXPDQ 1D.RWL 1D.D DQG +.F[L JHQHV 7KH IRXUWK ZDV ODWHU LGHQWLILHG DV +.D 0RG\DQRY HW DO f 7KH ILIWK ZKLFK LV SK\VLFDOO\ OLQNHG WR WKH 1D.D ZDV ODWHU LGHQWLILHG DV 1D.D E\ 6KDPUDM DQG /LQJUHO f ,Q D VLPLODU H[SHULPHQW 6YHUGORY HW DO f VFUHHQHG D KXPDQ JHQRPLF OLEUDU\ ZLWK D SUREH PDGH IURP SRUFLQH NLGQH\ 1D.RFL 7KH SUREH ZDV FRQVWUXFWHG WR FRQWDLQ WKH ZHOOFRQVHUYHG UHJLRQ VXUURXQGLQJ WKH DFWLYH VLWH DVSDUWDWH UHVLGXH 7KH\ REWDLQHG ILYH GLVWLQFW FORQHV 7KH\ ZHUH UHFRJQL]HG DV WKH WKUHH NQRZQ 1D.D VXEXQLWV DQG WKH WZR NQRZQ +.D VXEXQLWV ,Q VXP WKH UHVXOWV RI WKHVH WZR H[SHULPHQWV LPSO\ WKDW DOO PHPEHUV RI WKH JHQH IDPLO\ RI ;.$73DVHV DUH NQRZQ $W SUHVHQW WKHUH DUH QR NQRZQ VSHFLILF +.3 LVRIRUPV LQ DGGLWLRQ WR WKH RQH RULJLQDOO\ GLVFRYHUHG LQ JDVWULF WLVVXHV +RZHYHU LW LV WKRXJKW WKDW WKH 1D._L VXEXQLW LVRIRUP LV WKH SDUWQHU WR +.D LQ DFWLYH +.$73DVH SXPSV LQ FRORQ DQG NLGQH\ 'X%RVH HW DO .UDXW HW DO f 7KHVH REVHUYDWLRQV DUH WKH ILUVW VXJJHVWLQJ WKDW DQ LQGLYLGXDO 3W\SH $73DVH 3 VXEXQLW KDV PRUH WKDQ RQH SULPDU\ 3W\SH $73DVH D VXEXQLW SDUWQHU LQ YLYR 7KLV ZDV WKH GHWHUPLQDWLRQ UHDFKHG E\ WZR VHSDUDWH JURXSV XVLQJ GLIIHUHQW DQWLERGLHV WR VSHFLILFDOO\ LPPXQRSUHFLSLWDWH D3 SDLUV OHQGLQJ VWUHQJWK WR WKHLU LQGHSHQGHQW DQG LGHQWLFDO FRQFOXVLRQV +RZHYHU LW LV SRVVLEOH WKDW GXULQJ WLVVXH SURFHVVLQJ VRPH RI WKH DS SDLUV

PAGE 27

PD\ PL[ SDUWQHUV OHDGLQJ WR DQ HUURQHRXV FRQFOXVLRQ 3DLUV WKDW DUH QRW WKRXJKW WR DVVRFLDWH LQ YLYR KDYH EHHQ VHHQ LQ H[SUHVVLRQ V\VWHPV WR JLYH ULVH WR IXQFWLRQDO DFWLYLW\ +RULVEHUJHU HW D &RGLQD HW DO f VKRZLQJ WKDW WKH LQ YLYR 3W\SH $73DVH SDLUV DUH QRW H[FOXVLYH ZKHQ H[SUHVVHG LQ H[SUHVVLRQ V\VWHPV ([SUHVVHG LQ WKHLU SURSHU FHOO W\SHV WKHUH PD\ EH FRPSDUWPHQWDWLRQ WKDW FRQWUROV +.D DQG +.S VHOHFWLYLW\ 7KLV FRXOG VHJUHJDWH WKH VXEXQLWV IURP WKHLU LQFRUUHFW SDUWQHUV RQ WKH EDVLV RI WUDQVODWLRQ RI WKH YDULRXV +.$73DVH DQG 1D.$73DVH LVRIRUPV DW GLIIHUHQW WLPHV RU LQ GLIIHUHQW ORFDWLRQV $OWHUQDWLYH WUDQVFULSWLRQDO VWDUW VLWHV IRU +.3 LQ WKH VWRPDFK ZHUH GHWHFWHG E\ 1HZPDQ DQG 6KXOO f 7KH SULPHU H[WHQVLRQ PHWKRG XVHG E\ 1HZPDQ DQG 6KXOO f ZRXOG QRW KDYH QHFHVVDULO\ GLIIHUHQWLDWHG EHWZHHQ DOWHUQDWLYH WUDQVFULSWLRQDO VWDUW VLWHV DQG DOWHUQDWLYH VSOLFLQJ 3ULPHU H[WHQVLRQ ZRXOG RQO\ JLYH LQIRUPDWLRQ DERXW WKH GLVWDQFH IURP WKH SULPHU WR WKH EHJLQQLQJ RI DQ\ RU DOO RI WKH WUDQVFULSWV WKDW FRQWDLQ WKH SULPHU VLWH 6R LW LV SRVVLEOH WKDW WKH\ ZHUH GHWHFWLQJ DOWHUQDWLYH VSOLFLQJ DV ZHOO DV DOWHUQDWH WUDQVFULSWLRQ VWDUW VLWHV 7KXV IDU KRZHYHU WKHUH KDYH EHHQ QR UHSRUWV RI PXOWLSOH +.3 VXEXQLW WUDQVFULSWV LQ DQ\ WLVVXH VHHQ E\ 51$ DQDO\VLV WHFKQLTXHV VXFK DV QRUWKHUQ DQDO\VLV RU ULERQXFOHDVH SURWHFWLRQ DVVD\ ,Q SUHVHQW ZRUN SUHVHQW HYLGHQFH WKDW WKH WUDQVFULSWLRQDO VWDUW VLWH RI +.S VXEXQLW LQ WKH PHGXOOD KDV VOLJKW GLIIHUHQFHV UHODWLYH WR VWRPDFK DQG WKDW LQ UHQDO PHGXOOD WKHUH DUH WZR WUDQVFULSWV H[SUHVVHG DW FRPSDUDEOH OHYHO RQH RI ZKLFK DSSHDUV WR EH WKH SURGXFW RI DOWHUQDWLYH VSOLFLQJ ,Q VXPPDU\ WKH ILUVW +.$73DVH VXEXQLW GHWHFWHG LQ NLGQH\ ZDV WKH QRQJDVWULF LVRIRUP +.FW VKRZQ E\ 573&5 WR EH SUHVHQW LQ KXPDQ NLGQH\ 0RG\DQRY HW DO f 6KRUWO\ EHIRUH WKLV DXWKRU MRLQHG KLV ODE 'U %ULDQ &DLQ IRXQG WKDW WKH UDEELW 3

PAGE 28

VXEXQLW LVRIRUP RI VWRPDFK ZDV SUHVHQW LQ NLGQH\ &DOODJKDQ HW DO &DPSEHOO7KRPSVRQ HW DO f $IWHU WKH ZRUN GHVFULEHG KHUH ZDV EHJXQ ZRUN E\ RWKHU LQYHVWLJDWRUV $KQ DQG .RQH f HVWDEOLVKHG WKDW WKH FDWDO\WLF VXEXQLW LVRIRUP IRXQG LQ VWRPDFK +.DL LV DOVR IRXQG LQ NLGQH\ +.DL SURWHLQ ZDV VKRZQ E\ LPPXQREORW LQ UDEELW NLGQH\ &DOODJKDQ HW DO f 7R IXUWKHU FRPSOLFDWH WKH SLFWXUH DQ DOWHUQDWLYHO\ VSOLFHG +.D GXEEHG +.DD ZLWK WKH FDQRQLFDO +.D EHLQJ UHQDPHG +.DDf ZDV GLVFRYHUHG LQ NLGQH\ .RQH DQG +LJKDP f $ VHDUFK IRU WKH 3 VXEXQLW SDUWQHU WR +.DD HVWDEOLVKHG WKDW 1D.3L FRXSOHV WR +.DD LQ YLYR 'XERVH HW DO .UDXW HW DO f 3UHVXPDEO\ +.DL SDLUV ZLWK +.3 LQ NLGQH\ DV LW GRHV LQ VWRPDFK +DOO HWD 6KLQ DQG 6DFKV 0DWKHZV HW DO f $OO WKH NQRZQ +.$73DVH VXEXQLW LVRIRUPV DUH NQRZQ LQ NLGQH\ +.D+.3 DQG +.D1D.3L +.$73DVHV FRQWULEXWH WR WKH DFWLYLWLHV REVHUYHG LQ WKH FROOHFWLQJ GXFW ([SHULPHQWV KDYH EHHQ GRQH WR ILQG RWKHU FDQGLGDWH +.$73DVH JHQHV DQG WR GDWH QRQH KDYH EHHQ GHWHFWHG 6R IDU QR PROHFXODU LGHQWLW\ FDQ EH DVVRFLDWHG ZLWK WKH +.$73DVH DFWLYLW\ LQ WKH SUR[LPDO WXEXOH DQG WKLFN DVFHQGLQJ OLPE 'HILFLHQFLHV RI +.$73DVH 7KHUH DUH WZR OLQHV RI HYLGHQFH WR LQGLFDWH WKDW +.$73DVHV DUH FULWLFDO WR PDLQWHQDQFH RI .r KRPHRVWDVLV DQG WKDW GLVWXUEDQFHV LQ WKLV EDODQFH DUH D VHULRXV KHDOWK SUREOHP )LUVW WUDQVJHQLF PLFH ZLWK GHUDQJHG +.$73DVH IXQFWLRQ VKRZ VXEVWDQWLDO GLVWXUEDQFHV RI EDODQFH 0HQHWRQ HW DO f 6HFRQG DQ HQYLURQPHQWDOO\ KLJK OHYHO

PAGE 29

RI YDQDGLXP LQ QRUWKHDVW 7KDLODQG HIIHFWLYHO\ LQKLELWV +.$73DVH IXQFWLRQ DPRQJ KXPDQV DQG ZDWHU EXIIDOR OLYLQJ LQ WKH DUHD 'DIQLV HW D f ([SHULPHQWV KDYH EHHQ FDUULHG RXW WR VKRZ WKH FULWLFDO QDWXUH RI +.$73DVH H[SUHVVLRQ DQG LWV UHOHYDQFH LQ WKH NLGQH\ 0HQHWRQ HW DO f 0HQHWRQ VKRZHG WKDW WUDQVJHQLF PLFH KRPR]\JRXV ZLWK UHVSHFW WR DQ +.D VXEXQLW GHOHWLRQ ZHUH QRUPDO ZKHQ IHG GLHWV WKDW KDG QRUPDO OHYHOV RI b .f +RZHYHU ZKHQ IHG .nIUHH GLHWV b .f WKHVH PLFH H[SHULHQFHG ORVV LQ ERG\ ZHLJKW SODVPD DQG PXVFOH .? +.FW LV QRW WKH PDMRU PHFKDQLVP RI .n FRQVHUYDWLRQ LQ WKH NLGQH\ WKH XULQDU\ H[FUHWLRQ UDWH LQ ERWK ZLOGW\SH DQG +.DGHILFLHQW PLFH GHFOLQHG IROG FRPSDUHG WR +.DGHILFLHQW PLFH RQ QRUPDO GLHWV +RZHYHU PHDQ XULQDU\ H[FUHWLRQ SHU GD\ ZDV FRQVLVWHQWO\ KLJKHU W\SLFDOO\ b RI ZLOGW\SHf IROORZLQJ D ZHHN RI .IUHH IHHGLQJ 7KLV VXJJHVWV WKDW WKHUH PD\ EH D UROH SOD\HG E\ UHQDO +.D LQ FRQVHUYDWLRQ 7KH UROH SOD\HG E\ +.D LQ WKH FRORQ ZDV PRUH FOHDU )HFDO H[FUHWLRQ UDWH LQFUHDVHG IRXUIROG LQ +.FWGHILFLHQW FRPSDUHG WR QRUPDO PLFH WKDW KDG EHHQ IHG WKH VDPH ,&IUHH GLHW LQGLFDWLQJ DQ LQDELOLW\ WR UHDEVRUE & E\ WKH GLJHVWLYH WUDFW &DUGLDF DUUK\WKPLDV ZHUH REVHUYHG LQ VRPH RI WKH +.DGHILFLHQW PLFH SUHVXPDEO\ GXH WR ORZ SODVPD $QHFGRWDO HYLGHQFH FRQFHUQLQJ +.$73DVH DFWLYLW\ LQ KXPDQV FRPHV WR XV IURP 7KDLODQG ZKHUH HQYLURQPHQWDO YDQDGLXP OHYHOV DUH KLJK 9DQDGDWH LV D WUDQVLWLRQ VWDWH LQKLELWRU IRU DOO 3W\SH $73DVHV DQG LWV SUHVHQFH LQ GULQNLQJ ZDWHU DQG VRLO LQ QRUWKHDVW 7KDLODQG ZDV DVVRFLDWHG ZLWK DQ HSLGHPLF RI UHQDO GLVWDO WXEXODU DFLGRVLV ,W LV LQWHUHVWLQJ WKDW DOWKRXJK YDQDGDWH ZRXOG EH H[SHFWHG WR LQKLELW 1D.$73DVHV DQG &D$73DVHV DORQJ ZLWK +.$73DVH LQ VWRPDFK DQG GLVWDO FRORQ WKH SUHGRPLQDQW V\PSWRPV ZHUH

PAGE 30

UHQDO 7KH GLVHDVH LV FKDUDFWHUL]HG E\ DQ LQDELOLW\ WR ORZHU XULQH S+ WR EHORZ S+ XQLWV $IIHFWHG SHUVRQV KDG JHQHUDOL]HG SDUDO\VLV K\SRNDOHPLD PHWDEROLF DFLGRVLV PXVFOH DQG ERQH SDLQ DQG QRFWXULD 1LOZDUDQJNDU HW D f 7KH FRQQHFWLRQ EHWZHHQ DFLG VHFUHWLRQ LQ WKH NLGQH\ DQG VWRPDFK KDG EHHQ PDGH DQG VRPH SDWLHQWV WHVWHG SRVLWLYH IRU JDVWULF K\SRDFLGLW\ 6LWSULMD HW DK f +RZHYHU WKH H[DFW FDXVH RI WKH DFLG VHFUHWLRQ GHIHFW ZDV XQNQRZQ $V UHFHQWO\ DV D JHQHWLF SUHGLVSRVLWLRQ KDG QRW EHHQ UXOHG RXW 1LOZDUDQJNDU HW DO f 3DWLHQWV DUH WUHDWHG E\ .n DQG DONDOL VXSSOHPHQWV DQG VRPH GHDWKV RFFXUUHG ZLWK QRQFRPSOLDQFH ,W ZDV VKRZQ LQ UDWV WKDW LQWUDSHULWRQHDO LQMHFWLRQV RI YDQDGDWH PJNJf OHG WR K\SRNDOHPLF GLVWDO UHQDO WXEXODU DFLGRVLV DQG ORVV LQ PXVFOH 'DIQLV HW DO f &RUWLFDO FROOHFWLQJ GXFW .$73DVH DFWLYLW\ WKDW ZDV VHQVLWLYH WR 6FK S0f GHFOLQHG b LQ YDQDGDWHWUHDWHG UDWV 0HGXOODU\ FROOHFWLQJ GXFW DFWLYLW\ GHFOLQHG OHVV WKDQ b E\ WKH VDPH DVVD\ +RZHYHU LW VKRXOG EH QRWHG WKDW WKLV LV D VXIILFLHQWO\ KLJK 6FK FRQFHQWUDWLRQ WR LQKLELW +.D HQ]\PH DFWLYLW\ DFFRUGLQJ WR VRPH LQYHVWLJDWRUV 0RG\DQRY HW DO *ULVKLQ HW D f EXW RWKHU VWXGLHV KDYH QRW VHHQ VHQVLWLYLW\ WR 6FK HYHQ DW WKDW UHODWLYHO\ KLJK FRQFHQWUDWLRQ &RXJQRQ HW DO &RGLQD HW DO f 7KHUHIRUH D YDQDGDWH HIIHFW RQ +.D HQ]\PH DFWLYLW\ LQ WKLV VWXG\ PLJKW KDYH UHPDLQHG XQGHWHFWHG 1D.$73DVH DFWLYLW\ ZDV PHDVXUHG DOVR DQG VKRZHG D GHFOLQH LQ YDQDGDWHWUHDWHG DQLPDOV DV ZHOO 7KLV DVVD\ DOVR PD\ RU PD\ QRW KDYH GHWHFWHG D FRQWULEXWLRQ GXH WR +.D DFWLYLW\ ZKLFK LV H[SHFWHG WR EH RXDEDLQVHQVLWLYH DW FRQFHQWUDWLRQV RI EHWZHHQ S0 0RG\DQRY HW DO f DQGO P0 &RGLQD HW DO f GHSHQGLQJ RQ WKH VWXG\ 7KH HYLGHQFH VXJJHVWV WKDW YDQDGDWH FRXOG EH D IDFWRU LQ WKH HQGHPLF K\SRNDOHPLF GLVWDO UHQDO WXEXODU DFLGRVLV LQ QRUWKHDVW 7KDLODQG 0RUH SUHFLVH

PAGE 31

PHDVXUHPHQWV QHHG WR EH PDGH WR TXDQWLWDWH WKH HIIHFW RI 6FK DQG RXDEDLQ RQ +.D DFWLYLW\ ,Q VXPPDU\ WKHVH VWXGLHV LOOXVWUDWH WKH HVVHQWLDO QDWXUH RI +.$73DVHV LQ WKH UHQDO FROOHFWLQJ GXFW DQG LQ GLVWDO FRORQf IRU WKH PDLQWHQDQFH RI .I EDODQFH ,Q WKH H[WUHPH FDVH GHUDQJHG +.$73DVH IXQFWLRQ FDQ UHVXOW LQ GLVHDVH RU HYHQ GHDWK 7KHVH VWXGLHV LVRODWLQJ WKH DFWLYLW\ RI +.$73DVH GR QRW DGGUHVV WKH UROH +.$73DVH PLJKW SOD\ LQ EORRG SUHVVXUH UHJXODWLRQ 7KH RWKHU PRUH DFXWH DIIHFWV RI LPSDLUPHQWV RI +.$73DVH DFWLYLW\ SUREDEO\ REVFXUHG WKH DIIHFWV RQ EORRG SUHVVXUH UHJXODWLRQ $OWKRXJK LQ VRPH FDVHV D GHIHFW LQ D VLQJOH JHQH OHDGV WR D GUDPDWLF ORVV LQ EORRG SUHVVXUH FRQWURO K\SHUWHQVLRQ LV PRVW RIWHQ D PXOWLIDFWRULDO GLVHDVH +.$73DVH LV OLNHO\ WR EH RQH RI D FRPELQDWLRQ RI DFWLYLWLHV WKDW IDLO WR FRQWURO EORRG SUHVVXUH LQ WKH K\SHUWHQVLYH SDWLHQW +.$73DVH 6WUXFWXUH DQG )XQFWLRQ +.$73DVH FDWDO\WLF VXEXQLW 7KH +.D VXEXQLW FRQWDLQV WKH DFWLYH VLWHV UHODWLQJ WR LWV FDWDO\WLF DFWLRQ )LJXUH f $ QXPEHU RI IXQFWLRQDOO\ LPSRUWDQW VLWHV LQ WKH +.D KDYH EHHQ GHILQHG 7KH ORFDWLRQ RI WKH SKRVSKRU\ODWHG DVSDUW\O UHVLGXH RI WKH FDWDO\WLF LQWHUPHGLDWH LV NQRZQ DQG WKH UHJLRQ LPPHGLDWHGO\ VXUURXQGLQJ LW LV H[WUHPHO\ ZHOO FRQVHUYHG ZLWKLQ WKH 3W\SH $73DVH IDPLO\ :DOGHUKDXJ HW FLL f 7KH ORFDWLRQ RI D UHVLGXH WKDW ELQGV WKH IOXRUHVFHQW PROHFXOH ),7& LV DOVR NQRZQ )7& FRPSHWHV ZLWK $73 IRU ELQGLQJ WR +.$73DVH DQG WKHUHIRUH LV WKRXJKW WR EH DW RU QHDU WKH +.D $73 ELQGLQJ VLWH -DFNVRQ HW D )DUOH\ DQG )DOOHU f 7KH VLWH RI WKH .FRPSHWLWLYH LQKLELWRU 6FK ZKLFK DFWV DW DQ

PAGE 32

$73 $'33 LQWUDFHOOXODU )LJXUH 6FKHPDWLF GLDJUDP RI +.$73DVH 'DVKHG OLQH LQGLFDWHV WKH DPLQRWHUPLQDO H[WHQVLRQ RI +.DF SURWHLQ

PAGE 33

H[WUDFHOOXODU VLWH 0XQVRQ DQG 6DFKV f LV NQRZQ E\ VWXGLHV ZLWK D SKRWRDIILQLW\ DQDORJ WR OLH EHWZHHQ WKH ILUVW WZR WUDQVPHPEUDQH GRPDLQV 0XQVRQ HW DO f 7KH 1D.$73DVH LQKLELWRU RXDEDLQ ELQGV WR WKH FRUUHVSRQGLQJ VLWH LQ WKDW HQ]\PH EXW LW LV QRW NQRZQ ZKHWKHU WKLV LV WKH ELQGLQJ VLWH FRQIHUULQJ RXDEDLQfV OHVV VHQVLWLYH LQKLELWLRQ RI +.RW 7KH ELQGLQJ VLWH RI WKH PHGLFDOO\ LPSRUWDQW LQKLELWRU RPHSUD]ROH LV DOVR NQRZQ LW PD\ ELQG WR DQ\ RI WKUHH H[WUDFHOOXODU F\VWHLQHV ORFDWHG LQ WKH &WHUPLQDO TXDUWHU RI WKH VXEXQLW %HVDQFRQ HW DO f 7KLV LQKLELWRU KDV DFKLHYHG VRPH SRSXODU DFFODLP WHOHYLVLRQ DGYHUWLVHPHQWV PD\ EH VHHQ IRU LW XQGHU LWV EUDQG QDPH 3ULORVHF 8VLQJ K\GURSDWK\ DQDO\VLV WKH H[LVWHQFH RI IRXU WUDQVPHPEUDQH KHOLFHV LQ WKH DPLQRWHUPLQDO KDOI RI +.DL LV FOHDU 7KH QXPEHU RI WUDQVPHPEUDQH GRPDLQV RI WKH FDUER[\OWHUPLQDO KDOI RI +.D LV QRW DV DSSDUHQW IURP WKH K\GURSDWK\ SORW EXW PD\ EH SODFHG VRPHZKHUH EHWZHHQ WKUHH DQG ILYH E\ WKDW DQDO\VLV +RZHYHU WKH SUHVHQFH RI DQ RGG QXPEHU RI PHPEUDQHVSDQQLQJ UHJLRQV ZRXOG EH LQFRQVLVWHQW ZLWK WKH SODFHPHQW RI DPLQR DQG FDUER[\WHUPLQL LQ WKH F\WRSODVP E\ DQWLERG\ UHDFWLYLW\ 6PROND HW DO 0HUFLHU HW DO f $OVR WKH ORFDOL]DWLRQ RI WKH DFWLYH VLWHV GLVFXVVHG LQ WKH SUHFHGLQJ SDUDJUDSK SUHGLFWV D ODUJH LQWUDFHOOXODU F\WRVROLF ORRS IROORZLQJ WKH ILUVW IRXU WUDQVPHPEUDQH GRPDLQV 7KH SLFWXUH LV IXUWKHU FRPSOLFDWHG EHFDXVH UHFHQW UHVXOWV 5DXVVHQV HW DO f LPSO\ WKDW VRPH RI WKH WUDQVPHPEUDQH GRPDLQV PD\ EH FRPSULVHG RI VWUDQG VHFRQGDU\ VWUXFWXUH 8VLQJ OLPLWHG WU\SWLF GLJHVWLRQ IROORZHG E\ IOXRUHVFHQW ODEHOOLQJ RI F\VWHLQHV WKH IRXU WUDQVPHPEUDQH VHJPHQWV RI WKH DPLQRWHUPLQDO KDOI FRXOG EH FRQILUPHG %HVDQFRQ HW DO 6KLQ HW DO f ,Q WKH FDUER[\OWHUPLQDO KDOI RI WKH SURWHLQ RQO\ WKUHH WUDQVPHPEUDQH GRPDLQV ZHUH REVHUYHG 7KH WZR PRVW FDUER[\OWHUPLQDO PHPEUDQH VSDQV VWURQJO\ LPSOLHG E\ K\GURSDWK\ DQDO\VLV ZHUH QRW

PAGE 34

REVHUYHG E\ IOXRUHVFHQW ODEHOOLQJ GHVSLWH WKH SUHVHQFH RI PXOWLSOH F\VWHLQHV ,Q YLWUR WUDQVODWLRQ H[SHULPHQWV KDYH DOVR EHHQ SUHIRUPHG WR HOXFLGDWH +.$73DVH WRSRORJ\ %DPEHUJ DQG 6DFKV f 7KHVH H[SHULPHQWV LQYROYH V\QWKHVLV RI SXWDWLYH WUDQVPHPEUDQH VHJPHQWV LQ WKH SUHVHQFH DQG DEVHQFH RI PLFURVRPHV WKHQ GHWHFWLRQ RI JO\FRV\ODWLRQ RI WKH UHVXOWLQJ SRO\SHSWLGHV E\ HOHFWURSKRUHVLV 3RVLWLYH JO\FRV\ODWLRQ RI D IXVLRQ SURWHLQ FRQWDLQLQJ JO\FRV\ODWLRQ VLWHV ZRXOG LPSO\ WKH LQVHUWLRQ RI D VLQJOH WUDQVPHPEUDQH GRPDLQ :KHQ D SDLU RI PHPEUDQH VSDQQLQJ GRPDLQV ZHUH WUDQVODWHG QR JO\FRV\ODWLRQ ZRXOG UHVXOW %RWK VLQJOH WUDQVPHPEUDQH GRPDLQV DQG SDLUV RI WUDQVPHPEUDQHV ZHUH WHVWHG ,Q WKLV V\VWHP WKH SUHGLFWHG ILQDO WZR WUDQVPHPEUDQH VHJPHQWV ZHUH LQVHUWHG LQWR WKH PHPEUDQH 7DNHQ WRJHWKHU WKHVH H[SHULPHQWV SUHGLFW D VHFRQGDU\ VWUXFWXUH IRU +.FWL WKDW KDV DPLQR DQG FDUER[\WHUPLQL ORFDWHG LQWUDFHOOXODUO\ 7KHUH DUH IRXU WUDQVPHPEUDQH GRPDLQV LQ WKH DPLQRWHUPLQDO KDOI RI WKH SURWHLQ DQG EHWZHHQ IRXU DQG VL[ WUDQVPHPEUDQH GRPDLQV LQ WKH FDUER[\OWHUPLQDO KDOI ,I +.$73DVH PHPEUDQH WRSRORJ\ LV FRQVHUYHG ZLWK WKDW RI &D$73DVH UHFHQWO\ LPDJHG E\ FU\RHOHFWURQ PLFURVFRS\ =KDQJ HW D f WKHQ +.DL VXEXQLWV SUREDEO\ KDYH WHQ PHPEUDQH VSDQV 7KH VLJQLILFDQFH RI +.$73DVH HQ]\PH TXDWHUQDU\ VWUXFWXUH LV SUHVHQWO\ XQGHU DFWLYH FRQVLGHUDWLRQ 6WXGLHV VXJJHVW WKDW WKHUH DUH VSHFLILF DQG VWDEOH DVVRFLDWLRQV EHWZHHQ FDWDO\WLF VXEXQLWV 5DGLDWLRQ LQDFWLYDWLRQ VWXGLHV VKRZHG WKH PLQLPXP IXQFWLRQDO XQLW WR EH DQ [Sf KHWHURWHWUDPHU 5DEQ HW D f 7KH HOHFWURQ PLFURVFRSH GLIIUDFWLRQ SDWWHUQ LQ LPDJHV RI WZRGLPHQVLRQDO +.$73DVH FU\VWDOV VXJJHVWHG D WHWUDPHULF DUUDQJHPHQW RI +.DL VXEXQLWV +HEHUW HW DO f 7KH DSSDUHQW FRQWUDGLFWLRQ RI WKH UDGLDWLRQ LQDFWLYDWLRQ DQG HOHFWURQ PLFURVFRS\ H[SHULPHQWV FDQ EH H[SODLQHG $Q DD LQWHUDFWLRQ KDV

PAGE 35

EHHQ VKRZQ WR EH QHFHVVDU\ IRU RSWLPDO DFWLYLW\ RI +.$73DVH 0RULL HW DO f 'LPHULF DD LQWHUDFWLRQV ZHUH QHFHVVDU\ IRU +.$73DVH DFWLYLW\ DQG WHWUDPHULF DD LQWHUDFWLRQV FRQIHU KLJKHU DIILQLW\ ELQGLQJ RI $73 :KHQ FRH[SUHVVHG LQ LQVHFW FHOOV 1D.DL 1D.D DQG 1D.D ZHUH IRXQG WR FRLPPXQRSUHFLSLWDWH %ODQFR HW DO f 8VLQJ FKLPHULF FRQVWUXFWLRQV FRPELQLQJ 1D.DL DQG +.DL DOWHUQDWLQJ UHJLRQV LW ZDV IRXQG WKDW WKH ODUJH LQWUDFHOOXODU ORRS ZDV QHFHVVDU\ IRU WKLV DVVRFLDWLRQ .RVWHU HW DO f 8VLQJ D \HDVW WZRK\EULG V\VWHP DQG IXVLRQV RI *DO WR D VXEXQLW F\WRVROLF ORRSV &RORQQD HW DW f IXUWKHU H[SORUHG WKLV LQWHUDFWLRQ ,Q WZRK\EULG DVVD\V WKHUH ZDV QR DSSDUHQW GLUHFW LQWHUDFWLRQ EHWZHHQ SDLUV RI WKH ODUJH F\WRVROLF ORRS )LJXUH f /LNHZLVH WKHUH ZDV QR LQWHUDFWLRQ REVHUYHG EHWZHHQ WKH VPDOOHU ORRS EHWZHHQ WKH VHFRQG DQG WKLUG WUDQVPHPEUDQH GRPDLQV +RZHYHU WKH WZRK\EULG DVVD\ JDYH D SRVLWLYH LQWHUDFWLRQ EHWZHHQ WKH VPDOOHU DQG ODUJHU ORRSV 7KH LQWHUDFWLRQ LV DSSDUHQWO\ EHWZHHQ WKH ORRS EHWZHHQ WUDQVPHPEUDQH GRPDLQV WZR DQG WKUHH RI RQH PHPEHU RI WKH DD SDLU DQG WKH ODUJHU ORRS EHWZHHQ WUDQVPHPEUDQH GRPDLQV IRXU DQG ILYH RI WKH RWKHU 7KHVH UHVXOWV LPSO\ WKDW LQWHUDFWLRQV EHWZHHQ +.$73DVH PROHFXOHV SOD\ D UROH LQ WKHLU IXQFWLRQ 7KHUH PD\ EH LQWHUDFWLRQV ZLWK RWKHU PROHFXOHV DV ZHOO VXFK DV WKRVH JRYHUQLQJ FHOO SRODULW\ +.$73DVH % VXEXQLW $QWLERGLHV WR WKH +.3 VXEXQLW SURWHLQ &KRZ DQG )RUWH f DQG UHGXFWLRQ RI DQ\ RI WKH WKUHH GLVXOILGH ERQGV LQ WKH +.3 VXEXQLW &KRZ HW DO f KDYH EHHQ REVHUYHG WR DIIHFW FDWDO\WLF VXEXQLW IXQFWLRQ ,Q DGGLWLRQ WR D UROH LQ PRGXODWLQJ HQ]\PDWLF DFWLYLW\ WKH +.S VXEXQLW LV DOVR WKRXJKW WR SDUWLFLSDWH LQ VKHSKHUGLQJ WKH +.$73DVH WKURXJK WKH

PAGE 36

*ROJL DQG WR WKH SODVPD PHPEUDQH 5HQDXG HO DO f 7KH +.3 VXEXQLW FRQWDLQV D W\URVLQHEDVHG VLJQDO UHTXLUHG IRU LQWHUQDOL]DWLRQ RI WKH +.$73DVH SXPS &RXUWRLV&RXWU\ HW DO f DQG WKXV UHTXLUHG IRU SURSHU UHJXODWLRQ RI SXPS DFWLYLW\ 7KH +.3 VXEXQLW SURWHLQ FRQWDLQV FRQVHQVXV 1JO\FRV\ODWLRQ VLWHV DQG DOO DUH JO\FRV\ODWHG &KRZ DQG )RUWH f 7KXV WKH +.3 VXEXQLW LV UHTXLUHG IRU +.$73DVH SXPSV UHDFKLQJ WKH FHOO VXUIDFH DQG SURSHU IXQFWLRQ RI WKH HQ]\PH ,WV UROH LQ LQWHUQDOL]DWLRQ PHDQV WKDW LW LV UHTXLUHG WR GRZQUHJXODWH JDVWULF DFLG VHFUHWLRQ +\GURSDWK\ DQDO\VLV SUHGLFWV D VLQJOH PHPEUDQH GRPDLQ IRU WKH +.3 VXEXQLW SURWHLQ ,QWHUDFWLRQV EHWZHHQ +.D DQG +.3 VXEXQLW SURWHLQV KDYH EHHQ VWXGLHG E\ OLPLWHG WU\SWLF GLJHVWLRQ $IWHU GLJHVWLRQ GHWHUJHQW VROXELOL]DWLRQ DQG OHFWLQ ELQGLQJ RI WKH +.3 VXEXQLW DQ +.D VXEXQLW IUDJPHQW FRUUHVSRQGLQJ WR WKH SXWDWLYH ORRS EHWZHHQ WUDQVPHPEUDQH GRPDLQV VHYHQ DQG HLJKW ZDV UHFRYHUHG 6KLQ DQG 6DFKV f 7KH VHTXHQFH RI WKLV IUDJPHQW LV ZHOOFRQVHUYHG LPSO\LQJ VRPH LPSRUWDQW IXQFWLRQ
PAGE 37

LQWHUDFWLRQV DUH DOVR EHFRPLQJ NQRZQ 7KHVH PD\ EH LPSRUWDQW LQ FRQIHUULQJ WKH HIIHFWV RQ HQ]\PH DFWLYLW\ FRQIHUUHG E\ ROLJRPHULF VWUXFWXUH 7KH\ PD\ DOVR EH LPSRUWDQW LQ FRQWUROOLQJ WKH LQWHUDFWLRQ EHWZHHQ WKH YDULRXV D DQG VXEXQLW SURWHLQV RI WKH +.$73DVHV DQG 1D .$73DVHV 5HQDO 7LVVXH &XOWXUH &HOOV $ QXPEHU RI UHQDO FRQWLQXRXV FHOO OLQHV H[LVW EXW IRU WKH SXUSRVH RI VWXG\LQJ +.$73DVH UHOHYDQFH WR WKH FRUWLFDO FROOHFWLQJ GXFW WKH VHOHFWLRQ QDUURZV FRQVLGHUDEO\ ,Q FRUWLFDO FROOHFWLQJ GXFW +.$73DVH DFWLYLW\ LV UHODWLYHO\ KLJK DQG EDVHG RQ LPPXQRKLVWRFKHPLFDO :LQJR HW DO f DQG LQ VLWX K\EULGL]DWLRQ HYLGHQFH &DPSEHOO7KRPSVRQ HW DO $KQ DQG .RQH f +.$73DVH LV IRXQG LQ LQWHUFDODWHG FHOOV LQ FRUWLFDO FROOHFWLQJ GXFW 7KHUH DUH WZR FHOO OLQHV ZLWK FKDUDFWHULVWLFV RI WKHVH FHOO W\SHV 0'&. FHOOV DQG 5&&7$ FHOO 7KH 0DGLQ'DUE\ FDQLQH NLGQH\ 0'&.f FHOO OLQH LV DQ HSLWKHOLDO FHOO OLQH WKDW DSSHDUV WR KDYH RULJLQDWHG IURP GLVWDO WXEXOH +HU]OLQJHU HO DO f RU FRUWLFDO FROOHFWLQJ WXEXOH 9DOHQWLFK f DQG KDV SURSHUWLHV RI LQWHUFDODWHG FHOOV 3IDOOHU HW DO f 0'&. FHOOV DUH DOGRVWHURQHUHVSRQVLYH 6LPPRQV f DQG LPPXQRVWDLQLQJ RI +. $73DVH KDV EHHQ REVHUYHG $GDP 6PROND SHUVRQDO FRPPXQLFDWLRQf 2EHUOHLWKQHU HW DO f GHWHFWHG DQ DOGRVWHURQHVWLPXODWHG RPHSUD]ROHLQKLELWHG WUDQVSRUW DFWLYLW\ WKDW ZDV EORFNHG E\ LQFUHDVHG DSLFDO H[WUDFHOOXODU >,7@ RU GHFUHDVHG DSLFDO H[WUDFHOOXODU >.@ FRQVLVWHQW ZLWK WKH SUHVHQFH RI DQ DSLFDO +. $73DVH LQ 0'&. FHOOV 0'&. FHOOV DUH DYDLODEOH IRU SXUFKDVH IURP WKH $PHULFDQ 7\SH &XOWXUH &ROOHFWLRQ $7&& 5RFNYLOOH 0'f %HFDXVH RI WKH XQFHUWDLQW\ RI WKHLU RULJLQ DQG EHFDXVH ZH ZDQWHG WR WDNH IXOO

PAGE 38

DGYDQWDJH RI WKH NQRZOHGJH RI UDEELW UHQDO SK\VLRORJ\ DFFXPXODWHG RYHU WKH \HDUV E\ RXU FROODERUDWRU 'U &KDUOHV :LQJR ZH VHOHFWHG WKH 5&&7$ FHOO OLQH IRU XVH LQ RXU H[SHULPHQWV 7KH 5&&7$ WUDQVIRUPHG FHOO OLQH ZDV GHULYHG IURP LPPXQRGLVVHFWHG UDEELW &&' E\ $UHQG HW DO 7KH 5&&7$ OLQH ZDV FUHDWHG E\ PLFURGLVVHFWLQJ FRUWLFDO FROOHFWLQJ WXEXOH DQG GLVSHUVLQJ FHOOV RQ SODWHV FRDWHG ZLWK PRQRFORQDO DQWLERG\ VSHFLILF WR FROOHFWLQJ WXEXOH FHOOV 7KH DQWLERG\ FRDWLQJ WKH SODWHV NQRZQ DV ,J*UFWf KDG EHHQ PDGH DJDLQVW UDEELW UHQDO FRUWLFDO FHOOV LQMHFWHG LQWR PLFH 7KH UHVXOWDQW PRQRFORQDO DQWLERG\ VWDLQHG RQO\ FROOHFWLQJ WXEXOHV RQ FU\RWRPH VHFWLRQV 6WDLQLQJ ZDV SULPDULO\ EDVRODWHUDO LQ LQWHUFDODWHG DQG SULQFLSDO FHOOV &HOOV IURP WKH GLVVHFWHG UDEELW FROOHFWLQJ GXFW WKDW KDG ERXQG LQ WKH DQWLERG\FRDWHG GLVK ZHUH LPPRUWDOL]HG ZLWK DQ DGHQRYLUXV 69 K\EULG DQG WKHQ FORQHG E\ OLPLWHG GLIIXVLRQ $ SRSXODWLRQ RI FHOOV WKDW FRQWLQXHG WR SUROLIHUDWH ZKLOH UHWDLQLQJ HSLWKHOLDO PRUSKRORJ\ ZDV REWDLQHG 7KH DQWLJHQLF DQG KRUPRQH UHVSRQVH RI WKHVH FHOOV LV VSHFLILFDOO\ FRQVLVWHQW ZLWK WKHLU RULJLQ LQ WKH FRUWLFDO FROOHFWLQJ WXEXOH ,PPXQRF\WRFKHPLVWU\ VKRZHG UHDFWLYLW\ LQ b RI FHOOV WR DQ DQWLERG\ PUPFWf DJDLQVW PLWRFKRQGULDULFK FHOOV RI WKH PHGXOODU\ FROOHFWLQJ GXFW 6FKZHLEHUW HW DO f 7KH PUPFW DQWLERG\ ZDV VHHQ WR EH VSHFLILF IRU DFLGVHFUHWLQJ RU W\SH $ FHOOV %XUQDWRZVND+OHGLQ DQG 6SLHOPDQ f ,PPXQRUHDFWLYLW\ ZDV DOVR REVHUYHG WR DQ DQWLERG\ WR EDQG SURWHLQ ,9)f DQRWKHU PDUNHU IRU DFLGVHFUHWLQJ LQWHUFDODWHG FHOOV 6FKZHLEHUW HW D f 7KH SUHVHQFH RI FDUERQLF DQK\GUDVH LQ !b RI FHOOV ZDV LQGLFDWHG E\ WKH ELQGLQJ RI D IOXRUHVFHQW DFHWD]RODPLGH DQDORJ 'LHWO HW DO f $V H[SHFWHG IRU DQ LQWHUFDODWHG FHOO FRQGXFWDQFH RI &On EXW QRW 1Dn RU .? ZDV LQGLFDWHG E\ SDWFK FODPS PHDVXUHPHQWV 'LHWO

PAGE 39

HW DO f 6FKZHLEHUW HO DO f VDZ QR DQWLJHQLFLW\ RI WKH FHOOV WRZDUG WZR DQWLERGLHV VSHFLILF IRU EDVHVHFUHWLQJ RU W\SH %f FHOOV RU WRZDUG IRXU DQWLERGLHV VSHFLILF IRU SULQFLSDO FHOOV 7KH RULJLQ FROOHFWLRQ DQG FKDUDFWHUL]DWLRQ RI WKHVH FHOOV LQGLFDWHV WKDW WKH\ DUH D JRRG PRGHO RI WKH DFLGVHFUHWLQJ LQWHUFDODWHG FROOHFWLQJ GXFW FHOO 7KH ILUVW VWXG\ XQGHUWDNHQ XVLQJ WKHVH FHOOV VKRZHG WKDW DGHQRVLQH DQDORJV LQFUHDVH LQWUDFHOOXODU FDOFLXP E\ VWLPXODWLQJ SKRVSKRLQRVLWLGH WXUQRYHU $UHQG HO D f ,QRVLWRO WXUQRYHU ZDV PHDVXUHG E\ ODEHOLQJ FHOOV ZLWK P\R>+@LQRVLWRO DQG GHWHFWLQJ >+@LQRVLWRO SKRVSKDWH IRUPDWLRQ $UHFHSWRU DJRQLVWV LQFUHDVHG SKRVSKRLQRVLWLGH WXUQRYHU DQG WKH LQFUHDVH ZDV EORFNHG E\ DQ $UHFHSWRU DQWDJRQLVW $GHQRVLQH DOVR UHJXODWHG D S6 FKORULGH FKDQQHO LQ 5&&7$ FHOOV YLD SURWHLQ NLQDVH & DQG D SURWHLQ 6FKZLHEHUW HO D f &KORULGH FKDQQHOV LQ WKHVH FHOOV KDYH EHHQ FKDUDFWHUL]HG E\ WKH SDWFK FODPS PHWKRG VKRZLQJ &O FRQGXFWDQFH WR EH VWLPXODWHG E\ LVRSURWHUHQRO 'LHWO HO DO 'LHWO DQG 6WDQWRQ f &HOO VZHOOLQJ RI5&&7$ FHOOV DFWLYDWHG D &On FRQGXFWDQFH E\ DOWHULQJ WKH RUJDQL]DWLRQ RI DFWLQ ILODPHQWV 0LOOV HO DO 6FKZLHEHUW HW DO f $FWLYDWLRQ RI WKH FKDQQHO ZDV PLPLFNHG E\ VWUHWFKLQJ WKH PHPEUDQH DQG GLVUXSWLRQ RI )DFWLQ E\ GLK\GURF\WRFKDODVLQV 6WDELOL]LQJ )DFWLQ ZLWK SKDOORLGLQ EORFNHG DFWLYDWLRQ RI WKH &On FKDQQHO %HOOR5HXVV f UHSRUWHG +.$73DVH DFWLYLW\ LQ 5&&7$ FHOOV REVHUYLQJ DQ DSLFDO DFLGLILFDWLRQ PHFKDQLVP WKDW KDG D FRPSRQHQW VHQVLWLYH WR ZLWKGUDZDO RI .f DQG WZR +. $73DVH LQKLELWRUV 6FK DQG RPHSUD]ROH 6KH DOVR GHWHFWHG DFWLYLWLHV VXJJHVWLYH RI DQ DSLFDO +$73DVH DQG D EDVRODWHUDO &+&n H[FKDQJHU $FLG VHFUHWLRQ E\ WKHVH FHOOV ZDV GLPLQLVKHG LQ FHOOV JURZQ DW ORZ S&&) HYLGHQFH RI UHJXODWLRQ RI WKH DFLGLILFDWLRQ PHFKDQLVP E\ DONDOLQH FRQGLWLRQV 7KHVH FHOOV KDYH SURYHQ XVHIXO LQ VWXG\LQJ YDULRXV SURFHVVHV QRUPDOO\

PAGE 40

DVVRFLDWHG ZLWK DFLGVHFUHWLQJ LQWHUFDODWHG FHOOV 7KH REVHUYDWLRQ RI +.$73DVH DFWLYLW\ LQ WKHVH FHOOV PDGH WKHP SDUWLFXODUO\ DSSHDOLQJ IRU RXU VWXGLHV 6XPPDU\ +.$73DVH DFWLYLW\ LQ WKH FROOHFWLQJ GXFW KDV YHU\ UHDO LPSOLFDWLRQV IRU PDLQWHQDQFH RI KHDOWK DQG ZHOOEHLQJ 6WXGLHV KDYH VKRZQ D P\ULDG RI GHUDQJHPHQWV LQ WKH DEVHQFH RI IXQFWLRQDO +.$73DVH DFWLYLW\ LQFOXGLQJ D UHDO SRVVLELOLW\ RI GHDWK 7KH +.$73DVH SURYLGHV DQ H[FHOOHQW H[DPSOH RI KRZ FULWLFDO VRPH RI WKH HQ]\PHV DUH WKDW ILQH WXQH WKH HQYLURQPHQW RI WKH ERG\ ,W LV LQWHUHVWLQJ WKDW DQ HQ]\PH WKDW KDV VXFK DQ LPPHQVH OHYHO RI DFWLYLW\ LQ RQH RUJDQ WKH VWRPDFK DFWXDOO\ LV PRUH LPSRUWDQW LQ DQRWKHU WKH NLGQH\ LQ ZKLFK LWV OHYHO RI DFWLYLW\ PLJKW EH FDOOHG VPDOO 6HYHUDO FKDOOHQJHV H[LVW LQ VWXG\LQJ WKH +.$73DVH HQ]\PH DQG LWV IXQFWLRQ 2QH RI WKHVH LV WKH ODFN RI NQRZOHGJH RI WKH TXDQWLWDWLYH HIIHFWV RI RXDEDLQ DQG 6FK RQ WKH +.FW LVRIRUP RI WKH HQ]\PH $QRWKHU LWV ORZ OHYHO RI H[SUHVVLRQ PDNLQJ DVVD\V RI P51$ SURWHLQ DQG DFWLYLW\ GLIILFXOW 7KHUH ZDV DOVR D GHDUWK RI NQRZOHGJH DERXW WKH PROHFXODU IRUPV RI +.$73DVH LQ WKH NLGQH\ ZKHQ WKHVH VWXGLHV ZHUH XQGHUWDNHQ 7KLV VLWXDWLRQ KDV FKDQJHG DQG WKH FRQWULEXWLRQV GHVFULEHG KHUHLQ KDYH EHHQ SDUW RI WKDW FKDQJH

PAGE 41

0$7(5,$/6 $1' 0(7+2'6 0ROHFXODU %LRORJ\ 7LVVXH FXOWXUH 7KH 5&&7$ FHOO OLQH ZDV GHULYHG IURP LPPXQRGLVVHFWHG UHQDO FRUWLFDO FROOHFWLQJ GXFW $UHQG HW DO f 7KHVH FHOOV ZHUH WKH NLQG JLIW RI 'U :LOOLDP 6SLHOPDQ DQG H[SHULPHQWV ZHUH SHUIRUPHG XVLQJ FHOOV EHWZHHQ SDVVDJHV DQG &HOOV ZHUH JURZQ LQ '0(0 PHGLD VXSSOHPHQWHG WR b ZLWK )%6 DQG WR b ZLWK 3HQLFLOOLQ6WUHSWRP\FLQ $OO PHGLD ZDV EXEEOHG RYHUQLJKW ZLWK D PL[WXUH RI b & b b 1 WKHQ ILOWHU VWHULOL]HG E\ XVH RI D DP FHOOXORVH DFHWDWH V\ULQJHPRXQWHG ILOWHU &RUQLQJ &RUQLQJ 1
PAGE 42

,VRODWLRQ RI WRWDO 51$ 7RWDO 51$ ZDV LVRODWHG IURP FHOOV RU WLVVXHV HPSOR\LQJ WKH PHWKRG GHVFULEHG E\ &KRPF]\QVNL DQG 6DFFKL f $IWHU DVSLUDWLRQ RI PHGLD WLVVXH FXOWXUH FHOOV ZHUH ULQVHG LQ LFH FROG VWHULOH 3%6 P0 VRGLXP SKRVSKDWH S+ P0 1D&Of 1H[W P/ RI *7& VROXWLRQ 0 JXDQLGLQH WKLRF\DQDWH P0 VRGLXP FLWUDWH b QODXUR\OVDUFRVLQH P0 3PHUFDSWRHWKDQROf ZDV DGGHG WR SURPRWH FHOO O\VLV 7KH UHVXOWLQJ YLVFRXV IOXLG ZDV VFUDSHG IURP WKH LQVHUW DQG HPSWLHG LQWR SRO\SURS\OHQH FHQWULIXJH WXEHV RQ LFH 1HZ =HDODQG :KLWH 5DEELWV ZHUH VDFULILFHG E\ GHFDSLWDWLRQ DQG WKH NLGQH\V UHPRYHG LPPHGLDWHO\ .LGQH\V ZHUH GLVVHFWHG XQGHU D PLFURVFRSH VOLFLQJ FRURQDOO\ WR VHSDUDWH FRUWH[ DQG PHGXOOD 'LVWDO FRORQ ZDV SUHSDUHG E\ FOLSSLQJ WKH GLVWDO PP RI FRORQ FXWWLQJ ORQJLWXGLQDOO\ WKHQ ULQVLQJ DZD\ FRQWHQWV E\ D WKRURXJK VSUD\ RI LFH FROG 3%6 *DVWULF PXFRVD ZDV FROOHFWHG E\ VOLFLQJ WKH VWRPDFK WUDQVYHUVHO\ ULQVLQJ LQ LFH FROG 3%6 WKHQ VFUDSLQJ WKH UXJDH ZLWK D 6FRRSXOD )LVKHU 3LWWVEXUJK 3$f 7LVVXHV ZHUH GRXQFH KRPRJHQL]HG LQ P/ *7& VROXWLRQ XQWLO WKH VXVSHQVLRQ DSSHDUHG WR EH KRPRJQHRXV 7KH UHVXOWLQJ YLVFRXV IOXLG ZDV SRXUHG LQWR SRO\SURS\OHQH FHQWULIXJH WXEHV RQ LFH :KLOH EHLQJ KHOG RQ LFH YROXPH SKHQRO ZDV DGGHG WR WKH KRPRJHQL]HG WLVVXH WKHQ YROXPH 0 VRGLXP DFHWDWH S+ f DQG YROXPH FKORURIRUPLVRDP\O PL[WXUH f $IWHU HDFK DGGLWLRQ WKH VDPSOHV ZHUH EULHIO\ YRUWH[HG 7KH VDPSOHV ZHUH VXEMHFWHG WR FHQWULIXJDWLRQ DW ; PLQ DW & 7KH XSSHU SKDVH ZDV UHWDLQHG DQG 51$ ZDV SUHFLSLWDWHG WZLFH LQ LVRSURSDQRO DQG WZLFH LQ HWKDQRO WKHQ UHVXVSHQGHG LQ S/ '(3&WUHDWHG ZDWHU 6WRUDJH RI WKH 51$ ZDV DW r& 51$ FRQFHQWUDWLRQ ZDV

PAGE 43

GHWHUPLQHG E\ 2'R UHDGLQJ RQ D VSHFWURSKRWRPHWHU )RU DEVRUEDQFH RI DW QP WKH FRQFHQWUDWLRQ ZDV WDNHQ WR EH SJPO 1RUWKHUQ DQDO\VLV 1RUWKHUQ EORWV ZHUH GRQH IROORZLQJ WKH SURFHGXUHV RI 6DPEURRN HO D f 6DPSOHV RI WRWDO 51$ SJ SHU ODQHf RU P51$ SJ SHU ODQHf XQGHUZHQW HOHFWURSKRUHVLV LQ D b DJDURVH 0 IRUPDOGHK\GH GHQDWXULQJ JHO &DSLOODU\ WUDQVIHU WR D Q\ORQ PHPEUDQH +\ERQG 1 $PHUVKDP &RUS $UOLQJWRQ +HLJKWV ,/f ZDV FRQGXFWHG RYHUQLJKW LQ ; 66& 0 1D&O P0 1D FLWUDWHf $EVRUEHQW SDSHU WRZHOV ZHUH FKDQJHG WZLFH GXULQJ WUDQVIHU 51$ LV LPPRELOL]HG RQ WKH PHPEUDQH E\ EDNLQJ K DW r& LQ D YDFXXP RYHQ 3ODEHOOHG SUREHV ZHUH SUHSDUHG E\ UDQGRP SULPHU H[WHQVLRQ RI QJ '1$ DFFRUGLQJ WR WKH SURWRFRO RI WKH 0HJDSULPH .LW $PHUVKDPf 0HPEUDQHV ZHUH SUHK\EULGL]HG D PLQLPXP RI PLQ DQG K\EULGL]HG ZLWK ODEHOOHG SUREH IRU K LQ K\EULGL]DWLRQ VROXWLRQ DW r& :KHQ KHWHURORJRXV SUREHV ZHUH HPSOR\HG VXFK DV FURVVVSHFLHV SURELQJ WHPSHUDWXUHV DV ORZ DV r& ZHUH XVHG WR UHGXFH VWULQJHQF\ :DVKLQJ ZDV GRQH ILUVW DW URRP WHPSHUDWXUH IRU PLQ LQ ,; 66& b 6'6 WKHQ WLPHV DW K\EULGL]DWLRQ WHPSHUDWXUH IRU PLQ LQ ; 66& b 6'6 $IWHU ZDVKLQJ PHPEUDQHV ZHUH H[SRVHG WR .RGDN %LR0D[ 06 ILOP DW r& ZLWK .RGDN %LR0D[ LQWHQVLI\LQJ VFUHHQV ([SRVXUHV EHWZHHQ WKUHH DQG VL[ GD\V ZHUH RIWHQ UHTXLUHG WR GHWHFW +.$73DVH VXEXQLW P51$ $Q P51$ SUREH IRU JO\FHUDOGHK\GHSKRVSKDWH GHK\GURJHQDVH D JO\FRO\WLF HQ]\PH ZDV XVHG DV D FRQWURO WR HQVXUH HYHQ ORDGLQJ DPRXQWV RI 51$ EHWZHHQ ODQHV $Q H[SRVXUH RI HLJKW KU ZDV W\SLFDOO\ VXIILFLHQW WR YLVXDOL]H WKLV FRQWURO

PAGE 44

573&5 XVLQJ GHJHQHUDWH SULPHUV 57 3&5 ZDV FDUULHG RXW DV GHVFULEHG E\ 'DYLV HO DO 7KH F'1$ WHPSODWH IRU WKH 3&5 UHDFWLRQ ZDV SURGXFHG E\ LQFXEDWLQJ SJ WRWDO 51$ IURP PLFURGLVVHFWHG UDEELW UHQDO FRUWH[ DQG SJ UDQGRP KH[DPHUV LQ D YROXPH RI S/ DW r& ; PLQ 7KH UHDFWLRQ PL[WXUH ZDV TXHQFKHG E\ SODFLQJ WKH WXEH RQ LFH 7KH UHYHUVH WUDQVFULSWLRQ UHDFWLRQV ZHUH FDUULHG RXW DW r& ; KU LQ D YROXPH RI S/ 7KH PL[WXUH FRQWDLQHG 51$UDQGRP KH[DPHUV PL[ LQ WKH ILQDO FRQFHQWUDWLRQV LQGLFDWHG )LUVW 6WUDQG %XIIHU P0 7ULV+&O S+ f P0 .& P0 0J&Kf GLWKLRWKUHLWRO O2P0f G173V P0f 51$VLQ 8 3URPHJD 0DGLVRQ :Of DQG 6XSHUVFULSW ,, 8 *LEFR %5/ *DLWKHUVEXUJ 0'f 3&5 UHDFWLRQV ZHUH SULPHG ZLWK SDLUV RI ROLJRQXFOHRWLGHV VKRZQ LQ 7DEOH V\QWKHVL]HG E\ WKH 8QLYHUVLW\ RI )ORULGD ,QWHUGLVFLSOLQDU\ &HQWHU IRU %LRWHFKQRORJ\ 5HVHDUFK 8) ,&%5f '1$ 6\QWKHVLV &RUH 3&5 UHDFWLRQV ZHUH SHUIRUPHG LQ D YROXPH RI S/ DW WKH ILQDO FRQFHQWUDWLRQV LQGLFDWHG G173V P0f 3&5 %XIIHU P0 7ULV+&O S+ P0 .&f 0J&K P0f SULPHUV SJ HDFKf DQG 7DT '1$ 3RO\PHUDVH 8f 7KH UHDFWLRQV ZHUH RYHUODLG ZLWK S/ PLQHUDO RLO 7KHUPDO SDUDPHWHUV RI WKH UHDFWLRQV LQFOXGHG D PLQ ; r& SUHVRDN IROORZHG E\ & ; VHF GHQDWXUDWLRQ r& ; PLQ DQQHDO DQG r& ; PLQ H[WHQVLRQ IRU D WRWDO RI F\FOHV IROORZHG E\ D ILQDO H[WHQVLRQ RI PLQ 5HDFWLRQV ZHUH KHOG DW r& RYHUQLJKW EHIRUH 3&5 SURGXFW FORQLQJ LQWR WKH S&5 YHFWRU DQG WUDQVIRUPHG LQWR 2QH6KRW ( FROL FHOOV XWLOL]LQJ WKH 7$ &ORQLQJ .LW OQYLWURJHQ 6DQ 'LHJR &$f ( FROL FHOOV FRQWDLQLQJ WKH SODVPLG RI LQWHUHVW ZHUH JURZQ RYHUQLJKW LQ D P/ FXOWXUH DQG SODVPLGV LVRODWHG XVLQJ WKH

PAGE 45

4LD3UHS 6SLQ 0LQL .LW 4LDJHQ 6DQWD &ODULWD &$f 6HTXHQFLQJ RI SODVPLGV ZDV FDUULHG RXW E\ WKH 8) ,&%5 '1$ 6HTXHQFLQJ &RUH 573&5 XVLQJ VWDQGDUG SULPHUV $ UHYHUVH WUDQVFULSWLRQ UHDFWLRQ ZDV FDUULHG RXW DV LQ WKH 573&5 PHWKRG GHVFULEHG DERYH IRU GHJHQHUDWH SULPHUV 3&5 UHDFWLRQV ZHUH SULPHG E\ SDLUV RI ROLJRQXFOHRWLGHV V\QWKHVL]HG E\ WKH 8) ,&%5 '1$ '1$ 6\QWKHVLV &RUH DQG VXPPDUL]HG LQ 7DEOH 5HDFWLRQV ZHUH FDUULHG RXW XVLQJ SJ WRWDO 51$ LQ D S/ YROXPH LQ .OHQ7DT 3&5 5HDFWLRQ %XIIHU P0 7ULFLQH.2+ S+ P0 .2$F P0 0J2$Ff DQG SJP/ %RYLQH 6HUXP $OEXPLQf SULPHUV DV OLVWHG DERYH S0f DQG G173V P0f DQG $GYDQWDJH .OHQ7DT 3RO\PHUDVH 0L[ &ORQWHFK 3DOR $OWR &$f 7KHUPDO SDUDPHWHUV RI WKH UHDFWLRQV LQFOXGHG D PLQ ; r& SUHVRDN IROORZHG E\ r& ; VHF GHQDWXUDWLRQ DQG r& ; PLQ H[WHQVLRQ ZLWK D ILQDO H[WHQVLRQ RI PLQ 7KH QXPEHUV RI F\FOHV ZHUH VSHFLILF WR HDFK H[SHULPHQW DQG DUH LQGLFDWHG LQ WKH OHJHQGV 3&5 UHDFWLRQV ZHUH SXULILHG IRU VHTXHQFLQJ E\ SKHQROFKORURIRUP f H[WUDFWLRQ DQG WZR ; PLQ FHQWULIXJDWLRQ VWHSV LQ 8OWUDIUHH0& 10:/ UHJHQHUDWHG FHOOXORVH FROXPQV 0LOOLSRUH %HGIRUG 0$f 'XH WR ORZ \LHOG RI WKH +.DO 3&5 UHDFWLRQ D F\FOH UHDFWLRQ ZDV FDUULHG RXW WR JHQHUDWH SURGXFW IRU VHTXHQFLQJ 6HTXHQFLQJ RI 3&5 SURGXFWV ZDV FDUULHG RXW E\ WKH 8) ,&%5 '1$ 6HTXHQFLQJ &RUH *HQRPLF 3&5 7R DPSOLI\ JHQRPLF '1$ IRU VHTXHQFLQJ WHPSODWH XVHG ZDV SJ &ORQWHFK 5DEELW *HQRPLF '1$ &ORQWHFK .OHQO DT $GYDQWDJH 3&5 0L[ ZDV XVHG ZLWK FRPSRQHQWV DQG

PAGE 46

7DEOH 3&5 SULPHU SDLUV ,VRIRUP 1XFOHRWLGHV 6HQVH 3ULPHU 6HULDO $QWLVHQVH 3ULPHU 6HULDO +.D &7*&$&&*$&$7777&&&*7&&* %& 7*&&7***&$$&$*&*$$&&&$ %& +.DD 7*&&&*&&*$&&&*&**&*&&7&&$ %& 7$7&7*7$*&7*&$7**7*&7&&$& %& +.DD $*$5$777$<7&<*75*$5&7& %& 77*$7*$7&7&7****7&7* %& +.DD 0***$<**1&&7 $$<5&1&7 %& $$*$7*$7**&*7&&$**$& %& +.DD &$7&$7777&77&$7&$<&*& %& *&77*7&$77***$7&77&& %& +.DD $7&7*&7&1*$&$$5$&1** %& 7&1****&1&&<77&$7&$& %& +.DD &&*$&$&*$*7*$$*$&$$7 %& *&77*7&$77***$7&77&& %& +.DD **$$*$7&&&$$7*$&$$*& %& 7&&&$&&$*&71&&:***<$ %& +.DF &**$*$$$$*7*&7$*$&7**$*&7 %& $*$*7*&$$7$&&**&&&&$**7** %& +.3 7 $$**&&$*$&*7*7$7*** %& 7*7&*$$**7&$&*7*$7&* %& 1RWH 1RWDWLRQ LV WKDW RI WKH ,QWHUQDWLRQDO 8QLRQ RI %LRFKHPLVWU\ 1RPHQFODWXUH &RPPLWWHH 1ADQ\ EDVH 5 $ RU 0 $ RU & : $ RU 7 DQG < & RU 7

PAGE 47

FRQFHQWUDWLRQV VSHFLILHG LQ WKH GHVFULSWLRQ RI573&5 DERYH 3ULPHUV ZHUH $&&&*&**&*&&7&&$*&*&*$&$7 QXFOHRWLGHV %&f ORFDWHG LQ WKH ILUVW H[RQ RI +.RFD DQG 7$7&7*7$*&7*&$7**7*&7&&$& QXFOHRWLGHV %&f ORFDWHG LQ WKH VHFRQG H[RQ RI +.DD 7KHUPDO SDUDPHWHUV RI WKH UHDFWLRQV LQFOXGHG D PLQ ; r& SUHVRDN IROORZHG E\ F\FOHV RIr& ; VHF GHQDWXUDWLRQ DQG r& ; PLQ H[WHQVLRQ F\FOHV RI r& ; VHF GHQDWXUDWLRQ DQG r& ; PLQ H[WHQVLRQ DQG F\FOHV RIr& ; VHF GHQDWXUDWLRQ DQG r& ; PLQ H[WHQVLRQ ZLWK D ILQDO H[WHQVLRQ RI PLQ 5HDFWLRQV ZHUH KHOG DW r& RYHUQLJKW EHIRUH OLJDWLRQ RI WKH SURGXFWV LQWR WKH S&5 YHFWRU 7KH OLJDWLRQ PL[WXUH ZDV WUDQVIRUPHG LQWR 2QH6KRW ( FROL FHOOV XWLOL]LQJ WKH 72327$ &ORQLQJ .LW ,QYLWURJHQ 6DQ 'LHJR &$f ( FROL FHOOV FRQWDLQLQJ WKH SODVPLG RI LQWHUHVW ZHUH JURZQ RYHUQLJKW LQ D P/ FXOWXUH DQG SODVPLGV LVRODWHG XVLQJ WKH 4LD3UHS 6SLQ 0LQL .LW 6HTXHQFLQJ RI SODVPLGV ZDV FDUULHG RXW E\ WKH 8) ,&%5 '1$ 6HTXHQFLQJ &RUH n 5$&( $ n 5$&( UHDFWLRQ ZDV FDUULHG RXW DV GHVFULEHG E\ 'DYLV HO DO P51$ ZDV SUHSDUHG IURP UDEELW UHQDO FRUWH[ WRWDO 51$ XVLQJ WKH 3RO\$7WUDFW 3URPHJD 0DGLVRQ :,f V\VWHP $ UHYHUVH WUDQVFULSWLRQ UHDFWLRQ ZDV FDUULHG RXW DV LQ WKH 573&5 PHWKRG GHVFULEHG DERYH XVLQJ SJ P51$ DV WHPSODWH DQG SJ SULPHU *$&7&*$*7&*$&$7&*$>7@L %&f 7KH FRPSOHPHQWDU\ VWUDQG ZDV QH[W V\QWKHVL]HG XVLQJ S/ RI 57 UHDFWLRQ DORQJ ZLWK SJ RI VHQVH SULPHU 7*&**$$$&7&7&$7&$** QXFOHRWLGHV %&f LQ D UHDFWLRQ YROXPH RI S/ WKDW FRQWDLQHG WKH IROORZLQJ FRPSRQHQWV 3&5 %XIIHU P0 7ULV+&O S+

