Bioactive Properties of Peptides Derived from Enzymatic Hydrolysis of Cod Muscle Myosin with Trypsin, Chymotrypsin and E...

MISSING IMAGE

Material Information

Title:
Bioactive Properties of Peptides Derived from Enzymatic Hydrolysis of Cod Muscle Myosin with Trypsin, Chymotrypsin and Elastase
Physical Description:
1 online resource (545 p.)
Language:
english
Creator:
Crynen,Stefan Karl
Publisher:
University of Florida
Place of Publication:
Gainesville, Fla.
Publication Date:

Thesis/Dissertation Information

Degree:
Doctorate ( Ph.D.)
Degree Grantor:
University of Florida
Degree Disciplines:
Food Science and Human Nutrition
Committee Chair:
Marshall, Maurice R
Committee Members:
Gu, Liwei
Sims, Charles A
Welt, Bruce A
Kristinsson, Hordur G

Subjects

Subjects / Keywords:
ace -- antioxidant -- chelation -- ms -- proteases
Food Science and Human Nutrition -- Dissertations, Academic -- UF
Genre:
Food Science and Human Nutrition thesis, Ph.D.
bibliography   ( marcgt )
theses   ( marcgt )
government publication (state, provincial, terriorial, dependent)   ( marcgt )
born-digital   ( sobekcm )
Electronic Thesis or Dissertation

Notes

Abstract:
Low molecular weight peptides derived by controlled enzymatic hydrolysis from fish by-products and underutilized fish species have been shown to have potential application in the food, pharmaceutical and nutraceutical industries. A recently developed process to extract pure fish proteins from fish by-products (called fish protein isolates), which are usually rich in pro-oxidants and oxidative susceptible lipids, has made it possible to prepare fish protein hydrolysates without serious oxidative and color problems during processing and in the final product. Several studies have been conducted already to determine bioactive properties of fish protein hydrolysates with certain proteolytic enzyme mixtures and whole fish muscle extracts from different fish species. However, very limited studies have been done on fish protein isolate hydrolysates in terms of their functionality and bioactivity. For this research project, myosin, which is the most abundant single muscle protein in fish muscle (and fish protein isolates), was extracted from Atlantic cod (Gadus morhua) and then hydrolyzed by three separated individual enzymes (trypsin, chymotrypsin and elastase), which were also extracted from Atlantic cod (Gadus morhua). Low molecular weight peptides were separated from the myosin hydrolysates by ultrafiltration using 5 and 30 kDa membranes. The fractionated peptides were then tested for various bioactive properties, such as antioxidant capacities and angiotensin-converting enzyme (ACE) inhibition. All peptide fractions were finally analyzed by liquid chromatography coupled with tandem mass spectrometry. The results show that peptides with antioxidative and ACE inhibitory properties can be produced by enzymatic hydrolysis. Low molecular weight peptides show higher antioxidative and ACE inhibitory activities. The bioactive properties are dependent on the type of enzyme used, as well as the degree of hydrolysis and molecular size. Chymotrypsin derived peptides showed higher antioxidant potential than trypsin and elastase derived one, while trypsin derived peptides had the lowest IC50 values for ACE-Inhibition. Higher degrees of hydrolysis (%DH) seem to increase bioactive properties until about 30%, while hydrolysates with 43 %DH showed decreased antioxidant activity and increased ACE-inhibitory activities. Mass Spectrometry results discovered over 5000 low molecular weight peptides (less than 10 amino acids residues long) through De novo sequencing.
General Note:
In the series University of Florida Digital Collections.
General Note:
Includes vita.
Bibliography:
Includes bibliographical references.
Source of Description:
Description based on online resource; title from PDF title page.
Source of Description:
This bibliographic record is available under the Creative Commons CC0 public domain dedication. The University of Florida Libraries, as creator of this bibliographic record, has waived all rights to it worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.
Statement of Responsibility:
by Stefan Karl Crynen.
Thesis:
Thesis (Ph.D.)--University of Florida, 2011.
Local:
Adviser: Marshall, Maurice R.
Electronic Access:
RESTRICTED TO UF STUDENTS, STAFF, FACULTY, AND ON-CAMPUS USE UNTIL 2012-08-31

Record Information

Source Institution:
UFRGP
Rights Management:
Applicable rights reserved.
Classification:
lcc - LD1780 2011
System ID:
UFE0043193:00001


This item is only available as the following downloads:


Full Text

PAGE 1

1 BIOACTIVE PROPERTIES OF PEPTIDES DERIVED FROM ENZYMATIC HYDROLYSIS OF COD MUSCLE MYOSIN WITH TRYPSIN, CHYMOTRYPSIN AND ELASTASE By STEFAN CRYNEN A DISSERTATION PRESENTED TO THE GRADUATE SCHOOL OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY UNIVERSITY OF FLORIDA 20 11

PAGE 2

2 20 11 Stefan Crynen

PAGE 3

3 To my loving p arents my b rother and especially my w ife Gogce and her f amily

PAGE 4

4 ACKNOWLEDGMENTS I sincerely want to express my deep gratitude towards my major advisor s Dr. Maurice R. Marshall and Dr. Hordur G. Kristinsson who helped me to complete this dissertation with all their advice guidance and support. I would also like to thank my committee members Dr. Charles A. Sim s, Dr. Liwei Gu and Dr. Bruce Welt for their suggestions, advice and help in the completion of this research. I would further like to thank Dr. Yavuz Yagiz, Dr. Sara Aldaous, Dr. Sivakumar Raghavan and Dr. Sibel Damar and all my fellow class and lab mates at the University of Florida for their help and support during my research. I would also like to thank Dr. Patricia Hamaguchi, Dr. Holmfridur Sveinsdottir and Mrs. Margret Geirsdottir at Matis ohf. (Icelandic Food and Biotech R&D) for their immense help an d support in protein and peptide hydrolysis and bioactivity measurements. I would like to thank Mr. Jon Reed, his Family and his research team for his help and support with peptide mass spectrometry analysis. Finally I would like to thank my family for the ir love and support and especially my wife Gogce who believed in me and supported with guidance and understanding thru this entire project. She placed her entire life on hold so I could finish this dissertation.

PAGE 5

5 TABLE OF CONTENTS page ACKNOWLEDGMENTS ................................ ................................ ................................ .. 4 LIST OF TABLES ................................ ................................ ................................ ............ 8 LIST OF FIGURES ................................ ................................ ................................ .......... 9 LIST OF ABBREVATIONS ................................ ................................ ............................ 11 ABSTRACT ................................ ................................ ................................ ................... 12 CHAPTER 1 INTRODUCTION ................................ ................................ ................................ .... 14 2 LITERATURE REVIEW ................................ ................................ .......................... 17 Marine P rotein and Enzymes ................................ ................................ .................. 17 Proteins ................................ ................................ ................................ ............ 17 Enzymes ................................ ................................ ................................ ........... 21 Bioactive Peptides and Fish Protein Hydrolysates ................................ .................. 23 Antioxidant Capacity / Reactive Oxygen Species Scavenging Ability ..................... 24 Angiotensin Converting Enzyme Inhibition ................................ .............................. 31 Protein and Peptide Analysis ................................ ................................ .................. 36 3 OBJECTIVES ................................ ................................ ................................ ......... 42 4 ENZYME SEPARATION, M YOSIN EXTRACTION, HY DROLYSIS AND FRACTIONATION ................................ ................................ ................................ ... 43 Material and Methods ................................ ................................ ............................. 43 Separation and Purification of Trypsin, Chymotrypsin and Elastase ................ 43 Extraction of Atlantic Cod Muscle Myosin ................................ ......................... 49 Hydrolysis of Atlantic Cod Muscle Myosin ................................ ........................ 51 Fractionation of Atlantic Cod Muscle Myosin Hydrolysates .............................. 55 Protein and Peptide Assays ................................ ................................ ............. 56 Results ................................ ................................ ................................ .................... 58 Separation and Purification of Trypsin, Chymotrypsin and Elastase ................ 58 Extraction of Atlantic Cod Muscle Myosin ................................ ......................... 60 Hydrolysis of Atlantic Cod Muscle Myosin ................................ ........................ 61 Fractionation of Atlantic Cod Muscle Myosin Hydrolysates .............................. 63 5 DETERMINATION OF ANT IOXIDANT PROPERTIES OF COD MYOSIN HYDROLYSATES ................................ ................................ ................................ ... 75

PAGE 6

6 Material and Methods ................................ ................................ ............................. 75 Oxygen Radical Absorbance Capacity ................................ ............................. 75 DPPH Radical Scavenging Ability ................................ ................................ .... 76 Reducing Power of Antioxidants Assay ................................ ............................ 77 Ferrous Ion Chelation Ability ................................ ................................ ............ 78 Cellular Antioxidant Activity Assay ................................ ................................ ... 79 Statistical Analysis ................................ ................................ ............................ 81 Results ................................ ................................ ................................ .................... 82 Oxygen Radical Absorbance Capacity ................................ ............................. 82 DPPH Radical Scavenging Ability ................................ ................................ .... 83 Reducing Power of Antioxidants Assay ................................ ............................ 85 Ferrous Ion Chelation Ability ................................ ................................ ............ 87 Cellular Antioxidant Assay (CAA) ................................ ................................ ..... 87 Discussion ................................ ................................ ................................ .............. 88 6 ANGIONTENSIN CONVERT ING ENZYME (ACE) INHIBITION BY COD MYOSIN HYDROLYSATES ................................ ................................ .................... 98 Material and Methods ................................ ................................ ............................. 98 Statistical Analysis ................................ ................................ ................................ .. 99 Results ................................ ................................ ................................ .................. 100 Discussion ................................ ................................ ................................ ............ 101 7 MASS SPECTROMETRY ANALYSI S OF COD MYOSIN HYDR OLYSATES ...... 104 Material and Methods ................................ ................................ ........................... 104 LC MS/MS Analysis of Peptide Fragments from Myosin Digests ................... 104 Rationale for LC MS/MS Analysis ................................ ................................ .. 105 Data Analysis ................................ ................................ ................................ 107 Results ................................ ................................ ................................ .................. 110 Discussion ................................ ................................ ................................ ............ 114 8 CONCLUSION ................................ ................................ ................................ ...... 121 APPENDIX A CEL LULAR ANTIOXIDANT AS SAY ................................ ................................ ..... 124 B PROTEOME DISCOVERY R ESULTS FOR CHYMOTRYP SIN ........................... 130 C PROTEOME DISCOVERY R ESULTS FOR TRYPSIN ................................ ......... 137 D PROTEOME DISCOVERY R ESULTS FOR ELASTASE ................................ ...... 152 E PROTEOME DISCOVERY R ESULTS FOR CEM LOW ................................ ....... 159 F PROTEOME DISCOVERY R ESULTS FOR CEM HIGH ................................ ...... 166

PAGE 7

7 G PEAKS DATABASE SEARC H RESULTS FOR CHYMOT RYPSIN ...................... 173 H PEAKS DATABASE SEARC H RESULTS FOR TRYPSI N ................................ ... 180 I PEAKS DATABASE SEARC H RESULTS FOR ELASTA SE ................................ 218 J PEAKS DATABASE SEARC H RESULTS FOR CEM LO W ................................ .. 223 K PEAKS DATABASE SEARC H RESULTS FOR CEM HI GH ................................ 242 L DE NOVO SEQUENCING R ESULTS FOR CHYMOTRYP SIN ............................ 265 M DE NOVO SEQUENCING R ESULTS FOR TRYPSIN ................................ .......... 306 N DE NOVO SEQUENCING R ESULTS FOR ELASTASE ................................ ....... 372 O DE NOVO SEQUENCING R ESULTS FOR CEM LOW ................................ ........ 405 P DE NOVO SEQUENCING R ESULTS FOR CEM HIGH ................................ ....... 456 LIST OF REFERENCES ................................ ................................ ............................. 533 BIOGRAPHICAL SKETCH ................................ ................................ .......................... 545

PAGE 8

8 LIST OF TABLES Table page 2 1 List of amino acids with three and one letter codes ................................ .......... 40 2 2 Bioactive peptides found in different studies ................................ ....................... 41 4 1 Purificati on table for c hymotrypsin from cod enzyme mixture ............................. 66 4 2 Puri fication table for t rypsin from cod enzyme mixture ................................ ....... 67 4 3 Purification table for e lastase from cod enzyme mixture ................................ .... 67 4 4 Molecular weight distribution of extracted cod myosin ................................ ........ 69 4 5 Myosin hydrolysate analysis ................................ ................................ ............... 71 4 6 Myosin hydrolysate fractions analysis ................................ ................................ 74 6 1 IC 50 values for ACE inhibition by myosin peptide fractions ............................... 103 7 1 Atlantic cod ( Gadus morhua ) myosin fragment sequence for BLAST alignment comparison ................................ ................................ ...................... 117 7 2 Zebra fish myosin sequences aligning with Atlantic cod myosin fragment ....... 117 7 3 Number of peptides identified or De novo sequenced by mass spectrometry from myosin hydrolysates. ................................ ................................ ................ 119 7 4 False discovery rates (FDR) for the Sequest database search ........................ 120

PAGE 9

9 LIST OF FIGURES Figure page 4 1 Chromatogram of cod enzyme mixture separated on a PBA Column ................ 65 4 2 Chromatogram of chymotryps in and t rypsin separated on a PABA Column ....... 66 4 3 SDS PAGE analysis of myosin extracts ................................ ............................. 68 4 4 Sample profile plot of the colorimetric analysis of the myosin SDS PAGE gel ... 69 4 5 SDS PAGE analysis of myosin hydrolysates ................................ ...................... 70 4 6 SDS PAGE analysis of myosi n hydrolysate fractions A ................................ ...... 72 4 7 SDS PAGE analysis of myosin hydrolysate fractions B ................................ ...... 73 5 1 Method of proposed principle for the cellular antioxidant activity (CAA) assay ... 93 5 2 Oxygen radical absorbance capacity assay (ORAC) ................................ .......... 94 5 3 DPPH radical sca venging ability ................................ ................................ ......... 94 5 4 Reducing power of antioxidants assay ................................ ............................... 95 5 5 Ferrous ion chelating ability assay ................................ ................................ ...... 95 5 6 Cell viability measurements with peptides derived by individual enzymes ......... 96 5 7 Cell viability measurements with p eptides derived by CEM high and low ........... 96 5 8 Cellular antioxidant assay (CAA) results ................................ ............................ 97 6 1 ACE Inhibition for peptides derived by enzymatic hydrolysis from cod myosin 102 6 2 IC 50 values for ACE inhibitory effect of myosin peptides ................................ ... 103 7 1 LC/MS ch romatograms for myosin peptides with less than 5 kDa MW ............ 116 7 2 The alignment of myosin protein sequences from Atlantic cod and Zebrafish .. 118 7 3 Sample mass spectrum for trypsin digested myosin ................................ ......... 119 A 1 Cellular Antioxidant Assay (CAA) results for chymotrypsin digested myosin .... 124 A 2 Cellular Antioxidant Assay (CAA) results for trypsin digested myosin .............. 125 A 3 Cellular Antioxidant Assay (CAA) results for elastase digested myosin ........... 126

PAGE 10

10 A 4 Cellular Antioxidant Assay (CAA) results for CEM high digested myosin ......... 127 A 5 Ce llular Antioxidant Assay (CAA) results for C EM low digested myosin .......... 128 A 6 Cellular Antioxidant Assay (CAA) results for Trolox standards ......................... 129

PAGE 11

11 LIST OF ABBREVATIONS ANOVA Analysis of Variance CEM Cod enzyme mixture LC Liquid Chromatography MS Mass Spectrometry MS/MS or MS2 Tandem Mass S pectrometry MW Molecular Weight ORAC Oxygen Radical Absorbance Capacity SDS PAGE Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis U Units

PAGE 12

12 Abstract of Dissertation Presented to the Graduate School of the University of Florida in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy BIOACTIVE PROPERTIES OF PEPTIDES DERIVED FROM ENZYMATIC HYDROLYSIS OF COD MUSCLE MYOSIN WITH TRYPSIN, CHYMOTRYPSIN AND ELASTASE By Stefan Crynen August 2011 Chair: Maurice R Marshall Major: Food Science and Human Nutrition Low molecular weight peptides derived by controlled enzymatic hydrolysis from fish by products and underutilized fish species have been shown to have potential application in the food, pharmaceuti cal and nutraceutical industries. A recently developed process to extract pure fish proteins from fish by products (called fish protein isolates), which are usually rich in pro oxidants and oxidative susceptible lipids, has made it possible to prepare fish protein hydrolysates without serious oxidative and color problems during processing and in the final product. Several studies have been conducted already to determine bioactive properties of fish protein hydrolysates with certain proteolytic enzyme mixtur es and whole fish muscle extracts from different fish species. However, very limited studies have been done on fish protein isolate hydrolysates in terms of their functionality and bioactivity. For this research project, myosin, which is the most abundant single muscle protein in fish muscle (and fish protein isolates), was extracted from Atlantic cod ( Gadus

PAGE 13

13 morhua ) and then hydrolyzed by three separated individual enzymes (trypsin, chymotrypsin and elastase), which were also extracted from Atlantic cod ( Ga dus morhua ). Low molecular weight peptides were separated from the myosin hydrolysates by ultrafiltration using 5 and 30 kDa membranes. The fractionated peptides were then tested for various bioactive properties, such as antioxidant capacities and angioten sin converting enzyme (ACE) inhibition. All peptide fractions were finally analyzed by liquid chromatography coupled with tandem mass spectrometry. The results show that peptides with antioxidative and ACE inhibitory properties can be produced by enzymati c hydrolysis. Low molecular weight peptides show higher antioxidative and ACE inhibitory activities. The bioactive properties are dependent on the type of enzyme used, as well as the degree of hydrolysis and molecular size. Chymotrypsin derived peptides sh owed higher antioxidant potential than trypsin and elastase derived one, while trypsin derived peptides had the lowest IC 50 values for ACE Inhibition. Higher degrees of hydrolysis (%DH) seem to increase bioactive properties until about 30%, while hydrolysates with 43 %DH showed decreased antioxidant activity and increased ACE inhibitory activities. Mass Spectrometry results di scovered over 5000 low molecular weight peptides (less than 10 amino acids residues long) through De novo sequencing.

PAGE 14

14 CHAPTER 1 INTRODUCTION Recent data estimates that the world harvest of wild fish is close to 100 million metric tons and soon reaches the worlds estimated limit for a sustainable wild fish population according to the FAO (2006) It is believed by many that we are very close to a m (Valdimarsson, 2003) Recent news from the Associated Press (AP) about the ban of Bluefin tuna by the United States and the European Union and the economic difficulties resulting thereof for Japan show how dramatic the situation can become. It is also a fact that cur rently substantial amounts of protein rich material, which could be derived from marine animals, is discarded or underutilized (Kristinsso n and Rasco, 2000b) These materials are often by catch from fishery vessels and by products, such as frames and cut offs, from seafood processing facilities. It has been reported that up to 60% of the fish tissue remaining after processing is considere d waste and not used for human consumption (Mackie, 1982) Most of the material t hat could be recovered from by catch and by products is high in quality protein and could be used for human consumption and in a wide variety of other applications. Several researchers have demonstrated that applying controlled enzyme technology to fish pr oteins from byproducts and underutilized species can be recovered and modified to produce a wide range of protein ingredients, useful in the food, pharmaceutical and feed/fertilizer industry (Kristinsson and Rasco, 2000d; Kristinsson and Rasco, 2000c; Kristinsson and Rasco, 2000a; Kristinsson and Rasco, 2002; Baek and Cadwallader, 1995; Shahidi and others 1995; Vieira and others 1995; Onode nalore and Shahidi, 1996) Since these ingredients are mostly derived by chemical and enzymatic hydrolysis of fish protein into peptides of various sizes they are

PAGE 15

15 collecti vely called fish protein hydrolysates (FPH) (Skanderby, 1994) In recent years many publications and developments have emerged that promise novel use of fish protein hydrolysates. Endogenous and added enzymes are now used in the industry to produce fish protein hydrolysates with high fu nctional and nutritional value (Gonzlez Tello and others 1994; Kristinsson and Rasco, 2000b) Production of fish protein hydrolysates on a commercial scale has reached a sizable level in certain countries, like the United States, Norway, Denmark, France, Iceland, Mexico, Japan, Canada and parts of Southeast Asia (Kristinsson and others 2005) Th e speed of hydrolysis and the properties of the harvested peptides are influenced by a number of factors during and after the usually simple protein hydrolysis process. Special consideration has to be given to the choice of enzyme and the specific reaction conditions (Lahl and Braun, 1994; Kristinsson and Rasco, 2002) The use of commercial or purified enzymes instead of endogenous enzyme mixtures offers generally better control of the hydrolysis and the resulting peptides (Kristinsson and Rasco, 2000a; Shahidi and others, 1995) Furthermore the nature and quality of the raw material can hav e a great impact on the hydrolysis process and the properties and functionality of the resulting peptides. The raw material should be free of blood and dark muscle, which can cause serious oxidative and color problems during processing and in the final pro duct. The problems arise mainly from membrane lipids and powerful pro oxidants like heme proteins and some transition metals. A process developed by Hultin and others (2003) allows for the production of clean starting material by solubilization o f myofibrillar proteins at high pH and recovery of those proteins at pH 5.5. The clean

PAGE 16

16 starting material can be used for the hydrolysis process to produces functional and bioactive peptides Studies by Raghavan and others (Raghavan and others 2008; Raghavan and Kristinsson, 2009) reported a new protein extraction process and a commercial enzyme mixture called cod enzyme mixture (CEM), which contains trypsin, chymotrypsin and elastase from cod pyloric caeca, to prod uce protein hydrolysates with bioactive properties. Since myosin is the most abundant single muscle protein in fish muscle and comprises about 50% of the myofibrillar proteins, extracted by the new process (Hultin and others, 2003) and about 40% of the total pr otein content of fish muscle (Kristinsson and Rasco, 2000b; Kristinsson, 2001) it was chosen as the source material for the protein hydrolysates studies for this research project. It is also of interest to explore the hydrolysates p roduced by each individual purified enzyme (trypsin, chymotrypsin and elastase) from the cod enzyme mixture (CEM) in contrast to the hydrolysates produced by the mixture.

PAGE 17

17 CHAPTER 2 LITERATURE REVIEW Marine Protein and Enzymes It is widely known that most fish proteins have good functionality and high nutritional value. To further improve those properties, enzyme technology is now employed to produce a wide range of fish protein hydrolysates with various functional, nutritional and bioactive properties. Dur ing the past 50 years research has focused on fish protein hydrolysates with regard to optimizing production conditions for high protein yields and to investigate the food and nutritional functionality of fish protein hydrolysates (Kristinsson and Rasco, 2002) A major problem until recent years was the presence of potent pro oxidants and membrane lipids from the raw material that could cause serious oxidative and color problems dur ing processing. The development of a new method to extract pure fish proteins from by products and the further use of enzymatic hydrolysis of those proteins leads to better recovery of proteins from underutilized species and by products, enhanced protein q uality and induces many desirable properties to the proteins and protein hydrolysates (Kristinsson and Rasco, 2002; Hultin and others, 2003; Kristinsson and Rasco, 2000b) Proteins Proteins in foods are generally categorized as globular and fibrous proteins and each protein has its unique molecular structure and functional properties. The relative concentration of dietary essential amino acids is considered a major factor determining the nutritional value of a protein. It is also considered that proteins from animal sources are nutritionally superio r, as they contain a better balance of dietary amino acids than plant proteins. Among all animal tissues fish muscle is considered to have an excellent

PAGE 18

18 amino acid composition and is an excellent source of nutritive and easily digestible proteins. A drawbac k however is that fish proteins are extremely perishable and their chemical composition can vary, which presents unique food processing problems in the utilization of fish as a basic raw food material. For example a large portion of the commercially utiliz ed fish species are cold adapted or poikilothermic, which make them more heat sensitive than mammalian proteins and they exhibit a greater tendency to white part is more abundant than the dark meat, but the dark meat contains higher amounts of lipids and heme proteins, which, as discussed earlier, causes serious oxidative problems during processing of fish proteins and fish protein hydrolysates. The pri mary food proteins from fish muscle are the myofibrillar proteins which comprise about 60 to 70 percent of the total fish muscle protein. Myosin and actin are the most abundant proteins who build this protein complex, known as myofibril proteins. Since myo sin comprises about 50 to 60 percent of the myofibrillar proteins it is considered the most abundant of the single muscle proteins and accounts for almost 38 percent of the total muscle proteins. Myosin, with a molecular weight of almost 500 kDa, is a lar ge and fibrous protein, which is comprised of six polypeptide subunits. These six subunits include two identical heavy chains (HC), with molecular sizes of about 220 kDa, and four light chains, with sizes ranging from 16 kDa to 25 kDa. These four light cha ins are named light chain 1 (LC1), (two identical) light chain 2 (LC2) and a light chain 3 (LC3). LC1 and LC3 are referred to as alkali light chains, since they are released from native myosin by alkaline (pH 11) treatment, and the LC2 light chains are ref erred to as DTNB light chains, since

PAGE 19

19 they are released by DTNB (dithiobis (2 nitrobenzoic acid)). The entire myosin molecule consists of almost 4500 amino acid residues, which build an asymmetrical molecule with two pear shaped globular heads attached to a long rod like helical tail. (Xiong, 1997) Several methods can be employed to extract myosin from whole muscle and four of those methods were compared for th e extraction of cod muscle myosin by Kristinsson (2001) The author concluded that the method, described by Martone and others (1986) with slight modifications resulted in a myosin extract with the highest purity among the methods compared. During the my osin extraction process the molecule is separated into six polypeptide subunits, which can be analyzed by SDS PAGE analysis. Since the two heavy chains are identical and two of the light chains are identical, the SDS PAGE analysis shows 4 distinct bands fo r the myosin molecule, the heavy chain (around 220 kDa), light chain 1 (around 25 kDa), the two light chain 2 molecules (around 19.5 kDa) and the light chain 3 molecule (around 18 kDa) (Kristinsson, 2001) Kristinsson and Hultin also performed two studies on cod muscle proteins (Kristinsson and Hultin, 2003b) and cod myosin (Kristinsson and Hultin, 2003a) in 2003. The first study determined the effect of low and high pH treatment on the functional properties of cod muscle proteins and concluded that the pH treatment, which causes an unfolding and refolding of the myosin molecule, had no effect on the solubility of myosin but it enhanced the gel strength of myosin and improved its functionality (Kristi nsson and Hultin, 2003b) The second study observed changes in conformation and subunit assembly of cod myosin at low and high pH and after subsequent refolding. Their results suggest that high and low pH treatments on cod myosin cause significant

PAGE 20

20 confo rmational changes in the globular head fraction of myosin heavy chain and that a large portion of the myosin light chains are lost during those treatments. The authors concluded that acid and alkaline treatment may lead to substantial molecular changes in myosin (Kristinsson and Hultin, 2003a) This re search is significant since the acid and alkaline treatment is a new method to extract muscle proteins from fish waste and byproducts and should therefore be considered in marine myosin research. Belitz and others (2004) describe that the proportion of myofibrillar proteins, almost 43% of which is myosin (Xiong, 1997) in fish total protein is higher than in mammalian muscle tissue, but the proportions among the individual components are quite similar. However there are limited studies on the proteome characterization of fish muscle proteins and their sequence and the complete sequence of cod muscle myosin is not yet available in common proteomics databases. Zebrafish ( Danio rerio ) is a very popular aquarium fish, and is also used as a model fish in many genomic and proteomic studies. The ent ire mitochondrial genome and proteome of zebrafish is sequenced and available in most common proteomics databases (Broughton and others 2001) For this reason many comparative proteome analysis studies use zebrafish to compare protein expression in different species. Sveinsdottir and others (2008) performed a study on the Gadus morhua ) l highly identical with zebrafish proteins, including myosin light chain 2. A study by Bryson Richardson and others (2005) compared the myosin heavy chain expression in zebrafish and slow muscle composition in amniotes (four limbed animals with backbones or spinal column s) and found similarities in the expression of slow and fast

PAGE 21

21 heavy chain myosin between zebrafish and amniotes. As mentioned previously, the entire sequence of cod muscle myosin is not known yet, thus a complete comparison of the protein expression between zebrafish and cod myosin cannot be performed, but comparisons of cod myosin fraction sequences suggest that it is comparable to 80% zebrafish myosin and therefore the zebrafish database may be used for mass spectrometry analysis. Enzymes Both trypsin and chymotrypsin recognize a particular side of the myosin molecule, where they can cleave it into heavy meromyosin and light meromyosin. (Kristinsson and Rasco, 2000b) Chymotrypsin, trypsin and elastase are all endopeptidases, which can break peptide bonds of nonterminal amino acids in contrast to expopeptidases which cleave amino acids only from the ends of a protein. While expopeptidases cleave one amino acid at a time from the ends, they can eventually break the protein down into monomers, while the endopeptidases cannot. By using only endopeptidases, like trypsin, chymotrypsin and elastase, it is assured that molecules no smaller than a di peptide can be formed during hydrolysis. Trypsin is an enzyme having very high specificity that cleaves peptide bonds after arginine and lysine unless followed by proline. Chymotrypsin cleaves peptide bonds after phenylalanine, tryptopha n and tyrosine, unless followed by proline. It also cleaves peptide bonds after asparagine, histidine, methionine and leucine, but at a slower speed. Elastase cleaves peptide bonds after alanine, glycine, serine and valine, unless followed by proline accor ding to Simpson (2000) However an older study by Berglund and others (1998) determined that salmon elastase was cleaving peptide bonds after alanine, leucine, isoleucine and

PAGE 22

22 valine (unless followed by prol ine), but not glycine, serine or phenylalanine, compared to porcine and rat elastase. Trypsin, chymotrypsin and elastase belong to the category of serine proteases, which can be found in pancreatic tissues, pyloric caeca in fish and intestines of other ani mals. Enzymes extracted from cold water species are usually called cold adapted enzymes and several studies have been conducted to compare those cold adapted enzymes to their mammalian counterparts. Cold adapted trypsin extracted from Atlantic cod showed a 20 times higher catalytic efficiency than the mesophilic bovine counterpart according to a study by Jonsdottir (2004) Chymotrypsin, extracted fr om the pyloric caeca from Atlantic cod showed a slightly higher molecular weight, a more acidic isoelectric point (pI) and decreased heat stability compared to the bovine counterpart, but it showed also a higher activity at low temperature compared to bovi ne chymotrypsin (Asgeirsson and Bjarnason, 1991) Elastase is named after elastin, an elastic fibrous protein of connective tissue, it usually targets. However elastase is also effective in hydrolyzing various other soluble proteins (Lewis and others 1956) A study by Asgeirsson and Bjarnason (1993) showed that elastase, extracted and pur ified from Atlantic cod had a reduced heat and acid stability compared to porcine intestinal elastase, but the catalytic efficiency was about twice as high. An earlier study by Gildberg and Overbo (1990) showed similar results as they described cod elastase to be less thermostable than porcine elastase, but higher in turnover number and catalytic efficiency. Table 2 1 shows a list of all amino acids, as well as their three and one letter code and the side chain polarity, as described by Belitz and others (2004)

PAGE 23

23 Bioactive P eptides and F ish P rotein H ydrolys ates During the past 50 years research has focused on investigating and optimizing conditions to produce fish protein hydrolysates with high protein yield and good food functionality (Kristinsson and Rasco, 2002) Studies have shown that the size and chemical properties of peptides from fish protein hydrolysates have a dramatic impact on their functionality. Enzyme specificity and degree of hydrolysis (%DH) are key elements to produ ce peptides with properties that can be used in a wide variety of products (Mullally and others 1994; Kristinsson and Rasco, 2000a) While earlier research explored the use of fish protein hydrolysates in food systems and products, the focus has shifted in recent years to study their potential bioactive properties. Recent studies show that protein hydrolysates may provide physiologic al benefits to living systems as well as bioactive properties that might also be used to stabilize food products (Raghavan and others, 2008; Raghavan and Kristinsson, 2009) Fish protein hydrolysates have receive d increased attention lately for their potential to serve as antioxidants in food systems to limit lipid oxidation. Seafood products, especially those rich in lipids and potent pro oxidants, are highly susceptible to quality deterioration by lipid oxidatio n (Hultin, 1994) Some earlier studies on fish protein hydrolysates, prepared from sardine myofibrillar proteins, showed their antioxidant potential, which was substantially increased when combined with different commercial antioxidants (Hatate and others 1990) Other physiological benefits, beside antioxidant capacities, have been repor ted connected to hypertension (high blood pressure) and arteriosclerosis (Chuang and others 2000) The inhibition of angiotensin converting enzyme (ACE) is another useful activity which may lead to the reduc tion of hypertension (Jeon and others 1999) Various fish protein hydrolysates have been found to have the

PAGE 24

24 ability to inhibit ACE and therefore could possibly lead to reduced hypertension if consumed (Kohama and others 1991; Ukeda and others 1992; Matsumura and others 1993; Wako and others 1996) Fish protein hydrolysates (commercial cod and mackerel hydrolysates) have also been found to r educe anxiety in humans (Dorman and others 1995) and improve the learning performance and memory in rats (Le Poncin, 1996) and in humans (Le Poncin and Lamproglou, 1996) The same commercial hydrolysates have also been reported to reduce stress in laboratory rats similar to the known drug diazepam (valium) (Bernet and others 2000) Furthermore fish protein hydrolysates have been found to enhance the flow of red blood cells and stimulate the proliferation of white blood cells (Chuang and others, 2000; Thongthai and Gildberg, 2005) Antioxidant Capacity / Reactive Oxygen Species Sca venging Ability Potent antioxidants are useful substances, which can be used in food products to inhibit or delay deterioration caused by oxidation, like lipid oxidation, and to promote health effects as they act physiologically as antioxidants in vivo. In an early study Shahidi and others (1995) reported the addition of fish protein hydrolysates to minced pork reduced the formation of thibarbituric acid reactive substances (TBARS), an indicator for lipid oxidation, up to 60%. Metal chelation was suspected to be the cause of the antioxidant properties, but was not confirmed in this study. In later studies pro and anti oxidant fractions were extracted from fish protein hydrolysates, but it is assumed that the presence of t ransition metals, heme and heme proteins in the starting material could have contributed to the pro oxidative effect (Amarowicz and Shahidi, 1997) Decreased lipoxygenase and hemoglobin mediated linoleic acid oxidation has been reported by Chuang and others (2000) in the presence of mackerel protein hydrolysates. It was hypothesized that the antioxidant mechanism was likely due to

PAGE 25

25 histidine related di peptides such as anserine and carnosine, which were repo rted to scavenge free radicals (Chuang and others, 2000) Regarding the size of the peptide fractions, Jeon and others (1999) reported peptide fr actions below 5 kDa from cod protein hydrolysates showed good inhibition of oxidation in a linoleic acid model system. It seems that the antioxidant properties of fish protein hydrolysates are highly dependent upon the amino acid composition and the molecu lar size of the peptides, which in turn are dependent on the type of enzyme and the conditions used in the protein hydrolysis (Saiga and others 2003) Many h uman diseases are related to oxidative processes and fish protein hydrolysates have been reported as potential antioxidants. Antioxidants are believed to (ROS). These ROS a re harmful by products of normal cell aerobic respiration. It has been suggested that an increased intake in dietary antioxidants will help the body to maintain an adequate antioxidant status and support normal physiological function in living systems (Ou and others 2002a) In a study by Boukrott and others (2004) hypertensive rats were fed fish protein hydrolysates and showed an increase in overall antioxidant status compared to casein fed rats. In more recent studies fish protein hydrolysates, prepared from tilapia with a commercial enzyme mixture and a cod enzyme mixture (trypsin, chymotrypsin and elastase), showed to be effective scavengers of ROS, generated by human mononuclear cells and endogenous H 2 O 2 This study also showed that the ROS scavenging ability increased with increasing degree of hydrolysis and low molecular weight peptides seem to be better ROS

PAGE 26

26 scavengers than the remaining high molecular weight peptides (Raghavan and others, 2008) Many studies recently published, try to fractionate proteins, protein hydrolysates and peptides with various chromatography methods and isolate the fractions with the most antioxidant active peptides, usually followed by further analysis and identification of the peptides involved. Mass spectrometry is widely used to identify and sequence the peptides, although methods like Edman degradation are still employed to sequence purified peptides. In a study by Li and others (2008) chickpea protein hydrolysate was fractionated by gel filtration and the antioxidant and free radical scavenging ability of four fractions was analyzed. The amino acid analysis of the most a ctive fraction showed that it had the highest hydrophobicity among all other fractions and a molecular weight range from 200 to 3000 Da (Li and others, 2008) A study, whic h focused on the antioxidant activities of smooth hound muscle protein hydrolysates (digested by various gastrointestinal proteases), determined that the low molecular weight fraction (lower than 3500 Da) showed the highest antioxidant activity. Further am ino acid analysis of this fraction determined it was rich in histidine, methionine, tyrosine, leucine, isoleucine, glycine and arginine. This study also showed that the antioxidant activity of the hydrolysates is dependent on the enzyme used and the degree of hydrolysis achieved, as a low molecular weight alkaline protease (LMW) achieved the highest degree of hydrolysis and showed the highest antioxidant activity. (Bougatef and others 2009) A study by Qian and others (2008) purified a particular peptide from bullfrog ( Rana catesbeiana Shaw ) skin hydrolysate that showed higher lipid peroxidation inhibition than

PAGE 27

27 tocopherol and quenched efficiently different sources of free radicals, li ke DPPH radicals, hydroxyl radicals, superoxide radicals and peroxyl radicals. The peptide was purified by consecutive chromatography methods and analyzed by Q TOF ESI (Quadrupol Time of Flight, Electrospray Ionization) mass spectrometry (Qian and others, 2008) The sequence of this peptide (MW = 1478 Da) is listed in Table 2 2. Hernandez Ledesma and others (2005) studied the antioxidant and ACE inhibitory effects of peptides in fermented milk and ide ntified several peptides with sequences equal or similar to peptides previously described as antioxidants and ACE inhibitors. These peptides and their sequences are also listed in Table 2 2. The authors used RP HPLC (Reverse Phase High Performance Liqu id Chromatography) tandem mass spectrometry to analyze and identify these peptides (Hernandez Ledesma and others, 2005) Among the marine protein sources bigeye tuna ( Thunnus obesus ), horse mackerel ( Magalaspis cordyla ), hoki ( Johnius belengerii ) and grass carp ( Ctenopharyngodon idella ) have been studied by different authors for antioxidant activities of peptides derived by various methods and from different body tissues (Je and others 2008; Sampath and others 2011; Kim and others 2007; Ren and others 2008) Je and others (2008) isolated a peptide from bigeye tuna dark muscle (with a molecular weight of 1222 Da), which was derived by peptic hydrolysis and showed the most antioxidative potential compared to peptides derived by enzymatic hydrolysis using Alcalase, chymotrypsin, neutrase, papain and trypsin. The peptide was identified by Q TOF ESI mass spectrometry and is listed in Table 2 2 (Je and others, 2008) Sampath and others (2011) performed an in vitro gastrointestinal digestion of horse mac kerel viscera protein,

PAGE 28

28 followed by fast protein liquid chromatography (FPLC) to isolate a peptide that showed 89.2 and 59.1 percent scavenging effect for DPPH and hydroxyl radicals, respectively. The peptide was analyzed by ESI MS/MS and identified as Ala Cys Phe Leu with a molecular weight of 518.5 Da. This peptide is also listed in Table 2 2 (Sampath and others, 2011) Kim and others (2007) employed six different proteases (pepsin, trypsin, papain, chymotrypsin, Alcalase and Neutrase) to hydrolyze hoki frame proteins and identified the hydrolysate from the peptic digestion as the most potent antioxidant peptides. After further fractionation they purified and identified an 1801 Da peptide that showed high DPPH hydroxyl peroxyl and superoxyl radical scavenging abilities. This peptide is listed in Table 2 2 (Kim and others, 2007) A study by Ren and others (2008) identified a peptide (966.3 Da), that was derived from grass carp muscle by Alcalase hydrolysis and purified by several consecuti ve chromatography steps, as a potent antioxidant. Their study also concluded that basic peptides show greater hydroxyl radical scavenging ability than acidic or neutral peptides and that hydrophobic peptides observe higher antioxidant activities than hydro philic peptides ( Ren and others, 2008) A relatively new antioxidant assay is the Cellular Antioxidant Activity (CAA) assay, which was developed in 2007 by Wolfe and Liu (2007) Accord ing to Wolfe and Liu (2007) the measurement of antioxidant activity is an important screening method for fruits and vegetables and other phytochemicals in various food sy stems. However most of the chemical assays available cannot really predict the in vivo availability and ability of antioxidants. The CAA assay was developed by Wolfe and Liu (2007) to create a better model of the complexity of a biological system in regard to antioxidant activity

PAGE 29

29 assays compared to the traditional chemical assays. The assay uses HepG2 human hepatocellular carcinoma cells, but can also be adapted to other c ell lines, as shown by Roy and others (2009) Angelino and others (2011) and Xu and others (2010) A probe chemical (DCFH DA) is applied to the cells, absorbed by the cells and excess is washed away. The test substance is then applied to the cells, followed by a radical initiator (ABAP or AAPH), which initiates the release of radicals in the cell, and if not quenched by the antioxidant, wi ll react with the probe to form a fluorescent compound which can be measured. The difference between a control (no antioxidants) reaction and the reaction with test substances present can be calculated and is expressed as CAA units (Wolfe and others 2008; Wolfe and Liu, 2008; Wolfe and Liu, 2007) One important advantage of the CAA assay is that it does not only determine the antioxidative activity of a test substance, but determines whethe r this substance can be absorbed at or into the cell to work as an antioxidant in the biological system. Not many studies have been performed yet with the CAA assay, since it is relative new and it has to be tested and adapted for use with different forms of antioxidants. A cell cytotoxicity assay is usually performed before the CAA assay with the test substances to ensure they are compatible with the assay and do not influence or inhibit the cell line. A study by Salawu and others (2011) used the CAA assay to determine the antioxidant activities of green leafy vegetables. They successfully used the assay to determine differences in antioxidant activities among the different vegetables used and for different concentrations of freeze dried extracts of those vegetables (Salawu and others, 2011) Roy and others (2009) used chemical and cellular antioxi dant assays to determine that steam processed broccoli ( Brassica oleracea ) has higher antioxidant

PAGE 30

30 activities than the unprocessed counterpart. They determined that the hydrophilic part of the steamed broccoli showed a significant reduction of AAPH induced intracellular radicals compared to the fresh, unprocessed broccoli (Roy and others, 2009) An interesting study by Angelino and others (Angelino and others, 2011) observed the antioxidant activity of phyt ochemicals purified from olive mill waste waters with chemical and cellular antioxidant assays. They used the Oxygen Radical Absorbance Capacity (ORAC) assay and the CAA assay to measure antioxidant activities. For the CAA assay, red blood cells were used instead of the HepG2 cells (Wolfe and Liu, 2007) They concluded that the ORAC assay determined the overall antioxidant activity in ORAC units per gram dry weight and the CAA assay demon strated that the phytochemicals are able to penetrate the cells and work as antioxidants inside the biological system (Angelino and others, 2011) A study by Xu and others (2010) used the CAA assay to determine the antioxidant activities of soy milk manufactures by different temperature controlled methods, including traditional stove cooking, direct steam injection, direct ultrahigh temperature (UHT) and indirect UHT. The authors also used traditional chemical antioxidant assays, such as ORAC assay, Ferric reducing antioxidant power (FRAP) assay and DPPH radical scavenging ability assay. Interestingly they observed that thermal processing of soy milk significantly increased antioxi dant activities in chemical assays, but decreased cellular antioxidant capacity as compared to raw soy milk (Xu and others, 2010) This study shows that the CAA assay can be very useful to determine the bioavailability of a potential an tioxidant as compared to chemical assays alone.