PAGE 48

P0 .&,f 0J&) P0f G173V P0f RYHUODLG ZLWK S/ PLQHUDO RLO $IWHU D r& LQFXEDWLRQ IRU PLQ WKH WHPSHUDWXUH ZDV ORZHUHG WR r& DQG 8 7DT '1$ 3RO\PHUDVH ZDV DGGHG $ PLQ DQQHDOLQJ SKDVH IROORZHG DW r& WKHQ WKH FRPSOHPHQWDU\ VWUDQG ZDV H[WHQGHG DW r& IRU PLQ $QWLVHQVH SULPHU SJ *$&7&*$*7&*$&$7&* %&f ZDV DGGHG DQG D 3&5 UHDFWLRQ ZDV LQLWLDWHG ZLWK D r& ; VHF GHQDWXUDWLRQ IROORZHG E\ D r& ; PLQ DQQHDO DQG D r& ; PLQ H[WHQVLRQ IRU D WRWDO RI F\FOHV )LQDO H[WHQVLRQ ZDV IRU D GXUDWLRQ RI PLQ 5HDFWLRQV ZHUH KHOG DW r& RYHUQLJKW EHIRUH FORQLQJ 3&5 SURGXFWV LQWR WKH S&5 ,, YHFWRU XWLOL]LQJ WKH 7$ &ORQLQJ .LW ,QYLWURJHQ 6DQ 'LHJR &$f SHU PDQXIDFWXUHU LQVWUXFWLRQV 7KH OLEUDU\ RI FORQHV SURGXFHG LQ WKLV PDQQHU ZDV VFUHHQHG XVLQJ DQ ROLJR &7&7$&&&7**&$*&7**7* QXFOHRWLGHV %&f f ODEHOHG XVLQJ WKH (&/ NLW $PHUVKDP $UOLQJWRQ +HLJKWV ,/f 6HTXHQFLQJ ZDV FDUULHG RXW E\ WKH 8) ,&%5 '1$ VHTXHQFLQJ FRUH n 5$&( $ n 5$&( UHDFWLRQ ZDV SHUIRUPHG XVLQJ WKH 0DUDWKRQ F'1$ $PSOLILFDWLRQ .LW &ORQWHFK 3DOR $OWR &$f IROORZLQJ PDQXIDFWXUHUfV LQVWUXFWLRQV ZLWK WKH IROORZLQJ PRGLILFDWLRQV 57 UHDFWLRQV ZHUH FDUULHG RXW XVLQJ SJ WRWDO 51$ RI UDEELW UHQDO FRUWH[ LQFXEDWHG ZLWK WKH JHQHVSHFLILF SULPHU 77*&&$7&7&*&&&&7&&77 QXFOHRWLGHV %&f IRU PLQ DW r& WKHQ DW r& IRU PLQ 3&5 UHDFWLRQV ZHUH FDUULHG RXW XVLQJ WKH DQFKRU SULPHU &&$7&&7$$7$&*$&7&$&7$7$***& $3,f LQFOXGHG LQ WKH 0DUDWKRQ NLW SDLUHG ZLWK JHQHVSHFLILF SULPHU 7$7&7*7$*&7*&$7**7*&7&&$& QXFOHRWLGHV %&f &RQFHQWUDWLRQV

PAGE 49

DQG FRPSRQHQWV RI WKH UHDFWLRQV ZHUH GHWDLOHG DERYH IRU XVH RI &ORQWHFK .OHQ7DT $GYDQWDJH 3RO\PHUDVH 0L[ 7KHUPDO SDUDPHWHUV RI WKH UHDFWLRQV LQFOXGHG D PLQ ; r& SUHVRDN IROORZHG E\ F\FOHV RI r& ; VHF GHQDWXUDWLRQ DQG & ; PLQ H[WHQVLRQ F\FOHV RI r& ; VHF GHQDWXUDWLRQ DQG r& ; PLQ H[WHQVLRQ DQG F\FOHV RI r& ; VHF GHQDWXUDWLRQ DQG r& ; PLQ H[WHQVLRQ ZLWK D ILQDO H[WHQVLRQ RI PLQ (YDOXDWLRQ RI 3&5 SURGXFWV 3&5 SURGXFWV ZHUH DQDO\]HG E\ DJDURVH JHO HOHFWURSKRUHVLV S/ RI UHDFWLRQV ZHUH UXQ DORQJ ZLWK P/ '1$ ORDGLQJ G\H b JO\FHURO b [\OHQH F\DQRO b EURPRSKHQRO EOXHf RQ D b DJDURVH JHO LQ 7$( EXIIHU 7ULV P0 DFHWLF DFLG P0 ('7$ P0f /RZ '1$ 0DVV /DGGHU *LEFR %5/f ZDV HOHFWURSKRUHVHG DORQJVLGH 3&5 SURGXFWV WR TXDQWLWDWH '1$ FRQFHQWUDWLRQ DQG ES ODGGHU *LEFR %5/f WR HYDOXDWH WKH VL]H RI WKH SURGXFWV ,Q VRPH FDVHV SURGXFWV ZHUH QRW YLVLEOH DIWHU HWKLGLXP EURPLGH VWDLQLQJ VR 6RXWKHUQ EORWWLQJ ZDV XVHG WR YLVXDOL]H WKH SURGXFWV 3URFHGXUHV IROORZHG ZHUH DV GHVFULEHG E\ 'DYLV HW DL f $IWHU UXQQLQJ SURGXFWV RQ JHOV DV GHVFULEHG DERYH JHOV ZHUH VRDNHG PLQ LQ GHQDWXUDWLRQ VROXWLRQ 0 1D&O 0 1D2+f DQG PLQ LQ QHXWUDOL]DWLRQ EXIIHU 0 DPPRQLXP DFHWDWH 0 1D2+f &DSLOODU\ WUDQVIHU LQ QHXWUDOL]DWLRQ VROXWLRQ DQG EDNLQJ ; KU ZDV XWLOL]HG WR DGKHUH '1$ WR Q\ORQ PHPEUDQH +\ERQG 1f 3UREHV WR K\EULGL]H VSHFLILFDOO\ WR WKH H[SHFWHG SURGXFWV 7DEOH f ZHUH FUHDWHG XVLQJ 573&5 ZLWK UDEELW UHQDO FRUWH[ DV WHPSODWH FORQLQJ WKH LQVHUWV XVLQJ WKH 7$ &ORQLQJ .LW DV GHVFULEHG DERYH ,QVHUWV ZHUH VHTXHQFHG WR FRQILUP WKHLU LGHQWLW\ 3UREHV ZHUH ODEHOOHG XVLQJ WKH (&/ 'LUHFW 6\VWHP$PHUVKDPf IROORZLQJ PDQXIDFWXUHUV LQVWUXFWLRQV ([SRVXUH

PAGE 50

WR +\SHUILOP (&/ $PHUVKDPf IRU D SHULRG RI WZR KU ZDV UHTXLUHG WR YLVXDOL]H WKH UHVXOWV RI 3&5 UHDFWLRQV %LRFKHPLVWU\ 3UHSDUDWLRQ RI PHPEUDQH SURWHLQ IURP WLVVXH FXOWXUH FHOOV 7ZR FOXVWHUV RI VL[ ZHOOV HDFK ZHUH XVHG IRU HDFK H[SHULPHQWDO FRQGLWLRQ WKLV W\SLFDOO\ \LHOGHG SJ RI SURWHLQ $OO VROXWLRQV DQG JODVV GRXQFHUV DUH FRROHG RQ LFH DQG FHQWULIXJHV DUH HLWKHU UHIULJHUDWHG RU ORFDWHG LQ FROG URRPV &HOOV DUH KHOG RQ LFH DW DOO WLPHV &HOOV ZHUH ULQVHG LQ 3%6 FRQWDLQLQJ P0 306) P/ LQ WRS ZHOO RI 7UDQVZHOO P/ LQ ERWWRP ZHOO )ROORZLQJ DVSLUDWLRQ RI WKH ULQVH VROXWLRQ WR HDFK VLQJOH ZHOO ZDV DGGHG P/ 3%6 P0 306) P0 ('7$ $ FHOO VFUDSHU ZDV XVHG WR GLVORGJH FHOOV IURP WKH LQVHUW 7KLV VROXWLRQ FRQWDLQLQJ FHOOV ZDV SLSHWWHG IURP RQH ZHOO WR WKH QH[W GLVORGJLQJ DQG JDWKHULQJ DOO WKH FHOOV IURP RQH FOXVWHU 7KLV ZDV UHSHDWHG ZLWK D IUHVK P/ VROXWLRQ RQ WKH VDPH FOXVWHU WR UHPRYH DQ\ UHPDLQLQJ FHOOV 7KH WZR SDVVHV FRPELQHG IRU D WRWDO RI P/ DQG WKH RWKHU FOXVWHUV ZHUH SURFHVVHG LQ WKH VDPH PDQQHU &HOOV ZHUH VSXQ LQ D FHQWULIXJH IRU PLQ DW ; J WR UHPRYH FHOOXODU GHEULV 6XSHUQDWDQW ZDV GLVFDUGHG DQG WKH SHOOHW ZDV UHVXVSHQGHG LQ VZHOOLQJ EXIIHU WULV P0 S+ P0 ('7$ P0 306) S0 DSURWLQLQ S0 OHXSHSWLQ S0 SHSVWDWLQf IRU PLQ &HOOV ZHUH KRPRJHQL]HG E\ VWURNHV LQ D JODVV GRXQFHU $IWHU PRYLQJ FHOOV EDFN WR D PLFURIXJH WXEH P/ RI ; VDOWV P0 1D&O P0 0J&O P0 7ULV S+ f ZDV DGGHG EHIRUH YRUWH[LQJ 0L[WXUH ZDV VSXQ LQ D FHQWULIXJH IRU PLQXWH DW ; J WR UHPRYH QXFOHL 6XSHUQDWDQW ZDV UHWDLQHG DQG VSXQ LQ D FHQWULIXJH IRU PLQ DW

PAGE 51

; J 6XSHUQDWDQW ZDV UHWDLQHG DQG VSXQ LQ D FHQWULIXJH IRU PLQ DW ; J &HOOV ZHUH UHVXVSHQGHG LQ S/ UHVXVSHQVLRQ EXIIHU YROXPH VZHOOLQJ EXIIHU YROXPH ; VDOWVf DQG VWRUHG DW r& 3UHSDUDWLRQ RI PHPEUDQH SURWHLQ IURP UDEELW WLVVXHV .LGQH\ GLVWDO FRORQ DQG VWRPDFK WLVVXHV ZHUH REWDLQHG LQ WKH VDPH PDQQHU DV IRU 51$ LVRODWLRQ &DUH ZDV WDNHQ WR PDLQWDLQ VROXWLRQV DQG DSSDUDWXV LFH FROG 7ZR UDEELW GLVWDO FRORQV ZHUH UHTXLUHG SHU SUHSDUDWLRQ WR \LHOG XVHIXO FRQFHQWUDWLRQV RI SURWHLQ 7LVVXHV ZHUH KRPRJHQL]HG IRU VHFRQGV DW USP VHWWLQJ RQ 2PQL6RUYDOO WLVVXH KRPRJHQL]HUf LQ %XIIHU $ P0 VXFURVH P0 7ULV S+ P0 ('7$ P0 306)f $IWHU DOORZLQJ VHFRQGV IRU VHWWOLQJ KRPRJHQL]DWLRQ ZDV UHSHDWHG 7KUHH YROXPHV EXIIHU % P0 VXFURVH P0 7ULV S+ P0 ('7$ P0 306)f ZHUH DGGHG WKHQ KRPJHQDWH VSXQ LQ D FHQWULIXJH IRU PLQ DW ; J 7KH VXSHUQDWDQW ZDV VXEMHFWHG WR FHQWULIXJDWLRQ IRU PLQ DW ; J WKUHH WLPHV )LQDO FHQWULIXJDWLRQ ZDV IRU KU DW ; J $IWHU GLVFDUGLQJ VXSHUQDWDQW SHOOHW ZDV UHVXVSHQGHG LQ S/ ORDGLQJ VROXWLRQ P0 7ULV P0 0J&E P0 1D&Of $IWHU WUDQVIHUULQJ UHVXVSHQGHG SHOOHW WR JODVV GRXQFHU GRXQFH LV GURSSHG LQWR WKH GRXQFHU WXUQHG WKUHH WLPHV WKHQ UDLVHG DQG GURSSHG DJDLQ 7KLV ZDV GRQH WHQ WLPHV 7KH UHVXOWDQW SUHSDUDWLRQ ZDV VWRUHG DW r& $QWLERGLHV 3HSWLGHV XVHG DV LPPXQRJHQV ZHUH GHVLJQHG IRU PD[LPXP DQWLJHQLFLW\ DQG PLQLPXP KRPRORJ\ WR RWKHU SURWHLQV $YRLGLQJ KRPRORJ\ WR RWKHU 3W\SH $73DVHV ZDV SDUWLFXODUO\

PAGE 52

LPSRUWDQW 5DEELW +.$73DVH FDWDO\WLF VXEXQLW VHTXHQFHV ZHUH VFDQQHG XVLQJ WKH FRPSXWHU SURJUDP 3(37'(6758&785( *HQHWLFV &RPSXWHU *URXS f WR ILQG UHJLRQV UHODWLYHO\ KLJK LQ FKDUJHG K\GURSKLOLF UHVLGXHV -DPHVRQ DQG :ROI f 6XFK UHJLRQV ZHUH WKHQ VHDUFKHG E\ %/$67 $OWVFKXO HO DO f WR HOLPLQDWH WKRVH WKDW FRXOG EH SUHGLFWHG WR FURVVUHDFW ZLWK RWKHU SURWHLQV 2QFH WKHVH FRQVWUDLQWV ZHUH PHW WKH FDQGLGDWH VHTXHQFHV ZHUH H[DPLQHG XVLQJ WKH SURJUDP 027,)6 *HQHWLFV &RPSXWHU *URXS %DLURFK DQG $SZHLOHU f WR HQVXUH WKDW WKHUH ZHUH QR SRWHQWLDO VLWHV IRU SURWHLQ PRGLILFDWLRQ WKDW PLJKW DIIHFW UHDFWLYLW\ ,Q WKH FDVH RI +.RWL DQG +.DD WKHUH ZDV RQO\ RQH UHJLRQ WKDW VDWLVIDFWRULO\ PHW DOO RI WKHVH FULWHULD ,Q WKH FDVH RI +.DF WKHUH ZHUH WZR RQH EHLQJ WKH UHJLRQ LQ FRPPRQ ZLWK +.DD WKH RWKHU LQ WKH H[WHQGHG DPLQR WHUPLQDO UHJLRQ RI +.DF QRW FRQWDLQHG LQ +.DD 3HSWLGHV ZHUH V\QWKHVL]HG ZLWK DQ 1WHUPLQDO F\VWHLQH DQG FRQMXJDWHG WR NH\KROH OLPSHW KHPRF\DQLQ 8) ,&%5 3URWHLQ &RUHf XVLQJ WKH 3LHUFH 5RFNIRUG ,/f ,PMHFW V\VWHP 7KUHH SHSWLGHV ZHUH XVHG DV LPPXQRJHQV WKH ILUVW ZDV GHVLJQHG WR UHDFW ZLWK D SRUWLRQ RI +.DL WKH VHFRQG ZDV GHVLJQHG WR UHFRJQL]H D SRUWLRQ RI +.D IRXQG LQ ERWK +.DD DQG +.DF WKH WKLUG WR D SRUWLRQ XQLTXH WR +.DF 7KH SHSWLGH FKRVHQ IRU +.RWL FRUUHVSRQGHG WR DPLQR DFLGV &/
PAGE 53

SURGXFH DQWLVHUD 3UHLPPXQH VHUD ZDV FROOHFWHG SULRU WR LQLWLDO LQQRFXODWLRQ
PAGE 54

SXULILHG IURP HJJ \RON ZHUH XVHG DW D GLOXWLRQ RI WKH DQWLFKLFNHQ ,J
PAGE 55

7DEOH 6ROXWLRQV IRU GHWHUPLQDWLRQ RI S+ 6ROXWLRQV 1D&O &KROLQH &O $PPRQLD &O .& R .+3 3KRVSKRULF DFLG 1DDFHWDWH $FHWLF DFLG &D&O 0J6 $ODQLQH *OXFRVH +(3(6 1RWH &RQFHQWUDWLRQ XQLWV DUH LQ P0 2VPRODOLW\ ZDV DGMXVWHG WR s PRVPRONJ + E\ DGGLWLRQ RI WKH SULQFLSDO VDOW S+ ZDV DGMXVWHG WR s E\ DGGLWLRQ RI WHWUDPHWK\ODPPRQLXP2+ 6ROXWLRQV ZHUH EXEEOHG ZLWK b

PAGE 56

/:' OHQV RQ D 1LNRQ 'LDSOLRW70' LQYHUWHG PLFURVFRSH ([FLWDWLRQ OLJKW ZDV SURYLGHG E\ D : PHUFXU\ ODPS 7KH OLJKW ZDV VSOLW LQWR WZR EHDPV E\ D QP ORZSDVV GLFKURLF PLUURU 7KH WZR VSOLW OLJKW EHDPV WKHQ SDVVHG WKURXJK ILOWHUV WR \LHOG EHDPV RI WKH GHVLUHG ZDYHOHQJWKV 7KH WUDQVPLWWHG OLJKW SDWK FRQWDLQHG D QP ILOWHU WKH UHIOHFWHG OLJKW SDWK FRQWDLQHG D QP ILOWHU &RPSXWHUDFWXDWHG VKXWWHUV RQ HDFK OLJKW SDWK DOWHUQDWHG WKH LQFLGHQW OLJKW ZDYHOHQJWKV DQG PLQLPL]HG WKH WLPH WKH FHOOV ZHUH VXEMHFWHG WR WKH KLJK LQWHQVLW\ OLJKW 7KH WZR OLJKW EHDPV ZHUH UHFRPELQHG E\ D VHFRQG QP ORZSDVV GLFKURLF PLUURU /LJKW ZDV GLUHFWHG WR WKH PLFURVFRSH VWDJH E\ D QP KLJKSDVV PLUURU DQG WKH HPLWWHG OLJKW ZDV GLUHFWHG WR D 9LGHRVFRSH .6 LPDJH LQWHQVLILHU FRXSOHG WR D 'DJH &&' FDPHUD %HFDXVH WKH RSWLFV QHFHVVDU\ WR LPDJH FHOOV JURZQ RQ LQVHUWV UHTXLUHG UHODWLYHO\ LQWHQVH LQFLGHQW OLJKW PHDVXUHPHQW IUHTXHQF\ ZDV OLPLWHG WR DYRLG SKRWRWR[LFLW\ 7KHUHIRUH PHDVXUHPHQWV ZHUH PDGH DW VHFRQG LQWHUYDOV ,PDJHV ZHUH GLJLWL]HG DQG VWRUHG E\ FRPSXWHU DOORZLQJ VXEVHTXHQW DQDO\VLV RI VLQJOH FHOOV XVLQJ WKH ,PDJH )/ VRIWZDUH SDFNDJH 8QLYHUVDO ,PDJLQJ &RUS :HVWFKHVWHU 3$f 'XULQJ PHDVXUHPHQWV FHOOV ZHUH FRQVWDQWO\ SHUIXVHG DW D UDWH RI a P/PLQ E\ +(3(6EXIIHUHG VROXWLRQV WKDW ZHUH FRQWLQXRXVO\ EXEEOHG E\ b DQG KHDWHG WR EH GHOLYHUHG DW D WHPSHUDWXUH RI & 6ZLWFKHV IRU WKH YDULRXV VROXWLRQV ZHUH ORFDWHG SK\VLFDOO\ QHDU WKH LQSXW WR WKH FHOO FKDPEHU WR PLQLPL]H WKH WLPH UHTXLUHG WR VZLWFK VROXWLRQV DQG IOXLG ZDV FRQWLQXRXVO\ UHPRYHG IURP WKH RSSRVLWH VLGH RI WKH FKDPEHU E\ YDFXXP VXFWLRQ )RU VRPH H[SHULPHQWV WKH DSLFDO VLGH RI WKH FHOOV ZDV SHUIXVHG E\ GLIIHUHQW VROXWLRQV WKDQ WKH EDVRODWHUDO VLGH RI WKH FHOOV E\ XWLOL]LQJ VHSDUDWH LQSXW WXEHV LQ WKH XSSHU DQG ORZHU FKDPEHUV RI WKH 7UDQVZHOO LQVHUWV

PAGE 57

&HOOV ZHUH DFLGORDGHG XVLQJ WKH 1+B_& SUHSXOVH WHFKQLTXH %ULHIO\ FHOOV ZHUH LQFXEDWHG ZLWK LQ0 1+;O HTXLPRODU VXEVWLWXWLRQ IRU 1D&Of IRU PLQ WKHQ DPPRQLXP FKORULGH ZDV UHPRYHG IURP WKH SHUIXVLQJ VROXWLRQ $GGLWLRQ RI LQKLELWRUV RU UHPRYDO EHJDQ DW WKH VWDUW RI WKH DPPRQLXP SUHSXOVH 7KH HWK\OLVRSURSODPLORULGH (,3$f VWRFN VROXWLRQ ZDV P0 LQ GLPHWK\O VXOIR[LGH '062f DQG 6FK ZDV P0 LQ '062 (,3$ ZDV REWDLQHG IURP 5HVHDUFK %LRFKHPLFDOV ,QWHUQDWLRQDO 1DWLFN 0$f DQG 6FK ZDV WKH NLQG JLIW RI 'U -DPHV .DPLQVNL DW 6FKHULQJ &RUSRUDWLRQ %ORRPILHOG 1-f ,QKLELWRUV ZHUH VWRUHG DV VWRFN VROXWLRQV DW r& DQG GLOXWHG LQWR WKH VROXWLRQV LQGLFDWHG LPPHGLDWHO\ SUHFHGLQJ WKHLU XVH &DOLEUDWLRQ RI WKH S+ PHDVXUHG E\ %&(&) IOXRUHVFHQFH ZDV FDUULHG RXW E\ WKH QLJHULFLQ FDOLEUDWLRQ WHFKQLTXH RI 7KRPDV HO DW f &DOLEUDWLRQ VROXWLRQV P0 .& P0 &D&E P0 0J&K P0 +(3(6 S0 QLJHULFLQf ZHUH DGMXVWHG WR DQG S+ XQLWV XVLQJ 0 1D2+ DQG +& &HOOV ZHUH LQFXEDWHG ZLWK HDFK VROXWLRQ IRU D PLQLPXP RI WKUHH PLQ DQG WKUHH IOXRUHVFHQFH UDWLR PHDVXUHPHQWV ZHUH WDNHQ DW HDFK S+ 6WDWLVWLFDO PHWKRGV S+c UHFRYHU\ UDWHV IRU LQGLYLGXDO FHOOV ZHUH FDOFXODWHG XVLQJ OHDVWVTXDUHV OLQHDU UHJUHVVLRQ 5DWHV ZHUH FDOFXODWHG IRU WKH SHULRG EHJLQQLQJ WZR PLQ DIWHU 1+&, ZLWKGUDZDO DOORZLQJ WLPH IRU FHOOV WR HTXLOLEUDWH DIWHU DFLGLILFDWLRQ DQG HQGLQJ ZLWK 1D DGGLWLRQ RU (,3$ ZLWKGUDZDO 'DWD ZHUH FROOHFWHG IRU LQGHSHQGHQW H[SHULPHQWV LQYROYLQJ VHSDUDWH SDVVDJHV RI FHOOV S+ UHFRYHU\ UDWHV IRU HDFK H[SHULPHQWDO FRQGLWLRQ ZHUH SUHVHQWHG DV WKH PHDQ RI WKH UDWHV GHWHUPLQHG IRU WKH LQGLYLGXDO H[SHULPHQWV s 6( &HOOV

PAGE 58

ZLWKRXW 1D+ H[FKDQJHU DFWLYLW\ GHILQHG DV DQ LQFUHDVH LQ S+ UHFRYHU\ ZLWK (,3$ UHPRYDO ZHUH FODVVLILHG DV QRQYLDEOH DQG H[FOXGHG IURP IXUWKHU DQDO\VLV 3 E\ 6WXGHQWfV WHVW ZDV WDNHQ DV VLJQLILFDQW

PAGE 59

+.$73$6( 68%81,76 ,1 7+( 5$%%,7 5(1$/ 0('8//$5< &2//(&7,1* '8&7 ,QWURGXFWLRQ 7KHUH DUH PXOWLSOH +.$73DVH VXEXQLW LVRIRUPV WKDW DUH LQYROYHG LQ FRXSOHG + IRU DFWLYH H[FKDQJH LQ WKH NLGQH\ 7KHVH QRZ LQFOXGH WKH 1D.3L VXEXQLW WKDW LV WKH QHZO\ UHFRJQL]HG SDUWQHU IRU WKH +.DD VXEXQLW LQ DGGLWLRQ WR LWV ORQJNQRZQ UROH DV SDUWQHU WR 1D.DL ,Q DGGLWLRQ WR WKH FRPSOH[LW\ LQYROYHG LQ KDYLQJ PXOWLSOH +.$73DVH LVRIRUPV SUHVHQW WKHUH LV WKH SRVVLELOLW\ RI YDULDQW WUDQVFULSWV RI HDFK +.$73DVH VXEXQLW 'LIIHUHQFHV LQ SRO\DGHQ\ODWLRQ VLWHV WUDQVFULSWLRQ VWDUW VLWHV DQG DOWHUQDWLYH VSOLFLQJ LQ D WLVVXHVSHFLILF PDQQHU PLJKW IXUWKHU FRPSOLFDWH WKH SLFWXUH :KHQ UDW +.S VXEXQLW ZDV RULJLQDOO\ VHTXHQFHG PXOWLSOH WUDQVFULSWLRQDO VWDUW VLWHV ZHUH REVHUYHG E\ SULPHU H[WHQVLRQ H[SHULPHQWV 1HZPDQ DQG 6KXOO f ,W ZDV QRW NQRZQ ZKDW UROH WKHVH YDULRXV WUDQVFULSWLRQDO VWDUW VLWHV SOD\ :KHQ WKH &DLQ :LQJR DQG 1LFN ODERUDWRULHV GLG SUHOLPLQDU\ VWXGLHV FRQFHUQLQJ WKH UHJXODWLRQ E\ VWDWXV RI WKH +.3 VXEXQLW LQ UDEELWV LW ZDV QRWHG WKDW RQ VRPH QRUWKHUQ EORWV RI UHQDO WLVVXHV +.3 VXEXQLW P51$ DSSHDUHG DV D GRXEOHW 7KLV ZDV HYLGHQFH IRU D VHFRQG +.$73DVH VXEXQLW WUDQVFULSW SUHVHQW DW D OHYHO FRPSDUDEOH WR WKH SULPDU\ WUDQVFULSW +HUH ZH VKRZ WKDW WKHUH LV D YDULDQW +.S VXEXQLW P51$ WKDW LV H[SUHVVHG LQ UHQDO PHGXOOD DQG QRW LQ UHQDO FRUWH[ RU VWRPDFK :H KDYH GHVLJQDWHG WKH YDULDQW P51$

PAGE 60

+.3f 7KH +.3f WUDQVFULSW LV IRXQG LQ PHGXOOD DW D OHYHO FRPSDUDEOH WR WKH TXDQWLW\ RI WKH +.3 VXEXQLW DQG WKH WUDQVODWLRQ VWDUW VLWH LV XQFKDQJHG VR ERWK +.3 DQG +.3f HQFRGH WKH VDPH SURWHLQ +.3f PD\ EH WKH SURGXFW RI DOWHUQDWLYH VSOLFLQJ 5HQDO 0HGXOOD +.% P51$ 9DULDQW ,Q RUGHU WR LQYHVWLJDWH WKH GRXEOHW EDQG LQ QRUWKHUQV SUREHG ZLWK +NS F'1$ SUREHV 51$ ZDV SUHSDUHG IURP VWRPDFK UHQDO FRUWH[ DQG VWRPDFK ,Q QRUWKHUQ DQDO\VHV )LJXUH f LQYROYLQJ WZHQW\ GLIIHUHQW UDEELWV LQ H[SHULPHQWV VSDFHG RYHU VHYHUDO \HDUV RQO\ VLQJOH WUDQVFULSWV ZHUH REVHUYHG LQ HLWKHU JDVWULF RU UHQDO FRUWLFDO WLVVXHV *DVWULF DQG UHQDO FRUWLFDO WUDQVFULSWV DSSHDUHG WR EH RI LGHQWLFDO VL]H +RZHYHU LQ UHQDO PHGXOODU\ WLVVXHV D GRXEOHW ZDV XQLYHUVDOO\ YLVLEOH 1RUWKHUQ DQDO\VLV VKRZHG WKDW WKH VPDOOHU RI WKH WZR PHGXOODU\ +.3 WUDQVFULSWV ZDV WKH VDPH VL]H DV LQ WKH RWKHU WZR WLVVXHV DQG WKH VHFRQG UHQDO PHGXOODU\ WUDQVFULSW ZDV ODUJHU 7KH TXDQWLW\ RI WKH VHFRQG P51$ +.3f ZDV JHQHUDOO\ FRPSDUDEOH WR WKH TXDQWLW\ RI +.3 P51$ ,Q RUGHU WR GHWHUPLQH WKH PROHFXODU QDWXUH RI WKH GLIIHUHQW WUDQVFULSWV RI WKH PHGXOOD f DQG f 5$&( H[SHULPHQWV ZHUH FRQGXFWHG XVLQJ P51$ LVRODWHG IURP UDEELW UHQDO PHGXOOD 7KH UDEELW 51$ ZDV VHOHFWHG IURP WKRVH WKDW VKRZHG SURPLQHQW +.3 VXEXQLW XSSHU EDQGV E\ QRUWKHUQ DQDO\VLV EHFDXVH WKHVH ZRXOG KDYH D KLJKHU DEXQGDQFH RI WKH QRYHO WUDQVFULSW 5HSUHVHQWDWLYH 3&5 SURGXFWV JHQHUDWHG E\ WKH f DQG f 5$&( H[SHULPHQW DUH VKRZQ LQ )LJXUH 3&5 RIWHQ f 5$&( SURGXFWV VHTXHQFHG DOO ZHUH WKH VDPH DQG DOO H[WHQGHG WR ZLWKLQ ES RI WKH SXEOLVKHG +.3 F'1$ VHTXHQFH 5HXEHQ HW DO f 7HQ f 5$&( SURGXFWV ZHUH DOVR VHTXHQFHG 1LQH RI WKHVH ZHUH VLPLODU WR

PAGE 61

NES )LJXUH 1RUWKHUQ DQDO\VLV VKRZLQJ SUHVHQFH RI +.3 P51$ LQ UHQDO FRUWH[ UHQDO PHGXOOD DQG VWRPDFK 7KH H[LVWHQFH RI WZR P51$ VSHFLHV ZDV FOHDUO\ YLVLEOH LQ UHQDO PHGXOOD ZKHUHDV D VLQJOH P51$ VSHFLHV ZDV GHWHFWHG LQ VWRPDFK DQG UHQDO FRUWH[ *$3'+ ZDV XVHG WR VKRZ WKH FRQGLWLRQ RI WKH 51$ VDPSOHV

PAGE 62

)LJXUH n DQG n 5$&( UHDFWLRQV WR DPSOLI\ +. F'1$V XVLQJ UDEELW UHQDO PHGXOOD 51$ DV WHPSODWH

PAGE 63

WKH SXEOLVKHG +. F'1$VHTXHQFH +RZHYHU DOO HQGHG DSSUR[LPDWHO\ ES IURP WKH f HQG RI WKH SXEOLVKHG VHTXHQFH PDNLQJ LW LPSRVVLEOH WR FRQILUP WKH H[WUHPH f HQG RI WKH VHTXHQFH 2QH RI WKH VHTXHQFHV KDG D YHU\ GLIIHUHQW f HQG WKDQ WKH RWKHUV ,Q WKDW VHTXHQFH )LJXUH $f WKH ILUVW ES RI WKH SXEOLVKHG +.3 VHTXHQFH ZDV QRW IRXQG DQG LQ LWV SODFH WKHUH ZDV D GLIIHUHQW ES UHJLRQ )LJXUH %f 7KH VHTXHQFH ZDV FRQILUPHG E\ f 5$&( XVLQJ D SULPHU VSHFLILF WR WKH YDULDQW H[WHQVLRQ &&&7*&$&&&&*$&7*$** QXFOHRWLGHV %&f 7R H[DPLQH WKH SRVVLELOLW\ WKDW WKLV UHQDO PHGXOODVSHFLILF WUDQVFULSW PLJKW EH UHJXODWHG E\ VWDWXV LQ UDEELWV QRUWKHUQ DQDO\VLV ZDV FDUULHG RXW XVLQJ WRWDO 51$ IURP DQLPDOV IHG D ORZ GLHW 5HQDO PHGXOOD WRWDO 51$V IURP IRXU UDEELWV IHG D +DUODQ ,QGLDQDSROLV ,1f FRQWURO GLHW DQG IRXU UDEELWV IHG D +DUODQ UHVWULFWHG GLHW IRU WZR ZHHNV ZHUH SUREHG WR YLVXDOL]H +.S VXEXQLWV XVLQJ D SUREH PDGH IURP ES RI FRGLQJ UHJLRQ 7DEOH f 1HLWKHU RI WKH WZR +.3 WUDQVFULSWV RI UHQDO PHGXOOD KDG V\VWHPDWLF YDULDWLRQ LQ +. P51$ OHYHO GXH WR UHVWULFWLRQ LQ WKHVH DQLPDOV 1RUWKHUQ DQDO\VLV RI UHQDO FRUWH[ DQG VWRPDFK 51$ IURP WKHVH VDPH UDEELWV VKRZHG XQLIRUP OHYHO RI +.S P51$ EHWZHHQ UDEELWV 1R UHJXODWLRQ RI +.3 ZDV REVHUYHG DOWKRXJK LQ UHQDO PHGXOOD WKHUH ZDV D JUHDW GHDO RI LQGLYLGXDO YDULDWLRQ EHWZHHQ UDEELWV 'LVFXVVLRQ $ UDEELW UHQDO PHGXOODVSHFLILF +.3 YDULDQW P51$ ZDV FORQHG E\ f 5$&( DQG VHTXHQFHG ,W ZDV QRW NQRZQ ZK\ RQO\ RQH RXW RI WKH WHQ VHTXHQFHV SURYHG WR EH D

PAGE 64

$f **$*&7*$7**&7*&7*&7*$7$*&$&&*&&7&*$*&&$*&&&7*&$**&*7&*&&&*&*$7*&&777*$&&*7**&&** A ***$**&7$7$$*$&&&$*****&&7&&**&&7&$*7&****7*&$***7*****$*&**&**&77&&$&$*&$*$&$&& $7**&&*&&77*&$**$*$$*$$*7&*7*&$*&&$*&*&$7**$**$*77&&*&&$&7$&7*&7**$$&&&**$&$&*** 0$$/4(..6&6450(()5+<&:13'7* 5HPDLQGHU RI VHTXHQFH RPLWWHG IRU FODULW\ P51$V )LJXUH +.S DQG 3n VXEXQLWV $f 7KH n HQG RI WKH +.3f F'1$ DQG LWV GHGXFHG DPLQR DFLG VHTXHQFH 1XPEHULQJ EHJLQV DW WKH VWDUW RI WKH +.3n WUDQVFULSW +.3n QXFOHRWLGH FRUUHVSRQGV WR QXFOHRWLGH RI SXEOLVKHG JDVWULF +.3 VHTXHQFH 5HXEHQ HW DO f DQG WKH SRLQW RI GLYHUJHQFH LV PDUNHG E\ %f &RPSDULVRQ RI +.3 DQG +.3n P51$V 7KHUH LV QR GLIIHUHQFH LQ WKH GHGXFHG DPLQR DFLG VHTXHQFH

PAGE 65

YDULDQW VLQFH ERWK WUDQVFULSWV DUH REVHUYHG E\ QRUWKHUQ DQDO\VLV DW FRPSDUDEOH OHYHOV I 3HUKDSV WKH H[WUD OHQJWK RU 51$ VHFRQGDU\ VWUXFWXUH UHGXFHG DPSOLILFDWLRQ HIILFLHQF\ %HFDXVH WKH YDULDQW f HQG GLIIHUHG LQ VHTXHQFH IURP WKH f HQG UHSRUWHG IRU UDEELW 5HXEHQ HW DO f WKH YDULDQW LV SUHVXPHG WR DULVH IURP DOWHUQDWLYH VSOLFLQJ 7KLV ZDV QRW SXUVXHG EHFDXVH RXU IRFXV ZDV RQ WKH +.$73DVH D LVRIRUPV +.3 P51$ DQG +.3f P51$ SURGXFHG LGHQWLFDO +.3 VXEXQLW SURWHLQV 7KH VSOLFH VLWHV RI WKH UHODWHG UDW DQG PRXVH +.3 JHQHV 1HZPDQ DQG 6KXOO &DQILHOG DQG /HYHQVRQ f DUH QRW FRQVHUYHG DQG ZRUNLQJ RXW WKLV LVVXH PLJKW KDYH EHHQ D FRQVLGHUDEOH WDUJHW IRU RXU SULPDU\ HPSKDVLV 7KH GHGXFHG DPLQR DFLG VHTXHQFH LV XQFKDQJHG E\ WKH YDULDQW f HQG 'LIIHUHQWLDO UHJXODWLRQ E\ DOWHUQDWH SURPRWHUV PD\ EH WKH IXQFWLRQDO UHDVRQ IRU WKH WZR WUDQVFULSWV UHVWULFWLRQ ZDV VWXGLHG DV D SRVVLEOH VWLPXOXV IRU UHJXODWLQJ WKH SURPRWHUV EXW .VWDWXV DORQH GLG QRW FRUUHODWH ZLWK GLIIHUHQWLDO UHJXODWLRQ RI WKH WZR WUDQVFULSWV 2WKHU VWLPXOL VXFK DV DOGRVWHURQH OHYHOV PD\ UHJXODWH WKHVH WUDQVFULSWV LQ UHQDO PHGXOOD ,W LV LQWHUHVWLQJ WR QRWH WKDW DOWKRXJK +.3 VXEXQLW LV H[SUHVVHG DW H[WUHPHO\ KLJK OHYHOV LQ JDVWULF WLVVXHV WKLV YDULDQW WUDQVFULSW ZDV QRW REVHUYHG LQ VWRPDFK 7KH WLVVXHVSHFLILFLW\ RI WKH YDULDQW LV VWULNLQJ 6WXG\ RI LWV SURPRWHU UHJLRQ PD\ EH IUXLWIXO LQ WHUPV RI ILQGLQJ WKH FLV DFWLQJ IDFWRUV WKDW WXUQ WKH JHQH RQ VSHFLILFDOO\ LQ UHQDO PHGXOOD

PAGE 66

+.$73$6( D 68%81,76 ,1 7+( 5$%%,7 5(1$/ &257,&$/ &2//(&7,1* '8&7 ,QWURGXFWLRQ +.$73DVH KDV EHHQ VKRZQ WR SOD\ D UROH LQ DFLGEDVH DQG WUDQVSRUW LQ NLGQH\ FROOHFWLQJ GXFW IRU UHYLHZ VHH :LQJR DQG &DLQ :LQJR DQG 6PROND f +RZHYHU PDQ\ TXHVWLRQV UHPDLQHG WR EH DGGUHVVHG VXFK DV ILQGLQJ ZKLFK +.$73DVH LVRIRUPV DUH SUHVHQW LQ NLGQH\ DQG GHWHUPLQLQJ WKHLU GLVWULEXWLRQ DORQJ WKH QHSKURQ DQG FROOHFWLQJ GXFW 7KLV LQFOXGHG GHILQLQJ WKH FHOO W\SH VSHFLILFLW\ RI HDFK LVRIRUP )RU PDQ\ \HDUV WKH UDEELW KDV EHHQ WKH DUFKHW\SDO H[SHULPHQWDO DQLPDO IRU XVH LQ H[SHULPHQWV LQYROYLQJ PLFURSHUIXVLRQ RI UHQDO WXEXOHV 7R WDNH DGYDQWDJH RI WKH H[WHQVLYH NQRZOHGJH RI UDEELW UHQDO SK\VLRORJ\ LQ H[SORULQJ +.$73DVH IXQFWLRQ DW WKH PROHFXODU OHYHO SULPDU\ VWUXFWXUH LQIRUPDWLRQ ZDV QHHGHG IRU +.$73DVH VXEXQLWV LQ WKDW VSHFLHV %HFDXVH RI WKH GLVFRYHU\ RI +.$73DVH FDWDO\WLF VXEXQLW LVRIRUPV LQ DGGLWLRQ WR WKH JDVWULF LVRIRUP LQ VHYHUDO VSHFLHV WKH UHODWLRQVKLS EHWZHHQ WKHVH LVRIRUPV QHHGHG WR EH H[DPLQHG 3HUKDSV PRVW LPSRUWDQWO\ WKH UROH WKDW WKH PXOWLSOLFLW\ RI +.$73DVH VXEXQLW LVRIRUPV SOD\V LQ NLGQH\ IXQFWLRQ VKRXOG EH H[DPLQHG $W WKH WLPH WKH H[SHULPHQWV GHVFULEHG KHUH ZHUH XQGHUWDNHQ OLWWOH ZDV NQRZQ RI WKH LGHQWLW\ RI +.$73DVH VXEXQLWV LQ WKH NLGQH\ P51$V HQFRGLQJ FDWDO\WLF VXEXQLW LVRIRUPV FORQHG IURP KXPDQ D[LOODU\ VNLQ 0RG\DQRY HW DO f DQG UDW GLVWDO FRORQ &URZVRQ DQG 6KXOO f ZHUH WKH ILUVW WR EH GHWHFWHG LQ NLGQH\ ,Q FROODERUDWLRQV

PAGE 67

LQFOXGLQJ WKH &DLQ DQG :LQJR ODERUDWRULHV +. &DOODJKDQ HO DO &DPSEHOO7KRPSVRQ HO DO f ZDV REVHUYHG LQ UDEELW NLGQH\ 7KH NH\ H[SHULPHQW LGHQWLI\LQJ +.3 LQ WKH NLGQH\ GDWHG IURP SULRU WR WKH DUULYDO RI WKLV DXWKRU VR WKDW LQIRUPDWLRQ ZDV DYDLODEOH LQ GHVLJQLQJ WKLV GLVVHUWDWLRQ SURMHFW $V WKLV ZRUN SURJUHVVHG LW ZDV IRXQG WKDW WKH +.RWL VXEXQLW LVRIRUPV DUH SUHVHQW LQ UHQDO WLVVXHV $KQ DQG .RQH f ,Q DGGLWLRQ DQ DOWHUQDWLYHO\ VSOLFHG LVRIRUP RI UDW +.D ZDV UHFHQWO\ UHSRUWHG LQ NLGQH\ .RQH DQG +LJKDP f 7KH UDW +.D DOWHUQDWLYHO\ VSOLFHG YDULDQW ZDV GHVLJQDWHG +.DE ZLWK WKH RULJLQDO UHQDPHG +.DD 7KH SUHYLRXV H[SHULPHQWV ZHUH QRW GHVLJQHG WR GLVFULPLQDWH EHWZHHQ +.DD DQG +.DE ,Q WKHVH VWXGLHV D IXOOOHQJWK F'1$ VHTXHQFH ZDV GHWHUPLQHG IRU WKH +.D VXEXQLW LQ UDEELW $Q DOWHUQDWLYHO\ VSOLFHG YDULDQW RI WKLV +.D VXEXQLW LVRIRUP ZDV IRXQG LQ UDEELW 7KH SDWWHUQ RI VSOLFLQJ ZDV LGHQWLFDO WR WKDW IRXQG LQ UDW .RQH DQG +LJKDP f +RZHYHU WKH WUDQVODWLRQ VWDUW VLWH ZDV QRW FRQVHUYHG )RU WKLV UHDVRQ WKH DOWHUQDWLYHO\ VSOLFHG YDULDQW LQ UDEELW ZDV GHVLJQDWHG +.DF $QWLSHSWLGH SRO\FORQDO DQWLERGLHV ZHUH UDLVHG DQG XVHG WR VKRZ H[SUHVVLRQ RI ERWK +.DD DQG +.DF SURWHLQV LQ UDEELW UHQDO FRUWH[ 7KHVH UHVXOWV DOOXGH WR D SRWHQWLDOO\ FRPSOH[ SDWWHUQ RI UHJXODWLRQ RI +.$73DVH DFWLYLW\ LQ UHQDO FRUWH[ 0XOWLSOH +.$73DVH D 6XEXQLWV LQ WKH .LGQH\ :H VHW RXW WR ILQG WKH +.D VXEXQLWV WKDW PHGLDWH WKH +.$73DVH DFWLYLWLHV WKDW KDG EHHQ REVHUYHG LQ NLGQH\ %HFDXVH +.DD P51$ KDG EHHQ REVHUYHG LQ NLGQH\ LW ZDV QHFHVVDU\ WR ILQG WKH UDEELW VHTXHQFH RI +.DD LQ UDEELW IRU XVH LQ GHVLJQLQJ WRROV IRU

PAGE 68

VWXG\LQJ +.$73DVH IXQFWLRQ LQ WKH NLGQH\ 5DEELW +.RWL VHTXHQFH ZDV NQRZQ %DPEHUJ HW D f ,Q GHVLJQLQJ DQ H[SHULPHQWDO DSSURDFK WR WKLV JRDO ZH ZDQWHG WR FRQVLGHU f WKH SRVVLELOLW\ WKDW +.DL ZDV H[SUHVVHG LQ NLGQH\ XQNQRZQ DW WKH WLPHf LQ DGGLWLRQ WR +.D f WKH SRVVLELOLW\ WKDW WKH +.FW P51$ PLJKW EH GLIIHUHQW LQ NLGQH\ WKDQ LQ WKH RWKHU WLVVXHV IRU ZKLFK IXOO OHQJWK VHTXHQFH ZDV NQRZQ DQG f WKDW QRYHO +.D LVRIRUPV PLJKW EH SUHVHQW LQ UHQDO WLVVXHV $ JRRG WHFKQLTXH WR DGGUHVV DOO WKHVH SRVVLELOLWLHV ZDV WR GR 573&5 XVLQJ GHJHQHUDWH SULPHUV GHVLJQHG WR DQQHDO WR UHJLRQV RI VHTXHQFH WKDW ZHUH KLJKO\ FRQVHUYHG DPRQJ 3W\SH $73DVHV 7KLV DSSURDFK ZDV H[SHFWHG WR DPSOLI\ DQ\ 3W\SH +.$73DVH WKDW PLJKW EH SUHVHQW LQ UDEELW NLGQH\ 7KH DVSDUW\O UHVLGXH WKDW LV SKRVSKRU\ODWHG DV DQ LQWHUPHGLDWH LQ WKH FDWDO\WLF F\FOH RI +.$73DVH OLHV ZLWKLQ D PRWLI WKDW LV KLJKO\ FRQVHUYHG LQ WKH HQWLUH 3W\SH $73DVH IDPLO\ $QRWKHU ZHOOFRQVHUYHG UHJLRQ DPRQJ 3W\SH $73DVHV VXUURXQGV D O\VLQH UHVLGXH WKDW FDQ EH PRGLILHG E\ ),7& )7& FRPSHWHV ZLWK $73 IRU ELQGLQJ -DFNVRQ HW DO )DUOH\ DQG )DOOHU f VR WKLV UHJLRQ LV WKRXJKW WR PDNH XS SDUW RI WKH $73 ELQGLQJ VLWH $GYDQWDJH ZDV WDNHQ RI WKHVH WZR UHJLRQV WR GHVLJQ GHJHQHUDWH SULPHUV WR DPSOLI\ DQ\ 3W\SH $73DVH XVLQJ UHQDO FRUWH[ 51$ DV WHPSODWH )LIWHHQ 3W\SH $73DVH VHTXHQFHV ZHUH DOLJQHG XVLQJ WKH FRPSXWHU SURJUDP 3/(83 *HQHWLFV &RPSXWHU *URXS f 7KHVH VHTXHQFHV ZHUH VHOHFWHG WR JLYH D ZLGH UDQJH RI PDPPDOLDQ 1D.$73DVHV DQG +.$73DVHV &KLFNHQ 1D.$73DVHV ZHUH LQFOXGHG EHFDXVH DOO WKUHH D VXEXQLW LVRIRUPV ZHUH NQRZQ IRU WKDW VSHFLHV VR WKH\ FRPSULVHG D JRRG H[DPSOH RI 3W\SH $73DVHV IURP DQ RUJDQLVP OHVV UHODWHG WR PDPPDOV 7RDG VHTXHQFHV ZHUH LQFOXGHG EHFDXVH WRDG

PAGE 69

+.$73DVH ZDV RQH RI RQO\ WKUHH QRQJDVWULF +.$73DVHV NQRZQ DW WKH WLPH 'HJHQHUDWH SULPHUV ZHUH WKHQ GHVLJQHG WR DPSOLI\ DQ\ RI WKHVH $73DVHV )LJXUH f 7KH SURGXFWV RI WKH ILUVW WZR 573&5 UHDFWLRQV XVLQJ WKHVH SULPHUV ZKHQ FORQHG DQG VHTXHQFHG KDG KLJK KRPRORJ\ WR WKH 1D.RWL VXEXQLW LQ RWKHU VSHFLHV 7KH WKLUG UHDFWLRQ SURGXFW )LJXUH f ZDV PRUH UHODWHG WR WKH QRQJDVWULF +.$73DVH D VXEXQLWV WKDQ WR WKH +.RLL VXEXQLW RU WR DQ\ RI WKH 1D .$73DVH D VXEXQLWV ,W ZDV D ES IUDJPHQW WKDW FRUUHVSRQGHG WR QXFOHRWLGHV RI WKH IXOOOHQJWK UDEELW +.DD F'1$ VHTXHQFH $ %/$67 VHDUFK OLVWHG WKUHH QRQJDVWULF +.$73DVHV DV WKH PRVW KLJKO\ DOLJQHG VHTXHQFHV WR WKH ES VHTXHQFH ZLWK RWKHU +.$73DVHV DQG 1D.$73DVHV EHLQJ OHVV ZHOO DOLJQHG )LJXUH f 7KH VHTXHQFH RI WKH IUDJPHQW VKDUHG b QXFOHLF DFLG LGHQWLW\ ZLWK WKH UDW GLVWDO FRORQLF +.$73DVH D VXEXQLW b ZLWK D JXLQHD SLJ GLVWDO FRORQLF +.$73DVH D VXEXQLW DQG b ZLWK WKH +.$73DVH D VXEXQLW FORQHG IURP KXPDQ D[LOODU\ VNLQ %DVHG RQ WKHVH VLPLODULWLHV WKLV IUDJPHQW ZDV WHQWDWLYHO\ LGHQWLILHG DV EHORQJLQJ WR DQ +.$73DVH 8VLQJ GHJHQHUDWH SULPHUV GHVLJQHG WR DQQHDO WR FRQVHUYHG VHTXHQFHV ZH LGHQWLILHG IDUWKHU f DQG f LQ WKH VHTXHQFH DOLJQPHQW SDLUHG ZLWK JHQHVSHFLILF SULPHUV GHVLJQHG EDVHG RQ WKH QHZ VHTXHQFH 7DEOH f IUDJPHQWV FRQWDLQLQJ PRUH RI WKH WUDQVFULSW ZHUH FORQHG )LJXUH f 2XWVLGH WKH FRGLQJ VHTXHQFH KRPRORJ\ EHWZHHQ F'1$ VHTXHQFHV GHFOLQHV :LWK PXFK RI WKH FRGLQJ UHJLRQ FORQHG DQG VHTXHQFHG f DQG f 5$&( ZHUH XVHG WR FORQH WKH IXOO H[WHQW RI WKH F'1$ LQFOXGLQJ WKH WZR HQGV 7KH f HQG ZDV HDVLO\ REWDLQHG D VLQJOH f 5$&( SURGXFW ZDV REVHUYHG WKH ILUVW WLPH WKH SURFHGXUH ZDV SHUIRUPHG 7KH f HQG SURYHG IDU PRUH LQWHUHVWLQJ EXW PRUH FKDOOHQJLQJ WR ILQG ,QLWLDO

PAGE 70

$f +VX 5DWDWSDVH] %PKNDWSDV 'RJKNDWS 3LJDWSKN 2FDWSUQD 5DWDWSDVW &KNQDNDW &KNQDNDW 5DWDWSD 5DWDWSD 5DWDWSDO &KNDWSDV %PQNDDO 7FDWSPU &&$7&$7&7*&7&**$&$$*$&7***$&$& &&$7&$7&7*&7&$*$&$$*$&****$&&& &&$77$7&7*&7&&*$&$$$$&$**$$&&& &$*7*$7&7*&7&$*$&$$*$&$***$&&7 &$*7&$7&7*&7&7*$&$$*$&****$&&& &**7*$7&7*&7&&*$&$$*$&****$&&& &$*7&$7&7*&7&$*$&$$*$&$**$$&7& &&$&&$7&7*&7&&*$&$$$$&&***$&&& &&$&&$7&7*&7&&*$7$$*$&&***$&&& &&$&&$7&7*&7&&*$&$$*$&&**&$&&& f&&$&&$7&7*&7&**$&$$*$&$**&$&&&f &&$&&$7&7*&7&&*$&$$*$&7**$$&7& &&$&&$7&7*77&7*$&$$$$&$**&$&&& &&$&&$7&7*&7&7*$&$$*$&&**$$&&& &$$&&$777*&7&$*$&$$$$&7**$$&&7 n 3ULPHU %f +VX 5DWDWSDVH] %PKNDWSDV 'RJKNDWS 3LJDWSKN 2FDWSUQD 5DWDWSDVW &KNQDNDW &KNQDNDW 5DWDWSD 5DWDWSD 5DWDWSDO &KNDWSDV %PQNDDO 7FDWSPU $ $ $7&7*&7&&*$&$$$$&&** * 7 7 7&$7**7*$7*$$*****&&&&7*$*&*&$ 7&*7**7*$7*$$$**$*&&&&7*$*$**$ 7*&7&*7&$7*$$$**7*&&&&$*$*$*$$ 7*&7**7*$7*$$***&*&&&&&*$*&*&* 7*&77*7*$7*$$***&*&&&&&*$*&*&* 7*&7**7*$7*$$***&*&&&&&*$*&*&* 7*&7**7*$7*$$***&*&&&&$*$*&*&* 7&&7**7*$7*$$$****&&&&&*$*&*&$ 7*&7**7*$7*$$$**&*&&&&**$*&*&$ 7*77$*7*$7*$$***&*&&&&7*$$&*&$ 7*&7**7*$7*$$$**7*&&&&**$*&*&$ 7*&7$*7*$7*$$***&*&&&&$*$$$**$ 7*&7**7*$7*$$***$*&7&&$*$*$**$ 7*&7**7&$7*$$***&*&&&&&*$*$**$ 7*77**7*$7*$$***$*&$&&$*$$&**$ n 3ULPHU $ $ *7*$7*$$$**&*&&&&&*$ * 7 7 )LJXUH 'HVLJQ RI GHJHQHUDWH SULPHUV IRU 573&5 RI QRYHO 3W\SH $73DVHV $f 8SVWUHDP SULPHU ZDV GHVLJQHG WR DQQHDO WR ZHOOFRQVHUYHG VHTXHQFH DW WKH HQ]\PH DFWLYH VLWH SKRVSKRU\ODWHG DVSDUW\O UHVLGXH *HQ%DQN ORFL RI DOLJQHG VHTXHQFHV DUH VKRZQ DW OHIW 2OLJRQXFOHRWLGH LV VKRZQ EHQHDWK DOLJQHG VHTXHQFHV %f 'RZQVWUHDP SULPHU ZDV GHVLJQHG WR DQQHDO WR ZHOOFRQVHUYHG VHTXHQFH DW WKH SXWDWLYH $73 ELQGLQJ VLWH 2OLJRQXFOHRWLGH LV UHYHUVH FRPSOHPHQW RI FRQVHQVXV VHTXHQFH VKRZQ

PAGE 71

)LJXUH 573&5 SURGXFW DPSOLILHG IURP UHEELW UHQDO FRUWH[ 51$ XVLQJ GHJHQHUDWH SULPHUV *HO LVRODWHG SURGXFW ZDV FORQHG DQG VHTXHQFHG

PAGE 72

6HTXHQFHV SURGXFLQJ JE 8 +68 JE 0 5$7$73$6(= JE 8 518 GE@_'_*3,+.$$6 JE 8_518 HPE_=_%0+.$73$6 JE_0_&+.1$.$7 HPE_;_51$73$+2 JE 0 5$7$73$ JE 0 5$71$/3+ HPE_=_%01.$$ JE 8 ;/8 JE 8 ;/8 JE 5$7$73$67 JE 8 ;/8 HPE_;_2&$7351$ JE &+.$73$6 JE 6 6 JE 8 008 JE / +80$73* JE / '2*+.$73 HPE_;_2$$7305 JE 0 3,*$73+. JE 0 5$71$/3+ JE 6 6 JE 0 5$7$73$ JE 0 5$71$.$73 HPE ; $$63$$ HPE ; 51$73$5 HPE ; 7&$7305 JE 0 &+.1$.$7 JE 8 +68 HPE_;_+6$73$5 JE +80$73$6 JE / '2*1.$$ JE 0 3,*$73%6(1 HPE_;_66$73$5 JE_0_5$7$73$ HPE ; &&1$.$73 HPE ; $)1$.$73 JE 0 +<'$73$6( JE / +80$73* JE 6 6 JE +80$73** JE 0 +80+.$73& 6PDOOHVW 6XP +LJK 3UREDELOL +LJKVFRULQJ 6HJPHQW 3DLUV 6FRUH 31f +XPDQ $73GULYHQ LRQ SXPS $73$/ 5DW +.$73DVH P51$ FRPSOHWH FGV 5DWWXV QRUYHJLFXV +.$73DVH DOSKD *XLQHD SLJ P51$ IRU GLVWDO FRORQ + 5DWWXV QRUYHJLFXV +.$73DVH DOSKD %PDULQXV P51$ IRU +.$73DVH &KLFNHQ 1D.$73DVH DOSKDVXEXQL 5DW P51$ KRPRORJRXV WR DOSKD VXEXQ 5DW 1D .$73DVH DOSKD,,,f LVRI 5DWWXV QRUYHJLFXV 1D.$73DVH DOSK %PDULQXV P51$ IRU 1D .$73DVH DO ;HQRSXV ODHYLV 1D.$73DVH DOSKD ;HQRSXV ODHYLV DGHQRVLQH WULSKRVSK 5DW VWRPDFK +.f$73DVH P51$ F ;HQRSXV ODHYLV JDVWULF +f.f$ 2FXQLFXOXV P51$ IRU $73DVH DOSKD &KLFNHQ 1D .f$73DVH P51$ FR VRGLXP SXPS DOSKD VXEXQLW >&WHQRFH 0XV PXVFXOXV JDVWULF +f.f$73 +RPR VDSLHQV FORQH 6:f QRQJDV 'RJ +.$73DVH P51$ FRPSOHWH FGV 6KHHS P51$ IRU 1D DQG .f $73DVH 3LJ + .f$73DVH P51$ FRPSOHW 5DWWXV QRUYHJLFXV 1D.$73DVH DOSK +f.f$73DVH DOSKDVXEXQLW >UD 5DW 1D.$73DVH DOSKD LVRIRUP FD 5DW VRGLXPSRWDVVLXP $73DVH DOSKD $DQJXLOOD P51$ IRU VRGLXPSRWDVVL 5DW P51$ IRU DOSKD VXEXQLW NLGQH\ 7RUSHGR FDOLIRUQLFD P51$ IRU 1D &KLFNHQ 1$.$73DVH DOSKDVXEXQL +XPDQ 1D.$73DVH DOSKD VXEXQLW +XPDQ P51$ IRU 1D.$73DVH DOSKDV +XPDQ 1D. $73DVH DOSKDVXEXQLW &DQLV IDPLOLDULV 1D .$73DVH DOSK 3LJ 1$ .$73DVH DOSKD VXEXQLW P 3LJ P51$ IRU 1D .f$73DVH DOSK 5DW 1D.$73DVH DOSKDf LVRIRUP &FRPPHUVRQL P51$ IRU 1Df.f $ $IUDQFLVFDQD P51$ IRU 1D. $73DVH +YXOJDULV 1D.$73DVH DOSKD VXEXQ +RPR VDSLHQV FORQH 6:f QRQJ 1D.$73DVH DOSKD VXEXQLW >GRJV +XPDQ JDVWULF + .f$73DVH JHQ +XPDQ JDVWULF +.$73DVH FDWDO\WLF OH H H H H OH OH H H H H H OH H H OH H H H H H H H H H H H H H H H H H H H H H H 2H H H H H H H )LJXUH %/$67 VHDUFK XVLQJ VHTXHQFH RI ES IUDJPHQW RI +.D

PAGE 73

r S:*& r S:*& S:*& S:*&OO 5$&( 5$&( 3 :*& S:*& +.D $8* 8*$ $$$ UDFH S:*& S:*& )LJXUH &ORQLQJ RI +.DD DQG +.DF F'1$V ,QGLYLGXDOO\ FORQHG F'1$V DUH LQGLFDWHG E\ EDUV DQG WKH SODVPLG QXPEHUV DUH LQGLFDWHG $8* DQG 8*$ LQGLFDWH VWDUW DQG VWRS FRGRQV RI WKH P51$ UHVSHFWLYHO\ 6\PEROV r GHJHQHUDWHG SULPHUV 5$&( 5$&( SULPHU $OO RWKHU SULPHUV ZHUH JHQHVSHFLILF

PAGE 74

DWWHPSWV HPSOR\HG WKH FODVVLFDO WHFKQLTXH RI )URKPDQ HW DO f ZKLFK LV DQDORJRXV WR WKH f5$&( SURFHVV ,Q VHYHUDO DWWHPSWV WKLV WHFKQLTXH SURGXFHG RQO\ VKRUW F'1$ VHTXHQFHV ZKLFK SURYLGHG OLWWOH QHZ VHTXHQFH LQIRUPDWLRQ 7DNLQJ D QHZ DSSURDFK WKH 0DUDWKRQ F'1$ $PSOLILFDWLRQ .LW E\ &ORQWHFK 3DOR $OWR &$f ZDV WULHG 7KLV NLW XVHV D OLJDWLRQ WHFKQRORJ\ WR DGG D NQRZQ XSVWUHDP VHTXHQFH IRU 3&5 DPSOLILFDWLRQ UDWKHU WKDQ WKH OHVV HIILFLHQW WHUPLQDO WUDQVIHUDVH WHFKQRORJ\ HPSOR\HG E\ )URKPDQ HW DO f $OVR WKH UHYHUVH WUDQVFULSWLRQ VWHS ZDV FKDQJHG WR D KLJKHU WHPSHUDWXUH WR OHVVHQ WKH SRVVLELOLW\ RI VHFRQGDU\ VWUXFWXUH EORFNLQJ IXOO H[WHQVLRQ E\ WKH 51$ SRO\PHUDVH :LWK WKH QHZ SURWRFRO DIWHU VRPH RSWLPL]DWLRQ WZR GLIIHUHQW f HQGV ZHUH REWDLQHG ZKHQ f 5$&( SURGXFWV ZHUH VHTXHQFHG 7ZR UDEELW UHQDO +.RW F'1$ VHTXHQFHV ZHUH IRXQG LQ WKLV PDQQHU KDYLQJ EDVHV LQ FRPPRQ DW WKH n HQG EXW GLIIHUHQW n HQGV 7KH *HQ%DQN UHFRUGV RI WKHVH WZR F'1$V DUH VKRZQ LQ )LJXUH $ VHJPHQW RI WKH VKDUHG n SRUWLRQ RI WKH VHTXHQFHV ZDV LGHQWLFDO WR WKH ES VHTXHQFH REWDLQHG E\ )HMHV7WK f H[FHSW IRU WZR VLQJOH EDVH PLVPDWFKHV 2QH PLVPDWFK ZDV D WUDQVLWLRQ RI &}7 DW QXFOHRWLGH ZKLFK GRHV QRW FKDQJH WKH SULPDU\ SURWHLQ VHTXHQFH DQG WKH RWKHU D WUDQVYHUVLRQ RI *r7 DW QXFOHRWLGH LQ WKH n XQWUDQVODWHG UHJLRQ 7KH IXOOOHQJWK UDEELW +.DD QXFOHRWLGH VHTXHQFH ZDV b LGHQWLFDO WR KXPDQ +.D DQG b WR UDW ZKHUHDV LGHQWLW\ RI +.DD WR UDEELW +.RFL ZDV RQO\ b 7KH GHGXFHG DPLQR DFLG VHTXHQFH VKDUHG b LGHQWLW\ ZLWK KXPDQ +.D b LGHQWLW\ ZLWK UDW +.D EXW PHUHO\ b ZLWK UDEELW +.RWL 1RUWKHUQ DQDO\VLV XVLQJ DQ )O.DVSHFLILF SUREH 7DEOH f LV VKRZQ LQ )LJXUH

PAGE 75

/2&86 '(),1,7,21 $&&(66,21 1,' .(<:25'6 6285&( 25*$1,60 5()(5(1&( $87+256 7,7/( -2851$/ 5()(5(1&( $87+256 7,7/( -2851$/ )($785(6 VRXUFH &'6 $) ES P51$ 0$0 2&7 2U\FWRODJXV FXQLFXOXV +.$73DVH DOSKD D VXEXQLW P51$ FRPSOHWH FGV $) J 2U\FWRODJXV FXQLFXOXV 2U\FWRODJXV FXQLFXOXV (XNDU\RWDH 0HWD]RD &KRUGDWD 9HUWHEUDWD 0DPPDOLD (XWKHULD /DJRPRUSKD /HSRULGDH 2U\FWRODJXV EDVHV WR f &DPSEHOO:* :HLQHU,' :LQJR&6 DQG &DLQ%' +.$73DVH LQ WKH 5&&7$ UDEELW FRUWLFDO FROOHFWLQJ GXFW FHOO OLQH 8QSXEOLVKHG EDVHV WR f &DPSEHOO:* :LQJR&6 DQG &DLQ%' 'LUHFW 6XEPLVVLRQ 6XEPLWWHG 6(3f %LRFKHPLVWU\ 8QLYHUVLW\ RI )ORULGD -+0+& *DLQHVYLOOH )/ 86$ /RFDWLRQ4XDOLILHUV RUJDQLVP 2U\FWRODJXV FXQLFXOXV VWUDLQ 1HZ =HDODQG :KLWH GEB[UHI WD[RQ QRWH 3W\SH $73DVH FRGRQBVWDUW O SURGXFW +.$73DVH DOSKD D VXEXQLW GEB[ UH I 3,'J WUDQVDWLRQ 0545./(,< 69(/+$$7',...(*5'*..'1'/(/.5144.((/ ..(/'/''+./61.(/(7.<*7',,5*/6675$$(//$41*31$/733.473(,,.)/ .409**)6,//:9*$9/&:,$)*,4<96136$6/'59
PAGE 76