PAGE 31

31 Angiotensin Converting Enzyme Inhibition Angiotensin converting enzyme (ACE) is a dipeptidyl caboxy peptidase (EC 3.4.15.1), located in many tissues and biological fluids, that plays a key role in the regulat ion of blood pressure and normal cardiovascular functions (Meng and Oparil, 1996; Coates, 2003) The conversion of angiotensin I into angiotensin II is catalyzed by this peptidase. Angiotensin II is a powerful endogenous vasoconstrictor, but it also degrades bradykinin into inactive components, which have a vasodilation effect. Therefore ACE elevates blood pressure and the inhibition of ACE could result in an overall antihypertensive effect (Shalaby and others 2006) Peptides from dairy origin, have shown great bioactive properties in regard to antimicrobial, anticarcinogenic, cholesterol lowering, antithrombic, immunomodulating, enzyme inhibitory and antihypertensive effects (Meisel, 1998; Suetsuna and others 2000; Nagaoka and others 2001; Sipola and others 2002) The search for peptides able to inhibit ACE has been increased due to the potential use of t hose peptides in drugs, functional foods and nutraceuticals as antihypertensive agents (Ryhnen and others 2001; Schlothauer and others 2002; Sipola and others, 2002) Other sources hav e also been identified from which peptides with an ACE inhibitor effect can be extracted or produced, such as corn, soy, gelatin, milk, algae and fish proteins (Fujita and Yoshikawa, 1999; Kim and others 2001; Suetsuna and Chen, 2001; Wu and others 2008; Fuglsang and others 2003; Suh and others 2003; Vermeirssen and others 2003) The inhibitor effe ct appears to be highly dependent on the molecular size of the peptides, where smaller peptides tend to generate a greater inhibitor effect. In a study by Jeon and others (1999) cod protein hydr olysates were fractionized and a reduction in ACE inhibitor activity was recorded in order from 3 kDa to 5 kDa to 10 kDa and finally 30 kDa. Another study reported that

PAGE 32

32 sardine and cod head hydrolysates showed a 30% ACE inhibition while shrimp showed up to 57% ACE inhibition (Bordenave and others 20 02) A study by Theodore and Kristinsson (2008) showed high ACE inhibition (up to 90%) in fish protein hydrolysate s prepared from channel catfish protein isolate. They suggested that there was no simple relationship between average peptide size, degree of hydrolysis and ACE inhibition, but their results indicate that the soluble fraction of the hydrolysates, which con tains the smallest peptides, is responsible for most of the ACE inhibition. A recent study by Raghavan and Kristinsson (2009) on tilapia protein hydrolysates showed the highest ACE inhibition for low molecular weight peptides (<10 kDa), compared to medium (10 30 kDa) and high (>30 kDa) molecular weight peptides, as well hydrolysates with 25% degree of hydrolysis compared to 7.5%. Since peptides are widely researched for ACE inhibition, a study by Pripp and Ardo (2007) tried to model a relationship between ACE inhibition and the bitter taste of certain peptides. They found a significant correlation of increased ACE inhibition and bitterness found in certain dipeptides. They attributed the hydrophobicity of those peptid es to the relationship between ACE inhibition and bitter taste (Pripp and Ardo, 2007) This study is just an example how important the peptide properties are for ACE inhibition and that they are closely related to other easily measurable properties, such as molecular weight and hydrophobicity. Among many studies it is shown over and over again that the low molecular weight peptides observe much higher ACE inhibitory effects than larger peptides from the same source. Pihl anto and others (2008) published a study in 2007 which determined the ACE inhibitory and radical scavenging effects of potato protein hydrolysates. They

PAGE 33

33 observed that after ultrafiltration of the hydrol ysate the less than 3 kDa fraction observed the highest ACE inhibitory effect. Miguel and others (2009) studied the ACE inhibitory and antihypertensive effects of bovine casein hydrolysate. They measured the ACE inhibitory effect of the pepsin hydrolyzed bovine casein and a < 3 kDa fraction of the same hydrolysate. The ACE inhibitory effect was 10 fold high er for the low molecular weight fraction than for the parent hydrolysate. In an antihypertension study with rats, they observed that both the parent and the low MW fraction of the hydrolysate showed effects close to captopril, a synthetic antihypertension drug (Miguel and others, 2009) The ACE inhibitory effect of peptides from apricot ( Prunus armeniaca L. ) kernel protein hydrolysate was studied by Zhu and others (2010) The authors used six different proteases to hydrolyze the apricot kernel protein and determined that Alc alase showed the highest potential to produce peptides with ACE inhibitory effect. The Alcalase hydrolysates were further fractionated using ultrafiltration and it was determined that the lowest molecular weight fraction (less than 1 kDa) showed the highes t ACE inhibitory activity (Zhu and others, 2010) Guo and others (2009) used response surface methodology to optimize hydrolysis conditions to produce peptides from whey protein with ACE inhibitory effects. They dete rmined that the ACE inhibitory activity of the whey protein hydrolysates could be controlled by hydrolysis temperature, pH and enzyme to substrate ratio. They observed the highest ACE inhibitory activity (close to 92.2%) for a whey protein hydrolysate with 18.8% degree of hydrolysis (DH) (Guo and others, 2009)

PAGE 34

34 A very interesting study was conducted by Jia and others (2010) who investigated the use of ultrasound for enzymatic preparation of ACE inhibitory peptides from wheat germ protein. They studied the effect of ultrasound treatment before and during hydrolysis and determined that ultrasound pretreatment increased the ACE inhibitory activity up to 40% while the ultrasound treatment during hydrolysis had almost no effect. Furthe r analysis suggested that ultrasonic pretreatment may accelerate the release of hydrophobic amino acids during enzymatic hydrolysis, which may lead to the increased ACE inhibitory effect (Jia and others, 2010) Several studies have also been conducted recently to isolate and identify specific peptides from various protein sources (derived by enzymatic or chemical hydro lysis) that show high ACE inhibitory activity. Table 2 2 lists some of the peptides that were isolated and identified in recently published studies. Balti and others (2010) discovered three novel ACE inhibitory enzymes derived by digestive proteases from cuttlefish ( Sepia officinalis ). The cuttlefish was hydro lyzed by various proteases and tested for ACE inhibitory activity and the most active hydrolysate was further fractionated using gel filtration chromatography. The three novel peptides were identified by ESI mass spectrometry and their sequence is listed i n Table 2 2 (Balti and others, 2010) A study by Rho and others (2009) determined the ACE inhibitory effect of fermented soybean extract and tried to purify and identify the peptide with the ACE inhibitory activity. In this study fermented soybean extract was fractionated by ultrafiltration and consecutive chromatography methods. The parent soybean extract observed an IC 50 value of 1.46 mg/ml for ACE inhibition, while the purified peptide showed an IC 50 value of 22 g/ml. The amino acid sequence of this peptide was

PAGE 35

35 determined by Edman degradation and is listed in Table 2 2 (Rho and others, 2009) Sheih and others (2009) performed the isolation and characterization of a novel ACE inhibito ry peptide from algae protein waste. The pepsin hydrolysate of the algae protein waste was fractionated and then characterized by Edman degradation to reveal the peptide sequence of the ACE inhibitory peptide, which can be found in Table 2 2. Further analy sis revealed that this particular peptide retained most of its ACE inhibitory effect at a pH range from 2 10 and temperature from 40 (Sheih and others, 2009) The ACE inhibitory activity and antihypertensive effect of fermented milk was studied by Pihlanto and others (2010) where 25 lactic acid bacteria were us ed to prepare the test samples. Their experiment showed that the ACE inhibitory effect was dependent on the lactic acid bacteria used and correlated to the degree of hydrolysis, but independent on other fermentation conditions and pH. The milk fermented wi th Lb. jensenii showed the highest ACE inhibitory effect and provided a transient reduction of blood pressure in spontaneously hypertensive rats (Pihlanto and others 2010) Lee and others (2010) discovered a 21 amino acid long peptide, isolated from tuna frame protein hydrolysate, which showed ACE inhibitory activity and antihypertensive effects in spontaneously hypertensive rats. The authors used several proteinases and determined that the pepsin hydrolyzed tuna frame protein observed the highest ACE inhibitory effects. Further fractiona tion of high (5 10 kDa), medium (1 5 kDa) and low (less than 1 kDa) molecular weight fractions was performed and the 1 5 kDa fractions observed the highest ACE inhibitory activity. From this fraction the novel peptide was

PAGE 36

36 isolated by consecutive purificati on and sequenced by Q TOF ESI mass spectrometry. The sequence of this peptide is listed in Table 2 2 (Lee and others, 2010) Myosin hydrolysates from boneless chicken leg meat was prepared by pepsin digestion and analyzed for ACE inhibitory activity by Terashima and others (2010) The authors identified two distinct peptides which correspond to the amino acids 125 135 and 825 835 in the myosi n heavy chain protein molecule. These two peptides observed higher ACE inhibitory values than captopril, which is a synthetic ACE inhibitor. The sequence of those peptides are listed in Table 2 2 (Terashima and others, 2010) Further studies, where isolation and characterization of ACE inhib itory peptides derived by hydrolysis was performed, include studies on Alcalase hydrolysate of peanut flour (Guang and Phill ips, 2009) studies on smooth hound fish muscle protein hydrolysates (Bougatef and others, 2009) and studies on a novel ACE inhibitory peptide isolated from sea cucumber (Zhao and others 2009) The amino acid sequence o f these peptides is listed in Table 2 2. Most of these studies confirm that low molecular weight peptides have the highest ACE inhibitory activities and that the hydrolysis conditions, especially the degree of hydrolysis and the type of enzyme play an impo rtant role in determining ACE inhibitory activity. Protein and Peptide Analysis Protein and peptide analysis employs many different tools to identify and characterize the immense variety of proteins that are expressed in a cell of any organism. Traditional ly, sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS PAGE) is one of the first tools that can be used to analyze and characterize proteins or peptides, however as a one dimensional gel electrophoresis, it is limited to the analysis of refin ed or purified protein mixtures with less than 100 different proteins.

PAGE 37

37 To analyze the whole protein complement that can be expressed by a particular cell, the two dimensional (2D) gel electrophoresis should be employed, which consist of a isoelectric focu sing step in one direction of the gel and the SDS PAGE step in the second direction of the gel. Only one sample can be analyzed on a single gel, but a higher resolution can be achieved this way (Boguth and others 2000) St ill some protein mixtures may be too complex to be analyzed without prior fractionation; therefore most protein analysis should include some form of separation and purification before more complex analysis methods are employed. Usually any type of column c hromatography, like size exclusion, ion exchange, hydrophobic interaction or affinity chromatography is used to separate the protein mixture into smaller fractions that can then be analyzed and characterized (Palzkill, 2002) While the previously mentioned techniques are useful to separate and characterize a protein or peptide based on charge or molecular size, they are not capable of identifying the protein or peptide. A traditional technique to identify the sequence of a protein or peptide is the Edman degradation procedure, where a peptide is degraded ste pwise by phenylisothiocyanate, cleaved by trifluoroacetic acid and converted in aqueous HCl to phenylthiohydantoin, repeatedly until the entire protein is sequenced (Belitz and others, 2004) Since this process is slow and has a low throughput it is no longer used in most proteomics research (Palzkill, 2002) The major advancement in proteomics research came with the reliable adaptation of mass spectrometry (MS) for peptide analysis. Since most proteins are too large and complex for direct MS analysis a pre digestion into smaller peptides by specific proteases, for example trypsin, is usually performed before analysis (Matthias Wilm and

PAGE 38

38 others 1996; Mann, 1996; Palzkill, 2002) In mass spe ctrometry the fragmented molecules are characterized by their mass to charge ratio (m/z). In order to be analyzed the particles have to be ionized into a gas phase and are then analyzed by a mass analyzer which is coupled with a ion detector to determine t he mass to charge ratio of the ion (Yates, 2 000) Mass spectrometers are differentiated by their ionization source, their ion detector and mass analyzer. The most common ionization sources are MALDI (Matrix assisted laser desorption ionization) and ESI (Electrospray ionization). Mass analyzer and ion detectors used are TOF (Time of Flight) analyzer, Quadrupol mass filter and Ion traps, such as three dimensional Quadrupol ion trap, linear Quadrupol ion trap and orbitrap (Yates and others 2006; Henzel and others 1993; Miranker, 2000; Palzkill, 2002) Another common approach is the use of tandem mass spectrometry or MS/MS, where the ionized peptides are first resolved in the first mass analyzer, which separates and isolates one species at a time that is then sent to a collision cel l. In the collision cell the peptide is further fragmented, and then sent to the second mass analyzer. There the mass of the fragments is precisely analyzed and a partial amino acid sequence of the peptide can be determined. These partial sequences, called peptide sequence tags, can then be used in database searches to identify the protein or peptide (Mann and others 2001; Mann, 1996; Matthias Wilm and others, 1996; Palzkill, 2002) The final step after mass spectrometry analysis is to identify the protein or peptide sequence by database search or De novo sequencing (Wilm and others 2000; Yates and others 2000) The large amount of peptide sequence tags, generated by the mass spectrometer can be compared to a database of known protein and peptide sequences

PAGE 39

39 to identify the actual proteins and peptide present in the sample. Databases like UniProt or SwissProt contain large amounts of information regarding protein and peptide sequences for a larg e variety of species. Search engines like SEQUEST or PEAKS are employed to compare the mass spectrometry results to the databases and identify the proteins with a certain amount of accuracy, defined by probability parameters. To identify the error rate of false identification of certain amino acid sequences a decoy database search can be employed, where, the mass spectra are compared to the original database and a database where the amino acid sequences are reversed. A match in both databases would be consi dered false and increase the False Discovery Rate (FDR) of the protein or peptide detection (Yates and others, 2000) When the protein or peptide sequence is not known in any database De novo sequencing can be employed to determine the peptide amino acid sequence. De novo characterized without additional knowledge. In this regard the Edman degradation can be characterized as De novo sequencing. In mass spectrometry a labeling technique for the C terminal amino acid can be used to identify the side by the additional mass in the mass spectrometer and the correct sequence of a peptide can be analyzed by tandem mass spectrometry. Of course the more information is available of the original protein or peptide the more accurate are the results of the mass spectrometry analysis (Wilm and others, 2000) Many recently published articles and studies (see previous chapters) regarding antioxidant and ACE inhibitory effects of proteins, peptides and hydrolysates have used

PAGE 40

40 the various forms of mass spectrometry, described in this chapter, to identify a particular peptide, which showed bioactive potential. Table 2 1. List of amino acids with three and one letter codes Amino Acid Three Letter Code One Letter Code Side Chain Polarity Alanine Ala A nonpolar Arginine Arg R nonpolar Asparagine Asn N polar Aspartic acid Asp D polar Cysteine Cys C nonpolar Glutamic acid Glu E polar Glutamine Gln Q polar Glycine Gly G nonpolar Histidine His H polar Isoleucine Ile I nonpolar Leucine Leu L nonpolar Lysine Lys K polar Methionine Met M nonpolar Phenylalanine Phe F nonpolar Proline Pro P nonpolar Serine Ser S polar Threonine Thr T polar Tryptophan Trp W nonpolar Tyrosine Tyr Y polar Valine Val V nonpolar Note: This table was compiled of information obtained from Belitz and others (2004)

PAGE 41

41 Table 2 2. Bioactive peptides found in different studies Peptide Source Sequence Bioactivity Citation Bullfrog skin LEELEEELEGCE Antioxidant (Qian and others, 2008) Fe rmented milk TTMPLW ACE inhibition (Hernandez Ledesma and others, 2005) NIPPLTQTPV ACE inhibition VLPVPQ Antioxidant HLPLP ACE inhibition Bigeye tuna LNLPTAVYMVT Antioxidant (Je and others, 2008) Horse mackerel ACFL Antioxidant (Sampath and others, 2011) Hoki ESTVPERTHPACPDFN Antioxidant (Kim and others, 2007) Grass carp PSKYEPFV Antioxidant (Ren and others, 2008) Cuttlefish YAP ACE inhibition (Balti and others, 2010) VIIF ACE inhibition MAW ACE inhibition Soybean LVQGS ACE inhibition (Rho and others, 2009) Algae VECYGPNRPQF ACE inhibition (Sheih and others, 2009) Tuna frames GDLG KTTTVSNWSPPKYKDTP ACE inhibition (Lee and others, 2010) Sea cucumber MEGAQEAQGD ACE inhibition (Zhao and others, 2009) Smooth hound AGS ACE inhibition (Bougatef and others, 2009) Chicken myosin MNVKHWPWMK ACE inhibition (Terashima and others, 2010) VTVNPYKWLP ACE inhibition Peanut flour KAFR ACE inhibition (Guang and Phillips, 2009) Note: These are only a few peptides, isolated and identified in various studies, to show antioxidative or ACE inhibitory effects. The citation for each study is given at the end of the table.

PAGE 42

42 CHAPTER 3 OBJECTIVES The hypothesis for this study is that pe ptides with significant bioactive properties can be produced from Atlantic cod ( Gadus morhua ) myosin by enzymatic hydrolysis. Such bioactive properties include reactive oxygen species (ROS) scavenging ability, reducing capability, metal chelation ability a nd other antioxidant capacities, as well as angiotensin converting enzyme (ACE) inhibitor abilities. Enzymes that can produce such peptides (trypsin, chymotrypsin and elastase) were extracted and separated from Atlantic cod ( Gadus morhua ) pyloric caeca. T he first objective was to extract myosin from fresh Atlantic cod ( Gadus morhua ) fillets and to separate and purify trypsin, chymotrypsin and elastase from Atlantic cod ( Gadus morhua ) pyloric caeca. Using the three individual enzymes, myosin hydrolysates we re prepared and were then subjected to fractionation using ultrafiltration. The second objective was to test the parent hydrolysate fractions for antioxidant capabilities and angiotensin converting enzyme inhibitor capabilities using various in vitro chemi cal assays and a cell based assay. The final objective was to identify the peptide fractions that show the highest activities among all tested assays and characterize those peptides using Mass Spectrometry.

PAGE 43

43 CHAPTER 4 ENZYME SEPARATION, M YOSIN EXTRACTION, HYDROLYSIS AND FRACTIONATION Material and Methods Separation and Purification of Trypsin, Chymotrypsin and Elastase The cod enzyme mixture is a mixture of various cold active proteolytic enzymes extracted from Atlantic cod ( Gadus morhua ) by North Ltd. (Re ykjavik, Iceland), which has (according to the product specification sheet) practically no lipase, nuclease and amylase activities, but very high trypsin, chymotrypsin and elastase activities. The original product is an aqueous solution which contains 50% glycerol. Since glycerol will interfere with certain subsequent assay procedures for the myosin hydrolysates, a freeze dried preparation of the same enzyme mixture was obtained from this company and stored at 80C until further use. Trypsin, chymotrypsin and elastase were separated and purified from the enzyme mixture before they were used to hydrolyze myosin for further experiments. Cohen and others (1981) describe an experiment that extracts proteolytic enzymes from carp and separates trypsin, chymotrypsin and elastase from the extracted enzyme mixture using several affinity chromatography procedures. In their origi nal experiment they needed to activate the enzymes from their zymogen states by adding CaCl 2 to crude filtered extract and incubate the mixture for 20 h at 24C. Since, in preliminary experiments, the freeze dried cod enzyme mixture showed very high enzyme activities, the activation step was not required before purification. Enzyme activity measurements at every stage of the purification process were used to determine the success of the separation and purification procedure.

PAGE 44

44 Throughout the entire separation and purification procedure the following parameters were measured at every step: Protein concentration of the mixture or the collected fractions Trypsin activity of the mixture or the collected fractions Chymotrypsin activity of the mixture or the collected fractions Elastase activity of the mixture or the collected fractions Protein concentration was measured using the Pierce 660 nm Protein Assay from Thermo Scientific, calibrated with a bovine serum albumin (BSA) standard curve. The enzyme (trypsin, chymotrypsin and elastase) activities were measured by determining the initial rate of substrate (enzyme specific) conversion in 100 mM Tris HCl buff Benzoyl DL Arginine p nitroanilide (BAPNA) for trypsin, N Succinyl Ala Ala Pro Phe p nitroanilide for chymotrypsin and N Succinyl Ala Ala Ala p nitroanilide for elastase. Each substrate contains the colorimetric component p nitroanilide, which when cleaved from the substrate by the enzyme, will yield a yellow color. The substrate solutions were prepared by first dissolving 20 mM of each substrate separately in dimethyl sulfoxide (DMSO) to prepare a stock solution and then diluting each substrate stock solution in assay buffer to a final concentration of 5 mM (working solution). The undiluted substrate stock solutions (in DMSO) were stable at room temperature for about a week. For the enzyme activi ty assay, 1.35 ml of assay buffer and 150 L of substrate working solution were placed in a 1.5 ml plastic cuvette. Sample (200 L) was added to the cuvette, mixed and the absorbance was measured immediately for 3 minutes in 5 second intervals. The absorba nce was measured at 410 nm and since the extinction coefficient

PAGE 45

45 of p 410nm = 8.8*mM 1 *cm 1 Equation 4 1 was used for all three enzymes to calculate the activity based on the initial rate, measured in A 410nm /min. In Equation 4. 1 A410nm equals the linear rate change in absorbance units for a 1 minute time period, V equals the total volume of the assay solution in the cuvette, dF equals the 410nm equals the millimolar extinction coefficient of p nitroanillide and V e equals the volume of the enzyme solution added. One unit is defined (4 1) The enzymes were separated in two stages on two different affinit y chromatography columns as described by Cohen and others (1981) The first column, an affinity column using pheny lbutylamine (PBA) as a ligand, was used to separate elastase from chymotrypsin and trypsin, which were not separated on this column. The second column, which contained para aminobenzamidine (PABA) as a ligand, was used two separate chymotrypsin and trypsin from the pooled fractions collected in the first column. The elastase containing fractions from the first column were pooled and then concentrated using Amicon Ultra 15 10k Centrifugal Filter Devices with a molecular weight cut off (MWCO) of 10,000 kDa. During the concentration step the retentate was washed several times with ultra pure water, therefore exchanging the buffer and retaining the purified concentrated enzyme in ultra pure water. The chymotrypsin/trypsin fractions from the first column were tr eated in the same way, except that the final washing step contained the starting buffer for the second column chromatography step. The concentrated chymotrypsin/trypsin solution was added onto the second column to separate chymotrypsin and trypsin. The sep arated trypsin and chymotrypsin fractions

PAGE 46

46 were pooled, washed and concentrated as described for the elastase fraction. The three separated enzymes, trypsin, chymotrypsin and elastase, were then stored at 80 C until further use. For the first chromatograph y step a phenylbutylamine (PBA) Sepharose 4B chromatography column was prepared and packed. Cyanogen Bromide activated Sepharose 4B affinity media was obtained from GE Healthcare and phenylbutylamine (PBA), obtained from Sigma Chemicals Co. (St. Louis, MO) was attached as a ligand to the affinity media as described in the affinity media product manual. The lyophilized medium (30 g) was suspended in 200 ml 1 mM HCl solution and allowed to swell. The medium was subsequently washed on a sintered glass filter (porosity G3) for 15 minutes by adding 6000 ml 1 mM HCl solution in several aliquots. PBA (1.05 g) was added to 150 ml of coupling buffer (0.1 M NaHCO 3 pH 8.3 containing 0.5 M NaCl) and this solution was added to the pre swollen medium in a stoppered vess el. The suspension was slowly rotated (mixed) overnight at 4 C. The medium was washed with 500 ml of coupling buffer and transferred into 300 ml 0.1 M Tris HCl (pH 8.0) solution and incubated for 2 hours to block any remaining active groups. Finally the me dium was washed with three cycles of alternating pH, whereas each cycle contained a 500 ml wash with 0.1 mM acetic acid (pH 4.0, with 0.5 M NaCl) followed by a 500 ml wash with 0.1 M Tris HCl (pH 8.0, with 0.5 M NaCl). The medium was then stored in binding buffer A (10 mM Tris HCl, 10 mM CaCl 2 200 mM KCl, pH 8.0). The PBA Sepharose column was prepared by pouring the medium into a glass column (3 cm in diameter, 20 cm length packed) and packed to a bed volume of approximately 140 ml. The column was packed a t a flow rate of 3 ml/min with binding buffer and secured with a column adapter.

PAGE 47

47 The enzyme solution, to be applied to the first column, was prepared by adding 10 g freeze dried cod enzyme mixture to 40 ml of binding buffer A, vortex the mixture for 5 minu tes followed by centrifugation at 5000 x g for 5 minutes. The supernatant was collected and the protein content as well as specific enzyme activities were measured. The PBA column was equilibrated with binding buffer A until no further change in pH was obs erved for the effluent. Enzyme solution (10 ml) was added onto the column, followed by a rinse with 400 ml binding buffer A. Elution was carried out by rinsing the column with 300 ml elution buffer A (100 mM PBA in ultra pure water with 20% ethanol). Final ly the column was washed with 300 ml 7M Guanidine Hydrochloride (Gua HCl) solution, followed by re equilibration with binding buffer A for subsequent reuse. The flow rate was constant at 1 ml/min during the entire chromatography procedure using a peristalt ic pump, connected between the column and the fraction collector. Fractions (10 ml) were collected and analyzed. The absorbance of each fraction at 280 nm was measured and plotted against the fraction number. The specific enzyme activities were measured fo r every second fraction surrounding the peak area on the 280 nm chromatogram and for every fifth fraction outside the peak areas. The specific enzyme activities were then plotted against the fraction numbers inside the 280 nm chromatogram. The fractions sh owing the highest enzyme activities were pooled and used as previously described. This chromatography procedure was repeated 3 times to recover enough enzyme solutions for subsequent use. For the second chromatography step a para aminobenzamidine (PABA) Se pharose 4 Fast Flow (also referred to as Benzamidine Sepharose 4 Fast Flow) column was prepared and packed. The Benzamidine Sepharose 4 Fast Flow medium

PAGE 48

48 was obtained from GE Healthcare as a pre swollen media stored in 0.05 M acetate buffer (pH 4.0, with 20 % ethanol). To prepare the medium for packing, the storage solution was decanted off and replaced by binding buffer B (10 mM Tris HCl, 10mM CaCl 2 200 mM KCl, pH 7.4). The PABA Sepharose column was prepared by pouring the medium into a glass column (1.5 cm in diameter, 16 cm length packed) and packed to a bed volume of approximately 30 ml. The column was packed at a flow rate of 3 ml/min with binding buffer B and secured with a column adapter. The fractions containing chymotrypsin and trypsin from the first column were pooled and concentrated using Amicon Ultra 15 10k Centrifugal Filter Devices with a molecular weight cut off (MWCO) of 10,000 kDa. During the concentration step the retentate was washed several times with ultra pure water, therefore exchangin g the buffer and retaining the purified concentrated enzyme in ultra pure water. The retentate was finally washed with binding buffer B and concentrated, therefore retaining the desired enzymes in binding buffer B and ready for application onto the second column. The PABA column was equilibrated with binding buffer B until no further change in pH was observed for the effluent. Chymotrypsin/trypsin (2 ml) solution was added onto the column, followed by a rinse with 100 ml binding buffer B. Elution was carrie d out in two steps by rinsing the column with 500 ml binding buffer B (with 0.5 M NaCl added), followed by a rinse with 150 ml acetic acid (25 mM). To all fractions from the acetic acid rinse 1 ml 1M Tris HCl buffer (pH 9.0) was added to prevent enzyme ina ctivation or degradation due to low pH. Finally the column was washed with 50 ml 7M Guanidine Hydrochloride (Gua HCl) solution, followed by re equilibration with binding buffer B for subsequent reuse. The flow rate was constant at 1 ml/min during the entir e

PAGE 49

49 chromatography procedure using a peristaltic pump, connected between the column and the fraction collector. Fractions (12 ml) were collected and analyzed. The absorbance of each fraction at 280 nm was measured and plotted against the fraction number. The specific enzyme activities were measured for every second fraction surrounding the peak area on the 280 nm chromatogram and for every fifth fraction outside the peak areas. The specific enzyme activities were then plotted against the fraction numbers insi de the 280 nm chromatogram. The fractions showing the highest enzyme activities were pooled and used as previously described. This chromatography procedure was repeated 6 times to recover enough enzyme solutions for subsequent use. A purification table (Ta ble 4 1) was used to monitor the separation and purification process. Extraction of Atlantic C od M uscle M yosin To extract myosin from Atlantic cod ( Gadus morhua ) a modified procedure originally developed by Martone and others (1986) w as used. The original procedure was modified and described by Kristinsson (2001) The modified procedure was compared by Kristinsson (2001) to three other methods for myosin extraction and showed the highest purity results for myosin extraction. The following solutions were prepared for the extraction process and stored at ning 0.1 M KCl, 1 mM phenylmethylsulfonyl fluoride (PMSF), 0.02% sodium azide (NaN 3 ) and 0.02 M Tris HCl, was prepared with ultra pure water and adjusted to pH 7.5 with 1 M NaOH. Solution B, containing 0.45 M KCl, 0.2 M magnesium acetate (Mg(CH 3 COO) 2 ), 1 m M ethylene glycol tetraacetic acid (EGTA), 0.02 M Tris Maleate and 5 mM beta mercaptoethanol (was added just before use), was prepared with ultra pure water and adjusted to pH 6.8 with 1 M NaOH. Solution C,

PAGE 50

50 containing 0.5 M KCl, 0.02 M Tris HCl and 5 mM be ta mercaptoethanol (was added just before use), was prepared with ultra pure water and adjusted to pH 7.5 with 1 M NaOH. Adenosine triphosphate (ATP) was added to a concentration of 0.01 M during the second washing step and magnesium chloride (MgCl) was ad ded to a concentration of 0.01 M during the third washing step. Sodium bicarbonate (NaHCO3) was used as buffer in several non specific washing solutions at a concentration of 1 mM. All chemicals were obtained from Fisher Scientific Co. (Pittsburgh, PA) and Sigma Chemical Co (St. Louis, MO). Fresh Atlantic cod ( Gadus morhua ) w as obtained from Save On Seafood (Tampa FL ) and myosin w as extracted from the white muscle according to the modified procedure. A ny fat and connective tissue w as removed from the fille t and 200 g of muscle was then chopped and homogenized with 2 L of washing solution A, followed by a 60 min incubation at 4C and subsequent centrifugation at 1000g for 10 minutes at 4C. The collected pellet was then suspended in 1L of washing solution B, which contain ed 10 mM ATP, followed by 60 min incubation at 4C and subsequent centrifugation at 10,000g for 15 minutes at 4C. The supernatant was the n diluted very slowly into 19 L of 1mM Na HCO3 buffer, followed by overnight incubation at 4C and subse quent centrifugation at 12,000g for 10 min at 4C. The pellet w as then suspended in 1 L of washing solution C and homogenized by using a Potter Elvehjem tube. The suspension was incubated for 10 min at 4C and then diluted 3 fold (3 L) with 1mM Na HCO3 buf fer. Magnesium chloride was added to a final concentration of 10 mM. The suspension was then incubated at 4C overnight followed by a centrifugation at 22,000g for 15 min at 4C. For the original procedure the pellet would be suspended in solution

PAGE 51

51 C, homog enized and then stored for subsequent experiments. Following the modified procedure, the pellet was washed one more time with 40 volumes of deionized water and then centrifuged at 22,000g for 15 min at 4C. The pellet is considered purified myosin and w as stored at 80C until further use. This procedure was repeated several times with different batches of Atlantic cod ( Gadus morhua ) and the extracted myosin pellets were pooled to ensure a uniform sample for subsequent analysis. The extracted myosin was ana lyzed for purity by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS PAGE). Hydrolysis of Atlantic C od M uscle M yosin Enzymatic hydrolysis of myosin was performed using the three separated individual enzymes, trypsin, chymotrypsin and elastase, and the cod enzyme mixture. Five different hydrolysates were prepared by using the three separated enzymes and two different conc entrations of the cod enzyme mixture. Enzyme activity assay results showed that the ratio of chymotrypsin, trypsin and elastase is about 10:1:1, respectively. In order to reflect an enzyme activity of each enzyme in the mixture similar to the enzyme activi ty of the separated enzymes two different concentrations of cod enzyme mixture were chosen to hydrolyze myosin. These concentrations were named CEM high and CEM low. CEM high was added to myosin in such an amount that trypsin activity reached at least 2 Un its per gram protein. CEM low was added in such an amount that the combined enzyme activity did not exceed 2 Units per gram protein. The ratio of enzymes in CEM high and low remained unaltered. Since data from the enzyme separation and purification step al so showed trace amounts of chymotrypsin activity in the trypsin and elastase fraction 10 m of TPCK (N Tosyl L Phenylalanine Chloromethyl

PAGE 52

52 Ketone), a chymotrypsin inhibitor that shows no effect or inhibition of trypsin or elastase, was added to those fracti ons to inhibit any residual chymotrypsin activity. The hydrolysates were prepared by the following procedure. For each hydrolysate 60 g myosin (90% moisture) were suspended and homogenized in 240 ml hydrolysis buffer (10 mM Phosphate, pH 8.5) and the prote in content was measured and adjusted to reach a 2% w/v myosin solution. The pH was measured and, if necessary, adjusted to pH 8.5. Individual enzymes, trypsin, chymotrypsin and elastase, were added to reach a concentration of 2 U per gram protein. For the CEM high concentration hydrolysis, CEM solution was added to yield a concentration of 2 Units of trypsin per gram protein; chymotrypsin and elastase concentration were in excess of 2 Units per gram protein. For the CEM low concentration hydrolysis, CEM sol ution was added to yield an overall enzyme concentration of 2 Units per gram protein, which means trypsin and elastase were diluted and mainly chymotrypsin determined the enzyme activity. The myosin/enzyme solutions were transferred to 1 quart Ziploc free zer bags and the remaining air was removed before sealing the bags. The bags were gently shaken for enzyme activity was terminated by placing the bag in a water bath and heatin g the further denaturation. Unhydrolyzed and aggregated proteins were removed from the hydrolysates by centrifugation at 5000 x g for 10 minutes. The hydrolysates wer e adjusted to pH 7.5 and stored at before and after hydrolysis to determine protein/peptide content and degree of hydrolysis.

PAGE 53

53 The degree of hydrolysis (DH) was determined by the o phthaldialdehyde (OPA) me thod as described by Nielsen and others (2001) This method was chosen since, according to the authors, it is more accurate, is easier and faster to carry out, has a broader application range and is environmentally safer than other methods (Nielsen and others, 2001) This method is based on the reaction of OPA with primary amine groups and a sulfhydryl (SH) compound (dithiothreitol, DTT) to form a compound that will absorb light at 340nm. The degree of hydrolysis is defined by Equation 4 2, where DH is the degree of hydrolysis in percent, h tot is the total number of peptide bonds per protein equivalent and h is the number of hydrolyzed bonds. (4 2) The total number of peptide bonds h tot is dependent on the amino acid composition of the raw material. Nielsen and others (2001) provided a table to estimate h tot based on the raw material. For fish muscle myosin h tot was estimated as h tot = 8.6. To determine the number of hydrolyzed bonds from the absorbance value a standard was needed to translate the absorbance values into milliequivalents per gram protein of that standa rd. Serine was used as the standard and from the absorbance values the serine NH 2 meqv per gram protein were calculated by Equation 4 3, where A is the respective absorbance value, 0.9516 meqv/L is the serine NH 2 concentration, 0.1 is the sample volume in L, X is the gram of sample and P is the percent protein in the sample. (4 3) From the serine NH2 meqv value the amount of hydrolyzed peptide bonds h can be calculated by using Equation 4 4, where h is the number of hydrolyzed peptide bonds, Serine is the serine milliequivalents per gram protein (calculated by Equation 4 3) and

PAGE 54

54 and are protein specific values which were also estimated for fish muscle myosin by the table provided by Nielsen and others (2001) For fish muscle protein equals 1.00 and equals 0.40. (4 4) As mentioned earlier the degree of hydrolysis was calculated from the h tot and h values by Equation 4 2. The OPA reagent was prepared as follows: 7.620 g di Na tetraborate decahydrate and 200 mg SDS were dissolved in 150 ml deionized water The reagents were completely dissolved before continuing with the next step 160 mg OPA was dissolved in 4 ml ethanol OPA solution was transferred quantitatively to the first solution by rinsing with deionized water 176 mg DTT was added to the solution by rinsing with deionized water The solution was then made up to 200ml with deionized water Th e serine standard was prepared by diluting 50 mg of serine standard (Sigma Chemical Co., St. Louis, MO) in 500 ml Deionized water to achieve 0.9516 meqv per Liter. The test samples of the hydrolysates were diluted with deionized water to achieve a protein/ peptide concentration of 0.1 percent w/v. Three milliliters of OPA reagent were mixed with 400 L of standard, sample or blank (deionized water) in test tubes and incubated at room temperature for exactly two minutes. The absorbance at 340 nm was read imme diately after incubation. The typical absorbance value of the standard was 0.8 and for the blank 0.07. Previous studies showed that in general the antioxidant capacities of the muscle protein hydrolysates increased with increasing DH, and a DH of 25% was t he highest

PAGE 55

55 level achieved in those studies. Therefore for this experiment the goal was to achieve the highest DH in a 12 hour period. Fractionation of Atlantic Cod M uscle M yosin H ydrolysates Since preliminary data shows that the highest activity is present in the peptide fractions of a molecular weight of 5,000 Da or less, all hydrolysates were fractionated by ultrafiltration, using an ultrafiltration cell with ultrafiltration membranes with 30,000 and 5,000 Da molecular weight cut offs. Each hydrolysate wa s first transferred into an Amicon 200 ml ultrafiltration cell (Model 202) with magnetic stirrer and a Millipore polyethersulfone ultrafiltration membrane with a Nominal Molecular Weight Limit (NMWL) of 30,000 Da. The chamber was pressurized with nitrogen to 40 psi and the filtration was monitored periodically. The filtration was stopped by releasing the pressure in the chamber when 90% of the hydrolysate where filtered. The filtrate was retentate was recovered from the chamber and the membrane was washed 3 times with sample buffer (10 mM phosphate, pH 6.6) equal to the volume of the retentate. The retentate was aliquoted and stored at econd ultrafiltration cell with a Millipore polyethersulfone ultrafiltration membrane with a Nominal Molecular Weight Limit (NMWL) of 5,000 Da. The chamber was pressurized with nitrogen to 40 psi and the filtration was monitored periodically. The filtratio n was stopped by releasing the pressure in the chamber when 90% of the hydrolysate where filtered. The filtrate was collected, aliquoted and stored at retentate was recovered from the chamber and the membrane was washed 3 times with sample buffer (10 mM phosphate, pH 6.6) equal to the volume of the retentate. The retentate was aliquoted and stored at

PAGE 56

56 procedure resulted in 3 separate molecular weight (MW) fractions for each hydrolysat e that were designated as follows: less than 5 kDa fractions were designated < 5 kDa, 5 to 30 kDa fractions were designated 5 30 kDa and larger than 30 kDa fractions were designated > 30 kDa. The peptide concentration of each hydrolysate fraction was deter Protein and Peptide A ssays The Pierce 660 nm Protein Assay from Thermo Scientific was used to determine the protein content during the enzyme separation and purification procedures and the myosin extraction proc edure. It is a very quick and easy method to determine the total protein content of solutions with a range of 25 to 2000 g/ml protein. As with many other methods its limitation is the inaccuracy of detecting low molecular weight proteins and peptides. For this reason this method was not used after the proteins were hydrolyzed. It is a single reagent method that can be used in test tube or microplate procedure. For the test tube procedure 1.5 ml of assay reagent and 0.1 ml of sample were mixed and incubated at room temperature for 5 minutes. The absorbance was read at 660 nm. Bovine serum albumin (BSA) was used to construct a standard curve. The modified Lowry method (Bensadoun and Weinstein, 1976; Davis, 1988; Legler and others 1985; Lowry and others 1951; Ohnishi and Barr, 1978; Vallejo and Lagunas, 1970) was used to determine the protein/peptide content for all sample solutions containing the hydrolysates (whole or fractions) for further experiments. The modified Lowry method was perf ormed using the Pierce Modified Lowry Protein Assay Kit from Thermo Scientific. It is a two reagent procedure where the samples are first mixed with a cupric sulfate tartrate solution in which the proteins form tetradentate copper protein complexes, which then reduce the Folin Ciocalteu reagent (added in second step) to

PAGE 57

57 form a blue color compound that can be measured at 750nm. Like the 660nm assay this assay can be performed in a test tube or microplate mode. For the test tube procedure 0.2 ml of sample ar temperature for 10 minutes. After incubation 100 L of Folin Ciocalteu reagent is added and the mixture is incubated for an additional 30 minutes at room temperature. The absorbance is then read a t 750nm. Bovine serum albumin (BSA) was used to construct a standard curve. To determine the molecular weight distribution of myosin as well as the whole and fractionated hydrolysates Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS PAGE) w as performed. For the large MW myosin analysis Novex 4 20% Tris Glycine gels from Invitrogen were used. For the low MW peptide analysis of the hydrolysates and their fractions Novex 10 20% Tricine gels from Invitrogen were used. Tricine gels were used since they give better separation and resolution for low MW proteins and peptides. Both types of gels were run on the XCell SureLock Mini Cell System from Invitrogen and according to the sample preparation and running procedures provided with each gel ty pe. The procedures are nearly identical up to the point that the sample and running buffer have to match the gel type used. All reagents were obtained from Invitrogen and specifically designed for this System. For each SDS PAGE, samples were adjusted to 1 mg/ml and 40 L of sample were mixed with 50 L of sample buffer and 10 L of for 3 minutes. 5 to 15 L of sample or standard were added to each well and the gels were run for 90 minutes with 125 volts. Bo th types of gels were stained using Bio Safe Coomassie G 250 Stain from Bio Rad. A SDS PAGE wide range molecular

PAGE 58

58 weight standard was used for both gel as a reference to estimate the molecular weight of the peptide fractions (Schgger and Von Jagow, 1987) Results Separation and Purification of Trypsin, Chymotrypsin and Elastase A solution of cod enzyme mixture in binding buffer A was prepared and centrifuged to separate any remaining insoluble par ticles from the enzyme solution. The enzyme solution had a clear but very dark orange appearance which suggested that this unpurified enzyme mixture still contained larger protein and pigment compounds. The first chromatography step seemed to separate most of the color pigment compounds from the enzyme solution, as the collected fractions with the highest enzyme activities were completely clear and colorless. Most of the colored compounds were trapped on the column and eluted during the Guanidine HCl washin g step. Figure 4 1 shows the chromatogram for the first enzyme purification step using the PBA Column. Unbound large molecular proteins eluted first (fractions 0 10) followed by the fractions containing the elastase activity (fractions 11 25). The addition of PBA in the elution buffer slowly released chymotrypsin and trypsin, which were found in fractions 55 70. Since with the beginning of the Guanidine HCl wash the trapped colored compounds started to elute (fractions 65 90) only fractions 55 65 were colle cted and pooled to retain a solution containing only chymotrypsin and trypsin activities. This solution was called the CT/T fraction and was subsequently concentrated and applied to the PABA column to separate chymotrypsin and trypsin. Fractions 11 25 fro m the PBA column were pooled and called the elastase fraction. The elastase fraction was concentrated, aliquoted and then stored at until use for the hydrolysis experiment. Table 4 3 is the purification table for elastase. It

PAGE 59

59 shows a 36% recovery of elastase activity with no residual trypsin activity and only traces of chymotrypsin activity. The CT/T fraction was applied to the PABA column and separated into chymotrypsin and trypsin fractions. Figure 4 2 shows the chromatogram from the second chromato graphy step using the PABA column. Since the CT/T fraction contained little enzyme unrelated proteins, protein measurement at 280 nm was a great indicator of the fractions with the highest enzyme activities. Chymotrypsin started to elute from the column wi th the addition of NaCl in the elution buffer. The majority of chymotrypsin activity was around fractions 10 25, but it took a rather long wash (up to fraction 50) to elute the remaining chymotrypsin from the column. Trypsin was then eluted from the column using a 25 mM acetic acid solution. Trypsin eluted in only three fractions (56 58) from the column and was collected and pooled. Traces of chymotrypsin were still present in the collected trypsin fraction. It was decided that, rather than extend the NaCl wash to elute more chymotrypsin before eluting trypsin, the collected, pooled and concentrated trypsin would be treated with TPCK (N Tosyl L Phenylalanine Chloromethyl Ketone), a chymotrypsin inhibitor, to eliminate the traces of chymotrypsin activity and simplify the separation procedure. Only fractions 10 25 were collected and pooled to obtain the chymotrypsin fraction. Purification Table 4 1 shows a 15% recovery of chymotrypsin activity after two affinity chromatography steps and concentration by ultraf iltration. There were no measurable trypsin or elastase activities in the purified and concentrated chymotrypsin solutions. The solution was aliquoted and stored at

PAGE 60

60 Fractions 56 58 were collected and pooled as described bef ore and the protein content and enzyme activities were measured. Purification Table 4 2 shows a 13% recovery of trypsin activity after two chromatography steps and concentration by ultrafiltration. There were no elastase activities and only traces of measu reable chymotrypsin activities. The pooled and concentrated fractions were aliquoted and stored at Both chromatography procedures were repeated several times with similar results and the purified enzymes were pooled before further use. Trypsin and elastase were treated with 50 M of TPCK to inhibit any remaining chymotrypsin activity. Extraction of Atlantic C od M uscle M yosin Myosin was extracted from Atlantic cod ( Gadus morhua ), obtained from Save On Seafood (Tampa, FL). The fillets were trimmed and cleaned to remove blood stained or dark tissue. Only clean white muscle was used for the myosin extraction process. After completion of the extraction process myosin was recovered by centrifugation and the moisture content was det ermined at around 90%. Myosin was extracted in several batches, with each batch prepared from a fresh delivery of Atlantic cod ( Gadus morhua ), and each batch of myosin was vacuum sealed and frozen at use. After each extraction the purit y was analyzed by SDS PAGE. Figure 4 3 shows the SDS PAGE gel prepared after the last myosin extraction. In this gel the previously frozen myosin extracts were compared to the fresh extracted myosin to determine any changes during frozen storage. The visua l analysis of the gel determined no differences between the frozen and the fresh extracted myosin. It can clearly be seen that the amount of actin in the myosin extracts was greatly reduced compared to the fresh whole muscle. Further the amount of heavy ch ain, and light chain myosin (1, 2 and 3)

PAGE 61

61 increased. A small remaining amount of actin was to be expected compared to the study by Kristinsson (2001) Kristinsson (2001) compared several myosin extraction methods for Atlantic cod ( Gadus morhua ) and determined the method, used for this study, would result in the highest purity for myosin. A colorimetric analysis was performed using the ImageJ software to determ ine the ratio of each fraction, represented by a single band in the SDS PAGE gel, for the myosin extracts and the untreated whole muscle. Figure 4 4 shows a sample of a profile plot for a single column analyzed from the gel shown in Figure 4 3. Each column in Figure 4 3 was analyzed in the same way. The peaks areas identified and the areas under the peaks defined and calculated. Table 4 4 shows the results of the colorimetric analysis of the gel shown in Figure 4 3. The analysis shows that amounts of heavy chain and light chain myosin increased compared to the whole muscle. The amounts were also comparable to results described by Kristinsson (2001) with heavy chain myosin close to 80%, light chain myosin 1 close to 2%, light chain myosin 2 close to 9% and light chain myosin 3 close to 5%. With 4 6%, the amount of remaining actin was a little bit higher as described by Kristinsson (2001) but it was definitely reduced from the 26% in whole muscle. The batches were combined prior to hydrolysis to ensure a homogenate mixture of extracted myosin for each hydrolysate. Hydrolysis of Atlantic C od M uscle M yosin Myosin was hydrolyzed using the three separated enzymes, chymotrypsin, trypsin and elastase, and two different concentrations of the cod enzyme mixture (CEM). The concentrations of the cod enzyme mixture were chosen so that the overall enzyme activity matc hes that of the single enzymes (CEM low) and that the enzymes with the lowest activity in the mix would have a concentration equal to the single enzymes (CEM

PAGE 62

62 high). In the CEM high hydrolysate, the activity of chymotrypsin exceeded 10 U per gram protein, w hile the activity of trypsin and elastase were around 2 U per gram protein. For all the other hydrolysates, separated enzymes and CEM low, the amount of enzyme added was set to 2 U per gram protein. All myosin/enzyme samples were hydrolyzed for 12 hours at room temperature and pH 8.5. A control sample was prepared that contained myosin in buffer at pH 8.5, which was subjected to 12 hour incubation at room temperature without enzymes added, to determine any effect of the incubation period on the myosin itsel f. All hydrolysate solutions started with a cloudy appearance as part of the myosin in buffer suspension. For the separated enzymes the solutions decreased in cloudiness during the incubation period while the CEM low and CEM high solutions became almost tr ansparent. The control solution appeared and precipitated out in most hydrolysates except for the CEM high one. The CEM high hydrolysate remained clear even after inactiv ation. Precipitated proteins were removed by centrifugation and the clear hydrolysates were analyzed for protein/peptide content, degree of hydrolysis and peptide fraction profile with SDS PAGE. Figure 4 5 shows the SDS PAGE analysis of all hydrolysates a s well as the control sample and the untreated fresh myosin. The control sample and the untreated myosin show almost no differences, so it was decided that for further experiments the fresh myosin can be used as unhydrolyzed myosin control. The separated e nzyme hydrolysates show a variety of peptide fractions starting at 66 kDa. The myosin specific bands around 205 kDa, 36 kDa, 23 kDa and 19 kDa almost disappeared. The CEM high hydrolysates show no bands, which means the resulting peptides were too small to be

PAGE 63

63 detected on the SDS PAGE gel. The CEM low hydrolysates were prepared later than the other hydrolysates and were not included in Figure 4 5. Figure 4 7, which shows the ultrafiltration results, shows a similar variety of smaller peptides below 45 kDa fo r the CEM low hydrolysate (larger than 30 kDa fraction). The analysis of the protein content and the degree of hydrolysis (%DH) is shown in Table 4 5. The protein concentration of all hydrolysates was measured and adjusted to around 10 mg/ml for %DH analy sis. Table 4 5 shows that no degree of hydrolysis could be detected in the unhydrolyzed myosin fractions, while the separated enzyme hydrolysates observed %DH ranging from 6.2 for chymotrypsin to 14.2 for trypsin. CEM low hydrolysates reached a degree of h ydrolysis of almost 30% and the CEM high hydrolysate of nearly 43%. These high degrees of hydrolysis would explain the lack of larger peptide fractions detectable via SDS PAGE analysis. The degree of hydrolysis achieved with CEM low concentration is compar able to results from Raghavan and Kristinsson (2009) who achieved under similar conditions and with the same enzyme mixture nearly 25% degree of hydrolysis with tilapia protein isolates. All hydrolysates on. Fractionation of Atlantic Cod M uscle M yosin H ydrolysates Since many studies show that low molecular weight peptides observe higher bioactive properties than larger fractions, all hydrolysates were fractionated by ultrafiltration into three molecular we ight classes: less than 5 kDa, 5 kDa to 30 kDa and larger than 30 kDa. Since some of the subsequent bioactivity assays require protein/peptide concentrations of 1.0 mg/ml (or higher), the ultrafiltration procedure were conducted with great care and accurac y to ensure each fraction had a protein concentration of at least 1 mg/ml. The protein concentration of the <5 kDa fraction was

PAGE 64

64 the determining factor, as this fraction cannot be further concentrated, unless by methods like lyophilization or chromatography which could alter the peptide composition. Figures 4 6 and 4 7 show the SDS PAGE analysis of all ultrafiltered hydrolysate fractions. The molecular weight cut off (MWCO) limits for the two ultrafiltration steps are indicated and it can be seen that all h ydrolysate fractions stayed within their respected limits. The control and untreated myosin were run as a comparison in the second gel (Figure 4 7). Table 4 6 indicates the amount of hydrolysate fractions that were recovered after each ultrafiltration ste p and the protein/peptide concentration measured for each fraction. The 5 30 kDa fraction of elastase hydrolyzed myosin had the lowest protein concentration and was therefore used undiluted in most subsequent experiments. All other hydrolysates fractions were aliquoted and two aliquots of each treatment were adjusted to 1.0 mg/ml to be used in further experiments. All aliquots and dilutions were stored at

PAGE 65

6 5 Figure 4 1 Chromatogram o f cod enzyme mixture separated on a PBA Column Solid line without markers represents protein detection at 280nm. The square markers represent trypsin activity, the diamond markers represent chymotrypsin activity and the triangle markers represent elastase activity. The horizontal lines denote the dif ferent elution steps used. 0.0000 0.5000 1.0000 1.5000 2.0000 2.5000 3.0000 0.00000 0.50000 1.00000 1.50000 2.00000 2.50000 3.00000 3.50000 4.00000 4.50000 0 5 10 15 20 25 30 35 40 45 50 55 60 65 70 75 80 85 90 95 100 Units/ml (Enzyme Activity) A280nm (Protein) Fractions Protein (280nm) Trypsin Chymotrypsin Elastase PBA (100 mM) Gua HCl (7 M) Equilabration

PAGE 66

66 Figure 4 2. Chromatogram o f c hymotrypsin and t rypsin separated on a PABA Column Solid line without markers represents protein detection at 280nm. The square markers represent trypsin activity and the triangle markers represen t chymotrypsin activity. The horizontal lines denote the different elution steps used. Table 4 1. Purification table for c hymotrypsin from cod enzyme mixture Separation Step Volume [ml] Protein [mg/ml] Total Protein [mg] Units [per mg] Total Units Yield [%] CEM Solution 10 20 200 14.00 2800 100 Elastase Fraction (C1) 145 0.3 43.5 trace CT/T Fraction (C1) 170 0.4 68 20.00 1360 49 Conc. CT/T Fraction 9 7.1 63.9 23.00 1470 52 Chymotrypsin (C2) 140 0.3 42 8.70 365 13 Trypsin (C2) 120 0.15 18 trace Conc. Chymotrypsin 18 1.8 32.4 12.70 411 15 Conc. Trypsin 15 1.3 19.5 trace Conc. Elastase 18 2.1 37.8 trace Note: CT/T refers to the chymotrypsin and trypsin fraction that eluted together from column 1. This table shows that trace amounts (less than 0.01% in yield) of chymotrypsin were present in the concentrated trypsin and elastase fractions. 0.000000 0.100000 0.200000 0.300000 0.400000 0.500000 0.600000 0.00000 0.02000 0.04000 0.06000 0.08000 0.10000 0.12000 0.14000 0.16000 0 10 20 30 40 50 60 70 Units/ml (Enzyme Activity) A280nm (Protein) A280nm Trypsin Chymotrypsin NaCl (0.5 M) Acetic Acid (25 mM) Gua HCl (7 M)

PAGE 67

67 Table 4 2. Purification table for t rypsin from cod enzyme mixture Separation Step Volume [ml] Protein [mg/ml] Total Protein [mg] Units [per mg] Total Units Yield [%] CEM Solution 10 20 200 0.75 150 100 Elastase Fraction (C1) 145 0.3 43.5 none CT/T Fraction (C1) 170 0.4 68 0.75 51 34 Conc. CT/T Fraction 9 7.1 63.9 0.70 45 30 Chymotrypsin (C2) 140 0.3 42 none Trypsin (C2) 120 0.15 18 1.20 22 14 Conc. Chymotrypsin 18 1.8 32.4 none Conc. Trypsin 15 1.3 19.5 1.00 20 13 Conc. Elastase 18 2.1 37.8 none Note: CT/T refers to the chymotrypsin and trypsin fraction that eluted together from column 1. This table shows that no trypsin was detected in the concentrated chymotrypsin or elastase fractions. Table 4 3. Purification table for e lastase from cod enzyme mixture Separation Step Volume [ml] Protein [mg/ml] Total Protein [mg] Units [per mg] Total Units Yield [%] CEM Solution 10 20 200 1.20 240 100 Elastase Fraction (C1) 145 0.3 43.5 2.00 87 36 CT/T Fraction (C1) 170 0.4 68 none Conc. CT/T Fraction 9 7.1 63.9 none Chymotrypsin (C2) 140 0.3 42 none Trypsin (C2) 120 0.15 18 none Conc. Chymotrypsin 18 1.8 32.4 none Conc. Trypsin 15 1.3 19.5 none Conc. Elastase 18 2.1 37.8 2.30 87 36 Note: CT/T refers to the chymotrypsin and trypsin fraction that eluted together from column 1. This table shows that no elastase was detected in the concentrated chymotrypsin or trypsin fractions.