%$6( &2817 25,*,1 4/$9<6
PAGE 77

DDJDFDDFWD DFDFJJFWWW FFFJFDDJDD WFJFFWFFFD WDDDWWWFDF WFWJJJWDWD DWDDJDDFDW JWJJWFWWFJ FWFWFDWFWD WWFDJFWJWW DWJWFDDJJW DFDFDJDFWW WFDJDWFWFF FFFFWJDDDF JJFDJFDJJD WWJFWJWJDW FWJWWFFWJF DFFFDDDJJJ WDJFDFWDWW DDWFDFDWWW JDFDJJWWWW FWDDWWJWJD WJJDFDJJDD FWWWJWWJJF FWFFDWFWWF JDWFDWFJWF FDWJFWFDDJ FJDWJDDDWJ JWDWWDFWJD JFDDJDFFWF JDDFDFDJWJ WJWDWDWJDW FDWJJWJWDJ JWJWDDFFFD WWFFDFDFFF DWDDFWWWWJ JFDFFWFDJD JJJWWFFWJJ DDDJFWJDFF JFWJWFDFWJ WDWWWFWWJW WWJWDDFWWD WWWWWWWDDD WJWWWWDFWW WJJDFJDJWW DWFDWJJWFF DDJFDJJJJF JFFFWJFWFF JFWFDJWDFW FJJDDDFWFW JDFFDJJWFW WJWJWDJWJW JWJDDJFWWF WWWFDWFWFW JJDDJJDWJW JJWJJFWJFW WJWFDDDJJF JJJWWWJFWW DFDJFDDDJD FFDWJFJJFF WFFDDJWFFD DFWJJJDFWF DJDWDJJFWJ JDWDWDWWWJ WDDDDJDWJW DDWWFDDJWW DWFDJDJJFD DJFDDDWDJF WFWWFDJDDD WFWFWWDFJJ JJWWWJWJJF WFDWFDJJFW JWFWFWJDJW JJDWJWWJFF WWDFWJDWFW DWFWFFDWFW JWWWDWFWJW JJDJWFWJFF FFJJWJDJFW WJFWFDJFWJ FDJFFFFFJW FFDJWFFJFF WWFFDFDDDF JJFFWFWFFJ FFDDJFDFWF WJWJJJDFDF WWWWDDJWDD WWWFFDJDJJ DWDFFWJJDD DJDWFWJDWF WDDDJWWDWF JFWFJJFDJW FJWDFFFFDF FWDFFFFJJD FWFFFDJFJJ DDJFWFFDFW JWWJWDFWWF FFWWDFFWWD DWDWJDDJFW DWDDJWWJDJ FFDWDJJDWW DJJJWJWJDJ WWWJDFWFFF WWFWFDFDJF FWWDDFWFDD JDDDJFFDFW WFFDJFDJFF JDDDFDFDWD DDWJWWWWDW FDJJFDFJJD WJJDFDJJFW DWFDJJDDJD WJJJWJJJJD DWFDFDJFFF JFFDWFFWJD DJFWJJWJJJ FDFFWJFFWJ FJJJDJJDJD DDDJFWJDJD DDDJDWJWJJ FDFWJDWJWF FWDJDDWWJF WFWJWJDDWF WWJJDDJWJW DJDFDFWWWJ DFWFFDFFDF DFDWWFJWJJ JWJJWWWDJD DWWWWDWJWF FDWFFDWJWW JDDDFDDDDW DDDWDFFDD )LJXUH f§FRQWLQXHG

PAGE 78

%f /2&86 $35 '(),1,7,21 $&&(66,21 1,' .(<:25'6 6285&( 25*$1,60 5()(5(1&( $87+256 7,7/( -2851$/ 5()(5(1&( $87+256 7,7/( -2851$/ )($785(6 VRXUFH &'6 $) ES P51$ 0$0 2U\FWRODJXV FXQLFXOXV +.$73DVH DOSKD F VXEXQLW P51$ FRPSOHWH FGV $) J 2U\FWRODJXV FXQLFXOXV 2U\FWRODJXV FXQLFXOXV (XNDU\RWDH 0HWD]RD &KRUGDWD 9HUWHEUDWD 0DPPDOLD (XWKHULD /DJRPRUSKD /HSRULGDH 2U\FWRODJXV EDVHV WR f &DPSEHOO:* :HLQHU,' :LQJR&6 DQG &DLQ%' +.$73DVH LQ WKH 5&&7$ UDEELW FRUWLFDO FROOHFWLQJ GXFW FHOO OLQH 8QSXEOLVKHG EDVHV WR f &DPSEHOO:* :LQJR&6 DQG &DLQ%' 'LUHFW 6XEPLVVLRQ 6XEPLWWHG 6(3f %LRFKHPLVWU\ 8QLYHUVLW\ RI )ORULGD -+0+& *DLQHVYLOOH )/ 86$ /RFDWLRQ4XDOLILHUV RUJDQLVP 2U\FWRODJXV FXQLFXOXV VWUDLQ f1HZ =HDODQG :KLWH GEB[UHI WD[RQ QRWH 3W\SH $73DVH FRGRQBVWDUW O SURGXFW +.$73DVH DOSKD F VXEXQLW GEB[UHI 3,'J WUDQVODWLRQ 0$**$+5$'5$7*((5.(***5:5$3+63633*35*&393/.$$ $46/&5.37:*5<&7///)45./(,<69(/+$$7',...(*5'*..'1'/(/.5144. ((/..(/'/''+./61.(/(7.<*7',,5*/6675$$(//$41*31$/733.473(,, .)/.409**)6,//:9*$9/&:,$)*,4<96136$6/'59
PAGE 79

%$6( &2817 25,*,1 /&3)/,<,,/*/3/3,*7,7//),'/*7',,36,$/$<(.$(6',015.35+...'5/ 9144/$9<6
PAGE 80

JFDJFFJDFD JJFFJFWWJD JFFJDJFWFW DWFDFFFWFF JDJDDDJFDJ JWJDDFFDJF JFWWWFFWJJ FDFFWJFJJD JDDWJJDFJD JJFDWFDWJJ WWFDDJFDJJ JWFJFFFWJF DDJJFWFDJW DWJFJJDDDF WJDJDFFDJJ FWFWJWJWDJ JWJJWJDDJF JDWWWWFDWF WDJJJDDJJD FFDJJWJJFW FFFWJWFDDD WWJJJJWWWJ DJDDFDJFDD WJJFFDWJFJ DFFWFFDDJW FWJDFWJJJD WJWDJDWDJJ WWDJDWDWDW DDDWDDDDJD FWWDDWWFDD WJDWFFWJFW WDWWWJDFDD JFFFFWWWWW WJWWFDWFJD DDDJWJDFDW DJFWWJFWJW WJWDFWWFDF WDJFJWJJJD JWWDWFDJDJ WFFDJFDDDW JJFWFWWFDJ WFFWFWFWWD DFWJJWWWJW WFWWFDWFDJ WFWJWFWFWJ WJWJJDWJWW WWFWWDFWJD WFWDWFWFFD WJWJWWWDWF JFWJJDJWFW JJFFFJJWJD FWWWJFWFDJ DJDFDJFFFF JFFFFDJWFF FFDWWFFDFD FWFJJFFWFW FWJFFDDJFD WWJWJWJJJD WJWWWWWDDJ JWWWWWFFDJ JJDWJDFDDF FFWDDDJDDJ JDWWWDFDWF FWWJJJFDFD WDWJDDFDJJ DWDFWFJWDF WJWJWDFJFD FDJFJDFFDF JFDDWDFFWJ DJFDJDWFWJ DDDWDDDJWW FJJJFWFJJF JJFFJWDFFF JFWFWDFFFF DJWFWFFFDJ JFFDDJFWFF WFWJWWJWDF WFWFFWWDFF WJWDWDWJDD JFFDWDDJWW JFWFFDWDJJ FWJDJJJWJW FJWWWWJDFW JFFWWFWFDF DDFFWWDDFW FFJJDDDJFF FWFWFFDJFD FDFJDDDFDF WDDDDWJWWW DJJFDJJFDF WWFWFFWFWD DFFDWFJFWW DWWFWFJJJF JDFDWDDWFF DDJFFWFJJF FWJFDFDWWJ FDJFDJJJFW FWJDDFJDFW JDDWJJDFDJ DWFDWFDJJD DWFWJJJWJJ DJWDWFDFDJ FDFJFFDWFF JJDDJFWJJW FJJFDFFWJF DFWFJJJDJJ WWFDDDJFWJ WWDDDDJDWJ JFWFDFWJDW JDJFWDJDDW DWWWFWJWJD JDJWWJJDDJ FFFDJDFDFW DJFDFWFFDF FDDDFDWWFJ DFWJWJJWWW JFFDWWWWDW DWDFDWFFDW WDWJDDDFDD JJDDDDWDFF WFJWFDFDJJ DFDFFFWJDF WJFFFFWJFF FFWFFDWWJF DFDDJDDDDD JFFWFDWJFD WWFJJFFJDF WJJDDJDFDD JFWDFDFJJF DJDFFFJFDD JJDWFJFFWF FFFWDDDWWW WJDWFWJJJW JJJDWDDJDD FWJJWJJWFW DJDFWFWFDW DJDWWFDJFW WJJDWJWFDD JWFDFDFDJD WJFWFDJDWF DWFFFFFWJD WJWJJFDJFD WWJWWJFWJW FDFFWJWWFF WJJDFFFDDD DJDWDJFDFW JWFDDWFDFD JWWJDFDJJW DDWFWDDWWJ DD JJWJJDJJDD FDDJDDFDWW FDWWJJFDFF FWWJJFJWDW JJDFDJDFWJ DJFFFWJJJD FWFDFWJWWW FWDWJJDFDJ WWWFWWWJWW JDDFWFFDWF FFDJDWFDWF FDFFDWJFWF DWDFJDWJDD FDWJWDWWDF WFJJFDDJDF FWDJDDFDFD JWWWJWDWDW JJWFDWJJWJ FWWJWJWDDF WFFWWFFDFD DDFDWDDFWW JJDJFDFFWF JDWJJJWWFF WJFDDDJFWJ JJJJFWJWFD DWWWDWWWFW WWWWWJWDDF WWWWWWWWWW WJDWJWWWWD )LJXUH f§FRQWLQXHG

PAGE 81

'LVWDO 5HQDO &RORQ &RUWH[ )LJXUH 1RUWKHUQ DQDO\VLV VKRZLQJ SUHVHQFH RI +.DA LQ GLVWDO FRORQ DQG UHQDO FRUWH[ *$3'+ ZDV XVHG WR VKRZ WKH FRQGLWLRQ RI WKH 51$ VDPSOHV

PAGE 82

7R GHWHUPLQH WKH UHODWLRQVKLS EHWZHHQ WKH UDEELW +.D P51$V DQG RWKHU 3W\SH $73DVHV SK\ORJHQHWLF DQDO\VLV ZDV QHFHVVDU\ 6HYHUDO SURJUDPV DQG DOJRULWKPV ZHUH VDPSOHG DOO JLYLQJ WKH VDPH JHQHUDO SDWWHUQ RI VHTXHQFH UHODWLRQVKLSV 3URJUDPV HPSOR\HG LQFOXGH &/867$/: 7KRPSVRQ DODL f ',67$1&(6 *HQHWLFV &RPSXWHU *URXS f DQG 3$83 *HQHWLFV &RPSXWHU *URXS f $OO WKUHH SURJUDPV XVH WKH GLVWDQFH DOJRULWKP DQG WKH PD[LPXP SDUVLPRQ\ DOJRULWKP RI3$83 ZDV DOVR XVHG ,Q DGGLWLRQ WR GLVWDQFH DQG PD[LPXP SDUVLPRQ\ DQDO\VHV D WKLUG SRSXODU DOJRULWKP WR DVVD\ UHODWHGQHVV RI VHTXHQFHV LV XVHG WKH PD[LPXP OLNHOLKRRG DQDO\VLV 'LVWDQFH DQDO\VLV JHQHUDWHV D WUHH VKRZLQJ UHODWHGQHVV RI VHTXHQFHV E\ VLPSO\ FRXQWLQJ GLVVLPLODULWLHV LQ DOLJQHG VHTXHQFHV DV D WHVW RI WKHLU KRPRORJ\ 0D[LPXP SDUVLPRQ\ FRQVLGHUV RQO\ SRVLWLYH LQIRUPDWLRQ LQ PDNLQJ D FRPSDULVRQ )RU LQVWDQFH LQ DQ DOLJQPHQW RI IRXU VHTXHQFHV D SRVLWLRQ WKDW KDG RQH HDFK RI $ & DQG 7 ZRXOG QRW EH LQFOXGHG LQ WKH DQDO\VLV EHFDXVH WKDW SRVLWLRQ ZRXOG QRW JLYH LQIRUPDWLRQ DERXW DQ\ SDLU RI WKH VHTXHQFHV EHLQJ UHODWHG $ SRVLWLRQ WKDW KDG WZR $V DQG WZR &V ZRXOG EH FRXQWHG EHFDXVH LW ZRXOG VKRZ WKH JURXSLQJ RI WZR SDLUV 'LVWDQFH DQDO\VLV ZRXOG LQFOXGH ERWK SRVLWLRQV LQ WKH DQDO\VLV 0D[LPXP OLNHOLKRRG WDNHV LQWR DFFRXQW WKH WHQGHQF\ IRU D JLYHQ W\SH RI PXWDWLRQ WR RFFXU ,Q WZR VHTXHQFHV WKDW KDYH D SRLQW PXWDWLRQ WKDW SRLQW PXWDWLRQ ZDV PRUH SUREDEO\ FUHDWHG E\ D fOLNHO\f FKDQJH WKDQ D FKDQJH WKDW KDV OHVV WHQGHQF\ WR RFFXU 0D[LPXP OLNHOLKRG ZRXOG PHDVXUH WZR VHTXHQFHV DV PRUH UHODWHG LI WKHLU DOLJQPHQW VKRZV D fOLNHO\f PXWDWLRQ ,I WKH PXWDWLRQ KDG OHVV WHQGHQF\ LW PD\ LQGLFDWH D PRUH GLVWDQW UHODWLRQVKLS EHWZHHQ VHTXHQFHV DUULYHG DW RQO\ E\ PXOWLSOH FKDQJHV

PAGE 83

RU KLJKHU SUHVVXUH RI VHOHFWLRQ 7KH PD[LPXP OLNHOLKRRG DQDO\VLV UHTXLUHV LQIRUPDWLRQ WKDW LV QRW UHDGLO\ DYDLODEOH IRU UDEELW DQG ZDV QRW DWWHPSWHG $ UHSUHVHQWDWLYH SK\ORJUDP DUULYHG DW E\ GLVWDQFH DQDO\VLV E\ WKH &/867$/: SURJUDP LV VKRZQ LQ )LJXUH 7KH n HQG RI WKH VHFRQG UDEELW VHTXHQFH +.DFf GLIIHUHG GUDPDWLFDOO\ IURP WKH SXEOLVKHG UDW +.Dm &URZVRQ DQG 6KXOO f DQG KXPDQ +.DD *ULVKLQ HO DO f VHTXHQFHV 7KH +.DF n XQWUDQVODWHG UHJLRQ ERUH QR KRPRORJ\ WR WKH FRPSDUDEOH VHJPHQWV IURP WKH +.DD F'1$V IURP KXPDQ RU UDW RU WR DQ\ *HQ%DQN VHTXHQFH ,W ZDV FOHDU IURP WKH EHJLQQLQJ WKDW WKLV VHFRQG f HQG PLJKW UHSUHVHQW DQ DOWHUQDWLYH VSOLFLQJ SURGXFW WKH VHTXHQFH KRPRORJ\ GLYHUJHV IURP WKH KXPDQ +.D VHTXHQFH DW D SRLQW NQRZQ LQ WKH KXPDQ $73$/ JHQH WR EH D VSOLFH MXQFWLRQ QXFOHRWLGH RI $73$/f 6YHUGORY HW DO f $OWHUQDWLYH 6SOLFLQX RI +.$73DVH D 6XEXQLWV LQ WKH .LGQH\ :KHQ D VHTXHQFH IRU WKH f HQG RI WKH UDW +.D JHQH ZDV SXEOLVKHG .RQH DQG +LJKDP f ZH ZDQWHG WR FRPSDUH WKH VHTXHQFH DW WKH f HQG RI WKH UDEELW JHQH ,Q RUGHU WR GHWHUPLQH WKH H[RQ DUUDQJHPHQW DW WKH n HQG RI WKH +.D JHQH UDEELW JHQRPLF '1$ ZDV DPSOLILHG E\ 3&5 7KH DQWLVHQVH SULPHU ZDV VHOHFWHG ZLWKLQ WKH UHJLRQ RI VHTXHQFH WKDW LV FRPPRQ WR +.DD DQG +.DF %HFDXVH LW ZDV XQNQRZQ ZKLFK RI WKH WZR F'1$ n HQGV ZDV ORFDWHG PRUH n LQ WKH JHQH VHQVH SULPHUV WKDW DQQHDO WR VHTXHQFH ZLWKLQ HDFK ZHUH VHOHFWHG 7KH ROLJRQXFOHRWLGH SULPHU VSHFLILF WR +.D JDYH WKH ODUJHU DPSOLILHG SURGXFW DQG LWV VHTXHQFH LV VKRZQ LQ )LJXUH $ 7KH H[RQ VSHFLILF WR +.DD VSOLFHV WR WKH FRPPRQ FRUH VHTXHQFH DW WKH VSOLFH VLWH VKRZQ 7KH H[RQ VSHFLILF WR +.DF

PAGE 84

UDEELW +.DO UDW +.DO )LJXUH 'LVWDQFH DQDO\VLV RI VHOHFWHG +.D DQG 1D.D VXEXQLW FRGLQJ

PAGE 85

$f I +.D WUDQVFULSWLRQ VWDUW *&&&&&7*&& &*&&*$&&&* &**&*&&7&& $*&*&*$&$7 *&*&&$*JWJ 0 5 4 WJWJDJJDDJ WJDFJFJJWJ FJJDFWJJFJ DJDDJWJFJJ JDDDJJJWJD DJJJFWFFJW FFJJJJJWFW WWDFWFWJFD DFFFWJWWFF DJFFJFFJDJ FDFFFJWJWJ WFDFWFJJJD DFWJJFWJJJ WADDJDJJWF DDWFFDJDFD I +.RLMF WUDQVFULSWLRQ FJFJJJJDDJ JDJWWFFDJJ JJWFFWJJJF FDJ&7&&*&& &7&*&$&&7* VWDUW &***&7&**$ 77&**$*$$$ $*7*&7$*$& 7**$*&7$&$ &*7$7*&*7$ *&**7&7**$ $$$7*&&&&$ **&7&***7& 7*$****&&& $$*7&7$7*& $&&*&7**7* 7*$&&&&*&$ ***&$$&&&& *&**77$$&7 7&7&7&&7*& &&$&&&&7$* $**7*7&77& &7***$$*$& *$7**&$**& **7*&&&$&& 0$* $ + 5 *$*&&*$&&* 7*&$$&$*** *$$*$*$**$ $**$***$** 7***$**7** $'5 $7& *((5 .(* **: &*&*&7&&&& $&$*&&&77& &&&7&&7**& &&7&*$***7 *7&&**7&&& 5$3+ 636 33* 35*& 393 $&7&$$**&$ *&7*&*&$*$ -A&7*7*&$* $$$$&&&$&& 7****&&**7 / $ $ $ 4 6 /&5 .37 :*5< +.RWM VSOLFH VLWH $77*&$&7&7 *&77&7&777 &$*$*$$$*& 7**$$$777$ &7&&*7**$* &7/ //) 45./ ( < 69( %f +.FA UHPDLQGHU RI VHTXHQFH RPLWWHG IRU FODULW\ +.mF $7* $7* $7* &20021 LQWURQ VSOLFLQJ )LJXUH 5DEELW +.D JHQH VHTXHQFH DW WKH n HQG $f +.D JHQH VHTXHQFH DQG GHGXFHG DPLQR DFLG VHTXHQFHV DUH VKRZQ ,QWURQ VHTXHQFH LV LQ ORZHU FDVH W\SH 7KH DPLQR DFLG VHTXHQFH WKDW LV VKDUHG E\ +.DD DQG +.DF LV LQ EROGIDFH W\SH %f 3DWWHUQ RI DOWHUQDWLYH VSOLFLQJ DW WKH n HQGV RI WKH +.D WUDQVFULSWV

PAGE 86

LV FRQWLQXRXV ZLWK WKH FRUH VHTXHQFH DQG OLHV ZLWKLQ WKH ILUVW LQWURQ RI WKH +.RWD SUHP51$ 7KLV JHQHUDO LQWURQH[RQ VWUXFWXUH LV WKH VDPH DV WKDW UHSRUWHG IRU UDW +.DD DQG +.DE .RQH DQG +LJKDP f ([SUHVVLRQ RI +.$73DVH D 6XEXQLWV LQ WKH .LGQH\ 7KH VWDUW FRGRQ RI +.DD ZDV RPLWWHG LQ WKH +.DF VHTXHQFH ,QVWHDG D SUREDEOH VWDUW FRGRQ ZDV ORFDWHG XSVWUHDP LQ IUDPH ZLWK WKH +.DD RSHQ UHDGLQJ IUDPH 7KXV WKH GHGXFHG DPLQR DFLG VHTXHQFH HQFRGHG D SURWHLQ DPLQR DFLGV ORQJHU DW WKH DPLQR WHUPLQDO HQG WKDQ WKH UDEELW +.RWD VHTXHQFH 7KH GHGXFHG DPLQR DFLG VHTXHQFH RI WKH +.DD DQG +.RFF SURWHLQV DUH VKRZQ LQ )LJXUH $ LQGLFDWLQJ WUDQVODWLRQDO VWDUW VLWHV $OWKRXJK WKH +.D& F'1$ LQGLFDWHG D FRQWLQXRXV RSHQ UHDGLQJ IUDPH LQFOXGLQJ WKH DPLQRWHUPLQDO H[WHQVLRQ WKH SRVVLELOLW\ UHPDLQHG WKDW WUDQVODWLRQ PLJKW EH LQLWLDWHG DW WKH $7* FRGRQ KRPRORJRXV WR WKDW UHSRUWHG IRU WKH UDW .RQH DQG +LJKDP f 7KHUHIRUH WR GHWHUPLQH ZKHWKHU WKH XSVWUHDP $7* VHUYHG DV D WUDQVODWLRQDO VWDUW VLWH DQWLSHSWLGH DQWLERGLHV ZHUH JHQHUDWHG IRU SHSWLGHV FRUUHVSRQGLQJ WR DPLQR DFLGV DQG RI WKH +.DF VXEXQLW 7KH IRUPHU DQWLERG\ //&f ZDV +.D&VSHFLILF ZKLOH WKH ODWWHU DQWLERG\ //&f UHFRJQL]HG D VHJPHQW FRPPRQ WR ERWK +.DD DQG +.DF VXEXQLWV :HVWHUQ DQDO\VHV RI UDEELW NLGQH\ WLVVXHV DQG 5&&7$ FHOOV XVLQJ DQWLERG\ //& DQWL+.RE FRPPRQf UHYHDOHG D GRXEOHW PLJUDWLQJ DW DQ DSSDUHQW PROHFXODU PDVV RI DSSUR[LPDWHO\ .'D ILJXUH $f ([SHULPHQWV XVLQJ DQWLERG\ //& DQWL+.FIHf LQGLFDWHG D VLQJOH EDQG ZLWK D PLJUDWLRQ FRPSDUDEOH WR WKH XSSHU EDQG RI WKH GRXEOHW ILJXUH %f %RWK DQWLERGLHV DSSHDU WR UHFRJQL]H WKH VDPH SURWHLQ SURYLGLQJ VWURQJ

PAGE 87

$f %f DQWL+.D FRPPRQ DQWL+.DF )LJXUH :HVWHUQ DQDO\VLV VKRZLQJ SUHVHQFH RI +.DD DQG +.DF SURWHLQ LQ UHQDO FRUWH[ $f 'HWHFWHG ZLWK WKH DQWL+.D FRPPRQ DQWLERG\ //& %f 'HWHFWHG ZLWK WKH DQWL+.DFVSHFLILF DQWLERG\ //& $ DQG % VKRZ VHSDUDWH ODQHV IURP WKH VDPH 6'63$*( JHO 0HPEUDQH ZDV FXW DIWHU HOHFWURWUDQVIHU DQG UHDOLJQHG DIWHU DXWRUDGLRJUDSK\

PAGE 88

HYLGHQFH WKDW WKH +.DF VXEXQLW FRQWDLQLQJ WKH DPLQRWHUPLQDO H[WHQVLRQ ZDV LQGHHG SUHVHQW LQ ERWK UDEELW UHQDO WLVVXH DQG 5&&7$ FHOOV 7R WHVW WKH K\SRWKHVLV WKDW HQ]\PH ORFDOL]DWLRQ LQ WKH NLGQH\ RU LQ WKH FHOO LV FKDQJHG DV D UHVXOW RI WKH DOWHUQDWLYH VSOLFLQJ RI WKH P51$ LPPXQRKLVWRFKHPLVWU\ H[SHULPHQWV ZHUH SHUIRUPHG 8VLQJ RXU DQWLERGLHV 'U -LOO 9HUODQGHU DQG 0V 5RELQ 0RXG\ FRQGXFWHG LPPXQRKLVWRFKHPLVWU\ H[SHULPHQWV 1HLWKHU DQWLERG\ ZH KDG PDGH WR WKH DQWL+.FW FRPPRQ UHJLRQ //& RU //&f ZRUNHG ZHOO IRU LPPXQRKLVWRFKHPLVWU\ +RZHYHU //& DQWL+.DLf DQG //& DQWL+.D&f JDYH VDWLVIDFWRU\ UHVXOWV $ UHSUHVHQWDWLYH VHFWLRQ SKRWRJUDSKHG LQ 'U 9HUODQGHUfV ODERUDWRU\ LV VKRZQ LQ )LJXUH 7KHUH LV QR YLVLEOH UHDFWLYLW\ H[FHSW LQ WKH DSLFDO PHPEUDQHV RI VRPH FHOOV RI FRQQHFWLQJ VHJPHQW DQG FROOHFWLQJ GXFW $ PDMRULW\ RI WKH FHOOV LQ ZKLFK ODEHOOLQJ LV REVHUYHG EXOJH RXW LQWR WKH OXPHQ D KDOOPDUN RI WKH LQWHUFDODWHG FHOO )HZHU FHOOV DUH ODEHOOHG LQ FRQQHFWLQJ VHJPHQW FRPSDUHG WR PRUH GLVWDOO\ LQ WKH FROOHFWLQJ GXFW 7KLV LV LQ DFFRUGDQFH ZLWK WKH QRUPDO GLVWULEXWLRQ RI DFLGVHFUHWLQJ LQWHUFDODWHG FHOOV IHZHU LQ FRQQHFWLQJ VHJPHQW WKDQ IDUWKHU GRZQ LQ FRUWLFDO FROOHFWLQJ GXFW 7KHUH DSSHDUV WR EH VRPH ODEHOOLQJ RI FHOO W\SHV RWKHU WKDQ LQWHUFDODWHG FHOOV LQFOXGLQJ SULQFLSDO FHOOV /DEHOOLQJ FRQWLQXHV WR EH YLVLEOH LQ PRUH GLVWDO VHFWLRQV RI FROOHFWLQJ GXFW WKDQ RQH ZRXOG H[SHFW EDVHG RQ GLVWULEXWLRQ RI LQWHUFDODWHG FHOOV EXW LQGLYLGXDO UDEELWV PD\ YDU\ ZLGHO\ LQ WKLV GLVWULEXWLRQ 7KHUHIRUH WKH IHZ REVHUYDWLRQV PDGH GR QRW SHUPLW D FHUWDLQW\ WKDW +.RW& VXEXQLW SURWHLQ LV H[SUHVVHG PRUH GLVWDOO\ LQ FHOO W\SHV QRW QRUPDOO\ WKRXJKW WR EH DVVRFLDWHG ZLWK DFLG VHFUHWLRQ 7KH ODFN RI EDVRODWHUDO ODEHOOLQJ LPSOLHV WKDW WKHUH LV QRW D FHOO SRODULW\ FKDQJH LQ +.DF SURWHLQ FRPSDUHG WR +.DD

PAGE 89

)LJXUH ,PPXQRKLVWRFKHPLVWU\ E\ 'U -LOO 9HUODQGHU DQG 0V 5RELQ 0RXG\ $QWL+.DF DQWLERG\ UHDFWV ZLWK WKH DSLFDO VXUIDFHV LQ VRPH FHOOV LQ UDEELW UHQDO FROOHFWLQJ GXFW 7KH VHFWLRQ VKRZQ LV IURP WKH RXWHU VWULSH RI RXWHU PHGXOOD

PAGE 90

'LVFXVVLRQ :H KDYH JHQHUDWHG FRPSOHWH F'1$V IRU ERWK WKH UDEELW UHQDO +.DD DQG WKH QRYHO +.RFF VXEXQLWV 7KH\ ZHUH PRUH FORVHO\ UHODWHG WR RWKHU +.D QXFOHRWLGH VHTXHQFHV WKDQ WR +.RLL RU WR 1D.$73DVHV 7KH H[RQ VWUXFWXUH DW WKH f HQG ZDV IRXQG DQG FRPSDUHG WR WKH H[RQ VWUXFWXUH IRXQG DW WKH f HQG RI UDW .RQH DQG +LJKDP f 3URWHLQV FRUUHVSRQGLQJ WR ERWK +.D LVRIRUPV ZHUH GHWHFWHG E\ LPPXQREORW DQDO\VLV LQGLFDWLQJ WKDW WKH QRYHO +.DF KDV WKH SUHGLFWHG DPLQRWHUPLQDO H[WHQVLRQ 7KH +.D F'1$V UHSRUWHG KHUH JHQHUDWHG XVLQJ UDEELW UHQDO FRUWH[ 51$ DV WHPSODWH KDYH KLJK KRPRORJ\ WR SUHYLRXVO\ NQRZQ +.D VHTXHQFHV IURP KXPDQ VNLQ D[LOOD DQG WKH UDW GLVWDO FRORQ *ULVKLQ DW FLO &URZVRQ DQG 6KXOO f 7KH OHYHO RI KRPRORJ\ LV UHODWLYHO\ ORZ FRPSDUHG WR WKH KRPRORJ\ W\SLFDOO\ IRXQG ZKHQ FRPSDULQJ +.RWL RU 1D.D VXEXQLWV DFURVV PDPPDOLDQ VSHFLHV +RZHYHU LW LV PXFK KLJKHU WKDQ WKH KRPRORJ\ EHWZHHQ WKH UDW +.RWL DQG +.D F'1$V &URZVRQ DQG 6KXOO f RU DPRQJ WKH GLIIHUHQW 1D.$73DVH LVRIRUPV ZLWKLQ D VSHFLHV 7KH +.D LVRIRUPV DSSHDU WR KDYH XQGHUJRQH VRPHZKDW JUHDWHU HYROXWLRQDU\ GLYHUJHQFH WKDQ +.RWL RU WKH 1D.$73DVH FDWDO\WLF LVRIRUPV 3K\ORJHQHWLF DQDO\VLV SURYLGHV D FOHDUHU SLFWXUH RI WKH UHODWLRQVKLSV EHWZHHQ WKHVH 3W\SH $73DVHV ,Q D SK\ORJUDP ILJXUH f WKH +.RF VXEXQLW LVRIRUPV FOXVWHU WRJHWKHU FRPSDUHG WR WKH RWKHU 3W\SH $73DVHV 7KH +.D VXEXQLW QXFOHRWLGH VHTXHQFHV DOO UHSUHVHQW +.$73DVHV WKDW DUH H[SUHVVHG DW KLJK OHYHO LQ FRORQ DW ORZHU OHYHO LQ RWKHU WLVVXHV LQFOXGLQJ WKH NLGQH\ DQG QRW DW DOO LQ VWRPDFK $W OHDVW LQ UDW DQG

PAGE 91

UDEELW DQ DOWHUQDWLYHO\ VSOLFHG YDULDQW OLDV EHHQ VKRZQ WR EH WUDQVFULSWLRQDOO\ FRPSHWHQW DQG WKH SDWWHUQ RI LQWURQV DQG H[RQV WKDW JLYH ULVH WR WKLV DOWHUQDWLYH VSOLFLQJ DUH VWULNLQJO\ VLPLODU ,W ZRXOG EH KLJKO\ LQWHUHVWLQJ WR DWWHPSW WR GHWHFW D VLPLODU WUDQVFULSW LQ KXPDQ %DVHG RQ WLVVXH GLVWULEXWLRQ SK\ORJHQHWLF DQDO\VLV DQG WKH VLPLODULW\ RI DOWHUQDWLYHO\ VSOLFHG WUDQVFULSWV LW FRQWLQXHV WR EH D YDOLG SUHPLVH WKDW WKH +.D VXEXQLWV NQRZQ IRU UDW KXPDQ DQG UDEELW IRUP DQ RUWKRORJRXV JURXS /LNH WKH UDW WKH UDEELW DSSHDUV WR KDYH DOWHUQDWLYHO\ VSOLFHG WUDQVFULSWV RI +.D LQ WKH NLGQH\ 7KH RUJDQL]DWLRQ RI WKH UDW DOWHUQDWLYHO\ VSOLFHG F'1$ .RQH DQG +LJKDP f RPLWWHG WKH H[RQ FRQWDLQLQJ WKH VWDUW FRGRQ RI WKH VHTXHQFH SUHYLRXVO\ UHSRUWHG IRU UDW GLVWDO FRORQ &URZVRQ DQG 6KXOO f JLYLQJ ULVH WR D SURWHLQ WUXQFDWHG E\ DPLQR DFLGV DW WKH DPLQRWHUPLQDO HQG 7KH UDEELW +.DF VHTXHQFH DOVR RPLWV WKH VWDUW FRGRQ SUHVHQW LQ WKH +.D VHTXHQFH +RZHYHU DQ XSVWUHDP n $7* FRGRQ OLHV LQ WKH VDPH XQLQWHUUXSWHG UHDGLQJ IUDPH DV WKH FRGLQJ VHTXHQFH IRU +.D ,QLWLDWLRQ RI WUDQVODWLRQ DW WKLV SRVLWLRQ \LHOGV D VXEXQLW KDYLQJ DQ H[WHQGHG DPLQRWHUPLQXV DPLQR DFLGV ORQJHU WKDQ WKH FDQRQLFDO +.DD SURWHLQ :HVWHUQ DQDO\VLV GHPRQVWUDWHG WKDW D SURWHLQ KDYLQJ WKLV H[WHQVLRQ LV SUHVHQW LQ UDEELW NLGQH\ $Q DQWLERG\ GHVLJQHG WR GHWHFW WKH FRPPRQ FRUH UHJLRQ RI +.D ZDV UHDFWLYH WR WZR SURWHLQV YHU\ FORVH LQ DSSDUHQW PDVV ZKHUHDV DQ DQWLERG\ GHVLJQHG WR GHWHFW WKH DPLQRWHUPLQDO H[WHQVLRQ ZDV UHDFWLYH WR D VLQJOH VSHFLHV 7KH H[WHQGHG SRUWLRQ RI WKH +.DEHQFRGHG SURWHLQ FRQWDLQV D FDVHLQ NLQDVH ,, SKRVSKRU\ODWLRQ PRWLI DW WKU DQG D F$03GHSHQGHQW SURWHLQ NLQDVH SKRVSKRU\ODWLRQ PRWLI DW WKU 7KHVH VLWHV LPSDUW D SRWHQWLDO IRU UHJXODWLRQ RI +.DF GLVWLQFW IURP +.DD 7KHUH DUH QR DSSDUHQW JO\FRV\ODWLRQ VLWHV RU VLJQDO VHTXHQFHV 7KH +.DF H[WHQVLRQ LV

PAGE 92

K\GURSKLOLF LQ QDWXUH DQG ODFNV DQ\ FRQVSLFXRXV PHPEUDQHVSDQQLQJ GRPDLQV %HFDXVH WKH 1WHUPLQXV RI +.DW ZDV IRXQG WR EH F\WRVROLF 6PROND HW DO f WKH HORQJDWLRQ FDQ EH H[SHFWHG WR KDYH D F\WRVROLF ORFDWLRQ )LJXUH VKRZV WKH SXWDWLYH ORFDWLRQ RI WKH DPLQRWHUPLQDO H[WHQVLRQ &KRX)DVPDQ FDOFXODWLRQV SUHGLFW WKLV VHJPHQW WR EH SUHGRPLQDQWO\ DOSKD KHOLFDO ZLWK D WXUQ VWUXFWXUH LQ D UHJLRQ FRQWDLQLQJ VHYHQ SUROLQHV EHWZHHQ DPLQR DFLGV WKURXJK $ VLPLODUO\ SUROLQHULFK KLQJH UHJLRQ LV IRXQG LQ EDQG SURWHLQ DQG DQ DQN\ULQELQGLQJ VLWH KDV EHHQ ORFDOL]HG WR WKDW DUHD RI EDQG :LOODUGVRQ HW DO f 3URGXFWV RI DOWHUQDWLYH VSOLFLQJ RI WKH EDQG SURWHLQ $( JHQH KDYH EHHQ FKDUDFWHUL]HG LQ FKLFNHQ NLGQH\ ZKHUH LW LV WKRXJKW WKDW WKH YDULDWLRQ LQ WUDQVFULSWV VHUYHV WR GHWHUPLQH WKH PHPEUDQH GRPDLQ WR ZKLFK WKH SRO\SHSWLGHV DUH WDUJHWHG &R[ HW DO f $ VLPLODU VLWXDWLRQ PD\ H[LVW IRU WKH YDULRXV +.RW WUDQVFULSWV DOWHUQDWLYH VSOLFLQJ PD\ PHGLDWH WKH SRODULW\ RI H[SUHVVLRQ ,Q FRUWLFDO WKLFN DVFHQGLQJ OLPE DQ +.$73DVH DFWLYLW\ KDV EHHQ GHVFULEHG WKDW GLPLQLVKHG LQ UDWV IHG D ORZ GLHW
PAGE 93

PRGLILFDWLRQ LV DQRWKHU SRVVLEOH PHDQV RI GLIIHUHQWLDO UHJXODWLRQ ,Q WKLV FDVH SKRVSKRU\ODWLRQ LV DQ XQOLNHO\ FDQGLGDWH IRU GLIIHUHQWLDO UHJXODWLRQ EHFDXVH DOWKRXJK PRWLIV UHFRJQLVHG E\ NLQDVHV DUH SUHVHQW WKH\ DUH QRW FRQVHUYHG EHWZHHQ UDW .RQH DQG +LJKDP f DQG UDEELW +DYLQJ D GLIIHUHQW SURPRWHU UHJLRQ LPPHGLDWHO\ f WR WKH +.DF F'1$ JLYHV ULVH WR SRWHQWLDO GLIIHUHQFHV LQ UHJXODWLRQ UHODWLYH WR +.DD 2I FRXUVH GLIIHUHQW SURPRWHU UHJLRQV JLYLQJ GLIIHUHQW UHVSRQVHV WR FRQGLWLRQV VXFK DV DOGRVWHURQH VWDWXV DQG ORZ PD\ DFFRXQW IRU ZK\ WKHUH DUH WKH WKUHH FDWDO\WLF VXEXQLW LVRIRUPV +.DL +.DD DQG +.DF 7KHUH PD\ DOVR EH GLIIHUHQFHV LQ WKH NLQHWLFV EHWZHHQ +.DD DQG +.DF $QRWKHU SRVVLELOLW\ LV ORFDOL]DWLRQ ERWK ZLWKLQ WKH NLGQH\ DQG ZLWKLQ WKH FHOO 8VLQJ RXU DQWLERGLHV 'U -LOO 9HUODQGHU DQG 0V 5RELQ 0RXG\ FRQGXFWHG LPPXQRKLVWRFKHPLVWU\ H[SHULPHQWV 7KH\ IRXQG D VLPLODU SDWWHUQ RI H[SUHVVLRQ RI H[SUHVVLRQ RI +.DF FRPSDUHG WR RWKHU +.$73DVH SURWHLQV IRU ZKLFK ORFDOL]DWLRQ LV NQRZQ :LQJR HO DO &DPSEHOO7KRPSVRQ HWD $KQ DQG .RQH $KQ HW DO +DUDJVLP DQG %DVWDQL f 7KHVH UHVXOWV LPSO\ WKDW WKH DOWHUQDWLYH VSOLFLQJ GRHV QRW FRQIHU RQ WKH SURWHLQ D GLIIHUHQW SRODULW\ RI H[SUHVVLRQ RU ORFDOL]DWLRQ ZLWKLQ WKH NLGQH\ 7KH\ GR LPSO\ WKDW WKH +.DF SURWHLQ MRLQV RWKHU DFLG DQG LRQ WUDQVSRUWHUV LQ FHOO W\SHV VSHFLDOL]HG IRU KLJK WUDQVSRUW DFWLYLW\ ,PPXQRKLVWRFKHPLVWU\ VKRZHG WKDW GLIIHUHQFHV LQ +.DF VXEXQLW SURWHLQ FHOOXODU GLVWULEXWLRQ KDG QR PDMRU GHSDUWXUHV IURP WKH GLVWULEXWLRQ RI RWKHU +.$73DVH VXEXQLWV %HFDXVH WKH SKRVSKRU\ODWLRQ PRWLIV LQ UDW DQG UDEELW DOWHUQDWLYHO\ VSOLFHG LVRIRUPV DUH QRW FRQVHUYHG UHJXODWLRQ E\ SKRVSKRU\ODWLRQ LV D OHVV OLNHO\ FDQGLGDWH WR OHDG WR GLIIHUHQWLDO UHJXODWLRQ 7KHUH DUH P\ULDG SRVVLELOLWLHV IRU ZK\ WKHUH LV VXFK D KHWHURJHQHLW\ RI

PAGE 94

+.$73DVHV LQ WKH NLGQH\ VXFK DV GLIIHUHQWLDO UHJXODWLRQ DW WKH JHQH OHYHO E\ GLIIHUHQW SURPRWHU UHJLRQV GLIIHUHQWLDO UHJXODWLRQ RI SURWHLQ V\QWKHVLV E\ WKH VKRUW XSVWUHDP RSHQ UHDGLQJ IUDPHV RU GLIIHUHQFHV LQ HQ]\PH NLQHWLFV

PAGE 95

+.$73$6(6 LQ D UDEELW NLGQH\ FRUWLFDO FROOHFWLQJ WXEXOH DW\SH ,17(5&$/$7(' &(// /,1( ,QWURGXFWLRQ 7KH NLGQH\ LV D ZHOORUJDQL]HG DQG FRPSOLFDWHG RUJDQ ZLWK PDQ\ GLIIHUHQW FHOO W\SHV FRQWULEXWLQJ WR LWV PRUSKRORJ\ DQG IXQFWLRQ $Q\ XQGHUVWDQGLQJ RI WKH NLGQH\ PXVW LQFOXGH DQ DSSUHFLDWLRQ RI WKH SURFHVVHV PHGLDWHG E\ HDFK FHOO W\SH ([SUHVVLRQ RI +.$73DVH KDV EHHQ VKRZQ WR EH FRPSOH[ LQ UDEELW NLGQH\ VR RQH LVVXH RI LQWHUHVW LV WKH LGHQWLILFDWLRQ RI WKH FHOO W\SHV SRVVHVVLQJ WKH YDULRXV LVRIRUPV RI WKH SXPS ,PPXQRKLVWRFKHPLFDO HYLGHQFH ZDV SUHVHQWHG LQ WKH SUHYLRXV FKDSWHU LQGLFDWLQJ WKDW WKH FROOHFWLQJ GXFW $W\SH LQWHUFDODWHG FHOO LV RQH RI WKH SULPDU\ FHOO W\SHV WKDW H[SUHVVHV +.$73DVH FDWDO\WLF VXEXQLW SURWHLQV $Q LQGHSHQGHQW DSSURDFK VKRZLQJ WKDW $W\SH LQWHUFDODWHG FHOOV H[SUHVV WKHVH SXPSV LV WR GHWHFW +.$73DVH LQ D ZHOOFKDUDFWHUL]HG FHOO OLQH RI LQWHUFDODWHG FHOO RULJLQ $ FHOO OLQH LQ ZKLFK +.$73DVH ZDV SUHVHQW ZRXOG DOVR VHUYH DV D PRGHO FHOO V\VWHP RIIHULQJ WKH SRWHQWLDO IRU IXWXUH H[SHULPHQWV SHUWDLQLQJ WR UHQDO +.$73DVHV 7KH UDEELW FRQLFDO FROOHFWLQJ WXEXOH FHOO OLQH 5&&7$ ZDV VHOHFWHG E\ LPPXQRGLVVHFWLRQ $UHQG HW D f &RUWLFDO FROOHFWLQJ GXFW ZDV GLVVHFWHG XQGHU D PLFURVFRSH DQG WKH FROODJHQDVHGLVSHUVHG FHOOV LQFXEDWHG LQ FXOWXUH GLVKHV WR ZKLFK WKH DQWLERG\ UFW ZDV DWWDFKHG 6SLHOPDQ HW D f 7KH UFW DQWLERG\ ELQGV VSHFLILFDOO\ WR FROOHFWLQJ GXFW FHOOV 7KH UHVXOWDQW FHOO OLQH ZDV VKRZQ WR KDYH

PAGE 96

FKDUDFWHULVWLFV RI WKH FRUWLFDO FROOHFWLQJ GXFW $W\SH LQWHUFDODWHG FHOO $UHQG HW DO 6FKZLHEHUW HO DO 'LHWO HO DO %HOOR5HXVV f 7KH H[LVWHQFH RI +.$73DVH P51$ SURWHLQ DQG DFWLYLW\ LQ WKLV FHOO OLQH ZDV VWXGLHG WR GHPRQVWUDWH WKDW WKLV LV D FHOO W\SH WKDW H[SUHVVHV +.$73DVH +HUH ZH VKRZ E\ 573&5 WKDW P51$ IRU +.;L +.RFD +.RWF DQG +. DUH SUHVHQW LQ 5&&7$ FHOOV %\ ZHVWHUQ DQDO\VLV LW LV VKRZQ WKDW SURWHLQ FRUUHVSRQGLQJ WR WKH QRYHO DOWHUQDWLYHO\ VSOLFHG LVRIRUP +.DF LV SUHVHQW /DVWO\ IOXRUHVFHQFH PLFURVFRS\ PHDVXUHPHQWV DUH XVHG WR GHPRQVWUDWH WKDW 5&&7$ FHOOV KDYH D PHFKDQLVP IRU S+ UHJXODWLRQ WKDW LV .nGHSHQGHQW DQG VHQVLWLYH WR WKH +.$73DVH LQKLELWRU 6FK 7RJHWKHU WKH GDWD UHSUHVHQW YHU\ VWURQJ HYLGHQFH IRU +.$73DVH H[SUHVVLRQ LQ D FHOO OLQH GHULYHG IURP WKH W\SH$ LQWHUFDODWHG FHOO LQ WKH FROOHFWLQJ GXFW 'HWHFWLRQ RI +-$73DVH LQ 5&&7$ &HOOV 'HWHFWLRQ RI +.$73DVH P51$V LQ 5&&7$ FHOOV 7R GHWHUPLQH WKH SUHVHQFH RI +.$73DVH WUDQVFULSWV ZH H[DPLQHG ZKHWKHU WKH 5&&7$ FHOOV SRVVHVVHG P51$ IRU WKH NQRZQ +.$73DVH RU D VXEXQLWV ,Q WKH LQLWLDO H[SHULPHQWV WKHUH ZHUH QR +.$73DVH VXEXQLWV GHWHFWDEOH E\ QRUWKHUQ DQDO\VLV QRU ZHUH WKHUH 573&5 SURGXFWV DPSOLILHG IURP 5&&7$ FHOOV WKDW FRXOG EH GLUHFWO\ YLVXDOL]HG E\ DJDURVH JHO HOHFWURSKRUHVLV $ PRUH VHQVLWLYH WHFKQLTXH 6RXWKHUQ EORWWLQJ RI WKH 573&5 SURGXFWV XVLQJ F'1$ SUREHV GHVLJQHG WR K\EULGL]H WR WKH H[SHFWHG SURGXFWV ZDV HPSOR\HG WR GHPRQVWUDWH WKH SUHVHQFH RI +.$73DVH VXEXQLW P51$ LQ WKHVH FHOOV

PAGE 97

573&5 SURGXFWV ZHUH DPSOLILHG XVLQJ 5&&7$ FHOO WRWDO 51$ DV D WHPSODWH 7KH SUHVHQFH RI +. VXEXQLW P51$ ZDV REVHUYHG DV D SURGXFW RI DSSUR[LPDWHO\ ES K\EULGL]LQJ WR D SUREH FRQWDLQLQJ QXFOHRWLGHV RI WKH UDEELW +. VHTXHQFH REWDLQHG E\ 5HXEHQ HW DO f LQ JDVWULF WLVVXHV )LJXUH $f 6L]HV ZHUH HVWLPDWHG E\ PHDVXUHPHQWV IURP WKH RULJLQDO DJDURVH JHO RQ ZKLFK D ES ODGGHU ZDV YLVXDOL]HG E\ HWKLGLXP EURPLGH VWDLQLQJ 7KH f57f ODQHV LQ WKLV DQG DOO VXEVHTXHQW ILJXUHV GHSLFW QHJDWLYH FRQWUROV LQ ZKLFK 57 ZDV RPLWWHG IURP UHDFWLRQV WR VKRZ WKDW WKH 51$ WHPSODWH ZDV IUHH RI FRQWDPLQDQWV 3URGXFWV DPSOLILHG IURP P51$ LVRODWHG IURP UDEELW UHQDO FRUWH[ WLVVXH ZHUH DOVR LQFOXGHG LQ WKHVH H[SHULPHQWV DV D SRVLWLYH FRQWURO IRU WKH 573&5 UHDFWLRQ 7KH K\EULGL]DWLRQ RI D SUREH VSHFLILF IRU +.S WR DQ 573&5 SURGXFW RI WKH H[SHFWHG VL]H LPSOLHG WKH SUHVHQFH RI +._ LQ WKHVH FHOOV $W WKH WLPH WKHVH H[SHULPHQWV ZHUH FDUULHG RXW WKH H[LVWHQFH RI DOWHUQDWLYHO\ VSOLFHG +.DM YDULDQWV KDG QRW \HW EHHQ GLVFRYHUHG 7KHUHIRUH WKHVH H[SHULPHQWV ZHUH GHVLJQHG RQO\ WR VKRZ WKH SUHVHQFH RI +.D WUDQVFULSW LQ JHQHUDO DQG GR QRW GLIIHUHQWLDWH EHWZHHQ WKH +.RFMD DQG +.D& VSHFLHV )RU +.D P51$ D SULPHU SDLU \LHOGHG WKH DQWLFLSDWHG SURGXFW VL]H RI ES 7KLV SURGXFW ZDV K\EULGL]HG ZLWK D SUREH RI QXFOHRWLGHV RI WKH +.DD VHTXHQFH FRQWDLQHG LQ WKH UHJLRQ QRZ NQRZQ WR EH FRPPRQ WR )/.DD DQG +.D& )LJXUH %f $ VLPLODU VWUDWHJ\ ZDV HPSOR\HG WR VKRZ WKDW +.D ZDV SUHVHQW LQ WKH 5&&7$ FHOOV 3ULPHUV ZHUH GHVLJQHG WR DPSOLI\ D ES UHJLRQ RI +.D P51$ QXFOHRWLGHV f DQG DJDLQ D SURGXFW RI WKH H[SHFWHG VL]H ZDV REVHUYHG WR K\EULGL]H WR D SUREH FRQWDLQLQJ WKH VDPH ES UHJLRQ )LJXUH &f $W WKH WLPH WKHVH H[SHULPHQWV

PAGE 98

$f %f ES ES ES 57 &f ES ES ES 57 )LJXUH 6RXWKHUQ EORWV RI +.$73DVH VXEXQLW P51$ LQ 5&&7$ FHOOV $f 3URGXFWV DPSOLILHG E\ 573&5 ZHUH VKRZQ E\ 6RXWKHUQ EORW DQDO\VLV 3&5 SULPHUV ZHUH GHVLJQHG WR DPSOLI\ D ES UHJLRQ ZLWKLQ WKH n 875 RI +.$73DVH S VXEXQLW %f 3&5 SULPHUV GHVLJQHG WR DPSOLI\ D ES UHJLRQ ZLWKLQ WKH FRGLQJ VHTXHQFH RI +.$73DVH D VXEXQLW SURGXFHG WKH SURGXFWV VKRZQ &f 3&5 SULPHUV GHVLJQHG WR DPSOLI\ D ES UHJLRQ ZLWKLQ WKH n 875 RI +.$73DVH D VXEXQLW SURGXFHG WKH SURGXFWV VKRZQ 'f 5HVWULFWLRQ GLJHVWV RI WKH ES IUDJPHQW RI +.$73DVH D %DP +, GLJHVWLRQ ZDV SUHGLFWHG WR \LHOG IUDJPHQWV RI DQG ES 3VW GLJHVWLRQ ZDV SUHGLFWHG WR \LHOG IUDJPHQWV RI DQG ES

PAGE 99

ZHUH RQJRLQJ WKHUH ZHUH QR UHSRUWV LQ WKH OLWHUDWXUH RI +.FWL LQ NLGQH\ VR D IXUWKHU VWHS ZDV WDNHQ WR FRQILUP WKH LGHQWLW\ RI WKHVH SURGXFWV 5HVWULFWLRQ GLJHVWV ZHUH FDUULHG RXW RQ WKHVH SURGXFWV DQG WKH DQWLFLSDWHG VL]H IUDJPHQWV ZHUH REWDLQHG )LJXUH ,'f IXUWKHU HYLGHQFH WKDW WKHVH SURGXFWV FRUUHVSRQGHG WR +.RLL P51$ LQ 5&&7$ FHOOV :LWK IXUWKHU RSWLPL]DWLRQ RI 573&5 SURWRFROV LQFOXGLQJ VXFK SDUDPHWHUV DV DQQHDOLQJ WHPSHUDWXUHV DQG QXPEHU RI DPSOLILFDWLRQ F\FOHV LW ZDV IRXQG WKDW WKH 573&5 WHFKQLTXH ZDV FDSDEOH RI JHQHUDWLQJ SURGXFWV YLVLEOH E\ HWKLGLXP EURPLGH VWDLQLQJ RI DJDURVH JHOV 7KLV ZDV D VXEVWDQWLDO LPSURYHPHQW RYHU WKH SUHFHGLQJ H[SHULPHQWV EHFDXVH LW RIIHUHG WKH RSSRUWXQLW\ WR REWDLQ QXFOHRWLGH VHTXHQFHV RI WKH 3&5 SURGXFWV WR FRQILUP WKHLU LGHQWLW\ 573&5 SURGXFWV ZHUH JHQHUDWHG DQG VHTXHQFHG XVLQJ 5&&7$ FHOO WRWDO 51$ DV D WHPSODWH 7KH SUHVHQFH RI +.S VXEXQLW P51$ ZDV REVHUYHG E\ DPSOLILFDWLRQ RI D ES F'1$ FRUUHVSRQGLQJ WR QXFOHRWLGHV RI WKH VHTXHQFH REWDLQHG E\ 5HXEHQ HW WLO f LQ JDVWULF WLVVXHV )LJXUH $f 1XFOHRWLGH VHTXHQFLQJ RI WKH 5&&7$ SURGXFW FRQILUPHG WKDW WKH DPSOLILHG SURGXFW ZDV LGHQWLFDO ZLWK WKH UDEELW +. VXEXQLW P51$ ),.DL ZDV DOVR VKRZQ WR EH SUHVHQW LQ WKH 5&&7$ FHOOV E\ WKH VDPH WHFKQLTXH 3ULPHUV ZHUH GHVLJQHG WR DPSOLI\ D ES UHJLRQ RI +.RWL P51$ QXFOHRWLGHV f DQG DJDLQ D SURGXFW RI WKH H[SHFWHG VL]H ZDV REVHUYHG )LJXUH %f 7KH QXFOHRWLGH VHTXHQFH ZDV LGHQWLFDO WR WKDW UHSRUWHG E\ %DPEHUJ HW DO f H[FHSW IRU WZR VLQJOH EDVH PLVPDWFKHV 2QH PLVPDWFK ZDV D WUDQVLWLRQ RI *!$ DW QXFOHRWLGH DQG WKH RWKHU D *}& WUDQVYHUVLRQ DW QXFOHRWLGH QHLWKHU DIIHFWHG WKH GHGXFHG DPLQR DFLG VHTXHQFH

PAGE 100

R R + + Rr 7 Q U Q 3 &3 + &3 & fW L + Q! 3 + Q R D W ; )LJXUH +.S DQG +.D VXEXQLW P51$ LQ 5&&7$ FHOOV 3&5 SURGXFWV ZHUH JHQHUDWHG XVLQJ 5&&7$ FHOO DQG UDEELW UHQDO FRUWH[ WRWDO 51$ $PSOLILFDWLRQ ZDV F\FOHV IRU 5&&7$ FHOO 3&5 SURGXFWV DQG F\FOHV IRU UHQDO FRUWH[ 3&5 SURGXFWV ES ODGGHU LV VKRZQ IRU VL]H UHIHUHQFH

PAGE 101

)RU +.& P51$ D SULPHU SDLU \LHOGHG WKH DQWLFLSDWHG SURGXFW RI ES ZKLFK ZDV LGHQWLFDO WR QXFOHRWLGHV RI WKH +.DD VHTXHQFH 7KLV VHJPHQW ZDV FRQWDLQHG LQ WKH UHJLRQ FRPPRQ WR +.DD DQG +.DF )LJXUH $f 7R GHWHUPLQH ZKHWKHU +.DD DQG +.DF LVRIRUPV ZHUH ERWK SUHVHQW LQ 5&&7$ FHOOV SULPHU SDLUV ZHUH GHVLJQHG WKDW DPSOLI\ UHJLRQV VSHFLILF WR HDFK LVRIRUP +.DDVSHFLILF SULPHUV DPSOLI\ DQ ES QXFOHRWLGHV LQ WKH +.DD VHTXHQFHf 57 3&5 SURGXFW IURP 5&&7$ FHOOXODU 51$ DQG QXFOHRWLGH VHTXHQFH GHWHUPLQDWLRQ VKRZHG WKH SURGXFW WR EH LGHQWLFDO WR WKH VHTXHQFH RI WKH +.F[D F'1$ IURP UDEELW FRUWH[ )LJXUH %f $ SURGXFW RI ES QXFOHRWLGHV LQ WKH +.DW VHTXHQFHf DPSOLILHG XVLQJ UDEELW UHQDO FRUWH[ P51$ DV WHPSODWH ZDV DOVR JHQHUDWHG )LJXUH &f 7KH VHTXHQFH RI WKLV SURGXFW ZDV LGHQWLFDO WR WKH +.DF F'1$ VHTXHQFH IURP UDEELW UHQDO FRUWH[ 7KHUHIRUH 5&&7$ FHOOV FRQWDLQHG WKH P51$V HQFRGLQJ DOO WKUHH +.D VXEXQLWV DQG WKH +._ VXEXQLW 6LQFH 5&&7$ FHOOV DUH D FORQDO FHOO OLQH WKH LPSOLFDWLRQ LV WKDW LQGLYLGXDO $W\SH LQWHUFDODWHG FROOHFWLQJ GXFW FHOOV PD\ H[SUHVV DW OHDVW WKUHH GLIIHUHQW +.$73DVHV 'HWHFWLRQ RI +.D VXEXQLW SURWHLQ LQ 5&&7$ FHOOV :LWK FRQYLQFLQJ HYLGHQFH RI WKH SUHVHQFH RI P51$ IRU WKHVH +.$73DVH VXEXQLWV LQ KDQG WKH QH[W ORJLFDO H[SHULPHQWV ZDV WR GHPRQVWUDWH WKDW 5&&7$ FHOOV DOVR SURGXFHG +.$73DVH SURWHLQV :H HPSOR\HG WKH DQWLERGLHV GHVFULEHG LQ SUHYLRXV FKDSWHUV WR GHWHUPLQH WKH +.$73DVH FDWDO\WLF VXEXQLWV SUHVHQW LQ WKHVH FHOOV 8VLQJ ZHVWHUQ DQDO\VLV DQG RQH RI WKH DQWLERGLHV WR WKH FRPPRQ FRUH RI WKH +.D SURWHLQV //& DQWL+.D FRPPRQf DQG WZR RI WKH DQWLERGLHV VSHFLILF WR +.DF //& DQG

PAGE 102

)LJXUH +.D VXEXQLW P51$ LQ 5&&7$ FHOOV 3&5 SURGXFWV ZHUH JHQHUDWHG XVLQJ 5&&7$ FHOO DQG UDEELW UHQDO FRUWH[ WRWDO 51$ $PSOLILFDWLRQ ZDV F\FOHV IRU 5&&7$ FHOO 3&5 SURGXFWV DQG F\FOHV IRU UHQDO FRUWH[ 3&5 SURGXFWV ES ODGGHU LV VKRZQ IRU VL]H UHIHUHQFH

PAGE 103

//& DQWL+.DFf LW ZDV GHPRQVWUDWHG WKDW DW OHDVW WKH +.DF SURWHLQ ZDV SUHVHQW LQ WKHVH FHOOV 7KH VHFRQG DQWLERG\ WR WKH FRPPRQ FRUH SURWHLQ //& DQWL+.D FRPPRQf IDLOHG WR VKRZ UHDFWLYLW\ LQ WKH 5&&7$ FHOOV LQ LQLWLDO H[SHULPHQWV DQG DOO IXUWKHU ZHVWHUQ DQDO\VLV ZDV GRQH XVLQJ //& DQWL+.D FRPPRQf 2I WKH WZR +.DFVSHFLILF DQWLERGLHV //& DQWL+.DFf JDYH WKH OHDVW EDFNJURXQG VR LW ZDV VHOHFWHG IRU DOO IXUWKHU ZHVWHUQ DQDO\VLV ,Q )LJXUH $ LPPXQRUHDFWLYLW\ RI //& DQWL+.D FRPPRQf WR PHPEUDQH SURWHLQV RI 5&&7$ FHOOV LV VKRZQ 5HDFWLYH SURWHLQ ZDV GHWHFWHG PLJUDWLQJ DW DQ DSSUR[LPDWH PROHFXODU PDVV RI N'D FRQVLVWHQW ZLWK WKH SUHVHQFH RI +.D VXEXQLW SURWHLQ LQ WKHVH FHOOV $OWKRXJK WKLV EURDG EDQG PD\ UHSUHVHQW D GRXEOHW WKLV KDV QRW EHHQ FOHDUO\ UHVROYHG )LJXUH % VKRZV WKH UHVXOWV RI ZHVWHUQ DQDO\VLV RI 5&&7$ SURWHLQ DQG WKH //& DQWL+.DFf DQWLERG\ $ EDQG ZDV YLVLEOH FRUUHVSRQGLQJ WR D PROHFXODU PDVV RI N'D FRQVLVWHQW ZLWK WKH SUHVHQFH RI +.DF VXEXQLW SURWHLQ LQ WKH 5&&7$ FHOOV %DVHG RQ WKHVH GDWD RQH PD\ FRQFOXGH WKDW DQ +.DF VXEXQLW SURWHLQ ZDV SUHVHQW EXW EHFDXVH WZR VSHFLHV ZHUH QRW GLVFHUQDEOH XVLQJ //& DQWL+.D FRPPRQf LW ZDV QRW SURYHQ WKDW +.DD VXEXQLW SURWHLQ ZDV WKHUH DV ZHOO *LYHQ WKH UHVXOWV XVLQJ //& DQWL+.D FRPPRQf DQG //& DQWL+.DFf DQWLERGLHV LW PLJKW EH DUJXHG WKDW RQO\ +.DF ZDV SUHVHQW LQ 5&&7$ FHOOV ,W ZDV RQO\ ZLWK GLIILFXOW\ WKDW WKH GRXEOHW LQGLFDWLYH RI ERWK +.D SURWHLQV ZHUH REVHUYHG LQ NLGQH\ VR QRW REVHUYLQJ D GRXEOHW LQ WKH 5&&7$ FHOO ZHVWHUQ VKRXOG QRW EH WDNHQ DV SURRI RI WKH DEVHQFH RI +.DD SURWHLQ ,PSRUWDQWO\ WKH SUHFHGLQJ P51$ GHWHFWLRQ H[SHULPHQWV VKRZHG WKDW ERWK DOWHUQDWLYHO\ VSOLFHG WUDQVFULSWV ZHUH SUHVHQW LQ WKHVH FHOOV

PAGE 104

$f %f DQWL+.D FRPPRQ DQWL+.DF N'D N'D N'D N'D N'D N'D t t Q Q Q R + + WR WR RR ! )LJXUH :HVWHUQ DQDO\VLV VKRZLQJ SUHVHQFH RI +.DD DQG +.DF SURWHLQ LQ 5&&7$ FHOOV $f 'HWHFWHG ZLWK WKH DQWL+.D FRPPRQ DQWLERG\ //& %f 'HWHFWHG ZLWK WKH DQWL+.DFVSHFLILF DQWLERG\ //&