PAGE 68

68 Figure 4 3. SDS PAGE analysis of myosin extracts The first and last column show the Sigma wide range molecular marker. Columns 3 4 and 6 7 show the profile of myosin extracted and frozen at 10 show the profile of fresh extracted myosin. Columns 12 13 show the profile of unaltered cod muscle protein. HC describes Heavy Chain Myosin. LC 1 3 describes Light Chain Myosin 1 to 3.

PAGE 69

69 Figure 4 4. Sample profile plot of the colorimetric analysis of the myosin SDS PAGE gel This image was generated with the Im ageJ software, provided free by the National Institute of Health. The areas under the peaks were detected with the ImageJ software and the percentage of the major protein fractions calculated. Table 4 4. Molecular weight distribution of extracted cod myos in MW (kDa) Component Myosin 070310 Frozen Myosin 070910 Frozen Myosin 073010 Fresh Cod Muscle 073010 200.0 Myosin HC 70.61 % 70.58 % 74.11 % 40.54 % 55.0 ? 1.06 % 43.0 Actin 5.67 % 7.38 % 4.16 % 26.05 % 35.5 Tropomyosin 3.49 % 4.26 % 1.72 % 11.73 % 32.0 ? 2.05 % 1.71 % 3.52 % 25.0 Myosin LC1 1.93 % 1.52 % 2.58 % 1.51 % 19.5 Myosin LC2 10.81 % 9.81 % 11.3 % 8.57 % 18.0 Myosin LC3 6.04 % 4.73 % 6.13 % 4.17 % 10.0 ? 2.86 % Total Myosin 89.39 % 86.64 % 94.12 % 54.79 % Total all components 100.6 % 99.99 % 100 % 100.01 % Note: Myosin was extracted from three different batches of Atlantic cod ( Gadus morhua ) on three separate days. The first two batches were frozen at not frozen prior to SDS PAGE analysis. The fresh and frozen myosin extracts were analyze d together by SDS PAGE analysis to detect any differences in protein composition that might result from storage at

PAGE 70

70 Figure 4 5. SDS PAGE analysis of myosin hydrolysates The first and last columns show the Sigma wide range molecular marker. Column 3 shows the unaltered myosin and column 13 shows the unhydrolyzed myosin that was subjected to the same conditions as the hydrolysates. Column 5, 7 and 9 show the individual enzyme hydrolysates of chymotrypsin, trypsin and elastase respectively. Column 11 shows the cod enzyme mixture high hydrolysate.

PAGE 71

71 Table 4 5. Myosin hydrolysate analysis Protein Concentration [mg/ml] Degree of Hydrolysis [%] Amount of Hydrolysate [ml] Whole Myosin 9.8 0.00 N/A Control 10.2 0.00 200 Chymotrypsin 9.0 6.16 270 Trypsin 12.1 14.16 225 Elastase 10.1 12.29 240 CEM high 9.3 42.78 250 CEM low 9.1 29.89 250 Note: This table shows the protein concentration, the degree of hydrolysis and the amount of hydrolysate recovered after hydrolysis, enzyme inactivation and centrifugation. These hydrolysates were used unaltered in the subsequent fractionation (ultrafiltration) step.

PAGE 72

72 Figure 4 6. SDS PAGE analysis of myosin hydrolysate fractions A The first and last columns show the Sigma wide range molecular marker. Sampl es are grouped to show the less than 5 kDa, 5 to 30 kDa and larger than 30 kDa fractions together. This gel shows the chymotrypsin, trypsin and elastase digested myosin hydrolysates, fractionated by ultrafiltration.

PAGE 73

73 Figure 4 7. SDS PAGE analysis of myos in hydrolysate fractions B The first and last columns show the Sigma wide range molecular marker. Samples are grouped to show the less than 5 kDa, 5 to 30 kDa and larger than 30 kDa fractions together. This gel shows the cod enzyme mixture low and high co ncentration digested myosin hydrolysates, fractionated by ultrafiltration. The last two columns show the unfractionated myosin control samples.

PAGE 74

74 Table 4 6. Myosin hydrolysate fractions analysis Protein Concentration [mg/ml] Amount Recovered [ml] Chymotrypsin <5kD 1.30 200 Chymotrypsin 5 30kD 1.12 200 Chymotrypsin >30kD 8.76 200 Trypsin <5kD 3.55 155 Trypsin 5 30kD 3.45 150 Trypsin >30kD 9.45 180 Elastase <5kD 1.69 155 Elastase 5 30kD 1.04 120 Elastase >30kD 8.92 190 CEM high <5kD 8.17 210 CEM high 5 30kD 3.53 135 CEM high >30kD 2.77 125 CEM low <5kD 6.41 185 CEM low 5 30kD 5.34 135 CEM low >30kD 4.66 130 Note: This table shows the protein concentration and the amount of the hydrolysate fractions recovered after ultrafiltration with 30 kDa and 5 kDa MWCO membranes. These hydrolysate fractions were adjusted to 1 mg/ml protein content with sample buffer (10 mM Phosphate, pH 6.6) and used for all bioactivity assays and mass spectrometry analysis.

PAGE 75

75 CHAPTER 5 DETERMINATION OF ANTIOXIDANT PROPERTI ES OF COD MYOSIN HYDROLYSATES Material and Methods All chemical antioxidant assays were performed at the Biomolecular Research Laboratory at Matis Biotechnology Centre in Iceland. The laboratory has successfully adopted the antioxidant assays described below for fish protein hydrolysates and performs these assays routinely with repeatable results. Oxygen Radical Absorbance Capacity The method that w as used for this assay was a method adapted from Huang and others (2002) for a 96 well fluorescent microplate reader. The basic principle of this assay is to monitor the inhibition of decay of fluorescein in the presence of the peroxyl radical generator AAPH aminidinopropane] dihydrochloride). The ORAC assay was performed with slight mod ifications on a POLARstar Optima (BMG Labtech., Offenbu rg, Germany) microplate reader. Different dilutions of Trolox (50M 3,125M) were prepared in phosphate buffer (10 mM, pH 7.4). All peptide samples were adjusted to 1.0 mg/ml with phosphate buffer (10 mM, pH 7.4). In every working well of a black opaque micro plate (200 L, 96 wells, MJ Research, USA) the following was pipette d in triplicate s : 1) 60 L of 10 nM f luorescein solution; 2) 10 L of Trolox dilutions for standard; 10 L of sample solution; 10 L of phosphate buffer for blank. The micro plate was incubated for 15 min at 37C without shaking in the POLARstar Optima. After incubation 30 L of 120 mM AAPH solution was quickly added manually using a multi channel pipette. The fluorescence was recor ded every 0.5 min for the first 40 cycles and every min for the last 60 cycles. The filters used for excitation w ere 485 nm and for emission were 520 nm. The total time for the

PAGE 76

76 measurement was 80 min. The antioxidant curves (fluorescence versus time) were normalized. The area under the fluorescence decay curve (AUC) was calculated by the normal ized curves with the following E quation 5 1, w here f0 was the fluorescence reading at the initiation of the reaction and f79 was the last measurement (5 1) The net AUC was obtained by subtracting the AUC of the blank from that of a sample or standard. The ORAC value was calculated and expressed as micromoles of Trolox equivalents per gram of protein ) using the calibration curve of Trolox. All samples were run in triplicates on each plate and duplicate plates were run in this experiment. The unhydrolyzed control sample was not used due to insolubility issues. DPPH Radical Scavenging Ability The ability of the hydrolysates to scavenge d iphenylpicrylhydrazyl (DPPH) radicals w as measured by using the method described by Bersuder and others (1998) and Wu and others (2003) with a slight m odification. This assay is useful since it measures the ability of the peptides to act as free radical scavengers, as we can directly correlate this to the measured decomposition of the DPPH radical Peptide solutions (1.0 mg/ml) in phosphate buffer (10 m M, pH 6.6) were diluted with ultra pure water to reach a concentration of 0.5 mg/ml. The dilution step was necessary since it was discovered during initial experiments that the 10 mM phosphate buffer solution (the carrier for the peptide samples) causes sl ight disturbance issues with the DPPH test solution. A 50% dilution of the phosphate buffer resolved the incompatibility issues but still allowed for sufficient peptide concentration to perform the

PAGE 77

77 test. Therefore 150 L of the diluted peptide solutions we re mixed with 60 L of 2,2 diphenyl 1 picryhydrazyl (DPPH) in 0.02% methanol solution, 150 L of water /phosphate buffer (1:1) instead of peptide solutions was used as blank, and 60 L of methanol was used instead of DPPH solution as control. This procedur e was performed in microplates and the test solutions were incubated at room temperature in the dark for 30 min. The absorbance of the test solution s was read at 520 nm using POLARstar Optima (BMG Labtech, Offenburg, Germany) microplate reader. The scavenging e ffect was calculated as with Equation 5 2, w here A blank is the absorbance of the blank, A sample is the absorbance of the sample and A control is the absorbance of the control at 520 nm. % inhibition = (5 2) All samples were run in triplicates on each plate and duplicate plates were run in this experiment. The unhydrolyzed control sample was not used due to insolubility issues. Reducing Power of Antioxidants Assay The reducing power was measured as described by Benjakul and others (2005) Fifty microliters of peptide solutions (1.0 mg/ml) in phosphate buffer (10mM, pH 6.6) were mixed with 250 L of phosphate buffer (0.2 M, pH 6.6) and 250 L of 1% potassium ferricyanide [ K 3 Fe(CN) 6 ]. After 30 min incubation at 50C, 250 L of 10% trichloroacetic acid was added and the mixture was centrifuged at 4500 g for 10 min. The supernatant ( 200 L ) was mixed with 40 L of ferric chloride solution (0.1%) and the absorbance was measured at 700 nm. The relative activity of the sample was

PAGE 78

78 calculated in relation to the activity of ascorbic acid standards (0 results were expressed as mg of ascorbic acid equival ents (ASE) per gram of extract. All samples were run in triplicates on each plate and duplicate plates were run in this experiment. The unhydrolyzed control sample was not used due to insolubility issues. Ferrous Ion Chelation Ability Reactive oxygen speci es (ROS) can be produced by transition metals, such as Fe 2+ and Cu 2+ These ROS can then for example catalyze lipid oxidation. To assess the iron chelating ability of the peptides a modified procedure, originally described by Seth and Mahoney (2001) w as used. The soluble iron content in the supernatant w as determined by the ferrozine method described by Carter (1971) and then compared to the starting solu tion. The entire procedure was performed as described by Decker and Welch (1990) with minor modifications. Peptide solutions (1.0 mg/ml) in phosphate buffer (10 mM, pH 6.6) were dil uted with ultra pure water to reach a concentration of 0.5 mg/ml. The dilution step was necessary since it was discovered during initial experiments that the 10 mM phosphate buffer solution (the carrier for the peptide samples) causes slight disturbance is sues with the ferrous ion chelating ability test. A 50% dilution of the phosphate buffer resolved the incompatibility issues but still allowed for sufficient peptide concentration to perform the test. One hundred fifty microliters of sample solution ( 0. 5 m g/ml) were mixed with 5 L of 2 mM FeCl 2 The reaction was initiated by the addition of 10 L of 5 mM ferrozine. After incubation for 3 0 min at room temperature, the absorbance was measured at 560 nm using the microplate reader (POLARstar OPTIMA, BMG Labte ch, Offenburg,

PAGE 79

79 Germany). Distilled water (100 L ) instead of sample solution was used as a control. Distilled water (10 L ) instead of ferrozine solution was used as a blank. L ascorbic acid, citric acid and EDTA Na 2 were used as reference standards The ferrous ion chelating ability was calcula ted by Equation 5 3, where A 0 was the absorbance of the control, A 1 was the absorbance of the sample or standard and A 2 was the absorbance of the blank. (5 3) All samples were run in triplicates on each plate and duplicate plates were run in this experiment. The unhydrolyzed control sample was not used due to insolubility issues. Cellular Antioxidant Activity Assay The cellular antioxidant activity (CAA) assay is a newly developed method to determine the antioxidant capabilities of a compound in an in vitro cellular model system. A procedure, described by Wolfe and Liu (2007) w as used with modifications. The CAA assay was performed at the Cell Culture Laboratory at Matis Biotechnology Centre in Saudarkrokur, Iceland and the following descriptions are based on the procedures established by that laboratory. A cytotoxicity assay was performed initially to determine whether the hydrolysate samples have any negative effect on cell growth and viability. The CAA assay was then performed with the sample peptides to determine the antioxidant activity. H epG2 human he patocellular carcinoma cells w ere used for the cytotoxicity assay and the CAA assay. The HepG2 cells were maintained in Minimum Essential Medium (MEM ), supplemented with 10% (v/v) heat inactivated Fetal Bovine Serum (FBS), penicillin (50

PAGE 80

80 U/ml) and streptomycin (50 g/ml). The HepG2 cells were obtained from the American Type Culture Collection (ATCC No. HB 8065), the MEM the FBS, the penicillin and the streptomycin were obtained from GIBCO by Invitrogen HepG2 cells were ully humidified environment under 5% CO 2 and cells at passage 80 to 100 were used for the cytotoxicity and CAA assays. Cells were subcultured at 3 5 day intervals before reaching 90% confluency. For the cytotoxicity assay, HepG2 cells were seeded at 6 10 4 /well on a black 96 for 24 h at 37C. The medium was removed and 100 L of new medium added. The cells were then exposed to different concentrations of sample peptides in 100 L of medium and incubated at 37C for 24 h. After incubation, the medium containing the sample peptides was discarded and the cell viability was evaluated by exposure to 100 L A lamarBlue 37C f or 4 h. Finally, the fluorescence was measured at excitation 570 nm and emission 610 nm (Page and others 1993) using POLARstar OPTIMA (BMG Labtech, Offenburg, Germany). Control cells were exposed to A lamarBlue but not to the sample peptides The percentage of viable cells in the population of each concentration was calculated as % Mortality = (100 % viability) w here: % viability = (Mean fluorescence of treated cells)/(Mean fluorescence of control cells) 100 The cellul ar anti oxidant assay was performed on sample peptides using HepG2 cells at a density of 6 10 4 /well using black 96 growth medium/well according to Wolfe and Liu (2007) and Samaranayaka and others (2010) with minor modifications. Twenty four hours after seeding, 100 L of DCFH DA

PAGE 81

81 dichlorofluorescein diacetate) probe (1 M in H anks B alanced S alt S olution(HBSS) ) was added to the cells and incubated at 37C in the dark for 30 min. Cells were then treated wi th different concentrations of sample peptides and incubated for 1 h our at 37 C. This was followed by the addition of 100 L of Azobis (2 methylpropionamidi ne) dihydrochloride ( AAPH ) (500 M in HBSS) to the cultured cells after removal of the test com pounds. Fluorescence readings (excitation = 493 nm, emission = 527 nm) were recorded using a POLARstar OPTIMA (BMG Labtech) every 10 min for 2 h after addition o f AAPH. Each plate included four replicates of control and blank wells: Blank wells contained cells exposed to only the DCFH DA probe. The control consisted of cells with DCFH DA probe and the AAPH peroxyl radical initiator added but in the ab sence of any sample peptides Trolox, a powerful antioxidant, was used simultaneously with the peptide samples to compare the antioxidative activity. Antioxidative activity was expressed as % inhibition of AAPH radical based on the uninhibited control measurement after 120 minutes. Equation 5 4 shows the calculation, where F Control is the average fluorescence for the control wells at 120 minutes and F Sample is the average fluorescence of the sample wells at 120 minutes. (5 4) Statistical Analysis Simple one way analysis of variance (ANOVA) was used to determine significant differences between all treatments and fractions. When significant differences among the sample means were detected

PAGE 82

82 do a pair wise comparison between these sample means. The level of significance for = 0.05. Results Oxygen Radical Absorbance Capacity The Oxygen Radical Absorbance C apacity (ORAC) of the hydrolysate fractions was determined and expressed in M of Trolox equivalents per gram protein. Figure 5 2 shows the ORAC results for all hydrolysate fractions. Except for trypsin, the <5 kDa fraction showed the highest oxygen radica l absorbance capacity within their respective groups, although there was no significant ( p < 0.05) difference found between the low (<5 kDa) and medium (5 30 kDa) molecular weight fractions for chymotrypsin, trypsin and elastase. For chymotrypsin and tryp sin the high molecular weight fraction had significantly ( p < 0.05) lower ORAC values than their low and medium molecular weight fractions. CEM low and high (less than 5 kDa fraction) had significantly ( p < 0.05) higher ORAC values than the low molecular w eight fractions of the single enzyme digests, with CEM high having the highest value. The medium and low molecular weight fractions of CEM high and low were either similar or higher in ORAC values than the low molecular weight fractions of the single enzym e digests. The CEM high hydrolysate showed a very high degree of hydrolysis and no bands above 5 kDa were visible on the SDS PAGE analysis, which may suggest that during the ultrafiltration process the same small peptides were retained on either side of th e membranes and all fractions observe a similar peptide composition, resulting in similar antioxidant capacity values, especially above the 5 kDa membrane, where a kind of concentration step might have occurred. It may further be assumed that a similar

PAGE 83

83 pro cess took place for all other fractions and therefore some of the antioxidant activity may be attributed to remaining low molecular peptides in the larger fractions. However all samples follow the well known pattern that low molecular weight peptides show higher antioxidative activity than larger fractions and the antioxidative activity follows also quite similar the % degree of hydrolysis as shown in Table 4 5. Supporting results were found in several studies involving marine derived peptides (Bougatef and others, 2009; Kim and others, 2007; Sampath and others, 2011) Compared to other food sources such as fruits and vegetables, the ORAC values of myosin derived peptide s are very high (between 800 and 1800 Trolox equivalents per gram protein), considering typical ORAC values from 10 to about 300 mol Trolox equivalents per gram dried fruit or vegetable matter (Wang and others 1996; Ou and others 2 002b) Even recently published studies on fish protein hydrolysates from saithe, shrimp, loach and Pacific hake reported lower ORAC values (between 10 and 300 Trolox equivalents per gram protein) (Halldrsdttir and others 2011; Jensen and others 2009; Samaranayaka and others, 2010; You and others 2011) It is possible that the removal of pro oxidants and other undesired compounds, such as phospholipids, through the myosin extraction process increased the oxygen radical absorbance capacity of the myosin hydrolysates compared to ot her less purified fish muscle protein systems. DPPH Radical Scavenging Ability The DPPH radical scavenging ability of all fractions was determined and compared to the uninhibited DPPH reaction and expressed as percent DPPH inhibition. Figure 5 3 shows the results from the DPPH radical scavenging assay. The control sample was not compatible with this assay, as it caused precipitation of the DPPH

PAGE 84

84 compound and the protein. It was therefore assumed that it cannot be measured for DPPH radical scavenging ability. The fractions of the five hydrolysates were measured with no interference. It can be seen that the low molecular fractions of the hydrolysates usually show higher scavenging activity than the larger fractions. Except for elastase, all other low molecular weight fractions are significantly ( p < 0.05) different from the higher molecular weight fractions within their treatment groups. When focused on the low molecular weight fractions, chymotrypsin shows the highest DPPH scavenging activity, significantly ( p < 0.05) different from all other fractions except the medium molecular fraction of CEM high. Only in the elastase and the CEM high measurements were the scavenging abilities of the low fraction equal or even lower than that of the larger fractions. It is s urprising that the low molecular weight fraction of CEM high observed such a low DPPH radical scavenging ability, but it was consistent in all replicates. Further replication of the entire experiment may be advised to determine this phenomenon. Unfortunate ly DPPH radical scavenging results are difficult to compare, since protocols and procedures can be quite different between laboratories and the amount of DPPH vs. sample concentration is often poorly reported. The measurement of %DPPH radical scavenging ab ility allows only for comparison between samples of the same study; however, overall trends can be reported and compared. Similar to the ORAC assay most studies report that low molecular weight peptides observe higher DPPH radical scavenging ability than h igher molecular weight fractions, which is consistent with the findings in this study (Pi hlanto and others, 2008; Li and others, 2008; Bougatef and others, 2009; Sampath and others, 2011) It is difficult to comp are exact values between this study and other published studies, since DPPH radical scavenging

PAGE 85

85 results are usually not reported based on sample concentration. Therefore a finding of 50% DPPH inhibition for a sample with a protein concentration of 1.5 mg/ml in one study cannot be compared to the 30 % DPPH inhibition reported for a protein concentration of 0.5 mg/ml in another; most studies did not determine dose dependent relationships and used their assay merely to compare treatments within their respective experiments. For example, Halldrsdttir and others (2011) repo rted around 30% DPPH inhibition for two different fish protein hydrolysates (FPH at 1.5 mg/ml) that were diluted in water for the DPPH assay, while Sampath and others (2011) reported up to 60% DPPH inhibition for hydrolysates (1.0 mg/ml) derived b y in vitro gastrointestinal digestion of horse mackerel. Limited studies have been performed to study the effect peptides derived in a model system with a single protein source and separated purified enzymes; therefore it is hard to find comparable literat ure results. Some articles have been published with the purpose to detect novel peptides derived by different individual or mixed enzymes, but their discussion usually focuses on the most potent enzyme mixture to produce bioactive peptides and further resu lts regarding individual enzyme hydrolysates are of not shown (Qian and others, 2008; Je and others 2007; Kim and others, 2007; Mendis and others 2005) Reducing Power of Antioxidants Assay The reducing power of all hydrolysate fractions was measured and expressed in mg of ascorbic acid equivalents per g protein. Figure 5 4 shows the res ults of the reducing power assay for all hydrolysate fractions. Similar to the DPPH assay, the control sample was not compatible with the assay and therefore not measured. The results show nearly no differences in reducing power between the fractions of ea ch individual hydrolysate, but it seems that the chymotrypsin hydrolysates have slightly

PAGE 86

86 higher reducing power than the remaining hydrolysates. The chymotrypsin medium and high molecular weight fractions are significantly ( p < 0.05) higher than most other treatments and fractions. Probably some kind of sample contamination, which could not be resolved for analysis, caused the extreme low value for the low molecular weight trypsin fraction. Surprisingly CEM high observed the lowest reducing power values amon g all hydrolysates except for the trypsin less than 5 kDa fraction. It is hard to speculate whether a high degree of hydrolysis has a negative effect on the reducing power ability of myosin peptides as compared to the amino acid composition and molecular s ize of the peptides. Wu and others (2003) showed in a study with mackerel ( Scomber austriasicus ) that the reducing power increased with increasing hydrolysis tim e for both autolysation and hydrolysation with Protease N, which would assume an increase in %DH with prolonged hydrolysis time. Their results are contradictive of the findings in this assay, where the reducing power decreases with increasing %DH. Again it is difficult to compare measured values for reducing power assays, since the units of measurement vary from study to study. Wu and others (2003) for example, r eported the absorbance at 700 observed for different samples at the end of their assay, while Jensen and others (2009) performed the FRAP (ferric reducing antioxidant power) assay on shrimp and saithe hydrolysates and reported their results in Trolox equivalents per gram protein. The choice of enzyme seemed to be less important for the reducing power ability, since there was no significant ( p < 0.05) difference between the individual enzymes and the low concentration cod enzyme mixture (CEM), which observe similar degrees of hydrolysis.

PAGE 87

87 Ferrous Ion Chelation Ability The metal chelating abilities of the hydrolysates were me asured using the ferrous ion chelating ability assay and expressed as percent iron chelation compared to the un chelated reaction. Figure 5 5 shows the results of the ferrous ion chelating ability assay. The control sample was again not measured do to inco mpatibilities with the assay procedure. Similar to the r educing p ower assay results there was little difference observed between the fractions of each hydrolysate. Most hydrolysates observe a metal chelation ability of larger than 80 percent at 0.5 mg/ml p rotein in the test environment. Chymotrypsin, CEM high and CEM low observe nearly identical chelating abilities except for the CEM high less than 5 kDa fraction, which similar to the DPPH scavenging results exhibited a surprisingly low value and was signi ficantly ( p < 0.05) different from the remaining samples. Similar to the reducing power assay chymotrypsin showed the highest activity, followed by CEM low, CEM high, trypsin and elastase. Trypsin and elastase showed significantly ( p < 0.05) lower iron che lating abilities among all their fractions compared to chymotrypsin, CEM low and CEM high. These results are consistent with findings in recently published studies. Yin and others (2005) reported on the iron chelating ability of minced mackerel before and after hydrolysis. Their results show an increase from 40% (before hydrolysis) to almost 80% (after hydrolysis) of iron chelating ability. Raghavan an d others (2008) reported iron chelating abilities for tilapia protein hydrolysates around 80% for most enzymes mixtures test ed. Cellular Antioxidant Assay (CAA) The Cellular Antioxidant Assay (CAA) was performed as described earlier, but only the low molecular weight fractions were tested since preliminary results suggest that these were the most active factions and they have t he ability to be absorbed by the

PAGE 88

88 cells. All hydrolysates were tested in three different concentrations from 0.50 mg/ml over 0.25 mg/ml to 0.10 mg/ml. Figures 5 6 and 5 7 show the results of the cell viability assay, which was performed to determine that th e test substances do not interfere with regular cell growth or may even cause cytosis (cell death). As seen in figure 5 6, the hydrolysate fractions from the individual enzymes do not interfere with cell growth up to a concentration of 0.5 mg/ml. Figure 5 7 shows similar results for the hydrolysates derived by the cod enzyme mixture at low and high concentration. No significant ( p < 0.05) difference was observed among the three concentrations tested for chymotrypsin, elastase and CEM high digested myosin. T rypsin and CEM low hydrolysates observed an expected dose dependent relationship, where higher concentrations increased the amount of AAPH radical inhibition inside the cells. Among the individual enzymes, trypsin showed the highest amount of AAPH radical inhibition followed by chymotrypsin and elastase. Except for chymotrypsin at 0.25 mg/ml no significant ( p < 0.05) differences were detected between all chymotrypsin and elastase concentrations. The amount of AAPH radical scavenging ability seems to be less dependent on the dose (concentration) and more on the type of enzyme used and the degree of hydrolysis achieved. At higher degrees of hydrolysis small peptides are generated which may migrate easier into the cells and act as antioxidants, however results also suggest that extensive hydrolysis (as shown for CEM high) may lead to diminished antioxidant activity, whether inside or outside the cell. Limited studies have been performed using the CAA assay and therefore it is hard to find comparable data. Discu ssion Both the ORAC and the DPPH results show ed that lower molecular weight peptide s have higher antioxidant activities. However, only the DPPH results showed

PAGE 89

89 differences ( p < 0.05) between low and higher molecular weight fractions. Also reducing power and metal chelation results indicated no differences ( p < 0.05) between molecular weight fractions, as it was observed in recent studies (Bougatef and others, 2009; Kim and o thers, 2007; Sampath and others, 2011; Pihlanto and others, 2008; Li and others, 2008) The ORAC results, observed for the cod myosin hydrolysates, were much higher than for most dried fruit and vegetable matter with low phytochemical composition (Ou and others, 2002b; Wang and others, 1996) Even for chardonnay grapes, ORAC value up to only 450 Trolox equivalents have been reported (Yilmaz and Toledo, 2004) compared to the more than 600 Trolox equivalents observed for trypsin digested myosin (larger than 30 kDa). Less data are available to compare ORAC values of food protein de rived peptides to data acquired by this study, since ORAC, although widely used to determine antioxidant activity in fruits and vegetables, is not as commonly used to assess the antioxidant activity peptides, as the DPPH radical scavenging ability assay (Bougatef and others, 2009; Hernandez Ledesma and others, 2005; Je and others, 2008; Kim and others, 2007; Li and others, 2008; Qian and others, 2008; Ren and others, 2008; Sampath and others, 2011) .The DPPH radical scavenging results showed larger variation between samples and fractions than the ORAC, reducing power and iron chelation assay results. Here the importance of low molecular weight peptides to increase radical scavenging ability is supported by the data, which showed much lower radical scavenging ability for higher molecular weight fractions. Chymotrypsin, followed by trypsin and elastase showed the highest radical scavenging ability among the individual enzyme treatments; however no studies have been published that compare

PAGE 90

90 effects of individual enzymes on a protein model system. The effects of low molecular weight fractions on increases in DPPH radical scavenging ab ility is well documented (Pihlanto and others, 2008; Bougatef and others, 2009; Li and oth ers, 2008; Sampath and others, 2011) Both the reducing power and the iron chelating ability assay did not show much differ entiation, but the iron chelating ability assay showed more than 50% iron chelation for nearly all fractions and treatments, except CEM high (low MW). The reducing power assay reported up to 40 mg ascorbic acid equivalents per gram peptide for most fractio ns, except all CEM high fractions and the low molecular weight fraction of trypsin. Little literature data are available to compare reducing power assay results and it is is difficult to compare the data available, since the measurement of reducing power v aries among those studies. Some report ascorbic acid equivalents and others report antioxidant equivalents and FRAP values (Benzie and Szeto, 1999) It should however be noted that in this study no differences ( p < 0.05) were observed between most molecular weight fractions within treatment groups, which contradicts results reported by Wu and others (2003) who observed increased reducing power of hydrolysates with increasing hydrolysis time and %DH. The iron chelating ability values were similar among all molecular weight fractions: around 80% for chymotrypsin, CEM low and CEM high hydrolysates; around 60% for trypsin and elastase hydrolysates. Only CEM high (low MW fraction) showed a relative low iro n chelating ability at 20%. These finding are consistent with studies who reported an increase in iron chelating ability after protein hydrolysis in minced mackerel and tilapia (Yin and others, 2005; Raghavan and Kristinsson, 2008)

PAGE 91

91 The cellular antioxidant activity (CAA) assay results showed that for most peptide fractions a dose dependent relationship cannot be established, however trypsin and CEM low digested myosin showed results that would be expected with a decrease in peptide concentration. Standard deviations in this assay were much higher, especially for CEM high which may suggest t hat increased hydrolysis generates a complex mixture of peptides that may be absorbed in many different ways and vary in antioxidant potential. In comparison, the standard deviation of Trolox (a vitamin E derivative) was small, since it is a single compoun d and potent antioxidant with little variation in cell absorbance and antioxidant activity. The high variability and partly inconclusive results associated with CEM high peptides may suggest that degree of hydrolysis can exceed levels too high to produce p eptides that sustain bioactive functionality. Interestingly, overall antioxidative effects in the CAA assay seem to be correlated to degree of hydrolysis for different enzyme treatments. A higher degree of hydrolysis generates smaller peptides, which are e asier to absorb, until the peptides become too small (see CEM high) and may lose bioactivity. This hypothesis, however, could not be confirmed in the present study. Trypsin showed the highest antioxidative activity in the CAA assay and it also showed the h ighest amount of phosphorylated peptides among the individual enzyme treatments. Unfortunately, not many studies have been conducted using the CAA assay on food protein hydrolysates. This assay however was implemented successfully to study flavanoids and t he antioxidant properties of fruits, vegetables and even soy milk (Wolfe and Liu, 2007; Wolfe and others, 2 008; Wolfe and Liu, 2008; Salawu and others, 2011; Roy and others, 2009; Angelino and others, 2011; Xu and others, 2010)

PAGE 92

92 The mechanisms of antioxidant activity of proteins, peptides and amino acids are complex, but there are certain parameters that might indicate increased antioxidant potential. For example methionine and tyrosine have been shown to have strong H+ donating ability, an importa nt mechanism in antioxidant activity (Shahidi, 1997) Some studies also suggest that the antioxidant activity is strongly related to the metal chelating ability of proteins and peptides (Shahidi, 1997) as it was observed in this study, where the metal chelating ability of all fractions was greater than 60% at 1 mg/ml protein concentration. Furthermore, there are indications that an increase in hydrophobicity is correlated to the increase in antioxidant potential (Shahidi, 1997) which is consistent with the findings in this study. The liquid chromatography results show that trypsin, which observed the least antioxidant activity among the ch emical assays, produced far more hydrophilic peptides than all other treatments.

PAGE 93

93 Figure 5 1 Method of proposed principle for the cellular a ntioxidant activity (CAA) assay This figure is from Wolfe and Liu (2007) with some modifications. (Reprinted with permission from Wolfe and Liu (2007). Copyright 2007 American Chemical Society). DCFH DA diffuses into the cell where cellular esterases cleave the diacetate moiety t o form the more polar DCFH, which is trapped within the cell. The peptides bind to the cell membrane and/or passes through the membrane to enter the cell. AAPH spontaneously decomposed to form peroxyl radicals. These peroxyl radicals attacked the cell memb rane to produce more radicals and oxidize the intracellular DCFH to the fluorescent DCF. Antioxidants prevent oxidation of DCFH and membrane lipids and reduce the formation of DCF.

PAGE 94

94 Figure 5 2. Oxygen radical absorbance capacity assay (ORAC) Results are grouped by treatment and each group shows the different molecular weight fractions, from lowest to highest, respectively. Results are expressed as micromole of Studentized Range (HSD) test were performed and results bearing the same letter are not significantly different from each other ( p < 0.05) Figure 5 3. DPPH radical scavenging ability Results are grouped by treatment and each group shows the different molecular weight fractio ns, from lowest to highest, respectively. Results are expressed as % DPPH radical scavenging activity. Sample concentration for this test was 0.5 mg/ml protein. A single and results beari ng the same letter are not significantly different from each other ( p < 0.05) c,d d,e,f d,e,f b a d,e b f,g d,e,f b,c h h g,h e,f b 0.0 200.0 400.0 600.0 800.0 1000.0 1200.0 1400.0 1600.0 1800.0 2000.0 Chymotrypsin Trypsin Elastase CEM low CEM high mol TE/g protein < 5 kDa 5 30 kDa > 30 kDa a c c b e e f d,e f a c,d e c f c 0.0 5.0 10.0 15.0 20.0 25.0 30.0 35.0 Chymotrypsin Trypsin Elastase CEM low CEM high % DPPH Radical Inhibition < 5 kDa 5 30 kDa > 30 kDa

PAGE 95

95 Figure 5 4. Reducing power of antioxidants assay Results are grouped by treatment and each group shows the different molecular weight fractions, from lowest to highest, resp ectively. Results are expressed as milligram of Ascorbic Acid Studentized Range (HSD) test were performed and results bearing the same letter are not significantly different from each other ( p < 0.05) Figure 5 5. Ferrous ion chelating ability assay Results are grouped by treatment and each group shows the different molecular weight fractions, from lowest to highest, respectively. Results are expressed as % metal chelating ability. Sample c oncentration for this test was 0.5 mg/ml protein. A single factor results bearing the same letter are not significantly different from each other ( p < 0.05) c,d h f d,e g a c,d,e b,c c,d f a,b e,f d,e b,c g 0.0 10.0 20.0 30.0 40.0 50.0 60.0 Chymotrypsin Trypsin Elastase CEM low CEM high ascorbic acid equivalent in mg/g protein < 5 kDa 5 30 kDa > 30 kDa d f f b,c,d h a f e a,b c,d a f g a,b,c b,c,d 0.0 20.0 40.0 60.0 80.0 100.0 120.0 Chymotrypsin Trypsin Elastase CEM low CEM high iron chelating ability in % < 5 kDa 5 30 kDa > 30 kDa

PAGE 96

96 Figure 5 6. Cell viability me asurements with peptides derived by individual enzymes To ensure the HepG2 cells are viable and unaffected by the samples themselves during the CAA assay, a viability assay was performed with AlamarBlue to determine cell cytotoxicity. This graph shows th e viability results for the less than 5 kDa hydrolysate fractions derived by chymotrypsin (CT5), trypsin (T5) and elastase (E5) for different protein concentrations. Figure 5 7. Cell viability measurements with peptides derived by CEM high and low To e nsure the HepG2 cells are viable and unaffected by the samples themselves during the CAA assay, a viability assay was performed with AlamarBlue to determine cell cytotoxicity. This graph shows the viability results for the less than 5 kDa hydrolysate frac tions derived by high and low concentrations of cod enzyme mixture (CEMH 5 and CEML 5) for different protein concentrations. 0% 20% 40% 60% 80% 100% 120% 0.5 0.25 0.1 0.05 0.025 0.01 %Viable cells Protein content (mg/mL) CT5 T5 E5 0% 20% 40% 60% 80% 100% 120% 0.5 0.25 0.1 0.05 0.025 0.01 %Viable cells Protein content (mg/mL) CEMH 5 CEML 5

PAGE 97

97 Figure 5 8. Cellular antioxidant assay (CAA) results Inhibition of the AAPH induced cellular ROS gen eration in HepG2 cells by t he sample peptides at 0.5 mg/ml, 0.25 mg/ml and 0.1 mg protein/m L sample concentration after 120 minutes Values are expressed as percentages of the DCF fluorescence intensity to that of control cells. Each data point shows the mean SD ( n = 4). Values with different letters are significantly different from each other ( p < 0.05) h,i,j c,d,e,f,g i,j a,b,c g,h,i a d,e,f,g,h f,g,h,i h,i,j b,c,d c,d,e,f a,b h,i,j h,i,j j d,e,f,g,h e,f,g,h c,d,e 0.0 10.0 20.0 30.0 40.0 50.0 60.0 70.0 80.0 Chymotrypsin Trypsin Elastase CEM low CEM high Trolox % AAPH Radical Inhibition 0.50 mg/ml 0.25 mg/ml 0.10 mg/ml

PAGE 98

98 CHAPTER 6 ANGIONTENSIN CONVERT ING ENZYME (ACE) INHIBITION BY COD MY OSIN HYDROLYSATES Material and Methods Angiotensin converting enzyme (ACE) is a dipetidyl caboxy peptidase that plays a key role in the regulation of blood pressure and cardiovascular function and is located in many tissues and biological fluids (Meng and Oparil, 1996; Coates, 2003) The mechanism of ACE is to elevate bl ood pressure by converting angiotensin I into angiotensin II, which is a powerful vasoconstrictor. Any substance that can inhibit this enzyme can be considered to have an antihypertensive effect (Shalaby and others, 2006) Shalaby and others (2006) compared two commonly used ACE inhibition assays and concluded that the assay using furanacroloyl Phe Glu Glu (FA PGG) as the substrate is much faster and less material demanding and therefore a good choice for screening studies. A Tris HCl buffer (50 mM, pH 7.5) was prepared and filtered through a 0.45 m filter. The FAPGG substrate (N (3 (2 furyl) acryl o yl) Phe Gly Gly) from Sigma Chemical Co. (St. Louis, MO) was prepared as 0.88 mM in the previously described Tris HCl buffer. Angiotensin converting enzyme (ACE), extracted from rabbit lung, was obtained from Sigma Chemical Co. (St. Louis, MO) and prepared in ultra pure water to a concentration of 3 U/ml. Twenty microliters of peptide solutions (1.0 mg/ml) in phosphate buffer (10 mM, pH 6.6), or just buffer as the control, were mixed with 10 L of enzyme solution (ACE) in a NUNC The microplate was (BMG Labtech, Offenburg, Germany) microplate reader with temperature control system. During incubation of the the temperature

PAGE 99

99 at the time the substrate solution is added to the microplate. After incubation 170 L FAPGG substrate solution was added to each sample and control well and the absorbance was recorded for 60 minutes in 1 minute intervals. For each sample and control, the initial rate (linear part of the absorbance curve) was determined and expressed as A in min 1 The percent ACE inhibition was calculated by Equation 6 1, w here A sample is the slope of the linear part of the absorbance curve ( A 340 min 1 ) for the sample and A control is the slope of the linear part of the absorbance curve ( A 340 min 1 ) for the control. (6 1) By assaying increasing concentrations of each sample, until ACE inhibition higher than 50% was achieved, the IC 50 value for each sample was determined. By plotting the sample concentration against the measured ACE inhibition and determining the concentration of each sample, needed to inhibit ACE by 50%, IC 50 values we re calculated and expressed in mg/ml. All samples were run in triplicates on each plate and duplicate plates were run in this experiment. The unhydrolyzed control sample was not used due to insolubility issues. Statistical Analysis Simple one way analysis of variance (ANOVA) was used to determine significant ( p < 0.05) differences between all treatments and fractions. When significant ( p < 0.05) test was used to do a pair wise comparison between these sample means. The level of = 0.05.

PAGE 100

100 Results The ACE inhibitory effect of myosin hydrolysates fractions was assessed according to the procedure described above. Similar to all antioxidant assays the unhydrolyzed myosin could not be used for analysis, since it interfered intermittingly during the experiment. Data for the control sample is therefore not shown. Figure 6 1 shows the results of the initial ACE inhibition assay for a peptide concentration of 1 mg/ml. This test determined that a concentration of most of the samples was necessary to determine IC 50 values, which represent the amount of hydrolysate needed to inhibit ACE by 50%. These results indicate that the low molecula r weight fraction for most all of the hydrolysates exhibit higher ACE inhibition than the remaining fractions and significant ( p < 0.05) differences are found for chymotrypsin, elastase and CEM high, while trypsin and CEM low show no significant ( p < 0.05) differences between most of the fractions within their respective treatment groups. The order of the potency between the treatments shows that CEM high and elastase had the highest ACE inhibition activity followed by chymotrypsin and CEM low (not signific antly ( p < 0.05) different from each other) and trypsin the lowest. The IC 50 values obtained in a second trial after sample concentration are listed in Table 6 1 and shown graphically in Figure 6 2. Since IC 50 values describe the least amount of a substanc e needed to inhibit a reaction by 50% lower values denote more potent substances. In this case Figure 6 2 and Figure 6 1 are almost mirror images, therefore accounting for the reproducibility of the data. Many studies have been performed regarding the ACE inhibitory effects of food derived peptides. Guo and other (2009) studied ACE inhibitory peptides from whey protein s and determined a relationship between ACE inhibitory effect and degree of hydrolysis. Several studies reported on the observed effect that low molecular weight fraction of

PAGE 101

101 hydrolysates show higher ACE inhibitory abilities than the larger molecular weight fractions (Lee and others, 2010; Miguel and others, 2009; Zhao and others, 2009; Raghavan and Kristinsson, 2009) Certain studies reported IC 50 values for unpurified peptide fractions from sea cucumber, hard clam and bovine casein hydrolysate ranging from 5.5 down to almost 0. 5 mg/ml (Miguel and others, 2009; Tsai and others 2008; Zhao and others, 2009) Discussion The ACE inhibitory effects among different molecular weight fractions are well differentiated, and for all treatments the low molecular weight fraction showed the highest ACE inhibitory activity. The IC 50 values determine that trypsin, followed by chymotrypsin and elastase had the highest potency for ACE inhibition. Only CEM high showed lower IC 50 values than trypsin and CEM low and therefore, showed the highest potency amo ng all samples tested. The effect of low molecular weight fractions in ACE inhibitory properties, as observed in this study, are well documented (Lee and others, 2010; Miguel and others, 2009; Raghavan and Kristinsson, 2009; Zhao and others, 2009) Reported IC 50 values conform to those rep orted in recent studies for unpurified peptide fractions of sea cucumber, hard clam and bovine casein hydrolysate (Miguel and others, 2009; Tsai and others, 2008; Zhao and others, 2009)

PAGE 102

102 Figure 6 1. ACE Inhibition for peptides derived by enzymatic hydrolysis f rom cod myosin Results are grouped by treatment and each group shows the different molecular weight fractions, from lowest to highest, respectively. Results are expressed as % ACE Inhibition. Sample concentration for this test was 1.0 mg/ml protein. A sin test were performed and results bearing the same letter are not significantly different from each other ( p < 0.05). c d,e,f b c,d a g e,f f c,d c,d e,f g g c,d,e c 0.0 10.0 20.0 30.0 40.0 50.0 60.0 70.0 Chymotrypsin Trypsin Elastase CEM low CEM high % ACE Inhibition < 5 kDa 5 30 kDa > 30 kDa

PAGE 103

103 Table 6 1. IC 50 values for ACE inhibition by myosin peptide fractions Samples IC 50 *1 IC 50 *2 Avg. Std. Dev. Chymotrypsin ( < 5 kDa) 1.38 1.36 1.37 0.01 Chymotrypsin (5 30 kDa) 3.20 3.69 3.44 0.35 Chymotrypsin ( > 30 kDa) 2.00 2.89 2.45 0.63 Trypsin ( < 5 kDa) 0.70 0.69 0.70 0.01 Trypsin (5 30 kDa) 1.02 1.11 1.06 0.06 Trypsin ( > 30 kDa) 1.78 1.76 1.77 0.02 Elastase ( < 5 kDa) 1.76 2.19 1.98 0.31 Elastase (5 30 kDa) 1.36 1.52 1.44 0.11 Elastase ( > 30 kDa) 2.91 2.79 2.85 0.09 CEM low ( < 5 kDa) 0.77 0.79 0.78 0.01 CEM low (5 30 kDa) 1.26 1.48 1.37 0.16 CEM low ( > 30 kDa) 1.40 1.33 1.36 0.05 CEM high ( < 5 kDa) 0.35 0.37 0.36 0.01 CEM high (5 30 kDa) 0.95 0.86 0.91 0.06 CEM high ( > 30 kDa) 0.40 0.43 0.41 0.02 Note: IC 50 values are expressed in mg/ml peptide. Lower IC 50 values mean higher ACE inhibitory effect and higher potency, since less of the compound is needed. IC 50 *1 and IC 50 *2 represent replicate microplate readings with 4 replicates per microplate. Figure 6 2. IC 50 values for ACE inhibitory effect of myosin p eptides IC 50 values are expressed in mg/ml peptide. Lower IC 50 values mean higher ACE inhibitory effect and higher potency, since less of the compound is needed. 0.00 0.50 1.00 1.50 2.00 2.50 3.00 3.50 4.00 Chymotrypsin Trypsin Elastase CEM low CEM high IC 50 values expressed in mg/ml < 5 kDa 5-30 kDa > 30 kDa

PAGE 104

104 CHAPTER 7 MASS SPECTROMETRY AN ALYSIS OF COD MYOSIN HYDROLYSATES Material and Methods LC MS/M S A nalysis of P eptide F ragments from M yosin D igest s Two micrograms of digested peptides from each of the five enzymatic reactions were concentrated and de salted via reversed phase chromatography using C18 Zip Tips (Millipore) and eluted with 50% acetonitrile (MeCN), 0.1% formic acid (FA). The de salted peptides were taken to dryness in a vacuum centrifugal concentrator, and re suspended in 10 L mobile phase A (0.1% FA, 99.9% MS grade water). E ach sample ( 5 L) was then applied to a self packed 10 0 x 0.1 mm C18 Aq (3m particle, 200A pore size) reversed phase column with a carbon steel frit, and separated over a 45 min linear gradient of increasing amounts of mobile phase B (MeCN) from 0 50% MPB at 300 nl/min using an Eksigent nano 2DLC. Column elu ate was introduced into a Thermo (Waltham, MA) LTQ Orbitrap mass spectrometer via an ADVANCE captive spray ion source (Michrom) with the following settings: nitrogen sheath gas equal 3 arbitrary flow units, spray voltage equal 1.5kV. Xcalibur software v 2. 0.7 (Thermo Scientific, Waltham, MA) was used to control instrument settings. MS and MS/MS (MS 2 ) spectra were acquired in data dependent acquisition (DDA) mode. Major instrument and DDA settings were as follows: full scan MS spectra were acquired at 60,000 resolutions (FWHM at 400 m/z) in Fourier Transform mode (FTMS), MS2 spectra were acquired in ion trap (ITMS) mode (2 microscans, 100 millisecond maximum injection time). The top five most abundant peptides from each full scan MS were selected for fragment ation using collision induced dissociation in the ion trap; helium was used as the collision gas.

PAGE 105

105 Dynamic exclusion was enabled in Xcalibur software to avoid redundant isolation and fragmentation of peptides within a 60 second window. Rationale for LC MS/M S A nalysis Though direct infusion nano ESI MS analysis is often sufficient to identify proteins in a low complexity mixture (up to 20 proteins) there remains the concern of the isobaric (same mass) peptides overlapping one another in both the full scan an d the MS 2 spectra. Therefore, even in a simple enzymatic digest of 5 10 proteins, chromatographic separation is ideal, as it greatly increases the chances that isobaric peptides will be resolved and thus, analyzed individually. In these experiments, nano flow LC was used to run the analytical gradient Performing LC MS experiments at nano flow rates (50 1000 nl/min) greatly increase the sensitivity of the assay relative to traditional LC ESI MS, where flow rates typically range from 300 1000 L/min as the analytes (peptides, in this case) enter the MS via much smaller droplets than observed with conventional electrospray (Chelius and others 2003; Klampfl, 2004 ; Viberg and others 2004; Wetterhall and others 2002; Wickremsinhe and others 2006) This has two major implications: the smaller droplet size yields a much higher charge to volume ratio of the droplet (more analyte in a given droplet), as well as a much more efficient desolvation. As ions entering the MS must ultimately be in gas phase, any technique which can more readily lead to a desolvated ionic species is preferred. Additionally, using nano LC, the relative amounts of non volatile contaminants from the solvent mixture is much 500 to 1000 fold less, which leads to improved sensitivity, particularly with the type of ion trap instrumentation used for this work. As the traps are indiscrimin ate with regard to what ions occupy them and as they have a finite capacity filling them with an excess of contaminant ions would

PAGE 106

106 These improvements in sensitivity allow f or a comprehensive analysis of proteins, even from a complex digest of hundreds of proteins, from 500 ng 1 g of material. Mass spectrometer instrument settings also have a profound impact on the type and quality of data obtained. Recent generation hybrid mass spectrometers (i.e., those having two separate mass analyzers house d within the same instrument) allow for a high degree of flexibility for the types of experiments which can be performed. It is then up to the user to arrange the proper set of in strum ent parameters which best address the needs of the experiment. The LTQ Orbitrap MS used in these experiments is capable of operating in two high resolution, high mass accuracy (ex., +/ 0.0001 AMU) modes, as well as a rapid scan, low resolution (ex., +/ 0 .1 AMU) ion trap mode. A large majority of proteomic studies aimed at identification and quantification of peptides to charge ratios ( m/z ) of each peptide is obtained in the high resolution mode, follow ed by a sequential trapping and fragmentation of each peptide observed in the full scan mode using the rapid, low resolution ion trap. This arrangement represents a logical compromise between performing all scans at high resolution, which would lead to dec reased sensitivity as a consequence of the lower scan rates, and performing all scans in ion trap mode, which would lead to decreased statistical confidence in the datasets. A typical sequence of events in a MS experiment described above (and in fact, the same sequence used in these experiments) would be the data acquisition in the Orbitrap analyzer (Fourier Transform mode FTMS) for the full scan MS at high resolution (60,00 0 FWHM at m/z = 400), followed by the trapping and fragmentation via

PAGE 107

107 CID of the five most abundant peptides in the full scan spectrum. This is colloquially To avoid the collection of redundant data centered around only the most abundant peptides, a feature in the Xcalibur software called previous Big5 duty cycle for a given time period (usually 30 60 seconds). Extending the dynamic exclu sion time beyond 60 seconds is possible, but doing so increases the chances of excluding isobaric or nearly isobaric peptides which are eluting later in the LC separation, leading to a decrease in peptide coverage and characterization. It should be noted t oo, that fragmentation types other than CID could be used for this work (ex., electron transfer dissociation [ETD], or higher energy C trap dissociation [HCD]) could be used to provide complementary datasets, however such features were not available on the particular generation of LTQ Orbitrap instrumentation used herein. Data A nalysis MS spectra from each analysis were interrogated using Proteome Discoverer (PD) software (Thermo). This software utilizes the Sequest algorithm, which ranks the predicted m/z values for both full scan and fragment ion spectra against predicted spectra derived from protein sequence databases and in silico digests that correspond to the enzyme(s) used to hydrolyze the experimental material. Additional information can be specified when beginning the data analysis, such as post translational modifications including amino acid phosphorylation, oxidation, etc., that allow for such mass shifts in the spectra to be properly interpreted, rather than simply scoring them as a false negativ e due to a lack of correlation between, for example, a phosphorylated peptide observed in an experiment and its non phosphorylated complement from a sequence database. Proteome Discoverer is a proprietary software package, and so

PAGE 108

108 the exact means by which it analyzes and ranks peptide identifications are not very well described, however it is generally accepted in the MS field that it provides approximately twice the sensitivity as other commercial and/or free MS search engines (ex., Mascot, Xtandem, OMSA, Andromeda) for a given false discovery rate ( FDR ) (1% in this experiment). In all database searches and D e n ovo sequencing the enzymes were set to Trypsin (KR), Elastase (ALIV), Chymotrypsin (FWY) or CEM (FWYKRALIV). Proteome Discoverer 1.3 (Thermo Scienti fic) was used for SEQUEST search of the spectra against IPI.DANRE.v3.82 database (zebra fish database) The following settings were used for the database searches; precursor mass tolerance was set to 10 ppm, maximum missed cleavage was set to 3 for all enzymes the dynamic modifications were set to +15.99491 for oxidized methionine and +79.9663 for phosphorylated serine, threonine and tyrosine. The FDR was calculated using a decoy database search. Xcorr values matching the high confidence FDR we re chosen to filter the identified peptides further. The PEAKS Studio 5.3 (Bioinformatics Solutions, Waterloo, Ontario, Canada) was used for automated D e n ovo Sequencing and PEAKS database search. For D e n ovo sequencing the following setting were used; err or tolerance for parent ion set to 3 ppm, maximum allowed Posttranslational modification (PTM) were set to 3, up to 2 candidates were reported for each spectrum and the variable PTMs were set to +15.99491 for oxidized methionine and +79.9663 phosphorylated serine, threonine and

PAGE 109

109 Same settings were used for PEAKS search engine in which IPI.DANRE.v3.82 database was used to search against LC MS spectra. As the MS data obtained in the study were queried against amino acid sequence databases from exogenous model systems, the question arises regarding both the correctness and completeness of the dataset described. Data mining using PD is both rapid, and yields data with exceptional ly high statistical confidence, but all such data comes from sequences determine d a priori most often by in silico translations o f genomic sequence data or from expressed sequence tag ( EST ) libraries. In many cases, searches are performed against transla ted sequences from both genomic and EST information, as the EST data enables the identification of novel peptide data that arise from alternative spicing events during mRNA transcription. Once again, these peptides would be scored as false negative s if the data were searched against translated genomic databases alone. Still, the combination of EST and genomic information in the searchable database does not preclude the possibility that novel amino acid sequences from less well characterized species will be scored as negatives and excluded from the final dataset. To address this, several companies and academic groups have generated software aimed at D e novo sequencing from tandem (MS2) mass spectrometry data. One of the most reliable D e novo sequencing algor ithms is applied in PEAKS Studio 5.3 (BSI) which offers both D e novo sequencing algorithm and database search engine PEAKS DB. As there is neither a protein database for Atlantic cod, nor a complete sequence for the proteins extracted in the sample (myosin HC, actin, tropomyosin, myosin LC1, myosin LC2, myosin LC3) for Atlantic cod, D e novo sequencing approach

PAGE 110

110 would be ideal to identify the peptide sequences in the sample. Therefore, PEAKS Studio 5.3 has been used to identify the peptide sequences that were obtained by digesting with the five separate enzymes. Results The mass spectrometry analysis of the myosin peptide fractions resulted in a vast variety of peptides, identified by Peptide Spectra matching (PMS) in Sequest and PEAKS DB database search algor ithms and by De novo sequencing, for all of the hydrolysis treatments. Figure 7 1 shows the LC chromatograms of all samples treatments for the <5 kDa fractions. Since larger fractions showed usually less bioactivity in previous results and further hydrolys is or fractionation would be necessary anyways to analyze larger molecules with mass spectrometry only the low molecular weight fractions were analyzed. The chromatograms indicate definite differences among the peptide compositions of the five treatments, especially for the trypsin digestion, which shows peptide groups with lower retention times than the other treatments, determined by the LC setting and procedure. It is interesting to observe that the chromatograms for CEM low and CEM high seem to be quite different (note the peak at retention time 19.4), even though the enzyme composition and hydrolysis time for both treatments is the same and only the enzyme concentration during hydrolysis is significantly ( p < 0.05) increased in the CEM high treatment. T he chymotrypsin and CEM low chromatograms have many similarities, which could be explained by the fact that CEM is composed mostly of chymotrypsin and this is the dominating factor, especially at low concentration. The cod enzyme mixture (CEM) is comprised of about 88% chymotrypsin, 5% trypsin and 7% elastase, by unit comparison. Another interesting

PAGE 111

111 observation is the generation of peptides with very low retention times, within the specific LC settings. Since the entire sequence of cod muscle myosin is unkn own as of this date, the complete sequence of zebrafish (Danio rerio) ( IPI.DANRE.v3.82 database ) was used for the database identifications. The widely recognized online database UniProt contains some sequences of cod muscle myosin fragments, but not for th e complete myosin molecules (HC, LC1, LC2 and LC3). Table 7 1 shows the largest cod muscle myosin fragment found in the database, with a length of 259 amino acids, that was used to detect cod and zebrafish myosin similarities and therefore to decide whethe r the zebrafish database can be used in mass spectrometry database search analysis. The myosin heavy chain protein sequence fragment from Atlantic cod was aligned using BLAST algorithm using UniProt web tools ( http://www.uniprot.org/blast/ ). Table 7 2 lists the results for the comparison of the cod muscle myosin fragment and two identical zebrafish myosin sequences. Figure 7 2 gives a graphical representation of the alignment of Atlantic cod (Q8JIV4) and zebrafi sh (B8A561 and B3DJM6) myosin. The results indicate an 89% identity match between cod and zebrafish myosin. It was therefore decided to use the zebrafish database for Sequest and Peaks DB peptide matching searches. Figure 7 3 represents just one of the man y thousands of mass spectra analyzed during mass spectrometry data analysis. The red and blue peaks in the spectra represent the b (N terminal) and y (C terminal) ions generated in the collision cell. Since the amino acids of a peptide sequence are not det ected according to the sequence, as they would be by Edman degradation, the b and y ions are used for the De novo

PAGE 112

112 sequencing of the peptide (Palzkill, 2002) In Figure 7 3 the sample spectra is shown with the b and y ion labeling according to the Sequest database matching algorithm, which means, that only tho se ions are labeled that match a known sequence. The Sequest search algorithm does not account for peak intensity when matching spectra, therefore a good match can be visually recognized by the amount of high intensity peaks vs. low intensity peaks labeled The database search results for the Sequest and Peaks DB search algorithm, as well as the results of the De novo sequencing, for all myosin hydrolysate fractions are listed in appendices B P. Those results include the protein and peptide identification for each treatment. Protein identifications were performed by peptide (protein fragment) database matching. Table 7 3 lists the results for the amount of peptides found with Sequest and Peaks DB search algorithms and the amount of peptides discovered by D e novo sequencing. One of the tools available for the different search and sequencing data analysis methods is the detection and identification of phosphorylated peptides by mass addition. Some studies (Chen and others 2001; Dockray and others 1987; Hartmann and Meisel, 2007; Kitts and Weiler, 2003; Pihlanto, 2006) suggest that phosphorylation may increase certain bioactive properties in peptides and the amount of phosphorylated peptides was therefore reported in Table 7 3, however it is obvious that, except for elastase digested myosin, the ratio of phosphorylated peptides to total number of peptides is rather low. The number of peptides identified by the Sequest search algorithm is very low compared to the Pe aks DB search algorithm and the De novo sequencing. As mentioned before, this is probably the results of the more stringent

PAGE 113

113 correlation factor and the search algorithm used. Table 7 4 shows the false discovery rates (FDR) for the Sequest database searches, which are almost 0 for most of the treatments. A low FDR is usually desirable, but might also eliminate certain peptides from identification. Therefor it is always advisable to use different search algorithms and compare results. Another indication of goo d mass spectrometry peptide matching is to review the list of proteins that match with the discovered peptides. Appendices L to P show the results of the protein matches for the Sequest and Peaks DB search algorithms using the zebrafish database. It can be observed that the proteins, discovered with the highest probabilities, match with parent protein mixture, in the case myosin (HC, LC1, LC2 and LC3) and some contamination of actin and tropomyosin, as expected from the myosin extraction procedure (see Figu re 4 3 and Table 4 4). Table 7 3 shows that trypsin digestion resulted in the highest number of peptides generated, followed by CEM high, CEM low, chymotrypsin and elastase. De novo sequencing discovered the highest amount of peptides for CEM high, follow ed by trypsin, CEM low, chymotrypsin and elastase. Since all enzymes are present in the CEM mixture and hydrolysis was not performed to 100% digestion, the database search engines cannot identify the many peptides in the CEM high mixture that are really pr esent. De novo sequencing is the only way to discover those novel peptides. Trypsin is the enzyme most commonly used in proteomic research to predigest proteins and peptides for mass spectrometry analysis (Palzkill, 2002; Goodlett and others 2000) and these results give a good indication why. Except for the CEM high mixture it was able to generate the highest amount of peptides and phosphorylated peptides.

PAGE 114

114 Discussion The mass spectrometry results indicate the vast amount of peptides that can be generated by enzymatic hydrolysis of cod muscle myosin, but they also indicate that further isolation and purification of specific peptides is needed before novel peptides with specific bioactive properties can be identified. As mentioned earlier, many studies have isolated and identified novel peptides derived by enzymatic hydrolysis of food proteins that show great anti oxidative (Bougatef and o thers, 2009; Hernandez Ledesma and others, 2005; Je and others, 2008; Kim and others, 2007; Li and others, 2008; Qian and others, 2008; Ren and others, 2008; Sampath and others, 2011) and ACE inhibitory properties (Balti and others, 2010; Guang and Phillips, 2009; Guo and others, 2009; Lee and others, 2010; Miguel and others, 2009; Sheih and others, 2009; Terashima and others, 2010; Tsai and others, 2008; Zhao and others, 2009) However comparison of their novel peptides to peptides found during mass spectrometry analysis results in no matches. The protein identifications for each treatment, as listed in appendices B K, confirmed the SDS_PAGE results from the sample preparation step. For most treatm ents heavy chain myosin and light chain myosin fragments were identified with high probability, followed by actin and tropomyosin. Some unidentified muscle and cardiac muscle protein fragments were also identified, but with much less probability. Mass spec trometry results showed the highest protein matching coverage for peptides derived by trypsin digestion, followed by CEM low, CEM high, chymotrypsin and elastase. Since the coverage is an indicator how good the database search was able to match peptides to their apparent parent protein, these results showed that trypsin derived peptides were more predictable than peptides derived by chymotrypsin and

PAGE 115

115 elastase. This is an important indicator how well theoretical digestion can be performed ahead of future expe riments. The mass spectrometry data collected in this study were too broad to draw any conclusions regarding peptide sequences and bioactive properties; however there may be indications that post translational changes such as phosphorylation could have an effect on the antioxidative properties or the cell permeability of peptides and therefore bioavailability of peptides derived by enzymatic hydrolysis. It was shown that trypsin, commonly used in proteomics to digest peptides for mass spectrometry analysis, produced more low molecular weight peptides from muscle myosin than chymotrypsin and elastase; however it showed less antioxidative activities in chemical antioxidant assay, such as ORAC and DPPH radical scavenging ability. To perform effective mass spect rometry analysis, further fractionation and purification of potent peptides is required.

PAGE 116

116 Figure 7 1. LC/MS chromatograms for myosin peptides with less than 5 kDa MW Myosin peptides were separated on a self packed 100 x 0.1mm C18 Aq (3 m pa rticle, 200A pore size) reversed phase column with a carbon steel frit, and separated over a 45 min linear gradient of increasing amounts of mobile phase B (MeCN) from 0 50% MPB at 300 nl/ min using an Eksigent nano 2DLC, before mass spectrometry analysis.

PAGE 117

117 Table 7 1. Atlantic cod ( Gadus morhua ) myosin fragment sequence for BLAST alignment comparison Myosin fragment identification Sequence tr|Q8JIV4|Q8JIV4_GADMO Fast skeletal myosin heavy chain (Fragment) OS=Gadus morhua PE=2 SV=1 RNGLMVAEIEELRAALEQTERGRKVAEQELLDASERVGLLHSQNTSLLNSKKKLES DLVQVQGEVDDSVQEARDAEEKAKKAITDAAMMAEELKKEQDTSSHLERMKKNLE VTVKDLQHRLDEAENLAMKGGKKQLQKLEARVRDLESEVDNEQRRGAEAIKGVRK YERRVKELTYQTEEDKKNGCRLQDLVDKLQMKVKAYKRQSEETEEQANSYLSKC RKVQHELEEAEERADIAETQVNKLRAKTRDSGKGKE TAE Note: This myosin heavy chain protein sequence fragment from Atlantic cod was aligned using BLAST algorithm and UniProt web tools ( http://www.uniprot.org/blast/ ). Table 7 2. Zebra fish myosin sequences aligning with Atlantic cod myosin fragment Accession Entry name Show full text Protein names Organism Length Identity Score E Value Gene names Q8JIV4 Q8JIV4_GADMO Fast skeletal myosin heavy chain Gadus morhua (Atlantic cod) 259 100.00% 1,274 1.010 138 8A561 B8A561_DANRE Novel myosin family protein Danio rerio (Zebrafish) ( Brachydanio rerio ) 1,937 89.00% 1,143 1.010 123 CH211 158M24.8 001 B3DJM6 B3DJM6_DANRE Myosin, heavy polypeptide 1, skeletal muscle Danio rerio (Zebrafish) ( Brachydanio rerio ) 1,937 89.00% 1,143 1.010 123 myhz1.1 myhz1 si:ch211 158m24.7 Note: Zebra fish myosin sequences are aligning with Atlantic cod myosin fragment sequence with an identity percentage of 89.

PAGE 118

118 Figure 7 2. The alignment of myosin protein sequences from Atlantic cod and Zebrafish Myosin sequences of Atlantic cod (Q8JIV4) and zebrafish (B8A561 and B3DJM6) were aligned using the UniProt web tool BLAST ( http://www.uniprot.org/align/ ).

PAGE 119

119 Figure 7 3. Sample mass spectrum for trypsin digested myosin This spectrum is just a representation of the many mass spectra obtained during analysis of myosin peptides (less than 5 kDa fractions only). The following information and parameters were obtained with this partic ular spectrum at retention time 19.06 minutes: ( Sequence: KMEGDLNEMEIQLSHANR, Charge: +2, Monoisotopic m/z: 1058.00269 Da (+1.12 mmu/+1.06 ppm), MH+: 2114.99809 Da, RT: 19.06 min, Identified with: SEQUEST (v1.20); Xcorr: 6.39, Probability:0.00, Ions matche d by search engine: 27/34. Fragment match tolerance used for search: 0.8 Da. Fragments used for search: b; b H 2 O; b NH 3 ; y; y H 2 O; y NH 3 .) Table 7 3. Number of peptides identified or De novo sequenced by mass spectrometry from myosin hydrolysates. Enzyme Number of phosphorylated peptides in SEQUEST search Total number of peptides Number of phosphorylated peptides in PEAKS 5.3 DB search Total number of peptides in PEAKS 5.3 DB search Number of phosphorylated peptides in De novo sequencing Total number of pe ptides in De novo sequencing Trypsin 4 93 15 1003 286 1990 Chymotrypsin 2 15 8 112 160 1235 Elastase 3 15 13 34 119 962 CEM low 1 13 7 439 129 1539 CEM high 1 20 1 578 265 2343 Note: These peptides were found using two proprietary software packages, SEQUEST and PEAKS DB, and the IPI.DANRE.v3.82 (zebra fish) database. The De novo sequencing was performed using the PEAKS DB software.

PAGE 120

120 Table 7 4. False discovery rates (FDR) for the Sequest database search Enzyme FDR rate (high confidence) Total number of peptides Peptides that were detected by Decoy database. Trypsin 0.0065 93 2 Chymotrypsin 0.0000 15 0 Elastase 0.0000 15 0 CEM low 0.0000 1 3 0 CEM high 0.0000 20 0 Note: Stringency factors and the design of the Sequest search algorithm allow for very precise peptide matches; however these factors also lower the detectability of novel enzymes, not present in the database.

PAGE 121

121 CHAPTER 8 CONCLUSION This study was among the first to use a model system with a single protein sou rce (cod muscle myosin) and individual purified enzymes (chymotrypsin, trypsin and elastase), to study bioactive properties of peptides derived by enzymatic hydrolysis of cod muscle myosin. The results showed that peptides with antioxidative and ACE inhibi tory properties can be produced by enzymatic hydrolysis from cod muscle myosin. Bioactive properties were dependent on the type of enzyme used, as well as the degree of hydrolysis and molecular size of the peptides. Low molecular weight peptides showed hig her antioxidative and ACE inhibitory activities. Chemical antioxidant assay results showed that chymotrypsin digested myosin had the highest antioxidant activity among the individual enzyme treatments, followed by trypsin and elastase. Among all samples CE M low observed the highest antioxidant activities and with values comparable to chymotrypsin. This was to be expected, since CEM low essentially contains 80% chymotrypsin and 5% trypsin and elastase, and was added in such concentration that overall enzyme activity was equal to chymotrypsin. CEM high had the same enzyme composition as CEM low but was added in 10 fold higher concentration than the individual enzyme and CEM low. The resulting hydrolysate showed a higher degree of hydrolysis than CEM low. Resul ts from SDS PAGE analysis, as well as mass spectrometry, confirm a variety of peptides with molecular seizes much smaller than those generated by the other enzyme treatments. De Novo sequencing of CEM high hydrolysates showed most of the peptides were 5 or less amino acid residues long.

PAGE 122

122 The cellular antioxidant assay results show that trypsin observed the highest activity followed by chymotrypsin and elastase. Since the mass spectrometry analysis discovered higher amounts of phosphorylated peptides in trypsin, compared to the other treatments, there could be a correlation between phosphorylated peptides and absorbance of peptides into the cell. Future studies should include a detailed analysis of the mechanism of enzymatic derived peptides and in cell t ransfer mechanism. The highest potency for ACE inhibition was measured for CEM high, followed by CEM low, trypsin elastase and chymotrypsin. These results seem to be correlated to the degree of hydrolysis and confirm that higher degrees of hydrolysis gener ate smaller peptides with higher ACE inhibitory activities. Di and tri peptides are believed to be the key in ACE inhibition and it stays to reason that a high degree of hydrolysis, such as achieved by CEM high, should generate many such peptides and ther efore show higher ACE inhibitory activity. However the complexity of the peptides mixtures, generated in this study were too high, to conduct any reasonable mass spectrometry analysis without further fractionation or purification of those peptides mixtures Future studies should therefore focus on further fractionation and purification of potent peptides, followed by peptide characterization by mass spectrometry. It is further suggested that for any model system used, the entire protein sequence should be d etermined in advance to increase the probability of peptide identification and enhance mass spectrometry data analysis. Since the intended use of peptides, derived by enzymatic hydrolysis, is to enhance food stability and quality as well as provide health benefits to the consumer, sensory studies are advisable to determine consumer acceptance of products containing such peptides. As described earlier, a study by Pripp

PAGE 123

123 and Ardo (2007) determined that an in crease in ACE inhibitory effects was correlated to an increase in bitterness (also correlated to decrease in peptides size). Other sensory challenges, faced particularly with marine proteins, are the fishy odor and taste present in seafood derived proteins and peptides. Although no fishy odor was perceived from peptides, generated in this study, this needs to be confirmed by sensory panel analysis. Finally in vivo analysis should be performed for the most potent peptides generated in this and follow studie s to determine the bioavailability and bioactivity in and animal or human studies.

PAGE 124

124 APPENDIX A CELLULAR ANTIOXIDANT ASSAY Figure A 1 Cellular Antioxidant Assay (CAA) results for chymotrypsin digested myosin The increase in fluorescence in the presenc e of the AAPH radical initiator was monitored over time. The control represents the uninhibited reaction with no radical scavenging effect. Lower fluorescence value s, compared to the control represent antioxidant activity in the form of AAPH radical scavenging in live HepG2 cells. 0 10000 20000 30000 40000 50000 60000 70000 0 10 20 30 40 50 60 70 80 90 100 110 120 Fluoresence Incubation time (min) Blank 0,5 mg protein/mL 0,25 mg protein/mL 0,1 mg protein/mL 50 M Trolox Control

PAGE 125

125 Figure A 2 Cellular Antioxidant Assay (CAA) results for trypsin digested myosin The increase in fluorescence in the presence of the AAPH radical initiator was monitored over time. The control r epresents the uninhibited reaction with no radical scavenging effect Lower fluorescence values, compared to the control, represent antioxidant activity in the form of AAPH radical scavenging in live HepG2 cells. 0 10000 20000 30000 40000 50000 60000 70000 0 10 20 30 40 50 60 70 80 90 100 110 120 Fluoresence Incubation time (min) Blank 0,5 mg protein/mL 0,25 mg protein/mL 0,1 mg protein/mL 50 M Trolox Control

PAGE 126

126 Figure A 3 Cellular Antioxidant Assay ( CAA) results for elastase digested myosin The increase in fluorescence in the presence of the AAPH radical initiator was monitored over time. The control represents the uninhibited reaction with no radical scavenging effect. Lower fluorescence values, com pared to the control, represent antioxidant activity in the form of AAPH radical scavenging in live HepG2 cells. 0 10000 20000 30000 40000 50000 60000 70000 0 10 20 30 40 50 60 70 80 90 100 110 120 Fluoresence Incubation time (min) Blank 0,5 mg protein/mL 0,25 mg protein/mL 0,1 mg protein/mL 50 M Trolox Control

PAGE 127

127 Figure A 4 Cellular Antioxidant Assay (CAA) results for CEM high digested myosin The increase in fluorescence in the presence of the AAPH radical initiator was monitored over time. The control represents the uninhibited reaction with no radical scavenging effect. Lower fluorescence values, compared to the control, represent antioxidant activity in the form of AAPH radical scavenging in live HepG2 cells. 0 10000 20000 30000 40000 50000 60000 0 10 20 30 40 50 60 70 80 90 100 110 120 Fluoresence Incubation time (min) Blank 0,5 mg protein/mL 0,25 mg protein/mL 0,1 mg protein/mL 50 M Trolox Control

PAGE 128

128 Figure A 5 Cellular Antioxidant Assay (CAA) results for CEM low digested myosin The increase in fluorescence in the presence of the AAPH radical initiator was monitored over time. The control represents the uninhibited reaction with no ra dical scavenging effect. Lower fluorescence values, compared to the control, represent antioxidant activity in the form of AAPH radical scavenging in live HepG2 cells. 0 10000 20000 30000 40000 50000 60000 0 10 20 30 40 50 60 70 80 90 100 110 120 Fluoresence Incubation time (min) Blank 0,5 mg protein/mL 0,25 mg protein/mL 0,1 mg protein/mL 50 M Trolox Control

PAGE 129

129 Figure A 6 Cellular Antioxidant Assay (CAA) results for Trolox standards The increa se in fluorescence in the presence of the AAPH radical initiator was monitored over time. The control represents the uninhibited reaction with no radical scavenging effect. Lower fluorescence values, compared to the control, represent antioxidant activity in the form of AAPH radical scavenging in live HepG2 cells. 0 10000 20000 30000 40000 50000 60000 70000 0 10 20 30 40 50 60 70 80 90 100 110 120 Fluoresence Incubation time (min) Blank 150 M Trolox 100 M Trolox 50 M Trolox Control

PAGE 130

130 APPENDIX B PROTEOME DISCOVERY R ESULTS FOR CHYMOTRYP SIN Database s earch s ummary r eport (generated by PD software) Search report summary of file(s): C: \ Users \ Owner \ Documents \ Stephan_Data \ CT.msf Created with Discoverer version: 1.3.0.339 ================================================================== Number of filtered/unfiltered result items: 8/10 protein group(s) 64/64 merged protein(s) 15/15 peptide(s) 23/23 PSM(s) 3763/3 763 search input(s) ================================================================== Peptide Grouping Options Show peptide groups: True Group peptides by: Mass and Sequence Protein Grouping Options Enable protein grouping: True Consider l eucine and isoleucine as equal: True Consider only PSMs with confidence at least: Medium Consider only PSMs with delta Cn better than: 0.15 Apply strict maximum parsimony principle: True Data reduction filters: Peptide Confidence (Minimum con fidence: High) No result filters applied ================================================================== Summary of file C: \ Users \ Owner \ Documents \ Stephan_Data \ CT.msf Workflow created with Discoverer version: 1.3.0.339 (DBVersion:78) ==================== ============================================== Search name: CT Search description: danre database, oxi and phos is dynamic Search date: 06/23/2011 18:56:13 ================================================================== The pipeline tree: -----------------| (0) Spectrum Files | (1) Spectrum Selector | (2) SEQUEST | (3) Peptide Validator -----------------------------------------------------------------------------Processing node 0: Spectrum Files ----------------------------------------------------------------------------Input Data: ----------------------------File Name(s): C: \ Users \ Owner \ Documents \ Stephan_Data \ CT.RAW

PAGE 131

131 -----------------------------------------------------------------------------Processing node 1 : Spectrum Selector -----------------------------------------------------------------------------1. General Settings: ----------------------------Precursor Selection: Use MS1 Precursor Use New Precursor Reevaluation: True 2. Spectrum Properties Filte r: ----------------------------Lower RT Limit: 0 Upper RT Limit: 0 First Scan: 0 Last Scan: 0 Lowest Charge State: 0 Highest Charge State: 0 Min. Precursor Mass: 350 Da Max. Precursor Mass: 5000 Da Total Intensity Threshold: 0 Minimum Peak Count: 1 3. Scan Event Filters: ----------------------------MS Order: Is MS2 Scan Type: Is Full 4. Peak Filters: ----------------------------S/N Threshold (FT only): 1.5 5. Replacements for Unrecognized Properties: ----------------------------Unr ecognized Charge Replacements: Automatic Unrecognized Mass Analyzer Replacements: ITMS Unrecognized MS Order Replacements: MS2 Unrecognized Activation Type Replacements: CID Unrecognized Polarity Replacements: + 6. Just for Testing: ---------------------------Precursor Clipping Range Before: 2.5 Da Precursor Clipping Range After: 5.5 Da -----------------------------------------------------------------------------Processing node 2: SEQUEST ----------------------------------------------------------------------------1. Input Data: ----------------------------Protein Database: ipi.DANRE.v3.82.fasta Enzyme Name: Chymotrypsin(FWY) (Full) Maximum Missed Cleavage Sites: 3 1.1 Peptide Scoring Options:

PAGE 132

132 ----------------------------Maximum Peptides Considered: 500 Maximum Peptides Output: 10 Calculate Probability Scores: False Absolute XCorr Threshold: 0.4 Fragment Ion Cutoff Percentage: 0.1 Peptide Without Protein XCorr Threshold: 1.5 1.2 Protein Scoring Options: ----------------------------Maximum Protein References Per Peptide: 100 Protein Relevance Threshold: 1.5 Peptide Relevance Factor: 0.4 2. Tolerances: ----------------------------Precursor Mass Tolerance: 10 ppm Fragment Mass Tolerance: 0.8 Da Use Average Precursor Mass: Fals e Use Average Fragment Masses: False 3. Ion Series: ----------------------------Use Neutral Loss a Ions: True Use Neutral Loss b Ions: True Use Neutral Loss y Ions: True Weight of a Ions: 0 Weight of b Ions: 1 Weight of c Ions: 0 Weight of x Ions: 0 Weight of y Ions: 1 Weight of z Ions: 0 4. Dynamic Modifications: ----------------------------Max. Modifications Per Peptide: 4 1. Dynamic Modification: Oxidation / +15.995 Da (M) 2. Dynamic Modification: Phospho / +79.966 Da (S, T, Y) ----------------------------------------------------------------------------Processing node 3: Peptide Validator -----------------------------------------------------------------------------1. Decoy Database Search: ----------------------------Search Against Decoy Database: True Target FDR (Strict): 0.01 Target FDR (Relaxed): 0.05 ================================================================== Further information: SEQUEST (2): Number of sequences searched: 41893

PAGE 133

133 ====================================== ============================ Processing details: 06/23/2011 07:14 PM (2):SEQUEST: Total search time was 7 min 51 s. 06/23/2011 07:14 PM (2):SEQUEST: Search completed 06/23/2011 07:14 PM (2):SEQUEST: Protein grouping (1264 groups) took: 1.41 s 06/23/2011 0 7:14 PM (2):SEQUEST: 1763 protein(s) + 1750 decoy proteins scored and inserted into result file in 6.2 s 06/23/2011 07:14 PM (2):SEQUEST: 1763 protein(s) scored 06/23/2011 07:14 PM (2):SEQUEST: Result finalization started 06/23/2011 07:14 PM (3):Peptide Va lidator: Start calculating relaxed False Discovery Rate 06/23/2011 07:14 PM (3):Peptide Validator: Start calculating strict False Discovery Rate 06/23/2011 07:14 PM (3):Peptide Validator: Evaluating peptides of SEQUEST (2) started 06/23/2011 07:14 PM (2):SEQUEST: Sending 763 decoy peptide hits (3813 peptides) to result file 06/23/2011 07:13 PM (2):SEQUEST: Starting SEQUEST decoy search 06/23/2011 07:13 PM (2):SEQUEST: Sending 763 peptide hits (3820 peptides) to result file 06/23/2011 07:13 PM (2):SEQUE ST: Starting SEQUEST search 06/23/2011 07:13 PM (2):SEQUEST: Receiving spectra 3001 to 3764. 06/23/2011 07:13 PM (2):SEQUEST: Sending 1000 decoy peptide hits (6705 peptides) to result file 06/23/2011 07:12 PM (2):SEQUEST: Starting SEQUEST decoy search 06/2 3/2011 07:12 PM (2):SEQUEST: Sending 1000 peptide hits (6703 peptides) to result file 06/23/2011 07:11 PM (2):SEQUEST: Starting SEQUEST search 06/23/2011 07:11 PM (2):SEQUEST: Receiving spectra 2001 to 3001. 06/23/2011 07:11 PM (2):SEQUEST: Sending 1000 de coy peptide hits (9207 peptides) to result file 06/23/2011 07:09 PM (2):SEQUEST: Starting SEQUEST decoy search 06/23/2011 07:09 PM (2):SEQUEST: Sending 1000 peptide hits (9205 peptides) to result file 06/23/2011 07:08 PM (2):SEQUEST: Starting SEQUEST searc h 06/23/2011 07:08 PM (2):SEQUEST: Receiving spectra 1001 to 2001. 06/23/2011 07:07 PM (2):SEQUEST: Sending 1000 decoy peptide hits (4761 peptides) to result file 06/23/2011 07:07 PM (2):SEQUEST: Starting SEQUEST decoy search 06/23/2011 07:07 PM (2):SEQUES T: Sending 1000 peptide hits (4741 peptides) to result file 06/23/2011 07:06 PM (2):SEQUEST: Starting SEQUEST search 06/23/2011 07:06 PM (2):SEQUEST: There is already an adequate decoy FASTA index.

PAGE 134

134 06/23/2011 07:06 PM (2):SEQUEST: Looking for existing deco y FASTA index. 06/23/2011 07:06 PM (2):SEQUEST: There is already an adequate target FASTA index. 06/23/2011 07:06 PM (2):SEQUEST: Looking for existing target FASTA index. 06/23/2011 07:06 PM (2):SEQUEST: Receiving spectra 1 to 1001. 06/23/2011 07:06 PM (1) :Spectrum Selector: Reading from File 1 of 1:C: \ Users \ Owner \ Documents \ Stephan_Data \ CT.RAW (4563 spectra total)

PAGE 135

135 Protein and p eptide results for c hymotrypsin digested m yosin generated by Proteome Discovery s oftware Accession Description Score Coverage # Proteins # Unique Peptides # PSMs # AAs MW [kDa] calc. pI IPI00488085.2 Myosin, light polypeptide 2, skeletal muscle 19.58 8.88 3 3 8 169 18.9 4.73 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High SMFEQSQIQEYKEAF 6 2 1 0.0000 2.74 0.00 2 1864.84355 0.69 31.79 2 High EQSQIQEYKEAF 1 3 1 0.0000 2.55 0.00 2 1499.70134 0.02 28.97 1 High EQSQIQEY 1 3 1 0.0000 1.91 0.00 1 1024.45911 0.88 14.26 0 IPI00504207.1 Skeletal alpha1 actin 8.20 6.37 14 2 3 377 41.9 5.39 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High ELPDGQVITIGNERF 2 14 1 0.0000 3.11 0.00 2 1687.87175 3.96 23.35 0 High ETFNVPAMY 1 9 1 0.0000 2.11 0.00 1 1071.48254 0.88 22.39 1 IPI00975366.2 myosin heavy chain, fast skeletal muscle like 7.65 2.27 35 3 3 1410 161.1 6.58 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High LDKNKDPLNDSVVQLY 1 5 1 0.0000 2.98 0.00 2 1860.96770 1.37 20.61 0 High LLEKSRVTF 1 29 1 0.0000 2.79 0.00 2 1092.64092 0.28 15.72 0 High VLEQEEY 1 33 1 0.0000 1.88 0.00 1 909.41901 1.13 14.95 0 IPI00497753.5 Glyceraldehyde 3 phosphate dehydrogenase 4.45 6.61 2 1 1 333 35.8 8.12 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High RVPTPNVSVVDLTVRLEKPAKY 1 2 1 0.0000 4.45 0.00 4 2481.42177 1.17 21.96 0 IPI005 16071.1 Creatine kinase, brain 3.80 9.94 4 1 1 171 19.6 4.86 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High TLDDVIQTGVDNPGHPF 1 4 1 0.0000 3.80 0.00 2 1824.87737 0.56 22.38 0 IPI004 83373.1 Adenosine monophosphate deaminase 1 3.63 2.23 1 1 1 717 82.9 6.83 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High NAKYNPVGASELRDLY 1 1 1 0.0000 3.63 0.00 2 1809.91374 0.38 20.09 1 IPI009 98694.1 Uncharacterized protein 2.97 4.13 1 1 2 606 69.0 5.36 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages

PAGE 136

136 High TQtTyVKmPNYIPRERsLWIMITIF 2 1 1 T3(Phospho); Y5(Phospho); M8(Oxidation); S17(Phospho) 0.0000 2.97 0.00 3 3357.49839 8.08 20.40 3 IPI 00920244.1 Uncharacterized protein 2.93 5.68 1 1 2 511 56.2 7.15 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High NNIFSIVPAIMmGVSEVAGsFEIIIVARF 2 1 1 M12(Oxidation); S20(Phospho) 0.0000 2.93 0.00 3 3220.64829 9.16 25.92 2

PAGE 137

137 APPENDIX C PROTEOME DISCOVERY R ESULTS FOR TRYPSIN Database s earch s ummary r eport (generated by PD software) Search report summary of file(s): C: \ Users \ Owner \ Documents \ Stephan_Data \ TR.msf Created with Discoverer version: 1.3.0.339 ======== ========================================================== Number of filtered/unfiltered result items: 21/23 protein group(s) 129/129 merged protein(s) 93/93 peptide(s) 325/325 PSM(s) 4017/4017 search input(s) ================================================================== Peptide Grouping Options Show peptide groups: True Group peptides by: Mass and Sequence Protein Grouping Options Enable protein grouping: True Consider leucine and isoleucin e as equal: True Consider only PSMs with confidence at least: Medium Consider only PSMs with delta Cn better than: 0.15 Apply strict maximum parsimony principle: True Data reduction filters: Peptide Confidence (Minimum confidence: High) No re sult filters applied ================================================================== Summary of file C: \ Users \ Owner \ Documents \ Stephan_Data \ TR.msf Workflow created with Discoverer version: 1.3.0.339 (DBVersion:78) ======================================== ========================== Search name: TR Search description: danre database, oxi and phos is dynamic Search date: 06/23/2011 18:55:40 ================================================================== The pipeline tree: | (0) Spectrum Files | (1) S pectrum Selector | (2) SEQUEST | (3) Peptide Validator -----------------------------------------------------------------------------Processing node 0: Spectrum Files -----------------------------------------------------------------------------Input Data: ----------------------------File Name(s): C: \ Users \ Owner \ Documents \ Stephan_Data \ TR.RAW ----------------------------------------------------------------------------

PAGE 138

138 Processing node 1: Spectrum Selector -----------------------------------------------------------------------------1. General Settings: ----------------------------Precursor Selection: Use MS1 Precursor Use New Precursor Reevaluation: True 2. Spec trum Properties Filter: ----------------------------Lower RT Limit: 0 Upper RT Limit: 0 First Scan: 0 Last Scan: 0 Lowest Charge State: 0 Highest Charge State: 0 Min. Precursor Mass: 350 Da Max. Precursor Mass: 5000 Da Total Intensity Threshold: 0 Minimum Peak Count: 1 3. Scan Event Filters: ----------------------------MS Order: Is MS2 Scan Type: Is Full 4. Peak Filters: ----------------------------S/N Threshold (FT only): 1.5 5. Replacements for Unrecognized Properties: ----------------------------Unrecognized Charge Replacements: Automatic Unrecognized Mass Analyzer Replacements: ITMS Unrecognized MS Order Replacements: MS2 Unrecognized Activation Type Replacements: CID Unrecognized Polarity Replacements: + 6. Jus t for Testing: ----------------------------Precursor Clipping Range Before: 2.5 Da Precursor Clipping Range After: 5.5 Da -----------------------------------------------------------------------------Processing node 2: SEQUEST ----------------------------------------------------------------------------1. Input Data: ----------------------------Protein Database: ipi.DANRE.v3.82.fasta Enzyme Name: Trypsin (Full) Maximum Missed Cleavage Sites: 3 1.1 Peptide Scoring Options: ----------------------------

PAGE 139

139 Maximum Peptides Considered: 500 Maximum Peptides Output: 10 Calculate Probability Scores: False Absolute XCorr Threshold: 0.4 Fragment Ion Cutoff Percentage: 0.1 Peptide Without Protein XCorr Threshold: 1.5 1.2 Protein Scoring Options: ----------------------------Maximum Protein References Per Peptide: 100 Protein Relevance Threshold: 1.5 Peptide Relevance Factor: 0.4 2. Tolerances: ----------------------------Precursor Mass Tolerance: 10 ppm Fragment Mass Tolera nce: 0.8 Da Use Average Precursor Mass: False Use Average Fragment Masses: False 3. Ion Series: ----------------------------Use Neutral Loss a Ions: True Use Neutral Loss b Ions: True Use Neutral Loss y Ions: True Weight of a Ions: 0 Weight of b I ons: 1 Weight of c Ions: 0 Weight of x Ions: 0 Weight of y Ions: 1 Weight of z Ions: 0 4. Dynamic Modifications: ----------------------------Max. Modifications Per Peptide: 4 1. Dynamic Modification: Oxidation / +15.995 Da (M) 2. Dynamic Modification: Phospho / +79.966 Da (S, T, Y) -----------------------------------------------------------------------------Processing node 3: Peptide Validator -----------------------------------------------------------------------------1. Decoy Databa se Search: ----------------------------Search Against Decoy Database: True Target FDR (Strict): 0.01 Target FDR (Relaxed): 0.05 ================================================================== Further information: SEQUEST (2): Number of sequences searched: 41893 ==================================================================

PAGE 140

140 Processing details: 06/23/2011 07:06 PM (2):SEQUEST: Total search time was 9 min 26 s. 06/23/2011 07:06 PM (2):SEQUEST: Search completed 06/23/2011 07:06 PM (2):SEQUEST: Pr otein grouping (2233 groups) took: 6.73 s 06/23/2011 07:06 PM (2):SEQUEST: 3315 protein(s) + 3143 decoy proteins scored and inserted into result file in 14.89 s 06/23/2011 07:06 PM (2):SEQUEST: 3315 protein(s) scored 06/23/2011 07:05 PM (2):SEQUEST: Resul t finalization started 06/23/2011 07:05 PM (3):Peptide Validator: Start calculating relaxed False Discovery Rate 06/23/2011 07:05 PM (3):Peptide Validator: Start calculating strict False Discovery Rate 06/23/2011 07:05 PM (3):Peptide Validator: Evaluating peptides of SEQUEST (2) started 06/23/2011 07:05 PM (2):SEQUEST: Sending 17 decoy peptide hits (48 peptides) to result file 06/23/2011 07:05 PM (2):SEQUEST: Starting SEQUEST decoy search 06/23/2011 07:05 PM (2):SEQUEST: Sending 17 peptide hits (45 peptides ) to result file 06/23/2011 07:05 PM (2):SEQUEST: Starting SEQUEST search 06/23/2011 07:05 PM (2):SEQUEST: Receiving spectra 4001 to 4018. 06/23/2011 07:05 PM (2):SEQUEST: Sending 1000 decoy peptide hits (5856 peptides) to result file 06/23/2011 07:04 PM (2):SEQUEST: Starting SEQUEST decoy search 06/23/2011 07:04 PM (2):SEQUEST: Sending 1000 peptide hits (5833 peptides) to result file 06/23/2011 07:04 PM (2):SEQUEST: Starting SEQUEST search 06/23/2011 07:04 PM (2):SEQUEST: Receiving spectra 3001 to 4001. 0 6/23/2011 07:04 PM (2):SEQUEST: Sending 1000 decoy peptide hits (8840 peptides) to result file 06/23/2011 07:03 PM (2):SEQUEST: Starting SEQUEST decoy search 06/23/2011 07:03 PM (2):SEQUEST: Sending 1000 peptide hits (8835 peptides) to result file 06/23/20 11 07:02 PM (2):SEQUEST: Starting SEQUEST search 06/23/2011 07:02 PM (2):SEQUEST: Receiving spectra 2001 to 3001. 06/23/2011 07:02 PM (2):SEQUEST: Sending 1000 decoy peptide hits (9754 peptides) to result file 06/23/2011 07:00 PM (2):SEQUEST: Starting SEQU EST decoy search 06/23/2011 07:00 PM (2):SEQUEST: Sending 1000 peptide hits (9746 peptides) to result file 06/23/2011 06:59 PM (2):SEQUEST: Starting SEQUEST search 06/23/2011 06:59 PM (2):SEQUEST: Receiving spectra 1001 to 2001. 06/23/2011 06:59 PM (2):SEQ UEST: Sending 1000 decoy peptide hits (4452 peptides) to result file 06/23/2011 06:57 PM (2):SEQUEST: Starting SEQUEST decoy search