PAGE 105

,Q SUHOLPLQDU\ H[SHULPHQWV LQYROYLQJ 5&&7$ FHOOV WKH +.RWUVSHFLILF DQWLERGLHV ZH SURGXFHG //& DQG //& DQWL+.DLf GLG QRW VKRZ UHDFWLYLW\ +RZHYHU XVLQJ 5&&7$ FHOOV ZH SURYLGHG 'U $GDP 6PROND RI WKH 0HGLFDO 8QLYHUVLW\ RI 6RXWK &DUROLQD GLG VKRZ UHDFWLYLW\ WR WKH +.FFL DQWLERG\ +. SHUVRQDO FRPPXQLFDWLRQf 'HWHFWLRQ RI +.$73DVH DFWLYLW\ LQ 5&&7$ FHOOV +.$73DVH VXEXQLWV ZHUH QRW GHWHFWHG LQ 5&&7$ FHOOV E\ QRUWKHUQ DQDO\VLV DQG WKH VXEXQLWV ZHUH DSSDUHQWO\ DW UHODWLYHO\ ORZ DEXQGDQFH E\ ZHVWHUQ DQDO\VLV 7KHVH UHVXOWV LPSOLHG WKDW +.$73DVH H[SUHVVLRQ ZDV DW D ORZ OHYHO LQ WKHVH WLVVXH FXOWXUH FHOOV %HFDXVH P51$ DQG SURWHLQ OHYHOV ZHUH VR ORZ LW ZDV QHFHVVDU\ WR GHWHUPLQH D EDVDO +.$73DVH DFWLYLW\ LQ WKHVH FHOOV 7R FRQILUP E\ DQ LQGHSHQGHQW PHWKRG WKDW WKH 5&&7$ FORQDO FHOO OLQH KDV +.$73DVH DFWLYLW\ DV SUHYLRXVO\ UHSRUWHG %HOOR5HXVV f IOXRUHVFHQFH PLFURVFRS\ ZLWK GLJLWDO YLGHR LPDJH DQDO\VLV ZDV XVHG WR PHDVXUH S+ UHFRYHU\ UDWHV RI LQGLYLGXDO FHOOV DIWHU DQ DFLG ORDG 7KHVH H[SHULPHQWV ZHUH XQGHUWDNHQ LQ WKH ODERUDWRU\ RI 'U 'DYLG :HLQHU ZKR KDG D GHFDGH RI H[SHULHQFH PDNLQJ VLPLODU PHDVXUHPHQWV DQG NLQGO\ SURYLGHG KLV HTXLSPHQW DQG H[SHUWLVH 7KH GHYHORSPHQW RI D WHFKQLTXH IRU PHDVXULQJ +.$73DVH DFWLYLW\ ZDV LPSRUWDQW IRU IXWXUH VWXGLHV XQGHUWDNHQ E\ RXU ODE DQG WKH WHFKQLTXH GHYHORSHG KHUH RIIHUHG DGYDQWDJHV RYHU WKRVH SUHYLRXVO\ XVHG 7KLV WHFKQLTXH PHDVXUHV DFWLYLW\ RI LQGLYLGXDO FHOOV LQ RUGHU WR DFKLHYH PD[LPDO VHQVLWLYLW\ DQG WR DVVHVV WKH KRPRJHQHLW\ RI WKH SRSXODWLRQ RI WLVVXH FXOWXUH FHOOV $GGLWLRQDOO\ WKLV WHFKQLTXH XVHG WKH VDPH DSSDUDWXV XVHG WR PHDVXUH +.$73DVH DFWLYLW\ LQ SHUIXVHG WXEXOHV DOORZLQJ FRPSDULVRQ WR DFWLYLWLHV PHDVXUHG LQ D V\VWHP PRUH UHSUHVHQWDWLYH RI WKH NLGQH\ LQ WKH ZKROH DQLPDO 7KH

PAGE 106

DFWXDO SURWRFROV XVHG XQGHUZHQW VRPH HYROXWLRQ DV GHVFULEHG EHORZ 5HVXOWV DUH ILUVW GHVFULEHG IRU WKH HDUO\ SURWRFROV XVHG WR SURYLGH DQ DSSUHFLDWLRQ IRU KRZ WKH GLIIHULQJ SURWRFROV DIIHFWHG WKH PHDVXUHPHQWV )LQDO UHVXOWV REWDLQHG E\ WKH UHILQHG SURWRFRO WKHQ IROORZ 7KH WHFKQLTXH XVHG WR PHDVXUH +.$73DVH DFWLYLW\ LQ WKLV ZRUN FRQVLVWHG RI IOXRUHVFHQFH PLFURVFRS\ WR REVHUYH FKDQJHV LQ S+ RI VLQJOH FHOOV ZKLOH FHOOV ZHUH SHUIXVHG E\ VROXWLRQV FRQWDLQLQJ YDULRXV VXEVWUDWHV DQG LQKLELWRUV )RU H[DPSOH +.$73DVH DFWLYLW\ UHTXLUHV HQWU\ IRU LQWUDFHOOXODU DONDOLQL]DWLRQ ,I +.$73DVH DFWLYLW\ ZHUH WKH RQO\ PHWKRG RI DFLG H[WUXVLRQ DYDLODEOH WR DQ DFLGLILHG FHOO S+ ZRXOG EH H[SHFWHG WR ULVH EDFN WR LWV HTXLOLEULXP S+ LQ VROXWLRQV FRQWDLQLQJ .f GXH WR H[FKDQJH RI H[WUDFHOOXODU IRU LQWUDFHOOXODU +? ,Q VROXWLRQV ODFNLQJ .? WKLV H[FKDQJH ZRXOG EH DEVHQW DQG FHOOV FRXOG QRW UHFRYHU 7KH UDWH RI S+ UHFRYHU\ S+ XQLWVPLQf LQ WKH SUHVHQFH RI ZRXOG EH SURSRUWLRQDO WR +.$73DVH DFWLYLW\ $QRWKHU PDQHXYHU WKDW ZDV XVHG WR LGHQWLI\ +.$73DVH DFWLYLW\ ZDV WR PHDVXUH UHFRYHU\ UDWHV LQ WKH SUHVHQFH DQG DEVHQFH RI DQ +.$73DVH LQKLELWRU /LNH WKH DEVHQFH RI WKH SUHVHQFH RI WKH LQKLELWRU ZRXOG EORFN UHFRYHU\ RI DQ DFLGLILHG FHOO WR QRUPDO S+ %\ LQKLELWLRQ RI RWKHU PHFKDQLVPV RI S+ UHJXODWLRQ +.$73DVH DFWLYLW\ FDQ LQGHHG EH LVRODWHG DQG UDWHV GHWHUPLQHG LQ WKLV ZD\ S+ ZDV GHWHUPLQHG E\ FKDQJHV LQ IOXRUHVFHQFH RI WKH S+VHQVLWLYH G\H %&(&) 7KH DFHWR[\PHWK\O HVWHU RI %&(&) FURVVHV FHOO PHPEUDQHV IUHHO\ DQG LQWUDFHOOXODU HVWHUDVHV FOHDYH WKH HVWHU ERQG WUDSSLQJ %&(&) ZLWKLQ WKH FHOO 7KHUHIRUH %&(&)$0 ZDV WKH DJHQW XVHG WR ORDG FHOOV ZLWK %&(&) IRU S+ PHDVXUHPHQWV $IWHU %&(&) ORDGLQJ FHOOV ZHUH WUDQVIHUUHG WR WKH PLFURVFRSH VWDJH 7KH QH[W VWHS RI WKH H[SHULPHQW ZDV DFLG

PAGE 107

ORDGLQJ RI WKH FHOOV 7KLV ZDV GRQH XVLQJ DQ 1+&, SUHSXOVH 6ROXWLRQ 7DEOH f FRQWDLQHG WKH QHXWUDO PHPEUDQHSHUPHDQW DPPRQLD ZKLFK HQWHUHG WKH FHOO DQG HTXLOLEUDWHG WR SURGXFH DQ DPRXQW RI WKH ZHDN DFLG DPPRQLXP 8SRQ UHPRYDO RI DPPRQLD IURP WKH H[WUDFHOOXODU VROXWLRQ LQWUDFHOOXODU DPPRQLD HVFDSHG WKH FHOO GRZQ LWV HOHFWURFKHPLFDO JUDGLHQW $PPRQLXP ZDV WUDSSHG ZLWKLQ WKH FHOO E\ LWV PHPEUDQH LPSHUPHDQFH WKH HOHFWURQHJDWLYLW\ RI WKH FHOO LQWHULRU DQG WKH IDFW WKDW 1)/ LV WUDQVSRUWHG LQZDUGO\ E\ 1D.$73DVH 7KLV WUDSSHG DPPRQLXP DFLGLILHG WKH FHOOV $V DOUHDG\ QRWHG IROORZLQJ WKLV DFLGLILFDWLRQ PHDVXUHPHQWV PD\ EH PDGH RI WUDQVSRUWHUV WKDW PHGLDWH DFLG H[WUXVLRQ DQG WKXV JLYH ULVH WR DONDOLQL]DWLRQ RI WKH FHOO )ROORZLQJ WKHVH PHDVXUHPHQWV WKH 1D+r H[FKDQJHU ZDV UHOHDVHG IURP LQKLELWLRQ DQG LQ IXQFWLRQDO FHOOV D UREXVW UHFRYHU\ WRZDUG HTXLOLEULXP S+ IRU WKH FHOO HQVXHV 2QFH S+ IRU DOO WKH FHOOV LQ WKH ILHOG RI YLHZ RI WKH PLFURVFRSH ZDV UHFRUGHG E\ WKH FRPSXWHU IRU HDFK WLPH SRLQW LQ WKH H[SHULPHQW DQDO\VLV RI WKH LQGLYLGXDO FHOOV PD\ EHJLQ 7KH )/ SURJUDP DOORZV WKH VHOHFWLRQ RI VLQJOH FHOOV DQG WKH S+ LV SORWWHG WKURXJK WKH GLIIHUHQW FKDQJHV RI VROXWLRQ 5DWHV RI FKDQJH LQ S+ IRU WKH UHOHYDQW SHULRGV PD\ EH FDOFXODWHG E\ D VSUHDGVKHHW FRPSXWHU SURJUDP ,W LV WKHVH UDWHV RI UHFRYHU\ WKDW ZHUH WKH EDVLV RI GHILQLQJ +.$73DVH DFWLYLW\ 7KH PRVW UREXVW DQG XELTXLWRXV PHFKDQLVP RI S+ UHJXODWLRQ LQ FHOOV LV WKH 1D+ H[FKDQJHU 7KH UHODWLYHO\ ODUJH FRQWULEXWLRQ WR UHFRYHU\ IURP DQ DFLG ORDG PHGLDWHG E\ WKH 1D+ H[FKDQJHU REVFXUHG UHFRYHU\ E\ RWKHU PHFKDQLVPV VR LWV DFWLYLW\ KDG WR EH EORFNHG IRU PHDVXUHPHQWV RI DFWLYLWLHV RI RWKHU +n WUDQVSRUWHUV ,Q WKH LQLWLDO VWXGLHV RI WKLV ZRUN 1D UHPRYDO ZDV XVHG WR EORFN 1D + H[FKDQJHU DFWLYLW\ ,Q WKHVH VWXGLHV GHVFULEHG PRUH IXOO\ EHORZ +.$73DVH DFWLYLW\ S+ UHFRYHU\ UDWHV ZHUH ORZ $W WKH

PAGE 108

WLPH 'U :HLQHU ZDV DWWHPSWLQJ ZLWKRXW VXFFHVV WR GHWHFW +.$73DVH DFWLYLW\ LQ $W\SH LQWHUFDODWHG FHOOV LQ SHUIXVHG WXEXOHV $ VXJJHVWLRQ E\ D UHYLHZHU RI D PDQXVFULSW IURP 'U :HLQHUfV ODERUDWRU\ ZDV WR XWLOL]H WKH SRWHQW DPLORULGH DQDORJ (,3$ WR LQKLELW WKH 1D+ H[FKDQJHU LQVWHDG RI XVLQJ UHPRYDO RI 1D $V VHHQ EHORZ PHDVXUHPHQWV RI +.$73DVHPHGLDWHG UHFRYHU\ URXJKO\ GRXEOHG LQ WKH SUHVHQFH RI 1Df ZLWK (,3$ DQG WKLV PXVW EH UHJDUGHG DV D PDMRU LPSURYHPHQW RI WKLV DVVD\ FRPSDUHG WR LWV RULJLQDO IRUP +D\V DQG $OSHUQ f KDG SUHYLRXVO\ REVHUYHG DQ HIIHFW RI1D UHPRYDO RQ S+ UHJXODWLRQ E\ + SXPSV DQG LQ LWV ILQDO IRUP WKH VWXG\ RI $W\SH LQWHUFDODWHG FHOOV E\ 0LOWRQ DQG :HLQHU f REVHUYHG D VLPLODU HIIHFW $QRWKHU PDMRU HYROXWLRQ RI WKHVH VWXGLHV ZDV WKH ILQGLQJ WKDW WKHUH ZHUH WLPHGHSHQGHQW HIIHFWV WKDW DSSHDU DIWHU DFLG ORDGLQJ 7KHVH ZHUH QHYHU REVHUYHG LQ FRQWURO H[SHULPHQWV DW D WLPH OHVV WKDQ PLQ IROORZLQJ 1+& UHPRYDO $IWHU WKH PLQ SHULRG WZR VHSDUDWH HIIHFWV WKDW ZRXOG GLVWXUE UDWH PHDVXUHPHQWV ZHUH VHHQ LQ VRPH FHOOV 7KH ILUVW ZDV WKDW LQ VRPH FHOOV WKH UHFRYHU\ ZRXOG SODWHDX EHIRUH DWWDLQLQJ WKH QRUPDO HTXLOLEULXP EDVHOLQH S+ :KHQ 1Dn ZDV UHWXUQHG WR VROXWLRQV RU ZKHQ (,3$ ZDV UHPRYHG IXQFWLRQDO FHOOV IXOO\ UHFRYHUHG WRZDUG EDVHOLQH 7KLV SODWHDX HIIHFW KDV EHHQ REVHUYHG LQ SUHYLRXV VWXGLHV RI 1D LQGHSHQGHQW S+ UHJXODWLRQ 0RQWURVH DQG 0XUHU 0RQWURVH HO D f 7KH VHFRQG FRQIRXQGLQJ HIIHFW ZDV WKDW LQ WKH FRQWLQXHG DEVHQFH RI SRWDVVLXP D GHOD\HG LQFUHDVH LQ WKH S+ UHFRYHU\ UDWH GHYHORSHG FRQVLVWHQW ZLWK D GHOD\HG VWLPXODWLRQ RI +$73DVH 7KHVH UHVXOWV ZHUH FRQVLVWHQW ZLWK SUHYLRXV UHVXOWV E\ +D\V DQG $OSHUQ f ZKR GHVFULEHG DQ + $73DVH DFWLYLW\ WKDW ZDV GHOD\HG IROORZLQJ DQ 1+& SUHSXOVH %HOOR5HXVV f DOVR GHWHFWHG + $73DVH DV ZHOO DV +.$73DVH DFWLYLW\ LQ 5&&7$ FHOOV $V D FRQVHTXHQFH WKH RULJLQDO SURWRFROV FDOOLQJ

PAGE 109

IRU D SHULRG RI DEVHQFH IROORZHG E\ D SHULRG RI .n DGGLWLRQ KDG WR EH PRGLILHG ([SHULPHQWV LQROYLQJ SHUIXVHG WXEXOHV W\SLFDOO\ LQYROYHG WDNLQJ GDWD LQ DEVHQFH WKHQ SUHVHQFH RI VROXWLRQ VXEVWUDWHV RU LQKLELWRUV EXW LQ WKLV V\VWHP WKHUH ZDV QRW VXIILFLHQW WLPH IROORZLQJ DFLG ORDGLQJ IRU UDWHV WR EH DFFXUDWHO\ GHWHUPLQHG IRU ERWK & DEVHQFH DQG SUHVHQFH 7KHUHIRUH WKH ILQDO GHVLJQ RI WKH SURWRFRO FDOOHG IRU PDNLQJ PXOWLSOH VHSDUDWH PHDVXUHPHQWV RI GHSHQGHQW UHFRYHU\ UDWHV DQG .LQGHSHQGHQW UHFRYHU\ UDWHV 6FKVHQVLWLYH UHFRYHU\ UDWHV ZHUH DOVR GHWHUPLQHG LQ PXOWLSOH VHSDUDWH H[SHULPHQWV :LWK PHDVXUHPHQWV PDGH LQ WKLV ZD\ WKHUH ZDV D VWDWLVWLFDOO\ VLJQLILFDQW GLIIHUHQFH EHWZHHQ WKH H[SHULPHQWDO FRQGLWLRQV ZLWK WKH PHDVXUHPHQWV EHLQJ FRQVLVWHQW ZLWK WKH SUHVHQFH RI DQ +.$73DVH LQ 5&&7$ FHOOV $SLFDO ,&GHSHQGHQW 5&&7$ FHOO S+ UHJXODWLRQ LQ WKH DEVHQFH RI 1D )LJXUH VKRZV D UHSUHVHQWDWLYH WUDFLQJ RI D FHOO WKDW ZDV DFLG ORDGHG E\ DQ 1+& SUHSXOVH ^VROXWLRQ DGGHG WR EDVRODWHUDO FKDPEHUf DQG S+ UHFRYHU\ REVHUYHG IRU D SHULRG RI PLQ LQ WKH DEVHQFH RI 1D? +&2\ RU DSLFDO ^VROXWLRQ LQ DSLFDO FKDPEHU VROXWLRQ LQ EDVRODWHUDO FKDPEHUf 8QGHU WKHVH FRQGLWLRQV UHFRYHU\ RI S+ WR SK\VLRORJLFDO UDQJH PHGLDWHG E\ VXFK SURFHVVHV DV 1D9+ H[FKDQJH &+& H[FKDQJH RU DSLFDO +. H[FKDQJH ZRXOG EH EORFNHG $ SRSXODWLRQ RI FHOOV ZDV IRXQG LQ ZKLFK WKH PHDQ UHFRYHU\ S+ UDWH ZDV s S+ XQLWVPLQ XQGHU WKHVH FRQGLWLRQV QRW VLJQLILFDQWO\ GLIIHUHQW IURP ]HUR 8SRQ VZLWFKLQJ WKH PHGLD SHUIXVLQJ WKH DSLFDO VLGH WR VROXWLRQ D .FRQWDLQLQJ VROXWLRQ D PHDQ UHFRYHU\ UDWH RI s S+ XQLWVPLQ ZDV REVHUYHG FRQVLVWHQW ZLWK DQ DSLFDOO\ ORFDWHG .GHSHQGHQW PHFKDQLVP RI S+ UHFRYHU\ :LWK 1D DGGHG WR WKH SHUIXVLQJ VROXWLRQ D UREXVW UHFRYHU\ RI S+ WRZDUG EDVHOLQH YDOXH ZDV REVHUYHG SUHVXPDEO\ PHGLDWHG E\ 1D9+f H[FKDQJH

PAGE 110

QK 1D $S %O )LJXUH S+ UHFRYHU\ IURP DQ DFLG ORDG E\ 5&&7$ FHOOV LQ WKH DEVHQFH RI 1D $ UHSUHVHQWDWLYH WUDFLQJ RI S+c LQ DQ LQGLYLGXDO FHOO LV VKRZQ 3HULRGV GXULQJ ZKLFK VROXWLRQV FRQWDLQ P0 1+& P0 1D DQG P0 RQ DSLFDO $Sf VLGH DUH LQGLFDWHG7KURXJKRXW WKH H[SHULPHQW P0 .ZDV SUHVHQW RQ EDVRODWHUDO %Of VLGH &HOOV ZHUH DFLG ORDGHG DQG UHFRYHU\ ZDV REVHUYHG LQ WKH DEVHQFH RI $S WKHQ LQ WKH SUHVHQFH RI $S 1R .LQGHSHQGHQW UHFRYHU\ ZDV REVHUYHG EXW LQ WKH SUHVHQFH RI WKHUH ZDV GHWHFWDEOH UHFRYHU\ )LQDOO\ 1DZDV DGGHG EDFN DQG UREXVW UHFRYHU\ ZDV REVHUYHG

PAGE 111

.GHSHQGHQW 5&&7$ FHOO S+ UHJXODWLRQ LQ WKH SUHVHQFH RI 1Dn %HFDXVH RI WKH UDWKHU PRGHVW OHYHO RI +.$73DVH DFWLYLW\ GHWHFWHG LQ WKHVH FHOOV DQG EHFDXVH RI UHVXOWV REWDLQHG E\ 0LOWRQ DQG :HLQHU f LQGLFDWLQJ WKDW 1Dr PXVW EH SUHVHQW IRU RSWLPDO PHDVXUHPHQWV RI +.$73DVH DFWLYLW\ E\ WKLV WHFKQLTXH ZH XQGHUWRRN VWXGLHV LQ ZKLFK 1D ZDV SUHVHQW GXULQJ WKH S+ UHFRYHU\ SHULRG IROORZLQJ DQ DFLG ORDG 7KH FHOOV ZHUH DFLG ORDGHG E\ V\PPHWULFDO DGGLWLRQ RI VROXWLRQ FRQWDLQLQJ S0 (,3$ ,Q WKH DEVHQFH RI V\PPHWULFDO VROXWLRQ f D UHFRYHU\ UDWH WKDW ZDV QRW VLJQLILFDQWO\ GLIIHUHQW IURP ]HUR s S+ XQLWVPLQf FRXOG EH PHDVXUHG LQ WKUHH VHSDUDWH FHOO SUHSDUDWLRQV $ .GHSHQGHQW UHFRYHU\ V\PPHWULFDO VROXWLRQ SOXV S0 (,3$f FRXOG EH REVHUYHG s S+ XQLWVPLQ 3 YV IUHH SHUIXVLRQf 7KHUH ZDV DSSUR[LPDWHO\ D WKUHHIROG DFWLYDWLRQ RI GHSHQGHQW UHFRYHU\ UDWH S+ DWWULEXWDEOH WR WKH SUHVHQFH RI 1D LQ WKH SHUIXVLQJ VROXWLRQV .1GHSHQGHQW (O3$VHQVLWLYH 5&&7$ FHOO S+ UHJXODWLRQ 7KH IROORZLQJ PHDVXUHPHQWV UHSUHVHQW WKH FRQFOXVLYH H[SHULPHQWV LQ ZKLFK 1Dr LV SUHVHQW IRU PD[LPDO +.$73DVH DFWLYLW\ DQG PHDVXUHPHQWV ZHUH PDGH GXULQJ SHULRGV LQ ZKLFK WKHUH ZHUH QR .LQGHSHQGHQW DUWLIDFWV $ UHSUHVHQWDWLYH WUDFLQJ RI D FHOO DFLG ORDGHG E\ DQ 1)(&O SUHSXOVH V\PPHWULFDO VROXWLRQ SOXV S0 (,3$f DQG S+ UHFRYHU\ REVHUYHG LV VKRZQ LQ )LJXUH $ ,Q D PDMRULW\ RI 5&&7$ FHOOV WKHUH ZDV VLJQLILFDQW (O3$LQVHQVLWLYH S+ UHFRYHU\ LQ .FRQWDLQLQJ VROXWLRQV V\PPHWULFDO VROXWLRQ SOXV S0 (,3$f )RU FHOOV IURP VL[ LQGHSHQGHQW SDVVDJHV RI 5&&7$ FHOOV WKH PHDQ UHFRYHU\ UDWH ZDV s S+ XQLWVPLQ ,Q WKH DEVHQFH RI V\PPHWULFDO VROXWLRQ SOXV S0 (,3$f GXULQJ WKH SHULRG IROORZLQJ DFLG ORDG QR LPPHGLDWH S+ UHFRYHU\ ZDV REVHUYHG )LJXUH %f ,Q ILYH VHSDUDWH H[SHULPHQWV FHOOVf WKH .LQGHSHQGHQW S+ UHFRYHU\

PAGE 112

QK (,3$ )LJXUH S+c UHFRYHU\ IURP DQ DFLG ORDG E\ 5&&7$ FHOOV LQ WKH SUHVHQFH RI (,3$ 5HSUHVHQWDWLYH WUDFLQJV RI S+c LQ LQGLYLGXDO FHOOV DUH VKRZQ 3HULRGV GXULQJ ZKLFK VROXWLRQV FRQWDLQ P0 1+& DQG P0 (,3$ DUH LQGLFDWHG &HOOV ZHUH DFLG ORDGHG DQG UHFRYHU\ ZDV REVHUYHG LQ WKH SUHVHQFH RI $f LQ WKH DEVHQFH RI .%f DQG LQ WKH SUHVHQFH RI 6FK &f r} 9r

PAGE 113

UDWH DYHUDJHG s S+ XQLWVPLQ 3 YV P0 .f 7KH .LQGHSHQGHQW (,3$VHQVLWLYH S+ UHFRYHU\ UDWH PHDVXUHG LPPHGLDWHO\ DIWHU DFLG ORDGLQJ ZDV OHVV WKDQ WKDW PHDVXUHG GXULQJ WKH SURWRFROV LQ ZKLFK PHDVXUHPHQWV ZHUH GHOD\HG ZLWK UHVSHFW WR DFLG ORDGLQJ 6FK DQG (,3$VHQVLWLYH 5&&7$ FHOO S+ UHJXODWLRQ 7R WHVW WKH K\SRWKHVLV WKDW GHSHQGHQW S+ UHFRYHU\ IURP DQ DFLG ORDG UHVXOWHG IURP +.$73DVH WKH HIIHFW RI WKH FODVVLFDO +.$73DVH LQKLELWRU 6FK S0f ZDV H[DPLQHG RQ 5&&7$ FHOO S+ UHJXODWLRQ )LJXUH &f $IWHU DFLG ORDGLQJ LQ VROXWLRQ FRQWDLQLQJ 6FK SOXV (3$ FHOOV ZHUH SHUIXVHG LQ D .nFRQWDLQLQJ VROXWLRQ VROXWLRQ ZLWK 6FK SOXV (,3$f 8VLQJ WKLV SURWRFRO FHOOV IURP IRXU VHSDUDWH FHOO SUHSDUDWLRQV KDG D PHDQ UHFRYHU\ UDWH RI s S+ XQLWVPLQ 3 YV P0 3 16 YV P0 .f LQ WKH SUHVHQFH RI S0 6FK %XIIHU FDSDFLW\ DQG S+ DIWHU DFLG ORDGLQJ 7KH HIIHFWV RI WKH YDULRXV SURWRFROV SHUIRUPHG LQ WKHVH H[SHULPHQWV PLJKW EH H[SODLQHG E\ GLIIHUHQFHV LQ EXIIHU FDSDFLW\ RU WKH GHJUHH WR ZKLFK FHOOV DUH DFLGLILHG E\ WKH 1+& SUHSXOVH $OWKRXJK WKHVH H[SHULPHQWV GLUHFWO\ PHDVXUHG WKH UDWH RI S+ FKDQJH WKH YDULDEOH RI LQWHUHVW LV SURWRQ IOX[ WKHVH WZR YDOXHV DUH GLUHFWO\ UHODWHG E\ EXIIHU FDSDFLW\ 7KXV EXIIHU FDSDFLW\ KDG WR EH FRQVLGHUHG WR DYRLG PLVFRQFHSWLRQV FRQFHUQLQJ SURWRQ WOX[ FKDQJHV EDVHG RQ REVHUYDWLRQV RI S+ UHFRYHU\ UDWHV %XIIHU FDSDFLWLHV PHDVXUHG E\ WKH 1+"1+I WHFKQLTXH %R\DUVN\ HW DO f LQ WKH SUHVHQFH RI .? DEVHQFH RI DQG SUHVHQFH RI 6FK ZHUH s P(T +S+ 8/ FHOO YROXPH s 3 16 YV P0 .f DQG s 3 16 YV P0 .f UHVSHFWLYHO\ 7KHUHIRUH FKDQJHV LQ S+ UHFRYHU\ UDWHV DPRQJ WKH SURWRFROV FRXOG QRW EH DWWULEXWHG WR FKDQJHV LQ EXIIHU FDSDFLWLHV

PAGE 114

6RPH PHFKDQLVPV RI S+ UHFRYHU\ KDYH UHFRYHU\ UDWHV WKDW DUH LQIOXHQFHG E\ DEVROXWH S+ ZLWK D WHQGHQF\ IRU JUHDWHU DFLGLILFDWLRQ WR VWLPXODWH KLJKHU UDWHV RI S+ UHFRYHU\ 7KHUHIRUH D FKDQJH LQ WKH UDWH RI UHFRYHU\ PLJKW KDYH EHHQ GXH WR GLIIHUHQFHV LQ DEVROXWH S+ DIWHU DFLG ORDGLQJ $FWXDO QDGLU S+ REVHUYHG LQ WKHVH H[SHULPHQWV LQ WKH FDVH RI SUHVHQFH DEVHQFH DQG 6FK SUHVHQFH PHDVXUHG s s 3 16 YV P0 .f DQG s 3 16 YV P0 ,&f &RQVHTXHQWO\ FKDQJHV LQ S+ UHFRYHU\ UDWHV DPRQJ WKH SURWRFROV ZDV QRW GXH WR WKH QDGLU S+ 'LVFXVVLRQ 5&&7$ FHOOV FRQWDLQHG WKH P51$V HQFRGLQJ DOO WKUHH +.D VXEXQLWV DQG WKH +.L VXEXQLW 6LQFH 5&&7$ FHOOV DUH D FORQDO FHOO OLQH WKH LPSOLFDWLRQ LV WKDW LQGLYLGXDO $W\SH LQWHUFDODWHG FROOHFWLQJ GXFW FHOOV PD\ H[SUHVV DW OHDVW WKUHH GLIIHUHQW +.$73DVHV 7KH +.D VXEXQLW P51$ GHWHFWHG LQ 5&&7$ FHOOV JLYHV ULVH WR DW OHDVW WKH +.DL DQG +.DF SURWHLQV ,W LV RI LQWHUHVW WKDW WKH PRVW QRYHO VXEXQLW WKH DOWHUQDWLYHO\ VSOLFHG +.DF SURWHLQ LV LQGHHG SUHVHQW LQ WKH FRUWLFDO FROOHFWLQJ WXEXOH $W\SH LQWHUFDODWHG FHOO OLQH LQ DJUHHPHQW ZLWK WKH H[SHFWDWLRQV EURXJKW E\ WKH LPPXQRKLVWRFKHPLVWU\ VWXGLHV $QG OLNH WKH LPPXQRKLVWRFKHPLFDO HYLGHQFH ERWK ZLWK //& DQWL+.Df DQG LQ SUHYLRXV ZRUN E\ RWKHUV WKH H[SHULPHQWV ZLWK 5&&7$ FHOOV DGGV WR WKH HYLGHQFH WKDW +.DL LV DOVR D WUDQVSRUWHU H[SUHVVHG LQ WKH FROOHFWLQJ GXFW $W\SH LQWHUFDODWHG FHOO :H HOHFWHG QRW WR SXUVXH GHWHFWLRQ RI +. WKH SXWDWLYH SDUWQHU WR +.DL GXH WR WLPH FRQVWUDLQWV DQG EHFDXVH RI RXU LQWHUHVW LQ FKDUDFWHUL]LQJ RXU RZQ DQWLERGLHV ,W KDV TXLWH UHFHQWO\ OHVV WKDQ WZR PRQWKV DJRf EHHQ UHSRUWHG WKDW 1D.L LV D OLNHO\ SDUWQHU WR +.DF

PAGE 115

'XERVH HW DO HW DO .UDXW HW DO f VR GHWHFWLRQ RI WKDW VXEXQLW KDV DOVR QRW EHHQ GRQH 7KH XELTXLW\ RI 1D.L LQ WKH NLGQH\ DQG LQ WKH ZKROH DQLPDO ZRXOG PDNH D SRVLWLYH UHVXOW E\ ZHVWHUQ DQDO\VLV YHU\ GLIILFXOW WR LQWHUSUHW LQ WHUPV RI UHOHYDQFH WR +.$73DVH :H KDYH SURYLGHG LQGHSHQGHQW FRQILUPDWLRQ RI %HOOR5HXVVf %HOOR5HXVV f UHSRUW WKDW 5&&7$ FHOOV KDYH +.$73DVH DFWLYLW\ (LWKHU WKH SUHVHQFH RI WKH +.$73DVH LQKLELWRU 6FK RU WKH DEVHQFH RI .I YLUWXDOO\ DEROLVKHG WKH LQWUDFHOOXODU DONDOLQL]DWLRQ UDWHV RI 5&&7$ FHOOV IROORZLQJ DQ DFLG ORDGLQJ )LJXUH f :KHQ ZDV SUHVHQW RQ RQO\ WKH EDVRODWHUDO VLGH RI 5&&7$ FHOOV PHDQ UHFRYHU\ UDWHV ZHUH QRW VLJQLILFDQWO\ GLIIHUHQW IURP ]HUR ,Q WKH SUHVHQFH RI .f 5&&7$ FHLOV SRVVHVVHG D PHFKDQLVP IRU S+ UHFRYHU\ WKDW H[FHHGHG WKH UDWHV REVHUYHG ZLWKRXW RU ZLWK 6FK 7KHVH UHVXOWV FRQVWLWXWHG DQ LQGHSHQGHQW FRQILUPDWLRQ RI DSLFDO +. $73DVH DFWLYLW\ LQ 5&&7$ FHOOV 6WXGLHV LQ KHWHURORJRXV H[SUHVVLRQ V\VWHPV &RGLQD HW DO &RXJQRQ HW DO /HH HW DO 0RG\DQRY HW DW f DQG LQ D PDPPDOLDQ H[SUHVVLRQ V\VWHP *ULVKLQ HW DO f VXJJHVWHG WKDW DQ +.$73DVH ZLWK WKH +.D VXEXQLW ZDV OHVV VHQVLWLYH WR 6FK LQKLELWLRQ WKDQ WKH +.F[L SXPS WKXV WKH GLIIHUHQWLDO VHQVLWLYLW\ RI WKH WZR HQ]\PHV RIIHUHG WKH SRVVLELOLW\ RI GLVFULPLQDWLQJ EHWZHHQ WKH WZR DW WKH OHYHO RI DFWLYLW\ ,Q WKLV VWXG\ WKH .rLQGHSHQGHQW DQG 6FKVHQVLWLYH S+ UHFRYHULHV ZHUH VLPLODU DUJXLQJ WKDW +.RWL LV WKH LVRIRUP UHVSRQVLEOH IRU EDVDO OHYHOV RI +.$73DVH DFWLYLW\ LQ 5&&7$ FHOOV %XWOLQ0H\HU HW DO f REVHUYHG D OLNH VLWXDWLRQ LQ UDW

PAGE 116

GS+GW S+ XQLWVPLQf P0 P0 X0 6&+ )LJXUH 6XPPDU\ RI WKH UDWHV RI S+ UHFRYHU\ IURP DQ DFLG ORDG E\ 5&&7$ FHOOV 0HDQ UDWHV RI UHFRYHU\ DUH LQGLFDWHG E\ XQILOOHG SUHVHQFH RI .f EODFN DEVHQFH RI .f DQG VWLSSOHG LQ WKH SUHVHQFH RI 6FK ZLWK 5HSUHVHQWf EDUV r 3 YV P0 rr 3 YV P0 3 16 YV .

PAGE 117

&&' LQ ZKLFK +.$73DVH DFWLYLW\ ZDV DEROLVKHG E\ 6FK XQGHU QRUPDO FRQGLWLRQV DQG UHVLVWDQW WR 6FK RQO\ GXULQJ .n GHSOHWLRQ VXJJHVWLQJ XSUHJXODWLRQ RU PRELOL]DWLRQ RI +.D" SXPSV ,I EDVDO +.$73DVH DFWLYLW\ LQ 5&&7$ FHOOV LV PHGLDWHG SULPDULO\ E\ +.RWL WKHQ SRVWWUDQVFULSWLRQDO UHJXODWLRQ PD\ H[SODLQ WKH IXQFWLRQDO VLOHQFH RI WKH +.RW HQ]\PHV +RZHYHU WKHUH LV QRW \HW D FOHDU XQGHUVWDQGLQJ RI WKH 6FK LQKLELWRU SURILOH ,Q WKH PDPPDOLDQ H[SUHVVLRQ V\VWHP *ULVKLQ HW DO f WKH +.RW DFWLYLW\ LV LQKLELWHG E\ 6FK DW ORZHU FRQFHQWUDWLRQV WKDQ LQ WKH KHWHURORJRXV H[SUHVVLRQ V\VWHPV $OVR LW ZDV QRW FHUWDLQ WKDW WKH 3 LVRIRUP SDLUHG ZLWK WKH +.RW VXEXQLW LQ WKH H[SUHVVLRQ V\VWHPV LV WKH RQH WKDW DVVRFLDWHV ZLWK LW LQ YLYR 6FK PD\ KDYH DQ DUWLILFLDOO\ UHGXFHG SRWHQF\ LQ H[SUHVVLRQ V\VWHPV GXH WR WKH ODFN RI DVVRFLDWLRQ RI WKH FRUUHFW 3 VXEXQLW RU VRPH RWKHU LQGLUHFW HIIHFW WKHUHIRUH FRQFOXVLRQV UHDFKHG EDVHG RQ WKH LQKLELWRU SURILOH PXVW EH LQWHUSUHWHG FDXWLRXVO\ +.D LV VHQVLWLYH WR WKH LQKLELWRU RXDEDLQ 0RG\DQRY HW DO &RGLQD HW DO &RXJQRQ HW DO *ULVKLQ HW DO f ZKLOH +.RWL KDV QR DSSDUHQW VHQVLWLYLW\ VXJJHVWLQJ D SRWHQWLDO PHDQV WR GLVFULPLQDWH RQ D SKDUPDFRORJLFDO EDVLV EHWZHHQ WKH DFWLYLW\ RI WKH WZR LVRIRUPV +RZHYHU WKH SULPDU\ DFWLRQ RI RXDEDLQ LV LQKLELWLRQ RI 1D.$73DVH VR DSSOLFDWLRQ RI RXDEDLQ ZRXOG GLVWXUE WKH 1Dr DQG .n HTXLOLEULD RI WKH FHOO ,QGHHG LQ SUHOLPLQDU\ H[SHULPHQWV GLVFXVVHG DERYH +.$73DVH DFWLYLW\ ZDV REVHUYHG WR EH SURIRXQGO\ DIIHFWHG E\ WKH SUHVHQFH RU DEVHQFH RI 1D? 7KHUHIRUH DQ\ HIIHFW RI RXDEDLQ RQ DSSDUHQW DFWLYLWLHV RI WKH D VXEXQLW +.$73DVHV FRXOG QRW EH GLVWLQJXLVKHG IURP D VHFRQGDU\ HIIHFW GXH WR LQKLELWLRQ RI 1D.$73DVH 2QO\ ZKHQ D

PAGE 118

JUHDW GHDO PRUH LV NQRZQ DERXW WKH HIIHFW RI VSHFLILF LQKLELWRUV RQ +.$73DVH LVRIRUPV LQFOXGLQJ DQ\ VSHFLHV GLIIHUHQFHV LQ WKHLU SRWHQF\ ZRXOG LQKLELWRU VWXGLHV EH YDOXDEOH )OXRUHVFHQW PHDVXUHPHQWV RI S+ UHFRYHU\ UDWHV DWWULEXWDEOH WR +.$73DVH DFWLYLW\ LQ PLFURSHUIXVHG &&' LQ SUHYLRXV VWXGLHV &RQVWDQWLQHVFX HW DO 6LOYHU HW DO 6LOYHU HWD :HLQHU DQG 0LOWRQ 0LOWRQ DQG :HLQHU 6LOYHU HW DO f KDYH \LHOGHG YDOXHV EHWZHHQ s DQG s S+ 8PLQ 7KHVH YDOXHV DUH JUHDWHU WKDQ WKRVH LQ WKH SUHVHQW VWXG\ EXW WUDQVSRUW DFWLYLW\ LQ FRQWLQXRXV FHOO OLQHV LV W\SLFDOO\ OHVV UREXVW WKDQ WKDW RI PLFURSHUIXVHG WXEXOHV $QRWKHU FRQWLQXRXV FHOO OLQH RI UHQDO RULJLQ D PRXVH LQQHU PHGXOODU\ FROOHFWLQJ GXFW FHOO OLQH KDV EHHQ VWXGLHG XVLQJ WKHVH WHFKQLTXHV DQG UHFRYHU\ UDWHV RI s ZHUH REVHUYHG 2QR HO DO f 6SHFLHV GLIIHUHQFH DQG D[LDO KHWHURJHQHLW\ RI WKH FROOHFWLQJ GXFW PD\ H[SODLQ WKH GLIIHUHQFH LQ UDWHV EHWZHHQ WKH WZR UHQDO FHOO OLQHV $ PDMRU JRDO RI WKLV SURMHFW ZDV WR GHILQH ZKLFK FHOO W\SH RU W\SHV LQ WKH NLGQH\ FRQWDLQ +.$73DVH 7KH 5&&7$ FHOO OLQH ZKLFK KDV PDQ\ FKDUDFWHULVWLFV RI WKH FROOHFWLQJ GXFW DFLGVHFUHWLQJ LQWHUFDODWHG FHOO FOHDUO\ H[SUHVVHV VHYHUDO +.$73DVHV $OWKRXJK P51$ DQG SURWHLQ OHYHO ZHUH ORZ WKHUH ZDV GHWHFWDEOH +.$73DVH DFWLYLW\ LQ WKHVH FHOOV 0XOWLSOH +.$73DVH LVRIRUPV PD\ FRQWULEXWH WR WKLV DFWLYLW\ 8QGHUVWDQGLQJ RI +7 DQG WUDQVSRUW LQ WKH FROOHFWLQJ GXFW E\ +.$73DVHV PXVW LQYROYH LQYHVWLJDWLRQV LQWR WKH NLQHWLFV DQG UHJXODWLRQ RI HDFK LVRIRUP (DFK +.$73DVH LVRIRUP PLJKW KDYH EHHQ OLPLWHG WR D GLIIHUHQW VLQJOH FHOO W\SH UDWKHU WKDQ D VLQJOH FHOO FRQWDLQLQJ PXOWLSOH +.$73DVHV ,W ZDV LPSRUWDQW WR GHWHUPLQH ZKLFK RI WKHVH FDVHV DFWXDOO\ RFFXUV $Q LQWHUHVWLQJ DVSHFW WR WKHVH VWXGLHV LV WKH LPSOLFDWLRQ WKDW UHJXODWRU\ SURFHVVHV RI WKH YDULRXV +.$73DVH LVRIRUPV UHVLGH LQ D VLQJOH FHOO W\SH 7KLV ZRXOG

PAGE 119

DOORZ DQ LQWHUSOD\ DW WKH LQWUDFHOOXODU OHYHO EHWZHHQ LVRIRUPV SHUKDSV E\ FURVVWDON EHWZHHQ VLJQDO WUDQVGXFWLRQ SDWKZD\V RU SHUKDSV HYHQ E\ SK\VLFDO LQWHUDFWLRQ EHWZHHQ GLIIHUHQW +.$73DVH VXEXQLW LVRIRUPV

PAGE 120

3(563(&7,9( $1' )8785( ',5(&7,216 0XOWLSOLFLW\ RI +.$73DVH ,VRIRUPV LQ WKH .LGQH\ -XVW LQ WKH ODVW GHFDGH LW KDV EHFRPH NQRZQ WKDW +.$73DVH LV RQH RI WKH HQ]\PHV WKDW FRQWULEXWHV WR UHJXODWLRQ RI DFLGEDVH EDODQFH DQG SRWDVVLXP KRPHRVWDVLV E\ WKH NLGQH\ 'RXFHW DQG 0DUV\ :LQJR f 2QO\ UHFHQWO\ KDYH WKH PROHFXOHV WKDW PHGLDWH WKLV DFWLYLW\ LQ WKH NLGQH\ EHHQ LGHQWLILHG 0RG\DQRY HW D &DOODJKDQ HW DO $KQ DQG .RQH .RQH DQG +LJKDP f 7KLV \HDU HYLGHQFH ZDV SURYLGHG E\ WZR LQGHSHQGHQW LQYHVWLJDWLRQV WKDW WKH 1D.L VXEXQLW DOVR LV D SDUWLFLSDQW LQ +.$73DVH DFWLYLW\ 'X%RVH HO DO .UDXW HW DO f 7KHVH VWXGLHV VKRZHG WKDW 1D.L VXEXQLW ZDV WKH ORQJVRXJKW 3 VXEXQLW WKDW DVVRFLDWHV ZLWK WKH +.$73DVH FDWDO\WLF VXEXQLW GLVFRYHUHG LQ GLVWDO FRORQ E\ &URZVRQ DQG 6KXOO f 7KXV WKHUH LV D JUHDW GHDO RI FRPSOH[LW\ DW WKH PROHFXODU OHYHO EHKLQG WKH +.$73DVH DFWLYLW\ WKDW ZDV REVHUYHG LQ WKH NLGQH\ 7KH VWXGLHV GHVFULEHG LQ WKLV GLVVHUWDWLRQ DGGUHVV WKH PROHFXODU QDWXUH RI +.$73DVHV LQ WKH NLGQH\ $ QRYHO ),.S VXEXQLW YDULDQW P51$ +.3ff VSHFLILF WR UHQDO PHGXOOD ZDV IRXQG E\ QRUWKHUQ DQDO\VLV ,Q DGGLWLRQ WR WKH FDQRQLFDO WUDQVFULSW WKH QRYHO P51$ ZDV H[SUHVVHG LQ WKH UHQDO PHGXOOD EXW QRW LQ UHQDO FRUWH[ RU VWRPDFK 7KH +.3f VXEXQLW P51$ PD\ KDYH EHHQ D SURGXFW RI PHGXOODVSHFLILF DOWHUQDWLYH VSOLFLQJ DW WKH f HQG RI WKH +.3 JHQH 7KHUH ZDV LQGLYLGXDO YDULDWLRQ LQ UDEELWV ZLWK UHVSHFW WR

PAGE 121

UHODWLYH DEXQGDQFH RI +.3 DQG +.3f VXEXQLW QL51$ LQ PHGXOOD RI WKH NLGQH\ EXW +.3f ZDV DSSDUHQWO\ QRW UHJXODWHG E\ GLHWDU\ UHVWULFWLRQ 7KH H[LVWHQFH RI +.3f VKRZV WKDW WKH QDWXUH RI +.$73DVH 3 VXEXQLWV DV ZHOO DV D VXEXQLWV LV FRPSOH[ DQG PXVW EH FRQVLGHUHG LQ XQGHUVWDQGLQJ +.$73DVH IXQFWLRQ LQ WKH NLGQH\ $ QXPEHU RI +.$73DVH D VXEXQLW F'1$V KDYH EHHQ FORQHG DQG VHTXHQFHG IURP YDULRXV VSHFLHV 7KH\ PLJKW EH LQLWLDOO\ FKDUDFWHUL]HG E\ WKHLU WLVVXH GLVWULEXWLRQ )LUVW WKHUH ZDV WKH ZHOONQRZQ JDVWULF LVRIRUP +.FWL VXEXQLW FORQHG IURP UDW 6KXOO DQG /LQJUHO f SLJ 0DHGD HW DO f KXPDQ 0DHGD HO DO f UDEELW %DPEHUJ HW DO f IURJ 0DWKHZV HW DO f DQG PRXVH 0DWKHZV HW DO f 6HFRQG WKHUH ZHUH +.$73DVH FDWDO\WLF LVRIRUPV FORQHG IURP KXPDQ D[LOODU\ VNLQ 0RG\DQRY HW DO f UDW GLVWDO FRORQ &URZVRQ DQG 6KXOO f JXLQHD SLJ GLVWDO FRORQ :DWDQDEH HW DO f DQG D SDUWLDO F'1$ IURP UDEELW NLGQH\ )HMHV7RWK HW DW f 7KHVH ZHUH QRW GHWHFWHG LQ VWRPDFK EXW ZHUH H[SUHVVHG LQ QXPHURXV RWKHU WLVVXHV SULPDULO\ GLVWDO FRORQ 7KXV IDU DW PRVW WZR 3W\SH +.$73DVH D VXEXQLW LVRIRUPV KDYH EHHQ LGHQWLILHG LQ DQ\ RQH VSHFLHV $OWHUQDWLYHO\ VSOLFHG YDULDQWV RI WKH QRQJDVWULF LVRIRUPV KDYH EHHQ IRXQG LQ UDW .RQH DQG +LJKDP f DQG UDEELW &DPSEHOO HW DO f $Q +.$73DVH FDWDO\WLF VXEXQLW KDV EHHQ FORQHG IURP WKH EODGGHU RI WKH WRDG %XIR PDULQXV WKDW KDG D WLVVXH GLVWULEXWLRQ WKDW FRQWUDVWHG ZLWK WKDW VHHQ LQ PDPPDOV -DLVVHU HW DO f :KLOH QRUWKHUQ DQDO\VLV GHWHFWHG WKH WRDG +.D WUDQVFULSWV LQ EODGGHU LW ZDV QRW REVHUYHG LQ HLWKHU VWRPDFK RU GLVWDO FRORQ 7KLV PD\ UHIOHFW GLIIHUHQFHV LQ SK\VLRORJ\ EHWZHHQ WKH WRDG DQG PDPPDOLDQ VSHFLHV )RU H[DPSOH WKH WRDG PD\ QRW UHTXLUH GLVWDO

PAGE 122

FRORQLF UHDEVRUSWLRQ IRU .U KRPHRVWDVLV 2Q WKH RWKHU KDQG WKH WRDG +.D PD\ EH WKH ILUVW HYLGHQFH RI DQ +.$73DVH VXEXQLW WKDW KDV HVFDSHG GHWHFWLRQ LQ PDPPDOV &RQWURYHUV\ SHUVLVWV RYHU WKH QRPHQFODWXUH RI +.$73DVH VXEXQLWV 6RPH LQYHVWLJDWRUV FODVVLI\ WKH UDW QRQJDVWULF +.D DV D GLIIHUHQW +.$73DVH WKDQ WKH KXPDQ QRQJDVWULF +.D 7KLV LV EDVHG RQ TXDOLWDWLYH GLIIHUHQFHV LQ LQKLELWRU SURILOH REVHUYHG IRU UDW DQG KXPDQ QRQJDVWULF LVRIRUPV LQ KHWHURORJRXV H[SUHVVLRQ V\VWHPV 8QGHU WKHLU QRPHQFODWXUH UDW DQG KXPDQ +.$73DVH VXEXQLWV DUH UHIHUUHG WR DV +.D DQG +.FX UHVSHFWLYHO\ 4XDQWLWDWLYH GLIIHUHQFHV LQ VHQVLWLYLWLHV WR LQKLELWRUV PD\ QRW EH D YDOLG PHDVXUH E\ ZKLFK WR FODVVLI\ RUWKRORJRXV JURXSV 7KH 1D.$73DVHV DOVR KDYH ZLGHO\ GLIIHULQJ TXDOLWDWLYH GLIIHUHQFHV EHWZHHQ VSHFLHV LQ WKHLU UHVSRQVH WR LQKLELWRUV $V DQ H[DPSOH RXDEDLQ WKH ZLGHO\ XVHG fVSHFLILFf LQKLELWRU RI 1D.$73DVHV LV KLJKO\ HIIHFWLYH DJDLQVW WKH SXPSV LQ PRVW VSHFLHV RWKHU WKDQ UDW )RU UDW 1D.DL RXDEDLQ LV HIIHFWLYH RQO\ DW KLJKHU FRQFHQWUDWLRQV EXW WKH UDW 1D.DL LV QRW WKRXJKW RI DV D GLIIHUHQW 1D.DL WKDQ RWKHU VSHFLHV 7R FODVVLI\ +.$73DVH LVRIRUPV LW PLJKW EH PRUH YDOXDEOH WR ILUVW ORRN DW WLVVXH GLVWULEXWLRQ 7KLV ZRXOG OHDG WR WKUHH FODVVHV RI +.$73DVH FDWDO\WLF VXEXQLWV +.DL ZRXOG FRQWLQXH WR GHQRWH WKH JDVWULF +.$73DVHV FDWDO\WLF VXEXQLWV +.D ZRXOG UHIHU WR WKH QRQJDVWULF LVRIRUPV RI +.$73DVH D VXEXQLWV DQG +.D" ZRXOG GHQRWH WKH WRDG EODGGHU LVRIRUP ,W EHFDPH RQH RI WKH JRDOV RI WKLV GLVVHUWDWLRQ WR GHWHUPLQH KRZ WKH UDEELW +.D LVRIRUP UHODWHG WR RWKHU +.$73DVHV 5DEELW UDW DQG KXPDQ QRQJDVWULF +.$73DVH F'1$ VHTXHQFHV ZLOO EHVW ILW LQWR D VLQJOH JURXS EDVHG RQ WKHLU WLVVXH GLVWULEXWLRQ DQG RQ WKHLU SK\ORJHQHWLF UHODWLRQVKLS

PAGE 123

$ VHDUFK IRU QRYHO 3W\SH +.$73DVHV H[SUHVVHG LQ WKH NLGQH\ ZDV SHUIRUPHG 7KH SXUSRVH RI WKLV ZDV WZRIROG )LUVW D UDEELW +.D VHTXHQFH ZDV QHHGHG WR GHVLJQ UHDJHQWV IRU VWXG\ RI +.$73DVH UHJXODWLRQ DQG IXQFWLRQ LQ WKH NLGQH\ ,Q DGGLWLRQ WKH VHTXHQFH ZRXOG EH XVHIXO WR FRPSDUH DQG FRQWUDVW ZLWK +.D VHTXHQFHV IRXQG LQ RWKHU VSHFLHV WR H[DPLQH WKHLU UHODWLRQVKLS DQG ILQG LPSRUWDQW FRQVHUYHG PRWLIV 6HFRQG LW ZDV KRSHG WKDW VXFK D VHDUFK ZRXOG ILQG DQ\ SUHYLRXVO\ XQNQRZQ +.$73DVH FDWDO\WLF VXEXQLW LVRIRUPV 7KH VHDUFK DV FRQGXFWHG ZDV E\ QR PHDQV H[KDXVWLYH RQFH DQ LQWHUHVWLQJ IUDJPHQW RI VHTXHQFH ZDV IRXQG QR IXUWKHU DWWHPSWV ZHUH PDGH WR ILQG RWKHUV +RZHYHU RWKHU LQYHVWLJDWRUV DOVR ORRNLQJ IRU QRYHO +.$73DVHV LQ UDEELW NLGQH\ DOVR IRXQG WKH VDPH LVRIRUP DV GHVFULEHG LQ WKLV ZRUN )HMHV7RWK HO DO -DLVVHU SHUVRQDO FRPPXQLFDWLRQf %HFDXVH RI WKH QXPHURXV DWWHPSWV WR H[SDQG WKH QXPEHU RI +.$73DVHV NQRZQ LQ KXPDQ DQG UDW 6KXOO DQG /LQJUHO 6YHUGORY HO DO 0RG\DQRY HO DO &URZVRQ DQG 6KXOO f LW PXVW QRZ EH UHJDUGHG DV OHVV OLNHO\ WKDW FRPSOHWHO\ QRYHO PDPPDOLDQ LVRIRUPV ZLOO EH IRXQG $Q +.D VXEXQLW LVRIRUP ZDV IRXQG WKDW KDG KLJK KRPRORJ\ WR KXPDQ DQG UDW +.D 7KH UHODWLRQVKLS RI WKH UDEELW +.D VXEXQLW LVRIRUP WR RWKHU +.$73DVHV DQG 1D.$73DVHV ZDV FRPSXWDWLRQDOO\ DQDO\]HG E\ WKH GLVWDQFH DQG PD[LPXP SDUVLPRQ\ DOJRULWKPV ,W ZDV IRXQG WKDW VHTXHQFHV IRU UDW DQG KXPDQ +.D VXEXQLW LVRIRUPV ZHUH PRUH FORVHO\ UHODWHG WKDQ +.DL RU WKH 1D.$73DVHV 7KH +.D VXEXQLW VHTXHQFH RI %XIR PDULQDV ZDV VOLJKWO\ PRUH KRPRORJRXV WR WKH +.D VXEXQLW VHTXHQFHV WKDQ WR WKH +.DL VHTXHQFHV :LWKRXW PRUH +.$73DVH VHTXHQFHV UHODWHG WR +.D LWV H[DFW UHODWLRQVKLS WR RWKHU +.$73DVHV ZLOO EH GLIILFXOW WR MXGJH

PAGE 124

.RQH DQG +LJKDP f KDG IRXQG DQ DOWHUQDWLYHO\ VSOLFHG f HQG RI DQ P51$ WKDW WKH\ GHVLJQDWHG +.DE ,Q WKH ZRUN GHVFULEHG KHUH WKHUH ZHUH WZR f HQGV IRXQG LQ UDEELW DV ZHOO 7KH WUDQVODWLRQ VWDUW VLWHV RI WKH UDEELW DQG UDW DOWHUQDWLYHO\ VSOLFHG YDULDQWV DUH QRW FRQVHUYHG ,Q WKH UDW +.DE P51$ WKH VWDUW FRGRQ LV GRZQVWUHDP RI WKH VSOLFH VLWH .RQH DQG +LJKDP f DQG LQ WKH UDEELW +.DF WKH VWDUW FRGRQ LV XSVWUHDP RI WKH VSOLFH VLWH )RU WKLV UHDVRQ WKH UDEELW +.$73DVH FDWDO\WLF VXEXQLW WKDW LV WKH SURGXFW RI DOWHUQDWLYH VSOLFLQJ ZDV GHVLJQDWHG +.DF +RZHYHU WKH SDWWHUQ RI H[RQV DQG LQWURQV DW WKH f HQG RI WKH +.D JHQH LQ UDW DQG UDEELW ZDV GHWHUPLQHG WR EH WKH VDPH 7KH UHODWLRQVKLS VKRZQ E\ SKORJHQHWLF DQDO\VLV DQG WKH VLPLODULW\ RI DOWHUQDWLYH VSOLFLQJ LPSOLHG WKDW UDW DQG UDEELW +.D GR LQGHHG UHSUHVHQW WKH VDPH JHQH LQ GLIIHUHQW VSHFLHV $Q DOWHUQDWLYHO\ VSOLFHG WUDQVFULSW KDV QRW VR IDU EHHQ REVHUYHG IRU KXPDQ +.D EXW WKDW GRHV QRW FRQVWLWXWH DEVROXWH HYLGHQFH WKDW D VLPLODU YDULDQW ZDV QRW WUDQVFULSWLRQDOO\ FRPSHWHQW LQ KXPDQ 7KH KXPDQ +.D JHQH VHTXHQFH 6YHUGORY HO DO f SUHGLFWV D WUDQVODWLRQDO VWDUW FRGRQ WKDW ZDV GLIIHUHQW IURP ERWK UDW DQG UDEELW GRZQVWUHDP RI WKH VSOLFH VLWH EXW XSVWUHDP RI WKH ILUVW LQIUDPH $7* NQRZQ IRU UDW %DVHG RQ SK\ORJHQ\ WKH KXPDQ +.D ZDV DOVR DQ RUWKRORJ ZLWK LWV DOWHUQDWLYHO\ VSOLFHG WUDQVFULSW WKXV IDU XQVHHQ %HFDXVH RI WKH ODFN RI FRQVHUYDWLRQ RI VSOLFH VLWHV EHWZHHQ UDW DQG UDEELW DOWHUQDWLYHO\ VSOLFHG +.FW LW ZDV QHFHVVDU\ WR GHWHUPLQH WKDW WKH VWDUW FRGRQ LQ UDEELW WKDW JDYH ULVH WR WKH ORQJHVW RSHQ UHDGLQJ IUDPH ZDV LQGHHG XVHG :HVWHUQ DQDO\VHV XVLQJ WKH DQWL+.D FRPPRQ DQG DQWL+.DF DQWLERGLHV VKRZHG D SDWWHUQ RI UHDFWLYLW\ FRQVLVWHQW ZLWK WKH+.DF SURWHLQ EHLQJ ODUJHU WKDQ WKH+.DD SURWHLQ 7KHUHIRUH WKH SUHGLFWHG VWDUW FRGRQ LV WKH RQH XVHG LQ UDEELW

PAGE 125

,OO 7KH ZRUN LQYROYHG LQ WKLV GLVVHUWDWLRQ GLG QRW VXFFHHG LQ DQVZHULQJ WKH TXHVWLRQ RI ZK\ VR PDQ\ +.$73DVH LVRIRUPV H[LVW :LWK UHVSHFW WR +.DF UHJXODWLRQ E\ FRYDOHQW PRGLILFDWLRQ LV UHQGHUHG D OHVV DWWUDFWLYH SRVVLELOLW\ E\ WKH ODFN RI FRQVHUYDWLRQ RI WKH DPLQR WHUPLQDO HQG 7KH SRWHQWLDO SKRVSKRU\ODWLRQ VLWHV WKDW ZHUH LGHQWLILHG E\ FRPSXWHU DQDO\VLV LQ WKH UDEELW DUH ZLWKLQ WKH DPLQR WHUPLQDO UHJLRQ WKDW LV PLVVLQJ LQ WKH UDW ,PPXQRKLVWRFKHPLVWU\ VKRZHG WKDW WKH ORFDOL]DWLRQ RI +.DF ZLWKLQ WKH NLGQH\ GLG QRW GLIIHU ZLGHO\ IURP WKDW SUHYLRXVO\ IRXQG IRU +.FWL +.DF LV DSSDUHQWO\ QRW WKH PROHFXOH WKDW LV UHVSRQVLEOH IRU WKH EDVRODWHUDO +.$73DVH DFWLYLW\ FKDUDFWHUL]HG LQ SUR[LPDO WXEXOH DQG WKLFN DVFHQGLQJ OLPE RI +HQOH E\
PAGE 126

&HOO 7\SH 6SHFLILFLW\ RI +.$73DVH LQ WKH .LGQH\ +.$73DVH DFWLYLW\ LV IRXQG DW KLJKHVW OHYHO LQ FROOHFWLQJ GXFW ZLWK VRPH LQYHVWLJDWRUV UHSRUWLQJ DFWLYLW\ LQ WKLFN DVFHQGLQJ OLPE
PAGE 127

)XWXUH 6WXGLHV 7KH VWXGLHV GHWDLOHG LQ WKLV GLVVHUWDWLRQ QDWXUDOO\ OHDG WR PDQ\ TXHVWLRQV DQG PXVW OHDYH PDQ\ RI WKHVH TXHVWLRQV XQDQVZHUHG 7KH PRVW SUHVVLQJ TXHVWLRQ XSRQ ILQGLQJ D QRYHO HQ]\PH RU YDULDWLRQ RQ DQ HQ]\PH LV ZKDW LV WKH VLJQLILFDQFH RI WKH QRYHOW\" ,Q WKH FDVHV RI +.3f DQG +.DAF HIIRUWV ZHUH EHJXQ WR DQVZHU WKLV TXHVWLRQ EXW WKH DQVZHU OLHV HOVHZKHUH LQ H[SHULPHQWV \HW WR EH GRQH 'LHWDU\ UHVWULFWLRQ ZDV WHVWHG DV D SRVVLEOH UHJXODWRU\ IDFWRU DQG PLQHUDORFRUWLFRLG OHYHOV DQG DFLGEDVH VWDWXV DUH OLNHO\ FDQGLGDWHV WKDW UHPDLQ WR EH H[DPLQHG ,PPXQRKLVWRFKHPLVWU\ IDLOHG WR UHYHDO DQ\ ODUJH GHSDUWXUH RI +.RTF ORFDOL]DWLRQ FRPSDUHG WR RWKHU +.$73DVHV LQ WKH NLGQH\ EXW WKLV ORFDOL]DWLRQ FRXOG FKDQJH XSRQ GLVWXUEDQFHV LQ DFLGEDVH RU PLQHUDORFRUWLFRLG VWDWXV 7KHUH DUH QR LPPXQRKLVWRFKHPLFDO VWXGLHV DYDLODEOH IRU DQ\ RI WKH +.$73DVHV XQGHU WKHVH WKUHH FRQGLWLRQV 2QH ZRXOG H[SHFW WKDW LI WKHUH ZHUH D WKLUG PDPPDOLDQ +.$73DVH D VXEXQLW ZLWK WKH QXPEHU RI LQYHVWLJDWRUV VHDUFKLQJ WKDW LW ZRXOG KDYH EHHQ IRXQG 3HUKDSV WKHUH LV VRPH VHTXHQFHVSHFLILF GLIILFXOW\ LQ LWV DPSOLILFDWLRQ RU FORQLQJ $ GLIIHUHQFH LQ VL]H RU VHFRQGDU\ 51$ VWUXFWXUH FRXOG DIIHFW WKH HIILFLHQF\ ZLWK ZKLFK D QRYHO VHTXHQFH ZDV DPSOLILHG 3HUKDSV 573&5 UHDFWLRQV XVLQJ GHJHQHUDWH SULPHUV RXJKW WR EH DWWHPSWHG LQ JUHDWHU QXPEHUV WR LQFUHDVH WKH FKDQFH RI ILQGLQJ D WUXO\ QRYHO +.$73DVH RQH WKDW LV HLWKHU GLIILFXOW WR SURFHVV RU DW D PXFK ORZHU OHYHO WKDQ RWKHU 3W\SH $73DVHV 7KH H[SHULPHQW ZRXOG KDYH WR EH GRQH PDQ\ PRUH WLPHV 7KLV LV SUDFWLFDO JLYHQ FXUUHQW SULFHV IRU UHDJHQWV DQG VHTXHQFLQJ 7KH +.D" VXEXQLW P51$ IUDJPHQW ZDV IRXQG LQ WKH WKLUG

PAGE 128

UHDFWLRQ LI D QRYHO VHTXHQFH ZHUH SUHVHQW DW WHQIROG OHVV FRSLHV SHU UHDFWLRQ RU WHQIROG ORZHU HIILFLHQF\ LW VKRXOG EH IRXQG LQ WKLUW\ UHDFWLRQV 7KHUH LV HYLGHQFH RI DQ +.$73DVH LQ WKLFN DVFHQGLQJ OLPE KDYLQJ GLIIHUHQW SURSHUWLHV WKDQ NQRZQ +.$73DVHV
PAGE 129