PAGE 141

141 06/23/2011 06:57 PM (2):SEQUEST: Sending 1000 peptide hits (4378 peptides) to result file 06/23/2011 06:55 PM (2):SEQUEST: S tarting SEQUEST search 06/23/2011 06:55 PM (2):SEQUEST: There is already an adequate decoy FASTA index. 06/23/2011 06:55 PM (2):SEQUEST: Looking for existing decoy FASTA index. 06/23/2011 06:55 PM (2):SEQUEST: There is already an adequate target FASTA inde x. 06/23/2011 06:55 PM (2):SEQUEST: Looking for existing target FASTA index. 06/23/2011 06:55 PM (2):SEQUEST: Receiving spectra 1 to 1001. 06/23/2011 06:55 PM (1):Spectrum Selector: Reading from File 1 of 1:C: \ Users \ Owner \ Documents \ Stephan_Data \ TR.RAW (459 8 spectra total)

PAGE 142

142 Protein and p eptide results for t rypsin digested m yosin generated by Proteome Discovery s oftware Accession Description Score Coverage # Proteins # Unique Peptides # PSMs # AAs MW [kDa] calc. pI IPI 00503572.3 myosin, heavy polypeptide 1.1, skeletal muscle 771.63 21.17 18 2 199 1937 222.0 5.67 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High KMEGDLNEMEIQLSHANR 6 14 4 0.0000 6.39 0.00 2 2114.99809 1.06 19.06 1 High KAITDAAMMAEELKK 23 26 7 0.0000 6.13 0.00 3 1649.86081 0.37 16.94 2 High KKMEGDLNEMEIQLSHANR 16 14 4 0.0000 6.06 0.00 3 2243.09067 0.07 17.09 2 High DLEESTLQHEATAAALR 1 12 4 0.0000 6.00 0.00 2 1854.91863 0.35 19.56 0 High TKLEQQVDDLEGSLEQEKKLR 2 8 3 0.0000 5.61 0.00 3 2486.30655 1.30 21.31 3 High KmEGDLNEMEIQLSHANR 4 14 4 M2(Oxidation) 0.0000 5.53 0.00 3 2130.99002 0.35 17.56 1 High KKQADSVAELGEQIDNLQR 7 14 5 0.0000 5.27 0.00 3 2142.11808 1.42 18.87 2 High RDLEESTLQHEATAAALR 3 12 4 0.0000 5.21 0.00 2 2011.02190 0.74 17.25 1 High QADSVAELGEQIDNLQR 3 14 5 0.0000 5.13 0.00 3 1885.92643 0.70 22.26 0 High EQFEEEQEAKAELQR 1 12 5 0.0000 5.10 0.00 2 1863.87004 1.05 16.36 1 High KAITDAAmMAEELKK 4 26 7 M8(Oxidation) 0.0000 5.09 0.00 3 1665.85453 0.35 16.71 2 High AITDAAMMAEELKK 2 26 7 0.0000 4.99 0.00 2 1521.76567 0.29 18.57 1 High MEGDLNEMEIQLSHANR 12 14 4 0.0000 4.96 0.00 2 1986.90093 0.02 20.60 0 High EKSEYKMEIDDLSSNmEAVAK 1 11 4 M16(Oxidation) 0.0000 4.78 0.00 3 2433.11716 0.43 21.05 2 High LQEAEEQIEAVNSK 13 7 3 0.0000 4.76 0.00 2 1587.78459 0.97 25.97 0 High QLEEKEALVSQLTR 3 9 4 0.0000 4.62 0.00 3 1643.89469 1.01 17.36 1 High IEDEQSLGAQLQKK 1 10 4 0.0000 4.60 0.00 2 1586.83782 0.43 14.91 1 High TKLEQQVDDLEGSLEQEK 1 8 3 0.0000 4.60 0.00 3 2089.02756 0.99 21.99 1 High KVQHELEEAEER 2 11 3 0.0000 4.53 0.00 3 1496.73319 0.56 12.10 1 High KQADSVAELGEQIDNLQR 3 14 5 0.0000 4.53 0.00 3 2014.01932 0.37 20.72 1 High TPGLMENFLVIHQLR 2 16 4 0.0000 4.43 0.00 2 1767.95696 0.32 25.10 0 High VKELTYQTEEDKK 2 15 4 0.0000 4.42 0.00 3 1610.82694 0.19 12.38 2 High IEDEQSLGAQLQK 1 10 4 0.0000 4.40 0.00 2 1458.74199 1.06 15.83 0 High NLQQEISDLTEQLGETGK 1 12 4 0.0000 4.34 0.00 2 2002.99089 0.97 27.01 0 High KVAEQELVDASER 3 14 4 0.0000 4.27 0.00 2 1473.75456 0.08 14.24 1 High SEYKMEIDDLSSNmEAVAK 2 11 4 M14(Oxidation) 0.0000 4.27 0.00 2 2175.97905 0.24 21.67 1 High DLEESTLQHEATAAALRK 1 12 4 0.0000 4.22 0.00 3 1983.01480 0.28 18.03 1 High KGGSMQTVSSQFR 2 11 3 0.0000 4.17 0.00 2 1412.69414 0.71 14.06 1 High IEELEEEIEAERAAR 1 22 6 0.0000 4.13 0.00 2 1786.88127 0.32 18.44 1

PAGE 143

143 High KDFETSQLLSK 1 5 2 0.0000 4.08 0.00 2 1295.68401 0.16 15.28 1 High LEQQVDDLEGSLEQEKK 1 25 7 0.0000 3.99 0.00 3 1987.98301 0.53 18.21 1 High NLTEEmAAQDESIGKLTK 1 4 1 M6(Oxidation) 0.0000 3.94 0.00 2 1993.97551 0.37 19.31 1 High KDIDDLELTLAK 1 27 7 0.0000 3.87 0.00 2 1373.75383 1.11 19.01 1 High MEGDLNEmEIQLSHANR 1 14 4 M8(Oxidation) 0.0000 3.85 0.00 3 2002.89658 0.39 16.54 0 High KKDFETSQLLSK 1 5 2 0.0000 3.83 0.00 2 1423.77947 0.20 14.25 2 High FTGAVLHHGNMK 1 12 3 0.0000 3.80 0.00 2 1311.66155 0.89 13.25 0 High IEELEEEIEAER 1 22 6 0.0000 3.77 0.00 2 1488.70635 0.10 19.27 0 High LQDLVDKLQLK 17 25 6 0.0000 3.65 0.00 2 1312.78215 1.06 37.60 1 High VLNASVIPEGQFIDNK 1 16 4 0.0000 3.60 0.00 2 1743.92778 0.07 21.41 0 High VQHELEEAEER 2 11 3 0.0000 3.55 0.00 2 1368.63823 0.61 12.92 0 High ADLSRELEEISER 1 19 4 0.0000 3.55 0.00 3 1546.77298 1.40 20.92 1 High DAQLHLDDAVR 5 9 3 0.0000 3.49 0.00 2 1252.62871 0.49 15.26 0 High TKLEQQVDDLEGSLEQEKK 2 8 3 0.0000 3.36 0.00 4 2217.12490 0.13 20.84 2 High MEIDDLSSNmEAVAK 3 11 4 M10(Oxidation) 0.0000 3.35 0.00 2 1668.74529 0.20 50.43 0 High TLEDQLSEIK 2 8 3 0.0000 3.32 0.00 2 1175.61357 1.61 18.53 0 High GGSMQTVSSQFR 3 11 3 0.0000 3.27 0.00 2 1284.59941 0.59 14.97 0 High AGLLGTLEEMR 11 28 5 0.0000 3.24 0.00 2 1189.62444 0.15 37.34 0 High DLQHRLDEAENLAMK 3 14 4 0.0000 3.22 0.00 2 1782.88249 1.17 20.12 1 High VAEQELVDASER 1 14 4 0.0000 3.19 0.00 2 1345.65996 0.36 15.02 0 High LDEAENLAmK 1 14 4 M9(Oxidation) 0.0000 3.15 0.00 2 1149.54521 0.41 13.76 0 High GGSmQTVSSQFR 2 11 3 M4(Oxidation) 0.0000 3.14 0.00 2 1300.59416 0.71 13.53 0 High DFETSQLLSK 5 5 2 0.0000 3.13 0.00 2 1167.58953 0.24 18.02 0 High NLTEEmAAQDESIGK 1 4 1 M6(Oxidation) 0.0000 3.11 0.00 2 1651.74919 0.69 16.17 0 High EALVSQLTR 2 10 4 0.0000 3.07 0.00 2 1016.57408 0.54 16.01 0 High ELTYQTEEDKK 1 15 4 0.0000 3.02 0.00 2 1383.66326 0.44 12.30 1 High AITDAAMmAEELKK 3 26 7 M8(Oxidation) 0.0000 3.00 0.00 2 1537.75969 0.30 16.17 1 High LDEAENLAMK 2 14 4 0.0000 2.42 0.00 1 1133.55103 0.22 14.81 0 IPI00500057.4 myosin heavy chain, fast skeletal muscle 768.21 20.90 15 1 198 1933 222.1 5.67 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High KMEGDLNEMEIQLSHANR 6 14 4 0.0000 6.39 0.00 2 2114.99809 1.06 19.06 1 High KAITDAAMMAEELKK 23 26 7 0.0000 6.13 0.00 3 1649.86081 0.37 16.94 2 High KKMEGDLNEMEIQLSHANR 16 14 4 0.0000 6.06 0.00 3 2243.09067 0.07 17.09 2 High DLEESTLQHEATAAALR 1 12 4 0.0000 6.00 0.00 2 1854.91863 0.35 19.56 0

PAGE 144

144 High TKLEQQVDDLEGSLEQEKKLR 2 8 3 0.0000 5.61 0.00 3 2486.30655 1.30 21.31 3 High KmEGDLNEMEIQLSHANR 4 14 4 M2(Oxidation) 0.0000 5.53 0.00 3 2130.99002 0.35 17.56 1 High KKQADSVAELGEQIDNLQR 7 14 5 0.0000 5.27 0.00 3 2142.11808 1.42 18.87 2 High RDLEESTLQHEATAAALR 3 12 4 0.0000 5.21 0.00 2 2011.02190 0.74 17.25 1 High QADSVAELGEQIDNLQR 3 14 5 0.0000 5.13 0.00 3 1885.92643 0.70 22.26 0 High EQFEEEQEAKAELQR 1 12 5 0.0000 5.10 0.00 2 1863.87004 1.05 16.36 1 High KAITDAAmMAEELKK 4 26 7 M8(Oxidation) 0.0000 5.09 0.00 3 1665.85453 0.35 16.71 2 High AITDAAMMAEELKK 2 26 7 0.0000 4.99 0.00 2 1521.76567 0.29 18.57 1 High MEGDLNEMEIQLSHANR 12 14 4 0.0000 4.96 0.00 2 1986.90093 0.02 20.60 0 High EKSEYKMEIDDLSSNmEAVAK 1 11 4 M16(Oxidation) 0.0000 4.78 0.00 3 2433.11716 0.43 21.05 2 High LQEAEEQIEAVNSK 13 7 3 0.0000 4.76 0.00 2 1587.78459 0.97 25.97 0 High QLEEKEALVSQLTR 3 9 4 0.0000 4.62 0.00 3 1643.89469 1.01 17.36 1 High IEDEQSLGAQLQKK 1 10 4 0.0000 4.60 0.00 2 1586.83782 0.43 14.91 1 High TKLEQQVDDLEGSLEQEK 1 8 3 0.0000 4.60 0.00 3 2089.02756 0.99 21.99 1 High KVQHELEEAEER 2 11 3 0.0000 4.53 0.00 3 1496.73319 0.56 12.10 1 High KQADSVAELGEQIDNLQR 3 14 5 0.0000 4.53 0.00 3 2014.01932 0.37 20.72 1 High TPGLMENFLVIHQLR 2 16 4 0.0000 4.43 0.00 2 1767.95696 0.32 25.10 0 High VKELTYQTEEDKK 2 15 4 0.0000 4.42 0.00 3 1610.82694 0.19 12.38 2 High IEDEQSLGAQLQK 1 10 4 0.0000 4.40 0.00 2 1458.74199 1.06 15.83 0 High NLQQEISDLTEQIGETGK 1 12 4 0.0000 4.34 0.00 2 2002.99089 0.97 27.01 0 High KVAEQELVDASER 3 14 4 0.0000 4.27 0.00 2 1473.75456 0.08 14.24 1 High SEYKMEIDDLSSNmEAVAK 2 11 4 M14(Oxidation) 0.0000 4.27 0.00 2 2175.97905 0.24 21.67 1 High DLEESTLQHEATAAALRK 1 12 4 0.0000 4.22 0.00 3 1983.01480 0.28 18.03 1 High KGGSMQTVSSQFR 2 11 3 0.0000 4.17 0.00 2 1412.69414 0.71 14.06 1 High IEELEEEIEAERAAR 1 22 6 0.0000 4.13 0.00 2 1786.88127 0.32 18.44 1 High KDFETSQLLSK 1 5 2 0.0000 4.08 0.00 2 1295.68401 0.16 15.28 1 High LEQQVDDLEGSLEQEKK 1 25 7 0.0000 3.99 0.00 3 1987.98301 0.53 18.21 1 High KDIDDLELTLAK 1 27 7 0.0000 3.87 0.00 2 1373.75383 1.11 19.01 1 High MEGDLNEmEIQLSHANR 1 14 4 M8(Oxidation) 0.0000 3.85 0.00 3 2002.89658 0.39 16.54 0 High KKDFETSQLLSK 1 5 2 0.0000 3.83 0.00 2 1423.77947 0.20 14.25 2 High FTGAVLHHGNMK 1 12 3 0.0000 3.80 0.00 2 1311.66155 0.89 13.25 0 High IEELEEEIEAER 1 22 6 0.0000 3.77 0.00 2 1488.70635 0.10 19.27 0 High LQDLVDKLQLK 17 25 6 0.0000 3.65 0.00 2 1312.78215 1.06 37.60 1 High SAETEKELANMK 1 1 1 0.0000 3.62 0.00 2 1350.65618 0.63 13.76 1 High VLNASVIPEGQFIDNK 1 16 4 0.0000 3.60 0.00 2 1743.92778 0.07 21.41 0

PAGE 145

145 High VQHELEEAEER 2 11 3 0.0000 3.55 0.00 2 1368.63823 0.61 12.92 0 High ADLSRELEEISER 1 19 4 0.0000 3.55 0.00 3 1546.77298 1.40 20.92 1 High DAQLHLDDAVR 5 9 3 0.0000 3.49 0.00 2 1252.62871 0.49 15.26 0 High TKLEQQVDDLEGSLEQEKK 2 8 3 0.0000 3.36 0.00 4 2217.12490 0.13 20.84 2 High MEIDDLSSNmEAVAK 3 11 4 M10(Oxidation) 0.0000 3.35 0.00 2 1668.74529 0.20 50.43 0 High TLEDQLSEIK 2 8 3 0.0000 3.32 0.00 2 1175.61357 1.61 18.53 0 High GGSMQTVSSQFR 3 11 3 0.0000 3.27 0.00 2 1284.59941 0.59 14.97 0 High AGLLGTLEEMR 11 28 5 0.0000 3.24 0.00 2 1189.62444 0.15 37.34 0 High DLQHRLDEAENLAMK 3 14 4 0.0000 3.22 0.00 2 1782.88249 1.17 20.12 1 High VAEQELVDASER 1 14 4 0.0000 3.19 0.00 2 1345.65996 0.36 15.02 0 High LDEAENLAmK 1 14 4 M9(Oxidation) 0.0000 3.15 0.00 2 1149.54521 0.41 13.76 0 High GGSmQTVSSQFR 2 11 3 M4(Oxidation) 0.0000 3.14 0.00 2 1300.59416 0.71 13.53 0 High DFETSQLLSK 5 5 2 0.0000 3.13 0.00 2 1167.58953 0.24 18.02 0 High EALVSQLTR 2 10 4 0.0000 3.07 0.00 2 1016.57408 0.54 16.01 0 High ELTYQTEEDKK 1 15 4 0.0000 3.02 0.00 2 1383.66326 0.44 12.30 1 High AITDAAMmAEELKK 3 26 7 M8(Oxidation) 0.0000 3.00 0.00 2 1537.75969 0.30 16.17 1 High LDEAENLAMK 2 14 4 0.0000 2.42 0.00 1 1133.55103 0.22 14.81 0 IPI00933204.1 Myosin, heavy polypeptide 2, fast muscle specific 761.94 19.84 15 3 194 1935 221.7 5.69 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High KMEGDLNEMEIQLSHANR 6 14 4 0.0000 6.39 0.00 2 2114.99809 1.06 19.06 1 High KAITDAAMMAEELKK 23 26 7 0.0000 6.13 0.00 3 1649.86081 0.37 16.94 2 High KKMEGDLNEMEIQLSHANR 16 14 4 0.0000 6.06 0.00 3 2243.09067 0.07 17.09 2 High DLEESTLQHEATAAALR 1 12 4 0.0000 6.00 0.00 2 1854.91863 0.35 19.56 0 High TKLEQQVDDLEGSLEQEKKLR 2 8 3 0.0000 5.61 0.00 3 2486.30655 1.30 21.31 3 High KmEGDLNEMEIQLSHANR 4 14 4 M2(Oxidation) 0.0000 5.53 0.00 3 2130.99002 0.35 17.56 1 High KKQADSVAELGEQIDNLQR 7 14 5 0.0000 5.27 0.00 3 2142.11808 1.42 18.87 2 High RDLEESTLQHEATAAALR 3 12 4 0.0000 5.21 0.00 2 2011.02190 0.74 17.25 1 High QADSVAELGEQIDNLQR 3 14 5 0.0000 5.13 0.00 3 1885.92643 0.70 22.26 0 High EQFEEEQEAKAELQR 1 12 5 0.0000 5.10 0.00 2 1863.87004 1.05 16.36 1 High KAITDAAmMAEELKK 4 26 7 M8(Oxidation) 0.0000 5.09 0.00 3 1665.85453 0.35 16.71 2 High KLAEKDEEmEQIKR 1 1 1 M9(Oxidation) 0.0000 5.02 0.00 3 1762.89896 0.86 13.05 3 High AITDAAMMAEELKK 2 26 7 0.0000 4.99 0.00 2 1521.76567 0.29 18.57 1 High MEGDLNEMEIQLSHANR 12 14 4 0.0000 4.96 0.00 2 1986.90093 0.02 20.60 0

PAGE 146

146 High EKSEYKMEIDDLSSNmEAVAK 1 11 4 M16(Oxidation) 0.0000 4.78 0.00 3 2433.11716 0.43 21.05 2 High LQEAEEQIEAVNSK 13 7 3 0.0000 4.76 0.00 2 1587.78459 0.97 25.97 0 High QLEEKEALVSQLTR 3 9 4 0.0000 4.62 0.00 3 1643.89469 1.01 17.36 1 High IEDEQSLGAQLQKK 1 10 4 0.0000 4.60 0.00 2 1586.83782 0.43 14.91 1 High TKLEQQVDDLEGSLEQEK 1 8 3 0.0000 4.60 0.00 3 2089.02756 0.99 21.99 1 High KLAEKDEEMEQIKR 2 1 1 0.0000 4.60 0.00 3 1746.90525 0.18 13.03 3 High KVQHELEEAEER 2 11 3 0.0000 4.53 0.00 3 1496.73319 0.56 12.10 1 High KQADSVAELGEQIDNLQR 3 14 5 0.0000 4.53 0.00 3 2014.01932 0.37 20.72 1 High TPGLMENFLVIHQLR 2 16 4 0.0000 4.43 0.00 2 1767.95696 0.32 25.10 0 High VKELTYQTEEDKK 2 15 4 0.0000 4.42 0.00 3 1610.82694 0.19 12.38 2 High IEDEQSLGAQLQK 1 10 4 0.0000 4.40 0.00 2 1458.74199 1.06 15.83 0 High NLQQEISDLTEQLGETGK 1 12 4 0.0000 4.34 0.00 2 2002.99089 0.97 27.01 0 High LAEKDEEMEQIKR 2 1 1 0.0000 4.31 0.00 3 1618.81034 0.16 13.51 2 High KVAEQELVDASER 3 14 4 0.0000 4.27 0.00 2 1473.75456 0.08 14.24 1 High SEYKMEIDDLSSNmEAVAK 2 11 4 M14(Oxidation) 0.0000 4.27 0.00 2 2175.97905 0.24 21.67 1 High DLEESTLQHEATAAALRK 1 12 4 0.0000 4.22 0.00 3 1983.01480 0.28 18.03 1 High KGGSMQTVSSQFR 2 11 3 0.0000 4.17 0.00 2 1412.69414 0.71 14.06 1 High IEELEEEIEAERAAR 1 22 6 0.0000 4.13 0.00 2 1786.88127 0.32 18.44 1 High LEQQVDDLEGSLEQEKK 1 25 7 0.0000 3.99 0.00 3 1987.98301 0.53 18.21 1 High KDIDDLELTLAK 1 27 7 0.0000 3.87 0.00 2 1373.75383 1.11 19.01 1 High MEGDLNEmEIQLSHANR 1 14 4 M8(Oxidation) 0.0000 3.85 0.00 3 2002.89658 0.39 16.54 0 High LAEKDEEMEQIK 1 1 1 0.0000 3.84 0.00 3 1462.70771 1.21 13.89 1 High FTGAVLHHGNMK 1 12 3 0.0000 3.80 0.00 2 1311.66155 0.89 13.25 0 High IEELEEEIEAER 1 22 6 0.0000 3.77 0.00 2 1488.70635 0.10 19.27 0 High LQDLVDKLQLK 17 25 6 0.0000 3.65 0.00 2 1312.78215 1.06 37.60 1 High VLNASVIPEGQFIDNK 1 16 4 0.0000 3.60 0.00 2 1743.92778 0.07 21.41 0 High VQHELEEAEER 2 11 3 0.0000 3.55 0.00 2 1368.63823 0.61 12.92 0 High ADLSRELEEISER 1 19 4 0.0000 3.55 0.00 3 1546.77298 1.40 20.92 1 High DAQLHLDDAVR 5 9 3 0.0000 3.49 0.00 2 1252.62871 0.49 15.26 0 High TKLEQQVDDLEGSLEQEKK 2 8 3 0.0000 3.36 0.00 4 2217.12490 0.13 20.84 2 High MEIDDLSSNmEAVAK 3 11 4 M10(Oxidation) 0.0000 3.35 0.00 2 1668.74529 0.20 50.43 0 High GGSMQTVSSQFR 3 11 3 0.0000 3.27 0.00 2 1284.59941 0.59 14.97 0 High AGLLGTLEEMR 11 28 5 0.0000 3.24 0.00 2 1189.62444 0.15 37.34 0 High DLQHRLDEAENLAMK 3 14 4 0.0000 3.22 0.00 2 1782.88249 1.17 20.12 1 High VAEQELVDASER 1 14 4 0.0000 3.19 0.00 2 1345.65996 0.36 15.02 0

PAGE 147

147 High LDEAENLAmK 1 14 4 M9(Oxidation) 0.0000 3.15 0.00 2 1149.54521 0.41 13.76 0 High GGSmQTVSSQFR 2 11 3 M4(Oxidation) 0.0000 3.14 0.00 2 1300.59416 0.71 13.53 0 High EALVSQLTR 2 10 4 0.0000 3.07 0.00 2 1016.57408 0.54 16.01 0 High ELTYQTEEDKK 1 15 4 0.0000 3.02 0.00 2 1383.66326 0.44 12.30 1 High AITDAAMmAEELKK 3 26 7 M8(Oxidation) 0.0000 3.00 0.00 2 1537.75969 0.30 16.17 1 High LDEAENLAMK 2 14 4 0.0000 2.42 0.00 1 1133.55103 0.22 14.81 0 IPI00961738.2 myosin heavy chain, fast skeletal muscle 724.07 17.74 9 2 192 1934 221.3 5.77 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High KMEGDLNEMEIQLSHANR 6 14 4 0.0000 6.39 0.00 2 2114.99809 1.06 19.06 1 High KAITDAAMMAEELKK 23 26 7 0.0000 6.13 0.00 3 1649.86081 0.37 16.94 2 High KKMEGDLNEMEIQLSHANR 16 14 4 0.0000 6.06 0.00 3 2243.09067 0.07 17.09 2 High DLEESTLQHEATAAALR 1 12 4 0.0000 6.00 0.00 2 1854.91863 0.35 19.56 0 High KmEGDLNEMEIQLSHANR 4 14 4 M2(Oxidation) 0.0000 5.53 0.00 3 2130.99002 0.35 17.56 1 High KKQADSVAELGEQIDNLQR 7 14 5 0.0000 5.27 0.00 3 2142.11808 1.42 18.87 2 High RDLEESTLQHEATAAALR 3 12 4 0.0000 5.21 0.00 2 2011.02190 0.74 17.25 1 High QADSVAELGEQIDNLQR 3 14 5 0.0000 5.13 0.00 3 1885.92643 0.70 22.26 0 High EQFEEEQEAKAELQR 1 12 5 0.0000 5.10 0.00 2 1863.87004 1.05 16.36 1 High KAITDAAmMAEELKK 4 26 7 M8(Oxidation) 0.0000 5.09 0.00 3 1665.85453 0.35 16.71 2 High AITDAAMMAEELKK 2 26 7 0.0000 4.99 0.00 2 1521.76567 0.29 18.57 1 High MEGDLNEMEIQLSHANR 12 14 4 0.0000 4.96 0.00 2 1986.90093 0.02 20.60 0 High EKSEYKMEIDDLSSNmEAVAK 1 11 4 M16(Oxidation) 0.0000 4.78 0.00 3 2433.11716 0.43 21.05 2 High QLEEKEALVSQLTR 3 9 4 0.0000 4.62 0.00 3 1643.89469 1.01 17.36 1 High IEDEQSLGAQLQKK 1 10 4 0.0000 4.60 0.00 2 1586.83782 0.43 14.91 1 High NKDPLNDSVVQLYQK 2 5 1 0.0000 4.56 0.00 3 1760.91831 0.29 18.22 1 High KQADSVAELGEQIDNLQR 3 14 5 0.0000 4.53 0.00 3 2014.01932 0.37 20.72 1 High TPGLMENFLVIHQLR 2 16 4 0.0000 4.43 0.00 2 1767.95696 0.32 25.10 0 High VKELTYQTEEDKK 2 15 4 0.0000 4.42 0.00 3 1610.82694 0.19 12.38 2 High IEDEQSLGAQLQK 1 10 4 0.0000 4.40 0.00 2 1458.74199 1.06 15.83 0 High NLQQEISDLTEQLGETGK 1 12 4 0.0000 4.34 0.00 2 2002.99089 0.97 27.01 0 High KVAEQELVDASER 3 14 4 0.0000 4.27 0.00 2 1473.75456 0.08 14.24 1 High SEYKMEIDDLSSNmEAVAK 2 11 4 M14(Oxidation) 0.0000 4.27 0.00 2 2175.97905 0.24 21.67 1 High DLEESTLQHEATAAALRK 1 12 4 0.0000 4.22 0.00 3 1983.01480 0.28 18.03 1 High IEELEEEIEAERAAR 1 22 6 0.0000 4.13 0.00 2 1786.88127 0.32 18.44 1 High LEQQVDDLEGSLEQEKK 1 25 7 0.0000 3.99 0.00 3 1987.98301 0.53 18.21 1

PAGE 148

148 High KDIDDLELTLAK 1 27 7 0.0000 3.87 0.00 2 1373.75383 1.11 19.01 1 High MEGDLNEmEIQLSHANR 1 14 4 M8(Oxidation) 0.0000 3.85 0.00 3 2002.89658 0.39 16.54 0 High IEELEEEIEAER 1 22 6 0.0000 3.77 0.00 2 1488.70635 0.10 19.27 0 High VLDAMQSTLDSEVR 32 1 1 0.0000 3.75 0.00 2 1563.76824 0.09 19.07 0 High LQDLVDKLQLK 17 25 6 0.0000 3.65 0.00 2 1312.78215 1.06 37.60 1 High VLDAmQSTLDSEVR 3 1 1 M5(Oxidation) 0.0000 3.61 0.00 2 1579.76433 0.65 15.72 0 High VLNASVIPEGQFIDNK 1 16 4 0.0000 3.60 0.00 2 1743.92778 0.07 21.41 0 High ADLSRELEEISER 1 19 4 0.0000 3.55 0.00 3 1546.77298 1.40 20.92 1 High MEIDDLSSNmEAVAK 3 11 4 M10(Oxidation) 0.0000 3.35 0.00 2 1668.74529 0.20 50.43 0 High TLEDQLSEIK 2 8 3 0.0000 3.32 0.00 2 1175.61357 1.61 18.53 0 High AGLLGTLEEMR 11 28 5 0.0000 3.24 0.00 2 1189.62444 0.15 37.34 0 High DLQHRLDEAENLAMK 3 14 4 0.0000 3.22 0.00 2 1782.88249 1.17 20.12 1 High VAEQELVDASER 1 14 4 0.0000 3.19 0.00 2 1345.65996 0.36 15.02 0 High LDEAENLAmK 1 14 4 M9(Oxidation) 0.0000 3.15 0.00 2 1149.54521 0.41 13.76 0 High EALVSQLTR 2 10 4 0.0000 3.07 0.00 2 1016.57408 0.54 16.01 0 High ELTYQTEEDKK 1 15 4 0.0000 3.02 0.00 2 1383.66326 0.44 12.30 1 High AITDAAMmAEELKK 3 26 7 M8(Oxidation) 0.0000 3.00 0.00 2 1537.75969 0.30 16.17 1 High LDEAENLAMK 2 14 4 0.0000 2.42 0.00 1 1133.55103 0.22 14.81 0 IPI00882712.1 Ventricular myosin heavy chain 281.58 6.50 3 1 70 1938 223.1 5.73 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High KAITDAAMMAEELKK 23 26 7 0.0000 6.13 0.00 3 1649.86081 0.37 16.94 2 High KKQADSVAELGEQIDNLQR 7 14 5 0.0000 5.27 0.00 3 2142.11808 1.42 18.87 2 High QADSVAELGEQIDNLQR 3 14 5 0.0000 5.13 0.00 3 1885.92643 0.70 22.26 0 High KAITDAAmMAEELKK 4 26 7 M8(Oxidation) 0.0000 5.09 0.00 3 1665.85453 0.35 16.71 2 High AITDAAMMAEELKK 2 26 7 0.0000 4.99 0.00 2 1521.76567 0.29 18.57 1 High KQADSVAELGEQIDNLQR 3 14 5 0.0000 4.53 0.00 3 2014.01932 0.37 20.72 1 High IEELEEELEAERAAR 1 22 6 0.0000 4.13 0.00 2 1786.88127 0.32 18.44 1 High LEQQVDDLEGSLEQEKK 1 25 7 0.0000 3.99 0.00 3 1987.98301 0.53 18.21 1 High KDIDDLELTLAK 1 27 7 0.0000 3.87 0.00 2 1373.75383 1.11 19.01 1 High IEELEEELEAER 1 22 6 0.0000 3.77 0.00 2 1488.70635 0.10 19.27 0 High ALQEAHQQTLDDLQSEEDKVNTLTK 1 11 2 0.0000 3.77 0.00 3 2854.41281 2.18 20.53 1 High KALQEAHQQTLDDLQSEEDKVNTLTK 2 11 2 0.0000 3.71 0.00 4 2982.50112 0.15 19.37 2 High LQDLVDKLQLK 17 25 6 0.0000 3.65 0.00 2 1312.78215 1.06 37.60 1 High AGLLGQLEEMR 1 3 1 0.0000 3.44 0.00 2 1216.63896 2.84 23.18 0

PAGE 149

149 High AITDAAMmAEELKK 3 26 7 M8(Oxidation) 0.0000 3.00 0.00 2 1537.75969 0.30 16.17 1 IPI00490216.3 Myosin, heavy polypeptide 6, cardiac muscle, alpha 265.01 6.97 4 1 71 1936 222.7 5.68 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High KAITDAAMMAEELKK 23 26 7 0.0000 6.13 0.00 3 1649.86081 0.37 16.94 2 High EQFEEEQEAKAELQR 1 12 5 0.0000 5.10 0.00 2 1863.87004 1.05 16.36 1 High KAITDAAmMAEELKK 4 26 7 M8(Oxidation) 0.0000 5.09 0.00 3 1665.85453 0.35 16.71 2 High AITDAAMMAEELKK 2 26 7 0.0000 4.99 0.00 2 1521.76567 0.29 18.57 1 High LEQQVDDLEGSLEQEKK 1 25 7 0.0000 3.99 0.00 3 1987.98301 0.53 18.21 1 High KDIDDLELTLAK 1 27 7 0.0000 3.87 0.00 2 1373.75383 1.11 19.01 1 High ALQEAHQQTLDDLQSEEDKVNTLTK 1 11 2 0.0000 3.77 0.00 3 2854.41281 2.18 20.53 1 High KALQEAHQQTLDDLQSEEDKVNTLTK 2 11 2 0.0000 3.71 0.00 4 2982.50112 0.15 19.37 2 High LQDLVDKLQLK 17 25 6 0.0000 3.65 0.00 2 1312.78215 1.06 37.60 1 High LSSADIETYLLEK 2 2 1 0.0000 3.50 0.00 2 1481.77165 1.19 23.88 0 High DLQHRLDEAEQVAMK 2 1 1 0.1570 3.49 0.00 2 1782.88249 1.17 20.09 1 High LDEAEQVAMK 1 1 1 0.1067 3.35 0.00 2 1133.55242 1.45 14.79 0 High AGLLGTLEEMR 11 28 5 0.0000 3.24 0.00 2 1189.62444 0.15 37.34 0 High AITDAAMmAEELKK 3 26 7 M8(Oxidation) 0.0000 3.00 0.00 2 1537.75969 0.30 16.17 1 IPI00501288.3 Uncharacterized protein 155.35 3.54 2 1 37 1947 226.5 6.07 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High KAITDAAMMAEELKK 23 26 7 0.0000 6.13 0.00 3 1649.86081 0.37 16.94 2 High KAITDAAmMAEELKK 4 26 7 M8(Oxidation) 0.0000 5.09 0.00 3 1665.85453 0.35 16.71 2 High AITDAAMMAEELKKEQDTSSHLER 1 2 1 0.0000 5.06 0.00 3 2704.28830 1.29 19.86 2 High AITDAAMMAEELKK 2 26 7 0.0000 4.99 0.00 2 1521.76567 0.29 18.57 1 High IEELEEELEAERAAR 1 22 6 0.0000 4.13 0.00 2 1786.88127 0.32 18.44 1 High LEQQVDDLEGSLEQEKK 1 25 7 0.0000 3.99 0.00 3 1987.98301 0.53 18.21 1 High KDLDDLEITLAK 1 27 7 0.0000 3.87 0.00 2 1373.75383 1.11 19.01 1 High IEELEEELEAER 1 22 6 0.0000 3.77 0.00 2 1488.70635 0.10 19.27 0 High AITDAAMmAEELKK 3 26 7 M8(Oxidation) 0.0000 3.00 0.00 2 1537.75969 0.30 16.17 1 IPI00488248.1 Myosin, light polypeptide 3, skeletal muscle 101.85 17.88 17 2 30 151 16.8 4.55 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High VFDKEGNGTVMGAELR 23 16 1 0.0000 4.14 0.00 2 1722.84917 0.65 16.52 1 High VFDKEGNGTVmGAELR 1 16 1 M11(Oxidation) 0.0000 3.48 0.00 3 1738.84275 0.13 14.62 1

PAGE 150

150 High GTYDDYVEGLR 6 2 1 0.0000 3.20 0.00 2 1287.58623 0.79 29.91 0 IPI00504207.1 Skeletal alpha1 actin 43.78 26.53 18 7 11 377 41.9 5.39 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High KDLYANNVLSGGTTMYPGIADR 2 7 1 0.0000 5.62 0.00 3 2356.16288 1.11 21.22 1 High DLYANNVLSGGTTMYPGIADR 2 7 1 0.0000 4.69 0.00 2 2228.06719 0.85 23.04 0 High HQGVMVGMGQKDSYVGDEAQSKR 1 16 1 0.0000 4.37 0.00 4 2507.17397 1.09 14.47 2 High SYELPDGQVITIGNER 2 14 1 0.0000 4.09 0.00 2 1790.89055 0.80 22.39 0 High AGFAGDDAPR 1 17 1 0.0000 3.32 0.00 2 976.44890 0.56 12.82 0 High VAPEEHPTLLTEAPLNPK 1 7 1 0.0000 3.26 0.00 3 1956.04355 0.11 18.15 0 High EITALAPSTMK 2 9 1 0.0000 3.02 0.00 2 1161.61772 0.63 16.07 0 IPI00488085.2 Myosin, light polypeptide 2, skeletal muscle 21.09 18.93 2 1 6 169 18.9 4.73 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High DVLASMGQLNVK 3 2 1 0.0000 4.01 0.00 2 1274.67864 0.99 20.23 0 High DVLASmGQLNVK 1 2 1 M6(Oxidation) 0.0000 3.62 0.00 2 1290.67571 2.65 20.29 0 High EAFTIIDQNRDGIISKDDLR 1 3 2 0.0000 3.37 0.00 3 2319.19297 0.46 20.60 2 High EAFTIIDQNR 1 3 2 0.0000 3.08 0.00 2 1206.61125 0.11 17.08 0 IPI00508152.1 Tropomyosin alpha 1 chain 15.46 15.14 16 2 4 284 32.7 4.74 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High SKQLEDDLVALQK 1 1 1 0.0000 4.71 0.00 2 1486.80986 0.91 17.67 1 High TIDDLEDELYAQKLK 1 3 1 0.0000 3.89 0.00 2 1793.91594 0.49 21.68 1 High RIQLVEEELDRAQER 1 17 2 0.0000 3.70 0.00 3 1883.99247 0.53 17.71 2 High IQLVEEELDRAQER 1 17 2 0.0000 3.17 0.00 2 1727.88970 1.53 18.72 1 IPI00487267.1 Zgc:63734 15.10 12.50 14 1 4 248 28.7 4.75 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High AMKDEEKMEIQEIQLK 2 1 1 0.0000 4.90 0.00 3 1962.98966 1.05 18.08 2 High RIQLVEEELDRAQER 1 17 2 0.0000 3.70 0.00 3 1883.99247 0.53 17.71 2 High IQLVEEELDRAQER 1 17 2 0.0000 3.17 0.00 2 1727.88970 1.53 18.72 1 IPI00919778.1 Uncharacterized protein 9.03 21.32 2 1 3 136 15.3 4.48 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High EAFTIIDQNRDGIISKDDLR 1 3 2 0.0000 3.37 0.00 3 2319.19297 0.46 20.60 2 High EAFTIIDQNR 1 3 2 0.0000 3.08 0.00 2 1206.61125 0.11 17.08 0 High NEELEAMVK 1 2 1 0.0000 2.57 0.00 1 1062.51379 0.13 15.60 0 IPI00501538.1 Zgc:91930 7.31 6.70 1 1 2 194 21.4 8.00

PAGE 151

151 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High YGYTHLSSGDLLR 2 1 1 0.0000 3.99 0.00 3 1481.73923 0.59 17.84 0 IPI00817940.5 Uncharacterized protein 4.05 5.00 9 1 1 220 26.4 5.91 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High KKEEEELIALK 1 9 1 0.0000 4.05 0.00 2 1329.76225 0.17 14.60 2 IPI009 19917.1 Novel protein 3.52 5.38 6 1 1 260 29.4 7.59 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High GGDDLDPNYVLSSR 1 6 1 0.0000 3.52 0.00 2 1507.70098 0.94 18.83 0 IPI008 09962.2 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 like 3.40 1.51 9 1 1 991 108.9 5.15 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High VDQSILTGESVSVIK 1 9 1 0.0000 3.40 0.00 2 1574.86528 1.04 20.48 0 IPI009 01053.1 Uncharacterized protein 3.26 0.64 1 1 1 1560 179.4 5.58 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High ALQDELSELK 1 1 1 0.0000 3.26 0.00 2 1145.60405 0.74 17.45 0 IPI004 97753.5 Glyceraldehyde 3 phosphate dehydrogenase 3.22 4.20 2 1 1 333 35.8 8.12 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High VPTPNVSVVDLTVR 1 2 1 0.0000 3.22 0.00 2 1495.84917 0.82 21.63 0 IPI008 52117.1 Novel protein similar to vertebrate synaptotagmin I 3.20 5.67 2 1 1 388 43.9 8.70 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High KMDVGGLSDPyVKIHLMQNGKR 1 2 1 Y11(Phospho) 0.0000 3.20 0.00 3 2566.27164 1.77 17.43 3 IPI009 94333.1 Uncharacterized protein 2.37 0.78 1 1 1 1151 126.1 7.69 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High QLVQNILEK 1 1 1 0.0000 2.37 0.00 1 1084.63525 0.81 17.14 0

PAGE 152

152 APPENDIX D PROTEOME DISCOVERY R ESULTS FOR ELASTASE Database s earch s ummary r eport (generated by PD software) Search report summary of file(s): C: \ Users \ Owner \ Documents \ Stephan_Data \ EL.msf Created with Discoverer version: 1.3.0.339 ===== ==== ================== ======================================= Number of filtered/unfiltered result items: 8/9 protein group(s) 64/64 merged protein(s) 15/15 peptide(s) 17/17 PSM(s) 3701/3701 search input(s) ======= ================== ========================================= Peptide Grouping Options Show peptide groups: True Group peptides by: Mass and Sequence Protein Grouping Options Enable protein grouping: True Consider leucine and isoleucine as equal: True Cons ider only PSMs with confidence at least: Medium Consider only PSMs with delta Cn better than: 0.15 Apply strict maximum parsimony principle: True Data reduction filters: Peptide Confidence (Minimum confidence: High) No result filters applied ==== ===== ================== ======================================= Summary of file C: \ Users \ Owner \ Documents \ Stephan_Data \ EL.msf Workflow created with Discoverer version: 1.3.0.339 (DBVersion:78) ======================= ================== ========================= Search name: EL Search description: danre database, oxi and phos is dynamic Search date: 06/23/2011 18:57:31 ==================== ================== ============================ The pipeline tree: -----------------| (0) Spectrum Files | (1) Spectrum Selector | (2) SEQUEST | (3) Peptide Validator -----------------------------------------------------------------------------Processing node 0: Spectrum Files -----------------------------------------------------------------------------Input Data: ----------------------------File Name(s): C: \ Users \ Owner \ Documents \ Stephan_Data \ EL.RAW

PAGE 153

153 ----------------------------------------------------------------------------Processing node 1: Spectrum Selector -----------------------------------------------------------------------------1. General Settings: ----------------------------Precursor Selection: Use MS1 Precursor Use New Precursor Reevaluation: True 2. Spec trum Properties Filter: ----------------------------Lower RT Limit: 0 Upper RT Limit: 0 First Scan: 0 Last Scan: 0 Lowest Charge State: 0 Highest Charge State: 0 Min. Precursor Mass: 350 Da Max. Precursor Mass: 5000 Da Total Intensity Threshold: 0 Minimum Peak Count: 1 3. Scan Event Filters: ----------------------------MS Order: Is MS2 Scan Type: Is Full 4. Peak Filters: ----------------------------S/N Threshold (FT only): 1.5 5. Replacements for Unrecognized Properties: ----------------------------Unrecognized Charge Replacements: Automatic Unrecognized Mass Analyzer Replacements: ITMS Unrecognized MS Order Replacements: MS2 Unrecognized Activation Type Replacements: CID Unrecognized Polarity Replacements: + 6. Jus t for Testing: ----------------------------Precursor Clipping Range Before: 2.5 Da Precursor Clipping Range After: 5.5 Da -----------------------------------------------------------------------------Processing node 2: SEQUEST ----------------------------------------------------------------------------1. Input Data: ----------------------------Protein Database: ipi.DANRE.v3.82.fasta Enzyme Name: Elastase (Full) Maximum Missed Cleavage Sites: 3 1.1 Peptide Scoring Options:

PAGE 154

154 ---------------------------Maximum Peptides Considered: 500 Maximum Peptides Output: 10 Calculate Probability Scores: False Absolute XCorr Threshold: 0.4 Fragment Ion Cutoff Percentage: 0.1 Peptide Without Protein XCorr Threshold: 1.5 1.2 Protein Scoring Options: ----------------------------Maximum Protein References Per Peptide: 100 Protein Relevance Threshold: 1.5 Peptide Relevance Factor: 0.4 2. Tolerances: ----------------------------Precursor Mass Tolerance: 10 ppm Fragment Mass Tolerance: 0.8 Da Use Average Precursor Mass: False Use Average Fragment Masses: False 3. Ion Series: ----------------------------Use Neutral Loss a Ions: True Use Neutral Loss b Ions: True Use Neutral Loss y Ions: True Weight of a Ions: 0 Weight of b Ions: 1 Weight of c Ions: 0 Weight of x Ions: 0 Weight of y Ions: 1 Weight of z Ions: 0 4. Dynamic Modifications: ----------------------------Max. Modifications Per Peptide: 4 1. Dynamic Modification: Oxidation / +15.995 Da (M) 2. Dynamic Modification: Phospho / +79.966 Da (S, T, Y) -----------------------------------------------------------------------------Processing node 3: Peptide Validator -----------------------------------------------------------------------------1. Decoy Database Search: ---------------------------Search Against Decoy Database: True Target FDR (Strict): 0.01 Target FDR (Relaxed): 0.05 ======== ================== ======================================== Further information: SEQUEST (2): Number of sequences searched: 41893

PAGE 155

155 ======== ================== ======================================== Processing details: 06/26/2011 09:41 AM (2):SEQUEST: Total search time was 9 min 51 s. 06/26/2011 09:41 AM (2):SEQUEST: Search completed 06/26/2011 09:41 AM (2):SEQUEST: Protein grouping (2142 gro ups) took: 2.2 s 06/26/2011 09:41 AM (2):SEQUEST: 3053 protein(s) + 2991 decoy proteins scored and inserted into result file in 7.46 s 06/26/2011 09:41 AM (2):SEQUEST: 3053 protein(s) scored 06/26/2011 09:41 AM (2):SEQUEST: Result finalization started 06/2 6/2011 09:41 AM (3):Peptide Validator: Start calculating relaxed False Discovery Rate 06/26/2011 09:40 AM (3):Peptide Validator: Start calculating strict False Discovery Rate 06/26/2011 09:40 AM (3):Peptide Validator: Evaluating peptides of SEQUEST (2) sta rted 06/26/2011 09:40 AM (2):SEQUEST: Sending 701 decoy peptide hits (4480 peptides) to result file 06/26/2011 09:40 AM (2):SEQUEST: Starting SEQUEST decoy search 06/26/2011 09:40 AM (2):SEQUEST: Sending 701 peptide hits (4488 peptides) to result file 06/2 6/2011 09:39 AM (2):SEQUEST: Starting SEQUEST search 06/26/2011 09:39 AM (2):SEQUEST: Receiving spectra 3001 to 3702. 06/26/2011 09:39 AM (2):SEQUEST: Sending 1000 decoy peptide hits (7407 peptides) to result file 06/26/2011 09:38 AM (2):SEQUEST: Starting SEQUEST decoy search 06/26/2011 09:38 AM (2):SEQUEST: Sending 1000 peptide hits (7390 peptides) to result file 06/26/2011 09:37 AM (2):SEQUEST: Starting SEQUEST search 06/26/2011 09:37 AM (2):SEQUEST: Receiving spectra 2001 to 3001. 06/26/2011 09:37 AM (2) :SEQUEST: Sending 1000 decoy peptide hits (9179 peptides) to result file 06/26/2011 09:35 AM (2):SEQUEST: Starting SEQUEST decoy search 06/26/2011 09:35 AM (2):SEQUEST: Sending 1000 peptide hits (9191 peptides) to result file 06/26/2011 09:33 AM (2):SEQUES T: Starting SEQUEST search 06/26/2011 09:33 AM (2):SEQUEST: Receiving spectra 1001 to 2001. 06/26/2011 09:33 AM (2):SEQUEST: Sending 1000 decoy peptide hits (5591 peptides) to result file 06/26/2011 09:32 AM (2):SEQUEST: Starting SEQUEST decoy search 06/26 /2011 09:32 AM (2):SEQUEST: Sending 1000 peptide hits (5593 peptides) to result file 06/26/2011 09:30 AM (2):SEQUEST: Starting SEQUEST search 06/26/2011 09:30 AM (2):SEQUEST: There is already an adequate decoy FASTA index.