ZHUH IRXQG LQ V\QWHQLF UHJLRQV LW ZRXOG VWUHQJWKHQ WKH DUJXPHQW IRU WKHLU EHLQJ DQDORJV RI WKH VDPH JHQH LQ GLIIHUHQW VSHFLHV FRQVLGHUDEO\ 0XFK ZRUN UHPDLQV WR EH GRQH LQ DSSUHFLDWLQJ WKH ORFDOL]DWLRQ RI WKH +.$73DVHV LQ WKH NLGQH\ 'RXEOHODEHOLQJ LPPXQRKLVWRFKHPLVWU\ XVLQJ ZHOOFKDUDFWHUL]HG PDUNHUV ZRXOG KHOS GHILQH WKH FHOO W\SHV LQ ZKLFK HDFK +.$73DVH VXEXQLW LVRIRUP ZDV H[SUHVVHG 4XDOLW\ DQWLERGLHV DUH DYDLODEOH IRU FDUERQLF DQK\GUDVH D PDUNHU IRU LQWHUFDODWHG FHOOV DQG IRU EDQG SURWHLQ D PDUNHU IRU $W\SH LQWHUFDODWHG FHOOV 7KLV ZRXOG KHOS UHILQH RXU NQRZOHGJH RI WKH FHOO W\SHV LQ ZKLFK +.$73DVH LV H[SUHVVHG $W SUHVHQW DQ H[SHULHQFHG H\H LV WKH PDLQ WRRO IRU GHWHUPLQLQJ FHOO W\SHV :LWK GRXEOHODEHOOLQJ H[SHULPHQWV WKH FRQFOXVLRQV ZRXOG EH PRUH FRQFUHWH $ PDMRU DGYDQFH LQ PDNLQJ +.$73DVH DFWLYLW\ PHDVXUHPHQWV ZRXOG EH WR ILQG LQKLELWRUV WKDW ZRUNHG DW ORZ FRQFHQWUDWLRQV ZLWK KLJK VSHFLILFLW\ &KDUDFWHUL]DWLRQ KDV EHHQ OLPLWHG WR WKH HIIHFWV RI 6FK DQG RXDEDLQ DFWLRQ RQ +.D! EXW OLWHUDWXUH LV FRQIOLFWLQJ ZLWK UHVSHFW WR WKH FRQFHQWUDWLRQV REVHUYHG IRU LQKLELWLRQ FRQVWDQWV 0RG\DQRY HW DO &RGLQD HW DO *ULVKLQ HO DO &RXJQRQ HO DO f 7KHVH FRQIOLFWV QHHG WR EH UHVROYHG DQG RWKHU +.$73DVH LQKLELWRUV VXFK DV RPHSUD]ROH RU $$ PLJKW EH WULHG WR PHDVXUH WKHLU DFWLRQ RQ WKH +.RW VSHFLHV 7KHVH H[SHULPHQWV ZRXOG SUHIHUDEO\ EH FRQGXFWHG LQ PDPPDOLDQ H[SUHVVLRQ V\VWHPV 0HPEHUV RI WKH &DLQ ODERUDWRU\ DUH LQ WKH SURFHVV RI GHYHORSLQJ VXFK D V\VWHP :LWK XVHIXO LQIRUPDWLRQ DERXW LQKLELWRU SURILOHV VWXGLHV LQ SHUIXVHG WXEXOHV PLJKW EH SHUIRUPHG WR GHWHUPLQH WKH FHOO W\SHV WKDW KDYH WKH YDULRXV +.$73DVH DFWLYLWLHV 3URWRFROV IRU GHWHUPLQLQJ FHOO W\SHV IXQFWLRQDOO\ LQ SHUIXVHG WXEXOHV DUH ZHOO NQRZQ

PAGE 130

7R DQVZHU EURDGHU TXHVWLRQV VXFK DV KRZ GRHV WKH NLGQH\ UHVSRQG WR DFLGEDVH GLVWXUEDQFHV UHVWULFWLRQ RU PLQHUDORFRUWLFRLG OHYHOV QHZ WHFKQLTXHV ZLOO EH XVHIXO 7KHUH DUH QRZ EORW DUUD\V DYDLODEOH WKDW KDYH PDQ\ F'1$V DWWDFKHG 7KHVH PD\ EH SUREHG ZLWK ODEHOOHG P51$ IURP FRQWUROOHG DQG WUHDWHG DQLPDOV DQG GLIIHUHQWLDOV LQ PDQ\ P51$ OHYHOV REVHUYHG LQ SDUDOOHO (DFK F'1$ KDG DQ DVVLJQHG ORFDWLRQ RQ WKH EORW VR RQH FDQ TXLFNO\ ILQG ZKDW WUDQVFULSW LV EHLQJ UHJXODWHG )RU D PRUH DOOHQFRPSDVVLQJ DSSURDFK WR WKHVH H[SHULPHQWV PLFURDUUD\V PD\ EH XVHG WKDW FDQ KDYH HYHQ PRUH F'1$V RQ WKHP 7KHVH PHWKRGV VWXG\ PDQ\ UHJXODWRU\ SURFHVVHV LQ SDUDOOHO DQG FRXOG EH D TXLFN ZD\ WR SLQSRLQW LQWHUHVWLQJ UHVSRQVHV +RZHYHU WKHVH WHFKQLTXHV UHTXLUH ILUVW WKDW WKH UHVSRQVLYH HOHPHQW ZDV LGHQWLILHG DQG VHTXHQFHG 7KDW ZDV WKH JRDO RI WKLV ZRUN WR LGHQWLI\ DQG FKDUDFWHUL]H +.$73DVH PROHFXOHV HOHPHQWV WKDW SOD\ D UROH LQ WKH ELRORJLFDO SURFHVVHV FDUULHG RXW LQ WKH NLGQH\ 7R WKDW HQG YDULDQWV RI +.S DQG +.D KDYH EHHQ IRXQG DQG WKHLU VHTXHQFHV GHWHUPLQHG 6XFK WRROV DV F'1$ SUREHV DQG DQWLERGLHV KDYH EHHQ SURGXFHG 7KHVH DUH D SUHUHTXLVLWH IRU GHWHUPLQLQJ WKH VLJQLILFDQFH RI WKH QRYHO +.$73DVHV ,W ZDV VKRZQ WKDW +.D!F SURWHLQ LV H[SUHVVHG DQG WKDW WKH SUHGLFWHG VWDUW FRGRQ LV XVHG (YLGHQFH E\ LPPXQRKLVWRFKHPLVWU\ DQG WKH SUHVHQFH RI P51$ DQG SURWHLQ LQ DQ $W\SH LQWHUFDODWHG FROOHFWLQJ GXFW FHOO OLQH VKRZHG WKDW DFLGVHFUHWLQJ LQWHUFDODWHG FHOOV DUH D PDMRU FHOO W\SH LQ ZKLFK +.DLF SXPSV PD\ EH IRXQG 7KH +.RF SXPS DGGV WR WKH FRPSOHPHQW RI WUDQVSRUWHUV WKDW PD\ PHGLDWH DFLG VHFUHWLRQ DQG UHDEVRUSWLRQ LQ WKRVH FHOOV 7KHVH UHVXOWV GHILQH +.$73DVH YDULHWLHV WKDW ZHUH QRW NQRZQ ZKHQ WKLV ZRUN EHJDQ

PAGE 131

5()(5(1&(6 $GGLVRQ : / 7 7KH XVH RI VRGLXP FKORULGH SRWDVVLXP FKORULGH VRGLXP EURPLGH DQG SRWDVVLXP EURPLGH LQ FDVHV RI DUWHULDO K\SHUWHQVLRQ ZKLFK DUH DPHQDEOH WR SRWDVVLXP FKORULGH &DQ 0HG $VVRF + $KQ < DQG % & .RQH ([SUHVVLRQ DQG FHOOXODU ORFDOL]DWLRQ RI P51$ HQFRGLQJ WKH JDVWULF LVRIRUP RI +f.f$73DVH DOSKDVXEXQLW LQ UDW NLGQH\ $P 3K\VLRO ) $KQ < < 3DUN . .LP DQG % & .RQH &KURQLF K\SRNDOHPLD HQKDQFHV H[SUHVVLRQ RI WKH +f.f$73DVH DOSKD VXEXQLW JHQH LQ UHQDO PHGXOOD $P 3K\VLRO ) $OWVFKXO 6 ) : *LVK : 0LOOHU ( : 0\HUV DQG /LSPDQ %DVLF ORFDO DOLJQPHQW VHDUFK WRRO 0RO %LRO $PEDUG / DQG & %HDXMDUG &DXVHV GH OnK\SHUWHQVLRQ DUWHULHOOH $UFK *HQ 0HG $UHQG / 6 )ODQGOHU 6 5KLP ) *XVRYVN\ DQG : 6 6SLHOPDQ $GHQRVLQHVHQVLWLYH SKRVSKRLQRVLWLGH WXUQRYHU LQ D QHZO\ HVWDEOLVKHG UHQDO FHOO OLQH $P 3K\VLRO ), %DLURFK $ DQG 5 $SZHLOHU 7KH 6:663527 SURWHLQ VHTXHQFH GDWD EDQN DQG LWV QHZ VXSSOHPHQW 75(0%/ 1XFOHLF $FLGV 5HV %DPEHUJ ) 0HUFLHU 0 $ 5HXEHQ < .RED\DVKL % 0XQVRQ DQG 6DFKV F'QD FORQLQJ DQG PHPEUDQH WRSRORJ\ RI WKH UDEELW JDVWULF +.f$WSDVH DOSKDVXEXQLW %LRFKLP %LRSK\V $FWD %DPEHUJ DQG 6DFKV 7RSRORJLFDO DQDO\VLV RI +.f$73DVH XVLQJ LQ YLWUR WUDQVODWLRQ %LR &KHP %DVWDQL % &RORFDOL]DWLRQ RI +$73DVH DQG +.$73DVH LPPXQRUHDFWLYLW\ LQ WKH UDW NLGQH\ $P 6RF 1HSKURO %HOOR 5HXVV ( &KDUDFWHUL]DWLRQ RI DFLGEDVH WUDQVSRUW PHFKDQLVPV LQ WKH NLGQH\ FHOO OLQH 5&&7$ .LGQH\ ,QL

PAGE 132

%HVDQFRQ 0 0 6KLQ ) 0HUFLHU 0XQVRQ 0 0LOOHU 6 +HUVH\ DQG 6DFKV 0HPEUDQH WRSRORJ\ DQG RPHSUD]ROH ODEHOLQJ RI WKH JDVWULF +.fDGHQRVLQHWULSKRVSKDWDVH %LRFKHPLVWU\ %ODQFR & .RVWHU DQG 5 : 0HUFHU 7KH DOSKD VXEXQLW RI WKH 1D.$73DVH VSHFLILFDOO\ DQG VWDEO\ DVVRFLDWHV LQWR ROLJRPHUV 3URF 1DWO $FDG 6FL 86$ %XIILQ 0H\HU % 0
PAGE 133

&RGLQD 7 'HOPDV0DWD DQG 7 -U 7KH DOSKDVXEXQLW RI WKH FRORQLF +.$73DVH DVVHPEOHV ZLWK WKH EHWDO1D.$73DVH LQ NLGQH\ DQG GLVWDO FRORQ %LRO &KHP &RGLQD % & .RQH 7 'HOPDV 0DWD DQG 7 'X%RVH -U )XQFWLRQDO H[SUHVVLRQ RI WKH FRORQLF +.$73DVH DOSKDVXEXQLW 3KDUPDFRORJLF SURSHUWLHV DQG DVVHPEO\ ZLWK ;.$73DVH EHWDVXEXQLWV %LRO &KHP &RORQQD 7 ( / +X\QK DQG 0 )DPEURXJK 6XEXQLW LQWHUDFWLRQV LQ WKH 1D.$73DVH H[SORUHG ZLWK WKH \HDVW WZRK\EULG V\VWHP %LR &KHP &RQVWDQWLQHVFX $ 5 % 6LOYHU DQG / 0 6DWOLQ +.$73DVH DFWLYLW\ LQ 31$ELQGLQJ LQWHUFDODWHG FHOOV RI QHZERUQ UDEELW FRUWLFDO FROOHFWLQJ GXFW $P 3K\VLRO ) &RXJQRQ 0 3ODQHOOHV 0 6 &URZVRQ ( 6KXOO % & 5RVVLHU DQG ) -DLVVHU 7KH UDW GLVWDO FRORQ 3$73DVH DOSKD VXEXQLW HQFRGHV D RXDEDLQVHQVLWLYH + .$73DVH %LRO &KHP &RXUWRLV&RXWU\ 1 5RXVK 9 5DMHQGUDQ % 0F&DUWK\ *HLEHO 0 .DVKJDULDQ DQG 0 &DSODQ $ W\URVLQHEDVHG VLJQDO WDUJHWV +.$73DVH WR D UHJXODWHG FRPSDUWPHQW DQG LV UHTXLUHG IRU WKH FHVVDWLRQ RI JDVWULF DFLG VHFUHWLRQ &HOO &R[ + DQG 9 &R[ 9DULDQW FKLFNHQ $( DQLRQ H[FKDQJHUV SRVVHVV GLYHUJHQW 1+fWHUPLQDO F\WRSODVPLF GRPDLQV $P 3K\VLRO ) &URZVRQ 0 6 DQG ( 6KXOO ,VRODWLRQ DQG FKDUDFWHUL]DWLRQ RI D F'1$ HQFRGLQJ WKH SXWDWLYH GLVWDO FRORQ +.f$73DVH 6LPLODULW\ RI GHGXFHG DPLQR DFLG VHTXHQFH WR JDVWULF +.f$73DVH DQG 1D.f$73DVH DQG P51$ H[SUHVVLRQ LQ GLVWDO FRORQ NLGQH\ DQG XWHUXV %LRW &KHP &XUUDQ $ 0 +HEHUW % &DLQ DQG & 6 :LQJR (YLGHQFH IRU WKH SUHVHQFH RI D .GHSHQGHQW DFLGLI\LQJ DGHQRVLQH WULSKRVSKDWDVH LQ WKH UDEELW UHQDO PHGXOOD .LGQH\ ,QL 'DIQLV ( 0 6SRKQ % /RXLV 1 $ .XUW]PDQ DQG 6 6DEDWLQL 9DQDGDWH FDXVHV K\SRNDOHPLF GLVWDO UHQDO WXEXODU DFLGRVLV $P 3K\VLR ) 'DYLV / : 0 .XHKO DQG ) %DWWH\ %DVLF 0HWKRGV LQ 0ROHFXODU %LRORJ\ QG HGLWLRQ 1RUZDON &7 $SSOHWRQ DQG /DQJH 'LHWO 3 1 .L]HU DQG % $ 6WDQWRQ &RQGXFWLYH SURSHUWLHV RI D UDEELW FRUWLFDO FROOHFWLQJ GXFW FHOO OLQH UHJXODWLRQ E\ LVRSURWHUHQRO $P 3K\VLR )

PAGE 134

'LHWO 3 DQG % $ 6WDQWRQ &KORULGH FKDQQHOV LQ DSLFDO DQG EDVRODWHUDO PHPEUDQHV RI &&' FHOOV 5&&7$f LQ FXOWXUH $P 3K\VLRO ) 'RXFHW $ DQG 6 0DUV\ &KDUDFWHUL]DWLRQ RI .$73DVH DFWLYLW\ LQ GLVWDO QHSKURQ VWLPXODWLRQ E\ SRWDVVLXP GHSOHWLRQ $P 3K\VLRO ) 'X%RVH 7 -U &RGLQD $ %XUJHV DQG 7 $ 3UHVVOH\ 5HJXODWLRQ RI +f.f$73DVH H[SUHVVLRQ LQ NLGQH\ $P 3K\VLRO ) )DUOH\ 5 $ DQG / )DOOHU 7KH DPLQR DFLG VHTXHQFH RI DQ DFWLYH VLWH SHSWLGH IURP WKH +.$73DVH RI JDVWULF PXFRVD %LRO &KDP )HMHV7RWK ( 5XVYDL $ /RQJR DQG $ 1DUD\ )HMHV7RWK ([SUHVVLRQ RI FRORQLF +.$73DVH P51$ LQ FRUWLFDO FROOHFWLQJ GXFW 5HJXODWLRQ E\ DFLGEDVH EDODQFH $P 3K\VLRO ) )URKPDQ 0 $ 0 'XVK DQG 5 0DUWLQ 5DSLG SURGXFWLRQ RI IXOOOHQJWK F'1$V IURP UDUH WUDQVFULSWV DPSOLILFDWLRQ XVLQJ D VLQJOH JHQHVSHFLILF ROLJRQXFOHRWLGH SULPHU 3URF 1DWO $FDG 6FL 86$ *DQVHU $ / DQG )RUWH VWLPXODWHG $73DVH LQ SXULILHG PLFURVRPHV RI EXOOIURJ R[\QWLF FHOOV %LRFKLP %LRSK\V $GD *DUJ / & 5HVSHFWLYH UROHV RI +$73DVH DQG +.$73DVH LQ LRQ WUDQVSRUW LQ WKH NLGQH\ $P 6RF 1HSKURO *DUJ / & DQG 1 1DUDQJ 2XDEDLQLQVHQVLWLYH .DGHQRVLQH WULSKRVSKDWDVH LQ GLVWDO QHSKURQ VHJPHQWV RI WKH UDEELW &OLQ ,QYHVW *DUJ / & DQG 1 1DUDQJ 6XSSUHVVLRQ RI RXDEDLQLQVHQVLWLYH .$73DVH DFWLYLW\ LQ UDEELW QHSKURQ VHJPHQWV GXULQJ FKURQLF K\SHUNDOHPLD 5HQ 3K\VLRO %LRFKHP *HHULQJ 7KHXOD] ) 9HUUH\ 0 7 +DXSWOH DQG % & 5RVVLHU $ UROH IRU WKH EHWDVXEXQLW LQ WKH H[SUHVVLRQ RI IXQFWLRQDO 1D.$73DVH LQ ;HQRSXV RRF\WHV $P 3K\VLRO & *ULVKLQ $ 9 0 2 %HYHQVHH 1 1 0RG\DQRY 9 5DMHQGUDQ : ) %RURQ DQG 0 &DSODQ )XQFWLRQDO H[SUHVVLRQ RI WKH F'1$ HQFRGHG E\ WKH KXPDQ $73$/ JHQH $P 3K\VLR ) *ULVKLQ $ 9 9 ( 6YHUGORY 0 % .RVWLQD DQG 1 1 0RG\DQRY &ORQLQJ DQG FKDUDFWHUL]DWLRQ RW WKH HQWLUH F'1$ HQFRGHG E\ $73$/f§D PHPEHU RI WKH KXPDQ 1D.+.$73DVH JHQH IDPLO\ )(%6 /HWW

PAGE 135

*XQWXSDOOL 0 2QXLJER 6 :DOO 5 $OSHUQ DQG 7 'X%RVH -U $GDSWDWLRQ WR ORZ. PHGLD LQFUHDVHV +f.f$73DVH EXW QRW +f$73DVHPHGLDWHG S+L UHFRYHU\ LQ 20&' FHOOV $P 3K\VLRO & *XVWLQ 0 & DQG % *RRGPDQ ,VRODWLRQ RI EUXVKERUGHU PHPEUDQH IURP WKH UDEELW GHVFHQGLQJ FRORQ HSLWKHOLXP 3DUWLDO FKDUDFWHUL]DWLRQ RI D XQLTXH .DFWLYDWHG $73DVH %LRO &KHZ *X\WRQ $ & DQG ( +DOO 7H[WERRN RI 0HGLFDO 3K\VLRORJ\ 3KLODGHOSKLD 3$ : % 6DXQGHUV +DOO 3HUH] 6DFKV DQG ( 5DEQ ,GHQWLILFDWLRQ RI +.f$73DVH DOSKDEHWDKHWHURGLPHUV %LRFKLP %LRSK\V $FWD +D\V 6 5 DQG 5 $OSHUQ ,QKLELWLRQ RI 1DfLQGHSHQGHQW + SXPS E\ 1DfLQGXFHG FKDQJHV LQ FHOO &D *HQ 3K\VLR +HEHUW + < ;LDQ +DFNVHOO DQG 6 0DUGK 7ZRGLPHQVLRQDO FU\VWDOV RI PHPEUDQHERXQG JDVWULF +.$73DVH )(%6 /HWW +HUVH\ 6 DQG 6DFKV *DVWULF DFLG VHFUHWLRQ 3K\VLRO 5HY +HU]OLQJHU $ 7 (DVWRQ DQG 2MDNLDQ 7KH 0'&. HSLWKHOLDO FHOO OLQH H[SUHVVHV D FHOO VXUIDFH DQWLJHQ RI WKH NLGQH\ GLVWDO WXEXOH &HOO %LRO +RULVEHUJHU 3 -DXQLQ 0 $ 5HXEHQ / 6 /DVDWHU & &KRZ )RUWH 6DFKV % & 5RVVLHU DQG *HHULQJ 7KH +.$73DVH EHWDVXEXQLW FDQ DFW DV D VXUURJDWH IRU WKH EHWDVXEXQLW RI 1D.SXPSV %LRO &KHP ,17(56$/7 ,QWHUVDOW DQ LQWHUQDWLRQDO VWXG\ RI HOHFWURO\WH H[FUHWLRQ DQG EORRG SUHVVXUH 5HVXOWV IRU KRXU XULQDU\ VRGLXP DQG SRWDVVLXP H[FUHWLRQ ,QWHUVDOW &RRSHUDWLYH 5HVHDUFK *URXS %0-DLVVHU ) % (VFRXEHW 1 &RXWU\ ( (XJHQH 3 %RQYDOHW DQG 1 )DUPDQ 'LIIHUHQWLDO UHJXODWLRQ RI SXWDWLYH .f$73DVH E\ ORZ. GLHW DQG FRUWLFRVWHURLGV LQ UDW GLVWDO FRORQ DQG NLGQH\ $P 3K\VLRO & -DLVVHU ) +RULVEHUJHU *HHULQJ DQG % & 5RVVLHU 0HFKDQLVPV RI XULQDU\ DQG + H[FUHWLRQ SULPDU\ VWUXFWXUH DQG IXQFWLRQDO H[SUHVVLRQ RI D QRYHO +.$73DVH &HOO %LRO -DPHVRQ % $ DQG + :ROI 7KH DQWLJHQLF LQGH[ D QRYHO DOJRULWKP IRU SUHGLFWLQJ DQWLJHQLF GHWHUPLQDQWV &RPSQW $SSO %LRVFL

PAGE 136

.RQH % & 6WUXFWXUDO GLYHUVLW\ RI WKH FRORQLF +f.f$73DVH D VXEXQLW +.DOSKDf JHQH &ORQLQJ DQG LQWUDUHQDO GLVWULEXWLRQ RI DOWHUQDWLYH IRUPV $P 6RF 1HSKURO .RQH % & DQG 6 & +LJOLDP $ QRYHO 1WHUPLQDO VSOLFH YDULDQW RI WKH UDW +.$73DVH DOSKD VXEXQLW &ORQLQJ IXQFWLRQDO H[SUHVVLRQ DQG UHQDO DGDSWLYH UHVSRQVH WR FKURQLF K\SRNDOHPLD %LR &KHP .RVWHU & %ODQFR DQG 5 : 0HUFHU $ F\WRSODVPLF UHJLRQ RI WKH 1D.$73DVH DOSKDVXEXQLW LV QHFHVVDU\ IRU VSHFLILF DOSKDDOSKD DVVRFLDWLRQ %LRO &KHP .UDXW $ +LXUD 0 %HVDQFRQ $ 6PROND 6DFKV DQG 6FRWW (IIHFW RI K\SRNDOHPLD RQ WKH DEXQGDQFH RI +.DOSKDO DQG +.DSKD SURWHLQ LQ WKH UDW NLGQH\ $P 3K\VLRO ) .UDXW $ +LXUD 0 6KLQ 6 $ 6 DQG 6 7KH 1Df.f$73DVH EHWD VXEXQLW LV DVVRFLDWHG ZLWK WKH +. DOSKD SURWHLQ LQ WKH UDW NLGQH\ .LGQH\ ,QL .UDXW $ ) 6WDUU 6DFKV DQG 0 5HXEHQ ([SUHVVLRQ RI JDVWULF DQG FRORQLF +f.f$73DVH LQ WKH UDW NLGQH\ $P 3K\VLRO ) /HH 6LPSVRQ 3 6FKROHV $Q $73DVH IURP GRJ JDVWULF PXFRVD FKDQJHV RI RXWHU S+ LQ VXVSHQVLRQV RI PHPEUDQH YHVLFOHV DFFRPSDQ\LQJ $73 K\GURO\VLV %LRFKHP %LRSK\V 5HV &RP PX Q /HH 9 0 5DMHQGUDQ $ 6 0DQQ 0 .DVKJDULDQ DQG + %LQGHU )XQFWLRQDO H[SUHVVLRQ DQG VHJPHQWDO ORFDOL]DWLRQ RI UDW FRORQLF .DGHQRVLQH WULSKRVSKDWDVH &OLQ ,QYHVW /LIWRQ 5 3 0ROHFXODU JHQHWLFV RI KXPDQ EORRG SUHVVXUH YDULDWLRQ 6FLHQFH 0DHGD 0 OVKL]DNL DQG 0 )XWDL F'QD FORQLQJ DQG VHTXHQFH GHWHUPLQDWLRQ RI SLJ JDVWULF + .f$WSDVH %LRFKHP %LRSK\V OLHV &RPPQQ 0DHGD 0 2VKLPDQ 6 7DPXUD DQG 0 )XWDL +XPDQ JDVWULF + .f$73DVH JHQH 6LPLODULW\ WR 1D .f$73DVH JHQHV LQ H[RQLQWURQ RUJDQL]DWLRQ EXW GLIIHUHQFH LQ FRQWURO UHJLRQ %LRO &KHP 0DHGD 0 2VKLPDQ 6 7DPXUD 6 .D\D 6 0DKPRRG 0 $ 5HXEHQ / 6 /DVDWHU 6DFKV DQG 0 )XWDL 7KH UDW +.f$73DVH EHWD VXEXQLW JHQH DQG UHFRJQLWLRQ RI LWV FRQWURO UHJLRQ E\ JDVWULF '1$ ELQGLQJ SURWHLQ %LR &KHP

PAGE 137

0DUV\ 6 0 (ODORXI DQG $ 'RXFHW 4XDQWLWDWLYH 573&5 DQDO\VLV RIP51$V HQFRGLQJ D FRORQLF SXWDWLYH + .$73DVH DOSKD VXEXQLW DORQJ WKH UDW QHSKURQ HIIHFW RI GHSOHWLRQ 3IOXJHUV $UFK 0DWKHZV 3 0 &ODH\V ) -DLVVHU *HHULQJ +RULVEHUJHU 3 .UDHKHQEXKO DQG % & 5RVVLHU 3ULPDU\ VWUXFWXUH DQG IXQFWLRQDO H[SUHVVLRQ RI WKH PRXVH DQG IURJ DOSKDVXEXQLW RI WKH JDVWULF +f.f$73DVH >SXEOLVKHG HUUDWXP DSSHDUV LQ $P 3K\VLRO 2FW 3W OfVHFWLRQ & IROORZLQJ WDEOH RI FRQWHQWV@ $P 3K\VLRO & 0HQHWRQ 3 3 6FKXOWKHLV *UHHE 0 / 1LHPDQ / + /LX / / &ODUNH 'XII\ 7 'RHWVFKPDQ 1 /RUHQ] DQG ( 6KXOO ,QFUHDVHG VHQVLWLYLW\ WR GHSULYDWLRQ LQ FRORQLF +.$73DVHGHILFLHQW PLFH &OLQ ,QYHVW 0HUFLHU ) %D\OH 0 %HVDQFRQ 7 -R\V 0 6KLQ 0 /HZLQ & 3ULQ] 0 $ 5HXEHQ $ 6RXPDUPRQ + :RQJ DQG HW DO $QWLERG\ HSLWRSH PDSSLQJ RI WKH JDVWULF +.f$73DVH %LRFKLP %LRSK\V $FWD 0HUFN 6 DQG 'RKUQH 5HVHDUFK /DERUDWRULHV 7KH 0HUFN 0DQXDO RI 'LDJQRVLV DQG 7KHUDS\ 5DKZD\ 10HUFN 6KDUSH DQG 'RKUQH /DERUDWRULHV 0LOOV : ( 0 6FKZLHEHUW DQG % $ 6WDQWRQ (YLGHQFH IRU WKH UROH RI DFWLQ ILODPHQWV LQ UHJXODWLQJ FHOO VZHOOLQJ ([S =RRO 0LOWRQ $ ( DQG :HLQHU ,QWUDFHOOXODU S+ UHJXODWLRQ LQ WKH UDEELW FRUWLFDO FROOHFWLQJ GXFW $W\SH LQWHUFDODWHG FHOO $P 3K\VLRO ) 0RG\DQRY 1 1 3 0 0DWKHZV $ 9 *ULVKLQ 3 %HJXLQ $ 7 %HJJDK % & 5RVVLHU +RULVEHUJHU DQG *HHULQJ +XPDQ $73$/ JHQH HQFRGHV D RXDEDLQVHQVLWLYH +.$73DVH $P 3K\VLRO & 0RG\DQRY 1 1 ( 3HWUXNKLQ 9 ( 6YHUGORY $ 9 *ULVKLQ 0 < 2UORYD 0 % .RVWLQD 2 0DNDUHYLFK 1 ( %URXGH 6 0RQDVW\UVND\D DQG ( 6YHUGORY 7KH IDPLO\ RI KXPDQ 1D.$73DVH JHQHV $73$/ JHQH LV WUDQVFULSWLRQDOO\ FRPSHWHQW DQG SUREDEO\ HQFRGHV WKH UHODWHG LRQ WUDQVSRUW $73DVH )(%6/HWW 0RULL 0 < +D\DWD 0L]RJXFKL DQG 1 7DNHJXFKL 2OLJRPHULF UHJXODWLRQ RI JDVWULF +.$73DVH %LRO &KHP 0XQVRQ % & *XWLHUUH] 9 1 %DODML 5DPQDUD\DQ DQG 6DFKV LGHQWLILFDWLRQ RI DQ H[WUDF\WRSODVPLF UHJLRQ RI +.f$73DVH ODEHOHG E\ D .fFRPSHWLWLYH SKRWRDIILQLW\ LQKLELWRU %LRO &KHP

PAGE 138

0XQVRQ % DQG 6DFKV ,QDFWLYDWLRQ RI +.$73DVH E\ D .FRPSHWLWLYH SKRWRDIILQLW\ LQKLELWRU %LRFKHPLVWU\ 1HZPDQ 3 5 DQG ( 6KXOO 5DW JDVWULF +.$73DVH EHWDVXEXQLW JHQH LQWURQH[RQ RUJDQL]DWLRQ LGHQWLILFDWLRQ RI PXOWLSOH WUDQVFULSWLRQ LQLWLDWLRQ VLWHV DQG DQDO\VLV RI WKH nIODQNLQJ UHJLRQ *HQRPLFV 1LOZDUDQJNDU 6 6 1LPPDQQLW 9 &KDRYDNXO : 6XVDHQJUDW 6 2QJ$M
PAGE 139

6DFKV + + &KDQJ ( 5DEQ 5 6FKDFNPDQ 0 /HZLQ DQG 6DFFRPDQL $ QRQHOHFWURJHQLF + SXPS LQ SODVPD PHPEUDQHV RI KRJ VWRPDFK %LRO &KHP 6DFKV / )DOOHU DQG ( 5DEQ 3URWRQK\GUR[\O WUDQVSRUW LQ JDVWULF DQG LQWHVWLQDO HSLWKHOLD 0HPEU %LRO 6DQJDQ 3 9 0 5DMHQGUDQ $ 6 0DQQ 0 .DVKJDULDQ DQG + %LQGHU 5HJXODWLRQ RI FRORQLF +.$73DVH LQ ODUJH LQWHVWLQH DQG NLGQH\ E\ GLHWDU\ 1D GHSOHWLRQ DQG GLHWDU\ GHSOHWLRQ $P 3K\VLR & 6DUYD]\DQ 1 $ 1 1 0RG\DQRY DQG $ $VNDUL ,QWHUVXEXQLW DQG LQWUDVXEXQLW FRQWDFW UHJLRQV RI 1D.f$73DVH UHYHDOHG E\ FRQWUROOHG SURWHRO\VLV DQG FKHPLFDO FURVVOLQNLQJ %LRO &KHP 6FKZLHEHUW ( 0 + .DUOVRQ 3 $ )ULHGPDQ 3 'LHWO : 6 6SLHOPDQ DQG % $ 6WDQWRQ $GHQRVLQH UHJXODWHV D FKORULGH FKDQQHO YLD SURWHLQ NLQDVH & DQG D SURWHLQ LQ D UDEELW FRUWLFDO FROOHFWLQJ GXFW FHOO OLQH &OLQ ,QYHVW 6FKZLHEHUW ( 0 : 0LOOV DQG % $ 6WDQWRQ $FWLQEDVHG F\WRVNHOHWRQ UHJXODWHV D FKORULGH FKDQQHO DQG FHOO YROXPH LQ D UHQDO FRUWLFDO FROOHFWLQJ GXFW FHOO OLQH %LRO &KHP 6KDPUDM 2 % /LQJUHO $ SXWDWLYH IRXUWK 1Df.f$73DVH DVXEXQLW JHQH LV H[SUHVVHG LQ WHVWLV 3URF 1DWO $FDG 6FL 86$ 6KLQ 0 0 %HVDQFRQ $ 6LPRQ DQG 6DFKV 7KH VLWH RI DFWLRQ RI SDQWRSUD]ROH LQ WKH JDVWULF +.f$73DVH %LRFKLP %LRSK\V$FOD 6KLQ 0 DQG 6DFKV ,GHQWLILFDWLRQ RI D UHJLRQ RI WKH +.$73DVH DOSKD VXEXQLW DVVRFLDWHG ZLWK WKH EHWD VXEXQLW %LRO &KHP 6KXOO ( DQG % /LQJUHO 0ROHFXODU FORQLQJ RI WKH UDW VWRPDFK + .f$73DVH %LRO &KHP 6KXOO 0 0 DQG % /LQJUHO 0XOWLSOH JHQHV HQFRGH WKH KXPDQ 1D.$73DVH FDWDO\WLF VXEXQLW 3URF 1DOO $FDG 6FL 86$ 6LOYHU 5 % DQG )ULQGW )XQFWLRQDO LGHQWLILFDWLRQ RI +.$73DVH LQ LQWHUFDODWHG FHOOV RI FRUWLFDO FROOHFWLQJ WXEXOH $P 3K\VLRO ) 6LOYHU 5 % )ULQGW 3 0HQQLWW DQG / 0 6DWOLQ &KDUDFWHUL]DWLRQ DQG UHJXODWLRQ RI +.$73DVH LQ LQWHUFDODWHG FHOOV RI UDEELW FRUWLFDO FROOHFWLQJ GXFW ([S =RRO

PAGE 140

6LOYHU 5 % 3 $ 0HQQLWW DQG / 0 6DWOLQ 6WLPXODWLRQ RI DSLFDO +.$73DVH LQ LQWHUFDODWHG FHOOV RI FRUWLFDO FROOHFWLQJ GXFW ZLWK FKURQLF PHWDEROLF DFLGRVLV $P 3K\VLRO ) 6LWSULMD 9 (2 6 5 6XYDQDSKD 3 .XOODYDQLMD\D DQG 6 &KLQD\RQ *DVWULF K\SRDFLGLW\ LQ GLVWDO UHQDO WXEXODU DFLGRVLV 1HSKURQ 6PROND $ / $OYHUVRQ 5 )ULW] 6ZLJHU DQG 5 6ZLJHU *DVWULF +.$73DVH WRSRJUDSK\ DPLQR DFLGV DUH F\WRSODVPLF %LRFKHP %LRSK\V 5HV &RPPXQ 6PROND $ DQG 0 6ZLJHU 6LWHGLUHFWHG DQWLERGLHV DV WRSRJUDSKLFDO SUREHV RI WKH JDVWULF +.$73DVH DOSKDVXEXQLW %LRFKLP %LRSK\V $FWD 6SLHOPDQ : 6 : 6RQQHQEXUJ 0 / $OOHQ / $UHQG *HUR]LVVLV DQG : / 6PLWK ,PPXQRGLVVHFWLRQ DQG FXOWXUH RI UDEELW FRUWLFDO FROOHFWLQJ WXEXOH FHOOV $P 3K\VLRO ) 6YHUGORY ( 6 0RQDVW\UVND\D 1 ( %URXGH $ 8VKNDU\RY
PAGE 141

9DQ 'ULHO 5 DQG 0 &DOODJKDQ 3URWRQ DQG SRWDVVLXP WUDQVSRUW E\ +.f$73DVHV &OLQ ([S 3KDUPDFRO 3K\VLRO YDQ 'ULHO 5 DQG 0 &DOODJKDQ 3URWRQ DQG SRWDVVLXP WUDQVSRUW E\ +.f$73DVHV &OLQ ([S 3KDUPDFRO 3K\VLRO :DOGHUKDXJ 0 2 5 / 3RVW 6DFFRPDQL 5 7 /HRQDUG DQG 3 %ULVNLQ 6WUXFWXUDO UHODWHGQHVV RI WKUHH LRQWUDQVSRUW DGHQRVLQH WULSKRVSKDWDVHV DURXQG WKHLU DFWLYH VLWHV RI SKRVSKRU\ODWLRQ %LR &KDP :HLQHU DQG / / +DPP 8VH RI IOXRUHVFHQW G\H %&(&) WR PHDVXUH LQWUDFHOOXODU S+ LQ FRUWLFDO FROOHFWLQJ WXEXOH $P 3K\VLR ) :HLQHU DQG $ ( 0LOWRQ +f.f$73DVH LQ UDEELW FRUWLFDO FROOHFWLQJ GXFW %W\SH LQWHUFDODWHG FHOO $P 3K\VLRO ) :KHOWRQ 3 3RWDVVLXP DQG %ORRG 3UHVVXUH ,Q +\SHUWHQVLRQ 3ULPHU HGLWHG E\ / ,]]R %ODFN + 5 'DOODV 7; $PHULFDQ +HDUW $VVRFLDWLRQ S :LOODUGVRQ % 0 % 7KHYHQLQ 0 / +DUULVRQ : 0 .XVWHU 0 %HQVRQ DQG 3 6 /RZ /RFDOL]DWLRQ RI WKH DQN\ULQELQGLQJ VLWH RQ HU\WKURF\WH PHPEUDQH SURWHLQ EDQG %LRO &KHP :LQJR & 6 3RWDVVLXP WUDQVSRUW E\ PHGXOODU\ FROOHFWLQJ WXEXOH RI UDEELW HIIHFWV RI YDULDWLRQ LQ LQWDNH $P 3K\VLRO ), :LQJR & 6 $FWLYH SURWRQ VHFUHWLRQ DQG SRWDVVLXP DEVRUSWLRQ LQ WKH UDEELW RXWHU PHGXOODU\ FROOHFWLQJ GXFW )XQFWLRQDO HYLGHQFH IRU SURWRQSRWDVVLXPDFWLYDWHG DGHQRVLQH WULSKRVSKDWDVH &OLQ ,QYHVW :LQJR & 6 DQG % &DLQ 7KH UHQDO +.$73DVH SK\VLRORJLFDO VLJQLILFDQFH DQG UROH LQ SRWDVVLXP KRPHRVWDVLV $QQQ 5HY 3K\VLRO :LQJR & 6 0 0DGVHQ $ 6PROND DQG & & 7LVKHU +.$73DVH LPPXQRUHDFWLYLW\ LQ FRUWLFDO DQG RXWHU PHGXOODU\ FROOHFWLQJ GXFW .LGQH\ ,QW :LQJR & 6 DQG $ 6PROND )XQFWLRQ DQG VWUXFWXUH RI +.$73DVH LQ WKH NLGQH\ >HGLWRULDO@ $P 3K\VLRO ), :ROIH 0 0 DQG $ + 6ROL 7KH SK\VLRORJ\ RI JDVWULF DFLG VHFUHWLRQ 1(QJO 0HG

PAGE 142


PAGE 143

%,2*5$3+,&$/ 6.(7&+ *UDG\ &DPSEHOO ZDV ERUQ LQ &OHDUZDWHU )ORULGD RQ )HEUXDU\ +H JUDGXDWHG IURP &KDUOHV ( -RUGDQ +LJK 6FKRRO RI 'XUKDP 1RUWK &DUROLQD LQ -XQH 7KH IROORZLQJ 6HSWHPEHU KH HQWHUHG (PRU\ 8QLYHUVLW\ LQ $WODQWD *HRUJLD DQG LQ -XQH KH UHFHLYHG D %DFKHORU RI 6FLHQFH GHJUHH ZLWK D PDMRU LQ SK\VLFV ,Q $XJXVW RI WKDW \HDU KH EHJDQ HPSOR\PHQW DW (*t* 257(& LQ 2DN 5LGJH 7HQQHVVHH ,Q WKH IDOO RI KH HQUROOHG DV D SDUWWLPH VWXGHQW DW WKH 8QLYHUVLW\ RI 7HQQHVVHH .QR[YLOOH DQG EHJDQ VWXG\ WRZDUG D PDVWHUfV GHJUHH XQGHU WKH GLUHFWLRQ RI &DUURO 5 %LQJKDP ZLWK D PDMRU LQ SK\VLFV +LV WKHVLV ZDV HQWLWOHG 7KH 'HFD\ RI 0DVVVHSDUDWHG 3E WR ,7 WKH GHJUHH ZDV DZDUGHG LQ $XJXVW ,Q $SULO RI WKH IROORZLQJ \HDU KH EHJDQ HPSOR\PHQW DW &DOLIRUQLD ,QVWLWXWH RI 7HFKQRORJ\ LQ 3DVDGHQD &DOLIRUQLD ,Q $XJXVW KH HQUROOHG DV D JUDGXDWH VWXGHQW LQ WKH 'HSDUWPHQW RI %LRFKHPLVWU\ DQG 0ROHFXODU %LRORJ\ DW WKH 8QLYHUVLW\ RI )ORULGD LQ *DLQHVYLOOH )ORULGD 7KDW 'HFHPEHU KH MRLQHG %ULDQ &DLQfV ODERUDWRU\ ZKHUH KH FDUULHG RXW WKH ZRUN GHVFULEHG LQ WKLV GLVVHUWDWLRQ 8SRQ FRPSOHWLQJ WKH UHTXLUHPHQWV IRU KLV GHJUHH KH LV MRLQLQJ )UDQN 99 %RRWKfV ODERUDWRU\ DW WKH 8QLYHUVLW\ RI 7H[DV+RXVWRQ 0HGLFDO 6FKRRO LQ +RXVWRQ 7H[DV ZKHUH KH ZLOO ILQG DQG VWXG\ JHQHV LQYROYHG LQ FRQIHUULQJ WKH EHQHILW RI H[HUFLVH RQ FDUGLRYDVFXODU GLVHDVH

PAGE 144

, FHUWLI\ WKDW KDYH UHDG WKLV VWXG\ DQG WKDW LQ P\ RSLQLRQ LW FRQIRUPV WR DFFHSWDEOH VWDQGDUGV RI VFKRODUO\ SUHVHQWDWLRQ DQG LV IXOO\ DGHTXDWH LQ VFRSH DQG TXDOLW\ DV D GLVVHUWDWLRQ IRU WKH GHJUHH RI 'RFWRU RI 3KLORVRSK\ %ULDQ &DLQ &KDLU $VVRFLDWH 3URIHVVRU RI %LRFKHPLVWU\ DQG 0ROHFXODU %LRORJ\ FHUWLI\ WKDW KDYH UHDG WKLV VWXG\ DQG WKDW LQ P\ RSLQLRQ LW FRQIRUPV WR DFFHSWDEOH VWDQGDUGV RI VFKRODUO\ SUHVHQWDWLRQ DQG LV IXOO\ DGHTXDWH LQ VFRSH DQG TXDOLW\ DV D GLVVHUWDWLRQ IRU WKH GHJUHH RI 'RFWRU RI 3KLORVRSK\ nn6XVDQ & )URVW $VVRFLDWH 3URIHVVRU RI %LRFKHPLVWU\ DQG 0ROHFXODU %LRORJ\ FHUWLI\ WKDW KDYH UHDG WKLV VWXG\ DQG WKDW LQ P\ RSLQLRQ LW FRQIRUPV WR DFFHSWDEOH VWDQGDUGV RI VFKRODUO\ SUHVHQWDWLRQ DQG LV IXOO\ DGHTXDWH LQ VFRSH DQG TXDOLW\ DV D GLVVHUWDWLRQ IRU WKH GHJUHH RI 'RFWRU RI 3KLORVRSK\ 3URIHVVRU RI %LRFKHPLVWU\ DQG 0ROHFXODU %LRORJ\ FHUWLI\ WKDW KDYH UHDG WKLV VWXG\ DQG WKDW LQ P\ RSLQLRQ LW FRQIRUPV WR DFFHSWDEOH VWDQGDUGV RI VFKRODUO\ SUHVHQWDWLRQ DQG LV IXOO\ DGHTXDWH LQ VFRSH DQG TXDOLW\ DV D GLVVHUWDWLRQ IRU WKH GHJUHH RI 'RFWRU RI 3KLORVRSK\ $LL87IFFO +DUU\ 6 1LF 3URIHVVRU DIntLRFKHPLVWU\ DQG 0ROHFXODU %LRORJ\ FHUWLI\ WKDW KDYH UHDG WKLV VWXG\ DQG WKDW LQ P\ RSLQLRQ LW FRQIRUPV WR DFFHSWDEOH VWDQGDUGV RI VFKRODUO\ SUHVHQWDWLRQ DQG LV IXOO\ DGHTXDWH LQ VFRSH DQG TXDOLW\ DV D GLVVHUWDWLRQ IRU WKH GHJUHH RI 'RFWRU RI 3KLORVRSK\ &KDUOHV 6 :LQJR 3URIHVVRU RI 3K\VLRORJ\ DQG 3KDUPDFRORJ\

PAGE 145

7KLV GLVVHUWDWLRQ ZDV VXEPLWWHG WR WKH *UDGXDWH )DFXOW\ RI WKH &ROOHJH RI 0HGLFLQH DQG WR WKH *UDGXDWH 6FKRRO DQG ZDV DFFHSWHG DV SDUWLDO IXOILOOPHQW RI WKH UHTXLUHPHQWV IRU WKH GHJUHH RI 'RFWRU RI 3KLORVRSK\ $XJXVW 'HDQ &ROOHJH RI 0HGLFLQH 'HDQ *UDGXDWH 6FKRRO


xml version 1.0 encoding UTF-8
REPORT xmlns http:www.fcla.edudlsmddaitss xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.fcla.edudlsmddaitssdaitssReport.xsd
INGEST IEID EK4HNT829_VXV9N4 INGEST_TIME 2014-10-07T20:56:59Z PACKAGE AA00025809_00001
AGREEMENT_INFO ACCOUNT UF PROJECT UFDC
FILES


CHARACTERIZATION OF THE RABBIT RENAL H,K-ATPASES
by
W GRADY CAMPBELL
A DISSERTATION PRESENTED TO THE GRADUATE SCHOOL
OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT
OF THE REQUIREMENTS FOR THE DEGREE
OF DOCTOR OF PHILOSOPHY
UNIVERSITY OF FLORIDA
! 998

This thesis is dedicated to my father, William Maxwell Campbell, and my mother, Clara
Hicks Campbell.

ACKNOWLEDGMENTS
I would like to acknowledge the contributions of a number of people who helped me
in this work. First I would like to thank my committee, the chair Dr. Brian Cain, Dr.
Charles Wingo, Dr. Susan Frost, Dr Harry Nick, and Dr. Michael Kilberg. Also Dr. David
Weiner was very generous to share his lab and microscopes. Dr. Jill Verlander directed a
very interesting line of research to answer some questions that arose out of our own
research.
I would also like to thank my fellow lab members for putting up with me all this time.
Thanks go to Kim McCormick, Philip Hartzog, Abbe Stack, Jim Gordon, James Gardner,
Paul Sorgen, Tammy Caviston, and Regina Perry. James, Paul, Tammy, Regina, and I
shared many years together as a particularly cohesive lab family. Also 1 want to thank my
labmates in my lab home away from lab home, Jeanette Lynch, Amy Frank, and Robin
Moudy. They really went out of their way for me, and it was a pleasure working with
them. Mary Handlogten was also especially helpful in getting me started in protein work. I
want to acknowledge the contribution of the Yang lab, including Mike Litt, Chien Chen,
and Sue Lee. Having an adjacent lab with open doors and shared space between them has
turned out to be a great design, there has been a high level of camaraderie and exchange of
ideas between the labs.

I also appreciate the support and encouragement of my family, my sister Diane, her
children Emory and Lisacole, my brother-in-law Ken, and the newest addition to our
family Samma. The companionship and support of Ruth has helped me throughout my
time here. And most of all, I appreciate the enthusiastic support of my father and late
mother during my years here.
IV

TABLE OF CONTENTS
ACKNOWLEDGMENTS iii
LIST OF TABLES vii
LIST OF FIGURES viii
ABBREVIATIONS x
ABSTRACT xiii
BACKGROUND AND SIGNIFICANCE 1
Overview 1
H,K-ATPase in the Kidney 4
H,K-ATPase Structure and Function 17
Renal Tissue Culture Cells 23
Summary 26
MATERIALS AND METHODS 27
Molecular Biology 27
Biochemistry 36
Fluorescence Microscopy 40
H,K-ATPASE (3 SUBUNITS IN THE RABBIT RENAL MEDULLARY
COLLECTING DUCT 45
Introduction 45
Renal Medulla HKP mRNA Variant 46
Discussion 49
H,K-ATPASE a SUBUNITS IN THE RABBIT RENAL CORTICAL
COLLECTING DUCT 52
Introduction 52
Multiple H,K-ATPase a Subunits in the Kidney 53
Alternative Splicing of H,K-ATPase a Subunits in the Kidney 69
Expression of H,K-ATPase a Subunits in the Kidney 72
Discussion 76
v

H,K-ATPASE ACTIVITY IN A RABBIT KIDNEY CORTICAL
COLLECTING DUCT CELL LINE 81
Introduction 81
Detection of H,K-ATPase in RCCT-28A Cells 82
Discussion 100
PERSPECTIVE AND FUTURE DIRECTIONS 106
Multiplicity of H,K-ATPase Isoforms in the Kidney 106
Cell Type Specificity of H,K-ATPase in the Kidney 112
Future studies 113
REFERENCES 117
BIOGRAPHICAL SKETCH 129
vi

LIST OF TABLES
Table page
2-1. PCR primer pairs 32
2-2. Solutions for determination of pHi 41
vii

LIST OF FIGURES
Figure page
1-1. Schematic diagram of H,K-ATPase 18
3-1. Northern analysis showing presence of HKP mRNA in renal cortex, renal
medulla, and stomach 47
3-2. 3’ and 5’ RACE reactions to amplify HK(3 cDNAs using rabbit renal
medulla as template 48
3-3. HKP and p’ subunit mRNAs 50
4-1. Design of degenerate primers for RT-PCR of novel P-type ATPases 56
4-2. RT-PCR product amplified from rabbit renal cortex RNA using degenerate
primers 57
4-3. BLAST search using sequence of 419 bp fragment of HKoc2 58
4-4. Cloning of HKa2a and HKa2c cDN As 59
4-5. GenBank accession records for rabbit HKa2 sequences 61
4-6. Northern analysis showing presence of HKoc2a in distal colon and renal
cortex 67
4-7. Distance analysis of selected HKa and NaKa subunit coding 70
4-8. Rabbit HKa2 gene sequence at the 5’end 71
4-9. Western analysis showing presence of HKa2a and HKa2c protein in renal
cortex 73
4-10. Immunohistochemistry by Dr. Jill Verlander and Ms. Robin Moudy 75
5-1. Southern blots of H,K-ATPase subunit mRNA in RCCT-28A cells
84

5-2. HK(3 and HKai subunit mRNA in RCCT-28A cells 86
5-3. HKa.2 subunit mRNA in RCCT-28A cells 88
5-4. Western analysis showing presence of HKa2c protein in RCCT-28A cells 90
5-5. pH, recovery from an acid load by RCCT-28A cells in the absence ofNa+ .... 96
5-6. pH recovery from an acid load by RCCT-28 A cells in the presence of EIPA . . 98
5-7. Summary of the rates of pH, recovery from an acid load by RCCT-28 A cells .102
IX

ABBREVIATIONS
ATP
adenosine triphosphate
BCECF
2',7'-bis(carboxyethyl)-5(6)- carboxyfluorescein
BCECF-AM
acetoxymethyl ester of BCECF
bp
base pairs
DEPC
diethylpyrocarbonate
DNA
deoxyribonucleic acid
EDTA
ethylene diamine tetraacetic acid
EIPA
ethylisopropylamiloride
FBS
fetal bovine serum
FITC
fluoroisothiocyanate
HEPES
N-2- hydroxyethylpiperazine-N’-2-ethanesulfonic acid
HKa
H,K-ATPase a (catalytic) subunit
HKa,
H,K-ATPase oti subunit
HKa2a
H,K-ATPase a2a subunit
HKa2b
H,K-ATPase a2b subunit
HKa2c
H,K-ATPase a2c subunit
HKa3
H,K-ATPase a3 subunit

HKo4
H,K-ATPase a4 subunit
HK(3
H,K-ATPase P subunit
HKp’
H,K-ATPase P’ subunit
hr
hour
kb
thousand base pairs
kDa
thousand Daltons
M
molar
mEq
milliequivalents
min
minute
MW
molecular weight
NaKa
Na,K-ATPase a (catalytic) subunit
NaKa,
Na,K-ATPase ai subunit
NaKa2
Na,K-ATPase a2 subunit
NaKa3
Na,K-ATPase a3 subunit
NaKou
Na,K-ATPase a4 subunit
NaKp,
Na,K-ATPase Pi subunit
PAGE
polyacrylamide gel electrophoresis
PCR
polymerase chain reaction
pH,
intracellular pH
PMSF
phenylmethylsulfonyl fluoride
pS
picoSiemen
RACE
Rapid Amplification of cDNA Ends
XI

RNA
ribonucleic acid
RT
reverse transcription
RT-PCR
reverse transcriptase-polymerase chain reaction
SDS
sodium dodecyl sulfate
sec
second
Tris
tris[hydroxymethyl]aminomethane
UTR
untranslated region
xii

Abstract of Dissertation Presented to the Graduate School
of the University of Florida in Partial Fulfillment of the
Requirements for the Degree of Doctor of Philosophy
CHARACTERIZATION OF THE RABBIT RENAL H,K-ATPASES
By
W. Grady Campbell
August 1998
Chairperson: Dr. Brian D. Cain
Major Department: Biochemistry and Molecular Biology
H,K-ATPases are located on the apical membrane of epithelial cells lining the
collecting duct in the kidney. ATP hydrolysis drives luminal acidification and potassium
reabsorption by the enzyme. H,K-ATPases consist of two subunits. The catalytic sites are
located on the a subunits, and the P subunits play a role in intracellular trafficking. The
goal of this work was to elucidate the molecular identity of H,K-ATPase a and P subunits
in kidney. Northern analysis demonstrated two H,K-ATPase P subunit species in rabbit
renal medulla; only the smaller of these was present in renal cortex and gastric tissues. A
search for H,K-ATPase a subunit isoforms in rabbit renal cortex was conducted using
reverse transcriptase-polymerase chain reaction with degenerate primers. A full-length
cDNA of the H,K-ATPase ot2 subunit was obtained. Two 5’ ends of this transcript were
observed by 5’ Rapid Amplification of cDNA Ends. One (HKa2a) had high homology to
xiii

previously known H,K-ATPases, and the second was a novel variant (a2c). Phylogenetic
analysis showed that the rabbit a2a subunit clusters near H,K-ATPases from human axillary
skin and rat distal colon, but is more distant from gastric H,K-ATPase and
Na,K-ATPases. Gene sequence analysis showed that the first HKa2c exon was located
within the first HKa2a intron. Western analysis using antipeptide polyclonal antibodies
demonstrated the expression of HKoti, HKa2a and HKa2c subunits in rabbit renal cortex.
The mRNAs encoding the HKp, HKa,, HKa2a, and HKa2c subunits were detected in the
rabbit cortical collecting tubule intercalated cell line RCCT-28A. These results indicated
that acid-secreting intercalated collecting duct cells were a cell type containing
H,K-ATPase, and these cells appear capable of expressing multiple H,K-ATPase isoforms.
xiv

BACKGROUND AND SIGNIFICANCE
Overview
H,K-ATPase was first identified in the stomach, where it is expressed at an extremely
high level to mediate the extrusion of acid that aids digestion. A great deal has been
learned about regulation of H,K-ATPase in the stomach, enough to feel as though its
regulation is understood in a meaningful way. At the molecular level, gastric-specific
transcription factors have been found that may be responsible for the marked
tissue-specific regulation of expression of H,K-ATPase (Maeda et al., 1991; Oshiman et
al., 1991; Tamura et al., 1992). The principal means of induction of gastric H,K-ATPase
from its basal state is by unwinding a tightly coiled tubular network, exposing pumps
localized in the network and thereby increasing the size of the secretory surface (Pettit et
al., 1995). This morphological transformation is triggered by various stimuli including
activation of stretch receptors in the stomach by entering food, the sight of food, or even
the thought of food (reviewed by Wolfe and Soil, 1988; Hersey and Sachs, 1995). Thus,
there is a framework of understanding of the regulation of H,K-ATPase in the stomach at
the molecular and cellular levels, and the root stimuli that result in the H,K-ATPase
response are known.
H,K-ATPase is expressed at much lower level in the kidney, but its role in the kidney
is even more critical to life than its role in the stomach. The kidney plays the major role in
1

2
K+ homeostasis, maintaining extracellular (including plasma) K+ concentration within the
relatively narrow normal range of 3.8 to 5.0 mEq/L (Merck, 1992; Guyton and Hall,
1997) despite a wide variation in K+ intake. If plasma K+ levels depart significantly from
these values, then cardiac arrhythmias lead to life-threatening conditions.
K+ transport in the kidney is also important to blood pressure regulation. It has been
observed that urinary K' levels and urinary Na7K+ ratio are related to systolic and
diastolic blood pressures (INTERSALT, 1988; Whelton, 1993). Excretion rates show a
higher degree of correlation with elevated blood pressure than serum levels, implicating
the kidney as an important organ in regulating the effect of K* on blood pressure. Dietary
K+ supplementation has been shown to lower blood pressure since early this century
(Ambard and Beaujard, 1904; Addison, 1928).
The substantial role of renal ion transport in blood pressure regulation is emphasized
by studies conducted by Lifton (1996), who determined the molecular bases underlying
certain types of monogenic inherited extreme hypo- and hypertension disorders. Each of
the genetic defects found affected renal ion transport. Such well-defined inherited diseases
of blood pressure regulation are not common. In 95% of people experiencing hypertension
their diagnosis is essential hypertension, the root cause being essentially unknown. To
understand this majority of hypertensive disorders, a more complete understanding of
renal ion transport is needed. Because of the role of H,K-ATPase in the final regulation of
K+ excretion in the kidney, understanding its contribution to renal ion transport could well
be important in understanding the problem of essential hypertension.
In order to understand the role of H,K-ATPase in the kidney, the exact H,K-ATPase
pumps of the kidney must be characterized at a molecular level. This characterization must

3
be carried out to a high level of detail, to explore variations in the ion pumps conferred by
differences in changes in transcriptional start or adenylation sites, or by alternative
splicing. With the identity of the H,K-ATPase subunits known at a molecular level,
various reagents can then be developed to characterize H,K-ATPase regulation. These
include cDNA probes, antibodies, and activity assays. With these tools available, it will be
possible to develop a more complete framework of understanding of renal H,K-ATPase.
The studies in this dissertation contribute to our knowledge of the H,K-ATPase
subunits at a molecular level. At the time these studies began, it was not known what
H,K-ATPase subunits were responsible for the active H* and K+ exchange that had been
observed in renal collecting duct. Further evidence is presented that all the currently
known H,K-ATPase subunits are present in kidney, and that the primary cell type in which
all are expressed is the collecting duct acid-secreting intercalated cell. When these studies
were begun, there was no known alternative splicing of P-type ATPases. Here alternative
splicing of an HKa subunit mRNA is described, and expression of a protein product is
shown in kidney. In addition, a variant renal medulla HKP transcript is described that has
tissue-specific expression even within the kidney. In summary, this work has generated a
new appreciation for the complexity of H,K-ATPase molecules that underlie renal
collecting duct H,K-ATPase activity.

4
H.K-ATPase in the Kidney
Transport activity
The kidney is the principal organ responsible for potassium homeostasis and plays a
major role in maintenance of the acid-base balance of the body. The renal collecting duct
(CD) is the primary site of regulation of the excretion of potassium and the acidification of
urine. A number of studies implicate an apical H,K-ATPase as an important mediator of
these functions. The enzyme (pump) actively transports IT into the lumen of the nephron
in a nonelectrogenic exchange for K" (for review, see Wingo and Cain, 1993, Wingo and
Smolka, 1995).
A K+ activated ATPase was observed in frog gastric microsomes by Ganser and Forte
(1973). Lee et al. (1974) found that gastric microsomes isolated from dog mucosa were
able to accumulate H+ in the presence of ATP and K . These studies were the initial
observations of the now well-known gastric H,K-ATPase. The designation of
H,K-ATPase was given the enzyme by Sachs el al. (1976).
Gustin and Goodman (1981) isolated apical brush-border membrane of the rabbit
descending colon by isolation of epithelial cells, homogenization, and centrifugation on a
Percoll gradient. They found a membrane-bound, Reactivated ATPase, which had a
Kac^xlO^M for K', was competitively inhibited by Na+, but had no activation by Na+. It
was vanadate sensitive, but oligomycin and ouabain (ImM) insensitive. This represented
the first observations of enzymatic activity for the colonic H,K-ATPase.
Smolka and Sachs (in Sachs et al., 1982), employing monoclonal antibodies, detected
a protein at least similar to the gastric proton-potassium-translocating ATPase protein in

5
renal distal tubule and colon. Sachs et al. (1982) advanced the idea that this protein might
be involved in the K+ reabsorption or the acidification known to take place in kidney or
colon.
By quantitating the hydrolysis of [y-32P]ATP, Doucet and Marsy (1987) observed a
K+-stimulated ATPase activity in rabbit kidney. The level of activity was related to the
density of intercalated cells in microdissected segments of rabbit connecting segment
(highest activity), cortical collecting duct (intermediate), and outer medullary collecting
duct (lowest), and not detectable in any other nephron segments. The ATPase affinity for
K+ was high (Km=0.2-0.4mM). The pharmacological properties of the renal H,K-ATPase
was examined as a preliminary indication of the pumps present in the kidney. Omeprazole
is an inhibitor of the gastric isoform of H,K-ATPase, vanadate inhibits all P-type ATPases,
and ouabain is a Na,K-ATPase inhibitor that also inhibits non-gastric H,K-ATPase
isoforms. The renal ATPase was inhibited by omeprazole and vanadate, but not by
ouabain. They also observed a K-ATPase activity with potassium restriction in rat renal
outer medullary collecting duct that roughly doubled, changing little after 0.5 weeks
low-Kf diet. In cortical collecting duct activity doubled, rising steadily during a five week
low-K+ diet (Doucet and Marsy, 1987).
Wingo (1987) did a more complete study of dietary K' influence on K+ transport in the
kidney. He first established that rabbits on a Kf-replete diet, or on a Kf-depleted diet, or
on a Kf-deplete Na+-supplemented diet all consumed similar quantities. Wingo (1987)
used restricted diets containing 0.55% K+, marginally less than the 0.6% generally thought
to be required for normal rabbit growth. In time-course studies he found that after an
initial two-week period of K-replete meals, 72 hr was sufficient for the response to

6
equilibrate as judged by urinary Naf and K' excretion. Muscular K" levels had not altered
significantly in that time, showing that renal response preceded effects deleterious to the
animal. Serum K+ levels were slightly higher in K -replete animals, and the same in
K+-depleted Na"-supplemented animals compared to K’-depleted animals. The sodium
supplementation evidently maintained the K+ seaim level. Serum aldosterone was found to
be 2.88±.57 ng/dl in K+-depleted Na+-supplemented rabbits, 15.6±5.3 for K+-depleted
rabbits, and 44.7Ü4.0 for potassium-replete animals, and thus any changes in transport
observed cannot be correlated with aldosterone level.
In his experiments, Wingo (1987) found that perfused collecting ducts from outer
medullary inner stripe had similar rates of fluid reabsorption, gauged by 3H-inulin flux, and
similar transepithelial voltages. K+ reabsorption, however, roughly tripled among rabbits
on K+-restricted diets, measured as a flux of 4:K. Kf-replete rabbits had
5.9±0.8%,K+-depleted rabbits had 17.2±2.0%, and K'-depleted Na*-supplemented rabbits
had 20.8±4.2% reabsorption. The data were not significantly different in either of the two
K+-restricted cases. He concluded that K’ reabsorption in the medullary collecting tubule
is comparable to K+ secretion in the cortical segments at normal fluid flux rates, and could
have important contributions to the amount of K* excreted in urine. In a later report by
Wingo (1989), the name H,K-ATPase was first explicitly given to the K+-stimulated
ATPase that had been studied by others in the kidney.
Utilizing a fluorometric microassay in which ATP hydrolysis is coupled to the
oxidation ofNADH, Garg and Narang (1989) detected the presence of a K+-dependent,
ouabain-insensitive ATPase activity in rabbit kidney that was also omeprazole-,
SCH28080-, and vanadate-sensitive. Sch-28080, like omeprazole, is a potent gastric

7
H,K-ATPase inhibitor. Earlier work by this group (Garg and Narang, 1988) noted H+
secretion coupled to an ATPase that was not NEM-inhibited, and could not account for
the vacuolar H'-ATPase they were studying. Significant PC -ATPase activity was seen in
microdissected connecting segment (17.0±3.3 pinol min 1 mm'1), cortical collecting duct
(6.6±0.7), and outer medullary collecting duct (8.8±1.7), but not in proximal straight
tubule, convoluted tubules, nor the thick ascending limbs. They found the K+-ATPase
activity to be affected by diet. Activity was found in the connecting segment (13.0±4.0
pmol min’ mm'1), cortical collecting duct (10.1±3.0), and outer medullary collecting duct
(10.8±2.2) in animals on a low K’ diet. Cortical collecting duct activity varied with pH;
optimal pH of 7.4 gave activity of 10 pmol min'1 mm'1, falling at lower pH to 3 at pH of
7.0, and falling at higher pH to 5 at pH 7.8. Thus, a high K* diet completely suppressed
the K+-ATPase activity, while rabbits fed a normal diet had similar activity to the low K+
fed rabbits of the second study.
Studies by Cheval and co-workers (Cheval et al., 1991) examined the 8tiRb flux (86Rb is
a K+ analog used as a radioactive tracer for transporter studies) and K-ATPase activities.
These activities were blocked by Sch-28080 in cortical and medullary collecting duct.
Activities they attributed to Na,K-ATPase and H-ATPase were unaffected by Sch-28080.
In this study, ouabain was used at a concentration of 2.5 niM to inhibit Na,K-ATPase.
Although there are inconsistencies in the exact concentration at which ouabain inhibits
H,K-ATPases containing the HKa: subunit, all expression studies carried out to date
(Modyanov et al., 1995; Codina etal., 1996; Cougnon el al., 1996; Grishin el al., 1996)
except for one (Lee el al., 1995) indicate that 2.5 mM ouabain is sufficient to block the
HK<72 enzyme. Lee et at. (1995) detected no ouabain sensitivity at 1 mM, and it is not

8
known what effect 2.5 mM would have had in their system. In this work by Cheval et al.
(1991) the activities of Na,K-ATPase and an HKa: H,K-ATPase would be
indistinguishable.
These early studies do not distinguish between different isoforms of H,K-ATPase that
may together account for the H,K-ATPase activity observed in the kidney. Given
historical perspective, this makes sense because at the time these studies were conducted,
only HKoti and HK(3 subunit isoforms were known, and the ouabain-sensitive
H,K-ATPase was not yet known. Later studies (Younes-lbrahim et al., 1995;
Buffin-Meyer el al., 1997) addressed the issue of multiple isoforms of H,K-ATPase in the
kidney and their distribution along the nephron and collecting duct. These investigators
found three distinct H,K-ATPase activities. Two were found in the collecting duct; one of
these was sensitive to Sch-28080; the other was insensitive. The third was found in
proximal tubules and thick ascending limbs, and was inhibited by Sch-28080. In normal
rats, the sole H,K-ATPase activity present in collecting duct was the Sch-28080-sensitive
activity. In K7-depleted rats, the overall H,K-ATPase activity in collecting duct increased,
while the activity in proximal tubule decreased. The increase was abolished by ouabain,
but not by Sch-28080, implying that the increase is due to an H,K-ATPase isoform that is
pharmacologically dissimilar to HKcti. The proximal tubule/thick ascending limb
H,K-ATPase may have a basolateral polarity, rather than the apical localization of the
collecting duct H,K-ATPase. If the H,K-ATPase role in proximal tubule and thick
ascending limb involves K' homeostasis, then its down regulation by dietary K+ depletion
would imply a basolateral location. Together, these results argue for three different
H,K-ATPase isoforms in kidney. One was constitutively expressed in the collecting duct,

9
and was Sch-28080-sensitive and ouabain-insensitive, like the HKai isoform of
H,K-ATPase. The second was presumably located basolaterally in proximal tubule and
thick ascending limb, reduced by low K\ and was ouabain-sensitive. The third was located
apically in the collecting duct, stimulated by low K’, and Sch-28080-insensitive but
ouabain-sensitive.
Earlier studies naturally concentrated on establishing the existence of H,K-ATPase in
the kidney. The early studies demonstrated H,K-ATPase activity in connecting segment,
cortical collecting duct, and outer medullary collecting duct. Although measurements were
made for H,K-ATPase activity in other nephron segments, no H,K-ATPase activity was
found outside the connecting segment and collecting duct. More recently, proximal tubule
and thick ascending limb have been added as regions having H,K-ATPase activity. These
studies also began to address the differences among H,K-ATPases that are present in the
kidney, defining the characteristics of the H,K-ATPase activities and their localization.
The identity of the H,K-ATPase molecules responsible for the two collecting duct
activities have been found The identity of the H,K-ATPase molecule responsible for the
activity in the more proximal nephron is not yet known.
H.K-ATPase subunit isoforms in the kidney
Until the last five years, the presence of H,K-ATPase in the kidney has been defined
only on the basis of activity. We have now begun to determine the molecular identities of
the pumps responsible for this activity. And only very recently it has become appreciated
that the complexity of H,K-ATPase expression also includes alternative splicing of HKa
and HKP isoforms.

10
An H,K-ATPase has long been known to acidify the lumen of the stomach. This pump
is a member of the P-type ATPase family, which shares similarity of sequence, structure
and mechanism. The gastric H,K-ATPase is comprised of a catalytic co subunit and a (3
subunit; the active form of the enzyme is an (aP)2 oligomer (for review see Hershey and
Sachs, 1995; Van Driel and Callaghan, 1995). Full-length cDNAs for rabbit HKoti
(Bamberg et al., 1992) and HKp (Reuben et al., 1990) have been cloned and sequenced.
RT-PCR followed by sequencing of the amplified products has been used to demonstrate
that mRNA (Alin and Kone, 1995) and protein (Callaghan et at., 1995) for HKoo and that
mRNA and protein for HKP (Callaghan el al., 1995) isoforms are present in kidney. This
author was included in the latter study.
The non-gastric H,K-ATPase a subunit isoforms (HKa2) have been cloned from
several tissues. A partial cDNA for an HKa2 isoform was obtained from human axilla skin,
and mRNA observed in brain and kidney (Modyanov el a!., 1991). A full-length cDNA
was found subsequently (Grishin et al., 1994). An HKa2 cDNA was cloned from rat distal
colon by Crowson and Shull (1992); the corresponding amino acid sequence has 86%
amino acid identity to the cDNA derived from human skin. This rat HKa2 mRNA was
detected in kidney, uterus, and heart using two separate cDNA probes from HKot? 3’ UTR
and C-terminal transmembrane domains. The 3’ UTR derived probe detected HKa2 in
forestomach as well. These human and rat cDNAs were shown to encode H7K+ exchange
activity when expressed in Xenopus laevis oocytes (Modyanov et al., 1995; Cougnon et
al., 1996), although recent work questions the stoichiometry of the exchange in the human
isoform (Grishin et al., 1996). In two of these studies rabbit HKP subunits were

11
cotransfected (Modyanov et al., 1995; Grishin et al., 1996), and in the other Bufo marinus
HK(3 subunits were cotransfected (Cougnon et al., 1996). A partial HKa2 cDNA was
cloned from a rabbit cortical CD (CCD) library having 84% amino acid identity to the
human HKa2, and mRNA was detected in CCD and colon (Fejes-Toth el al., 1995).
Watanabe et al. (1992) cloned and sequenced a similar cDNA from distal colon of guinea
pig. The degree of identity at the amino acid level among human, rat, guinea pig, and
rabbit HKa2 clones is less than the amino acid identity of HKoti (>97%) between the three
species, but much greater than the typical amino acid identity between HKoci and other
P-type ATPases (<64%). Therefore, although controversy on this point exists, this author
considers these to be orthologous and refers to them collectively as HKa2. As part of this
dissertation, further evidence will be presented that the HKa2 genes are indeed orthologs.
A related cDNA (75% identity at the amino acid level) was cloned from Bufo marinus
bladder, an analog of mammalian collecting duct (Jaisser et al., 1993). While mRNA was
detected in toad bladder, none was observed in either stomach or colon. The evolutionary
distance between toad and mammal coupled with the tissue distribution dissimilarity of the
toad HKa make it difficult to evaluate the relationship between the toad and mammalian
isoforms. In addition to uncertainty in the number of H,K-ATPase isoforms in the kidney,
it has been recently been discovered that there are two alternatively spliced transcripts of
the rat HKa2 in kidney (Kone, 1996, Higham and Kone, 1998). Thus, several
H,K-ATPase a subunit isoforms have been reported in kidney, but it is at present
uncertain whether these account for all the renal H,K-ATPases. Also uncertain is their
relative contributions to renal H,K-ATPase activity.

12
Experiments have been conducted in attempts to find more members of the gene
family that includes the a subunits of Na,K-ATPases and H,K-ATPases. Shull and Lingrel
(1987) probed a human genomic library at low stringency with probes made from
Na,K-ATPase sheep cci, rat oil, rat a?, and rat a3. Five different sequences were obtained,
with two to ten clones representing each sequence. Three of these were known to be
human NaKoti, NaKa2, and HKcxi genes. The fourth was later identified as HKa2
(Modyanov et al., 1991). The fifth, which is physically linked to the NaKa2, was later
identified as NaKa3 by Shamraj and Lingrel (1994). In a similar experiment, Sverdlov et
al., (1987) screened a human genomic library with a probe made from porcine kidney
NaKoci. The probe was constructed to contain the well-conserved region surrounding the
active site aspartate residue. They obtained five distinct clones. They were recognized as
the three known NaKa subunits and the two known HKa subunits. In sum, the results of
these two experiments imply that all members of the gene family of X,K-ATPases are
known.
At present, there are no known specific HKP isoforms in addition to the one originally
discovered in gastric tissues. However, it is thought that the NaK|3i subunit isoform is the
partner to HKa2 in active H,K-ATPase pumps in colon and kidney (DuBose et al., 1998;
Kraut et al., 1998). These observations are the first suggesting that an individual P-type
ATPase P subunit has more than one primary P-type ATPase a subunit partner in vivo.
This was the determination reached by two separate groups using different antibodies to
specifically immunoprecipitate aP pairs, lending strength to their independent and identical
conclusions. However, it is possible that during tissue processing some of the a/p pairs

13
may mix partners, leading to an erroneous conclusion. Pairs that are not thought to
associate in vivo have been seen in expression systems to give rise to functional activity
(Horisberger et a/., 1991; Codina et al., 1996), showing that the in vivo P-type ATPase
pairs are not exclusive when expressed in expression systems. Expressed in their proper
cell types, there may be compartmentation that controls HKa and HKp selectivity. This
could segregate the subunits from their incorrect partners on the basis of translation of the
various H,K-ATPase and Na,K-ATPase isoforms at different times or in different
locations.
Alternative transcriptional start sites for HKP in the stomach were detected by
Newman and Shull (1991). The primer extension method used by Newman and Shull
(1991) would not have necessarily differentiated between alternative transcriptional start
sites and alternative splicing. Primer extension would only give information about the
distance from the primer to the beginning of any or all of the transcripts that contain the
primer site. So it is possible that they were detecting alternative splicing as well as
alternate transcription start sites. Thus far, however, there have been no reports of
multiple HKP subunit transcripts in any tissue seen by RNA analysis techniques such as
northern analysis or ribonuclease protection assay. In present work, I present evidence
that the transcriptional start site of HKp subunit in the medulla has slight differences
relative to stomach, and that in renal medulla there are two transcripts expressed at
comparable level, one of which appears to be the product of alternative splicing.
In summary, the first H,K-ATPase subunit detected in kidney was the non-gastric
isoform HKct2, shown by RT-PCR to be present in human kidney (Modyanov et al.,
1991). Shortly before this author joined his lab, Dr. Brian Cain found that the rabbit P

14
subunit isoform of stomach was present in kidney (Callaghan et al., 1995;
Campbell-Thompson et al., 1995). After the work described here was begun, work by
other investigators (Ahn and Kone, 1995) established that the catalytic subunit isoform
found in stomach, HKai, is also found in kidney. HKai protein was shown by immunoblot
in rabbit kidney (Callaghan et al., 1995). To further complicate the picture, an
alternatively spliced HKa2 (dubbed HKaa, with the canonical HKa2 being renamed
HKa2a) was discovered in kidney (Kone and Higham, 1998). A search for the P subunit
partner to HKa2a established that NaKp, couples to HKa2a in vivo (Dubose et al., 1998;
Kraut et al., 1998). Presumably, HKai pairs with HKP in kidney as it does in stomach
(Hall eta/., 1991; Shin and Sachs, 1994, Mathews et al.; 1995). All the known
H,K-ATPase subunit isoforms are known in kidney. HKai/HKP and HKa2/NaKPi
H,K-ATPases contribute to the activities observed in the collecting duct. Experiments
have been done to find other candidate H,K-ATPase genes, and to date none have been
detected. So far no molecular identity can be associated with the H,K-ATPase activity in
the proximal tubule and thick ascending limb.
Deficiencies of H,K-ATPase
There are two lines of evidence to indicate that H,K-ATPases are critical to
maintenance of K* homeostasis, and that disturbances in this balance are a serious health
problem. First, transgenic mice with deranged H,K-ATPase function show substantial
disturbances of K balance (Meneton el al., 1998). Second, an environmentally high level

15
of vanadium in northeast Thailand effectively inhibits H,K-ATPase function among
humans and water buffalo living in the area (Dafnis et a!., 1993).
Experiments have been carried out to show the critical nature of H,K-ATPase
expression and its relevance in the kidney (Meneton et al., 1998). Meneton showed that
transgenic mice homozygous with respect to an HKa2 subunit deletion were normal when
fed diets that had normal levels of K+ (1% K+). However, when fed K'-free diets
(<0.004% K+) these mice experienced loss in body weight, plasma K+, and muscle K+.
HKct2 is not the major mechanism of K' conservation in the kidney; the urinary K+
excretion rate in both wild-type and HKa.2-deficient mice declined 100-fold compared to
HKa2-deficient mice on normal diets. However, mean urinary K+ excretion per day was
consistently higher (typically 120% of wild-type) following a week of K+-free feeding.
This suggests that there may be a role played by renal HKa2 in K+ conservation. The role
played by HKa2 in the colon was more clear. Fecal excretion rate increased four-fold in
HKct2-deficient compared to normal mice that had been fed the same Kf-free diet,
indicating an inability to reabsorb 1C by the digestive tract. Cardiac arrhythmias were
observed in some of the HKa2-deficient mice, presumably due to low plasma K+.
Anecdotal evidence concerning H,K-ATPase activity in humans comes to us from
Thailand, where environmental vanadium levels are high. Vanadate is a transition state
inhibitor for all P-type ATPases, and its presence in drinking water and soil in northeast
Thailand was associated with an epidemic of renal distal tubular acidosis. It is interesting
that although vanadate would be expected to inhibit Na,K-ATPases and Ca-ATPases,
along with H,K-ATPase in stomach and distal colon, the predominant symptoms were

16
renal. The disease is characterized by an inability to lower urine pH to below 5.5 pH units.
Affected persons had generalized paralysis, hypokalemia, metabolic acidosis, muscle and
bone pain, and nocturia (Nilwarangkar et al., 1990). The connection between acid
secretion in the kidney and stomach had been made, and some patients tested positive for
gastric hypoacidity (Sitprija et ah, 1988). However, the exact cause of the acid secretion
defect was unknown. As recently as 1990, a genetic predisposition had not been ruled out
(Nilwarangkar et al., 1990). Patients are treated by K' and alkali supplements, and some
deaths occurred with non-compliance.
It was shown in rats that intraperitoneal injections of vanadate (5 mg/kg) led to
hypokalemic distal renal tubular acidosis and loss in muscle K/ (Dafnis et al., 1993).
Cortical collecting duct K-ATPase activity that was sensitive to Sch-28080 (200 pM)
declined 75% in vanadate-treated rats. Medullary collecting duct activity declined less than
50% by the same assay. However, it should be noted that this is a sufficiently high
Sch-28080 concentration to inhibit HKct: enzyme activity according to some investigators
(Modyanov et al., 1995; Grishin et al., 1996), but other studies have not seen sensitivity
to Sch-28080 even at that relatively high concentration (Cougnon et al., 1996; Codina et
al., 1996). Therefore, a vanadate effect on HKa; enzyme activity in this study might have
remained undetected. Na,K-ATPase activity was measured also, and showed a decline in
vanadate-treated animals as well. This assay also may or may not have detected a
contribution due to HKa: activity, which is expected to be ouabain-sensitive at
concentrations of between >10 pM (Modyanov et al., 1995) and 1996) depending on the study. The evidence suggests that vanadate could be a factor in
the endemic hypokalemic distal renal tubular acidosis in northeast Thailand. More precise

17
measurements need to be made to quantitate the effect of Sch-28080 and ouabain on
HKa2 activity.
In summary, these studies illustrate the essential nature of H,K-ATPases in the renal
collecting duct (and in distal colon) for the maintenance of Kf balance. In the extreme
case, deranged H,K-ATPase function can result in disease or even death. These studies
isolating the activity of H,K-ATPase do not address the role H,K-ATPase might play in
blood pressure regulation. The other more acute affects of impairments of H,K-ATPase
activity probably obscured the affects on blood pressure regulation. Although in some
cases a defect in a single gene leads to a dramatic loss in blood pressure control,
hypertension is most often a multifactorial disease. H,K-ATPase is likely to be one of a
combination of activities that fail to control blood pressure in the hypertensive patient.
H,K-ATPase Structure and Function
H.K-ATPase catalytic subunit
The HKa subunit contains the active sites relating to its catalytic action (Figure 1-1).
A number of functionally important sites in the HKa have been defined. The location of
the phosphorylated aspartyl residue of the catalytic intermediate is known and the region
immediatedly surrounding it is extremely well conserved within the P-type ATPase family
(Walderhaug et al., 1985). The location of a residue that binds the fluorescent molecule
FITC is also known; F1TC competes with ATP for binding to H,K-ATPase and therefore
is thought to be at or near the HKa ATP binding site (Jackson et al, 1983; Farley and
Faller, 1985). The site of the K"-competitive inhibitor Sch-28080 which acts at an

18
ATP ADP+P,
intracellular
Figure 1-1. Schematic diagram of H,K-ATPase. Dashed line indicates the
amino-terminal extension of HKa2c protein.

19
extracellular site (Munson and Sachs, 1988) is known by studies with a photoaffinity
analog to lie between the first two transmembrane domains (Munson et al., 1991). The
Na,K-ATPase inhibitor ouabain binds to the corresponding site in that enzyme, but it is
not known whether this is the binding site conferring ouabain’s less sensitive inhibition of
HKot2. The binding site of the medically important inhibitor omeprazole is also known, it
may bind to any of three extracellular cysteines located in the C-terminal quarter of the
subunit (Besancon et al., 1993). This inhibitor has achieved some popular acclaim,
television advertisements may be seen for it under its brand name Prilosec.
Using hydropathy analysis, the existence of four transmembrane helices in the
amino-terminal half of HKai is clear. The number of transmembrane domains of the
carboxyl-terminal half of HKa is not as apparent from the hydropathy plot, but may be
placed somewhere between three and five by that analysis. However, the presence of an
odd number of membrane-spanning regions would be inconsistent with the placement of
amino- and carboxy-termini in the cytoplasm by antibody reactivity (Smolka et al., 1992;
Mercier et al., 1993). Also, the localization of the active sites discussed in the preceding
paragraph, predicts a large intracellular cytosolic loop following the first four
transmembrane domains. The picture is further complicated because recent results
(Raussens et al., 1998) imply that some of the transmembrane domains may be comprised
of (3-strand secondary structure. Using limited tryptic digestion followed by fluorescent
labelling of cysteines, the four transmembrane segments of the amino-terminal half could
be confirmed (Besancon et al., 1993; Shin et al., 1993). In the carboxyl-terminal half of
the protein, only three transmembrane domains were observed. The two most
carboxyl-terminal membrane spans strongly implied by hydropathy analysis were not

20
observed by fluorescent labelling despite the presence of multiple cysteines. In vitro
translation experiments have also been preformed to elucidate H,K-ATPase topology
(Bamberg and Sachs, 1994). These experiments involve synthesis of putative
transmembrane segments in the presence and absence of microsomes, then detection of
glycosylation of the resulting polypeptides by electrophoresis. Positive glycosylation of a
fusion protein containing glycosylation sites would imply the insertion of a single
transmembrane domain. When a pair of membrane spanning domains were translated, no
glycosylation would result. Both single transmembrane domains and pairs of
transmembranes were tested. In this system, the predicted final two transmembrane
segments were inserted into the membrane. Taken together these experiments predict a
secondary structure for HKcti that has amino- and carboxy-termini located intracellularly.
There are four transmembrane domains in the amino-terminal half of the protein, and
between four and six transmembrane domains in the carboxyl-terminal half. If
H,K-ATPase membrane topology is conserved with that of Ca-ATPase, recently imaged
by cryoelectron microscopy (Zhang el a!., 1998), then HKcti subunits probably have ten
membrane spans.
The significance of H,K-ATPase enzyme quaternary structure is presently under active
consideration. Studies suggest that there are specific and stable associations between
catalytic subunits. Radiation inactivation studies showed the minimum functional unit to be
an ( in images of two-dimensional H,K-ATPase crystals suggested a tetrameric arrangement of
HKoti subunits (Hebert et al., 1992). The apparent contradiction of the radiation
inactivation and electron microscopy experiments can be explained. An a/a interaction has

21
been shown to be necessary for optimal activity of H,K-ATPase (Morii et al., 1996).
Dimeric a/a interactions were necessary for H,K-ATPase activity, and tetrameric a/a
interactions confer higher affinity binding of ATP. When coexpressed in insect cells,
NaKai, NaKa2, and NaKa3 were found to coimmunoprecipitate (Blanco et al., 1994).
Using chimeric constructions combining NaKai and HKai alternating regions, it was
found that the large intracellular loop was necessary for this association (Koster et al.,
1995). Using a yeast two-hybrid system and fusions of Gal4 to a subunit cytosolic loops
Colonna et al. (1997) further explored this interaction. In two-hybrid assays, there was no
apparent direct interaction between pairs of the large cytosolic loop (Figure 1-1). Likewise
there was no interaction observed between the smaller loop between the second and third
transmembrane domains. However, the two-hybrid assay gave a positive interaction
between the smaller and larger loops. The interaction is apparently between the loop
between transmembrane domains two and three of one member of the a/a pair and the
larger loop between transmembrane domains four and five of the other. These results
imply that interactions between H,K-ATPase molecules play a role in their function. There
may be interactions with other molecules as well, such as those governing cell polarity.
H.K-ATPase B subunit
Antibodies to the HKP subunit protein (Chow and Forte, 1993) and reduction of any
of the three disulfide bonds in the HKP subunit (Chow et al., 1992) have been observed to
affect catalytic subunit function. In addition to a role in modulating enzymatic activity, the
HKp subunit is also thought to participate in shepherding the H,K-ATPase through the

22
Golgi and to the plasma membrane (Renaud el al., 1991). The HKP subunit contains a
tyrosine-based signal required for internalization of the H,K-ATPase pump
(Courtois-Coutry et al., 1997) and thus required for proper regulation of pump activity.
The HKp subunit protein contains 7 consensus N-glycosylation sites and all are
glycosylated (Chow and Forte, 1993). Thus, the HKP subunit is required for H,K-ATPase
pumps reaching the cell surface and proper function of the enzyme. Its role in
internalization means that it is required to down-regulate gastric acid secretion.
Hydropathy analysis predicts a single membrane domain for the HKP subunit protein.
Interactions between HKa and HKp subunit proteins have been studied by limited tryptic
digestion. After digestion, detergent solubilization, and lectin binding of the HKP subunit,
an HKa subunit fragment corresponding to the putative loop between transmembrane
domains seven and eight was recovered (Shin and Sachs, 1994). The sequence of this
fragment is well-conserved, implying some important function. Yeast two-hybrid analysis
has confirmed this area of the HKa subunit protein (Arg-898 to Arg-922) as a region of
association with the HKP subunit (Melle-Milovanovic el al., 1998). The yeast two-hybrid
analysis has also shown that two extracellular domains of the HKP protein to be regions of
association with the HKa subunit. The HKP subunit amino acids involved are Gln-64
through Ash-130 (adjacent to the membrane) and Ala-156 to Arg-188.
The HKP subunit is quite important to H,K-ATPase activity due to its role in
intracellular trafficking of the holoenzyme. It apparently also affects the conformation of
the intact complex, because HKp-specific effects modify enzymatic activity. Just as there
are a/a interactions that are now known, the regions of the subunit important to a/p

23
interactions are also becoming known. These may be important in conferring the effects on
enzyme activity conferred by oligomeric structure. They may also be important in
controlling the interaction between the various a and (3 subunit proteins of the
H,K-ATPases and Na, K-ATPases.
Renal Tissue Culture Cells
A number of renal continuous cell lines exist, but for the purpose of studying
H,K-ATPase relevance to the cortical collecting duct the selection narrows considerably.
In cortical collecting duct H,K-ATPase activity is relatively high, and based on
immunohistochemical (Wingo et al., 1990) and in situ hybridization evidence
(Campbell-Thompson el a!., 1995; Ahn and Kone, 1995). H,K-ATPase is found in
intercalated cells in cortical collecting duct. There are two cell lines with characteristics of
these cell types, MDCK cells and RCCT-28A cell.
The Madin-Darby canine kidney (MDCK) cell line is an epithelial cell line that
appears to have originated from distal tubule (Herzlinger et al., 1982) or cortical
collecting tubule (Valentich, 1981), and has properties of intercalated cells (Pfaller et al.,
1989). MDCK cells are aldosterone-responsive (Simmons, 1978), and immunostaining of
H7K+ ATPase has been observed (Adam Smolka, personal communication). Oberleithner
et al. (1990) detected an aldosterone-stimulated, omeprazole-inhibited transport activity
that was blocked by increased apical extracellular [FT], or decreased apical extracellular
[K+], consistent with the presence of an apical H7K+ ATPase in MDCK cells. MDCK cells
are available for purchase from the American Type Culture Collection (ATCC, Rockville,
MD). Because of the uncertainty of their origin, and because we wanted to take full

24
advantage of the knowledge of rabbit renal physiology accumulated over the years by our
collaborator Dr. Charles Wingo, we selected the RCCT-28A cell line for use in our
experiments.
The RCCT-28A transformed cell line was derived from immunodissected rabbit CCD
by Arend et al. 1989. The RCCT-28A line was created by microdissecting cortical
collecting tubule and dispersing cells on plates coated with monoclonal antibody specific
to collecting tubule cells. The antibody coating the plates, known as IgG3(rct-30), had
been made against rabbit renal cortical cells injected into mice. The resultant monoclonal
antibody stained only collecting tubules on cryotome sections. Staining was primarily
basolateral in intercalated and principal cells. Cells from the dissected rabbit collecting
duct that had bound in the antibody-coated dish were immortalized with an adenovirus
2-SV40 hybrid, and then cloned by limited diffusion. A population of cells that continued
to proliferate while retaining epithelial morphology was obtained.
The antigenic and hormone response of these cells is specifically consistent with their
origin in the cortical collecting tubule. Immunocytochemistry showed reactivity in 100%
of cells to an antibody (mr-mct) against mitochondria-rich cells of the medullary collecting
duct (Schweibert et al., 1992). The mr-mct antibody was seen to be specific for
acid-secreting, or type A cells (Burnatowska-Hledin and Spielman, 1988).
Immunoreactivity was also observed to an antibody to band 3 protein (IVF12), another
marker for acid-secreting intercalated cells (Schweibert et a/., 1992). The presence of
carbonic anhydrase in >95% of cells was indicated by the binding of a fluorescent
acetazolamide analog (Dietl et al., 1992). As expected for an intercalated cell,
conductance of Cl', but not Na' or K+, was indicated by patch clamp measurements (Dietl

25
el al, 1992). Schweibert el al. (1992) saw no antigenicity of the cells toward two
antibodies specific for base-secreting (or type B) cells or toward four antibodies specific
for principal cells. The origin, collection, and characterization of these cells indicates that
they are a good model of the acid-secreting intercalated collecting duct cell.
The first study undertaken using these cells showed that adenosine analogs increase
intracellular calcium by stimulating phosphoinositide turnover (Arend el al., 1989).
Inositol turnover was measured by labeling cells with myo-[3H]inositol and detecting
[3H]inositol phosphate formation. A1-receptor agonists increased phosphoinositide
turnover, and the increase was blocked by an A1-receptor antagonist. Adenosine also
regulated a 305 pS chloride channel in RCCT-28A cells via protein kinase C and a G
protein (Schwiebert el al., 1992). Chloride channels in these cells have been characterized
by the patch clamp method, showing Cl conductance to be stimulated by isoproterenol
(Dietl el al., 1992; Dietl and Stanton, 1992). Cell swelling ofRCCT-28A cells activated a
Cl' conductance by altering the organization of actin filaments (Mills el al., 1994;
Schwiebert et al., 1994). Activation of the channel was mimicked by stretching the
membrane and disruption of F-actin by dihydrocytochalasins. Stabilizing F-actin with
phalloidin blocked activation of the Cl' channel Bello-Reuss (1993) reported H,K-ATPase
activity in RCCT-28A cells, observing an apical acidification mechanism that had a
component sensitive to withdrawal of K’ and two H,K- ATPase inhibitors, Sch-28080 and
omeprazole. She also detected activities suggestive of an apical H-ATPase and a
basolateral C1/HC03 exchanger. Acid secretion by these cells was diminished in cells
grown at low pCCF, evidence of regulation of the acidification mechanism by alkaline
conditions. These cells have proven useful in studying various processes normally

26
associated with acid-secreting intercalated cells. The observation of H,K-ATPase activity
in these cells made them particularly appealing for our studies.
Summary
H,K-ATPase activity in the collecting duct has very real implications for maintenance
of health and well-being. Studies have shown a myriad of derangements in the absence of
functional H,K-ATPase activity, including a real possibility of death. The H,K-ATPase
provides an excellent example of how critical some of the enzymes are that fine tune the
environment of the body. It is interesting that an enzyme that has such an immense level of
activity in one organ, the stomach, actually is more important in another, the kidney, in
which its level of activity might be called small.
Several challenges exist in studying the H,K-ATPase enzyme and its function. One of
these is the lack of knowledge of the quantitative effects of ouabain and Sch-28080 on the
HKct2 isoform of the enzyme. Another its low level of expression, making assays of
mRNA, protein, and activity difficult. There was also a dearth of knowledge about the
molecular forms of H,K-ATPase in the kidney when these studies were undertaken. This
situation has changed, and the contributions described herein have been part of that
change.

MATERIALS AND METHODS
Molecular Biology
Tissue culture
The RCCT-28A cell line was derived from immunodissected renal cortical collecting
duct (Arend et cil., 1989). These cells were the kind gift of Dr. William Spielman, and
experiments were performed using cells between passages 11 and 31. Cells were grown in
DMEM media supplemented to 10% with FBS and to 1% with Penicillin-Streptomycin.
All media was bubbled overnight with a mixture of 5% C02, 21% 02, 74% N2, then filter
sterilized by use of a 0.20 jam cellulose acetate syringe-mounted filter (Corning, Corning,
NY). Cells were maintained in culture in tissue culture flasks at 37°C in a 5% C02
atmosphere. Media was changed on alternate days, and cells were split 4:1 at confluency.
For experiments, cells were passaged to Corning Costar Transwell Collagen-coated
semipermeable inserts. Cells were plated to a density of 2xl07cnr on the inserts, grown
for 2 days in media containing 10% FBS, and then shifted to 0.1% FBS for a period of 24
hr prior to the experiment.
27

28
Isolation of total RNA
Total RNA was isolated from cells or tissues employing the method described by
Chomczynski and Sacchi (1987). After aspiration of media, tissue culture cells were rinsed
in ice cold sterile PBS (10 mM sodium phosphate, pH 7.4, 150 mM NaCl). Next, 0.5 mL
of GTC solution (4 M guanidine thiocyanate, 25 mM sodium citrate, 0.5%
n-lauroylsarcosine, 100 mM P-mercaptoethanol) was added to promote cell lysis. The
resulting viscous fluid was scraped from the insert and emptied into polypropylene
centrifuge tubes on ice. New Zealand White Rabbits were sacrificed by decapitation and
the kidneys removed immediately. Kidneys were dissected under a microscope, slicing
coronally to separate cortex and medulla. Distal colon was prepared by clipping the distal
25 mm of colon, cutting longitudinally, then rinsing away contents by a thorough spray of
ice cold PBS. Gastric mucosa was collected by slicing the stomach transversely, rinsing in
ice cold PBS, then scraping the rugae with a Scoopula (Fisher, Pittsburgh, PA). Tissues
were dounce homogenized in 4 mL GTC solution until the suspension appeared to be
homogneous. The resulting viscous fluid was poured into polypropylene centrifuge tubes
on ice.
While being held on ice, I volume phenol was added to the homogenized tissue, then
1/10 volume 2 M sodium acetate (pH 4.0), and 0.22 volume chloroform-isoamyl mixture
(24:1). After each addition, the samples were briefly vortexed The samples were
subjected to centrifugation at 1000G X 25 min at 4 C. The upper phase was retained, and
RNA was precipitated twice in isopropanol and twice in ethanol, then resuspended in 100
pL DEPC-treated water. Storage of the RNA was at -20°C. RNA concentration was

29
determined by OD26o reading on a spectrophotometer. For absorbance of 1.0 at 260 nm,
the concentration was taken to be 40 p.g/ml.
Northern analysis
Northern blots were done following the procedures of Sambrook el a!. (1989).
Samples of total RNA (20 pg per lane) or mRNA (2 pg per lane) underwent
electrophoresis in a 1% agarose, 0.22 M formaldehyde denaturing gel. Capillary transfer
to a nylon membrane (Hybond N, Amersham Corp., Arlington Heights, IL) was conducted
overnight in 20X SSC (3M NaCl, 300 mM Na citrate). Absorbent paper towels were
changed twice during transfer. RNA is immobilized on the membrane by baking 2 h at
80°C in a vacuum oven. 3:P-labelled probes were prepared by random primer extension of
75-150 ng DNA according to the protocol of the Megaprime Kit (Amersham).
Membranes were prehybridized a minimum of 15 min and hybridized with labelled probe
for 24 h in hybridization solution at 65°C. When heterologous probes were employed, such
as cross-species probing, temperatures as low as 42°C were used to reduce stringency.
Washing was done first at room temperature for 20 min in IX SSC, 0.1% SDS, then 3
times at hybridization temperature for 20 min in 0.2X SSC, 0.1% SDS. After washing,
membranes were exposed to Kodak BioMax MS film at -80°C with Kodak BioMax
intensifying screens. Exposures between three and six days were often required to detect
H,K-ATPase subunit mRNA. An mRNA probe for glyceraldehyde-3-phosphate
dehydrogenase, a glycolytic enzyme, was used as a control to ensure even loading
amounts of RNA between lanes. An exposure of eight hr was typically sufficient to
visualize this control.

30
RT-PCR using degenerate primers
RT- PCR was carried out as described by Davis el al., 1994. The cDNA template for
the PCR reaction was produced by incubating 1 pg total RNA from microdissected rabbit
renal cortex and 0.1 pg random hexamers in a volume of 11 pL at 70°C X 2 min. The
reaction mixture was quenched by placing the tube on ice. The reverse transcription
reactions were carried out at 37°C X 1 hr in a volume of 25 pL. The mixture contained
RNA-random hexamers mix in the final concentrations indicated: First Strand Buffer (50
mM Tris-HCl (pH 8.3), 75 mM KC1, 3 mM MgCh), dithiothreitol (lOmM), dNTPs
(2mM), RNAsin (30 U, Promega, Madison, Wl), and Superscript II (200 U, Gibco BRL,
Gaithersburg, MD). PCR reactions were primed with pairs of oligonucleotides shown in
Table 2-1 synthesized by the University of Florida Interdisciplinary Center for
Biotechnology Research (UF 1CBR) DNA Synthesis Core. PCR reactions were
performed in a volume of 100 pL at the final concentrations indicated: dNTPs (0.22 mM),
PCR Buffer (20 mM Tris-HCl, pH 8.4, 50 mM KC1), MgCh (50 mM), primers (1 pg
each), and Taq DNA Polymerase (5 U). The reactions were overlaid with 50 pL mineral
oil. Thermal parameters of the reactions included a 5 min X 94°C presoak followed by
94 C X 40 sec denaturation, 55°C X 1 min anneal, and 72°C X 2 min extension for a total
of 30 cycles followed by a final extension of 5 min. Reactions were held at 4°C overnight
before PCR product cloning into the pCR 11 vector and transformed into OneShot E. coli
cells utilizing the TA Cloning Kit (lnvitrogen, San Diego, CA). E. cali cells containing the
plasmid of interest were grown overnight in a 5 mL culture and plasmids isolated using the

31
QiaPrep Spin Mini Kit (Qiagen, Santa Clarita, CA). Sequencing of plasmids was carried
out by the UF ICBR DNA Sequencing Core.
RT-PCR using standard primers
A reverse transcription reaction was carried out as in the RT-PCR method described
above for degenerate primers. PCR reactions were primed by pairs of oligonucleotides
synthesized by the UF ICBR DNA DNA Synthesis Core and summarized in Table 2-1.
Reactions were carried out using 1 pg total RNA in a 50 pL volume in KlenTaq PCR
Reaction Buffer (40 mM Tricine-KOH, pH 9.2, 15 mM KOAc, 3.5 mM Mg(OAc):, and
75 pg/mL Bovine Serum Albumin), primers as listed above (0.5 pM), and dNTPs (0.8
mM), and Advantage KlenTaq Polymerase Mix (Clontech, Palo Alto, CA). Thermal
parameters of the reactions included a 2 min X 94°C presoak followed by 94°C X 30 sec
denaturation and 68°C X 1 min extension with a final extension of 5 min. The numbers of
cycles were specific to each experiment and are indicated in the 1 legends. PCR reactions
were purified for sequencing by phenol/chloroform (1:1) extraction and two 3000 G X 5
min centrifugation steps in Ultrafree-MC 30000 NMWL regenerated cellulose columns
(Millipore, Bedford, MA). Due to low yield of the HKal PCR reaction, a 45 cycle
reaction was carried out to generate product for sequencing. Sequencing of PCR products
was carried out by the UF ICBR DNA Sequencing Core.
Genomic PCR
To amplify genomic DNA for sequencing, template used was 1 pg Clontech Rabbit
Genomic DNA. Clontech Klenl aq Advantage PCR Mix was used with components and

Table 2-1. PCR primer pairs
Isoform Nucleotides Sense Primer Serial # Antisense Primer Serial #
HKa,
2537-3147
CTGCACCGACATTTTCCCGTCCG
BC204
TGCCTGGGCAACAGCGAACCCA
BC203
HKa2a
7-93
TGCCCGCCGACCCGCGGCGCCTCCA
BC381
TATCTGTAGCTGCATGGTGCTCCAC
BC334
HKa2a
56-337
AGARATTTAYTCYGTRGARCTC
BC328
TTGATGATCTCTGGGGTCTG
BC 265
HKa:a
285-1033
MGGGAYGGNCCT AAYRCNCT
BC198
AAGATGATGGCGTCCAGGAC
BC250
HKa2a
974-1569
CATCATTTTCTTCATCAYCGC
BC243
GCTTGTCATTGGGATCTTCC
BC231
HKa2a
1182-1600
ATCTGCTCNGACAARACNGG
BC199
TCNGGGGCNCCYTTCATCAC
BC200
HKa2a
1264-1569
CCGACACGAGTGAAGACAAT
BC230
GCTTGTCATTGGGATCTTCC
BC231
HKa2a
1550-3121
GGAAGATCCCAATGACAAGC
BC257
TCCCACCAGCTNCCWGGGYA
BC197
HKa2c
24-377
CGGAGAAAAGTGCTAGACTGGAGCT
BC366
AGAGTGCAATACCGGCCCCAGGTGG
BC344
HKP
304-873
T AAGGCCAGACGTGTATGGG
BC92
TGTCGAAGGTCACGTGATCG
BC91
Note: Notation is that of the International Union of Biochemistry Nomenclature Committee: N^any base, R=A or G, M=A or C, W=A
or T, and Y=C or T.

33
concentrations specified in the description of RT-PCR above. Primers were
ACCCGCGGCGCCTCCAGCGCGACAT (nucleotides 16-40, BC386) located in the
first exon of HKoc2a and TATCTGTAGCTGCATGGTGCTCCAC (nucleotides 69-93,
BC334) located in the second exon of HKa:a. Thermal parameters of the reactions
included a 1.5 min X 94°C presoak followed by 5 cycles of94°C X 15 sec denaturation
and 72°C X 2 min extension, 5 cycles of 94°C X 15 sec denaturation and 70°C X 2 min
extension, and 25 cycles of94°C X 15 sec denaturation and 68°C X 2 min extension with a
final extension of 8 min. Reactions were held at 15°C overnight before ligation of the
products into the pCR 2.1 vector. The ligation mixture was transformed into OneShot E.
coli cells utilizing the TOPO-TA Cloning Kit (Invitrogen, San Diego, CA). E. coli cells
containing the plasmid of interest were grown overnight in a 5 mL culture and plasmids
isolated using the QiaPrep Spin Mini Kit. Sequencing of plasmids was carried out by the
UF ICBR DNA Sequencing Core.
3' RACE
A 3' RACE reaction was carried out as described by Davis el a/., 1994. mRNA was
prepared from rabbit renal cortex total RNA using the PolyATtract (Promega, Madison,
WI) system. A reverse transcription reaction was carried out as in the RT-PCR method
described above, using 1 pg mRNA as template and 0.1 pg primer
(GACTCGAGTCGACATCGA[T]i7, BC229). The complementary strand was next
synthesized using 5 pL of RT reaction along with 0.1 pg of sense primer
(TGCGGAAACTCT TCATCAGG, nucleotides 3088-3107, BC262) in a reaction volume
of 98 pL that contained the following components: PCR Buffer (20 mM Tris-HCl, pH

34
8.4, 50 mM KCI), MgCF (50 mM), dNTPs (0.22 mM), overlaid with 50 pL mineral oil.
After a 95°C incubation for 5 min, the temperature was lowered to 70°C and 5 U Taq
DNA Polymerase was added. A 2 min annealing phase followed at 55°C, then the
complementary strand was extended at 72°C for 10 min. Antisense primer (0.1 pg,
GACTCGAGTCGACATCG, BC230) was added, and a PCR reaction was initiated with a
94°C X 40 sec denaturation, followed by a 55°C X 1 min anneal, and a 72°C X 2 min
extension for a total of 40 cycles. Final extension was for a duration of 5 min. Reactions
were held at 4°C overnight before cloning PCR products into the pCR II vector utilizing
the TA Cloning Kit (Invitrogen, San Diego, CA) per manufacturer instructions. The
library of clones produced in this manner was screened using an oligo
(CTCTACCCTGGCAGCTGGTG, nucleotides 3108-3127, BC261) 5’ labeled using the
ECL kit (Amersham, Arlington Heights, IL). Sequencing was carried out by the UF ICBR
DNA sequencing core.
5' RACE
A 5' RACE reaction was performed using the Marathon cDNA Amplification Kit
(Clontech, Palo Alto, CA) following manufacturer’s instructions with the following
modifications. RT reactions were carried out using 5.5 pg total RNA of rabbit renal
cortex, incubated with the gene-specific primer TTGCCATCTCGCCCCTCCTT
(nucleotides 121-102, BC331) for 30 min at 50°C, then at 55°C for 15 min. PCR reactions
were carried out using the anchor primer (CCATCCTAATACGACTCACTATAGGGC,
API) included in the Marathon kit paired with gene-specific primer
TATCTGTAGCTGCATGGTGCTCCAC (nucleotides 93-69, BC334). Concentrations

35
and components of the reactions were detailed above for use of Clontech KlenTaq
Advantage Polymerase Mix. Thermal parameters of the reactions included a 1 min X 94°C
presoak followed by 5 cycles of 94°C X 15 sec denaturation and 72 C X 1 min extension,
5 cycles of 94°C X 15 sec denaturation and 70°C X 1 min extension, and 25 cycles of 94°C
X 15 sec denaturation and 68°C X 1 min extension with a final extension of 8 min.
Evaluation of PCR products
PCR products were analyzed by agarose gel electrophoresis. 20 pL of reactions were
run along with 1 mL DNA loading dye (50% glycerol, 1% xylene cyanol, 1%
bromophenol blue) on a 1.2% agarose gel in TAE buffer (Tris mM, acetic acid mM,
EDTA mM). Low DNA Mass Ladder (Gibco BRL) was electrophoresed alongside PCR
products to quantitate DNA concentration, and 100 bp ladder (Gibco BRL) to evaluate
the size of the products.
In some cases, products were not visible after ethidium bromide staining, so Southern
blotting was used to visualize the products. Procedures followed were as described by
Davis et ai, (1994). After running products on gels as described above, gels were soaked
30 min in denaturation solution (1.5 M NaCl, .5 M NaOH), and 30 min in neutralization
buffer (1 M ammonium acetate, .02 M NaOH). Capillary transfer in neutralization solution
and baking 80 X 1 hr was utilized to adhere DNA to nylon membrane (Hybond N).
Probes to hybridize specifically to the expected products (Table 2-1) were created using
RT-PCR with rabbit renal cortex as template, cloning the inserts using the TA Cloning Kit
as described above. Inserts were sequenced to confirm their identity. Probes were labelled
using the ECL Direct System(Amersham) following manufacturers instructions. Exposure

36
to Hyperfilm ECL (Amersham) for a period of two hr was required to visualize the results
of PCR reactions.
Biochemistry
Preparation of membrane protein from tissue culture cells
Two clusters of six wells each were used for each experimental condition; this
typically yielded 50 pg of protein. All solutions and glass douncers are cooled on ice, and
centrifuges are either refrigerated or located in cold rooms. Cells are held on ice at all
times. Cells were rinsed in PBS containing 0.5 mM PMSF, 1.5 mL in top well of
Transwell, 2.5 mL in bottom well. Following aspiration of the rinse solution, to each
single well was added 0.5 mL PBS, 0.5 mM PMSF, 1 mM EDTA. A cell scraper was used
to dislodge cells from the insert. This solution containing cells was pipetted from one well
to the next dislodging and gathering all the cells from one cluster. This was repeated with
a fresh 0.5 mL solution on the same cluster to remove any remaining cells. The two passes
combined for a total of 1 mL, and the other clusters were processed in the same manner.
Cells were spun in a centrifuge for 5 min at 500 X g to remove cellular debris.
Supernatant was discarded, and the pellet was resuspended in swelling buffer (tris 10 mM
pH 7.8, 1 mM EDTA, 1 mM PMSF, 2 pM aprotinin, 2 pM leupeptin, 2 pM pepstatin) for
15 min. Cells were homogenized by 50 strokes in a glass douncer. After moving cells back
to a microfuge tube, 0.11 mL of 10X salts (300 mM NaCl, 20 mM MgCl2, 10 mM Tris
pH 7.8) was added before vortexing. Mixture was spun in a centrifuge for 1 minute at
1000 X g to remove nuclei. Supernatant was retained and spun in a centrifuge for 5 min at

37
1500 X g. Supernatant was retained and spun in a centrifuge for 30 min at 23000 X g.
Cells were resuspended in 20 pL resuspension buffer (1 volume swelling buffer, 1/10
volume 10X salts) and stored at -20°C.
Preparation of membrane protein from rabbit tissues
Kidney, distal colon, and stomach tissues were obtained in the same manner as for
RNA isolation. Care was taken to maintain solutions and apparatus ice cold. Two rabbit
distal colons were required per preparation to yield useful concentrations of protein.
Tissues were homogenized for 15 seconds at 12500 rpm (setting 8 on Omni-Sorvall tissue
homogenizer) in Buffer A (50 mM sucrose, 10 mM Tris pH 7.4, 1 mM EDTA, . 1 mM
PMSF). After allowing 15 seconds for settling, homogenization was repeated. Three
volumes buffer B (250 mM sucrose, 10 mM Tris pH 7.4, 1 mM EDTA, . 1 mM PMSF)
were added, then homgenate spun in a centrifuge for 10 min at 1000 X g. The supernatant
was subjected to centrifugation for 20 min at 10000 X g three times. Final centrifugation
was for 1 hr at 100000 X g. After discarding supernatant, pellet was resuspended in 500
pL loading solution (1 mM Tris, 10 mM MgCF, 150 mM NaCl). After transferring
resuspended pellet to glass douncer, dounce is dropped into the douncer, turned three
times, then raised and dropped again. This was done ten times. The resultant preparation
was stored at -20°C.
Antibodies
Peptides used as immunogens were designed for maximum antigenicity and minimum
homology to other proteins. Avoiding homology to other P-type ATPases was particularly

38
important. Rabbit H,K-ATPase catalytic subunit sequences were scanned using the
computer program PEPT1DESTRUCTURE (Genetics Computer Group, 1997) to find
regions relatively high in charged, hydrophilic residues (Jameson and Wolf, 1988). Such
regions were then searched by BLAST (Altschul el al., 1990) to eliminate those that could
be predicted to cross-react with other proteins. Once these constraints were met the
candidate sequences were examined using the program MOTIFS (Genetics Computer
Group, 1997; Bairoch and Apweiler, 1996) to ensure that there were no potential sites for
protein modification that might affect reactivity. In the case of HKoti and HKot2a, there
was only one region that satisfactorily met all of these criteria. In the case of HKot2c, there
were two, one being the region in common with HKot2a, the other in the extended amino
terminal region of HKa2c not contained in HKa2a.
Peptides were synthesized with an N-terminal cysteine and conjugated to keyhole
limpet hemocyanin (UF ICBR Protein Core) using the Pierce (Rockford, IL) Imject
system. Three peptides were used as immunogens, the first was designed to react with a
portion of HKoti, the second was designed to recognize a portion of HKa2 found in both
HKa2a and HKot2c, the third to a portion unique to HKa2c. The peptide chosen for HKoti
corresponded to amino acids 569-582 (CLYLSEKDYPPGYAF). The peptide chosen
within the common region contained amino acids 18-37 in HKa2a and 79-88 in HKa2c
(CDIKKKEGRDGKKDNDLELKR). The peptide chosen within the HKa2c-specific
region corresponded to amino acids 13-25 (CGEERKEGGGRWRA). Antipeptide
antibodies were raised in chickens by Lofstrand Laboratories (Bethesda, MD). Chickens
received boost innoculations at 21 day intervals, and were exsanguinated at day 73 to

39
produce antisera. Preimmune sera was collected prior to initial innoculation. Yolks of eggs
collected over the two week period prior to final bleed were pooled, and immunoglubulins
purified from yolk material by the Promega EGGstract method. Concentration of the
EGGstracted yolks was determined by the modified Lowry procedure of Markwell et al.
(1978) and the concentrations adjusted to 2 mg/mL by addition of lgY buffer solution
(Promega). Purity and concentration of the IgY obtained was confirmed by non-reducing
SDS-PAGE and staining with Coomassie blue.
Western analysis
Protein concentrations in tissue and cell samples were determined by modified Lowry
(Markwell et al., 1978). Proteins (10 pg/lane) were separated on 4-20% reducing
SDS-polyacrylamide gels (BioRad, Hercules, CA ), 10 pg per lane. Vesicle preparations
were suspended in buffer (62.5 mM Tris-HCl pH 6.8, 10% glycerol, 5%
P-mercaptoethanol, 3% SDS) and incubated 2 min X 90°C prior to electrophoresis. Gels
were rinsed 10 min in TBS (10 mM Tris- HC1 pH 7.2, 150 mM NaCl), and 10 min in
transfer buffer (20 mM Tris-HCL, 150 mM glycine, 20% methanol, pH 8.3). Proteins
were electrotransferred at 104 V, .25 A, 4°C to Hybond ECL nitrocellulose membranes
(Amersham) in transfer buffer. Blocking of membranes was done in TBS-T (TBS, 0.1%
TWEEN-20) containing sodium azide and 5% non-fat dry milk at 4°C overnight or room
temperature for 1 hr. Antibody incubations were one hour each, carried out in TBS-T
containing 5% non-fat dry milk. Following blocking and following primary and secondary
antibody incubations, immunoblots were rinsed in TBS-T with continuous agitation. This
was done three times for one minute each, then twice for 5 min each. Primary antibodies

40
purified from egg yolk were used at a dilution of 1:200, the anti-chicken IgY-horseradish
peroxidase conjugated secondary antibody (Promega) was diluted to 1:10000. When
antisera or preimmune sera were used as primary antibodies, dilution was 1:2000. A final
wash was carried out in TBS for 10 min, and then antibody reactivity was detected using
chemiluminescence (Pierce). Apparent molecular masses were established using the High
Mass Range Molecular Weight Markers (BioRad).
Fluorescence Microscopy
Measurement of pH,
The fluorescent, pH-sensitive dye BCECF-AM was used to directly measure pH, in
RCCT-28A tissue culture cells. BCECF-AM was stored as a stock at -20°C in a 30 mM
solution in DMSO. Cells were incubated at room temperature for a period of 30 min in
solution 1 (Table 2-2) with BCECF-AM at a final concentration of 5 //M. A minimum of
5 min perfusion with solution l delivered at 37°C was allowed to rinse BCECF away at
the beginning of each experiment.
Cells were imaged by epifluorescence at 530 nm emission on an inverted microscope
(Boyarsky et al., 1988, Weiner and Hamm, 1989) using excitation wavelengths of 440 nm
and 490 nm. These wavelengths correspond to the isosbestic point and to a highly
pH-sensitive wavelength of BCECF, respectively. The ratio of emission intensities at the
two wavelengths is directly proportional to pH over the pH range being studied, and is
constant with respect to such variables as cell-to-cell variations in dye uptake and leakage.
A field containing approximately 50 cells could be visualized using a Nikon X40, 0.55

41
Table 2-2. Solutions for determination of pH,
Solutions
1
2
3
4
5
6
7
NaCl
119.2
102.2
122.2
99.2
Choline Cl
102.2
122.2
119.2
Ammonia Cl
20
20
20
KC1
O
J
3
3
KH:P04
2
2
2
Phosphoric acid
2
2
2
2
Na-acetate
1
1
1
1
Acetic acid
1
1
1
CaCl2
1.2
1.2
1.2
1.2
1.2
1.2
1.2
MgS04
1
1
1
1
1
1
1
Alanine
5
5
5
5
5
5
5
Glucose
8.3
8.3
8.3
8.3
8.3
8.3
8.3
HEPES
25
25
25
25
25
25
25
Note: Concentration units are in mM. Osmolality was adjusted to 290±5 mosmol/kg H20
by addition of the principal salt. pH was adjusted to 7.40±.05 by addition of
tetramethylammonium-OH Solutions were bubbled with 100% 02.

42
LWD lens on a Nikon Diapliot-TMD inverted microscope. Excitation light was provided
by a 100 W mercury lamp. The light was split into two beams by a 470 nm low-pass
dichroic mirror. The two split light beams then passed through filters to yield beams of the
desired wavelengths. The transmitted light path contained a 440 nm filter; the reflected
light path contained a 490 nm filter. Computer-actuated shutters on each light path
alternated the incident light wavelengths and minimized the time the cells were subjected
to the high intensity light. The two light beams were recombined by a second 470 nm
low-pass dichroic mirror. Light was directed to the microscope stage by a 510 nm
high-pass mirror, and the emitted light was directed to a Videoscope KS-1381 image
intensifier coupled to a Dage 72 CCD camera. Because the optics necessary to image cells
grown on inserts required relatively intense incident light, measurement frequency was
limited to avoid phototoxicity. Therefore, measurements were made at 30 second
intervals, linages were digitized and stored by computer allowing subsequent analysis of
single cells using the Image 1/FL software package (Universal Imaging Corp.,
Westchester, PA).
During measurements, cells were constantly perfused at a rate of ~10 mL/min by
HEPES-buffered solutions that were continuously bubbled by 100% O: and heated to be
delivered at a temperature of 37 C. Switches for the various solutions were located
physically near the input to the cell chamber to minimize the time required to switch
solutions, and fluid was continuously removed from the opposite side of the chamber by
vacuum suction. For some experiments, the apical side of the cells was perfused by
different solutions than the basolateral side of the cells by utilizing separate input tubes in
the upper and lower chambers of the Transwell inserts.

43
Cells were acid-loaded using the NH_|C1 prepulse technique. Briefly, cells were
incubated with 20 inM NHXl (equimolar substitution for NaCl) for 5 min, then
ammonium chloride was removed from the perfusing solution. Addition of inhibitors or
K+ removal began at the start of the ammonium pre-pulse. The ethylisoproplamiloride
(EIPA) stock solution was 1 mM in dimethyl sulfoxide (DMSO), and Sch-28080 was 10
mM in DMSO. EIPA was obtained from Research Biochemicals, International (Natick,
MA) and Sch-28080 was the kind gift of Dr. James Kaminski at Schering Corporation
(Bloomfield, NJ). Inhibitors were stored as stock solutions at -20°C and diluted into the
solutions indicated immediately preceding their use.
Calibration of the pH, measured by BCECF fluorescence was carried out by the
nigericin calibration technique of Thomas el at. (1979). Calibration solutions (120 mM
KC1, 1.2 mM CaCh, 1 mM MgCh, 25 mM HEPES, 14 pM nigericin) were adjusted to
6.6, 6.8, 7.0, 7.2, and 7.4 pH units using 1 M NaOH and HC1. Cells were incubated with
each solution for a minimum of three min, and three fluorescence ratio measurements were
taken at each pH.
Statistical methods
pH¡ recovery rates for individual cells were calculated using least-squares linear
regression. Rates were calculated for the period beginning two min after NH4CI
withdrawal, allowing time for cells to equilibrate after acidification, and ending with Na+
addition or EIPA withdrawal. Data were collected for independent experiments involving
separate passages of cells. pH, recovery rates for each experimental condition were
presented as the mean of the rates determined for the individual experiments ± SE. Cells

44
without Na7H+ exchanger activity, defined as an increase in pH, recovery with EIPA
removal, were classified as non-viable and excluded from further analysis. P<0.05 by
Student’s /-test was taken as significant.

H,K-ATPASE p subunits in the rabbit renal medullary collecting
DUCT
Introduction
There are multiple H,K-ATPase subunit isoforms that are involved in coupled H' for
K+ active exchange in the kidney. These now include the NaKPi subunit that is the newly
recognized partner for the HKa2a subunit, in addition to its long-known role as partner to
NaKoti. In addition to the complexity involved in having multiple H,K-ATPase isoforms
present, there is the possibility of variant transcripts of each H,K-ATPase subunit.
Differences in polyadenylation sites, transcription start sites, and alternative splicing in a
tissue-specific manner might further complicate the picture.
When rat HK.p subunit was originally sequenced, multiple transcriptional start sites
were observed by primer extension experiments (Newman and Shull, 1991). It was not
known what role these various transcriptional start sites play. When the Cain, Wingo and
Nick laboratories did preliminary studies concerning the regulation by K.4 status of the
HKP subunit in rabbits, it was noted that on some northern blots of renal tissues HKP
subunit mRNA appeared as a doublet. This was evidence for a second H,K-ATPase
subunit transcript present at a level comparable to the primary transcript.
Here we show that there is a variant HKp subunit mRNA that is expressed in renal
medulla, and not in renal cortex or stomach. We have designated the variant mRNA
45

46
HKP’. The HKP’ transcript is found in medulla at a level comparable to the quantity of
the HKP subunit, and the translation start site is unchanged, so both HKP and HKP’
encode the same protein. HKP’ may be the product of alternative splicing.
Renal Medulla HKB mRNA Variant
In order to investigate the doublet band in northerns probed with Hkp cDNA probes,
RNA was prepared from stomach, renal cortex, and stomach In northern analyses (Figure
3-1) involving twenty different rabbits in experiments spaced over several years, only
single transcripts were observed in either gastric or renal cortical tissues. Gastric and renal
cortical transcripts appeared to be of identical size. However, in renal medullary tissues, a
doublet was universally visible. Northern analysis showed that the smaller of the two
medullary HKP transcripts was the same size as in the other two tissues, and the second
renal medullary transcript was larger. The quantity of the second mRNA, HKP’, was
generally comparable to the quantity of HKP mRNA.
In order to determine the molecular nature of the different transcripts of the medulla, 3’
and 5’ RACE experiments were conducted using mRNA isolated from rabbit renal
medulla. The rabbit RNA was selected from those that showed prominent HKP subunit
s'
upper bands by northern analysis because these would have a higher abundance of the
novel transcript. Representative PCR products generated by the 3’ and 5’ RACE
experiment are shown in Figure 3-2. PCR of ten 3’ RACE products sequenced, all were
the same, and all extended to within 5 bp of the published HKP cDNA sequence (Reuben
et al., 1990). Ten 5’ RACE products were also sequenced. Nine of these were similar to

GAP3DH
1.3 kbp
•-t
o>
3
CO
o
o
3
O)
X
Figure 3-1. Northern analysis showing presence of HKP mRNA in renal cortex, renal
medulla, and stomach. The existence of two mRNA species was clearly visible in renal
medulla, whereas a single mRNA species was detected in stomach and renal cortex.
GAP3DH was used to show the condition of the RNA samples.

48
Figure 3-2. 3' and 5' RACE reactions to amplify HKp cDNAs using rabbit renal
medulla RNA as template.

49
the published HK(3 cDNAsequence. However, all ended approximately 20 bp from the 5’
end of the published sequence making it impossible to confirm the extreme 5’ end of the
sequence.
One of the sequences had a very different 5’ end than the others. In that sequence
(Figure 3-3A), the first 11 bp of the published HKP sequence was not found, and in its
place there was a different 118 bp region (Figure 3-3B). The sequence was confirmed by
5’ RACE using a primer specific to the variant extension
(CCCTGCACCCCGACTGAGG, nucleotides 104-121, BC388).
To examine the possibility that this renal medulla-specific transcript might be regulated
by K+ status in rabbits, northern analysis was carried out using total RNA from animals fed
a low K+ diet. Renal medulla total RNAs from four rabbits fed a Harlan (Indianapolis, IN)
control diet and four rabbits fed a Harlan K -restricted diet for two weeks were probed to
visualize HKp subunits using a probe made from 570 bp of coding region (Table 2-1).
Neither of the two HKP transcripts of renal medulla had systematic variation in HK(3
mRNA level due to K7 restriction in these animals. Northern analysis of renal cortex and
stomach RNA from these same rabbits showed uniform level of HKp mRNA between
rabbits. No regulation of HKP was observed, although in renal medulla there was a great
deal of individual variation between rabbits.
Discussion
A rabbit renal medulla-specific HKP variant mRNA was cloned by 5’ RACE and
sequenced. It was not known why only one out of the ten sequences proved to be a

A)
50
1 GGAGCTGATGGCTGCTGCTGATAGCACCGCCTCGAGCCAGCCCTGCAGGCGTCGCCCGCGATGCCTTTGACCGTGGCCGG 8 0
+ + + ^-+ + + + +
81 GGGAGGCTATAAGACCCAGGGGGCCTCCGGCCTCAGTCGGGGTGCAGGGTGGGGGAGCGGCGGCTTCCACAGCAGACACC 160
+ + + + + + + +
161 ATGGCCGCCTTGCAGGAGAAGAAGTCGTGCAGCCAGCGCATGGAGGAGTTCCGCCACTACTGCTGGAACCCGGACACGGG 24 0
+ + + + + + + +
1MAALQEKKSCSQRMEEFRHYCWNPDTG 27
241 ...
28 ... Remainder of sequence omitted for clarity
mRNAs
Figure 3-3. HKp and P' subunits. A) The 5' end of the HKP’ cDNA and its deduced
amino acid sequence. Numbering begins at the start of the HKP' transcript. HKP'
nucleotide 119 corresponds to nucleotide 12 of published gastric HKP sequence
(Reuben, et al., 1990), and the point of divergence is marked by Y. B) Comparison of
HKP and HKP' mRNAs. There is no difference in the deduced amino acid sequence.

51
variant, since both transcripts are observed by northern analysis at comparable levels.
f
Perhaps the extra length or RNA secondary structure reduced amplification efficiency.
Because the variant 5’ end differed in sequence from the 5’ end reported for rabbit
(Reuben et al., 1990), the variant is presumed to arise from alternative splicing. This was
not pursued because our focus was on the H,K-ATPase a isoforms. HKP mRNA and
HKP’ mRNA produced identical HKP subunit proteins. The splice sites of the related rat
and mouse HKP genes (Newman and Shull, 1991; Canfield and Levenson, 1991) are not
conserved, and working out this issue might have been a considerable target for our
primary emphasis.
The deduced amino acid sequence is unchanged by the variant 5’ end. Differential
regulation by alternate promoters may be the functional reason for the two transcripts. K+
restriction was studied as a possible stimulus for regulating the promoters, but K+status
alone did not correlate with differential regulation of the two transcripts. Other stimuli,
such as aldosterone levels, may regulate these transcripts in renal medulla. It is interesting
to note that although HKP subunit is expressed at extremely high levels in gastric tissues,
this variant transcript was not observed in stomach. The tissue-specificity of the variant is
striking. Study of its promoter region may be fruitful in terms of finding the cis acting
factors that turn the gene on specifically in renal medulla.