PAGE 156

156 06/26/2011 09:30 AM (2):SEQUEST: Looking for existing decoy FASTA index. 06/26/2011 09:30 AM (2):SEQUEST: There is already an adequate target FASTA index. 06/26/2011 09:30 AM (2):SEQUEST: Looking for existing target FASTA index. 06/26/2011 09:30 AM (2):SEQUEST: Receiving spectra 1 to 1001 06/26/2011 09:30 AM (1):Spectrum Selector: Reading from File 1 of 1:C: \ Users \ Owner \ Documents \ Stephan_Data \ EL.RAW (4359 spectra total)

PAGE 157

157 Protein and p eptide results for e lastase digested m yosin generated by Proteome Discovery s oftware Accession Description Score Coverage # Proteins # Unique Peptides # PSMs # AAs MW [kDa] calc. pI IPI 00500057.4 myosin heavy chain, fast skeletal muscle 15.67 2.85 35 3 5 1933 222.1 5.67 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High REQFEEEQEAKAELQRGMSKA 1 10 1 0.0000 4.47 0.00 4 2494.20400 1.92 18.20 3 High SSQFRENLGKLMTNL 2 11 1 0.0000 3.34 0.00 2 1737.89751 1.26 23.27 2 High RNDNSSRFGKFI 1 35 2 0.0000 2.96 0.00 2 1440.74516 7.54 15.61 0 High SDLTEQI 1 17 1 0.0000 1.86 0.00 1 805.39459 0.96 16.40 1 IPI00800858.4 myosin 7 8.13 1.64 17 2 3 1952 225.4 5.96 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High SERLEEAGGATSA 1 3 1 0.0000 3.30 0.00 2 1277.59624 0.49 12.57 3 High RNDNSSRFGKFI 1 35 2 0.0000 2.96 0.00 2 1440.74516 7.54 15.61 0 High QLELNQI 1 1 1 0.0000 1.87 0.00 1 857.47040 2.73 19.52 2 IPI00504207.1 Skeletal alpha1 actin 6.93 8.49 13 2 2 377 41.9 5.39 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High YEGYALPHAIMRL 1 9 1 0.0000 3.69 0.00 2 1533.78691 0.91 22.64 3 High SSSSLEKSYELPDGQVITI 1 12 1 0.0000 3.25 0.00 2 2053.03398 0.17 25.86 3 IPI00919778.1 Uncharacterized protein 6.19 19.12 5 2 2 136 15.3 4.48 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High mFEQSQIQEYKEA 1 1 1 M1(Oxidation) 0.0000 3.18 0.00 2 1646.73857 1.12 17.51 1 High KEASGPINFTVFL 1 5 1 0.0000 3.01 0.00 2 1422.76189 0.65 26.97 3 IPI00804071.4 myosin 10 like 3.47 0.72 2 1 1 1808 209.8 5.50 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High NPILESFGNAKTV 1 2 1 0.0000 3.47 0.00 2 1389.73772 0.29 19.38 3 IPI004 93726.3 Zgc:175264 protein 2.85 2.60 2 1 1 691 77.8 8.47 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High NLyLKmEKKPNKKDQLNI 1 2 1 Y3(Phospho); M6(Oxidation) 0.0000 2.85 0.00 2 2313.22002 7.04 25.63 3 IPI005 05707.1 Doublesex and mab 3 related transcription factor A2 2.61 2.73 2 1 1 440 47.3 8.16 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High FPNHKRsVLELV 1 2 1 S7(Phospho) 0.0000 2.61 0.00 2 1518.79070 5.13 19.20 3

PAGE 158

158 IPI004 88184.1 Estradiol 17 beta dehydrogenase 12 B 2.59 3.86 1 1 1 311 34.3 9.55 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High IESKyKVETKTI 1 1 1 Y5(Phospho) 0.0000 2.59 0.00 2 1518.79021 5.70 37.28 2

PAGE 159

159 APPENDIX E PROTEOME DISCOVERY R ESULTS FOR CEM LOW Database s earch summary r eport (generated by PD software) Search report summary of file(s): C: \ Users \ Owner \ Documents \ Stephan_Data \ CEM_LOW.msf Created with Discoverer version: 1.3.0.339 =============== ================== ================================= Number of filtered/unfiltered result items: 7/7 protein group(s) 56/56 merged protein(s) 13/13 peptide(s) 19/19 PSM(s) 3783/3783 search input(s) ================ ================== ================================ Peptide Grouping Options Show peptide groups: True Group peptides by: Mass and Sequence Protein Grouping Options Enable protein grouping: True Consider leucine and isoleucine as equal: True Consider only PSMs with confidence at least: Medium Consider only PSMs with delta Cn better than: 0.15 Apply strict maximum parsimony principle: True Data reduction filters: Peptide Confidence (Minimum confidence: High) No result filters app lied =============== ================== ================================= Summary of file C: \ Users \ Owner \ Documents \ Stephan_Data \ CEM_LOW.msf Workflow created with Discoverer version: 1.3.0.339 (DBVersion:78) ================== ================== =============== =============== Search name: CEM_LOW Search description: danre database, oxi and phos is dynamic Search date: 06/23/2011 18:57:01 ======================= =================== ======================== The pipeline tree: -----------------| (0) Spectrum File s | (1) Spectrum Selector | (2) SEQUEST | (3) Peptide Validator -----------------------------------------------------------------------------Processing node 0: Spectrum Files -----------------------------------------------------------------------------Input Data: ----------------------------

PAGE 160

160 File Name(s): C: \ Users \ Owner \ Documents \ Stephan_Data \ CEM_LOW.RAW ----------------------------------------------------------------------------Processing node 1: Spectrum Selector -----------------------------------------------------------------------------1. General Settings: ----------------------------Precursor Selection: Use MS1 Precursor Use New Precursor Reevaluation: True 2. Spectrum Properties Filter: ----------------------------Lower RT Limit: 0 Upper RT Limit: 0 First Scan: 0 Last Scan: 0 Lowest Charge State: 0 Highest Charge State: 0 Min. Precursor Mass: 350 Da Max. Precursor Mass: 5000 Da Total Intensity Thresh old: 0 Minimum Peak Count: 1 3. Scan Event Filters: ----------------------------MS Order: Is MS2 Scan Type: Is Full 4. Peak Filters: ----------------------------S/N Threshold (FT only): 1.5 5. Replacements for Unrecognized Properties: ----------------------------Unrecognized Charge Replacements: Automatic Unrecognized Mass Analyzer Replacements: ITMS Unrecognized MS Order Replacements: MS2 Unrecognized Activation Type Replacements: CID Unrecognized Polarity Replacements: + 6. Jus t for Testing: ----------------------------Precursor Clipping Range Before: 2.5 Da Precursor Clipping Range After: 5.5 Da -----------------------------------------------------------------------------Processing node 2: SEQUEST ----------------------------------------------------------------------------1. Input Data: ----------------------------Protein Database: ipi.DANRE.v3.82.fasta Enzyme Name: Elastase/Tryp/Chymo (Full) Maximum Missed Cleavage Sites: 3

PAGE 161

161 1.1 Peptide Scoring Options: ---------------------------Maximum Peptides Considered: 500 Maximum Peptides Output: 10 Calculate Probability Scores: False Absolute XCorr Threshold: 0.4 Fragment Ion Cutoff Percentage: 0.1 Peptide Without Protein XCorr Threshold: 1.5 1.2 Protein Scoring Options: ----------------------------Maximum Protein References Per Peptide: 100 Protein Relevance Threshold: 1.5 Peptide Relevance Factor: 0.4 2. Tolerances: ----------------------------Precursor Mass Tolerance: 10 ppm Fragment Mass Tolerance: 0. 8 Da Use Average Precursor Mass: False Use Average Fragment Masses: False 3. Ion Series: ----------------------------Use Neutral Loss a Ions: True Use Neutral Loss b Ions: True Use Neutral Loss y Ions: True Weight of a Ions: 0 Weight of b Ions: 1 Weight of c Ions: 0 Weight of x Ions: 0 Weight of y Ions: 1 Weight of z Ions: 0 4. Dynamic Modifications: ----------------------------Max. Modifications Per Peptide: 4 1. Dynamic Modification: Oxidation / +15.995 Da (M) 2. Dynamic Modification: Phospho / +79.966 Da (S, T, Y) -----------------------------------------------------------------------------Processing node 3: Peptide Validator -----------------------------------------------------------------------------1. Decoy Database Search: ---------------------------Search Against Decoy Database: True Target FDR (Strict): 0.01 Target FDR (Relaxed): 0.05 ============ ================== ==================================== Further information: SEQUEST (2):

PAGE 162

1 62 Number of sequences searched: 4189 3 ================== ================== ============================== Processing details: 06/26/2011 09:30 AM (2):SEQUEST: Total search time was 6 min 57 s. 06/26/2011 09:30 AM (2):SEQUEST: Search completed 06/26/2011 09:30 AM (2):SEQUEST: Protein grouping (1739 groups) took: 2.06 s 06/26/2011 09:30 AM (2):SEQUEST: 2596 protein(s) + 2523 decoy proteins scored and inserted into result file in 7.59 s 06/26/2011 09:30 AM (2):SEQUEST: 2596 protein(s) scored 06/26/2011 09:30 AM (2):SEQUEST: Result finalization s tarted 06/26/2011 09:30 AM (3):Peptide Validator: Start calculating relaxed False Discovery Rate 06/26/2011 09:30 AM (3):Peptide Validator: Start calculating strict False Discovery Rate 06/26/2011 09:30 AM (3):Peptide Validator: Evaluating peptides of SEQU EST (2) started 06/26/2011 09:30 AM (2):SEQUEST: Sending 783 decoy peptide hits (4711 peptides) to result file 06/26/2011 09:29 AM (2):SEQUEST: Starting SEQUEST decoy search 06/26/2011 09:29 AM (2):SEQUEST: Sending 783 peptide hits (4706 peptides) to resul t file 06/26/2011 09:28 AM (2):SEQUEST: Starting SEQUEST search 06/26/2011 09:28 AM (2):SEQUEST: Receiving spectra 3001 to 3784. 06/26/2011 09:28 AM (2):SEQUEST: Sending 1000 decoy peptide hits (8419 peptides) to result file 06/26/2011 09:27 AM (2):SEQUEST: Starting SEQUEST decoy search 06/26/2011 09:27 AM (2):SEQUEST: Sending 1000 peptide hits (8418 peptides) to result file 06/26/2011 09:26 AM (2):SEQUEST: Starting SEQUEST search 06/26/2011 09:26 AM (2):SEQUEST: Receiving spectra 2001 to 3001. 0 6/26/2011 09:26 AM (2):SEQUEST: Sending 1000 decoy peptide hits (9389 peptides) to result file 06/26/2011 09:25 AM (2):SEQUEST: Starting SEQUEST decoy search 06/26/2011 09:25 AM (2):SEQUEST: Sending 1000 peptide hits (9417 peptides) to result file 06/26/20 11 09:24 AM (2):SEQUEST: Starting SEQUEST search 06/26/2011 09:24 AM (2):SEQUEST: Receiving spectra 1001 to 2001. 06/26/2011 09:24 AM (2):SEQUEST: Sending 1000 decoy peptide hits (6557 peptides) to result file 06/26/2011 09:23 AM (2):SEQUEST: Starting SEQU EST decoy search 06/26/2011 09:23 AM (2):SEQUEST: Sending 1000 peptide hits (6597 peptides) to result file 06/26/2011 09:22 AM (2):SEQUEST: Starting SEQUEST search 06/26/2011 09:22 AM (2):SEQUEST: There is already an adequate decoy FASTA index.

PAGE 163

163 06/26/2011 09:22 AM (2):SEQUEST: Looking for existing decoy FASTA index. 06/26/2011 09:22 AM (2):SEQUEST: There is already an adequate target FASTA index. 06/26/2011 09:22 AM (2):SEQUEST: Looking for existing target FASTA index. 06/26/2011 09:22 AM (2):SEQUEST: Recei ving spectra 1 to 1001. 06/26/2011 09:22 AM (1):Spectrum Selector: Reading from File 1 of 1:C: \ Users \ Owner \ Documents \ Stephan_Data \ CEM_LOW.RAW (4425 spectra total)

PAGE 164

164 Protein and p eptide results for CEM low digested m yosin generated by Proteome Di scovery software Accession Description Score Coverage # Proteins # Unique Peptides # PSMs # AAs MW [kDa] calc. pI IPI 00500057.4 myosin heavy chain, fast skeletal muscle 32.02 3.16 31 5 10 1933 222.1 5.67 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High SDLTEQIGETGK 1 13 1 0.0000 3.85 0.00 2 1277.61565 4.98 15.08 2 High REQFEEEQEAK 2 14 2 0.0000 3.75 0.00 2 1422.64983 0.14 12.06 3 High GGSmQTVSSQFR 1 11 1 M4(Oxidation) 0.0000 3.23 0.00 2 1300.59502 0.05 15.41 2 High TLEDQLSEIK 3 8 1 0.0000 3.10 0.00 2 1175.61687 1.20 18.51 3 High GGSMQTVSSQFR 1 11 1 0.0000 2.91 0.00 2 1284.60039 0.17 15.40 2 High DASERVGL 1 13 1 0.0000 2.72 0.00 2 846.43608 5.27 13.97 3 High YETDAIQR 1 23 1 0.0000 2.68 0.00 2 995.47966 0.38 12.75 3 IPI00490216.3 Myosin, heavy polypeptide 6, cardiac muscle, alpha 10.29 0.98 1 1 3 1936 222.7 5.68 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High REQFEEEQEAK 2 14 2 0.0000 3.75 0.00 2 1422.64983 0.14 12.06 3 High VGNEYVTK 1 1 1 0.0000 2.84 0.00 2 909.46745 0.22 11.62 3 IPI00998237.1 Uncharacterized protein 6.01 16.41 17 2 2 128 14.1 5.76 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High DSYVGDEAQSK 1 16 1 0.0000 3.01 0.00 2 1198.52251 0.19 12.06 3 High AGFAGDDAPR 1 17 1 0.0000 3.00 0.00 2 976.44878 0.44 12.89 3 IPI00492089.6 synaptotagmin 14 5.41 2.28 1 1 2 526 58.0 6.20 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High TmLDsKGKEMSK 2 1 1 M2(Oxidation); S5(Phospho) 0.0000 2.76 0.00 2 1450.63494 2.14 33.18 3 IPI009 01816.4 FYVE and coiled coil domain containing protein 1 like 2.87 0.89 2 1 1 1346 153.5 5.22 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High ELDQSELKQQQL 1 2 1 0.0000 2.87 0.00 2 1458.74382 0.21 16.10 3 IPI008 00858.4 myosin 7 2.86 0.51 1 1 1 1952 225.4 5.96 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High ALQESHQQTL 1 1 1 0.0000 2.86 0.00 2 1154.58330 2.80 13.00 2

PAGE 165

165 IPI009 96062.1 Uncharacterized protein 2.54 1.33 3 1 1 527 59.0 5.26 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High EEIIKmL 1 3 1 M6(Oxidation) 0.0000 2.54 0.00 1 891.48291 3.06 26.29 3

PAGE 166

166 APPENDIX F PROTEOME DISCOVERY R ESULTS FOR CEM HIGH Database s earch s ummary r eport (generated by PD software) Search report summary of file(s): C: \ Users \ Owner \ Documents \ Stephan_Data \ CEM_HIGH.msf Created with Discoverer version: 1.3.0.339 =============== ================== ================================= Number of filtered/unfiltered result items: 6/7 protein group(s) 52/52 merged protein(s) 20/20 peptide(s) 38/38 PSM(s) 3925/3925 search input(s) =============== ================== ================================= Peptide Grouping Options Show peptide groups: True Group peptides by: Mass and Sequence Protein Grouping Options Enable protein grouping: True Consider leucine and isoleucine as equal: Tru e Consider only PSMs with confidence at least: Medium Consider only PSMs with delta Cn better than: 0.15 Apply strict maximum parsimony principle: True Data reduction filters: Peptide Confidence (Minimum confidence: High) No result filters ap plied ============= ================== =================================== Summary of file C: \ Users \ Owner \ Documents \ Stephan_Data \ CEM_HIGH.msf Workflow created with Discoverer version: 1.3.0.339 (DBVersion:78) ================ ================== =============== ================= Search name: CEM_HIGH Search description: danre database, oxi and phos is dynamic Search date: 06/23/2011 18:56:40 ==================== ================== ============================ The pipeline tree: -----------------| (0) Spectrum F iles | (1) Spectrum Selector | (2) SEQUEST | (3) Peptide Validator -----------------------------------------------------------------------------Processing node 0: Spectrum Files -----------------------------------------------------------------------------Input Data: ----------------------------

PAGE 167

167 File Name(s): C: \ Users \ Owner \ Documents \ Stephan_Data \ CEM_HIGH.RAW ----------------------------------------------------------------------------Processing node 1: Spectrum Selector -----------------------------------------------------------------------------1. General Settings: ----------------------------Precursor Selection: Use MS1 Precursor Use New Precursor Reevaluation: True 2 Spectrum Properties Filter: ----------------------------Lower RT Limit: 0 Upper RT Limit: 0 First Scan: 0 Last Scan: 0 Lowest Charge State: 0 Highest Charge State: 0 Min. Precursor Mass: 350 Da Max. Precursor Mass: 5000 Da Total Intensity Thres hold: 0 Minimum Peak Count: 1 3. Scan Event Filters: ----------------------------MS Order: Is MS2 Scan Type: Is Full 4. Peak Filters: ----------------------------S/N Threshold (FT only): 1.5 5. Replacements for Unrecognized Properties: ----------------------------Unrecognized Charge Replacements: Automatic Unrecognized Mass Analyzer Replacements: ITMS Unrecognized MS Order Replacements: MS2 Unrecognized Activation Type Replacements: CID Unrecognized Polarity Replacements: + 6. Jus t for Testing: ----------------------------Precursor Clipping Range Before: 2.5 Da Precursor Clipping Range After: 5.5 Da -----------------------------------------------------------------------------Processing node 2: SEQUEST ----------------------------------------------------------------------------1. Input Data: ----------------------------Protein Database: ipi.DANRE.v3.82.fasta Enzyme Name: Elastase/Tryp/Chymo (Full) Maximum Missed Cleavage Sites: 3

PAGE 168

168 1.1 Peptide Scoring Options: ---------------------------Maximum Peptides Considered: 500 Maximum Peptides Output: 10 Calculate Probability Scores: False Absolute XCorr Threshold: 0.4 Fragment Ion Cutoff Percentage: 0.1 Peptide Without Protein XCorr Threshold: 1.5 1.2 Protein Scoring Options: ----------------------------Maximum Protein References Per Peptide: 100 Protein Relevance Threshold: 1.5 Peptide Relevance Factor: 0.4 2. Tolerances: ----------------------------Precursor Mass Tolerance: 10 ppm Fragment Mass Tolerance: 0. 8 Da Use Average Precursor Mass: False Use Average Fragment Masses: False 3. Ion Series: ----------------------------Use Neutral Loss a Ions: True Use Neutral Loss b Ions: True Use Neutral Loss y Ions: True Weight of a Ions: 0 Weight of b Ions: 1 Weight of c Ions: 0 Weight of x Ions: 0 Weight of y Ions: 1 Weight of z Ions: 0 4. Dynamic Modifications: ----------------------------Max. Modifications Per Peptide: 4 1. Dynamic Modification: Oxidation / +15.995 Da (M) 2. Dynamic Modification: Phospho / +79.966 Da (S, T, Y) -----------------------------------------------------------------------------Processing node 3: Peptide Validator -----------------------------------------------------------------------------1. Decoy Database Search: ---------------------------Search Against Decoy Database: True Target FDR (Strict): 0.01 Target FDR (Relaxed): 0.05 ============== ================== ================================== Further information: SEQUEST (2):

PAGE 169

169 Number of sequences searched: 4189 3 ================== ================== ============================== Processing details: 06/26/2011 09:22 AM (2):SEQUEST: Total search time was 62 h 8 min. 06/26/2011 09:22 AM (2):SEQUEST: Search completed 06/26/2011 09:22 AM (2):SEQUEST: Protein grouping (2041 groups) took: 2.22 s 06/26/2011 09:22 AM (2):SEQUEST: 2927 protein(s) + 3095 decoy proteins scored and inserted into result file in 9.26 s 06/26/2011 09:22 AM (2):SEQUEST: 2927 protein(s) scored 06/26/2011 09:22 AM (2):SEQUEST: Result finalization s tarted 06/26/2011 09:21 AM (3):Peptide Validator: Start calculating relaxed False Discovery Rate 06/26/2011 09:21 AM (3):Peptide Validator: Start calculating strict False Discovery Rate 06/26/2011 09:21 AM (3):Peptide Validator: Evaluating peptides of SEQU EST (2) started 06/26/2011 09:21 AM (2):SEQUEST: Sending 925 decoy peptide hits (5118 peptides) to result file 06/26/2011 09:21 AM (2):SEQUEST: Starting SEQUEST decoy search 06/26/2011 09:21 AM (2):SEQUEST: Sending 925 peptide hits (5134 peptides) to resul t file 06/26/2011 09:20 AM (2):SEQUEST: Starting SEQUEST search 06/26/2011 09:20 AM (2):SEQUEST: Receiving spectra 3001 to 3926. 06/26/2011 09:20 AM (2):SEQUEST: Sending 1000 decoy peptide hits (7545 peptides) to result file 06/26/2011 09:19 AM (2):SEQUEST: Starting SEQUEST decoy search 06/26/2011 09:19 AM (2):SEQUEST: Sending 1000 peptide hits (7607 peptides) to result file 06/26/2011 09:18 AM (2):SEQUEST: Starting SEQUEST search 06/26/2011 09:18 AM (2):SEQUEST: Receiving spectra 2001 to 3001. 0 6/26/2011 09:18 AM (2):SEQUEST: Sending 1000 decoy peptide hits (9229 peptides) to result file 06/26/2011 09:17 AM (2):SEQUEST: Starting SEQUEST decoy search 06/26/2011 09:17 AM (2):SEQUEST: Sending 1000 peptide hits (9262 peptides) to result file 06/23/20 11 07:18 PM (2):SEQUEST: Starting SEQUEST search 06/23/2011 07:18 PM (2):SEQUEST: Receiving spectra 1001 to 2001. 06/23/2011 07:18 PM (2):SEQUEST: Sending 1000 decoy peptide hits (7090 peptides) to result file 06/23/2011 07:16 PM (2):SEQUEST: Starting SEQU EST decoy search 06/23/2011 07:16 PM (2):SEQUEST: Sending 1000 peptide hits (7072 peptides) to result file 06/23/2011 07:15 PM (2):SEQUEST: Starting SEQUEST search 06/23/2011 07:15 PM (2):SEQUEST: There is already an adequate decoy FASTA index.

PAGE 170

170 06/23/2011 07:15 PM (2):SEQUEST: Looking for existing decoy FASTA index. 06/23/2011 07:15 PM (2):SEQUEST: There is already an adequate target FASTA index. 06/23/2011 07:15 PM (2):SEQUEST: Looking for existing target FASTA index. 06/23/2011 07:15 PM (2):SEQUEST: Recei ving spectra 1 to 1001. 06/23/2011 07:15 PM (1):Spectrum Selector: Reading from File 1 of 1:C: \ Users \ Owner \ Documents \ Stephan_Data \ CEM_HIGH.RAW (4447 spectra total)

PAGE 171

171 Protein and p eptide results for CEM high digested m yosin generated by Proteome Discovery s oftware Accession Description Score Coverage # Proteins # Unique Peptides # PSMs # AAs MW [kDa] calc. pI IPI 00500057.4 myosin heavy chain, fast skeletal muscle 86.70 6.05 28 2 28 1933 222.1 5.67 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High EQQVDDLEGSLEQEK 1 25 3 0.0000 4.43 0.00 2 1746.80193 0.56 18.38 3 High KMEIDDLSSNMEA 1 11 2 0.0000 3.72 0.00 2 1482.64519 0.02 19.45 3 High SDLTEQIGETGK 1 13 2 0.0000 3.62 0.00 2 1277.62200 0.01 15.25 2 High REQFEEEQEAK 2 14 3 0.0000 3.43 0.00 2 1422.64958 0.03 11.96 3 High VQHELEEAEER 2 11 2 0.0000 3.34 0.00 2 1368.63835 0.52 12.94 3 High TLEDQLSEIK 15 8 1 0.0000 3.28 0.00 2 1175.61504 0.36 37.99 3 High SKIEDEQSLGA 1 10 2 0.0000 3.27 0.00 2 1176.57366 0.57 13.77 3 High DDLEGSLEQEKK 1 25 3 0.0000 2.93 0.00 2 1390.66777 1.39 14.58 3 High DDLQAEEDKV 1 12 2 0.0000 2.86 0.00 1 1161.52722 0.15 15.69 3 High EEAEGTLEHEESK 1 16 2 0.0000 2.86 0.00 2 1487.64897 0.48 12.38 2 High SERLEEAGGA 1 25 3 0.0000 2.69 0.00 2 1018.48003 0.01 11.75 3 High TLEDQLSEI 1 8 1 0.0000 2.46 0.00 1 1047.51868 1.73 21.72 2 IPI00933204.1 Myosin, heavy polypeptide 2, fast muscle specific 44.81 6.10 21 1 13 1935 221.7 5.69 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High EQQVDDLEGSLEQEK 1 25 3 0.0000 4.43 0.00 2 1746.80193 0.56 18.38 3 High AEKDEEMEQIK 1 1 1 0.0000 4.22 0.00 3 1349.62506 0.25 12.79 3 High KMEIDDLSSNMEA 1 11 2 0.0000 3.72 0.00 2 1482.64519 0.02 19.45 3 High SDLTEQLGETGK 1 13 2 0.0000 3.62 0.00 2 1277.62200 0.01 15.25 2 High REQFEEEQEAK 2 14 3 0.0000 3.43 0.00 2 1422.64958 0.03 11.96 3 High VQHELEEAEER 2 11 2 0.0000 3.34 0.00 2 1368.63835 0.52 12.94 3 High SKIEDEQSLGA 1 10 2 0.0000 3.27 0.00 2 1176.57366 0.57 13.77 3 High DDLEGSLEQEKK 1 25 3 0.0000 2.93 0.00 2 1390.66777 1.39 14.58 3 High DDLQAEEDKV 1 12 2 0.0000 2.86 0.00 1 1161.52722 0.15 15.69 3 High EEAEGTLEHEESK 1 16 2 0.0000 2.86 0.00 2 1487.64897 0.48 12.38 2 High SERLEEAGGA 1 25 3 0.0000 2.69 0.00 2 1018.48003 0.01 11.75 3 IPI00490216.3 Myosin, heavy polypeptide 6, cardiac muscle, alpha 20.66 2.43 10 1 6 1936 222.7 5.68

PAGE 172

172 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High EQQVDDLEGSLEQEK 1 25 3 0.0000 4.43 0.00 2 1746.80193 0.56 18.38 3 High REQFEEEQEAK 2 14 3 0.0000 3.43 0.00 2 1422.64958 0.03 11.96 3 High NSYEETLDHL 1 2 1 0.0000 3.27 0.00 2 1220.54057 1.99 19.71 2 High DDLEGSLEQEKK 1 25 3 0.0000 2.93 0.00 2 1390.66777 1.39 14.58 3 High SERLEEAGGA 1 25 3 0.0000 2.69 0.00 2 1018.48003 0.01 11.75 3 IPI00998237.1 Uncharacterized protein 5.94 16.41 17 2 2 128 14.1 5.76 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High AGFAGDDAPR 1 17 1 0.0000 3.04 0.00 2 976.44780 0.56 12.97 3 High DSYVGDEAQSK 1 16 1 0.0000 2.90 0.00 2 1198.52214 0.12 12.03 3 IPI00901816.4 FYVE and coiled coil domain containing protein 1 like 3.13 0.89 2 1 1 1346 153.5 5.22 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High ELDQSELKQQQL 1 2 1 0.0000 3.13 0.00 2 1458.74321 0.21 16.36 3 IPI00489530.5 Novel protein similar to H.sapiens HPS1, Hermansky Pudlak syndrome 1 2.31 1.35 1 1 1 668 77.0 5.59 A2 Sequence # PSMs # Proteins # Protein Groups Modifications XCorr Probability Charge MH+ [Da] [ppm] RT [min] # Missed Cleavages High FENETGyKL 1 1 1 Y7(Phospho) 0.0000 2.31 0.00 1 1180.48669 4.69 21.46 3

PAGE 173

173 APPENDIX G PEAKS DATABASE SEARCH RESULTS FOR CHYMOTRYPSIN Database s earch s ummary report (generated by Peaks DB software)

PAGE 174

174

PAGE 175

175 Protein r esults for c hymotrypsin digested m yosin generated by PEAKS DB Software Protein Group Protein ID Accession 10lgP Coverage (%) #Peptides #Unique Mass Best Unique Peptide Description 4 13 IPI00484075 150.95 4 10 1 222841.6 2039 Tax_Id=7955 Gene_Symbol=myhb Uncharacterized protein 3 12 IPI00975366 150.71 10 11 1 161231.6 1421 Tax_Id=7955 Gene_Symbol=LOC100537594 myosin heavy chain, fast skeletal muscle like 3 10 IPI00997196 150.71 8 11 1 1200239 1421 Tax_Id=7955 Gene_Symbol= Uncharacterized protein (Fragment) 2 6 IPI00500057 146.1 7 11 4 222199 1566 Tax_Id=7955 Gene_Symbol=LOC100149148 myosin heavy chain, fast skeletal muscle 2 3 IPI00503572 146.1 7 11 4 222148 1566 Tax_Id=7955 Gene_Symbol=myhz1.1 myosin, heavy polypeptide 1.1, skeletal muscle 2 2 IPI00773363 146.1 7 11 4 222157.9 1566 Tax_Id=7955 Gene_Symbol=myhz1.2 Novel myosin family protein 2 5 IPI00932699 146.1 7 11 4 222314.2 1566 Tax_Id=7955 Gene_Symbol=myhz1.1 Uncharacterized protein 1 52 IPI00496651 121.32 28 7 7 19122.63 2832 Tax_Id=7955 Gene_Symbol=zgc:103639 Zgc:103639 19 95 IPI00516071 79.53 10 1 1 19612.86 1825 Tax_Id=7955 Gene_Symbol=ckbb Creatine kinase, brain 19 97 IPI00919712 79.53 6 1 1 30369.56 1825 Tax_Id=7955 Gene_Symbol=ckba Novel protein 19 100 IPI00497388 79.53 4 1 1 42883.61 1825 Tax_Id=7955 Gene_Symbol=ckbb Creatine kinase, brain b 19 101 IPI00506249 79.53 4 1 1 42866.06 1825 Tax_Id=7955 Gene_Symbol=ckba Zgc:154095 9 4648 IPI00497753 78.58 18 2 2 35784.06 1785 Tax_Id=7955 Gene_Symbol=gapdh Glyceraldehyde 3 phosphate dehydrogenase 9 4649 IPI00963432 78.58 10 2 2 65912.7 1785 Tax_Id=7955 Gene_Symbol= hypothetical protein LOC326976 10 4650 IPI00483373 75.07 2 1 1 82936.84 1610 Tax_Id=7955 Gene_Symbol=ampd1 Adenosine monophosphate deaminase 1 20 99 IPI00482319 42.07 2 1 1 42814.61 1099 Tax_Id=7955 Gene_Symbol=ckma Muscle specific creatine kinase 21 20 IPI00504207 40.65 2 1 1 41972.96 1826 Tax_Id=7955 Gene_Symbol=actc1b Skeletal alpha1 actin 21 21 IPI00507230 40.65 2 1 1 41974.94 1826 Tax_Id=7955 Gene_Symbol=hm:zewp0073;actc1a Actin, alpha, cardiac muscle like 21 26 IPI00509458 40.65 2 1 1 42004.96 1826 Tax_Id=7955 Gene_Symbol=zgc:86709 Zgc:86709 protein 21 22 IPI00551966 40.65 2 1 1 41983 1826 Tax_Id=7955 Gene_Symbol=actc1b Actin, alpha 1, skeletal muscle 21 27 IPI00551994 40.65 2 1 1 41994.95 1826 Tax_Id=7955 Gene_Symbol=acta2 Actin, alpha 2, smooth muscle, aorta 21 28 IPI00570197 40.65 2 1 1 42018.99 1826 Tax_Id=7955 Gene_Symbol=acta1a Actin, alpha 1a, skeletal muscle 21 23 IPI00628880 40.65 2 1 1 41974.94 1826 Tax_Id=7955 Gene_Symbol=acta1b Actin, alpha 1b, skeletal muscle 21 41 IPI00931756 40.65 2 1 1 42006.01 1826 Tax_Id=7955 Gene_Symbol=zgc:86725 Zgc:86725 21 40 IPI00492396 40.65 2 1 1 42033.04 1826 Tax_Id=7955 Gene_Symbol=zgc:86725 Novel protein similar to vertebrate skeletal alpha actin 1 8 164 IPI00993122 25.12 0 2 2 3026090 1727 Tax_Id=7955 Gene_Symbol= Uncharacterized protein (Fragment) 8 175 IPI00890560 25.12 0 2 2 3200994 1727 Tax_Id=7955 Gene_Symbol=ttnb titin total 27 proteins

PAGE 176

176 Peptide r esults for c hymotrypsin digested m yosin generated by PEAKS DB s oftware Protein ID Protein Accession Peptide isUnique 10lgP ppm m/z z RT Scan #Spectra Start End hasPTM 13 IPI00484075 W.LDKNKDPLNDSVVQLY.Q N 64.8 1.3 930.9875 2 20.608 1658 2 596 611 N 13 IPI00484075 Y.LLEKSRVTF.Q N 53.74 0.2 546.8241 2 15.72 1206 4 269 277 N 13 IPI00484075 F.TNEKLQQFF.N N 50.56 0 577.7957 2 20.008 1601 1 483 491 N 13 IPI00484075 Y.KFGHTKVFF.K N 44.56 0.3 555.8082 2 15.656 1199 1 759 767 N 13 IPI00484075 Y.NISGWLDKNKDPLNDSVVQLY.Q Y 44.27 0.2 806.7483 3 24.733 2039 1 591 611 N 13 IPI00484075 F.GHTKVFF.K N 41.62 0.1 418.2266 2 14.63 1103 1 761 767 N 13 IPI00484075 F.IGVLDIAGF.E N 37.13 0.6 904.5143 1 27.379 2268 2 459 467 N 13 IPI00484075 F.VLEQEEY.K N 31.9 1.1 909.419 1 14.953 1133 1 497 503 N 13 IPI00484075 Y.KFGHTKVF.F N 30.32 0.7 321.8521 3 13.82 1025 1 759 766 N 13 IPI00484075 Y.GNAKTVRNDNSSRFGKF.I N 28.35 0.2 475.2462 4 13.839 1027 1 233 249 N 12 IPI00975366 W.LDKNKDPLNDSVVQLY.Q N 64.8 1.3 930.9875 2 20.608 1658 2 596 611 N 12 IPI00975366 Y.LLEKSRVTF.Q N 53.74 0.2 546.8241 2 15.72 1206 4 269 277 N 12 IPI00975366 F.TNEKLQQFF.N N 50.56 0 577.7957 2 20.008 1601 1 483 491 N 12 IPI00975366 Y.KFGHTKVFF.K N 44.56 0.3 555.8082 2 15.656 1199 1 760 768 N 12 IPI00975366 F.GHTKVFF.K N 41.62 0.1 418.2266 2 14.63 1103 1 762 768 N 12 IPI00975366 F.IGVLDIAGF.E N 37.13 0.6 904.5143 1 27.379 2268 2 459 467 N 12 IPI00975366 F.MLTDRENQSVLITGESGAGKTVNTKRVIQYF.A N 32.39 2.5 864.7064 4 21.704 1761 2 165 195 N 12 IPI00975366 F.VLEQEEY.K N 31.9 1.1 909.419 1 14.953 1133 1 497 503 N 12 IPI00975366 Y.KFGHTKVF.F N 30.32 0.7 321.8521 3 13.82 1025 1 760 767 N 12 IPI00975366 Y.GNAKTVRNDNSSRFGKF.I N 28.35 0.2 475.2462 4 13.839 1027 1 233 249 N 12 IPI00975366 Y.DAVVVAGYRGKKRIEAPPHIFSISDNAY.Q Y 18.89 1.4 439.9528 7 18.046 1421 5 135 162 N 12 IPI00975366 Y.AGTVDYNIVGW.L Y 9.33 2.1 1194.5815 1 23.954 1969 1 585 595 N 10 IPI00997196 W.LDKNKDPLNDSVVQLY.Q N 64.8 1.3 930.9875 2 20.608 1658 2 597 612 N 10 IPI00997196 Y.LLEKSRVTF.Q N 53.74 0.2 546.8241 2 15.72 1206 4 270 278 N 10 IPI00997196 F.TNEKLQQFF.N N 50.56 0 577.7957 2 20.008 1601 1 484 492 N 10 IPI00997196 Y.KFGHTKVFF.K N 44.56 0.3 555.8082 2 15.656 1199 1 762 770 N 10 IPI00997196 F.GHTKVFF.K N 41.62 0.1 418.2266 2 14.63 1103 1 764 770 N 10 IPI00997196 F.IGVLDIAGF.E N 37.13 0.6 904.5143 1 27.379 2268 2 460 468 N

PAGE 177

177 10 IPI00997196 F.MLTDRENQSVLITGESGAGKTVNTKRVIQYF.A N 32.39 2.5 864.7064 4 21.704 1761 2 166 196 N 10 IPI00997196 F.VLEQEEY.K N 31.9 1.1 909.419 1 14.953 1133 1 498 504 N 10 IPI00997196 Y.KFGHTKVF.F N 30.32 0.7 321.8521 3 13.82 1025 1 762 769 N 10 IPI00997196 Y.GNAKTVRNDNSSRFGKF.I N 28.35 0.2 475.2462 4 13.839 1027 1 234 250 N 10 IPI00997196 Y.DAVVVAGYRGKKRIEAPPHIFSISDNAY.Q Y 18.89 1.4 439.9528 7 18.046 1421 5 136 163 N 10 IPI00997196 Y.AGTVDYNIVGW.L Y 9.33 2.1 1194.5815 1 23.954 1969 1 586 596 N 6 IPI00500057 F.GRQLEEKEALVSQLTRGKQAF.T Y 57.88 0.6 597.8306 4 19.625 1566 1 1288 1308 N 6 IPI00500057 Y.LLEKSRVTF.Q N 53.74 0.2 546.8241 2 15.72 1206 4 271 279 N 6 IPI00500057 F.QLPDERGY.H Y 50.58 0.6 489.2382 2 14.209 1062 1 280 287 N 6 IPI00500057 F.TNEKLQQFF.N N 50.56 0 577.7957 2 20.008 1601 1 485 493 N 6 IPI00500057 F.GHTKVFF.K N 41.62 0.1 418.2266 2 14.63 1103 1 759 765 N 6 IPI00500057 F.IGVLDIAGF.E N 37.13 0.6 904.5143 1 27.379 2268 2 461 469 N 6 IPI00500057 F.MLTDRENQSVLITGESGAGKTVNTKRVIQYF.A N 32.39 2.5 864.7064 4 21.704 1761 2 167 197 N 6 IPI00500057 Y.ADFKQRY.K Y 32.25 0.4 464.2379 2 12.884 949 2 716 722 N 6 IPI00500057 F.VLEQEEY.K N 31.9 1.1 909.419 1 14.953 1133 1 499 505 N 6 IPI00500057 Y.GNAKTVRNDNSSRFGKF.I N 28.35 0.2 475.2462 4 13.839 1027 1 235 251 N 6 IPI00500057 Y.RGKKRMEAPPHIF.S Y 25.34 0.2 522.9609 3 14.081 1049 1 145 157 N 3 IPI00503572 F.GRQLEEKEALVSQLTRGKQAF.T Y 57.88 0.6 597.8306 4 19.625 1566 1 1290 1310 N 3 IPI00503572 Y.LLEKSRVTF.Q N 53.74 0.2 546.8241 2 15.72 1206 4 271 279 N 3 IPI00503572 F.QLPDERGY.H Y 50.58 0.6 489.2382 2 14.209 1062 1 280 287 N 3 IPI00503572 F.TNEKLQQFF.N N 50.56 0 577.7957 2 20.008 1601 1 485 493 N 3 IPI00503572 F.GHTKVFF.K N 41.62 0.1 418.2266 2 14.63 1103 1 761 767 N 3 IPI00503572 F.IGVLDIAGF.E N 37.13 0.6 904.5143 1 27.379 2268 2 461 469 N 3 IPI00503572 F.MLTDRENQSVLITGESGAGKTVNTKRVIQYF.A N 32.39 2.5 864.7064 4 21.704 1761 2 167 197 N 3 IPI00503572 Y.ADFKQRY.K Y 32.25 0.4 464.2379 2 12.884 949 2 718 724 N 3 IPI00503572 F.VLEQEEY.K N 31.9 1.1 909.419 1 14.953 1133 1 499 505 N 3 IPI00503572 Y.GNAKTVRNDNSSRFGKF.I N 28.35 0.2 475.2462 4 13.839 1027 1 235 251 N 3 IPI00503572 Y.RGKKRMEAPPHIF.S Y 25.34 0.2 522.9609 3 14.081 1049 1 145 157 N 2 IPI00773363 F.GRQLEEKEALVSQLTRGKQAF.T Y 57.88 0.6 597.8306 4 19.625 1566 1 1290 1310 N 2 IPI00773363 Y.LLEKSRVTF.Q N 53.74 0.2 546.8241 2 15.72 1206 4 271 279 N 2 IPI00773363 F.QLPDERGY.H Y 50.58 0.6 489.2382 2 14.209 1062 1 280 287 N

PAGE 178

178 2 IPI00773363 F.TNEKLQQFF.N N 50.56 0 577.7957 2 20.008 1601 1 485 493 N 2 IPI00773363 F.GHTKVFF.K N 41.62 0.1 418.2266 2 14.63 1103 1 761 767 N 2 IPI00773363 F.IGVLDIAGF.E N 37.13 0.6 904.5143 1 27.379 2268 2 461 469 N 2 IPI00773363 F.MLTDRENQSVLITGESGAGKTVNTKRVIQYF.A N 32.39 2.5 864.7064 4 21.704 1761 2 167 197 N 2 IPI00773363 Y.ADFKQRY.K Y 32.25 0.4 464.2379 2 12.884 949 2 718 724 N 2 IPI00773363 F.VLEQEEY.K N 31.9 1.1 909.419 1 14.953 1133 1 499 505 N 2 IPI00773363 Y.GNAKTVRNDNSSRFGKF.I N 28.35 0.2 475.2462 4 13.839 1027 1 235 251 N 2 IPI00773363 Y.RGKKRMEAPPHIF.S Y 25.34 0.2 522.9609 3 14.081 1049 1 145 157 N 5 IPI00932699 F.GRQLEEKEALVSQLTRGKQAF.T Y 57.88 0.6 597.8306 4 19.625 1566 1 1291 1311 N 5 IPI00932699 Y.LLEKSRVTF.Q N 53.74 0.2 546.8241 2 15.72 1206 4 270 278 N 5 IPI00932699 F.QLPDERGY.H Y 50.58 0.6 489.2382 2 14.209 1062 1 279 286 N 5 IPI00932699 F.TNEKLQQFF.N N 50.56 0 577.7957 2 20.008 1601 1 484 492 N 5 IPI00932699 F.GHTKVFF.K N 41.62 0.1 418.2266 2 14.63 1103 1 762 768 N 5 IPI00932699 F.IGVLDIAGF.E N 37.13 0.6 904.5143 1 27.379 2268 2 460 468 N 5 IPI00932699 F.MLTDRENQSVLITGESGAGKTVNTKRVIQYF.A N 32.39 2.5 864.7064 4 21.704 1761 2 166 196 N 5 IPI00932699 Y.ADFKQRY.K Y 32.25 0.4 464.2379 2 12.884 949 2 719 725 N 5 IPI00932699 F.VLEQEEY.K N 31.9 1.1 909.419 1 14.953 1133 1 498 504 N 5 IPI00932699 Y.GNAKTVRNDNSSRFGKF.I N 28.35 0.2 475.2462 4 13.839 1027 1 234 250 N 5 IPI00932699 Y.RGKKRMEAPPHIF.S Y 25.34 0.2 522.9609 3 14.081 1049 1 144 156 N 52 IPI00496651 F.SMFEQSQIQEYKEAF.T Y 61.9 1.8 932.9264 2 34.172 2832 21 21 35 N 52 IPI00496651 F.SMFEQSQIQEY.K Y 45.41 0.8 695.3037 2 46.426 3889 1 21 31 N 52 IPI00496651 F.EQSQIQEYKEAF.T Y 45.03 0.1 750.3543 2 28.974 2402 4 24 35 N 52 IPI00496651 F.EQSQIQEY.K Y 33.76 1 1024.4591 1 14.264 1067 2 24 31 N 52 IPI00496651 F.TVFLTMF.G Y 29.89 0.6 858.4425 1 28.162 2335 3 82 88 N 52 IPI00496651 F.KVLDPEATGTIKKEF.L Y 26.67 1.5 559.3145 3 27.315 2262 29 106 120 N 52 IPI00496651 Y.VITHGEEKEEE Y 19.92 0.6 433.8733 3 10.942 794 1 160 170 N 95 IPI00516071 F.TLDDVIQTGVDNPGHPF.I Y 79.53 0.7 912.9423 2 22.382 1825 1 52 68 N 97 IPI00919712 F.TLDDVIQTGVDNPGHPF.I Y 79.53 0.7 912.9423 2 22.382 1825 1 62 78 N 100 IPI00497388 F.TLDDVIQTGVDNPGHPF.I Y 79.53 0.7 912.9423 2 22.382 1825 1 52 68 N 101 IPI00506249 F.TLDDVIQTGVDNPGHPF.I Y 79.53 0.7 912.9423 2 22.382 1825 1 52 68 N 4648 IPI00497753 F.RVPTPNVSVVDLTVRLEKPAKY.D Y 53.42 1.3 621.1109 4 21.96 1785 1 232 253 N

PAGE 179

179 4648 IPI00497753 W.RDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAF.R Y 50.34 1.5 740.0049 5 25.231 2083 1 195 231 N 4649 IPI00963432 F.RVPTPNVSVVDLTVRLEKPAKY.D Y 53.42 1.3 621.1109 4 21.96 1785 1 485 506 N 4649 IPI00963432 W.RDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAF.R Y 50.34 1.5 740.0049 5 25.231 2083 1 448 484 N 4650 IPI00483373 F.NAKYNPVGASELRDLY.M Y 75.07 0.5 905.4605 2 20.093 1610 2 347 362 N 99 IPI00482319 M.PFGNTHNNF.K Y 42.07 2 524.2347 2 14.584 1099 1 2 10 N 20 IPI00504207 F.ETFNVPAMY.V Y 40.65 0.9 1071.4825 1 22.391 1826 1 127 135 N 21 IPI00507230 F.ETFNVPAMY.V Y 40.65 0.9 1071.4825 1 22.391 1826 1 127 135 N 26 IPI00509458 F.ETFNVPAMY.V Y 40.65 0.9 1071.4825 1 22.391 1826 1 127 135 N 22 IPI00551966 F.ETFNVPAMY.V Y 40.65 0.9 1071.4825 1 22.391 1826 1 127 135 N 27 IPI00551994 F.ETFNVPAMY.V Y 40.65 0.9 1071.4825 1 22.391 1826 1 127 135 N 28 IPI00570197 F.ETFNVPAMY.V Y 40.65 0.9 1071.4825 1 22.391 1826 1 127 135 N 23 IPI00628880 F.ETFNVPAMY.V Y 40.65 0.9 1071.4825 1 22.391 1826 1 127 135 N 41 IPI00931756 F.ETFNVPAMY.V Y 40.65 0.9 1071.4825 1 22.391 1826 1 127 135 N 40 IPI00492396 F.ETFNVPAMY.V Y 40.65 0.9 1071.4825 1 22.391 1826 1 127 135 N 164 IPI00993122 F.LRKLSNISIPMSQKLRLECKFT(+79.97)GDRKLFVTW.Y Y 17.25 1.6 632.1782 6 21.351 1727 1 2915 2945 Y 164 IPI00993122 Y.T(+79.97)ITAKNDGGEVKKSVIVEVLDVPGPVGVPF.T Y 15.74 2.4 524.9505 6 18.766 1487 1 10732 10761 Y 164 IPI00993122 F.LRKLSNIS(+79.97)IPMSQKLRLECKFTGDRKLFVTW.Y Y 9.99 2.4 758.413 5 49.273 4124 1 2915 2945 Y 164 IPI00993122 F.SIELTHSDVKGS(+79.97)QW.I Y 7.17 1.8 556.2549 3 45.922 3846 2 462 475 Y 175 IPI00890560 F.LRKLSNISIPMSQKLRLECKFT(+79.97)GDRKLFVTW.Y Y 17.25 1.6 632.1782 6 21.351 1727 1 4488 4518 Y 175 IPI00890560 Y.T(+79.97)ITAKNDGGEVKKSVIVEVLDVPGPVGVPF.T Y 15.74 2.4 524.9505 6 18.766 1487 1 12305 12334 Y 175 IPI00890560 F.LRKLSNIS(+79.97)IPMSQKLRLECKFTGDRKLFVTW.Y Y 9.99 2.4 758.413 5 49.273 4124 1 4488 4518 Y 175 IPI00890560 F.SIELTHSDVKGS(+79.97)QW.I Y 7.17 1.8 556.2549 3 45.922 3846 2 2035 2048 Y