H,K-ATPASE a SUBUNITS IN THE RABBIT RENAL CORTICAL COLLECTING
DUCT
Introduction
H,K-ATPase has been shown to play a role in acid/base and K+ transport in kidney
collecting duct (for review, see Wingo and Cain, 1993; Wingo and Smolka, 1995).
However, many questions remained to be addressed, such as finding which H,K-ATPase
isoforms are present in kidney, and determining their distribution along the nephron and
collecting duct. This included defining the cell type specificity of each isoform. For many
years, the rabbit has been the archetypal experimental animal for use in experiments
involving microperfusion of renal tubules. To take advantage of the extensive knowledge
of rabbit renal physiology in exploring H,K-ATPase function at the molecular level,
primary structure information was needed for H,K-ATPase subunits in that species.
Because of the discovery of H,K-ATPase catalytic subunit isoforms in addition to the
gastric isoform in several species, the relationship between these isoforms needed to be
examined. Perhaps most importantly, the role that the multiplicity of H,K-ATPase subunit
isoforms plays in kidney function should be examined.
At the time the experiments described here were undertaken, little was known of the
identity of H,K-ATPase subunits in the kidney. mRNAs encoding catalytic subunit
isoforms cloned from human axillary skin (Modyanov et al., 1991) and rat distal colon
(Crowson and Shull, 1992) were the first to be detected in kidney. In collaborations
52

53
including the Cain and Wingo laboratories, HK3 (Callaghan et al., 1995,
Campbell-Thompson el al., 1995) was observed in rabbit kidney. The key experiment
identifying HKP in the kidney dated from 1992, prior to the arrival of this author, so that
information was available in designing this dissertation project. As this work progressed, it
was found that the HKoti subunit isoforms are present in renal tissues (Ahn and Kone,
1995). In addition, an alternatively spliced isoform of rat HKa2 was recently reported in
kidney (Kone and Higham, 1998). The rat HKa2 alternatively spliced variant was
designated HKa2b, with the original renamed HKa2a. The previous experiments were not
designed to discriminate between HKa2a and HKa2b.
In these studies a full-length cDNA sequence was determined for the HKa2 subunit in
rabbit. An alternatively spliced variant of this HKa2 subunit isoform was found in rabbit.
The pattern of splicing was identical to that found in rat (Kone and Higham, 1998).
However, the translation start site was not conserved For this reason, the alternatively
spliced variant in rabbit was designated HKa2c. Antipeptide polyclonal antibodies were
raised and used to show expression of both HKa2a and HKa2c proteins in rabbit renal
cortex. These results allude to a potentially complex pattern of regulation of H,K-ATPase
activity in renal cortex.
Multiple H.K-ATPase a Subunits in the Kidney
We set out to find the HKa subunits that mediate the H,K-ATPase activities that had
been observed in kidney. Because HKa2a mRNA had been observed in kidney, it was
necessary to find the rabbit sequence of HKa2a in rabbit for use in designing tools for

54
studying H,K-ATPase function in the kidney. Rabbit HKoti sequence was known
(Bamberg et a!., 1992). In designing an experimental approach to this goal, we wanted to
consider 1) the possibility that HKai was expressed in kidney (unknown at the time) in
addition to HKa2, 2) the possibility that the HKa2 mRNA might be different in kidney than
in the other tissues for which full length sequence was known, and 3) that novel HKa
isoforms might be present in renal tissues. A good technique to address all these
possibilities was to do RT-PCR using degenerate primers designed to anneal to regions of
sequence that were highly conserved among P-type ATPases. This approach was expected
to amplify any P-type H,K-ATPase that might be present in rabbit kidney.
The aspartyl residue that is phosphorylated as an intermediate in the catalytic cycle of
H,K-ATPase lies within a motif that is highly conserved in the entire P-type ATPase
family. Another well-conserved region among P-type ATPases surrounds a lysine residue
that can be modified by FITC. F1TC competes with ATP for binding (Jackson et al., 1983;
Farley and Faller, 1985), so this region is thought to make up part of the ATP binding site.
Advantage was taken of these two regions to design degenerate primers to amplify any
P-type ATPase using renal cortex RNA as template. Fifteen P-type ATPase sequences
were aligned using the computer program P1LEUP (Genetics Computer Group, 1997).
These sequences were selected to give a wide range of mammalian Na,K-ATPases and
H,K-ATPases. Chicken Na,K-ATPases were included because all three a subunit isoforms
were known for that species so they comprised a good example of P-type ATPases from
an organism less related to mammals. Toad sequences were included because toad

55
H,K-ATPase was one of only three non-gastric H,K-ATPases known at the time.
Degenerate primers were then designed to amplify any of these ATPases (Figure 4-1).
The products of the first two RT-PCR reactions using these primers, when cloned and
sequenced, had high homology to the NaKoo subunit in other species. The third reaction
product (Figure 4-2) was more related to the non-gastric H,K-ATPase a subunits than to
the HKoti subunit or to any of the Na, K-ATPase a subunits. It was a 419 bp fragment
that corresponded to nucleotides 1 182-1600 of the full-length rabbit HKa2a cDNA
sequence. A BLAST search listed three non-gastric H,K-ATPases as the most highly
aligned sequences to the 419 bp sequence, with other H,K-ATPases and Na,K-ATPases
being less well aligned (Figure 4-3). The sequence of the fragment shared
89% nucleic acid identity with the rat distal colonic H,K-ATPase a subunit, 88% with a
guinea pig distal colonic H,K-ATPase a subunit, and 86% with the H,K-ATPase a subunit
cloned from human axillary skin. Based on these similarities, this fragment was tentatively
identified as belonging to an H,K-ATPase.
Using degenerate primers designed to anneal to conserved sequences we identified
farther 5’ and 3’ in the sequence alignment paired with gene-specific primers designed
based on the new sequence (Table 2-1), fragments containing more of the transcript were
cloned (Figure 4-4). Outside the coding sequence, homology between cDNA sequences
declines. With much of the coding region cloned and sequenced, 5’ and 3’ RACE were
used to clone the full extent of the cDNA including the two ends. The 3’ end was easily
obtained; a single 3’ RACE product was observed the first time the procedure was
performed. The 5’ end proved far more interesting, but more challenging to find. Initial

56
A)
Hsu02 07 6
Ratatpasez
Bmhkatpas
Doghkatp
Pigatphk
Ocatprna
Ratatpast
Chknakat2
Chknakat3
Ratatpa3
Ratatpa2
Ratatpal
Chkatpas
Bmnkaal
Tcatpmr
...CCATCATCTGCTCGGACAAGACTGGGACAC..
...CCATCATCTGCTCAGACAAGACGGGGACCC..
...CCATTATCTGCTCCGACAAAACAGGAACCC..
...CAGTGATCTGCTCAGACAAGACAGGGACCT..
...CAGTCATCTGCTCTGACAAGACGGGGACCC..
...CGGTGATCTGCTCCGACAAGACGGGGACCC..
...CAGTCATCTGCTCAGACAAGACAGGAACTC..
...CCACCATCTGCTCCGACAAAACCGGGACCC..
...CCACCATCTGCTCCGATAAGACCGGGACCC..
...CCACCATCTGCTCCGACAAGACCGGCACCC..
..•CCACCATCTGCTCGGACAAGACAGGCACCC•.
...CCACCATCTGCTCCGACAAGACTGGAACTC..
...CCACCATCTGTTCTGACAAAACAGGCACCC..
...CCACCATCTGCTCTGACAAGACCGGAACCC..
...CAACCATTTGCTCAGACAAAACTGGAACCT..
5' Primer
B)
Hsu02076
Ratatpasez
Bmhkatpas
Doghkatp
Pigatphk
Ocatprna
Ratatpast
Chknakat2
Chknakat3
Ratatpa3
Ratatpa2
Ratatpal
Chkatpas
Bmnkaal
Tcatpmr
A A
ATCTGCTCCGACAAAACCGG
G G G
T T
...TCATGGTGATGAAGGGGGCCCCTGAGCGCA..
...TCGTGGTGATGAAAGGAGCCCCTGAGAGGA..
...TGCTCGTCATGAAAGGTGCCCCAGAGAGAA..
...TGCTGGTGATGAAGGGCGCCCCCGAGCGCG..
...TGCTTGTGATGAAGGGCGCCCCCGAGCGCG..
...TGCTGGTGATGAAGGGCGCCCCCGAGCGCG..
...TGCTGGTGATGAAGGGCGCCCCAGAGCGCG..
...TCCTGGTGATGAAAGGGGCCCCCGAGCGCA..
...TGCTGGTGATGAAAGGCGCCCCGGAGCGCA..
...TGTTAGTGATGAAGGGCGCCCCTGAACGCA..
...TGCTGGTGATGAAAGGTGCCCCGGAGCGCA..
...TGCTAGTGATGAAGGGCGCCCCAGAAAGGA..
...TGCTGGTGATGAAGGGAGCTCCAGAGAGGA..
...TGCTGGTCATGAAGGGCGCCCCCGAGAGGA..
...TGTTGGTGATGAAGGGAGCACCAGAACGGA..
31 Primer
A A
GTGATGAAAGGCGCCCCCGA
G G G
T T
Figure 4-1. Design of degenerate primers for RT-PCR of novel P-type ATPases. A)
Upstream primer was designed to anneal to well-conserved sequence at the enzyme active
site phosphorylated aspartyl residue. GenBank loci of 15 aligned sequences are shown at
left. Oligonucleotide is shown beneath aligned sequences. B) Downstream primer was
designed to anneal to well-conserved sequence at the putative ATP binding site.
Oligonucleotide is reverse complement of consensus sequence shown.

57
Figure 4-2. RT-PCR product amplified from rebbit renal cortex RNA using degenerate
primers. Gel isolated product was cloned and sequenced.

58
Sequences producing
gb U02076 HSU02076
gb M90398 RATATPASEZ
gb U94912 RNU94912
db]|D21854|GPIHKAAS
gb U94913|RNU94913
emb|Z25809|BMHKATPAS
gb|M59960|CHKNAKAT3
emb|X05883|RNATPAHO
gb M14513 RATATPA3
gb M28648 RATNALPH2
emb|Z11798|BMNKAA1
gb U10108 XLU10108
gb U49238 XLU49238
gb J02649 RATATPAST
gb U17249 XLU17249
emb|X64694|OCATPRNA
gb J03230 CHKATPAS
gb S66043 S66043
gb U17282 MMU17282
gb L42565 HUMATP1G04
gb L11568 DOGHKATP
emb|X02813|OAATPMR
gb M22724 PIGATPHK
gb M28647 RATNALPH1
gb S74801 S74801
gb M14511 RATATPA1
gb M74494 RATNAKATP
emb X76108 AASPAA
emb X05882 RNATPAR
emb X02810 TCATPMR
gb M59959 CHKNAKAT2
gb U16798 HSU16798
emb|X04297|HSATPAR
gb J03007 HUMATPAS
gb L42173 DOGNKAA
gb M38445 PIGATPBSEN
emb|X03938|SSATPAR
gb|M14512 j RATATPA2
emb X58629 CCNAKATP
emb X56650 AFNAKATP
gb M75140 HYDATPASE
gb L42566 HUMATP1G05
gb S76581 S76581
gb J05451 HUMATPGG
gb M63962 HUMHKATPC
Smallest
Sum
High Probabili
High-scoring Segment Pairs: Score P(N)
Human ATP-driven ion pump (ATP1AL1..
Rat H+,K+-ATPase mRNA, complete cds.
Rattus norvegicus H-K-ATPase alpha..
Guinea pig mRNA for distal colon H..
Rattus norvegicus H-K-ATPase alpha..
B.marinus mRNA for H,K-ATPase
Chicken Na,K-ATPase alpha-3-subuni..
Rat mRNA homologous to alpha subun..
Rat Na+, K+-ATPase alpha(III) isof..
Rattus norvegicus Na,K-ATPase alph..
B.marinus mRNA for Na, K-ATPase al..
Xenopus laevis Na+-K+-ATPase alpha..
Xenopus laevis adenosine triphosph..
Rat stomach (H+,K+)-ATPase mRNA, c..
Xenopus laevis gastric H(+)-K(+)-A..
O.cuniculus mRNA for ATPase (alpha..
Chicken (Na+ + K+)-ATPase mRNA, co..
sodium pump alpha subunit (Ctenoce..
Mus musculus gastric H(+)-K(+)-ATP..
Homo sapiens (clone 1SW34) non-gas..
Dog H+,K+-ATPase mRNA, complete cds.
Sheep mRNA for (Na+ and K+) ATPase..
Pig (H+ + K+)-ATPase mRNA, complet..
Rattus norvegicus Na,K-ATPase alph..
H(+)-K(+)-ATPase alpha-subunit [ra..
Rat Na+,K+-ATPase alpha isoform ca..
Rat sodium/potassium ATPase alpha-..
A.anguilla mRNA for sodium/potassi..
Rat mRNA for alpha subunit kidney-..
Torpedo californica mRNA for (Na+ ..
Chicken NA,K-ATPase alpha-2-subuni..
Human Na,K-ATPase alpha-1 subunit ..
Human mRNA for Na,K-ATPase alpha-s..
Human Na+,K+ ATPase alpha-subunit ..
Canis familiaris Na, K-ATPase alph..
Pig NA+, K+-ATPase alpha subunit m..
Pig mRNA for (Na+, K+)-ATPase alph..
Rat Na+,K+-ATPase alpha(+) isoform..
C.commersoni mRNA for Na(+)/K(+) A..
A.franciscana mRNA for Na/K ATPase..
H.vulgaris Na,K-ATPase alpha subun..
Homo sapiens (clone 1SW11-1) non-g..
Na,K-ATPase alpha-1 subunit [dogs,..
Human gastric (H+ + K+)-ATPase gen..
Human gastric H,K-ATPase catalytic..
1663
4.le-128
1582
2.2e-121
1582
2.2e-121
1582
2.2e-121
1582
2.2e-121
1069
1.le-78
907
3.le-65
898
1.8e-64
898
1.8e-64
889
9.9e-64
889
9.9e-64
880
5.5e-63
871
3.le-62
853
9.7e-61
844
5.5e-60
835
3.le-59
826
1.7e-58
826
1.7e-58
817
9.6e-58
458
2.4e-56
790
1.7e-55
772
5.3e-54
772
5.3e-54
763
3.0e-53
760
5.3e-53
736
5.3e-51
736
5.3e-51
727
2.9e-50
727
2.9e-50
667
3.9e-49
710
7.6e-49
709
9.3e-49
709
9.3e-49
709
9.3e-49
700
5.2e-48
691
2.9e-47
682
1.6e-46
674
7.6e-46
665
9.Oe-46
646
1.6e-43
606
3.4e-40
551
1.3e-35
514
1.5e-32
318
4.8e-24
327
5.5e-24
Figure 4-3. BLAST search using sequence of 419 bp fragment of HKa2.

59
* pWGC3 +
* pWGC7
pWGC9
pWGCll
RACE
race pWGC 1 5
pWGC53
HKa
AUG...
UGA ...AAA
race pWGC14
pWGC54
Figure 4-4. Cloning of HKa2a and HKa2c cDNAs. Individually cloned cDNAs are
indicated by bars and the plasmid numbers are indicated. AUG and UGA indicate start
and stop codons of the mRNA, respectively. Symbols: *, degenerated primers; RACE,
RACE primer. All other primers were gene-specific.

60
attempts employed the classical technique of Frohman et al. (1988), which is analogous
to the 3’RACE process. In several attempts, this technique produced only short cDNA
sequences which provided little new sequence information. Taking a new approach, the
Marathon cDNA Amplification Kit by Clontech (Palo Alto, CA) was tried. This kit uses a
ligation technology to add a known upstream sequence for PCR amplification, rather than
the less efficient terminal transferase technology employed by Frohman et al. (1988). Also,
the reverse transcription step was changed to a higher temperature to lessen the possibility
of secondary structure blocking full extension by the RNA polymerase. With the new
protocol, after some optimization, two different 5’ ends were obtained when 5’ RACE
products were sequenced.
Two rabbit renal HKot2 cDNA sequences were found in this manner, having 4035
bases in common at the 3' end but different 5' ends. The GenBank records of these two
cDNAs are shown in Figure 4-5. A segment of the shared 3' portion of the sequences was
identical to the 1456 bp sequence obtained by Fejes-Tóth (1995) except for two single
base mismatches. One mismatch was a transition of C-»T at nucleotide 2927, which does
not change the primary protein sequence and the other a transversion of G-*T at
nucleotide 3259, in the 3' untranslated region. The full-length rabbit HKa2a nucleotide
sequence was 86% identical to human HKa2 and 83% to rat, whereas identity of HKot2a to
rabbit FIKoci was only 67%. The deduced amino acid sequence shared 87% identity with
human HKa2, 87% identity with rat HKa2, but merely 64% with rabbit HKoti. Northern
analysis using an FIKa2..-specific probe (Table 2-1) is shown in Figure 4-6.

61
LOCUS
DEFINITION
ACCESSION
NID
KEYWORDS
SOURCE
ORGANISM
REFERENCE
AUTHORS
TITLE
JOURNAL
REFERENCE
AUTHORS
TITLE
JOURNAL
FEATURES
source
CDS
AF023128 4079 bp mRNA MAM 13-OCT-1997
Oryctolagus cuniculus H+,K+-ATPase alpha 2a subunit mRNA,
complete cds.
AF023128
g2511766
Oryctolagus cuniculus.
Oryctolagus cuniculus
Eukaryotae; Metazoa; Chordata; Vertebrata; Mammalia;
Eutheria; Lagomorpha; Leporidae; Oryctolagus.
1 (bases 1 to 4079)
Campbell,W.G., Weiner,I.D., Wingo,C.S. and Cain,B.D.
H,K-ATPase in the RCCT-28A rabbit cortical collecting duct
cell line
Unpublished
2 (bases 1 to 4079)
Campbell,W.G., Wingo,C.S. and Cain,B.D.
Direct Submission
Submitted (08-SEP-1997) Biochemistry, University of Florida,
JHMHC 100245, Gainesville, FL 32610, USA
Location/Qualifiers
1..4079
/organism="Oryctolagus cuniculus"
/strain="New Zealand White"
/db_xref="taxon:9986"
39..3140
/note="P-type ATPase"
/codon_start=l
/product="H+,K+-ATPase alpha 2a subunit"
/db_x re f = "PID:g2511767"
/transíation="MRQRKLEIY SVELHAATDIKKKEGRDGKKDNDLELKRNQQKEEL
KKELDLDDHKLSNKELETKYGTDIIRGLSSTRAAELLAQNGPNALTPPKQTPEIIKFL
KQMVGGFSILLWVGAVLCWIAFGIQYVSNPSASLDRVYLGTVLAVVVILTGIFAYYQE
AKSTNIMASFCKMIPQQAVVIRDSEKKVIPAEQLVVGDIVEIKGGDQIPADIRLLSAQ
GCKVDNSSLTGESEPQSRSSGFTHENPLETKNITFYSTTCLEGTATGMVINTGDRTII
GRIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSVGILFFIIAVCMKYHVLDAIIFLI
AIIVANVPEGLLATVTVALSLTAKRVAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQ
NRMTVAHLWFDNQIFVADTSEDNLNQGFDQSSGTWTSLSKIIALCNRAEFKPGEESVP
IMKRVVVGDASETALLKFSEVILGDVMEIRKRNHKVVEIPFNSTNKFQLSIHQTEDPN
DKRFLLVMKGAPERILEKCSTIMINGKEQPLDKSMAQAFHTAYMELGGLGERVLGFCH
FYLPADEFPETYSFDSESMNFPTSNLCFVGLLSMIDPPRSTVPDAVTKCRSAGIKVIM
VTGDHPITAKAIAKSVGIISANSETVEDIAKRCNIAVEQVNKRDAKAAWTGMELKDM
SPEQLDELLANYPEIVFARTSPQQKLIIVEGCQRQDAVVAVTGDGVNDSPALKKADIG
VAMGITGSDAAKNAADMILLDDNFSSIVTGVEEGRLIFDNLKKTIAYTLTKNIAELCP
FLIYIILGLPLPIGTITLLFIDLGTDIIPSIALAYEKAESDIMNRKPRHKKKDRLVNQ
Figure 4-5. GenBank accession records for rabbit HKa: sequences. A) Genbank record
for rabbit HKa^a- B) Genbank record for rabbit HKa^.

62
BASE COUNT
ORIGIN
1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
1441
1501
1561
1621
1681
1741
1801
1861
1921
1981
2041
2101
2161
2221
2281
2341
2401
2461
2521
2581
2641
2701
QLAVYSYLHIGLMQALGAFLVYFTVYAQQGFRPTSLFHLRIAWDSDHLNDLEDNYGQE
WTSYQRQYLEWTGYTAFFVGIMVQQIADLIIRKTRKNSIFKQGLFRNKVIWVGIASQI
IVALLLSYGLGSITALNFTMLKAQYWFVAVPHAILIWVYDEMRKLFIRLYPGSWWDKN
MYY "
1037 a 1073 c 1024 g 945 t
gccccctgcc cgccgacccg
tttactccgt ggagctccat
agaaagacaa tgacttggaa
ttgatctgga tgaccacaaa
tcattcgggg tctctccagc
ccctcacccc tcccaaacag
cggcgcctcc
gcagctacag
ctcaaaagga
ctcagcaata
accagagctg
accccagaga tcatcaagtt cctcaagcag
gcttttccat ccttctgtgg gtaggagctg tcctgtgttg gatcgcattt
atgtcagcaa tccatctgcc tccctggaca gagtgtacct gggcactgta
ttgtcatttt aacaggaatc tttgcctatt accaagaggc aaaaagcacc
agcgcgacat gcgccagaga
atatcaagaa gaaggagggg
atcagcagaa agaggagctt
aggagctgga aacgaaatat
ctgagctcct ggcacagaac
ccagcttctg caagatgatc
ttatccctgc agagcagctg
ttcctgccga catcaggctg
ctggagagtc tgagccccag
caaagaacat cactttctac
tcaacacggg tgaccggacc
atgagaagac gcccattgcc
ccgtctccgt cggcatcctg
acgccatcat cttcctcatt
ctgtcactgt ggccctgtcg
agaacttgga ggcagtggag
ggactctgac gcagaacagg
tggccgacac gagtgaagac
cctccttgtc
gtgtccccat
tctcagaagt
aaatcccttt
atgacaagcg
gcaccatcat
acacggccta
acctgccagc
ccacctccaa
tcccagatgc
atcatcccat
agacagtgga
atgccaaggc
atgagctctt
tgatcatcgt
tgaatgactc
ctgacgcggc
tcacaggggt
ccctgaccaa
ccctgcccat
ccattgcctt
agaaaaagga
tcatgcaagc
ggccgacctc
ccccagcaag
gtggtggggg
ctgtctgccc
tcccgctcaa
tccacgacct
atcattggcc
attgagatcg
ttcttcatca
gccatcattg
ctcacagcca
accctcggct
atgaccgtgg
aatttaaacc
caagataata gcattgtgta
ctgttgtcat ccgtgactcg
acatcgtgga gattaaagga
aggggtgtaa ggtggataac
gtgggttcac
gcctggaagg
gcattgcctc
aacattttgt
tcgcagtgtg
tggccaacgt
aacgggtggc
ccacctccat
cccatctgtg
aaggctttga
accgagctga
ccacgaaaac
cacggcaact
cttggcttca
gcacattgtg
catgaagtac
gcctgaaggc
aagctggaaa
cgagatggca
aagaaagaac
ggcacagaca
ggacccaacg
atggtgggcg
gggattcagt
cttgccgtgg
aacatcatgg
gagaaaaagg
ggtgaccaga
tcatctctta
cccctggaaa
ggcatggtca
ggcgtcggga
gcaggagtgg
cacgtcctgg
ctcctggcca
caagaagaac tgcctggtga
catctgctct gacaagactg
catgaagaga gtcgtggttg gagatgcttc
cattttgggt
taactcaacc
cttcctgctg
gatcaacggc
catggagctg
agatgagttt
cttatgtttt
agtcaccaaa
cacagccaaa
agacattgca
cgccgtggtg
agccaactac
ggagggctgt
ccccgctcta
caagaacgca
ggaggaaggc
gaacattgcc
tggcaccatc
ggcgtatgag
cagactggtg
gacgtgatgg
aacaaatttc
gtgatgaagg
aaggagcagc
ggcggcctgg
ccagagacct
gtggggctct
tgccggagtg
gccattgcca
aaacgctgca
accggcatgg
ccggaaatcg
cagaggcagg
aagaaggccg
gccgacatga
cgcttgatat
gagctctgcc
accctcctgt
aaagcagaaa
aaccagcagc
cctgggagct ttcctggtgt
actgtttcac ctgcggatag
gtttgacaat cagatcttcg
ccaaagctct ggaacctgga
gttcaagcca ggagaggaga
agaaactgct cttctgaaat
aaattagaaa aagaaaccac aaagtagtcg
agctctccat acaccagacg gaagatccca
gggcccccga gcggatccta gagaagtgca
cactggacaa gagcatggcc caggccttcc
gcgagcgcgt gctgggtttc tgccatttct
actcatttga ctcagaatcc atgaacttcc
tatcaatgat tgatcctcct cgatccactg
caggaatcaa ggttatcatg gttacaggtg
agagtgtagg gatcatttca gccaacagtg
acatcgccgt ggagcaggtt aacaaacggg
agctgaagga catgagccca gaacagctgg
tgtttgcacg gacgtccccc cagcaaaagc
acgcagttgt ggccgtgacg ggggacggag
acattggcgt tgccatgggg ataacgggtt
tcctgctgga tgacaacttc tcctctatcg
ttgacaacct aaagaagacc atcgcttaca
cctttttgat ttacatcatt ctcgggctgc
tcatcgactt gggcacagac ataatcccct
gtgacattat gaacaggaag cctcggcaca
ttgctgtata ctcgtacctg cacattggcc
acttcactgt gtacgcacag cagggctttc
cgtgggacag cgaccacctg aacgacttgg
Figure 4-5—continued

2761 aagacaacta
2821 acacggcttt
2881 cccgcaagaa
2941 tcgcctccca
3001 taaatttcac
3061 tctgggtata
3121 ataagaacat
3181 gtggtcttcg
3241 ctctcatcta
3301 ttcagctgtt
3361 atgtcaaggt
3421 acacagactt
3481 tcagatctcc
3541 cccctgaaac
3601 ggcagcagga
3661 ttgctgtgat
3721 ctgttcctgc
3781 acccaaaggg
3841 tagcactatt
3901 aatcacattt
3961 gacaggtttt
4021 ctaattgtga
//
tggacaggaa
ctttgttggc
ctccatcttc
gatcatcgtc
catgctcaag
cgatgaaatg
gtattactga
gcaagacctc
gaacacagtg
tgtatatgat
catggtgtag
gtgtaaccca
ttccacaccc
ataacttttg
gcacctcaga
gggttcctgg
aaagctgacc
gctgtcactg
tatttcttgt
ttgtaactta
tttttttaaa
tgttttactt
tggacgagtt
atcatggtcc
aagcaggggc
gccctgctcc
gctcagtact
cggaaactct
gaccaggtct
tgtgtagtgt
gtgaagcttc
tttcatctct
ggaaggatgt
ggtggctgct
tgtcaaaggc
gggtttgctt
acagcaaaga
ccatgcggcc
tccaagtcca
actgggactc
agataggctg
gatatatttg
taaaagatgt
aattcaagtt
atcagaggca
agcaaatagc
tcttcagaaa
tctcttacgg
ggtttgtggc
tcatcaggct
gtctctgagt
ggatgttgcc
ttactgatct
atctccatct
gtttatctgt
ggagtctgcc
ccggtgagct
tgctcagctg
cagcccccgt
ccagtccgcc
ttccacaaac
ggcctctccg
ccaagcactc
tgtgggacac
ttttaagtaa
tttccagagg
atacctggaa
agatctgatc
taaagttatc
gctcggcagt
cgtaccccac
ctaccccgga
ctcccagcgg
aagctccact
gttgtacttc
ccttacctta
atatgaagct
ataagttgag
ccataggatt
agggtgtgag
tttgactccc
ttctcacagc
cttaactcaa
gaaagccact
tccagcagcc
gaaacacata
aatgttttat
caggcacgga
63
tggacaggct
atcaggaaga
tgggtgggga
atcacagccc
gccatcctga
agctggtggg
cacctgcctg
cgggaggaga
aaagctgaga
aaagatgtgg
cactgatgtc
ctagaattgc
tctgtgaatc
ttggaagtgt
agacactttg
actccaccac
acattcgtgg
gtggtttaga
attttatgtc
catccatgtt
gaaacaaaat
aaataccaa
Figure 4-5—continued

64
B)
LOCUS
16-APR-1998
DEFINITION
ACCESSION
NID
KEYWORDS
SOURCE
ORGANISM
REFERENCE
AUTHORS
TITLE
JOURNAL
REFERENCE
AUTHORS
TITLE
JOURNAL
FEATURES
source
CDS
AF023129 4422 bp mRNA MAM
Oryctolagus cuniculus H+,K+-ATPase alpha 2c subunit mRNA,
complete cds.
AF023129
g2511768
Oryctolagus cuniculus.
Oryctolagus cuniculus
Eukaryotae; Metazoa; Chordata; Vertebrata; Mammalia;
Eutheria;
Lagomorpha; Leporidae; Oryctolagus.
1 (bases 1 to 4422)
Campbell,W.G., Weiner,I.D., Wingo,C.S. and Cain,B.D.
H,K-ATPase in the RCCT-28A rabbit cortical collecting duct
cell line
Unpublished
2 (bases 1 to 4422)
Campbell,W.G., Wingo,C.S. and Cain,B.D.
Direct Submission
Submitted (08-SEP-1997) Biochemistry, University of Florida,
JHMHC
100245, Gainesville, FL 32610, USA
Location/Qualifiers
1..4422
/organism="Oryctolagus cuniculus"
/strain=”New Zealand White"
/db_xref="taxon:9986"
199..3483
/note="P-type ATPase”
/codon_start=l
/product="H+,K+-ATPase alpha 2c subunit"
/db_xref="PID:g2511769"
/translation="MAGGAHRADRATGEERKEGGGRWRAPHSPSPPGPRGCPVPLKAA
AQSLCRKPTWGRYCTLLLFQRKLEIYSVELHAATDIKKKEGRDGKKDNDLELKRNQQK
EELKKELDLDDHKLSNKELETKYGTDIIRGLSSTRAAELLAQNGPNALTPPKQTPEII
KFLKQMVGGFSILLWVGAVLCWIAFGIQYVSNPSASLDRVYLGTVLAVWILTGIFAY
YQEAKSTNIMASFCKMIPQQAVVIRDSEKKVIPAEQLVVGDIVEIKGGDQIPADIRLL
SAQGCKVDNSSLTGESEPQSRSSGFTHENPLETKNITFYSTTCLEGTATGMVINTGDR
TIIGRIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSVGILFFIIAVCMKYHVLDAII
FLIAIIVANVPEGLLATVTVALSLTAKRVAKKNCLVKNLEAVETLGSTSIICSDKTGT
LTQNRMTVAHLWFDNQIFVADTSEDNLNQGFDQSSGTWTSLSKIIALCNRAEFKPGEE
SVPIMKRVVVGDASETALLKFSEVILGDVMEIRKRNHKVVEIPFNSTNKFQLSIHQTE
DPNDKRFLLVMKGAPERILEKCSTIMINGKEQPLDKSMAQAFHTAYMELGGLGERVLG
FCHFYLPADEFPETYSFDSESMNFPTSNLCFVGLLSMIDPPRSTVPDAVTKCRSAGIK
VIMVTGDHPITAKAIAKSVGIISANSETVEDIAKRCNIAVEQVNKRDAKAAWTGMEL
KDMSPEQLDELLANYPEIVFARTSPQQKLIIVEGCQRQDAVVAVTGDGVNDSPALKKA
DIGVAMGITGSDAAKNAADMILLDDNFSSIVTGVEEGRLIFDNLKKTIAYTLTKNIAE
Figure 4-5—continued

65
BASE COUNT
ORIGIN
1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
1441
1501
1561
1621
1681
1741
1801
1861
1921
1981
2041
2101
2161
2221
2281
2341
2401
2461
2521
2581
LCPFLIYIILGLPLPIGTITLLFIDLGTDIIPSIALAYEKAESDIMNRKPRHKKKDRL
VNQQLAVYSYLHIGLMQALGAFLVYFTVYAQQGFRPTSLFHLRIAWDSDHLNDLEDNY
GQEWTSYQRQYLEWTGYTAFFVGIMVQQIADLIIRKTRKNSIFKQGLFRNKVIWVGIA
SQIIVALLLSYGLGSITALNFTMLKAQYWFVAVPHAILIWVYDEMRKLFIRLYPGSWW
DKNMYY"
1103 a 1174 c 1136 g 1009 t
ctccgccctc gcacctgcgg
atgcgtagcg gtctggaaaa
gctggtgtga ccccgcaggg
tgtcttcctg ggaagacgat
gagaggaagg agggaggtgg
cgagggtgtc cggtcccact
ggccggtatt gcactctgct
catgcagcta cagatatcaa
gaactcaaaa ggaatcagca
aaactcagca ataaggagct
agcaccagag
cagaccccag
tgggtaggag
gcctccctgg
atctttgcct
atcccccagc
ctggtggtgg
ctgctgtctg
cagtcccgct
tactccacga
ctgctgagct
agatcatcaa
gctcggattc ggagaaaagt
tgccccaggc tcgggtctga
caaccccgcg gttaacttct
ggcaggcggt gcccaccgag
gaggtggcgc gctccccaca
caaggcagct gcgcagagcc
tctctttcag agaaagctgg
gaagaaggag gggcgagatg
gaaagaggag cttaagaaag
ggaaacgaaa tatggcacag
cctggcacag aacggaccca
gctagactgg
ggggcccaag
ctcctgccca
ccgaccgtgc
gcccttcccc
tgtgcagaaa
aaatttactc
gcaagaaaga
aacttgatct
agctacacgt
tctatgcacc
cccctagagg
aacaggggaa
tcctggcccg
acccacctgg
cgtggagctc
caatgacttg
ggatgaccac
acatcattcg gggtctctcc
acgccctcac ccctcccaaa
gttcctcaag
ctgtcctgtg ttggatcgca
acagagtgta cctgggcact
attaccaaga ggcaaaaagc
aagctgttgt catccgtgac
gggacatcgt
cccaggggtg
caagtgggtt
cctgcctgga
accatcattg gccgcattgc
gccattgaga tcgaacattt
ctgttcttca tcatcgcagt
attgccatca ttgtggccaa
tcgctcacag
gagaccctcg
aggatgaccg
gacaatttaa
atagcattgt
agagtcgtgg
ggtgacgtga
accaacaaat
ctggtgatga
ggcaaggagc
ctgggcggcc
tttccagaga
tttgtggggc
aaatgccgga
aaagccattg
gcaaaacgct
ccaaacgggt
gctccacctc
tggcccatct
accaaggctt
gtaaccgagc
ttggagatgc
tggaaattag
ttcagctctc
ggagattaaa
taaggtggat
cacccacgaa
aggcacggca
ctccttggct
tgtgcacatt
gtgcatgaag
cgtgcctgaa
ggccaagaag
catcatctgc
gtggtttgac
tgaccaaagc
tgagttcaag
ttcagaaact
aaaaagaaac
catacaccag
cagatggtgg
tttgggattc
gtacttgccg
accaacatca
tcggagaaaa
ggaggtgacc
aactcatctc
aaccccctgg
actggcatgg
gcggcttttc
agtatgtcag
tggttgtcat
tggccagctt
aggttatccc
agattcctgc
ttactggaga
aaacaaagaa
tcatcaacac
tcaggcgtcg ggaatgagaa
gtggcaggag tggccgtctc
agggggcccc cgagcggatc
agccactgga
tgggcgagcg
taccacgtcc
ggcctcctgg
aactgcctgg
tctgacaaga
aatcagatct
tctggaacct
ccaggagagg
gctcttctga
cacaaagtag
acggaagatc
ctagagaagt
caagagcatg gcccaggcct
cgtgctgggt ttctgccatt
cctactcatt
tcttatcaat
gtgcaggaat
ccaagagtgt
gcaacatcgc
gtgaccggca tggagctgaa
tacccggaaa tcgtgtttgc
tgtcagaggc aggacgcagt
ctaaagaagg ccgacattgg
tgactcagaa
gattgatcct
caaggttatc
agggatcatt
cgtggagcag
ggacatgagc
acggacgtcc
tgtggccgtg
cgttgccatg
tccatgaact
cctcgatcca
atggttacag
tcagccaaca
gttaacaaac
ccagaacagc
ccccagcaaa
acgggggacg
gggataacgg
tggacgccat
ccactgtcac
tgaagaactt
ctgggactct
tcgtggccga
ggacctcctt
agagtgtccc
aattctcaga
tcgaaatccc
ccaatgacaa
gcagcaccat
tccacacggc
tctacctgcc
tccccacctc
catccttctg
caatccatct
tttaacagga
ctgcaagatg
tgcagagcag
cgacatcagg
gtctgagccc
catcactttc
gggtgaccgg
gacgcccatt
cgtcggcatc
catcttcctc
tgtggccctg
ggaggcagtg
gacgcagaac
cacgagtgaa
gtccaagata
catcatgaag
agtcattttg
ttttaactca
gcgcttcctg
catgatcaac
ctacatggag
agcagatgag
caacttatgt
ctgtcccaga tgcagtcacc
gtgatcatcc catcacagcc
gtgagacagt ggaagacatt
gggatgccaa ggccgccgtg
tggatgagct cttagccaac
agctgatcat cgtggagggc
gagtgaatga ctcccccgct
gttctgacgc ggccaagaac
Figure 4-5—continued

2641 gcagccgaca
2701 ggccgcttga
2761 gccgagctct
2821 atcaccctcc
2881 gagaaagcag
2941 gtgaaccagc
3001 gctttcctgg
3061 cacctgcgga
3121 gaatggacga
3181 ggcatcatgg
3241 ttcaagcagg
3301 gtcgccctgc
3361 aaggctcagt
3421 atgcggaaac
3481 tgagaccagg
3541 ctctgtgtag
3601 gtggtgaagc
3661 gattttcatc
3721 tagggaagga
3781 ccaggtggct
3841 ccctgtcaaa
3901 ttggggtttg
3961 agaacagcaa
4021 tggccatgcg
4081 acctccaagt
4141 ctgactggga
4201 tgtagatagg
4261 ttagatatat
4321 aaataaaaga
4381 cttaattcaa
//
tgatcctgct
tatttgacaa
gccccttttt
tgttcatcga
aaagtgacat
agcttgctgt
tgtacttcac
tagcgtggga
gttatcagag
tccagcaaat
ggctcttcag
tcctctctta
actggtttgt
tcttcatcag
tctgtctctg
tgtggatgtt
ttcttactga
tctatctcca
tgtgtttatc
gctggagtct
ggcccggtga
ctttgctcag
agacagcccc
gccccagtcc
ccattccaca
ctcggcctct
ctgccaagca
ttgtgtggga
tgtttttaag
gtttttccag
66
ggatgacaac
cctaaagaag
gatttacatc
cttgggcaca
tatgaacagg
atactcgtac
tgtgtacgca
cagcgaccac
gcaatacctg
agcagatctg
aaataaagtt
cgggctcggc
ggccgtaccc
gctctacccc
agtctcccag
gccaagctcc
tctgttgtac
tctccttacc
tgtatatgaa
gccataagtt
gctccatagg
ctgagggtgt
cgttttgact
gccttctcac
aaccttaact
ccggaaagcc
ctctccagca
cacgaaacac
taaaatgttt
aggcaggcac
ttctcctcta
accatcgctt
attctcgggc
gacataatcc
aagcctcggc
ctgcacattg
cagcagggct
ctgaacgact
gaatggacag
atcatcagga
atctgggtgg
agtatcacag
cacgccatcc
ggaagctggt
cggcacctgc
actcgggagg
ttcaaagctg
ttaaaagatg
gctcactgat
gagctagaat
atttctgtga
gagttggaag
cccagacact
agcactccac
caaacattcg
actgtggttt
gccattttat
atacatccat
tatgaaacaa
ggaaaatacc
tcgtcacagg
acaccctgac
tgcccctgcc
cctccattgc
acaagaaaaa
gcctcatgca
ttcggccgac
tggaagacaa
gctacacggc
agacccgcaa
ggatcgcctc
ccctaaattt
tgatctgggt
gggataagaa
ctggtggtct
agactctcat
agattcagct
tggatgtcaa
gtcacacaga
tgctcagatc
atccccctga
tgtggcagca
ttgttgctgt
cacctgttcc
tggacccaaa
agatagcact
gtcaatcaca
gttgacaggt
aatctaattg
aa
ggtggaggaa
caagaacatt
cattggcacc
cttggcgtat
ggacagactg
agccctggga
ctcactgttt
ctatggacag
tttctttgtt
gaactccatc
ccagatcatc
caccatgctc
atacgatgaa
catgtattac
tcggcaagac
ctagaacaca
gtttgtatat
ggtcatggtg
cttgtgtaac
tccttccaca
aacataactt
ggagcacctc
gatgggttcc
tgcaaagctg
ggggctgtca
atttatttct
tttttgtaac
tttttttttt
tgatgtttta
Figure 4-5—continued

67
Distal Renal
Colon Cortex
Figure 4-6. Northern analysis showing presence of HKa^ in distal colon and renal
cortex. GAP3DH was used to show the condition of the RNA samples.

68
To determine the relationship between the rabbit HKa: mRNAs and other P-type
ATPases, phylogenetic analysis was necessary. Several programs and algorithms were
sampled, all giving the same general pattern of sequence relationships. Programs employed
include CLUSTALW (Thompson et al., 1994), DISTANCES (Genetics Computer Group,
1997), and PAUP (Genetics Computer Group, 1997). All three programs use the distance
algorithm, and the maximum parsimony algorithm of PAUP was also used. In addition to
distance and maximum parsimony analyses, a third popular algorithm to assay relatedness
of sequences is used, the maximum likelihood analysis. Distance analysis generates a tree
showing relatedness of sequences by simply counting
dissimilarities in aligned sequences as a test of their homology. Maximum parsimony
considers only positive information in making a comparison For instance, in an alignment
of four sequences, a position that had one each of A, C, G, and T would not be included in
the analysis because that position would not give information about any pair of the
sequences being related. A position that had two As and two Cs would be counted
because it would show the grouping of two pairs. Distance analysis would include both
positions in the analysis. Maximum likelihood takes into account the tendency for a given
type of mutation to occur In two sequences that have a point mutation, that point
mutation was more probably created by a “likely” change than a change that has less
tendency to occur. Maximum likelihod would measure two sequences as more related if
their alignment shows a “likely” mutation If the mutation had less tendency, it may
indicate a more distant relationship between sequences arrived at only by multiple changes

69
or higher pressure of selection. The maximum likelihood analysis requires information that
is not readily available for rabbit, and was not attempted. A representative phylogram
arrived at by distance analysis by the CLUSTALW program is shown in Figure 4-7.
The 5' end of the second rabbit sequence (HK.a2c) differed dramatically from the
published rat HKcci, (Crowson and Shull, 1992) and human HKa2a (Grishin el al., 1994)
sequences. The HKa2c 5' untranslated region bore no homology to the comparable
segments from the HKa2a cDNAs from human or rat, or to any GenBank sequence. It
was clear from the beginning that this second 5’ end might represent an alternative splicing
product; the sequence homology diverges from the human HKa2 sequence at a point
known in the human ATP1AL1 gene to be a splice junction (nucleotide 177 of ATP1AL1)
(Sverdlov et al., 1996).
Alternative Splicinu of H,K-ATPase a Subunits in the Kidney
When a sequence for the 5’ end of the rat HKa2 gene was published (Kone and
Higham, 1998), we wanted to compare the sequence at the 5’ end of the rabbit gene. In
order to determine the exon arrangement at the 5' end of the HKa2 gene, rabbit genomic
DNA was amplified by PCR. The antisense primer was selected within the region of
sequence that is common to HKa2a and HKa2c. Because it was unknown which of the two
cDNA 5' ends was located more 5' in the gene, sense primers that anneal to sequence
within each were selected. The oligonucleotide primer specific to HKa2., gave the larger
amplified product, and its sequence is shown in Figure 4-8A. The exon specific to HKa2a
splices to the common core sequence at the splice site shown. The exon specific to HKa2c

70
rabbit HKal rat HKal
Figure 4-7.
Distance analysis of selected HKa and NaKa subunit coding.

A)
71
f HKa,. transcription start
1 GCCCCCTGCC CGCCGACCCG CGGCGCCTCC AGCGCGACAT GCGCCAGgtg
M R Q
51
tgtgaggaag tgacgcggtg cggactggcg agaagtgcgg gaaagggtga
101
agggctccgt ccgggggtct ttactctgca accctgttcc agccgccgag
151
cacccgtgtg tcactcggga actggctggg t^aagaggtc aatccagaca
201
f
HKoijc transcription
cgcggggaag gagttccagg ggtcctgggc cagCTCCGCC CTCGCACCTG
251
start
CGGGCTCGGA TTCGGAGAAA AGTGCTAGAC TGGAGCTACA CGTATGCGTA
301
GCGGTCTGGA AAATGCCCCA GGCTCGGGTC TGAGGGGCCC AAGTCTATGC
351
ACCGCTGGTG TGACCCCGCA GGGCAACCCC GCGGTTAACT TCTCTCCTGC
401
CCACCCCTAG AGGTGTCTTC CTGGGAAGAC GATGGCAGGC GGTGCCCACC
MAG G A H R
451
GAGCCGACCG TGCAACAGGG GAAGAGAGGA AGGAGGGAGG TGGGAGGTGG
ADR ATC GEER KEG GGW
501
CGCGCTCCCC ACAGCCCTTC CCCTCCTGGC CCTCGAGGGT GTCCGGTCCC
RAPH SPS PPG PRGC PVP
551
ACTCAAGGCA GCTGCGCAGA J^CTGTGCAG AAAACCCACC TGGGGCCGGT
L K A A A Q S LCR KPT WGRY
601
HKa,. splice site
ATTGCACTCT GCTTCTCTTT CAGAGAAAGC TGGAAATTTA CTCCGTGGAG
CTL LLF QRKL E I Y SVE
B)
> HKc.2a
... remainder of sequence omitted for clarity
HK«2c
...ATG...
ATG . ...ATG... COMMON
intron
splicing
Figure 4-8. Rabbit HKa2 gene sequence at the 5' end. A) HKa2 gene sequence and
deduced amino acid sequences are shown. Intron sequence is in lower case type. The
amino acid sequence that is shared by HKa2a and HKa2c is in boldface type. B) Pattern of
alternative splicing at the 5' ends of the HKa2 transcripts.

72
is continuous with the core sequence and lies within the first intron of the HKoc2a
pre-mRNA. This general intron/exon structure is the same as that reported for rat HKa2a
and HKa.2b (Kone and Higham, 1998)
Expression of H,K-ATPase a Subunits in the Kidney
The start codon of HKa2a was omitted in the HKa2c sequence. Instead, a probable
start codon was located upstream in frame with the HKa2a open reading frame. Thus, the
deduced amino acid sequence encoded a protein 61 amino acids longer at the amino
terminal end than the rabbit HKa2a sequence. The deduced amino acid sequence of the
HKa2a and HKa2c proteins are shown in Figure 4-8A, indicating translational start sites.
Although the HKa2c cDNA indicated a continuous open reading frame including the
amino-terminal extension, the possibility remained that translation might be initiated at the
ATG codon homologous to that reported for the rat (Kone and Higham, 1998).
Therefore, to determine whether the upstream ATG served as a translational start site,
antipeptide antibodies were generated for peptides corresponding to amino acids 13-25
and 79-98 of the HKa2c subunit. The former (antibody LLC27) was HKa2c-specific, while
the latter (antibody LLC25) recognized a segment common to both HKa2a and HKa2c
subunits. Western analyses of rabbit kidney tissues and RCCT-28A cells using antibody
LLC25 (anti-HKa2 common) revealed a doublet migrating at an apparent molecular mass
of approximately 90KDa (figure 4-9A). Experiments using antibody LLC27 (anti-HKa2c)
indicated a single band with a migration comparable to the upper band of the doublet
(figure 4-9B). Both antibodies appear to recognize the same protein providing strong

73
A) B)
anti-HKa2 common anti-HKa2c
Figure 4-9. Western analysis showing presence of HKa2a and HKa2c protein in renal
cortex. A) Detected with the anti-HKa2 common antibody LLC25. B) Detected with the
anti-HKa2c-specific antibody LLC27. A and B show separate lanes from the same
SDS-PAGE gel. Membrane was cut after electrotransfer and re-aligned after
autoradiography.

74
evidence that the HKa2c subunit containing the amino-terminal extension was indeed
present in both rabbit renal tissue and RCCT-28A cells.
To test the hypothesis that enzyme localization in the kidney or in the cell is changed
as a result of the alternative splicing of the mRNA, immunohistochemistry experiments
were performed. Using our antibodies, Dr. Jill Verlander and Ms. Robin Moudy
conducted immunohistochemistry experiments. Neither antibody we had made to the
anti-HKct2 common region (LLC24 or LLC25) worked well for immunohistochemistry.
However LLC22 (anti-HKai) and LLC26 (anti-HKa2c) gave satisfactory results. A
representative section photographed in Dr. Verlander’s laboratory is shown in Figure
4-10. There is no visible reactivity except in the apical membranes of some cells of
connecting segment and collecting duct. A majority of the cells in which labelling is
observed bulge out into the lumen, a hallmark of the intercalated cell. Fewer cells are
labelled in connecting segment compared to more distally in the collecting duct. This is in
accordance with the normal distribution of acid-secreting intercalated cells, fewer in
connecting segment than farther down in cortical collecting duct. There appears to be
some labelling of cell types other than intercalated cells, including principal cells. Labelling
continues to be visible in more distal sections of collecting duct than one would expect
based on distribution of intercalated cells, but individual rabbits may vary widely in this
distribution. Therefore, the few observations made do not permit a certainty that HKa2c
subunit protein is expressed more distally in cell types not normally thought to be
associated with acid secretion. The lack of basolateral labelling implies that there is not a
cell polarity change in HKa:c protein compared to HKa2a.

75
Figure 4-10. Immunohistochemistry by Dr. Jill Verlander and Ms. Robin Moudy.
Anti-HKa2c antibody reacts with the apical surfaces in some cells in rabbit renal
collecting duct. The section shown is from the outer stripe of outer medulla.

76
Discussion
We have generated complete cDNAs for both the rabbit renal HKai, and the novel
HKoc:c subunits. They were more closely related to other HKa; nucleotide sequences than
to HKoti or to Na,K-ATPases. The exon structure at the 5’ end was found and compared
to the exon structure found at the 5’ end of rat (Kone and Higham, 1998). Proteins
corresponding to both HKa; isoforms were detected by immunoblot analysis, indicating
that the novel HKa;c has the predicted amino-terminal extension.
The HKa; cDNAs reported here generated using rabbit renal cortex R.NA as template
have high homology to previously known HKa: sequences from human skin axilla and the
rat distal colon (Grishin at al., 1994; Crowson and Shull, 1992). The level of homology is
relatively low compared to the homology typically found when comparing HKoti or NaKa
subunits across mammalian species. However, it is much higher than the homology
between the rat HKoti and HKa.; cDNAs (Crowson and Shull, 1992) or among the
different Na,K-ATPase isoforms within a species. The HKa; isoforms appear to have
undergone somewhat greater evolutionary divergence than HKai or the Na,K-ATPase
catalytic isoforms. Phylogenetic analysis provides a clearer picture of the relationships
between these P-type ATPases. In a phylogram (figure 4-7), the HKa; subunit isoforms
cluster together compared to the other P-type ATPases. The HKa; subunit nucleotide
sequences all represent H,K-ATPases that are expressed at high level in colon, at lower
level in other tissues including the kidney, and not at all in stomach. At least in rat and

77
rabbit, an alternatively spliced variant lias been shown to be transcriptionally competent,
and the pattern of introns and exons that give rise to this alternative splicing are strikingly
similar. It would be highly interesting to attempt to detect a similar transcript in human.
Based on tissue distribution, phylogenetic analysis, and the similarity of alternatively
spliced transcripts, it continues to be a valid premise that the HKa: subunits known for
rat, human, and rabbit form an orthologous group.
Like the rat, the rabbit appears to have alternatively spliced transcripts of HKa2 in the
kidney. The organization of the rat alternatively spliced cDNA (Kone and Higham, 1998)
omitted the exon containing the start codon of the sequence previously reported for rat
distal colon (Crowson and Shull, 1992), giving rise to a protein truncated by 108 amino
acids at the amino-terminal end. The rabbit HKot2c sequence also omits the start codon
present in the HKa2a sequence. However, an upstream 5' ATG codon lies in the same
uninterrupted reading frame as the coding sequence for HKa2. Initiation of translation at
this position yields a subunit having an extended amino-terminus 61 amino acids longer
than the canonical HKa2a protein. Western analysis demonstrated that a protein having
this extension is present in rabbit kidney. An antibody designed to detect the common
core region of HKa2 was reactive to two proteins very close in apparent mass, whereas an
antibody designed to detect the amino-terminal extension was reactive to a single species.
The extended portion of the HKa2b-encoded protein contains a casein kinase II
phosphorylation motif at thr-12, and a cAMP-dependent protein kinase phosphorylation
motif at thr-53. These sites impart a potential for regulation of HKa2c distinct from HKa2a.
There are no apparent glycosylation sites or signal sequences. The HKa2c extension is

78
hydrophilic in nature and lacks any conspicuous membrane-spanning domains. Because the
N-terminus of HKat was found to be cytosolic (Smolka et al., 1992), the elongation can
be expected to have a cytosolic location. Figure 1-1 shows the putative location of the
amino-terminal extension. Chou-Fasman calculations predict this segment to be
predominantly alpha- helical with a turn structure in a region containing seven prolines
between amino acids 26 through 40. A similarly proline-rich hinge region is found in band
3 protein, and an ankyrin-binding site has been localized to that area of band 3 (Willardson
et al., 1989). Products of alternative splicing of the band 3 protein AE1 gene have been
characterized in chicken kidney, where it is thought that the variation in transcripts serves
to determine the membrane domain to which the polypeptides are targeted (Cox et al.,
1995). A similar situation may exist for the various HKct: transcripts; alternative splicing
may mediate the polarity of expression. In cortical thick ascending limb, an H,K-ATPase
activity has been described that diminished in rats fed a low K+ diet (Younes-lbrahim et
al., 1995). Basolateral polarity of expression would be consistent with potassium
homeostasis in that case. However, no basolateral staining using the anti-HKotjc antibody
was seen in this segment of the nephron (discussed below). If the HKa:b protein is the
molecule responsible for that activity, its absence in RCCT-28A could be explained by the
normal expression being in a region of the cortex other than CCD
A number of possibilities exist to answer the question of why there are multiple
H,K-ATPases in the kidney. One possibility is differential regulation. In rat (Kone and
Higham, 1998) and rabbit (this work) the alternatively spliced HKa: subunit mRNA
contains multiple upstream open reading frames. This may be associated with an inhibition
of translation, leading to a decrease in HKa^ subunit protein in the cell. Covalent

79
modification is another possible means of differential regulation. In this case,
phosphorylation is an unlikely candidate for differential regulation because although motifs
recognised by kinases are present, they are not conserved between rat (Kone and Higham,
1998) and rabbit. Having a different promoter region immediately 5’ to the HKa2c cDNA
gives rise to potential differences in regulation relative to HKa2a. Of course, different
promoter regions giving different responses to conditions such as aldosterone status and
low K+ may account for why there are the three catalytic subunit isoforms HKai, HKa2a,
and HKa2c. There may also be differences in the kinetics between HKa2a and HKa2c.
Another possibility is localization, both within the kidney and within the cell. Using
our antibodies, Dr. Jill Verlander and Ms. Robin Moudy conducted immunohistochemistry
experiments. They found a similar pattern of expression of expression of HKa2c compared
to other H,K-ATPase proteins for which localization is known (Wingo el al., 1990;
Campbell-Thompson et al., 1995; Alin and Kone, 1995; Ahn elal., 1996; Haragsim and
Bastani, 1996). These results imply that the alternative splicing does not confer on the
protein a different polarity of expression or localization within the kidney. They do imply
that the HKa2c protein joins other acid and ion transporters in cell types specialized for
high transport activity.
Immunohistochemistry showed that differences in HKa2c subunit protein cellular
distribution had no major departures from the distribution of other H,K-ATPase subunits.
Because the phosphorylation motifs in rat and rabbit alternatively spliced isoforms are not
conserved, regulation by phosphorylation is a less likely candidate to lead to differential
regulation. There are myriad possibilities for why there is such a heterogeneity of

80
H,K-ATPases in the kidney, such as differential regulation at the gene level by different
promoter regions, differential regulation of protein synthesis by the short upstream open
reading frames, or differences in enzyme kinetics.

H,K-ATPASES in a rabbit kidney cortical collecting tubule a-type
INTERCALATED CELL LINE
Introduction
The kidney is a well-organized and complicated organ, with many different cell types
contributing to its morphology and function Any understanding of the kidney must
include an appreciation of the processes mediated by each cell type. Expression of
H,K-ATPase has been shown to be complex in rabbit kidney, so one issue of interest is the
identification of the cell types possessing the various isoforms of the pump.
Immunohistochemical evidence was presented in the previous chapter indicating that the
collecting duct A-type intercalated cell is one of the primary cell types that expresses
H,K-ATPase catalytic subunit proteins. An independent approach showing that A-type
intercalated cells express these pumps is to detect H,K-ATPase in a well-characterized cell
line of intercalated cell origin A cell line in which H,K-ATPase was present would also
serve as a model cell system offering the potential for future experiments pertaining to
renal H,K-ATPases.
The rabbit conical collecting tubule cell line RCCT-28A was selected by
immunodissection (Arend et a/., 1989). Cortical collecting duct was dissected under a
microscope and the collagenase-dispersed cells incubated in culture dishes to which the
antibody rct-30 was attached (Spielman et a/., 1986). The rct-30 antibody binds
specifically to collecting duct cells. The resultant cell line was shown to have
81

82
characteristics of the cortical collecting duct A-type intercalated cell (Arend et al.,
1989;Schwiebert el al., 1992; Dietl el al., 1989; Bello-Reuss, 1993). The existence of
H,K-ATPase mRNA, protein, and activity in this cell line was studied to demonstrate that
this is a cell type that expresses H,K-ATPase. Here we show by RT-PCR that mRNA for
HK(Xi, HKoc2a, HKot2c, and HK(3 are present in RCCT-28A cells. By western analysis it is
shown that protein corresponding to the novel alternatively spliced isoform HKa2c is
present. Lastly, fluorescence microscopy measurements are used to demonstrate that
RCCT-28A cells have a mechanism for pH, regulation that is K'-dependent and sensitive
to the H,K-ATPase inhibitor Sch-28080. Together the data represent very strong evidence
for H,K-ATPase expression in a cell line derived from the type-A intercalated cell in the
collecting duct.
Detection of HJ<-ATPase in RCCT-28A Cells
Detection of H.K-ATPase mRNAs in RCCT-28A cells
To determine the presence of H,K-ATPase transcripts, we examined whether the
RCCT-28A cells possessed mRNA for the known H,K-ATPase (3 or a subunits. In the
initial experiments, there were no H,K-ATPase subunits detectable by northern analysis,
nor were there RT-PCR products amplified from RCCT-28A cells that could be directly
visualized by agarose gel electrophoresis. A more sensitive technique, Southern blotting of
the RT-PCR products using cDNA probes designed to hybridize to the expected products
was employed to demonstrate the presence of H,K-ATPase subunit mRNA in these cells.

83
RT-PCR products were amplified using RCCT-28A cell total RNA as a template. The
presence of HK(3 subunit mRNA was observed as a product of approximately 309 bp
hybridizing to a probe containing nucleotides 304-873 of the rabbit HK(3 sequence
obtained by Reuben et al. (1990) in gastric tissues (Figure 5-1 A). Sizes were estimated by
measurements from the original agarose gel on which a 100 bp ladder was visualized by
ethidium bromide staining. The “-RT” lanes in this and all subsequent figures depict
negative controls in which RT was omitted from reactions to show that the RNA template
was free of contaminants. Products amplified from mRNA isolated from rabbit renal
cortex tissue were also included in these experiments as a positive control for the RT-PCR
reaction. The hybridization of a probe specific for HKP to an RT-PCR product of the
expected size implied the presence of HK|3 in these cells.
At the time these experiments were carried out, the existence of alternatively spliced
FIKaj variants had not yet been discovered Therefore, these experiments were designed
only to show the presence of HKa: transcript in general, and do not differentiate between
the HKot2a and HKa:c species. For HKa: mRNA, a primer pair yielded the anticipated
product size of 305 bp. This product was hybridized with a probe of nucleotides
1264-1569 of the HKa*. sequence, contained in the region now known to be common to
HKaja and HKct2C (Figure 5-1B).
A similar strategy was employed to show that FlKai was present in the RCCT-28A
cells. Primers were designed to amplify a 611 bp region of HKa, mRNA (nucleotides
2537-3147), and again a product of the expected size was observed to hybridize to a
probe containing the same 611 bp region (Figure 5-1C). At the time these experiments

84
A) B)
600 bp -
300 bp -
100 bp -
RT
C)
600 bp -
300 bp -
100 bp -
RT
Figure 5-1. Southern blots of H,K-ATPase subunit mRNA in RCCT-28A cells. A)
Products amplified by RT-PCR were shown by Southern blot analysis. PCR primers
were designed to amplify a 309 bp region within the 3' UTR of H,K-ATPase p subunit.
B) PCR primers designed to amplify a 305 bp region within the coding sequence of
H,K-ATPase a2 subunit produced the products shown. C) PCR primers designed to
amplify a 611 bp region within the 3' UTR of H,K-ATPase a, subunit produced the
products shown. D) Restriction digests of the 611 bp fragment of H,K-ATPase a,.
Bam HI digestion was predicted to yield fragments of 423 and 187 bp. Pst I digestion
was predicted to yield fragments of 353 and 257 bp.

85
were ongoing, there were no reports in the literature of HKcti in kidney, so a further step
was taken to confirm the identity of these products. Restriction digests were carried out
on these products, and the anticipated size fragments were obtained (Figure 5-ID), further
evidence that these products corresponded to HKoii mRNA in RCCT-28A cells.
With further optimization of RT-PCR protocols, including such parameters as
annealing temperatures and number of amplification cycles, it was found that the RT-PCR
technique was capable of generating products visible by ethidium bromide staining of
agarose gels. This was a substantial improvement over the preceding experiments, because
it offered the opportunity to obtain nucleotide sequences of the PCR products to confirm
their identity. RT-PCR products were generated and sequenced using RCCT-28A cell
total RNA as a template. The presence of HK.p subunit mRNA was observed by
amplification of a 570 bp cDNA corresponding to nucleotides 304-873 of the sequence
obtained by Reuben et al. (1990) in gastric tissues (Figure 5-2A). Nucleotide sequencing
of the RCCT-28A product confirmed that the amplified product was identical with the
rabbit HK(3 subunit mRNA.
FfKcti was also shown to be present in the RCCT-28A cells by the same technique.
Primers were designed to amplify a 611 bp region of HKoti mRNA (nucleotides
2537-3147), and again a product of the expected size was observed (Figure 5-2B). The
nucleotide sequence was identical to that reported by Bamberg et al. (1992) except for
two single base mismatches. One mismatch was a transition of G->A at nucleotide 2567
and the other a G-*C transversion at nucleotide 3089; neither affected the deduced amino
acid sequence.

86
o
4~
o
H
H
cr
T3
po
n
r
n
P
O-
H
Q.
n
•t
00
>
i
po
H
po
a
3
P
+
PO
H
n
o
a
CD
X
Figure 5-2. HKp and HKa, subunit mRNA in RCCT-28A cells. PCR products were
generated using RCCT-28A cell and rabbit renal cortex total RNA. Amplification was
40 cycles for RCCT-28A cell PCR products and 30 cycles for renal cortex PCR
products. 100 bp ladder is shown for size reference.

87
For HK0C2 mRNA, a primer pair yielded the anticipated product of 305 bp, which was
identical to nucleotides 1264-1569 of the HK.a2a sequence. This segment was contained in
the region common to HKa2a and HKa2c (Figure 5-3A). To determine whether HKa2a and
HKa2c isoforms were both present in RCCT-28A cells, primer pairs were designed that
amplify regions specific to each isoform. HKa2a-specific primers amplify an 86 bp
(nucleotides 7-93 in the HKa2a sequence) RT- PCR product from RCCT-28A cellular
RNA and nucleotide sequence determination showed the product to be identical to the
sequence of the HKa2a cDNA from rabbit cortex (Figure 5-3B). A product of 354 bp
(nucleotides 24-377 in the HKa2l. sequence) amplified using rabbit renal cortex mRNA as
template was also generated (Figure 5-3C). The sequence of this product was identical to
the HKa2c cDNA sequence from rabbit renal cortex. Therefore, RCCT-28A cells
contained the mRNAs encoding all three HKa subunits and the HK|) subunit. Since
RCCT-28A cells are a clonal cell line, the implication is that individual A-type intercalated
collecting duct cells may express at least three different H,K-ATPases.
Detection of HKa subunit protein in RCCT-28A cells
With convincing evidence of the presence of mRNA for these H,K-ATPase subunits in
hand, the next logical experiments was to demonstrate that RCCT-28A cells also
produced H,K-ATPase proteins. We employed the antibodies described in previous
chapters to determine the H,K-ATPase catalytic subunits present in these cells. Using
western analysis and one of the antibodies to the common core of the HKa2 proteins
(LLC25 anti-HKa2 common) and two of the antibodies specific to HKa2c (LLC26 and

88
Figure 5-3. HKa2 subunit mRNA in RCCT-28A cells. PCR products were generated
using RCCT-28A cell and rabbit renal cortex total RNA. Amplification was 40 cycles
for RCCT-28A cell PCR products and 30 cycles for renal cortex PCR products. 100 bp
ladder is shown for size reference.

89
LLC27 anti-HKa2c), it was demonstrated that at least the HKa2c protein was present in
these cells. The second antibody to the common core protein (LLC24 anti-HKa2
common) failed to show reactivity in the RCCT-28A cells in initial experiments, and all
further western analysis was done using LLC25 (anti-HKa2 common). Of the two
HKa2c-specific antibodies, LLC27 (anti-HKa2c) gave the least background so it was
selected for all further western analysis.
In Figure 5-4A, immunoreactivity of LLC25 (anti-HKa2 common) to membrane
proteins of RCCT-28A cells is shown. Reactive protein was detected migrating at an
approximate molecular mass of 90 kDa, consistent with the presence of HKa2 subunit
protein in these cells. Although this broad band may represent a doublet, this has not been
clearly resolved. Figure 5-4B shows the results of western analysis of RCCT-28A protein
and the LLC27 (anti-HKa2c) antibody. A band was visible corresponding to a molecular
mass of 90 kDa, consistent with the presence of HKa2, subunit protein in the RCCT-28A
cells. Based on these data one may conclude that an HKa2c subunit protein was present,
but because two species were not discernable using LLC25 (anti-HKa2 common) it was
not proven that HKa2a subunit protein was there as well. Given the results using LLC25
(anti-HKa2 common) and LLC27 (anti-HKa2c) antibodies, it might be argued that only
HKa2c was present in RCCT-28A cells. It was only with difficulty that the doublet
indicative of both HKa2 proteins were observed in kidney, so not observing a doublet in
the RCCT-28A cell western should not be taken as proof of the absence of HKa2a protein.
Importantly, the preceding mRNA detection experiments showed that both alternatively
spliced transcripts were present in these cells.

90
A) B)
anti-HKa2 common
anti-HKa2c
121 kDa -
78 kDa -
50 kDa -
120 kDa -
80 kDa -
50 kDa -
n
n
o
o
H
H
to
to
oo
00
>
>
Figure 5-4. Western analysis showing presence of HKa2a and HKa2c protein in
RCCT-28A cells. A) Detected with the anti-HKa2 common antibody LLC25. B) Detected
with the anti-HKa2c-specific antibody LLC27.

91
In preliminary experiments involving RCCT-28A cells, the HKotrspecific antibodies
we produced (LLC22 and LLC23 anti-HKai) did not show reactivity. However, using
RCCT-28A cells we provided, Dr. Adam Smolka of the Medical University of South
Carolina did show reactivity to the HKcci antibody HK12.18 (personal communication).
Detection of H.K-ATPase activity in RCCT-28A cells
H,K-ATPase subunits were not detected in RCCT-28A cells by northern analysis, and
the subunits were apparently at relatively low abundance by western analysis. These
results implied that H,K-ATPase expression was at a low level in these tissue culture cells.
Because mRNA and protein levels were so low, it was necessary to determine a basal
H,K-ATPase activity in these cells. To confirm by an independent method that the
RCCT-28A clonal cell line has H,K-ATPase activity as previously reported (Bello-Reuss,
1993), fluorescence microscopy with digital video image analysis was used to measure pH,
recovery rates of individual cells after an acid load.
These experiments were undertaken in the laboratory of Dr. David Weiner, who had a
decade of experience making similar measurements, and kindly provided his equipment
and expertise. The development of a technique for measuring H,K-ATPase activity was
important for future studies undertaken by our lab, and the technique developed here
offered advantages over those previously used. This technique measures activity of
individual cells in order to achieve maximal sensitivity and to assess the homogeneity of
the population of tissue culture cells. Additionally, this technique used the same apparatus
used to measure H,K-ATPase activity in perfused tubules, allowing comparison to
activities measured in a system more representative of the kidney in the whole animal. The

92
actual protocols used underwent some evolution as described below. Results are first
described for the early protocols used to provide an appreciation for how the differing
protocols affected the measurements. Final results obtained by the refined protocol then
follow.
The technique used to measure H,K-ATPase activity in this work consisted of
fluorescence microscopy to observe changes in pH, of single cells while cells were
perfused by solutions containing various substrates and inhibitors. For example,
H,K-ATPase activity requires K+ entry for intracellular alkalinization. If H,K-ATPase
activity were the only method of acid extrusion available to an acidified cell, pH, would be
expected to rise back to its equilibrium pH, in solutions containing K4 due to exchange of
extracellular K4 for intracellular H\ In solutions lacking K\ this exchange would be
absent, and cells could not recover. The rate of pH, recovery (pH units/min) in the
presence of K+ would be proportional to H,K-ATPase activity. Another maneuver that
was used to identify H,K-ATPase activity was to measure recovery rates in the presence
and absence of an H,K-ATPase inhibitor. Like the absence of K+, the presence of the
inhibitor would block recovery of an acidified cell to normal pH,. By inhibition of other
mechanisms of pH, regulation, H,K-ATPase activity can indeed be isolated and rates
determined in this way.
pH, was determined by changes in fluorescence of the pH-sensitive dye BCECF. The
acetoxymethyl ester of BCECF crosses cell membranes freely, and intracellular esterases
cleave the ester bond trapping BCECF within the cell. Therefore, BCECF-AM was the
agent used to load cells with BCECF for pH, measurements. After BCECF loading, cells
were transferred to the microscope stage. The next step of the experiment was acid

93
loading of the cells. This was done using an NH4CI prepulse. Solution 2 (Table 2-2)
contained the neutral, membrane-permeant ammonia which entered the cell and
equilibrated to produce an amount of the weak acid ammonium. Upon removal of
ammonia from the extracellular solution, intracellular ammonia escaped the cell down its
electrochemical gradient. Ammonium was trapped within the cell by its membrane
impermeance, the electronegativity of the cell interior, and the fact that NFL7 is
transported inwardly by Na,K-ATPase. This trapped ammonium acidified the cells. As
already noted, following this acidification, measurements may be made of transporters that
mediate acid extrusion and thus give rise to alkalinization of the cell. Following these
measurements, the Na7H+ exchanger was released from inhibition, and in functional cells a
robust recovery toward equilibrium pH, for the cell ensues.
Once pH, for all the cells in the field of view of the microscope was recorded by the
computer for each time point in the experiment, analysis of the individual cells may begin.
The FL/1 program allows the selection of single cells, and the pH, is plotted through the
different changes of solution. Rates of change in pH, for the relevant periods may be
calculated by a spreadsheet computer program. It is these rates of recovery that were the
basis of defining H,K-ATPase activity.
The most robust and ubiquitous mechanism of pH, regulation in cells is the Na7H+
exchanger. The relatively large contribution to recovery from an acid load mediated by the
Na7H+ exchanger obscured recovery by other mechanisms, so its activity had to be
blocked for measurements of activities of other H' transporters. In the initial studies of
this work, Na" removal was used to block Na /H" exchanger activity. In these studies,
described more fully below, H,K-ATPase activity pH, recovery rates were low. At the

94
time, Dr. Weiner was attempting without success to detect H,K-ATPase activity in A-type
intercalated cells in perfused tubules. A suggestion by a reviewer of a manuscript from Dr.
Weiner’s laboratory was to utilize the potent amiloride analog EIPA to inhibit the Na+/H+
exchanger instead of using removal of Na\ As seen below, measurements of
H,K-ATPase-mediated recovery roughly doubled in the presence of Na* with EIPA, and
this must be regarded as a major improvement of this assay compared to its original form.
Hays and Alpern (1991) had previously observed an effect ofNa+ removal on pH,
regulation by H+ pumps, and in its final form, the study of A-type intercalated cells by
Milton and Weiner (1997) observed a similar effect.
Another major evolution of these studies was the finding that there were
time-dependent effects that appear after acid loading. These were never observed in
control experiments at a time less than 8 min following NH4C1 removal. After the 8 min
period, two separate effects that would disturb rate measurements were seen in some cells.
The first was that in some cells the recovery would plateau before attaining the normal
equilibrium, baseline pH,. When Na' was returned to solutions, or when EIPA was
removed, functional cells fully recovered toward baseline. This plateau effect has been
observed in previous studies of Na -independent pH, regulation (Montrose and Murer,
1986, Montrose et a/., 1987). The second confounding effect was that in the continued
absence of potassium a delayed increase in the pH, recovery rate developed, consistent
with a delayed stimulation of H -ATPase. These results were consistent with previous
results by Hays and Alpern (1991), who described an H -ATPase activity that was delayed
following an NH4C1 prepulse. Bello-Reuss (1993) also detected H -ATPase as well as
H,K-ATPase activity in RCCT-28A cells. As a consequence, the original protocols calling

95
for a period of K" absence followed by a period of K' addition had to be modified.
Experiments inolving perfused tubules typically involved taking data in absence then
presence of solution substrates or inhibitors, but in this system there was not sufficient
time following acid loading for rates to be accurately determined for both 1C absence and
K+ presence. Therefore, the final design of the protocol called for making multiple
separate measurements of K'-dependent recovery rates and IC-independent recovery
rates. Sch-28080-sensitive recovery rates were also determined in multiple separate
experiments. With measurements made in this way, there was a statistically significant
difference between the experimental conditions with the measurements being consistent
with the presence of an H,K-ATPase in RCCT-28A cells.
Apical IC-dependent RCCT-28A cell pH, regulation in the absence of Na*. Figure 5-5
shows a representative tracing of a cell that was acid loaded by an NH4C1 prepulse
{solution 2 added to basolateral chamber) and pH, recovery observed for a period of 5 min
in the absence of Na\ HCOf, or apical K {solution 3 in apical chamber, solution 4 in
basolateral chamber). Under these conditions, recovery of pH, to physiological range
mediated by such processes as NaVH exchange, C1/HC03 exchange, or apical H7K+
exchange would be blocked A population of cells was found in which the mean recovery
pH, rate was 0.000±0.001 pH units/min under these conditions, not significantly different
from zero. Upon switching the media perfusing the apical side to solution 4, a
K+-containing solution, a mean recovery rate of0.015±0.004 pH units/min was observed,
consistent with an apically located K-dependent mechanism of pH, recovery. With Na+
added to the perfusing solution, a robust recovery of pH, toward baseline value was
observed, presumably mediated by NaVH' exchange.

96
nh4+
-
+
Na+
+
+
Ap K+
+
+
Bl K+
+
Figure 5-5. pH, recovery from an acid load by RCCT-28A cells in the absence of Na+. A
representative tracing of pH, in an individual cell is shown. Periods during which
solutions contain 20 mM NH4C1, 120 mM Na+, and 5 mM K+ on apical (Ap) side are
indicated.Throughout the experiment 5 mM K+was present on basolateral (Bl) side. Cells
were acid loaded and recovery was observed in the absence of Ap K+, then in the presence
of Ap K+. No K+-independent recovery was observed, but in the presence of K+ there was
detectable recovery. Finally, Na+was added back and robust recovery was observed.

97
K+-dependent RCCT-28A cell pH, regulation in the presence of Na'. Because of the
rather modest level of H,K-ATPase activity detected in these cells, and because of results
obtained by Milton and Weiner (1997) indicating that Na* must be present for optimal
measurements of H,K-ATPase activity by this technique, we undertook studies in which
Na+ was present during the pH, recovery period following an acid load. The cells were
acid loaded by symmetrical addition of solution 5 containing 1 pM E1PA. In the absence
of K+ (symmetrical solution 6), a recovery rate that was not significantly different from
zero (0.001±0.003 pH units/min) could be measured in three separate cell preparations. A
K+-dependent recovery (symmetrical solution 1 plus 1 pM E1PA) could be observed
(0.032±0.006 pH units/min, P<0001 vs K -free perfusion). There was approximately a
three-fold activation of K - dependent recovery rate pH, attributable to the presence of
Na+ in the perfusing solutions.
K+-dependent. EIPA-sensitive RCCT-28A cell pH, regulation. The following
measurements represent the conclusive experiments, in which Na+ is present for maximal
H,K-ATPase activity and measurements were made during periods in which there were no
K+-independent artifacts. A representative tracing of a cell acid loaded by an NEECl
prepulse (symmetrical solution 5 plus 1 pM E1PA) and pH, recovery observed is shown in
Figure 5-6A. In a majority of RCCT-28A cells there was significant ElPA-insensitive pH,
recovery in K+-containing solutions (symmetrical solution 1 plus 1 pM EIPA). For 136
cells from six independent passages of RCCT-28A cells, the mean recovery rate was
0.022±0.005 pH units/min. In the absence of K (symmetrical solution 6 plus 1 pM
EIPA) during the period following acid load no immediate pH, recovery was observed
(Figure 5-6B). In five separate experiments (129 cells), the K-independent pH, recovery

98
nh4+
+
-
EIPA -
+
Figure 5-6. pH¡ recovery from an acid load by RCCT-28A cells in the presence of
EIPA. Representative tracings of pH¡ in individual cells are shown. Periods during which
solutions contain 20 mM NH4C1 and 1 mM EIPA are indicated. Cells were acid loaded
and recovery was observed in the presence of K+ (A), in the absence of K+(B) and in the
presence of Sch-28080 (C).

99
rate averaged 0.004±0.002 pH units/min (P<0.01 vs. 5 mM K+). The K+-independent,
EIPA-sensitive pH, recovery rate measured immediately after acid loading was less than
that measured during the protocols in which measurements were delayed with respect to
acid loading.
Sch-28080- and EIPA-sensitive RCCT-28A cell pH, regulation. To test the
hypothesis that K+- dependent pH, recovery from an acid load resulted from H,K-ATPase,
the effect of the classical H,K-ATPase inhibitor Sch-28080 (10 pM) was examined on
RCCT-28A cell pH, regulation (Figure 5-6C). After acid loading in solution 7 containing
Sch-28080 plus E1PA, cells were perfused in a K'-containing solution (solution 6 with
Sch-28080 plus EIPA). Using this protocol, 109 cells from four separate cell preparations
had a mean recovery rate of 0.002±0.002 pH units/min (P<0.05 vs. 5 mM K+, P=NS vs. 0
mM K+) in the presence of 10 pM Sch-28080.
Buffer capacity and pH, after acid loading The effects of the various protocols
performed in these experiments might be explained by differences in buffer capacity or the
degree to which cells are acidified by the NH4C1 pre-pulse. Although these experiments
directly measured the rate of pH, change, the variable of interest is proton flux; these two
values are directly related by buffer capacity. Thus, buffer capacity had to be considered to
avoid misconceptions concerning proton tlux changes based on observations of pH,
recovery rates. Buffer capacities measured by the NH?/NHf technique (Boyarsky et al.,
1988) in the presence of K\ absence of K , and presence of Sch-28080 were 15±1 mEq
H7pH, U/L cell volume, 16±1 (P=NS vs. 5 mM K+), and 16±2 (P=NS vs. 5 mM K+),
respectively. T herefore, changes in pH, recovery rates among the protocols could not be
attributed to changes in buffer capacities.

100
Some mechanisms of pH, recovery have recovery rates that are influenced by absolute
pH,, with a tendency for greater acidification to stimulate higher rates of pH, recovery.
Therefore, a change in the rate of recovery might have been due to differences in absolute
pH after acid loading. Actual nadir pH, observed in these experiments in the case of K"
presence, K+ absence, and Sch-28080 presence measured 6.64±0.06, 6.59±0.08 (P=NS vs.
5 mM K+), and 6.54±0.03 (P=NS vs. 5 mM IC). Consequently, changes in pH, recovery
rates among the protocols was not due to the nadir pH,.
Discussion
RCCT-28A cells contained the mRNAs encoding all three HKa subunits and the HKfl
subunit. Since RCCT-28A cells are a clonal cell line, the implication is that individual
A-type intercalated collecting duct cells may express at least three different H,K-ATPases.
The HKa subunit mRNA detected in RCCT-28A cells gives rise to at least the HKai and
HKa2c proteins. It is of interest that the most novel subunit, the alternatively spliced HKa2c
protein is indeed present in the cortical collecting tubule A-type intercalated cell line, in
agreement with the expectations brought by the immunohistochemistry studies. And like
the immunohistochemical evidence both with LLC22 (anti-HKa,) and in previous work by
others, the experiments with RCCT-28A cells adds to the evidence that HKai is also a
transporter expressed in the collecting duct A-type intercalated cell.
We elected not to pursue detection of HK0, the putative partner to HKai, due to time
constraints and because of our interest in characterizing our own antibodies. It has quite
recently (less than two months ago) been reported that NaK(3i is a likely partner to HKa2c

101
(Dubose et al., 1998; et al. Kraut et al., 1998), so detection of that subunit has also not
been done. The ubiquity of NaK(3, in the kidney and in the whole animal would make a
positive result by western analysis very difficult to interpret in terms of relevance to
H,K-ATPase.
We have provided independent confirmation of Bello-Reuss’ (Bello-Reuss, 1993)
report that RCCT-28A cells have H,K-ATPase activity. Either the presence of the
H,K-ATPase inhibitor Sch-28080 or the absence of IC virtually abolished the intracellular
alkalinization rates of RCCT-28A cells following an acid loading (Figure 5-7). When K+
was present on only the basolateral side of RCCT-28A cells, mean recovery rates were not
significantly different from zero. In the presence of K’, RCCT-28A ceils possessed a
mechanism for pH, recovery that exceeded the rates observed without K" or with
Sch-28080. These results constituted an independent confirmation of apical H,K- ATPase
activity in RCCT-28A cells.
Studies in heterologous expression systems (Codina et al., 1996; Cougnon et al.,
1996; Lee et al., 1995; Modyanov et al., 1995) and in a mammalian expression system
(Grishin et al., 1996) suggested that an H,K-ATPase with the HKa: subunit was less
sensitive to Sch-28080 inhibition than the HKo.i pump, thus the differential sensitivity of
the two enzymes offered the possibility of discriminating between the two at the level of
activity. In this study the K*-independent and Sch-28080-sensitive pH, recoveries were
similar, arguing that HKoti is the isoform responsible for basal levels of H,K-ATPase
activity in RCCT-28A cells. But!in-Meyer et at. (1997) observed a like situation in rat

dpH/dt (pH units/min)
102
0.030
0.025
0.020
0.015
0.010
0.005
0.000
5 mM K+ 0 mM K+ 10 uM SCH
Figure 5-7. Summary of the rates of pH recovery from an acid load by RCCT-28A
cells. Mean rates of recovery are indicated by unfilled (presence of K+), black (absence
of K+), and stippled (in the presence of Sch-28080 with Represent) bars. * P<.01 vs. 5
mM K+. ** P<.05 vs. 5 mM K+, P=NS vs. 0 K+.

103
CCD, in which H,K-ATPase activity was abolished by Sch-28080 under normal
conditions, and resistant to Sch-28080 only during K' depletion, suggesting up-regulation
or mobilization of HKa? pumps. If basal H,K-ATPase activity in RCCT-28A cells is
mediated primarily by HKoti, then post-transcriptional regulation may explain the
functional silence of the HKot: enzymes. However, there is not yet a clear understanding
of the Sch-28080 inhibitor profile. In the mammalian expression system (Grishin et al.,
1996), the HKot: activity is inhibited by Sch-28080 at lower concentrations than in the
heterologous expression systems. Also, it was not certain that the P isoform paired with
the HKot: subunit in the expression systems is the one that associates with it in vivo.
Sch-28080 may have an artificially reduced potency in expression systems due to the lack
of association of the correct P subunit or some other indirect effect, therefore conclusions
reached based on the inhibitor profile must be interpreted cautiously.
HKa2 is sensitive to the inhibitor ouabain (Modyanov et al., 1995; Codina et al. 1996,
Cougnon et al., 1996; Grishin et al., 1996), while HKoti has no apparent sensitivity,
suggesting a potential means to discriminate on a pharmacological basis between the
activity of the two isoforms. However, the primary action of ouabain is inhibition of
Na,K-ATPase, so application of ouabain would disturb the Na* and K’ equilibria of the
cell. Indeed, in preliminary experiments discussed above, H,K-ATPase activity was
observed to be profoundly affected by the presence or absence of Na\ Therefore, any
effect of ouabain on apparent activities of the ot: subunit H,K-ATPases could not be
distinguished from a secondary effect due to inhibition of Na,K-ATPase. Only when a

104
great deal more is known about the effect of specific inhibitors on H,K-ATPase isoforms,
including any species differences in their potency, would inhibitor studies be valuable.
Fluorescent measurements of pH, recovery rates attributable to H,K-ATPase activity
in microperfused CCD in previous studies (Constantinescu t•! al., 1997; Silver et al., 1993;
Silver eta/., 1996; Weiner and Milton, 1996, Milton and Weiner, 1997; Silver et al.,
1997) have yielded values between 0.03±0.01 and 0.129±0.045 pH U/min. These values
are greater than those in the present study, but transport activity in continuous cell lines is
typically less robust than that of microperfused tubules. Another continuous cell line of
renal origin, a mouse inner medullary collecting duct cell line, has been studied using these
techniques and recovery rates of 0.055 ±0.009 were observed Ono et al., (1996). Species
difference and axial heterogeneity of the collecting duct may explain the difference in rates
between the two renal cell lines.
A major goal of this project was to define which cell type or types in the kidney
contain H,K-ATPase. The RCCT-28A cell line, which has many characteristics of the
collecting duct acid-secreting intercalated cell, clearly expresses several H,K-ATPases.
Although mRNA and protein level were low, there was detectable H,K-ATPase activity in
these cells. Multiple H,K-ATPase isoforms may contribute to this activity.
Understanding of HT and K+ transport in the collecting duct by H,K-ATPases must
involve investigations into the kinetics and regulation of each isoform. Each H,K-ATPase
isoform might have been limited to a different single cell type rather than a single cell
containing multiple H,K-ATPases. It was important to determine which of these cases
actually occurs. An interesting aspect to these studies is the implication that regulatory
processes of the various H,K-ATPase isoforms reside in a single cell type. This would

105
allow an interplay at the intracellular level between isoforms, perhaps by crosstalk between
signal transduction pathways, or perhaps even by physical interaction between different
H,K-ATPase subunit isoforms.

PERSPECTIVE AND FUTURE DIRECTIONS
Multiplicity of H.K-ATPase Isoforms in the Kidney
Just in the last decade it has become known that H,K-ATPase is one of the enzymes
that contributes to regulation of acid/base balance and potassium homeostasis by the
kidney (Doucet and Marsy, 1987; Wingo, 1989). Only recently have the molecules that
mediate this activity in the kidney been identified (Modyanov et a/., 1991; Callaghan et al.,
1995; Ahn and Kone, 1995; Kone and Higham, 1998). This year, evidence was provided
by two independent investigations that the NaKPi subunit also is a participant in
H,K-ATPase activity (DuBose el al., 1998; Kraut et al., 1998). These studies showed that
NaK(3i subunit was the long-sought P subunit that associates with the H,K-ATPase
catalytic subunit discovered in distal colon by Crowson and Shull (1992). Thus, there is a
great deal of complexity at the molecular level behind the H,K-ATPase activity that was
observed in the kidney.
The studies described in this dissertation address the molecular nature of
H,K-ATPases in the kidney. A novel FIKp subunit variant mRNA (HKP’) specific to renal
medulla was found by northern analysis. In addition to the canonical transcript, the novel
mRNA was expressed in the renal medulla, but not in renal cortex or stomach. The HKP’
subunit mRNA may have been a product of medulla-specific alternative splicing at the 5’
end of the HKP gene. There was individual variation in rabbits with respect to
106

107
relative abundance of HKP and HKP’ subunit niRNA in medulla of the kidney, but HKP’
was apparently not regulated by dietary K restriction. The existence of HKP’ shows that
the nature of H,K-ATPase P subunits, as well as a subunits, is complex and must be
considered in understanding H,K-ATPase function in the kidney.
A number of H,K-ATPase a subunit cDNAs have been cloned and sequenced from
various species. They might be initially characterized by their tissue distribution. First,
there was the well-known gastric isoform HKcti subunit cloned from rat (Shull and
Lingrel, 1986), pig (Maeda et al., 1988), human (Maeda el al., 1990), rabbit (Bamberg et
al., 1992), frog (Mathews et al., 1995), and mouse (Mathews et al., 1995). Second, there
were H,K-ATPase catalytic isoforms cloned from human axillary skin (Modyanov et al.,
1991), rat distal colon (Crowson and Shull, 1992), guinea pig distal colon (Watanabe et
al., 1993), and a partial cDNA from rabbit kidney (Fejes-Toth et al. 1995). These were
not detected in stomach, but were expressed in numerous other tissues, primarily distal
colon. Thus far, at most two P-type H,K-ATPase a subunit isoforms have been identified
in any one species. Alternatively spliced variants of the non-gastric isoforms have been
found in rat (Kone and Higham, 1998) and rabbit (Campbell et al., 1998).
An H,K-ATPase catalytic subunit has been cloned from the bladder of the toad Bufo
wat inns that had a tissue distribution that contrasted with that seen in mammals (Jaisser et
al., 1993). While northern analysis detected the toad HKa transcripts in bladder, it was
not observed in either stomach or distal colon. This may reflect differences in physiology
between the toad and mammalian species. For example, the toad may not require distal

108
colonic K+ reabsorption for K" homeostasis. On the other hand, the toad HKa may be the
first evidence of an H,K-ATPase subunit that has escaped detection in mammals.
Controversy persists over the nomenclature of H,K-ATPase subunits. Some
investigators classify the rat non-gastric HKa as a different H,K-ATPase than the human
non-gastric HKa. This is based on qualitative differences in inhibitor profile observed for
rat and human non-gastric isoforms in heterologous expression systems. Under their
nomenclature, rat and human H,K-ATPase subunits are referred to as HKa2 and HKcu,
respectively. Quantitative differences in sensitivities to inhibitors may not be a valid
measure by which to classify orthologous groups. The Na,K-ATPases also have widely
differing qualitative differences between species in their response to inhibitors. As an
example ouabain, the widely used “specific” inhibitor of Na,K-ATPases, is highly effective
against the pumps in most species other than rat. For rat NaKai, ouabain is effective only
at higher concentrations, but the rat NaKai is not thought of as a different NaKai than
other species. To classify H,K-ATPase isoforms, it might be more valuable to first look at
tissue distribution This would lead to three classes of H,K-ATPase catalytic subunits.
HKai would continue to denote the gastric H,K-ATPases catalytic subunits, HKa2 would
refer to the non-gastric isoforms of H,K-ATPase a subunits, and HKa? would denote the
toad bladder isoform. It became one of the goals of this dissertation to determine how the
rabbit HKa isoform related to other H,K-ATPases. Rabbit, rat, and human non-gastric
H,K-ATPase cDNA sequences will best fit into a single group based on their tissue
distribution and on their phylogenetic relationship.

109
A search for novel P-type H,K-ATPases expressed in the kidney was performed. The
purpose of this was twofold. First, a rabbit HKa2 sequence was needed to design reagents
for study of H,K-ATPase regulation and function in the kidney. In addition, the sequence
would be useful to compare and contrast with HKot;» sequences found in other species to
examine their relationship and find important conserved motifs. Second, it was hoped that
such a search would find any previously unknown H,K-ATPase catalytic subunit isoforms.
The search as conducted was by no means exhaustive, once an interesting fragment of
sequence was found, no further attempts were made to find others. However, other
investigators also looking for novel H,K-ATPases in rabbit kidney also found the same
isoform as described in this work (Fejes-Toth el al., 1995; Jaisser, personal
communication). Because of the numerous attempts to expand the number of
H,K-ATPases known in human and rat (Shull and Lingrel, 1987; Sverdlov el al., 1987;
Modyanov el al., 1991; Crowson and Shull, 1992), it must now be regarded as less likely
that completely novel mammalian isoforms will be found.
An HKot subunit isoform was found that had high homology to human and rat HKa2.
The relationship of the rabbit HKa subunit isoform to other H,K-ATPases and
Na,K-ATPases was computationally analyzed by the distance and maximum parsimony
algorithms. It was found that sequences for rat and human HKa.: subunit isoforms were
more closely related than HKai or the Na,K-ATPases. The HKa3 subunit sequence of
Bufo marinus was slightly more homologous to the HKa: subunit sequences than to the
HKai sequences. Without more H,K-ATPase sequences related to HKa.:, its exact
relationship to other H,K-ATPases will be difficult to judge.

110
Kone and Higham (1998) had found an alternatively spliced 5’ end of an mRNA that
they designated HKa2b. In the work described here, there were two 5’ ends found in
rabbit as well. The translation start sites of the rabbit and rat alternatively spliced variants
are not conserved. In the rat HKa2b mRNA, the start codon is downstream of the splice
site (Kone and Higham, 1998), and in the rabbit HKa2c the start codon is upstream of the
splice site. For this reason, the rabbit H,K-ATPase catalytic subunit that is the product of
alternative splicing was designated HKa2c. However, the pattern of exons and introns at
the 5’ end of the HKa2 gene in rat and rabbit was determined to be the same. The
relationship shown by phlogenetic analysis and the similarity of alternative splicing implied
that rat and rabbit HKa2 do indeed represent the same gene in different species. An
alternatively spliced transcript has not so far been observed for human HKa2, but that does
not constitute absolute evidence that a similar variant was not transcriptionally competent
in human. The human HKa2 gene sequence (Sverdlov el al., 1996) predicts a translational
start codon that was different from both rat and rabbit, downstream of the splice site, but
upstream of the first in-frame ATG known for rat. Based on phylogeny, the human HKa2
was also an ortholog, with its alternatively spliced transcript thus far unseen.
Because of the lack of conservation of splice sites between rat and rabbit alternatively
spliced HKct:, it was necessary to determine that the start codon in rabbit that gave rise to
the longest open reading frame was indeed used. Western analyses using the anti-HKa2
common and anti-HKa2c antibodies showed a pattern of reactivity consistent with
theHKa2c protein being larger than theHKa2a protein. Therefore, the predicted start codon
is the one used in rabbit.

Ill
The work involved in this dissertation did not succeed in answering the question of
why so many H,K-ATPase isoforms exist. With respect to HKa:c, regulation by covalent
modification is rendered a less attractive possibility by the lack of conservation of the
amino terminal end. The potential phosphorylation sites that were identified by computer
analysis in the rabbit are within the amino terminal region that is missing in the rat.
Immunohistochemistry showed that the localization of HKa:c within the kidney did not
differ widely from that previously found for HKai. HKa:c is apparently not the molecule
that is responsible for the basolateral H,K-ATPase activity characterized in proximal
tubule and thick ascending limb of Henle by Younes-Ibrahim e! al. (1995).
The existence of an alternatively spliced isoform offers the possibility of more complex
transcriptional regulation. One alternatively spliced isoform may be responsive to different
stimuli than another. Perhaps the protein arising from the alternative splicing has different
properties, such as kinetic parameters, degradation rates, or internalization rates. Protein
interactions have been seen to have major effects on such catalytic properties as ATP
binding affinity (Morii el al., 1996), and the amino terminal extension could easily play a
role in intra-molecular interaction with other H,K-ATPase molecules or with other
proteins. Regulatory proteins could bind the extension to activate or inactivate the
enzyme. There is also a possible role of the upstream open reading frames in reducing the
efficiency of translation All these possibilities deserve attention, and work is under way in
the Cain laboratory to explore the ways in which HKa:a and HKa2C differ functionally in
an expression system.

112
Cell Type Specificity of H.K-ATPase in the Kidney
H,K-ATPase activity is found at highest level in collecting duct, with some
investigators reporting activity in thick ascending limb (Younes-lbrahim et ctl., 1995). In
situ hybridization studies have been conducted that show the distribution of HKai (Ahn
and Kone, 1995) and HKP (Campbell-Thompson et al., 1995). Both HKai and HKP
share a similar distribution, primarily in collecting duct intercalated cells. A similar cellular
distribution was obtained by immunohistochemistry for HKai, with apical polar
distribution (Wingo el al., 1990; Haragsim and Bastani, 1996). In immunohistochemical
studies using the anti-HKa2c carried out by Dr. Jill Verlander, a similar localization of
immunoreactivity was seen, indicating that HKa2c was expressed in generally the same cell
types and polarity as HKai and HKP The implication was that HKa2c represents an
H,K-ATPase that has the same qualitative function as other H,K-ATPases, but may have
some regulatory differences. The observation that HKai, HKa2a, HKa2c, and HKP were all
detected in an acid-secreting intercalated cell line of the cortical collecting duct adds to the
weight of the evidence that one of the cell types in vivo expressing H,K-ATPase subunits
were A-type intercalated cells. It was highly interesting that all these acid pumps, like the
V-type H-ATPase (Haragsim and Bastani, 1996) are expressed in the same cells. These
cells are uniquely differentiated to mediate acid secretion. Intercalated cells undergo
hypertrophy and hyperplasia in animals facing an acid compromise. Because of the
capability of that single cell type to increase the overall capability of the kidney for
handling an acid state, it is logical that the molecules that participate is acid extrusion may
be found in that cell type.

113
Future Studies
The studies detailed in this dissertation naturally lead to many questions and must
leave many of these questions unanswered. The most pressing question upon finding a
novel enzyme or variation on an enzyme is what is the significance of the novelty? In the
cases of HKP’ and HKa^c, efforts were begun to answer this question, but the answer lies
elsewhere in experiments yet to be done. Dietary 1C restriction was tested as a possible
regulatory factor, and mineralocorticoid levels and acid/base status are likely candidates
that remain to be examined. Immunohistochemistry failed to reveal any large departure of
HKoq-c localization compared to other H,K-ATPases in the kidney, but this localization
could change upon disturbances in acid/base, 1C, or mineralocorticoid status. There are no
immunohistochemical studies available for any of the H,K-ATPases under these three
conditions.
One would expect that if there were a third mammalian H,K-ATPase a subunit, with
the number of investigators searching, that it would have been found. Perhaps there is
some sequence-specific difficulty in its amplification or cloning. A difference in size or
secondary RNA structure could affect the efficiency with which a novel sequence was
amplified. Perhaps RT-PCR reactions using degenerate primers ought to be attempted in
greater numbers to increase the chance of finding a truly novel H,K-ATPase, one that is
either difficult to process or at a much lower level than other P-type ATPases. The
experiment would have to be done many more times. This is practical given current prices
for reagents and sequencing. The HKa? subunit mRNA fragment was found in the third

114
reaction; if a novel sequence were present at tenfold less copies per reaction or ten-fold
lower efficiency, it should be found in thirty reactions.
There is evidence of an H,K-ATPase in thick ascending limb having different
properties than known H,K-ATPases (Younes-lbrahim el al., 1995; Buffin-Meyer et al.,
1997). This is tantalizing evidence that more H,K-ATPase molecules may exist. RT-PCR
is now being carried out in glass capillaries with vanishingly small amounts of starting
material. Perhaps this could help by allowing individual regions of nephron and collecting
duct to be tried as sources for novel H,K-ATPases.
To look at the question of novel H,K-ATPases a different way, it will over the next
five to ten years be a simpler task to put an upper limit on how many P-type H,K-ATPases
there are. If this number were raised, it would lend weight to the argument for more
attempts at finding novel H,K-ATPase molecules. All of the P-type H,K-ATPases pointed
to by earlier work by Shull and Lingrel (1987) and Sverdlov el al. (1987) have now been
associated with a specific enzyme. Southern analysis of restriction digested genomic DNA
probed at low stringency by probes corresponding to well-conserved regions of P-type
ATPases could help determine the number of P-type Na,K- and H,K-ATPases exist. With
the sequencing of the human genome, such searches will be able to be carried out in silico.
This will allow many more parameters in the experiment.
Alternative splicing has now been observed in rat and rabbit HKa: It would be quite
interesting to try to observe alternative splicing of a transcript in human HKa: as well. A
positive result would constitute one further piece of evidence that the rat, rabbit, and
human genes are analogs of the same gene in different species. Another piece of
interesting evidence could come from chromosomal location of these genes. If the genes

115
were found in syntenic regions, it would strengthen the argument for their being analogs
of the same gene in different species considerably.
Much work remains to be done in appreciating the localization of the H,K-ATPases in
the kidney. Double-labeling immunohistochemistry using well-characterized markers
would help define the cell types in which each H,K-ATPase subunit isoform was
expressed. Quality antibodies are available for carbonic anhydrase, a marker for
intercalated cells, and for band 3 protein, a marker for A-type intercalated cells. This
would help refine our knowledge of the cell types in which H,K-ATPase is expressed. At
present, an experienced eye is the main tool for determining cell types. With
double-labelling experiments, the conclusions would be more concrete.
A major advance in making H,K-ATPase activity measurements would be to find
inhibitors that worked at low concentrations with high specificity. Characterization has
been limited to the effects of Sch-28080 and ouabain action on HKa>, but literature is
conflicting with respect to the concentrations observed for inhibition constants (Modyanov
et al., 1995; Codina et al., 1996; Grishin el al., 1996; Cougnon el al., 1996). These
conflicts need to be resolved, and other H,K-ATPase inhibitors, such as omeprazole or
A80915A, might be tried to measure their action on the HKot: species. These experiments
would preferably be conducted in mammalian expression systems. Members of the Cain
laboratory are in the process of developing such a system. With useful information about
inhibitor profiles, studies in perfused tubules might be performed to determine the cell
types that have the various H,K-ATPase activities Protocols for determining cell types
functionally in perfused tubules are well known.

116
To answer broader questions, such as how does the kidney respond to acid/base
disturbances, K+ restriction, or mineralocorticoid levels, new techniques will be useful.
There are now blot arrays available that have many cDNAs attached. These may be
probed with labelled mRNA from controlled and treated animals and differentials in many
mRNA levels observed in parallel. Each cDNA had an assigned location on the blot, so
one can quickly find what transcript is being regulated. For a more all-encompassing
approach to these experiments, microarrays may be used that can have even more cDNAs
on them. These methods study many regulatory processes in parallel, and could be a quick
way to pinpoint interesting responses. However, these techniques require first that the
responsive element was identified and sequenced. That was the goal of this work, to
identify and characterize H,K-ATPase molecules, elements that play a role in the
biological processes carried out in the kidney.
To that end, variants of HK.p and HKa: have been found and their sequences
determined. Such tools as cDNA probes and antibodies have been produced. These are a
prerequisite for determining the significance of the novel H,K-ATPases. It was shown that
HKa;>c protein is expressed and that the predicted start codon is used Evidence by
immunohistochemistry and the presence of mRNA and protein in an A-type intercalated
collecting duct cell line showed that acid-secreting intercalated cells are a major cell type
in which HKaic pumps may be found The HKoüc pump adds to the complement of
transporters that may mediate acid secretion and K reabsorption in those cells. These
results define H,K-ATPase varieties that were not known when this work began.

REFERENCES
Addison, W. L. T. The use of sodium chloride, potassium chloride, sodium
bromide, and potassium bromide in cases of arterial hypertension which are amenable to
potassium chloride. Can Med Assoc H 18: 281-5, 1928.
Ahn, K. Y., and B C. Kone. Expression and cellular localization of mRNA
encoding the "gastric" isoform of H(+)-K(+)-ATPase alpha-subunit in rat kidney. Aw J
Physiol 268: F99-109, 1995.
Ahn, K. Y., K. Y. Park, K. K. Kim, and B. C. Kone. Chronic hypokalemia
enhances expression of the H(+)-K(+)-ATPase alpha 2-subunit gene in renal medulla. Aw
J Physiol 271: F3 14-21, 1996.
Altschul, S. F., W. Gish, W Miller, E. W. Myers, and D. J. Lipman. Basic local
alignment search tool. J Mol Biol 215: 403-10, 1990.
Ambard, L., and C. Beaujard Causes de l'hypertension arterielle. Arch Gen Med
10: 520-33, 1904.
Arend, L. J., J. S. Flandler, J. S. Rhim, F. Gusovsky, and W. S. Spielman.
Adenosine-sensitive phosphoinositide turnover in a newly established renal cell line. Aw J
Physiol 256: FI067-74, 1989.
Bairoch, A., and R. Apweiler. The SW1SS-PROT protein sequence data bank and
its new supplement TREMBL. Nucleic Acids Res 24: 21 -5, 1996.
Bamberg, K., F. Mercier, M A. Reuben, Y. Kobayashi, K. B. Munson, and G.
Sachs. cDna cloning and membrane topology of the rabbit gastric H+/K(+)-Atpase
alpha-subunit. Biochiw Biophys Acta 1131: 69-77, 1992.
Bamberg, K., and G Sachs. Topological analysis of H+,K(+)-ATPase using in
vitro translation. J Bio! Chew 269: 16909-19, 1994.
Bastani, B. Colocalization of H-ATPase and H,K-ATPase immunoreactivity in the
rat kidney. J Aw Soc Nephrol 5: 1476-82, 1995.
Bello Reuss, E. Characterization of acid-base transport mechanisms in the kidney
cell line RCCT-28A. Kidney Ini 43: 173-81, 1993.

118
Besancon, M, J. M. Shin, F. Mercier, K. Munson, M. Miller, S. Hersey, and G.
Sachs. Membrane topology and omeprazole labeling of the gastric
H+,K(+)-adenosinetriphosphatase. Biochemistry 32: 2345-55, 1993.
Blanco, G., J. C. Koster, and R. W. Mercer. The alpha subunit of the
Na,K-ATPase specifically and stably associates into oligomers. Proc Natl Acad Sci USA
91: 8542-6, 1994.
Buffin Meyer, B., M. Younes Ibrahim, C. Barlet Bas, L. Cheval, S. Marsy, and A.
Doucet. K depletion modifies the properties of Sch-28080-sensitive K-ATPase in rat
collecting duct. Am J Physio1272: F124-31, 1997.
Burnatowska-Hledin, M. A., and W. S. Spielman. Vasopressin increases cytosolic
free calcium in LLC-PK1 cells through a VI-receptor. Am J Physiol 253: F328-32, 1987.
Callaghan, J. M , S. S. Tan, M. A. Khan, K. A. Curran, W. G. Campbell, A. J.
Smolka, B. H. Toll, P. A. Gleeson, C. S. Wingo, B. D. Cain, and et al. Renal expression of
the gene encoding the gastric H(+)-K(+)-ATPase beta-subunit. Am J Physiol 268:
F363-74, 1995.
Campbell Thompson, M. L., J W Verlander, K. A. Curran, W. G. Campbell, B.
D. Cain, C. S. Wingo, and J. E. McGuigan. In situ hybridization of H-K-ATPase
beta-subunit mRNA in rat and rabbit kidney. Am J Physiol 269: F345-54, 1995.
Canfield, V. A., and R. Levenson. Structural organization and transcription of the
mouse gastric H+, K(+)-ATPase beta subunit gene. Proc Natl Acad Sci USA 88: 8247-51,
1991.
Cheval, L, C. Barlet Bas, C. Khadouri, E. Feraille, S. Marsy, and A. Doucet.
K(+)-ATPase-mediated Rb+ transport in rat collecting tubule: modulation during K+
deprivation. Am J Physiol 260: F800-5, 1991.
Chomczynski, P., and N. Sacchi. Single-step method of RNA isolation by acid
guanidinium thiocyanate-phenol-chloroform extraction. Anal Biochem 162: 156-9, 1987.
Chow, D. C., C. M. Browning, and J. G. Forte. Gastric H(+)-K(+)-ATPase
activity is inhibited by reduction of disulfide bonds in beta-subunit. Am J Physio! 263:
C39-46, 1992.
Chow, D. C., and J. G. Forte. Characterization of the beta-subunit of the
H(+)-K(+)-ATPase using an inhibitory monoclonal antibody. Am J Physiol 265:
Cl 562-70, 1993.

119
Codina, J., J. T. Delmas-Mata, and D. T. D Jr. The alpha-subunit of the colonic
H+,K+-ATPase assembles with the betal-Na+,K+-ATPase in kidney and distal colon. J
Biol Chem 273: 7894-9, 1998.
Codina, J., B. C. Kone, J. T. Delmas Mata, and T. D. DuBose, Jr. Functional
expression of the colonic H+,K+-ATPase alpha-subunit. Pharmacologic properties and
assembly with X+,K+-ATPase beta-subunits. J Biol Chem 271: 29759-63, 1996.
Colonna, T. E., L. Huynh, and D. M. Fambrough. Subunit interactions in the
Na,K-ATPase explored with the yeast two-hybrid system. J Bio! Chem 272: 12366-72,
1997.
Constantinescu, A., R. B. Silver, and L. M. Satlin. H-K-ATPase activity in
PNA-binding intercalated cells of newborn rabbit cortical collecting duct. Am J Physiol
272: F167-77, 1997.
Cougnon, M., G. Planelles, M. S. Crowson, G. E. Shull, B. C. Rossier, and F.
Jaisser. The rat distal colon P-ATPase alpha subunit encodes a ouabain-sensitive H+,
K+-ATPase. J Biol Chem 271: 7277-80, 1996.
Courtois-Coutry, N., D. Roush, V. Rajendran, J. B McCarthy, J. Geibel, M.
Kashgarian, and M. J. Caplan. A tyrosine-based signal targets H/K-ATPase to a regulated
compartment and is required for the cessation of gastric acid secretion. Cell 90: 501-10,
1997.
Cox, K. H , and J. V. Cox. Variant chicken AE1 anion exchangers possess
divergent NH(2)-terminal cytoplasmic domains. Am J Physiol 268: F503-13, 1995.
Crowson, M. S., and G. E. Shull. Isolation and characterization of a cDNA
encoding the putative distal colon H+,K(+)-ATPase. Similarity of deduced amino acid
sequence to gastric H+,K(+)-ATPase and Na+,K(+)-ATPase and mRNA expression in
distal colon, kidney, and uterus. J Biot Chem 267: 13740-8, 1992.
Curran, K. A., M. J. Hebert, B. D. Cain, and C. S. Wingo. Evidence for the
presence of a K-dependent acidifying adenosine triphosphatase in the rabbit renal medulla.
Kidney Ini 42: 1093-8, 1992.
Dafnis, E., M. Spohn, B. Louis, N. A. Kurtzman, and S. Sabatini. Vanadate causes
hypokalemic distal renal tubular acidosis. Am J Physio! 262: F449-53, 1992.
Davis, L. G , W. M. Kuehl, and J F. Battey. Basic Methods in Molecular Biology,
2nd edition. Norwalk, CT: Appleton and Lange, 1994.
Dietl, P , N. Kizer, and B. A. Stanton. Conductive properties of a rabbit cortical
collecting duct cell line: regulation by isoproterenol. Am J Physio! 262: F578-82, 1992,

120
Dietl, P., and B. A. Stanton. Chloride channels in apical and basolateral
membranes of CCD cells (RCCT-28A) in culture. Am J Physiol 263: F243-50, 1992.
Doucet, A., and S. Marsy. Characterization of K-ATPase activity in distal
nephron: stimulation by potassium depletion. Am J Physiol 253: F418-23, 1987.
DuBose, T. D., Jr., J. Codina, A. Burges, and T. A. Pressley. Regulation of
H(+)-K(+)-ATPase expression in kidney. Am J Physiol 269: F500-7, 1995.
Farley, R. A., and L. D Faller. The amino acid sequence of an active site peptide
from the H,K-ATPase of gastric mucosa. J Biol Cham 260: 3899-901, 1985.
Fejes-Toth, G., E. Rusvai, K. A. Longo, and A. Naray Fejes-Toth. Expression of
colonic H-K-ATPase mRNA in cortical collecting duct: Regulation by acid/base balance.
Am J Physiol 269: F551-7, 1995.
Frohman, M. A., M. K. Dush, and G. R. Martin. Rapid production of full-length
cDNAs from rare transcripts: amplification using a single gene-specific oligonucleotide
primer. Proc Natl Acad Sci USA 85: 8998-9002, 1988.
Ganser, A. L., and J. G. Forte. K + -stimulated ATPase in purified microsomes of
bullfrog oxyntic cells. Biochim Biophys Ada 307: 169-80, 1973.
Garg, L. C. Respective roles of H-ATPase and H-K-ATPase in ion transport in the
kidney. J Am Soc Nephrol 2: 949-60, 1991.
Garg, L. C., and N. Narang. Ouabain-insensitive K-adenosine triphosphatase in
distal nephron segments of the rabbit. J Clin Invest 81: 1204-8, 1988.
Garg, L. C., and N. Narang. Suppression of ouabain-insensitive K-ATPase activity
in rabbit nephron segments during chronic hyperkalemia. Ren Physiol Biochem 12:
295-301, 1989.
Geering, K., 1. Theulaz, F. Verrey, M. T. Hauptle, and B. C. Rossier. A role for
the beta-subunit in the expression of functional Na+-K+-ATPase in Xenopus oocytes. Am
J Physiol 257: C85 1-8, 1989.
Grishin, A. V., M. O. Bevensee, N. N. Modyanov, V Rajendran, W. F. Boron,
and M. J. Caplan. Functional expression of the cDNA encoded by the human ATP1AL1
gene. Am J Physio! 271: F539-51, 1996.
Grishin, A. V., V. E. Sverdlov, M B. Kostina, and N. N. Modyanov. Cloning and
characterization ot the entire cDNA encoded by ATP1AL1—a member of the human
Na,K/H,K-ATPase gene family. FEBS Lett 349: 144-50, 1994.

121
Guntupalli, J., M. Onuigbo, S. Wall, R. J Alpern, and T. D. DuBose, Jr.
Adaptation to low-K+ media increases H(+)-K(+)-ATPase but not
H(+)-ATPase-mediated pHi recovery in OMCD1 cells. Am J Physiol 273: C558-71, 1997.
Gustin, M. C., and D. B. Goodman. Isolation of brush-border membrane from the
rabbit descending colon epithelium. Partial characterization of a unique K+-activated
ATPase. J Biol Chem 256: 10651-6, 1981.
Guyton, A. C., and J. E. Hall Textbook of Medical Physiology. Philadelphia, PA:
W. B. Saunders, 1996.
Hall, K., G. Perez, G. Sachs, and E Rabón. Identification of H+/K(+)-ATPase
alpha,beta-heterodimers. Biochim Biophys Acta 1077: 173-9, 1991.
Hays, S. R , and R. J. Alpern. Inhibition of Na(+)-independent H+ pump by
Na(+)-induced changes in cell Ca2+. J Gen Physio! 98: 791-813, 1991.
Hebert, H., Y. Xian, 1. Hacksell, and S. Mardh. Two-dimensional crystals of
membrane-bound gastric H,K-ATPase. FEBS Lett 299: 159-62, 1992.
Hersey, S. J., and G. Sachs. Gastric acid secretion. Physiol Rev 75: 155-89, 1995.
Herzlinger, D. A., T. G. Easton, and G. K. Ojakian. The MDCK epithelial cell line
expresses a cell surface antigen of the kidney distal tubule. J Cell Biol 93: 269-77, 1982.
Horisberger, J. D , P. Jaunin, M. A. Reuben, L. S. Lasater, D. C. Chow, J. G.
Forte, G. Sachs, B. C. Rossier, and K. Geering. The H,K-ATPase beta-subunit can act as
a surrogate for the beta-subunit of Na,K-pumps. J Biol Chem 266: 19131-4, 1991.
INTERSALT. Intersalt: an international study of electrolyte excretion and blood
pressure. Results for 24 hour urinary sodium and potassium excretion. Intersalt
Cooperative Research Group. BMJ 297: 319-28, 1988.
Jaisser, F., B. Escoubet, N. Coutry, E. Eugene, J. P, Bonvalet, and N. Farman.
Differential regulation of putative K(+)-ATPase by low-K+ diet and corticosteroids in rat
distal colon and kidney. Am J Physiol 270: C679-87, 1996.
Jaisser, F., J. D. Horisberger, K. Geering, and B. C. Rossier. Mechanisms of
urinary K+ and H+ excretion: primary structure and functional expression of a novel
H,K-ATPase. J Cell Biol 123: 1421-9, 1993.
Jameson, B. A., and H. Wolf The antigenic index: a novel algorithm for predicting
antigenic determinants. Compnt Appl Biosci 4: 181-6, 1988.

122
Kone, B. C. Structural diversity of the colonic H(+)-K(+)-ATPase a subunit
(HKalpha2) gene: Cloning and intrarenal distribution of alternative forms. J Am Soc
Nephrol 7: 1283, 1996.
Kone, B. C., and S. C. Higham. A novel N-terminal splice variant of the rat
H+-K+-ATPase alpha2 subunit. Cloning, functional expression, and renal adaptive
response to chronic hypokalemia. J Bio! Chem 273: 2543-52, 1998.
Koster, J. C., G. Blanco, and R. W. Mercer. A cytoplasmic region of the
Na,K-ATPase alpha-subunit is necessary for specific alpha/alpha association. J Biol Chem
270: 14332-9, 1995.
Kraut, J. A., J. Hiura, M. Besancon, A. Smolka, G. Sachs, and D. Scott. Effect of
hypokalemia on the abundance of HKalphal and HKalpha2 protein in the rat kidney. Am J
Physiol 272: F744-50, 1997.
Kraut, J. A., J Hiura, J M. Shin, S. A., S. G., and S. D The Na(+)-K(+)-ATPase
beta 1 subunit is associated with the HK alpha 2 protein in the rat kidney. Kidney Ini 53:
958-62, 1998.
Kraut, J. A., F. Starr, G. Sachs, and M. Reuben. Expression of gastric and colonic
H(+)-K(+)-ATPase in the rat kidney. Am J Physiol 268: F581-7, 1995.
Lee, J., G. Simpson P. Scholes. An ATPase from dog gastric mucosa: changes of
outer pH in suspensions of membrane vesicles accompanying ATP hydrolysis. Biochem
Biophys Res Commnn 60 825-32, 1974
Lee, J., V. M Rajendran, A S Mann, M. Kashgarian, and H. J. Binder. Functional
expression and segmental localization of rat colonic K-adenosine triphosphatase. J Clin
Invest 96: 2002-8, 1995.
Lifton, R. P. Molecular genetics of human blood pressure variation. Science 272:
676-80, 1996.
Maeda, M., J. lshizaki, and M. Futai. cDna cloning and sequence determination of
pig gastric (H+ + K+)-Atpase. Biochem Biophys Res Commnn 157: 203-9, 1988
Maeda, M., K Oshiman, S. Tamura, and M. Futai Human gastric (H+ +
K+)-ATPase gene. Similarity to (Na+ + K+)-ATPase genes in exon/intron organization
but difference in control region. J Biol Chem 265: 9027-32, 1990.
Maeda, M , K. Oshiman, S. Tamura, S Kaya, S. Mahmood, M. A. Reuben, L. S.
Lasater, G. Sachs, and M. Futai. The rat H+/K(+)-ATPase beta subunit gene and
recognition of its control region by gastric DNA binding protein. J Bio! Chem 266:
21584-8, 1991.

123
Marsy, S., J. M. Elalouf, and A. Doucet. Quantitative RT-PCR analysis ofmRNAs
encoding a colonic putative H, K-ATPase alpha subunit along the rat nephron: effect of
K+ depletion. Pflugers Arch 432: 494-500, 1996.
Mathews, P. M , D. Claeys, F. Jaisser, K. Geering, J. D. Horisberger, J. P.
Kraehenbuhl, and B. C. Rossier. Primary structure and functional expression of the mouse
and frog alpha-subunit of the gastric H(+)-K(+)-ATPase [published erratum appears in
Am J Physiol 1995 Oct;269(4 Pt l):section C following table of contents]. Am J Physiol
268: C1207-14, 1995.
Meneton, P., P. J. Schultheis, J. Greeb, M. L. Nieman, L. H. Liu, L. L. Clarke, J.
J. Duñy, T. Doetschman, J. N. Lorenz, and G E. Shull. Increased sensitivity to K+
deprivation in colonic H,K-ATPase-deficient mice. J Clin Invest 101: 536-42, 1998.
Mercier, F., D. Bayle, M. Besancon, T. Joys, J. M. Shin, M. J. Lewin, C. Prinz, M.
A. Reuben, A. Soumarmon, H. Wong, and et al. Antibody epitope mapping of the gastric
H+/K(+)-ATPase. Biochim Biophys Acta 1149: 151-65, 1993.
Merck, S., and Dohrne Research Laboratories. The Merck Manual of Diagnosis
and Therapy. Rahway, NJ: Merck, Sharpe, and Dohrne Laboratories, 1992.
Mills, J. W., E. M. Schwiebert, and B A. Stanton. Evidence for the role of actin
filaments in regulating cell swelling. J Exp Zoo/ 268: 1 1 1-20, 1994.
Milton, A. E., and 1. D. Weiner. Intracellular pH regulation in the rabbit cortical
collecting duct A-type intercalated cell. Am J Physiol 273: F340-7, 1997.
Modyanov, N. N., P. M. Mathews, A. V. Grishin, P. Beguin, A. T. Beggah, B. C.
Rossier, J. D. Horisberger, and K. Geering. Human ATP1AL1 gene encodes a
ouabain-sensitive H-K-ATPase. Am J Physiol 269: C992-7, 1995.
Modyanov, N. N., K. E. Petrukhin, V. E. Sverdlov, A. V. Grishin, M. Y. Orlova,
M. B. Kostina, O. 1. Makarevich, N. E. Broude, G. S. Monastyrskaya, and E. D.
Sverdlov. The family of human Na,K-ATPase genes. ATP1AL1 gene is transcriptionally
competent and probably encodes the related ion transport ATPase. FEBSLett 278: 91-4,
1991.
Morii, M , Y. Hayata, K. Mizoguchi, and N. Takeguchi Oligomeric regulation of
gastric H+,K+-ATPase. J Biol Chem 271: 4068-72, 1996.
Munson, K. B , C. Gutierrez, V. N. Balaji, K. Ramnarayan, and G. Sachs,
identification of an extracytoplasmic region of H+,K(+)-ATPase labeled by a
K(+)-competitive photoaffinity inhibitor. J Bio! Chem 266: 18976-88, 1991.

124
Munson, K. B., and G. Sachs. Inactivation of H+,K+-ATPase by a K+-competitive
photoaffinity inhibitor. Biochemistry 27: 3932-8, 1988.
Newman, P. R., and G. E. Shull Rat gastric H,K-ATPase beta-subunit gene:
intron/exon organization, identification of multiple transcription initiation sites, and
analysis of the 5'-flanking region. Genomics 11: 252-62, 1991.
Nilwarangkar, S., S. Nimmannit, V. Chaovakul, W. Susaengrat, S. Ong-Aj-Yooth,
S. Vasuvattakul, P. Pidetcha, and P. Malasit. Endemic primary distal renal tubular acidosis
in Thailand. Quarterly Journal of Medicine 74: 289-302, 1990.
Okusa, M. D., R. J. Unwin, H. Velazquez, G. Giebisch, and F. S. Wright. Active
potassium absorption by the renal distal tubule. Am J Physiol 262: F488-93, 1992.
Ono, S., J. Guntupalli, and T. D. DuBose, Jr. Role of H(+)-K(+)-ATPase in pHi
regulation in inner medullary collecting duct cells in culture. Am J Physiol 270: F852-61,
1996.
Oshiman, K., K. Motojima, S. Mahmood, A. Shimada, S. Tamura, M. Maeda, and
M. Futai. Control region and gastric specific transcription of the rat H+,K(+)-ATPase
alpha subunit gene. FEES Lett 281: 250-4, 1991.
Pettitt, J. M., D. C. Humphris, S. P Barrett, B. H. Toll, 1. R. van Driel, and P. A.
Gleeson. Fast freeze-fixation/freeze-substitution reveals the secretory membranes of the
gastric parietal cell as a network of helically coiled tubule. A new model for parietal cell
transformation. J Cell Sci 108: 1127-41, 1995,
Pfaller, W., G. Gstraunthaler, U. Kersting, and FI. Oberleithner. Carbonic
anhydrase activity in Madin Darby canine kidney cells. Evidence for intercalated cell
properties. Ren Physiol Biochem 12:328-37, 1989.
Rabón, E. C., R. D. Gunther, S. Bassilian, and E. S. Kempner. Radiation
inactivation analysis of oligomeric structure of the H,K-ATPase. J Biol Chem 263:
16189-94, 1988.
Raussens, V., H. de Jongh, M. Pezolet, J. M. Ruysschaert, and E. Goormaghtigh.
Secondary structure of the intact H+,K+-ATPase and of its membrane-embedded region.
An attenuated total reflection infrared spectroscopy, circular dichroism and Raman
spectroscopy study. Eur J Biochem 252: 261-7, 1998.
Reuben, M. A., L. S. Lasater, and G. Sachs. Characterization of a beta subunit of
the gastric H+/K(+)-transporting ATPase. Proc Nat! Acad Sci USA 87: 6767-71, 1990.

125
Sachs, G., H. H. Chang, E. Rabón, R. Schackman, M. Lewin, and G. Saccomani.
A nonelectrogenic H+ pump in plasma membranes of hog stomach. J Biol Chem 251:
7690-8, 1976.
Sachs, G., L. D. Faller, and E. Rabón. Proton/hydroxyl transport in gastric and
intestinal epithelia. JMembrBiol 64: 123-35, 1982.
Sangan, P., V. M. Rajendran, A. S. Mann, M. Kashgarian, and H. J. Binder.
Regulation of colonic H-K-ATPase in large intestine and kidney by dietary Na depletion
and dietary K depletion. Am J Physio! 272: C685-96, 1997.
Sarvazyan, N. A., N. N. Modyanov, and A. Askari. Intersubunit and intrasubunit
contact regions of Na+/K(+)-ATPase revealed by controlled proteolysis and chemical
cross-linking. J Biol Chem 270: 26528-32, 1995.
Schwiebert, E. M., K. H. Karlson, P. A. Friedman, P. Dietl, W. S. Spielman, and
B. A. Stanton. Adenosine regulates a chloride channel via protein kinase C and a G
protein in a rabbit cortical collecting duct cell line. J Clin Invest 89: 834-41, 1992.
Schwiebert, E. M., J. W. Mills, and B. A. Stanton. Actin-based cytoskeleton
regulates a chloride channel and cell volume in a renal cortical collecting duct cell line. J
Biol Chem 269: 7081-9, 1994.
Shamraj, O. I., J. B. Lingrel. A putative fourth Na(+),K(+)-ATPase a-subunit gene
is expressed in testis. Proc Natl Acad Sci USA 91:12952-6, 1994.
Shin, J. M., M. Besancon, A. Simon, and G. Sachs. The site of action of
pantoprazole in the gastric Fl+/K(+)-ATPase. Biochim Biophys Acta 1148: 223-33, 1993.
Shin, J. M., and G. Sachs. Identification of a region of the H,K-ATPase alpha
subunit associated with the beta subunit. J Biol Chem 269: 8642-6, 1994.
Shull, G. E., and J. B. Lingrel. Molecular cloning of the rat stomach (H+ +
K+)-ATPase. J Biol Chem 261: 16788-91, 1986.
Shull, M. M., and J. B. Lingrel. Multiple genes encode the human Na+,K+-ATPase
catalytic subunit. Proc Nall Acad Sci USA 84: 4039-43, 1987.
Silver, R. B., and G. Frindt. Functional identification of H-K-ATPase in
intercalated cells of cortical collecting tubule. Am J Physiol 264: F259-66, 1993.
Silver, R. B., G. Frindt, P. Mennitt, and L. M. Satlin. Characterization and
regulation of H-K-ATPase in intercalated cells of rabbit cortical collecting duct. J Exp
Zool 279: 443-55, 1997.

126
Silver, R. B , P. A. Mennitt, and L. M. Satlin. Stimulation of apical H-K-ATPase
in intercalated cells of cortical collecting duct with chronic metabolic acidosis. Am J
Physiol 270: F539-47, 1996.
Sitprija, V., E.-O. S., R. Suvanapha, P. Kullavanijaya, and S. Chinayon. Gastric
hypoacidity in distal renal tubular acidosis. Nephron 50: 395-6, 1988.
Smolka, A., L. Alverson, R. Fritz, K. Swiger, and R. Swiger. Gastric H,K-ATPase
topography: amino acids 888-907 are cytoplasmic. Biochem Biophys Res Commun 180:
1356-64, 1991.
Smolka, A., and K. M. Swiger. Site-directed antibodies as topographical probes of
the gastric H,K-ATPase alpha-subunit. Biochim Biophys Acta 1108: 75-85, 1992.
Spielman, W. S., W. K. Sonnenburg, M. L. Allen, L. J. Arend, K. Gerozissis, and
W. L. Smith. Immunodissection and culture of rabbit cortical collecting tubule cells. Am J
Physiol 251: F348-57, 1986.
Sverdlov, E. D., G. S. Monastyrskaya, N. E. Broude, A. Ushkaryov Yu, R. L.
Allikmets, A. M. Melkov, V. Smirnov Yu, 1. V. Malyshev, I. E. Dulobova, K. E.
Petrukhin, A. V. Grishin, N. 1. Kijatkin, M. B. Kostina, V. E. Sverdlov, N. N. Modyanov,
and Y. A. Ovchinikov. The family of human Na+,K+-ATPase genes. No less than five
genes and/or pseudogenes related to the alpha-subunit. FEBSLett 217: 275-8, 1987.
Sverdlov, V. E., M. B. Kostina, and N. N. Modyanov. Genomic organization of
the human ATP1AL1 gene encoding a ouabain-sensitive H,K-ATPase. Genomics 32:
317-27, 1996.
Tamura, S., K. Oshiman, T. Nishi, M. Mori, M. Maeda, and M. Futai. Sequence
motif in control regions of the H+/K+ ATPase alpha and beta subunit genes recognized by
gastric specific nuclear protein(s). FEBS Lett 298: 137-41, 1992.
Thomas, J. A., R. N. Buchsbaum, A. Zimniak, and E. Racker. Intracellular pH
measurements in Ehrlich ascites tumor cells utilizing spectroscopic probes generated in
situ. Biochemistry 18: 2210-8, 1979.
Thompson, J. D., D. G. Higgins, and T. J. Gibson. CLUSTAL W: improving the
sensitivity of progressive multiple sequence alignment through sequence weighting,
position-specific gap penalties and weight matrix choice. Nucleic Acids Res 22: 4673-80,
1994.
Valentich, J. D. Morphological similarities between the dog kidney cell line MDCK
and the mammalian cortical collecting tubule. Ann N Y AcadSci 372: 384-405, 1981.

127
Van Driel, I. R, and J M. Callaghan. Proton and potassium transport by
H+/K(+)-ATPases. Clin Exp Pharmacol Physiol 22: 952-60, 1995.
van Driel, 1. R., and J. M. Callaghan. Proton and potassium transport by
H+/K(+)-ATPases. Clin Exp Pharmacol Physiol 22: 952-60, 1995.
Walderhaug, M. O., R. L. Post, G. Saccomani, R. T. Leonard, and D. P. Briskin.
Structural relatedness of three ion-transport adenosine triphosphatases around their active
sites of phosphorylation. J Bio! Chan 260: 3852-9, 1985.
Weiner, 1. D , and L. L. Hamm. Use of fluorescent dye BCECF to measure
intracellular pH in cortical collecting tubule. Am J Physio! 256: F957-64, 1989.
Weiner, 1. D , and A. E. Milton. H(+)-K(+)-ATPase in rabbit cortical collecting
duct B-type intercalated cell. Am J Physiol 270: F518-30, 1996.
Whelton, P. K. Potassium and Blood Pressure. In: Hypertension Primer, edited by
J. L. Izzo, Black, H. R. Dallas, TX: American Heart Association, 1993, p. 170-2.
Willardson, B. M., B. J. Thevenin, M. L. Harrison, W. M. Kuster, M. D. Benson,
and P. S. Low. Localization of the ankyrin-binding site on erythrocyte membrane protein,
band 3. J Biol Chem 264: 15893-9, 1989.
Wingo, C. S. Potassium transport by medullary collecting tubule of rabbit: effects
of variation in K intake. Am J Physiol 253: F1136-41, 1987.
Wingo, C. S. Active proton secretion and potassium absorption in the rabbit outer
medullary collecting duct. Functional evidence for proton-potassium-activated adenosine
triphosphatase. J Clin Invest 84: 361-5, 1989.
Wingo, C. S., and B. D Cain. The renal H-K-ATPase: physiological significance
and role in potassium homeostasis. Annn Rev Physiol 55: 323-47, 1993.
Wingo, C. S., K. M. Madsen, A. Smolka, and C. C. Tisher. H-K-ATPase
immunoreactivity in cortical and outer medullary collecting duct. Kidney Int 38: 985-90,
1990.
Wingo, C. S., and A. J. Smolka. Function and structure of H-K-ATPase in the
kidney [editorial]. Am J Physiol 269: FI -16, 1995.
Wolfe, M. M., and A. H. Soli The physiology of gastric acid secretion. NEngl J
Med 319: 1707-15, 1988.

128
Younes Ibrahim, M, C. Barlet Bas, B. Buffin Meyer, L. Cheval, R. Rajerison, and
A. Doucet. Ouabain-sensitive and -insensitive K-ATPases in rat nephron: effect of K
depletion. Am JPhysiol 268: FI 141-7, 1995.
Zhang, P., C. Toyoshima, K. Yonejura, N. M. Green, and D L. Stokes. Structure
of the calcium pump from sarcoplasmic reticulum at 8-A resolution. Nature 392: 835-839,
1998.

BIOGRAPHICAL SKETCH
Grady Campbell was born in Clearwater, Florida, on February 1, 1955. He graduated
from Charles E. Jordan High School of Durham, North Carolina, in June 1973. The
following September he entered Emory University in Atlanta, Georgia, and in June 1977
he received a Bachelor of Science degree, with a major in physics. In August of that year
he began employment at EG&G ORTEC in Oak Ridge, Tennessee. In the fall of 1979 he
enrolled as a part-time student at the University of Tennessee, Knoxville, and began study
toward a master’s degree under the direction of Carrol R. Bingham, with a major in
physics. His thesis was entitled The Decay of Mass-separated 193Pb to I93T1; the degree was
awarded in August 1985. In April of the following year he began employment at California
Institute of Technology in Pasadena, California. In August 1992 he enrolled as a graduate
student in the Department of Biochemistry and Molecular Biology at the University of
Florida in Gainesville, Florida. That December, he joined Brian D. Cain’s laboratory where
he carried out the work described in this dissertation. Upon completing the requirements
for his degree, he is joining Frank VV. Booth’s laboratory at the University of
Texas-Houston Medical School in Houston, Texas, where he will find and study genes
involved in conferring the benefit of exercise on cardiovascular disease.
129

I certify that I have read this study and that in my opinion it conforms to acceptable
standards of scholarly presentation and is fully adequate, in scope and quality, as a
dissertation for the degree of Doctor of Philosophy.
Brian D. Cain, Chair
Associate Professor of Biochemistry
and Molecular Biology
I certify that I have read this study and that in my opinion it conforms to acceptable
standards of scholarly presentation and is fully adequate, in scope and quality, as a
dissertation for the degree of Doctor of Philosophy.
''Susan C. Frost
Associate Professor of Biochemistry
and Molecular Biology
I certify that I have read this study and that in my opinion it conforms to acceptable
standards of scholarly presentation and is fully adequate, in scope and quality, as a
dissertation for the degree of Doctor of Philosophy.
Professor of Biochemistry and
Molecular Biology
I certify that I have read this study and that in my opinion it conforms to acceptable
standards of scholarly presentation and is fully adequate, in scope and quality, as a
dissertation for the degree of Doctor of Philosophy.
auq¿7ÉÁ
Harry S. Nic
Professor af'&iochemistry and
Molecular Biology
I certify that I have read this study and that in my opinion it conforms to acceptable
standards of scholarly presentation and is fully adequate, in scope and quality, as a
dissertation for the degree of Doctor of Philosophy.
Charles S. Wingo
Professor of Physiology and
Pharmacology

This dissertation was submitted to the Graduate Faculty of the College of Medicine
and to the Graduate School and was accepted as partial fulfillment of the requirements for
the degree of Doctor of Philosophy.
August 1998
Dean, College of Medicine
Dean, Graduate School