PAGE 180

180 APPENDIX H PEAKS DATABASE SEARC H RESULTS FOR TRYPSI N Database s earch s ummary r eport (generated by Peaks DB software)

PAGE 181

181

PAGE 182

182 Protein r esults for t rypsin digested m yosin generated by PEAK S DB s oftware Protein Group Protein ID Accession 10lgP Coverage (%) #Peptides #Unique Mass Best Unique Peptide Description 1 6 IPI00500057 504.48 28 74 1 222199.0312 1101 Tax_Id=7955 Gene_Symbol=LOC100149148 myosin heavy chain, fast skeletal muscle 2 3 IPI00503572 503.32 27 74 0 222147.9531 Tax_Id=7955 Gene_Symbol=myhz1.1 myosin, heavy polypeptide 1.1, skeletal muscle 2 2 IPI00773363 503.32 27 74 0 222157.875 Tax_Id=7955 Gene_Symbol=myhz1.2 Novel myosin family protein 4 1 IPI00933204 503.03 26 73 4 221878.8125 1083 Tax_Id=7955 Gene_Symbol=myhz2 Myosin, heavy polypeptide 2, fast muscle specific 3 4 IPI00858466 501.96 27 72 0 222215.1094 Tax_Id=7955 Gene_Symbol=myhz1.3 Uncharacterized protein 5 8 IPI00961738 469.78 23 59 1 221423.5469 1297 Tax_Id=7955 Gene_Symbol=wu:fd14a01 myosin heavy chain, fast skeletal muscle 6 13 IPI00484075 439.19 16 43 0 222841.5781 Tax_Id=7955 Gene_Symbol=myhb Uncharacterized protein 11 31 IPI00882712 316.03 9 20 0 223229.7812 Tax_Id=7955 Gene_Symbol=vmhc Ventricular myosin heavy chain 7 14 IPI00934366 315.33 10 22 0 223043.4375 Tax_Id=7955 Gene_Symbol=smyhc1 Uncharacterized protein 9 38 IPI00496068 310.4 10 21 0 223285.625 Tax_Id=7955 Gene_Symbol=smyhc2 Slow myosin heavy chain 2 8 11 IPI00490216 310.19 11 21 3 222803.3594 1036 Tax_Id=7955 Gene_Symbol=myh6 Myosin, heavy polypeptide 6, cardiac muscle, alpha 10 30 IPI00616127 302.55 7 17 0 224164 Tax_Id=7955 Gene_Symbol=vmhcl Uncharacterized protein 15 20 IPI00504207 302.03 47 18 18 41972.9648 1174 Tax_Id=7955 Gene_Symbol=actc1b Skeletal alpha1 actin 15 21 IPI00507230 302.03 47 18 18 41974.9375 1174 Tax_Id=7955 Gene_Symbol=hm:zewp0073;actc1a Actin, alpha, cardiac muscle like 15 26 IPI00509458 302.03 47 18 18 42004.9648 1174 Tax_Id=7955 Gene_Symbol=zgc:86709 Zgc:86709 protein 15 22 IPI00551966 302.03 47 18 18 41983.0039 1174 Tax_Id=7955 Gene_Symbol=actc1b Actin, alpha 1, skeletal muscle 15 28 IPI00570197 302.03 47 18 18 42018.9922 1174 Tax_Id=7955 Gene_Symbol=acta1a Actin, alpha 1a, skeletal muscle 15 23 IPI00628880 302.03 47 18 18 41974.9375 1174 Tax_Id=7955 Gene_Symbol=acta1b Actin, alpha 1b, skeletal muscle 12 18 IPI00501288 292.79 6 15 1 226660.125 1709 Tax_Id=7955 Gene_Symbol=myh7;myh7bb Uncharacterized protein 14 29 IPI00800858 259.61 4 11 0 225510.3594 Tax_Id=7955 Gene_Symbol=myh7b myosin 7 19 112 IPI00508152 205.67 35 8 1 32722.6777 1497 Tax_Id=7955 Gene_Symbol=tpma Tropomyosin alpha 1 chain 20 111 IPI00506010 190.33 30 8 1 32889.8633 1071 Tax_Id=7955 Gene_Symbol=tpm3 Zgc:77592 13 63 IPI00488248 182.47 24 4 4 16767.8711 2783 Tax_Id=7955 Gene_Symbol=mylz3 Myosin, light polypeptide 3, skeletal muscle 21 45 IPI00488085 179.53 19 5 1 18865.3379 1737 Tax_Id=7955 Gene_Symbol=mylz2 Myosin, light polypeptide 2, skeletal muscle 22 51 IPI00919778 171.6 21 5 1 15343.418 1288 Tax_Id=7955 Gene_Symbol=zgc:103639 Uncharacterized protein 22 52 IPI00496651 171.6 17 5 1 19122.625 1288 Tax_Id=7955 Gene_Symbol=zgc:103639 Zgc:103639 34 98 IPI00508395 125.22 7 2 2 42851.7188 1612 Tax_Id=7955 Gene_Symbol=ckmb Ckmb protein

PAGE 183

183 34 99 IPI00482319 125.22 6 2 2 42814.6055 1612 Tax_Id=7955 Gene_Symbol=ckma Muscle specific creatine kinase 24 5441 IPI00487267 121.43 12 4 1 28731.1191 1537 Tax_Id=7955 Gene_Symbol=zgc:63734 Zgc:63734 27 70 IPI00615483 116.06 0 3 2 3648343.75 1784 Tax_Id=7955 Gene_Symbol=ttna Titin a 27 73 IPI01016913 116.06 0 3 2 2114474.5 1784 Tax_Id=7955 Gene_Symbol=ttna Novel protein similar to human titin 36 5442 IPI00493235 85.15 2 2 2 113581.3984 1767 Tax_Id=7955 Gene_Symbol=atp2a2b Novel protein similar to vertebrate ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 67 5460 IPI00852114 84.38 1 1 1 91669.3984 1964 Tax_Id=7955 Gene_Symbol=zgc:136820;mybpc2a Zgc:136545 67 5461 IPI00786523 84.38 1 1 1 125159.1875 1964 Tax_Id=7955 Gene_Symbol=zgc:136820;mybpc2a Zgc:136820 66 4648 IPI00497753 82.82 4 1 1 35784.0586 1876 Tax_Id=7955 Gene_Symbol=gapdh Glyceraldehyde 3 phosphate dehydrogenase 66 4649 IPI00963432 82.82 2 1 1 65912.6953 1876 Tax_Id=7955 Gene_Symbol= hypothetical protein LOC326976 54 5449 IPI00900800 82.05 1 1 1 150574.5469 2194 Tax_Id=7955 Gene_Symbol=wu:fi38e05 Uncharacterized protein 54 5450 IPI01004767 82.05 1 1 1 165270.25 2194 Tax_Id=7955 Gene_Symbol= protein tyrosine phosphatase, receptor type, D like 37 108 IPI00501538 80.28 7 1 1 21441.8359 1515 Tax_Id=7955 Gene_Symbol=zgc:91930 Zgc:91930 38 5451 IPI00817940 62.77 5 1 1 26424.4316 1187 Tax_Id=7955 Gene_Symbol=tnnt3b Uncharacterized protein 38 5452 IPI00993469 62.77 5 1 1 27109.7266 1187 Tax_Id=7955 Gene_Symbol=tnnt3b Uncharacterized protein 38 5453 IPI00817723 62.77 5 1 1 27293.9219 1187 Tax_Id=7955 Gene_Symbol=tnnt3b Tnnt3b protein 38 5454 IPI00510978 62.77 5 1 1 27830.416 1187 Tax_Id=7955 Gene_Symbol=tnnt3b Fast troponin T isoform b 38 5455 IPI00817598 62.77 5 1 1 27180.9922 1187 Tax_Id=7955 Gene_Symbol=tnnt3b Uncharacterized protein 38 5456 IPI00817728 62.77 4 1 1 29337.8594 1187 Tax_Id=7955 Gene_Symbol=tnnt3b Putative uncharacterized protein 38 5457 IPI00972437 62.77 4 1 1 33442.3477 1187 Tax_Id=7955 Gene_Symbol=tnnt3b Uncharacterized protein 38 5458 IPI00817813 62.77 4 1 1 33598.5273 1187 Tax_Id=7955 Gene_Symbol=tnnt3b Tnnt3b protein 38 5459 IPI00817433 62.77 4 1 1 34885.75 1187 Tax_Id=7955 Gene_Symbol=tnnt3b Uncharacterized protein 28 437 IPI00901053 61.62 1 1 1 179550.7031 1475 Tax_Id=7955 Gene_Symbol=cep152 Uncharacterized protein 30 175 IPI00890560 55.56 0 2 1 3200993.75 1655 Tax_Id=7955 Gene_Symbol=ttnb titin 30 164 IPI00993122 55.56 0 2 1 3026089.5 1655 Tax_Id=7955 Gene_Symbol= Uncharacterized protein (Fragment) 73 5467 IPI00902219 45.05 0 1 1 174044.0625 1323 Tax_Id=7955 Gene_Symbol=im:7165255 Uncharacterized protein 73 5468 IPI00968820 45.05 0 1 1 204515.9062 1323 Tax_Id=7955 Gene_Symbol=wnk1 Uncharacterized protein 73 5469 IPI00901954 45.05 0 1 1 216468.4531 1323 Tax_Id=7955 Gene_Symbol= serine/threonine protein kinase WNK1 like 70 5464 IPI00490239 38.21 2 1 1 33454.8398 1155 Tax_Id=7955 Gene_Symbol=tnnt3a Uncharacterized protein 69 5463 IPI00832038 36.68 2 1 1 63944.7227 1528 Tax_Id=7955 Gene_Symbol=LOC100003595 Novel protein similar to vertebrate adenylate cyclase family 32 1228 IPI00802686 28.89 1 2 2 323595.125 1239 Tax_Id=7955 Gene_Symbol=nipblb Uncharacterized protein 32 5443 IPI00897175 28.89 1 2 2 327605.5938 1239 Tax_Id=7955 Gene_Symbol=nipblb Uncharacterized protein

PAGE 184

184 17 5474 IPI00899172 26.4 3 1 1 1044279 3277 Tax_Id=7955 Gene_Symbol=si:dkey 85a20.4 Uncharacterized protein 17 5475 IPI00961853 26.4 1 1 1 178837.7188 3277 Tax_Id=7955 Gene_Symbol=si:dkey 85a20.4 Uncharacterized protein 25 5477 IPI00501623 26.36 2 1 1 31395.207 1700 Tax_Id=7955 Gene_Symbol=otx5 Orthodenticle homolog 5 26 2304 IPI00487236 25.75 0 1 1 294555.7812 546 Tax_Id=7955 Gene_Symbol=flncb Uncharacterized protein 18 5476 IPI00960403 25.54 1 1 1 133889.7344 3729 Tax_Id=7955 Gene_Symbol= Gag protease integrase RT RNaseH polyprotein like 23 288 IPI00859309 21.19 0 1 1 593962.25 2284 Tax_Id=7955 Gene_Symbol=si:dkey 266j7.1 novel protein similar to H.sapiens PCLO, piccolo 80 5486 IPI00501009 20.85 2 1 1 47410.4648 3921 Tax_Id=7955 Gene_Symbol= Uncharacterized protein 80 5487 IPI00932925 20.85 2 1 1 47463.5117 3921 Tax_Id=7955 Gene_Symbol=got2b Aspartate aminotransferase 49 5488 IPI00510504 20.51 0 1 1 327396 831 Tax_Id=7955 Gene_Symbol=ash1l Uncharacterized protein 81 5490 IPI00999083 20.19 2 1 1 162139.1562 1353 Tax_Id=7955 Gene_Symbol= Rho kinase 2 33 5466 IPI01007404 20.07 2 1 1 153309.625 2440 Tax_Id=7955 Gene_Symbol= Uncharacterized protein 82 5491 IPI00998552 20.07 2 1 1 59667.7461 2332 Tax_Id=7955 Gene_Symbol=LOC560938 Uncharacterized protein total 70 proteins

PAGE 185

185 Peptide r esults for t rypsin digested m yosin generated by P EAKS DB s oftware Protein ID Protein Accession Peptide isUnique 10lgP ppm m/z z RT Scan #Spectra Start End hasPTM 6 IPI00500057 K.MEGDLNEMEIQLSHANR.Q N 146.95 0.1 993.9541 2 20.596 1778 20 1618 1634 N 6 IPI00500057 K.GGSMQTVSSQFR.E N 112.37 0.5 642.8033 2 14.967 1225 13 641 652 N 6 IPI00500057 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1757 1771 N 6 IPI00500057 K.TPGLMENFLVIHQLR.C N 104.56 0.3 884.4821 2 25.096 2188 2 680 694 N 6 IPI00500057 R.LQEAEEQIEAVNSK.C N 104.32 0.4 794.3969 2 51.019 4288 13 1397 1410 N 6 IPI00500057 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1758 1771 N 6 IPI00500057 K.FTGAVLHHGNMK.F N 102.41 0.8 656.3344 2 13.25 1054 2 356 367 N 6 IPI00500057 K.GGSM(+15.99)QTVSSQFR.E N 100.99 0.7 650.8007 2 13.526 1078 2 641 652 Y 6 IPI00500057 K.KQADSVAELGEQIDNLQR.V N 99.26 0.2 1007.513 2 20.724 1790 4 1195 1212 N 6 IPI00500057 K.SAETEKELANMK.E Y 98 0.5 675.8317 2 13.765 1101 2 842 853 N 6 IPI00500057 K.SEYKMEIDDLSSNM(+15.99)EAVAK.A N 95.57 0.2 1088.493 2 21.67 1880 2 1222 1240 Y 6 IPI00500057 K.AGLLGTLEEMR.D N 95.04 0.4 595.3156 2 23.555 2053 35 767 777 N 6 IPI00500057 K.VAEQELVDASER.V N 94.92 0.5 673.3336 2 15.024 1231 1 1701 1712 N 6 IPI00500057 K.TKLEQQVDDLEGSLEQEKKLR.M N 94.89 1.2 829.4404 3 21.306 1847 2 1025 1045 N 6 IPI00500057 R.DLEESTLQHEATAAALR.K N 94.23 0.3 927.963 2 19.562 1681 4 1177 1193 N 6 IPI00500057 K.KGGSMQTVSSQFR.E N 94.18 0.6 706.8507 2 14.062 1131 3 640 652 N 6 IPI00500057 K.DAQLHLDDAVR.A N 94.15 0.6 626.818 2 15.259 1255 35 1652 1662 N 6 IPI00500057 K.KMEGDLNEMEIQLSHANR.Q N 93.3 1 1058.003 2 19.061 1634 8 1617 1634 N 6 IPI00500057 K.KM(+15.99)EGDLNEMEIQLSHANR.Q N 92.12 0.3 711.0015 3 17.562 1486 1 1617 1634 Y 6 IPI00500057 K.VQHELEEAEER.A N 90.69 0.5 684.8228 2 12.917 1024 2 1899 1909 N 6 IPI00500057 K.TKLEQQVDDLEGSLEQEKK.L N 90.21 0.6 739.7126 3 20.785 1796 2 1025 1043 N 6 IPI00500057 K.KKMEGDLNEMEIQLSHANR.Q N 89.06 0 748.3684 3 17.091 1439 15 1616 1634 N 6 IPI00500057 R.KVAEQELVDASER.V N 88.91 0.2 737.3809 2 14.239 1149 3 1700 1712 N 6 IPI00500057 K.QADSVAELGEQIDNLQR.V N 87.89 1.2 943.4673 2 22.248 1933 3 1196 1212 N 6 IPI00500057 K.IEDEQSLGAQLQKK.I N 87.83 0.3 793.9225 2 14.913 1220 2 1094 1107 N 6 IPI00500057 K.NLQQEISDLTEQIGETGK.S N 87.57 0.9 1001.999 2 27.013 2345 1 1504 1521 N 6 IPI00500057 R.KKQADSVAELGEQIDNLQR.V N 87.29 0.9 1071.562 2 18.889 1617 7 1194 1212 N 6 IPI00500057 R.RDLEESTLQHEATAAALR.K N 86.71 0.8 1006.015 2 17.252 1455 4 1176 1193 N

PAGE 186

186 6 IPI00500057 K.VLNASVIPEGQFIDNK.K N 86.35 0.1 872.4675 2 21.406 1856 1 724 739 N 6 IPI00500057 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 952 963 N 6 IPI00500057 R.QLEEKEALVSQLTR.G N 85.82 1 822.4509 2 17.365 1466 33 1290 1303 N 6 IPI00500057 R.EQFEEEQEAKAELQR.G N 84.5 0.9 932.4387 2 16.361 1366 5 1345 1359 N 6 IPI00500057 R.KVQHELEEAEER.A N 84.44 1.1 748.8698 2 12.234 969 3 1898 1909 N 6 IPI00500057 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1758 1771 Y 6 IPI00500057 R.IEELEEEIEAERAAR.A N 82.3 0.2 893.9443 2 18.439 1573 2 1115 1129 N 6 IPI00500057 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1758 1770 Y 6 IPI00500057 K.MEIDDLSSNM(+15.99)EAVAK.A N 79.32 0.2 834.8765 2 20.588 1777 20 1226 1240 Y 6 IPI00500057 K.DFETSQLLSK.I N 79.24 0.3 584.2984 2 18.021 1531 26 1084 1093 N 6 IPI00500057 R.IEELEEEIEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1115 1126 N 6 IPI00500057 K.IEDEQSLGAQLQK.K N 77.68 0.9 729.8746 2 15.833 1311 1 1094 1106 N 6 IPI00500057 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1757 1771 Y 6 IPI00500057 R.VKELTYQTEEDKK.N N 74.8 0.1 537.6138 3 12.375 980 2 1847 1859 N 6 IPI00500057 R.LDEAENLAM(+15.99)K.G N 74.76 0.3 575.2762 2 13.758 1100 1 1797 1806 Y 6 IPI00500057 R.ENLGKLMTNLR.S N 74.7 1 644.8564 2 18.112 1541 1 653 663 N 6 IPI00500057 R.TLEDQLSEIK.S N 73.95 0 588.3113 2 19.446 1670 5 1251 1260 N 6 IPI00500057 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1757 1771 Y 6 IPI00500057 R.EQFEEEQEAK.A N 73.74 0 633.7778 2 12.289 973 1 1345 1354 N 6 IPI00500057 K.ELTYQTEEDKK.N N 73.25 0.4 692.3353 2 12.299 974 1 1849 1859 N 6 IPI00500057 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 953 963 N 6 IPI00500057 K.AGLLGTLEEM(+15.99)R.D N 73.06 0.8 603.3138 2 19.327 1659 2 767 777 Y 6 IPI00500057 K.KDFETSQLLSK.I N 72.88 0.1 648.3456 2 15.278 1258 1 1083 1093 N 6 IPI00500057 R.DLEESTLQHEATAAALRK.K N 72.77 0.4 661.6765 3 18.027 1532 1 1177 1194 N 6 IPI00500057 K.KMEGDLNEM(+15.99)EIQLSHANR.Q N 72.57 1.4 711.0007 3 19.127 1640 2 1617 1634 Y 6 IPI00500057 K.TKLEQQVDDLEGSLEQEK.K N 72.48 0.9 697.014 3 21.992 1910 1 1025 1042 N 6 IPI00500057 K.MEGDLNEM(+15.99)EIQLSHANR.Q N 70.89 0.5 668.3037 3 16.541 1385 1 1618 1634 Y 6 IPI00500057 K.KKDFETSQLLSK.I N 69.93 0.3 712.3934 2 14.246 1150 2 1082 1093 N 6 IPI00500057 R.LDEAENLAMK.G N 69.57 1.5 567.2798 2 14.792 1207 3 1797 1806 N 6 IPI00500057 K.LYDQHLGK.C N 69.42 1.4 487.258 2 11.849 937 3 556 563 N 6 IPI00500057 K.IEDEQSLGAQLQKKIKELQAR.I N 68.98 0.1 607.0906 4 22.519 1959 2 1094 1114 N

PAGE 187

187 6 IPI00500057 K.EKSEYKMEIDDLSSNM(+15.99)EAVAK.A N 68.83 0.5 811.7106 3 21.05 1821 1 1220 1240 Y 6 IPI00500057 K.M(+15.99)EIDDLSSNM(+15.99)EAVAK.A N 66.32 0.9 842.8731 2 18.456 1575 1 1226 1240 Y 6 IPI00500057 K.VLNASVIPEGQFIDNKK.A N 64.59 0.8 624.6785 3 19.57 1682 1 724 740 N 6 IPI00500057 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1375 1382 N 6 IPI00500057 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1758 1771 Y 6 IPI00500057 R.NFDKVLAEWK.Q N 61.76 0.3 417.2239 3 20.741 1792 2 1448 1457 N 6 IPI00500057 K.DLQHRLDEAENLAMK.G N 60.68 1.2 891.9449 2 20.094 1730 3 1792 1806 N 6 IPI00500057 R.HDCDLLR.E N 60.31 0.4 436.208 2 13.626 1087 1 1338 1344 N 6 IPI00500057 K.EALVSQLTR.G N 56.97 0.9 508.7899 2 47.214 3983 7 1295 1303 N 6 IPI00500057 R.ILYADFK.Q N 56.89 0.2 435.2421 2 16.885 1417 10 713 719 N 6 IPI00500057 K.KGGSM(+15.99)QTVSSQFR.E N 56.47 0.5 476.9013 3 12.661 1003 2 640 652 Y 6 IPI00500057 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1864 1874 N 6 IPI00500057 R.SLSTELFK.M N 52.49 0.6 462.7557 2 35.763 3049 41 1476 1483 N 6 IPI00500057 R.ADLSRELEEISER.L N 50.52 1.5 516.2625 3 20.916 1808 1 1137 1149 N 6 IPI00500057 K.LEQQVDDLEGSLEQEKK.L N 48.54 0.6 663.3325 3 18.209 1550 1 1027 1043 N 6 IPI00500057 K.AGLLGTLEEMRDEK.L N 47.23 0.5 521.2681 3 22.569 1963 2 767 780 N 6 IPI00500057 K.MEIDDLSSNM(+15.99)EAVAKAK.A N 43.95 0.1 623.2973 3 20.181 1739 1 1226 1242 Y 6 IPI00500057 R.VQLELNQVKGEIDR.K N 43.71 0.4 820.9515 2 18.653 1595 4 1561 1574 N 6 IPI00500057 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1758 1770 N 6 IPI00500057 K.DLQHRLDEAENLAM(+15.99)K.G N 41.09 0.6 600.2962 3 20.172 1738 1 1792 1806 Y 6 IPI00500057 R.VQLELNQVKGEIDRK.L N 40.47 0.3 884.9996 2 17.296 1459 3 1561 1575 N 6 IPI00500057 K.CASLEK.T N 39.15 0.1 325.6625 2 3.599 287 3 1411 1416 N 6 IPI00500057 K.LRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1044 1050 N 6 IPI00500057 K.NLEITVK.D N 37.86 0.2 408.7448 2 14.765 1205 1 1785 1791 N 6 IPI00500057 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 658 663 N 6 IPI00500057 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1864 1870 N 6 IPI00500057 K.KKGGSMQTVSSQFR.E N 31.75 0.6 385.9527 4 13.516 1077 1 639 652 N 6 IPI00500057 R.SFMNVK.H N 31.11 0.1 363.1862 2 14.189 1144 1 820 825 N 6 IPI00500057 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 658 663 Y 6 IPI00500057 K.IQLEAK.L N 28.41 0.7 351.213 2 11.787 932 1 913 918 N 6 IPI00500057 K.FTGAVLHHGNM(+15.99)K.F N 22.15 1.5 332.6693 4 13.307 1059 1 356 367 Y

PAGE 188

188 6 IPI00500057 K.IEDEQSLGAQLQKKIK.E N 14.55 0.3 457.7597 4 16.792 1409 1 1094 1109 N 6 IPI00500057 R.ESIYT(+79.97)IQYNIRSFM(+15.99)NVK.H N 7.27 0.8 551.2625 4 3.664 292 1 809 825 Y 3 IPI00503572 K.MEGDLNEMEIQLSHANR.Q N 146.95 0.1 993.9541 2 20.596 1778 20 1620 1636 N 3 IPI00503572 K.GGSMQTVSSQFR.E N 112.37 0.5 642.8033 2 14.967 1225 13 643 654 N 3 IPI00503572 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1759 1773 N 3 IPI00503572 K.TPGLMENFLVIHQLR.C N 104.56 0.3 884.4821 2 25.096 2188 2 682 696 N 3 IPI00503572 R.LQEAEEQIEAVNSK.C N 104.32 0.4 794.3969 2 51.019 4288 13 1399 1412 N 3 IPI00503572 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1760 1773 N 3 IPI00503572 K.FTGAVLHHGNMK.F N 102.41 0.8 656.3344 2 13.25 1054 2 356 367 N 3 IPI00503572 K.GGSM(+15.99)QTVSSQFR.E N 100.99 0.7 650.8007 2 13.526 1078 2 643 654 Y 3 IPI00503572 K.KQADSVAELGEQIDNLQR.V N 99.26 0.2 1007.513 2 20.724 1790 4 1197 1214 N 3 IPI00503572 K.SEYKMEIDDLSSNM(+15.99)EAVAK.A N 95.57 0.2 1088.493 2 21.67 1880 2 1224 1242 Y 3 IPI00503572 K.AGLLGTLEEMR.D N 95.04 0.4 595.3156 2 23.555 2053 35 769 779 N 3 IPI00503572 K.VAEQELVDASER.V N 94.92 0.5 673.3336 2 15.024 1231 1 1703 1714 N 3 IPI00503572 K.TKLEQQVDDLEGSLEQEKKLR.M N 94.89 1.2 829.4404 3 21.306 1847 2 1027 1047 N 3 IPI00503572 R.DLEESTLQHEATAAALR.K N 94.23 0.3 927.963 2 19.562 1681 4 1179 1195 N 3 IPI00503572 K.KGGSMQTVSSQFR.E N 94.18 0.6 706.8507 2 14.062 1131 3 642 654 N 3 IPI00503572 K.DAQLHLDDAVR.G N 94.15 0.6 626.818 2 15.259 1255 35 1654 1664 N 3 IPI00503572 K.KMEGDLNEMEIQLSHANR.Q N 93.3 1 1058.003 2 19.061 1634 8 1619 1636 N 3 IPI00503572 K.KM(+15.99)EGDLNEMEIQLSHANR.Q N 92.12 0.3 711.0015 3 17.562 1486 1 1619 1636 Y 3 IPI00503572 K.VQHELEEAEER.A N 90.69 0.5 684.8228 2 12.917 1024 2 1901 1911 N 3 IPI00503572 K.TKLEQQVDDLEGSLEQEKK.L N 90.21 0.6 739.7126 3 20.785 1796 2 1027 1045 N 3 IPI00503572 K.KKMEGDLNEMEIQLSHANR.Q N 89.06 0 748.3684 3 17.091 1439 15 1618 1636 N 3 IPI00503572 R.KVAEQELVDASER.V N 88.91 0.2 737.3809 2 14.239 1149 3 1702 1714 N 3 IPI00503572 K.QADSVAELGEQIDNLQR.V N 87.89 1.2 943.4673 2 22.248 1933 3 1198 1214 N 3 IPI00503572 K.IEDEQSLGAQLQKK.I N 87.83 0.3 793.9225 2 14.913 1220 2 1096 1109 N 3 IPI00503572 K.NLQQEISDLTEQLGETGK.S N 87.57 0.9 1001.999 2 27.013 2345 1 1506 1523 N 3 IPI00503572 R.KKQADSVAELGEQIDNLQR.V N 87.29 0.9 1071.562 2 18.889 1617 7 1196 1214 N 3 IPI00503572 R.RDLEESTLQHEATAAALR.K N 86.71 0.8 1006.015 2 17.252 1455 4 1178 1195 N 3 IPI00503572 K.VLNASVIPEGQFIDNK.K N 86.35 0.1 872.4675 2 21.406 1856 1 726 741 N 3 IPI00503572 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 954 965 N

PAGE 189

189 3 IPI00503572 R.QLEEKEALVSQLTR.G N 85.82 1 822.4509 2 17.365 1466 33 1292 1305 N 3 IPI00503572 R.EQFEEEQEAKAELQR.G N 84.5 0.9 932.4387 2 16.361 1366 5 1347 1361 N 3 IPI00503572 R.KVQHELEEAEER.A N 84.44 1.1 748.8698 2 12.234 969 3 1900 1911 N 3 IPI00503572 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1760 1773 Y 3 IPI00503572 R.IEELEEEIEAERAAR.A N 82.3 0.2 893.9443 2 18.439 1573 2 1117 1131 N 3 IPI00503572 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1760 1772 Y 3 IPI00503572 K.MEIDDLSSNM(+15.99)EAVAK.A N 79.32 0.2 834.8765 2 20.588 1777 20 1228 1242 Y 3 IPI00503572 K.DFETSQLLSK.I N 79.24 0.3 584.2984 2 18.021 1531 26 1086 1095 N 3 IPI00503572 R.IEELEEEIEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1117 1128 N 3 IPI00503572 K.IEDEQSLGAQLQK.K N 77.68 0.9 729.8746 2 15.833 1311 1 1096 1108 N 3 IPI00503572 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1759 1773 Y 3 IPI00503572 R.VKELTYQTEEDKK.N N 74.8 0.1 537.6138 3 12.375 980 2 1849 1861 N 3 IPI00503572 R.LDEAENLAM(+15.99)K.G N 74.76 0.3 575.2762 2 13.758 1100 1 1799 1808 Y 3 IPI00503572 R.ENLGKLMTNLR.S N 74.7 1 644.8564 2 18.112 1541 1 655 665 N 3 IPI00503572 R.TLEDQLSEIK.S N 73.95 0 588.3113 2 19.446 1670 5 1253 1262 N 3 IPI00503572 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1759 1773 Y 3 IPI00503572 R.EQFEEEQEAK.A N 73.74 0 633.7778 2 12.289 973 1 1347 1356 N 3 IPI00503572 K.ELTYQTEEDKK.N N 73.25 0.4 692.3353 2 12.299 974 1 1851 1861 N 3 IPI00503572 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 955 965 N 3 IPI00503572 K.AGLLGTLEEM(+15.99)R.D N 73.06 0.8 603.3138 2 19.327 1659 2 769 779 Y 3 IPI00503572 K.KDFETSQLLSK.I N 72.88 0.1 648.3456 2 15.278 1258 1 1085 1095 N 3 IPI00503572 R.DLEESTLQHEATAAALRK.K N 72.77 0.4 661.6765 3 18.027 1532 1 1179 1196 N 3 IPI00503572 K.KMEGDLNEM(+15.99)EIQLSHANR.Q N 72.57 1.4 711.0007 3 19.127 1640 2 1619 1636 Y 3 IPI00503572 K.TKLEQQVDDLEGSLEQEK.K N 72.48 0.9 697.014 3 21.992 1910 1 1027 1044 N 3 IPI00503572 K.MEGDLNEM(+15.99)EIQLSHANR.Q N 70.89 0.5 668.3037 3 16.541 1385 1 1620 1636 Y 3 IPI00503572 K.KKDFETSQLLSK.I N 69.93 0.3 712.3934 2 14.246 1150 2 1084 1095 N 3 IPI00503572 R.LDEAENLAMK.G N 69.57 1.5 567.2798 2 14.792 1207 3 1799 1808 N 3 IPI00503572 K.LYDQHLGK.C N 69.42 1.4 487.258 2 11.849 937 3 556 563 N 3 IPI00503572 K.IEDEQSLGAQLQKKIKELQAR.I N 68.98 0.1 607.0906 4 22.519 1959 2 1096 1116 N 3 IPI00503572 K.EKSEYKMEIDDLSSNM(+15.99)EAVAK.A N 68.83 0.5 811.7106 3 21.05 1821 1 1222 1242 Y 3 IPI00503572 K.M(+15.99)EIDDLSSNM(+15.99)EAVAK.A N 66.32 0.9 842.8731 2 18.456 1575 1 1228 1242 Y

PAGE 190

190 3 IPI00503572 K.VLNASVIPEGQFIDNKK.A N 64.59 0.8 624.6785 3 19.57 1682 1 726 742 N 3 IPI00503572 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1377 1384 N 3 IPI00503572 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1760 1773 Y 3 IPI00503572 K.NLTEEM(+15.99)AAQDESIGKLTK.E N 61.88 0.4 997.4914 2 19.31 1657 2 979 996 Y 3 IPI00503572 R.NFDKVLAEWK.Q N 61.76 0.3 417.2239 3 20.741 1792 2 1450 1459 N 3 IPI00503572 K.NLTEEM(+15.99)AAQDESIGK.L N 60.96 0.8 826.3782 2 16.157 1345 2 979 993 Y 3 IPI00503572 K.DLQHRLDEAENLAMK.G N 60.68 1.2 891.9449 2 20.094 1730 3 1794 1808 N 3 IPI00503572 R.HDCDLLR.E N 60.31 0.4 436.208 2 13.626 1087 1 1340 1346 N 3 IPI00503572 K.EALVSQLTR.G N 56.97 0.9 508.7899 2 47.214 3983 7 1297 1305 N 3 IPI00503572 R.ILYADFK.Q N 56.89 0.2 435.2421 2 16.885 1417 10 715 721 N 3 IPI00503572 K.KGGSM(+15.99)QTVSSQFR.E N 56.47 0.5 476.9013 3 12.661 1003 2 642 654 Y 3 IPI00503572 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1866 1876 N 3 IPI00503572 R.SLSTELFK.M N 52.49 0.6 462.7557 2 35.763 3049 41 1478 1485 N 3 IPI00503572 R.ADLSRELEEISER.L N 50.52 1.5 516.2625 3 20.916 1808 1 1139 1151 N 3 IPI00503572 K.LEQQVDDLEGSLEQEKK.L N 48.54 0.6 663.3325 3 18.209 1550 1 1029 1045 N 3 IPI00503572 K.AGLLGTLEEMRDEK.L N 47.23 0.5 521.2681 3 22.569 1963 2 769 782 N 3 IPI00503572 K.MEIDDLSSNM(+15.99)EAVAKAK.A N 43.95 0.1 623.2973 3 20.181 1739 1 1228 1244 Y 3 IPI00503572 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1760 1772 N 3 IPI00503572 K.DLQHRLDEAENLAM(+15.99)K.G N 41.09 0.6 600.2962 3 20.172 1738 1 1794 1808 Y 3 IPI00503572 K.KNLEVTVK.D N 39.8 0.5 465.7848 2 11.806 934 1 1786 1793 N 3 IPI00503572 K.CASLEK.T N 39.15 0.1 325.6625 2 3.599 287 3 1413 1418 N 3 IPI00503572 K.LRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1046 1052 N 3 IPI00503572 K.NLEVTVK.D N 36.87 0.3 401.7369 2 13.821 1107 1 1787 1793 N 3 IPI00503572 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 660 665 N 3 IPI00503572 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1866 1872 N 3 IPI00503572 K.KKGGSMQTVSSQFR.E N 31.75 0.6 385.9527 4 13.516 1077 1 641 654 N 3 IPI00503572 R.SFMNVK.H N 31.11 0.1 363.1862 2 14.189 1144 1 822 827 N 3 IPI00503572 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 660 665 Y 3 IPI00503572 K.IQLEAK.L N 28.41 0.7 351.213 2 11.787 932 1 915 920 N 3 IPI00503572 K.FTGAVLHHGNM(+15.99)K.F N 22.15 1.5 332.6693 4 13.307 1059 1 356 367 Y 3 IPI00503572 K.IEDEQSLGAQLQKKIK.E N 14.55 0.3 457.7597 4 16.792 1409 1 1096 1111 N

PAGE 191

191 2 IPI00773363 K.MEGDLNEMEIQLSHANR.Q N 146.95 0.1 993.9541 2 20.596 1778 20 1620 1636 N 2 IPI00773363 K.GGSMQTVSSQFR.E N 112.37 0.5 642.8033 2 14.967 1225 13 643 654 N 2 IPI00773363 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1759 1773 N 2 IPI00773363 K.TPGLMENFLVIHQLR.C N 104.56 0.3 884.4821 2 25.096 2188 2 682 696 N 2 IPI00773363 R.LQEAEEQIEAVNSK.C N 104.32 0.4 794.3969 2 51.019 4288 13 1399 1412 N 2 IPI00773363 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1760 1773 N 2 IPI00773363 K.FTGAVLHHGNMK.F N 102.41 0.8 656.3344 2 13.25 1054 2 356 367 N 2 IPI00773363 K.GGSM(+15.99)QTVSSQFR.E N 100.99 0.7 650.8007 2 13.526 1078 2 643 654 Y 2 IPI00773363 K.KQADSVAELGEQIDNLQR.V N 99.26 0.2 1007.513 2 20.724 1790 4 1197 1214 N 2 IPI00773363 K.SEYKMEIDDLSSNM(+15.99)EAVAK.A N 95.57 0.2 1088.493 2 21.67 1880 2 1224 1242 Y 2 IPI00773363 K.AGLLGTLEEMR.D N 95.04 0.4 595.3156 2 23.555 2053 35 769 779 N 2 IPI00773363 K.VAEQELVDASER.V N 94.92 0.5 673.3336 2 15.024 1231 1 1703 1714 N 2 IPI00773363 K.TKLEQQVDDLEGSLEQEKKLR.M N 94.89 1.2 829.4404 3 21.306 1847 2 1027 1047 N 2 IPI00773363 R.DLEESTLQHEATAAALR.K N 94.23 0.3 927.963 2 19.562 1681 4 1179 1195 N 2 IPI00773363 K.KGGSMQTVSSQFR.E N 94.18 0.6 706.8507 2 14.062 1131 3 642 654 N 2 IPI00773363 K.DAQLHLDDAVR.G N 94.15 0.6 626.818 2 15.259 1255 35 1654 1664 N 2 IPI00773363 K.KMEGDLNEMEIQLSHANR.Q N 93.3 1 1058.003 2 19.061 1634 8 1619 1636 N 2 IPI00773363 K.KM(+15.99)EGDLNEMEIQLSHANR.Q N 92.12 0.3 711.0015 3 17.562 1486 1 1619 1636 Y 2 IPI00773363 K.VQHELEEAEER.A N 90.69 0.5 684.8228 2 12.917 1024 2 1901 1911 N 2 IPI00773363 K.TKLEQQVDDLEGSLEQEKK.L N 90.21 0.6 739.7126 3 20.785 1796 2 1027 1045 N 2 IPI00773363 K.KKMEGDLNEMEIQLSHANR.Q N 89.06 0 748.3684 3 17.091 1439 15 1618 1636 N 2 IPI00773363 R.KVAEQELVDASER.V N 88.91 0.2 737.3809 2 14.239 1149 3 1702 1714 N 2 IPI00773363 K.QADSVAELGEQIDNLQR.V N 87.89 1.2 943.4673 2 22.248 1933 3 1198 1214 N 2 IPI00773363 K.IEDEQSLGAQLQKK.I N 87.83 0.3 793.9225 2 14.913 1220 2 1096 1109 N 2 IPI00773363 K.NLQQEISDLTEQIGETGK.S N 87.57 0.9 1001.999 2 27.013 2345 1 1506 1523 N 2 IPI00773363 R.KKQADSVAELGEQIDNLQR.V N 87.29 0.9 1071.562 2 18.889 1617 7 1196 1214 N 2 IPI00773363 R.RDLEESTLQHEATAAALR.K N 86.71 0.8 1006.015 2 17.252 1455 4 1178 1195 N 2 IPI00773363 K.VLNASVIPEGQFIDNK.K N 86.35 0.1 872.4675 2 21.406 1856 1 726 741 N 2 IPI00773363 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 954 965 N 2 IPI00773363 R.QLEEKEALVSQLTR.G N 85.82 1 822.4509 2 17.365 1466 33 1292 1305 N 2 IPI00773363 R.EQFEEEQEAKAELQR.G N 84.5 0.9 932.4387 2 16.361 1366 5 1347 1361 N

PAGE 192

192 2 IPI00773363 R.KVQHELEEAEER.A N 84.44 1.1 748.8698 2 12.234 969 3 1900 1911 N 2 IPI00773363 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1760 1773 Y 2 IPI00773363 R.IEELEEEIEAERAAR.A N 82.3 0.2 893.9443 2 18.439 1573 2 1117 1131 N 2 IPI00773363 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1760 1772 Y 2 IPI00773363 K.MEIDDLSSNM(+15.99)EAVAK.A N 79.32 0.2 834.8765 2 20.588 1777 20 1228 1242 Y 2 IPI00773363 K.DFETSQLLSK.I N 79.24 0.3 584.2984 2 18.021 1531 26 1086 1095 N 2 IPI00773363 R.IEELEEEIEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1117 1128 N 2 IPI00773363 K.IEDEQSLGAQLQK.K N 77.68 0.9 729.8746 2 15.833 1311 1 1096 1108 N 2 IPI00773363 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1759 1773 Y 2 IPI00773363 R.VKELTYQTEEDKK.N N 74.8 0.1 537.6138 3 12.375 980 2 1849 1861 N 2 IPI00773363 R.LDEAENLAM(+15.99)K.G N 74.76 0.3 575.2762 2 13.758 1100 1 1799 1808 Y 2 IPI00773363 R.ENLGKLMTNLR.S N 74.7 1 644.8564 2 18.112 1541 1 655 665 N 2 IPI00773363 R.TLEDQLSEIK.S N 73.95 0 588.3113 2 19.446 1670 5 1253 1262 N 2 IPI00773363 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1759 1773 Y 2 IPI00773363 R.EQFEEEQEAK.A N 73.74 0 633.7778 2 12.289 973 1 1347 1356 N 2 IPI00773363 K.ELTYQTEEDKK.N N 73.25 0.4 692.3353 2 12.299 974 1 1851 1861 N 2 IPI00773363 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 955 965 N 2 IPI00773363 K.AGLLGTLEEM(+15.99)R.D N 73.06 0.8 603.3138 2 19.327 1659 2 769 779 Y 2 IPI00773363 K.KDFETSQLLSK.I N 72.88 0.1 648.3456 2 15.278 1258 1 1085 1095 N 2 IPI00773363 R.DLEESTLQHEATAAALRK.K N 72.77 0.4 661.6765 3 18.027 1532 1 1179 1196 N 2 IPI00773363 K.KMEGDLNEM(+15.99)EIQLSHANR.Q N 72.57 1.4 711.0007 3 19.127 1640 2 1619 1636 Y 2 IPI00773363 K.TKLEQQVDDLEGSLEQEK.K N 72.48 0.9 697.014 3 21.992 1910 1 1027 1044 N 2 IPI00773363 K.MEGDLNEM(+15.99)EIQLSHANR.Q N 70.89 0.5 668.3037 3 16.541 1385 1 1620 1636 Y 2 IPI00773363 K.KKDFETSQLLSK.I N 69.93 0.3 712.3934 2 14.246 1150 2 1084 1095 N 2 IPI00773363 R.LDEAENLAMK.G N 69.57 1.5 567.2798 2 14.792 1207 3 1799 1808 N 2 IPI00773363 K.LYDQHLGK.C N 69.42 1.4 487.258 2 11.849 937 3 556 563 N 2 IPI00773363 K.IEDEQSLGAQLQKKIKELQAR.I N 68.98 0.1 607.0906 4 22.519 1959 2 1096 1116 N 2 IPI00773363 K.EKSEYKMEIDDLSSNM(+15.99)EAVAK.A N 68.83 0.5 811.7106 3 21.05 1821 1 1222 1242 Y 2 IPI00773363 K.M(+15.99)EIDDLSSNM(+15.99)EAVAK.A N 66.32 0.9 842.8731 2 18.456 1575 1 1228 1242 Y 2 IPI00773363 K.VLNASVIPEGQFIDNKK.A N 64.59 0.8 624.6785 3 19.57 1682 1 726 742 N 2 IPI00773363 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1377 1384 N

PAGE 193

193 2 IPI00773363 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1760 1773 Y 2 IPI00773363 K.NLTEEM(+15.99)AAQDESIGKLTK.E N 61.88 0.4 997.4914 2 19.31 1657 2 979 996 Y 2 IPI00773363 R.NFDKVLAEWK.Q N 61.76 0.3 417.2239 3 20.741 1792 2 1450 1459 N 2 IPI00773363 K.NLTEEM(+15.99)AAQDESIGK.L N 60.96 0.8 826.3782 2 16.157 1345 2 979 993 Y 2 IPI00773363 K.DLQHRLDEAENLAMK.G N 60.68 1.2 891.9449 2 20.094 1730 3 1794 1808 N 2 IPI00773363 R.HDCDLLR.E N 60.31 0.4 436.208 2 13.626 1087 1 1340 1346 N 2 IPI00773363 K.EALVSQLTR.G N 56.97 0.9 508.7899 2 47.214 3983 7 1297 1305 N 2 IPI00773363 R.ILYADFK.Q N 56.89 0.2 435.2421 2 16.885 1417 10 715 721 N 2 IPI00773363 K.KGGSM(+15.99)QTVSSQFR.E N 56.47 0.5 476.9013 3 12.661 1003 2 642 654 Y 2 IPI00773363 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1866 1876 N 2 IPI00773363 R.SLSTELFK.M N 52.49 0.6 462.7557 2 35.763 3049 41 1478 1485 N 2 IPI00773363 R.ADLSRELEEISER.L N 50.52 1.5 516.2625 3 20.916 1808 1 1139 1151 N 2 IPI00773363 K.LEQQVDDLEGSLEQEKK.L N 48.54 0.6 663.3325 3 18.209 1550 1 1029 1045 N 2 IPI00773363 K.AGLLGTLEEMRDEK.L N 47.23 0.5 521.2681 3 22.569 1963 2 769 782 N 2 IPI00773363 K.MEIDDLSSNM(+15.99)EAVAKAK.A N 43.95 0.1 623.2973 3 20.181 1739 1 1228 1244 Y 2 IPI00773363 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1760 1772 N 2 IPI00773363 K.DLQHRLDEAENLAM(+15.99)K.G N 41.09 0.6 600.2962 3 20.172 1738 1 1794 1808 Y 2 IPI00773363 K.KNLEVTVK.D N 39.8 0.5 465.7848 2 11.806 934 1 1786 1793 N 2 IPI00773363 K.CASLEK.T N 39.15 0.1 325.6625 2 3.599 287 3 1413 1418 N 2 IPI00773363 K.LRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1046 1052 N 2 IPI00773363 K.NLEVTVK.D N 36.87 0.3 401.7369 2 13.821 1107 1 1787 1793 N 2 IPI00773363 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 660 665 N 2 IPI00773363 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1866 1872 N 2 IPI00773363 K.KKGGSMQTVSSQFR.E N 31.75 0.6 385.9527 4 13.516 1077 1 641 654 N 2 IPI00773363 R.SFMNVK.H N 31.11 0.1 363.1862 2 14.189 1144 1 822 827 N 2 IPI00773363 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 660 665 Y 2 IPI00773363 K.IQLEAK.L N 28.41 0.7 351.213 2 11.787 932 1 915 920 N 2 IPI00773363 K.FTGAVLHHGNM(+15.99)K.F N 22.15 1.5 332.6693 4 13.307 1059 1 356 367 Y 2 IPI00773363 K.IEDEQSLGAQLQKKIK.E N 14.55 0.3 457.7597 4 16.792 1409 1 1096 1111 N 1 IPI00933204 K.MEGDLNEMEIQLSHANR.Q N 146.95 0.1 993.9541 2 20.596 1778 20 1620 1636 N 1 IPI00933204 K.GGSMQTVSSQFR.E N 112.37 0.5 642.8033 2 14.967 1225 13 643 654 N

PAGE 194

194 1 IPI00933204 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1759 1773 N 1 IPI00933204 K.TPGLMENFLVIHQLR.C N 104.56 0.3 884.4821 2 25.096 2188 2 682 696 N 1 IPI00933204 R.LQEAEEQIEAVNSK.C N 104.32 0.4 794.3969 2 51.019 4288 13 1399 1412 N 1 IPI00933204 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1760 1773 N 1 IPI00933204 K.FTGAVLHHGNMK.F N 102.41 0.8 656.3344 2 13.25 1054 2 356 367 N 1 IPI00933204 K.GGSM(+15.99)QTVSSQFR.E N 100.99 0.7 650.8007 2 13.526 1078 2 643 654 Y 1 IPI00933204 K.KQADSVAELGEQIDNLQR.V N 99.26 0.2 1007.513 2 20.724 1790 4 1197 1214 N 1 IPI00933204 K.LAEKDEEMEQIKR.N Y 97.46 0.7 809.9083 2 13.578 1083 3 1578 1590 N 1 IPI00933204 R.KLAEKDEEMEQIKR.N Y 96.43 0.4 873.9559 2 13.064 1037 3 1577 1590 N 1 IPI00933204 K.SEYKMEIDDLSSNM(+15.99)EAVAK.A N 95.57 0.2 1088.493 2 21.67 1880 2 1224 1242 Y 1 IPI00933204 K.AGLLGTLEEMR.D N 95.04 0.4 595.3156 2 23.555 2053 35 769 779 N 1 IPI00933204 K.VAEQELVDASER.V N 94.92 0.5 673.3336 2 15.024 1231 1 1703 1714 N 1 IPI00933204 K.TKLEQQVDDLEGSLEQEKKLR.M N 94.89 1.2 829.4404 3 21.306 1847 2 1027 1047 N 1 IPI00933204 R.DLEESTLQHEATAAALR.K N 94.23 0.3 927.963 2 19.562 1681 4 1179 1195 N 1 IPI00933204 K.KGGSMQTVSSQFR.E N 94.18 0.6 706.8507 2 14.062 1131 3 642 654 N 1 IPI00933204 K.DAQLHLDDAVR.G N 94.15 0.6 626.818 2 15.259 1255 35 1654 1664 N 1 IPI00933204 K.KMEGDLNEMEIQLSHANR.Q N 93.3 1 1058.003 2 19.061 1634 8 1619 1636 N 1 IPI00933204 K.KM(+15.99)EGDLNEMEIQLSHANR.Q N 92.12 0.3 711.0015 3 17.562 1486 1 1619 1636 Y 1 IPI00933204 K.VQHELEEAEER.A N 90.69 0.5 684.8228 2 12.917 1024 2 1901 1911 N 1 IPI00933204 K.TKLEQQVDDLEGSLEQEKK.L N 90.21 0.6 739.7126 3 20.785 1796 2 1027 1045 N 1 IPI00933204 K.KKMEGDLNEMEIQLSHANR.Q N 89.06 0 748.3684 3 17.091 1439 15 1618 1636 N 1 IPI00933204 R.KVAEQELVDASER.V N 88.91 0.2 737.3809 2 14.239 1149 3 1702 1714 N 1 IPI00933204 K.QADSVAELGEQIDNLQR.V N 87.89 1.2 943.4673 2 22.248 1933 3 1198 1214 N 1 IPI00933204 K.IEDEQSLGAQLQKK.I N 87.83 0.3 793.9225 2 14.913 1220 2 1096 1109 N 1 IPI00933204 K.NLQQEISDLTEQLGETGK.S N 87.57 0.9 1001.999 2 27.013 2345 1 1506 1523 N 1 IPI00933204 R.KKQADSVAELGEQIDNLQR.V N 87.29 0.9 1071.562 2 18.889 1617 7 1196 1214 N 1 IPI00933204 R.RDLEESTLQHEATAAALR.K N 86.71 0.8 1006.015 2 17.252 1455 4 1178 1195 N 1 IPI00933204 K.VLNASVIPEGQFIDNK.K N 86.35 0.1 872.4675 2 21.406 1856 1 726 741 N 1 IPI00933204 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 954 965 N 1 IPI00933204 R.QLEEKEALVSQLTR.G N 85.82 1 822.4509 2 17.365 1466 33 1292 1305 N 1 IPI00933204 R.EQFEEEQEAKAELQR.G N 84.5 0.9 932.4387 2 16.361 1366 5 1347 1361 N

PAGE 195

195 1 IPI00933204 R.KVQHELEEAEER.A N 84.44 1.1 748.8698 2 12.234 969 3 1900 1911 N 1 IPI00933204 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1760 1773 Y 1 IPI00933204 R.IEELEEEIEAERAAR.A N 82.3 0.2 893.9443 2 18.439 1573 2 1117 1131 N 1 IPI00933204 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1760 1772 Y 1 IPI00933204 K.MEIDDLSSNM(+15.99)EAVAK.A N 79.32 0.2 834.8765 2 20.588 1777 20 1228 1242 Y 1 IPI00933204 R.IEELEEEIEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1117 1128 N 1 IPI00933204 K.IEDEQSLGAQLQK.K N 77.68 0.9 729.8746 2 15.833 1311 1 1096 1108 N 1 IPI00933204 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1759 1773 Y 1 IPI00933204 R.VKELTYQTEEDKK.N N 74.8 0.1 537.6138 3 12.375 980 2 1849 1861 N 1 IPI00933204 R.LDEAENLAM(+15.99)K.G N 74.76 0.3 575.2762 2 13.758 1100 1 1799 1808 Y 1 IPI00933204 R.ENLGKLMTNLR.S N 74.7 1 644.8564 2 18.112 1541 1 655 665 N 1 IPI00933204 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1759 1773 Y 1 IPI00933204 R.EQFEEEQEAK.A N 73.74 0 633.7778 2 12.289 973 1 1347 1356 N 1 IPI00933204 K.ELTYQTEEDKK.N N 73.25 0.4 692.3353 2 12.299 974 1 1851 1861 N 1 IPI00933204 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 955 965 N 1 IPI00933204 K.AGLLGTLEEM(+15.99)R.D N 73.06 0.8 603.3138 2 19.327 1659 2 769 779 Y 1 IPI00933204 R.DLEESTLQHEATAAALRK.K N 72.77 0.4 661.6765 3 18.027 1532 1 1179 1196 N 1 IPI00933204 K.KMEGDLNEM(+15.99)EIQLSHANR.Q N 72.57 1.4 711.0007 3 19.127 1640 2 1619 1636 Y 1 IPI00933204 K.TKLEQQVDDLEGSLEQEK.K N 72.48 0.9 697.014 3 21.992 1910 1 1027 1044 N 1 IPI00933204 K.MEGDLNEM(+15.99)EIQLSHANR.Q N 70.89 0.5 668.3037 3 16.541 1385 1 1620 1636 Y 1 IPI00933204 R.LDEAENLAMK.G N 69.57 1.5 567.2798 2 14.792 1207 3 1799 1808 N 1 IPI00933204 K.LYDQHLGK.C N 69.42 1.4 487.258 2 11.849 937 3 556 563 N 1 IPI00933204 K.LAEKDEEMEQIK.R Y 69.39 1.1 488.2408 3 13.888 1114 1 1578 1589 N 1 IPI00933204 K.IEDEQSLGAQLQKKIKELQAR.I N 68.98 0.1 607.0906 4 22.519 1959 2 1096 1116 N 1 IPI00933204 K.EKSEYKMEIDDLSSNM(+15.99)EAVAK.A N 68.83 0.5 811.7106 3 21.05 1821 1 1222 1242 Y 1 IPI00933204 K.M(+15.99)EIDDLSSNM(+15.99)EAVAK.A N 66.32 0.9 842.8731 2 18.456 1575 1 1228 1242 Y 1 IPI00933204 K.VLNASVIPEGQFIDNKK.A N 64.59 0.8 624.6785 3 19.57 1682 1 726 742 N 1 IPI00933204 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1377 1384 N 1 IPI00933204 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1760 1773 Y 1 IPI00933204 R.NFDKVLAEWK.Q N 61.76 0.3 417.2239 3 20.741 1792 2 1450 1459 N 1 IPI00933204 K.DLQHRLDEAENLAMK.G N 60.68 1.2 891.9449 2 20.094 1730 3 1794 1808 N

PAGE 196

196 1 IPI00933204 R.HDCDLLR.E N 60.31 0.4 436.208 2 13.626 1087 1 1340 1346 N 1 IPI00933204 K.EALVSQLTR.G N 56.97 0.9 508.7899 2 47.214 3983 7 1297 1305 N 1 IPI00933204 K.KGGSM(+15.99)QTVSSQFR.E N 56.47 0.5 476.9013 3 12.661 1003 2 642 654 Y 1 IPI00933204 R.KLAEKDEEM(+15.99)EQIKR.N Y 55.6 0.7 588.3045 3 13.048 1035 3 1577 1590 Y 1 IPI00933204 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1866 1876 N 1 IPI00933204 R.SLSTELFK.M N 52.49 0.6 462.7557 2 35.763 3049 41 1478 1485 N 1 IPI00933204 R.ADLSRELEEISER.L N 50.52 1.5 516.2625 3 20.916 1808 1 1139 1151 N 1 IPI00933204 K.LAEKDEEM(+15.99)EQIKR.N Y 50.21 0.8 545.6062 3 13.569 1082 2 1578 1590 Y 1 IPI00933204 K.LEQQVDDLEGSLEQEKK.L N 48.54 0.6 663.3325 3 18.209 1550 1 1029 1045 N 1 IPI00933204 K.AGLLGTLEEMRDEK.L N 47.23 0.5 521.2681 3 22.569 1963 2 769 782 N 1 IPI00933204 K.MEIDDLSSNM(+15.99)EAVAKAK.A N 43.95 0.1 623.2973 3 20.181 1739 1 1228 1244 Y 1 IPI00933204 R.VQLELNQVKGEIDR.K N 43.71 0.4 820.9515 2 18.653 1595 4 1563 1576 N 1 IPI00933204 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1760 1772 N 1 IPI00933204 K.DLQHRLDEAENLAM(+15.99)K.G N 41.09 0.6 600.2962 3 20.172 1738 1 1794 1808 Y 1 IPI00933204 R.VQLELNQVKGEIDRK.L N 40.47 0.3 884.9996 2 17.296 1459 3 1563 1577 N 1 IPI00933204 K.KNLEVTVK.D N 39.8 0.5 465.7848 2 11.806 934 1 1786 1793 N 1 IPI00933204 K.CASLEK.T N 39.15 0.1 325.6625 2 3.599 287 3 1413 1418 N 1 IPI00933204 K.LRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1046 1052 N 1 IPI00933204 K.NLEVTVK.D N 36.87 0.3 401.7369 2 13.821 1107 1 1787 1793 N 1 IPI00933204 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 660 665 N 1 IPI00933204 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1866 1872 N 1 IPI00933204 K.KKGGSMQTVSSQFR.E N 31.75 0.6 385.9527 4 13.516 1077 1 641 654 N 1 IPI00933204 R.SFMNVK.H N 31.11 0.1 363.1862 2 14.189 1144 1 822 827 N 1 IPI00933204 K.DEEMEQIKR.N Y 30.75 0.9 393.1884 3 12.671 1004 1 1582 1590 N 1 IPI00933204 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 660 665 Y 1 IPI00933204 K.IQLEAK.L N 28.41 0.7 351.213 2 11.787 932 1 915 920 N 1 IPI00933204 K.FTGAVLHHGNM(+15.99)K.F N 22.15 1.5 332.6693 4 13.307 1059 1 356 367 Y 1 IPI00933204 K.IEDEQSLGAQLQKKIK.E N 14.55 0.3 457.7597 4 16.792 1409 1 1096 1111 N 1 IPI00933204 R.ESIYT(+79.97)IQYNIRSFM(+15.99)NVK.H N 7.27 0.8 551.2625 4 3.664 292 1 811 827 Y 4 IPI00858466 K.MEGDLNEMEIQLSHANR.Q N 146.95 0.1 993.9541 2 20.596 1778 20 1620 1636 N 4 IPI00858466 K.GGSMQTVSSQFR.E N 112.37 0.5 642.8033 2 14.967 1225 13 643 654 N

PAGE 197

197 4 IPI00858466 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1759 1773 N 4 IPI00858466 K.TPGLMENFLVIHQLR.C N 104.56 0.3 884.4821 2 25.096 2188 2 682 696 N 4 IPI00858466 R.LQEAEEQIEAVNSK.C N 104.32 0.4 794.3969 2 51.019 4288 13 1399 1412 N 4 IPI00858466 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1760 1773 N 4 IPI00858466 K.FTGAVLHHGNMK.F N 102.41 0.8 656.3344 2 13.25 1054 2 356 367 N 4 IPI00858466 K.GGSM(+15.99)QTVSSQFR.E N 100.99 0.7 650.8007 2 13.526 1078 2 643 654 Y 4 IPI00858466 K.KQADSVAELGEQIDNLQR.V N 99.26 0.2 1007.513 2 20.724 1790 4 1197 1214 N 4 IPI00858466 K.SEYKMEIDDLSSNM(+15.99)EAVAK.A N 95.57 0.2 1088.493 2 21.67 1880 2 1224 1242 Y 4 IPI00858466 K.AGLLGTLEEMR.D N 95.04 0.4 595.3156 2 23.555 2053 35 769 779 N 4 IPI00858466 K.VAEQELVDASER.V N 94.92 0.5 673.3336 2 15.024 1231 1 1703 1714 N 4 IPI00858466 K.TKLEQQVDDLEGSLEQEKKLR.M N 94.89 1.2 829.4404 3 21.306 1847 2 1027 1047 N 4 IPI00858466 R.DLEESTLQHEATAAALR.K N 94.23 0.3 927.963 2 19.562 1681 4 1179 1195 N 4 IPI00858466 K.KGGSMQTVSSQFR.E N 94.18 0.6 706.8507 2 14.062 1131 3 642 654 N 4 IPI00858466 K.DAQLHLDDAVR.G N 94.15 0.6 626.818 2 15.259 1255 35 1654 1664 N 4 IPI00858466 K.KMEGDLNEMEIQLSHANR.Q N 93.3 1 1058.003 2 19.061 1634 8 1619 1636 N 4 IPI00858466 K.KM(+15.99)EGDLNEMEIQLSHANR.Q N 92.12 0.3 711.0015 3 17.562 1486 1 1619 1636 Y 4 IPI00858466 K.VQHELEEAEER.A N 90.69 0.5 684.8228 2 12.917 1024 2 1901 1911 N 4 IPI00858466 K.TKLEQQVDDLEGSLEQEKK.L N 90.21 0.6 739.7126 3 20.785 1796 2 1027 1045 N 4 IPI00858466 K.KKMEGDLNEMEIQLSHANR.Q N 89.06 0 748.3684 3 17.091 1439 15 1618 1636 N 4 IPI00858466 R.KVAEQELVDASER.V N 88.91 0.2 737.3809 2 14.239 1149 3 1702 1714 N 4 IPI00858466 K.QADSVAELGEQIDNLQR.V N 87.89 1.2 943.4673 2 22.248 1933 3 1198 1214 N 4 IPI00858466 K.IEDEQSLGAQLQKK.I N 87.83 0.3 793.9225 2 14.913 1220 2 1096 1109 N 4 IPI00858466 K.NLQQEISDLTEQLGETGK.S N 87.57 0.9 1001.999 2 27.013 2345 1 1506 1523 N 4 IPI00858466 R.KKQADSVAELGEQIDNLQR.V N 87.29 0.9 1071.562 2 18.889 1617 7 1196 1214 N 4 IPI00858466 R.RDLEESTLQHEATAAALR.K N 86.71 0.8 1006.015 2 17.252 1455 4 1178 1195 N 4 IPI00858466 K.VLNASVIPEGQFIDNK.K N 86.35 0.1 872.4675 2 21.406 1856 1 726 741 N 4 IPI00858466 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 954 965 N 4 IPI00858466 R.QLEEKEALVSQLTR.G N 85.82 1 822.4509 2 17.365 1466 33 1292 1305 N 4 IPI00858466 R.EQFEEEQEAKAELQR.G N 84.5 0.9 932.4387 2 16.361 1366 5 1347 1361 N 4 IPI00858466 R.KVQHELEEAEER.A N 84.44 1.1 748.8698 2 12.234 969 3 1900 1911 N 4 IPI00858466 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1760 1773 Y

PAGE 198

198 4 IPI00858466 R.IEELEEEIEAERAAR.A N 82.3 0.2 893.9443 2 18.439 1573 2 1117 1131 N 4 IPI00858466 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1760 1772 Y 4 IPI00858466 K.MEIDDLSSNM(+15.99)EAVAK.A N 79.32 0.2 834.8765 2 20.588 1777 20 1228 1242 Y 4 IPI00858466 K.DFETSQLLSK.I N 79.24 0.3 584.2984 2 18.021 1531 26 1086 1095 N 4 IPI00858466 R.IEELEEEIEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1117 1128 N 4 IPI00858466 K.IEDEQSLGAQLQK.K N 77.68 0.9 729.8746 2 15.833 1311 1 1096 1108 N 4 IPI00858466 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1759 1773 Y 4 IPI00858466 R.VKELTYQTEEDKK.N N 74.8 0.1 537.6138 3 12.375 980 2 1849 1861 N 4 IPI00858466 R.LDEAENLAM(+15.99)K.G N 74.76 0.3 575.2762 2 13.758 1100 1 1799 1808 Y 4 IPI00858466 R.ENLGKLMTNLR.S N 74.7 1 644.8564 2 18.112 1541 1 655 665 N 4 IPI00858466 R.TLEDQLSEIK.S N 73.95 0 588.3113 2 19.446 1670 5 1253 1262 N 4 IPI00858466 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1759 1773 Y 4 IPI00858466 R.EQFEEEQEAK.A N 73.74 0 633.7778 2 12.289 973 1 1347 1356 N 4 IPI00858466 K.ELTYQTEEDKK.N N 73.25 0.4 692.3353 2 12.299 974 1 1851 1861 N 4 IPI00858466 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 955 965 N 4 IPI00858466 K.AGLLGTLEEM(+15.99)R.D N 73.06 0.8 603.3138 2 19.327 1659 2 769 779 Y 4 IPI00858466 K.KDFETSQLLSK.I N 72.88 0.1 648.3456 2 15.278 1258 1 1085 1095 N 4 IPI00858466 R.DLEESTLQHEATAAALRK.K N 72.77 0.4 661.6765 3 18.027 1532 1 1179 1196 N 4 IPI00858466 K.KMEGDLNEM(+15.99)EIQLSHANR.Q N 72.57 1.4 711.0007 3 19.127 1640 2 1619 1636 Y 4 IPI00858466 K.TKLEQQVDDLEGSLEQEK.K N 72.48 0.9 697.014 3 21.992 1910 1 1027 1044 N 4 IPI00858466 K.MEGDLNEM(+15.99)EIQLSHANR.Q N 70.89 0.5 668.3037 3 16.541 1385 1 1620 1636 Y 4 IPI00858466 K.KKDFETSQLLSK.I N 69.93 0.3 712.3934 2 14.246 1150 2 1084 1095 N 4 IPI00858466 R.LDEAENLAMK.G N 69.57 1.5 567.2798 2 14.792 1207 3 1799 1808 N 4 IPI00858466 K.LYDQHLGK.C N 69.42 1.4 487.258 2 11.849 937 3 556 563 N 4 IPI00858466 K.IEDEQSLGAQLQKKIKELQAR.I N 68.98 0.1 607.0906 4 22.519 1959 2 1096 1116 N 4 IPI00858466 K.EKSEYKMEIDDLSSNM(+15.99)EAVAK.A N 68.83 0.5 811.7106 3 21.05 1821 1 1222 1242 Y 4 IPI00858466 K.M(+15.99)EIDDLSSNM(+15.99)EAVAK.A N 66.32 0.9 842.8731 2 18.456 1575 1 1228 1242 Y 4 IPI00858466 K.VLNASVIPEGQFIDNKK.A N 64.59 0.8 624.6785 3 19.57 1682 1 726 742 N 4 IPI00858466 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1377 1384 N 4 IPI00858466 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1760 1773 Y 4 IPI00858466 K.NLTEEM(+15.99)AAQDESIGKLTK.E N 61.88 0.4 997.4914 2 19.31 1657 2 979 996 Y

PAGE 199

199 4 IPI00858466 R.NFDKVLAEWK.Q N 61.76 0.3 417.2239 3 20.741 1792 2 1450 1459 N 4 IPI00858466 K.NLTEEM(+15.99)AAQDESIGK.L N 60.96 0.8 826.3782 2 16.157 1345 2 979 993 Y 4 IPI00858466 K.DLQHRLDEAENLAMK.G N 60.68 1.2 891.9449 2 20.094 1730 3 1794 1808 N 4 IPI00858466 R.HDCDLLR.E N 60.31 0.4 436.208 2 13.626 1087 1 1340 1346 N 4 IPI00858466 K.EALVSQLTR.G N 56.97 0.9 508.7899 2 47.214 3983 7 1297 1305 N 4 IPI00858466 K.KGGSM(+15.99)QTVSSQFR.E N 56.47 0.5 476.9013 3 12.661 1003 2 642 654 Y 4 IPI00858466 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1866 1876 N 4 IPI00858466 R.SLSTELFK.M N 52.49 0.6 462.7557 2 35.763 3049 41 1478 1485 N 4 IPI00858466 R.ADLSRELEEISER.L N 50.52 1.5 516.2625 3 20.916 1808 1 1139 1151 N 4 IPI00858466 K.LEQQVDDLEGSLEQEKK.L N 48.54 0.6 663.3325 3 18.209 1550 1 1029 1045 N 4 IPI00858466 K.AGLLGTLEEMRDEK.L N 47.23 0.5 521.2681 3 22.569 1963 2 769 782 N 4 IPI00858466 K.MEIDDLSSNM(+15.99)EAVAKAK.A N 43.95 0.1 623.2973 3 20.181 1739 1 1228 1244 Y 4 IPI00858466 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1760 1772 N 4 IPI00858466 K.DLQHRLDEAENLAM(+15.99)K.G N 41.09 0.6 600.2962 3 20.172 1738 1 1794 1808 Y 4 IPI00858466 K.CASLEK.T N 39.15 0.1 325.6625 2 3.599 287 3 1413 1418 N 4 IPI00858466 K.LRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1046 1052 N 4 IPI00858466 K.NLEITVK.D N 37.86 0.2 408.7448 2 14.765 1205 1 1787 1793 N 4 IPI00858466 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 660 665 N 4 IPI00858466 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1866 1872 N 4 IPI00858466 K.KKGGSMQTVSSQFR.E N 31.75 0.6 385.9527 4 13.516 1077 1 641 654 N 4 IPI00858466 R.SFMNVK.H N 31.11 0.1 363.1862 2 14.189 1144 1 822 827 N 4 IPI00858466 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 660 665 Y 4 IPI00858466 K.IQLEAK.L N 28.41 0.7 351.213 2 11.787 932 1 915 920 N 4 IPI00858466 K.FTGAVLHHGNM(+15.99)K.F N 22.15 1.5 332.6693 4 13.307 1059 1 356 367 Y 4 IPI00858466 K.IEDEQSLGAQLQKKIK.E N 14.55 0.3 457.7597 4 16.792 1409 1 1096 1111 N 4 IPI00858466 R.ESIYT(+79.97)IQYNIRSFM(+15.99)NVK.H N 7.27 0.8 551.2625 4 3.664 292 1 811 827 Y 8 IPI00961738 K.MEGDLNEMEIQLSHANR.Q N 146.95 0.1 993.9541 2 20.596 1778 20 1618 1634 N 8 IPI00961738 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1757 1771 N 8 IPI00961738 K.TPGLMENFLVIHQLR.C N 104.56 0.3 884.4821 2 25.096 2188 2 680 694 N 8 IPI00961738 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1758 1771 N 8 IPI00961738 K.KQADSVAELGEQIDNLQR.V N 99.26 0.2 1007.513 2 20.724 1790 4 1195 1212 N

PAGE 200

200 8 IPI00961738 K.SEYKMEIDDLSSNM(+15.99)EAVAK.A N 95.57 0.2 1088.493 2 21.67 1880 2 1222 1240 Y 8 IPI00961738 K.AGLLGTLEEMR.D N 95.04 0.4 595.3156 2 23.555 2053 35 767 777 N 8 IPI00961738 K.VAEQELVDASER.V N 94.92 0.5 673.3336 2 15.024 1231 1 1701 1712 N 8 IPI00961738 R.DLEESTLQHEATAAALR.K N 94.23 0.3 927.963 2 19.562 1681 4 1177 1193 N 8 IPI00961738 K.KMEGDLNEMEIQLSHANR.Q N 93.3 1 1058.003 2 19.061 1634 8 1617 1634 N 8 IPI00961738 K.KM(+15.99)EGDLNEMEIQLSHANR.Q N 92.12 0.3 711.0015 3 17.562 1486 1 1617 1634 Y 8 IPI00961738 K.KKMEGDLNEMEIQLSHANR.Q N 89.06 0 748.3684 3 17.091 1439 15 1616 1634 N 8 IPI00961738 R.KVAEQELVDASER.V N 88.91 0.2 737.3809 2 14.239 1149 3 1700 1712 N 8 IPI00961738 K.QADSVAELGEQIDNLQR.V N 87.89 1.2 943.4673 2 22.248 1933 3 1196 1212 N 8 IPI00961738 K.IEDEQSLGAQLQKK.I N 87.83 0.3 793.9225 2 14.913 1220 2 1094 1107 N 8 IPI00961738 K.NLQQEISDLTEQLGETGK.S N 87.57 0.9 1001.999 2 27.013 2345 1 1504 1521 N 8 IPI00961738 R.KKQADSVAELGEQIDNLQR.V N 87.29 0.9 1071.562 2 18.889 1617 7 1194 1212 N 8 IPI00961738 R.RDLEESTLQHEATAAALR.K N 86.71 0.8 1006.015 2 17.252 1455 4 1176 1193 N 8 IPI00961738 K.VLNASVIPEGQFIDNK.K N 86.35 0.1 872.4675 2 21.406 1856 1 724 739 N 8 IPI00961738 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 952 963 N 8 IPI00961738 R.QLEEKEALVSQLTR.G N 85.82 1 822.4509 2 17.365 1466 33 1290 1303 N 8 IPI00961738 K.NKDPLNDSVVQLYQK.S N 84.7 0.4 880.9621 2 18.172 1547 2 599 613 N 8 IPI00961738 R.EQFEEEQEAKAELQR.G N 84.5 0.9 932.4387 2 16.361 1366 5 1345 1359 N 8 IPI00961738 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1758 1771 Y 8 IPI00961738 R.IEELEEEIEAERAAR.A N 82.3 0.2 893.9443 2 18.439 1573 2 1115 1129 N 8 IPI00961738 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1758 1770 Y 8 IPI00961738 K.MEIDDLSSNM(+15.99)EAVAK.A N 79.32 0.2 834.8765 2 20.588 1777 20 1226 1240 Y 8 IPI00961738 R.IEELEEEIEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1115 1126 N 8 IPI00961738 K.IEDEQSLGAQLQK.K N 77.68 0.9 729.8746 2 15.833 1311 1 1094 1106 N 8 IPI00961738 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1757 1771 Y 8 IPI00961738 R.VKELTYQTEEDKK.N N 74.8 0.1 537.6138 3 12.375 980 2 1847 1859 N 8 IPI00961738 R.LDEAENLAM(+15.99)K.G N 74.76 0.3 575.2762 2 13.758 1100 1 1797 1806 Y 8 IPI00961738 R.ENLGKLMTNLR.S N 74.7 1 644.8564 2 18.112 1541 1 653 663 N 8 IPI00961738 R.TLEDQLSEIK.T N 73.95 0 588.3113 2 19.446 1670 5 1251 1260 N 8 IPI00961738 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1757 1771 Y 8 IPI00961738 R.EQFEEEQEAK.A N 73.74 0 633.7778 2 12.289 973 1 1345 1354 N

PAGE 201

201 8 IPI00961738 K.ELTYQTEEDKK.N N 73.25 0.4 692.3353 2 12.299 974 1 1849 1859 N 8 IPI00961738 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 953 963 N 8 IPI00961738 K.AGLLGTLEEM(+15.99)R.D N 73.06 0.8 603.3138 2 19.327 1659 2 767 777 Y 8 IPI00961738 R.DLEESTLQHEATAAALRK.K N 72.77 0.4 661.6765 3 18.027 1532 1 1177 1194 N 8 IPI00961738 K.KMEGDLNEM(+15.99)EIQLSHANR.Q N 72.57 1.4 711.0007 3 19.127 1640 2 1617 1634 Y 8 IPI00961738 K.MEGDLNEM(+15.99)EIQLSHANR.Q N 70.89 0.5 668.3037 3 16.541 1385 1 1618 1634 Y 8 IPI00961738 R.LDEAENLAMK.G N 69.57 1.5 567.2798 2 14.792 1207 3 1797 1806 N 8 IPI00961738 K.IEDEQSLGAQLQKKIKELQAR.I N 68.98 0.1 607.0906 4 22.519 1959 2 1094 1114 N 8 IPI00961738 K.EKSEYKMEIDDLSSNM(+15.99)EAVAK.A N 68.83 0.5 811.7106 3 21.05 1821 1 1220 1240 Y 8 IPI00961738 R.VLDAM(+15.99)QSTLDSEVR.S Y 68.74 0.8 790.3858 2 15.7 1297 2 1593 1606 Y 8 IPI00961738 K.M(+15.99)EIDDLSSNM(+15.99)EAVAK.A N 66.32 0.9 842.8731 2 18.456 1575 1 1226 1240 Y 8 IPI00961738 R.VLDAMQSTLDSEVR.S Y 64.79 0.6 782.3873 2 26.395 2294 41 1593 1606 N 8 IPI00961738 K.VLNASVIPEGQFIDNKK.A N 64.59 0.8 624.6785 3 19.57 1682 1 724 740 N 8 IPI00961738 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1375 1382 N 8 IPI00961738 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1758 1771 Y 8 IPI00961738 R.NFDKVLAEWK.Q N 61.76 0.3 417.2239 3 20.741 1792 2 1448 1457 N 8 IPI00961738 K.DLQHRLDEAENLAMK.G N 60.68 1.2 891.9449 2 20.094 1730 3 1792 1806 N 8 IPI00961738 R.HDCDLLR.E N 60.31 0.4 436.208 2 13.626 1087 1 1338 1344 N 8 IPI00961738 K.MVSLLQEK.N N 59.52 1.1 474.2646 2 26.71 2320 23 877 884 N 8 IPI00961738 K.EALVSQLTR.G N 56.97 0.9 508.7899 2 47.214 3983 7 1295 1303 N 8 IPI00961738 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1864 1874 N 8 IPI00961738 R.SLSTEIFK.M N 52.49 0.6 462.7557 2 35.763 3049 41 1476 1483 N 8 IPI00961738 R.ADLSRELEEISER.L N 50.52 1.5 516.2625 3 20.916 1808 1 1137 1149 N 8 IPI00961738 K.LEQQVDDLEGSLEQEKK.L N 48.54 0.6 663.3325 3 18.209 1550 1 1027 1043 N 8 IPI00961738 K.AGLLGTLEEMRDEK.L N 47.23 0.5 521.2681 3 22.569 1963 2 767 780 N 8 IPI00961738 K.MEIDDLSSNM(+15.99)EAVAKAK.A N 43.95 0.1 623.2973 3 20.181 1739 1 1226 1242 Y 8 IPI00961738 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1758 1770 N 8 IPI00961738 K.DLQHRLDEAENLAM(+15.99)K.G N 41.09 0.6 600.2962 3 20.172 1738 1 1792 1806 Y 8 IPI00961738 K.KNLEVTVK.D N 39.8 0.5 465.7848 2 11.806 934 1 1784 1791 N 8 IPI00961738 K.CASLEK.T N 39.15 0.1 325.6625 2 3.599 287 3 1411 1416 N 8 IPI00961738 K.LRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1044 1050 N

PAGE 202

202 8 IPI00961738 K.NLEVTVK.D N 36.87 0.3 401.7369 2 13.821 1107 1 1785 1791 N 8 IPI00961738 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 658 663 N 8 IPI00961738 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1864 1870 N 8 IPI00961738 R.SFMNVK.H N 31.11 0.1 363.1862 2 14.189 1144 1 820 825 N 8 IPI00961738 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 658 663 Y 8 IPI00961738 K.IQLEAK.L N 28.41 0.7 351.213 2 11.787 932 1 913 918 N 8 IPI00961738 K.IEDEQSLGAQLQKKIK.E N 14.55 0.3 457.7597 4 16.792 1409 1 1094 1109 N 8 IPI00961738 R.VLDAMQSTLDSEVRSR.N Y 10.2 0.9 602.9725 3 20.558 1775 1 1593 1608 N 13 IPI00484075 K.MEGDLNEMEIQLSHANR.Q N 146.95 0.1 993.9541 2 20.596 1778 20 1622 1638 N 13 IPI00484075 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1761 1775 N 13 IPI00484075 K.TPGLMENFLVIHQLR.C N 104.56 0.3 884.4821 2 25.096 2188 2 682 696 N 13 IPI00484075 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1762 1775 N 13 IPI00484075 K.KQADSVAELGEQIDNLQR.V N 99.26 0.2 1007.513 2 20.724 1790 4 1197 1214 N 13 IPI00484075 K.AGLLGTLEEMR.D N 95.04 0.4 595.3156 2 23.555 2053 35 769 779 N 13 IPI00484075 K.VAEQELVDASER.V N 94.92 0.5 673.3336 2 15.024 1231 1 1705 1716 N 13 IPI00484075 R.DLEESTLQHEATAAALR.K N 94.23 0.3 927.963 2 19.562 1681 4 1179 1195 N 13 IPI00484075 K.KMEGDLNEMEIQLSHANR.Q N 93.3 1 1058.003 2 19.061 1634 8 1621 1638 N 13 IPI00484075 K.KM(+15.99)EGDLNEMEIQLSHANR.Q N 92.12 0.3 711.0015 3 17.562 1486 1 1621 1638 Y 13 IPI00484075 K.KKMEGDLNEMEIQLSHANR.Q N 89.06 0 748.3684 3 17.091 1439 15 1620 1638 N 13 IPI00484075 R.KVAEQELVDASER.V N 88.91 0.2 737.3809 2 14.239 1149 3 1704 1716 N 13 IPI00484075 K.QADSVAELGEQIDNLQR.V N 87.89 1.2 943.4673 2 22.248 1933 3 1198 1214 N 13 IPI00484075 R.KKQADSVAELGEQIDNLQR.V N 87.29 0.9 1071.562 2 18.889 1617 7 1196 1214 N 13 IPI00484075 R.RDLEESTLQHEATAAALR.K N 86.71 0.8 1006.015 2 17.252 1455 4 1178 1195 N 13 IPI00484075 K.VLNASVIPEGQFIDNK.K N 86.35 0.1 872.4675 2 21.406 1856 1 726 741 N 13 IPI00484075 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 954 965 N 13 IPI00484075 K.NKDPLNDSVVQLYQK.S N 84.7 0.4 880.9621 2 18.172 1547 2 599 613 N 13 IPI00484075 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1762 1775 Y 13 IPI00484075 R.IEELEEEIEAERAAR.A N 82.3 0.2 893.9443 2 18.439 1573 2 1117 1131 N 13 IPI00484075 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1762 1774 Y 13 IPI00484075 R.IEELEEEIEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1117 1128 N 13 IPI00484075 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1761 1775 Y

PAGE 203

203 13 IPI00484075 R.VKELTYQTEEDKK.N N 74.8 0.1 537.6138 3 12.375 980 2 1851 1863 N 13 IPI00484075 R.ENLGKLMTNLR.S N 74.7 1 644.8564 2 18.112 1541 1 655 665 N 13 IPI00484075 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1761 1775 Y 13 IPI00484075 K.ELTYQTEEDKK.N N 73.25 0.4 692.3353 2 12.299 974 1 1853 1863 N 13 IPI00484075 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 955 965 N 13 IPI00484075 K.AGLLGTLEEM(+15.99)R.D N 73.06 0.8 603.3138 2 19.327 1659 2 769 779 Y 13 IPI00484075 R.DLEESTLQHEATAAALRK.K N 72.77 0.4 661.6765 3 18.027 1532 1 1179 1196 N 13 IPI00484075 K.KMEGDLNEM(+15.99)EIQLSHANR.Q N 72.57 1.4 711.0007 3 19.127 1640 2 1621 1638 Y 13 IPI00484075 K.MEGDLNEM(+15.99)EIQLSHANR.Q N 70.89 0.5 668.3037 3 16.541 1385 1 1622 1638 Y 13 IPI00484075 K.VLNASVIPEGQFIDNKK.A N 64.59 0.8 624.6785 3 19.57 1682 1 726 742 N 13 IPI00484075 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1377 1384 N 13 IPI00484075 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1762 1775 Y 13 IPI00484075 R.NFDKVLAEWK.Q N 61.76 0.3 417.2239 3 20.741 1792 2 1450 1459 N 13 IPI00484075 R.HDCDLLR.E N 60.31 0.4 436.208 2 13.626 1087 1 1340 1346 N 13 IPI00484075 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1868 1878 N 13 IPI00484075 R.SLSTELFK.M N 52.49 0.6 462.7557 2 35.763 3049 41 1478 1485 N 13 IPI00484075 K.LEQQVDDLEGSLEQEKK.L N 48.54 0.6 663.3325 3 18.209 1550 1 1029 1045 N 13 IPI00484075 K.AGLLGTLEEMRDEK.L N 47.23 0.5 521.2681 3 22.569 1963 2 769 782 N 13 IPI00484075 R.VQLELNQVKGEIDR.K N 43.71 0.4 820.9515 2 18.653 1595 4 1565 1578 N 13 IPI00484075 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1762 1774 N 13 IPI00484075 R.VQLELNQVKGEIDRK.L N 40.47 0.3 884.9996 2 17.296 1459 3 1565 1579 N 13 IPI00484075 K.KNLEVTVK.D N 39.8 0.5 465.7848 2 11.806 934 1 1788 1795 N 13 IPI00484075 K.CASLEK.T N 39.15 0.1 325.6625 2 3.599 287 3 1413 1418 N 13 IPI00484075 K.LRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1046 1052 N 13 IPI00484075 K.NLEVTVK.D N 36.87 0.3 401.7369 2 13.821 1107 1 1789 1795 N 13 IPI00484075 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 660 665 N 13 IPI00484075 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1868 1874 N 13 IPI00484075 R.SFMNVK.H N 31.11 0.1 363.1862 2 14.189 1144 1 822 827 N 13 IPI00484075 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 660 665 Y 13 IPI00484075 K.IQLEAK.L N 28.41 0.7 351.213 2 11.787 932 1 915 920 N 31 IPI00882712 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1759 1773 N

PAGE 204

204 31 IPI00882712 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1760 1773 N 31 IPI00882712 K.KQADSVAELGEQIDNLQR.V N 99.26 0.2 1007.513 2 20.724 1790 4 1197 1214 N 31 IPI00882712 K.QADSVAELGEQIDNLQR.V N 87.89 1.2 943.4673 2 22.248 1933 3 1198 1214 N 31 IPI00882712 R.KKQADSVAELGEQIDNLQR.V N 87.29 0.9 1071.562 2 18.889 1617 7 1196 1214 N 31 IPI00882712 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 954 965 N 31 IPI00882712 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1760 1773 Y 31 IPI00882712 R.IEELEEELEAERAAR.A N 82.3 0.2 893.9443 2 18.439 1573 2 1117 1131 N 31 IPI00882712 K.AGLLGQLEEMR.D N 81.62 2.9 608.8231 2 23.178 2017 1 769 779 N 31 IPI00882712 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1760 1772 Y 31 IPI00882712 R.IEELEEELEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1117 1128 N 31 IPI00882712 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1759 1773 Y 31 IPI00882712 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1759 1773 Y 31 IPI00882712 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 955 965 N 31 IPI00882712 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1377 1384 N 31 IPI00882712 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1760 1773 Y 31 IPI00882712 K.MVSLLQEK.N N 59.52 1.1 474.2646 2 26.71 2320 23 879 886 N 31 IPI00882712 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1866 1876 N 31 IPI00882712 K.LEQQVDDLEGSLEQEKK.L N 48.54 0.6 663.3325 3 18.209 1550 1 1029 1045 N 31 IPI00882712 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1760 1772 N 31 IPI00882712 K.LRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1046 1052 N 31 IPI00882712 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 660 665 N 31 IPI00882712 K.KALQEAHQQTLDDLQSEEDKVNTLTK.A N 35.43 0.1 746.3807 4 19.372 1663 2 999 1024 N 31 IPI00882712 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1866 1872 N 31 IPI00882712 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 660 665 Y 31 IPI00882712 K.IQLEAK.A N 28.41 0.7 351.213 2 11.787 932 1 915 920 N 31 IPI00882712 K.ALQEAHQQTLDDLQSEEDKVNTLTKAK.A N 14.47 0.3 764.1403 4 20.368 1757 1 1000 1026 N 31 IPI00882712 K.ALQEAHQQTLDDLQSEEDKVNTLTK.A N 12.54 2.2 952.1425 3 20.534 1772 1 1000 1024 N 31 IPI00882712 R.ERLEAQT(+79.97)RPFDMKK.E N 8.18 0.4 457.975 4 17.493 1479 1 22 35 Y 14 IPI00934366 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1760 1774 N 14 IPI00934366 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1761 1774 N 14 IPI00934366 K.AGLLGTLEEMR.D N 95.04 0.4 595.3156 2 23.555 2053 35 770 780 N

PAGE 205

205 14 IPI00934366 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 955 966 N 14 IPI00934366 R.EQFEEEQEAKAELQR.S N 84.5 0.9 932.4387 2 16.361 1366 5 1348 1362 N 14 IPI00934366 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1761 1774 Y 14 IPI00934366 R.IEELEEELEAERAAR.A N 82.3 0.2 893.9443 2 18.439 1573 2 1118 1132 N 14 IPI00934366 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1761 1773 Y 14 IPI00934366 R.IEELEEELEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1118 1129 N 14 IPI00934366 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1760 1774 Y 14 IPI00934366 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1760 1774 Y 14 IPI00934366 R.EQFEEEQEAK.A N 73.74 0 633.7778 2 12.289 973 1 1348 1357 N 14 IPI00934366 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 956 966 N 14 IPI00934366 K.AGLLGTLEEM(+15.99)R.D N 73.06 0.8 603.3138 2 19.327 1659 2 770 780 Y 14 IPI00934366 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1378 1385 N 14 IPI00934366 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1761 1774 Y 14 IPI00934366 R.NFDKVLAEWK.Q N 61.76 0.3 417.2239 3 20.741 1792 2 1451 1460 N 14 IPI00934366 K.MVSLLQEK.N N 59.52 1.1 474.2646 2 26.71 2320 23 880 887 N 14 IPI00934366 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1867 1877 N 14 IPI00934366 R.SLSTELFK.L N 52.49 0.6 462.7557 2 35.763 3049 41 1479 1486 N 14 IPI00934366 R.ADLSRELEEISER.L N 50.52 1.5 516.2625 3 20.916 1808 1 1140 1152 N 14 IPI00934366 K.LEQQVDDLEGSLEQEKK.L N 48.54 0.6 663.3325 3 18.209 1550 1 1030 1046 N 14 IPI00934366 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1761 1773 N 14 IPI00934366 K.LRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1047 1053 N 14 IPI00934366 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 661 666 N 14 IPI00934366 K.KALQEAHQQTLDDLQSEEDKVNTLTK.A N 35.43 0.1 746.3807 4 19.372 1663 2 1000 1025 N 14 IPI00934366 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1867 1873 N 14 IPI00934366 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 661 666 Y 14 IPI00934366 K.IQLEAK.A N 28.41 0.7 351.213 2 11.787 932 1 916 921 N 14 IPI00934366 K.ALQEAHQQTLDDLQSEEDKVNTLTKAK.A N 14.47 0.3 764.1403 4 20.368 1757 1 1001 1027 N 14 IPI00934366 K.ALQEAHQQTLDDLQSEEDKVNTLTK.A N 12.54 2.2 952.1425 3 20.534 1772 1 1001 1025 N 38 IPI00496068 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1760 1774 N 38 IPI00496068 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1761 1774 N 38 IPI00496068 K.AGLLGTLEEMR.D N 95.04 0.4 595.3156 2 23.555 2053 35 770 780 N

PAGE 206

206 38 IPI00496068 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 955 966 N 38 IPI00496068 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1761 1774 Y 38 IPI00496068 R.IEELEEELEAERAAR.A N 82.3 0.2 893.9443 2 18.439 1573 2 1118 1132 N 38 IPI00496068 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1761 1773 Y 38 IPI00496068 R.IEELEEELEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1118 1129 N 38 IPI00496068 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1760 1774 Y 38 IPI00496068 K.LSSADIETYLLEK.S N 75.72 1.1 741.3895 2 23.885 2083 1 258 270 N 38 IPI00496068 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1760 1774 Y 38 IPI00496068 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 956 966 N 38 IPI00496068 K.AGLLGTLEEM(+15.99)R.D N 73.06 0.8 603.3138 2 19.327 1659 2 770 780 Y 38 IPI00496068 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1378 1385 N 38 IPI00496068 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1761 1774 Y 38 IPI00496068 R.NFDKVLAEWK.Q N 61.76 0.3 417.2239 3 20.741 1792 2 1451 1460 N 38 IPI00496068 K.MVSLLQEK.N N 59.52 1.1 474.2646 2 26.71 2320 23 880 887 N 38 IPI00496068 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1867 1877 N 38 IPI00496068 R.SLSTELFK.L N 52.49 0.6 462.7557 2 35.763 3049 41 1479 1486 N 38 IPI00496068 R.ADLSRELEEISER.L N 50.52 1.5 516.2625 3 20.916 1808 1 1140 1152 N 38 IPI00496068 K.LEQQVDDLEGSLEQEKK.I N 48.54 0.6 663.3325 3 18.209 1550 1 1030 1046 N 38 IPI00496068 K.LSSADIETYLLEKSR.V N 46.7 0.5 575.6406 3 23.063 2008 1 258 272 N 38 IPI00496068 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1761 1773 N 38 IPI00496068 K.IRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1047 1053 N 38 IPI00496068 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 661 666 N 38 IPI00496068 K.KALQEAHQQTLDDLQSEEDKVNTLTK.A N 35.43 0.1 746.3807 4 19.372 1663 2 1000 1025 N 38 IPI00496068 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1867 1873 N 38 IPI00496068 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 661 666 Y 38 IPI00496068 K.ALQEAHQQTLDDLQSEEDKVNTLTKAK.A N 14.47 0.3 764.1403 4 20.368 1757 1 1001 1027 N 38 IPI00496068 K.ALQEAHQQTLDDLQSEEDKVNTLTK.A N 12.54 2.2 952.1425 3 20.534 1772 1 1001 1025 N 38 IPI00496068 K.ERLEAQT(+79.97)RPFDMKK.E N 8.18 0.4 457.975 4 17.493 1479 1 22 35 Y 11 IPI00490216 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1757 1771 N 11 IPI00490216 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1758 1771 N 11 IPI00490216 K.AGLLGTLEEMR.D N 95.04 0.4 595.3156 2 23.555 2053 35 767 777 N

PAGE 207

207 11 IPI00490216 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 952 963 N 11 IPI00490216 R.EQFEEEQEAKAELQR.A N 84.5 0.9 932.4387 2 16.361 1366 5 1345 1359 N 11 IPI00490216 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1758 1771 Y 11 IPI00490216 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1758 1770 Y 11 IPI00490216 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1757 1771 Y 11 IPI00490216 K.LSSADIETYLLEK.S N 75.72 1.1 741.3895 2 23.885 2083 1 257 269 N 11 IPI00490216 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1757 1771 Y 11 IPI00490216 R.EQFEEEQEAK.A N 73.74 0 633.7778 2 12.289 973 1 1345 1354 N 11 IPI00490216 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 953 963 N 11 IPI00490216 K.AGLLGTLEEM(+15.99)R.D N 73.06 0.8 603.3138 2 19.327 1659 2 767 777 Y 11 IPI00490216 R.VKVGNEYVTK.G Y 66.66 0.9 379.5482 3 13.057 1036 1 403 412 N 11 IPI00490216 K.VGNEYVTK.G Y 64.36 0.1 455.2374 2 6.542 523 4 405 412 N 11 IPI00490216 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1758 1771 Y 11 IPI00490216 R.HDCDLLR.E N 60.31 0.4 436.208 2 13.626 1087 1 1338 1344 N 11 IPI00490216 K.MVSLLQEK.N N 59.52 1.1 474.2646 2 26.71 2320 23 877 884 N 11 IPI00490216 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1864 1874 N 11 IPI00490216 R.SLSTELFK.L N 52.49 0.6 462.7557 2 35.763 3049 41 1476 1483 N 11 IPI00490216 K.LEQQVDDLEGSLEQEKK.V N 48.54 0.6 663.3325 3 18.209 1550 1 1027 1043 N 11 IPI00490216 K.LSSADIETYLLEKSR.V N 46.7 0.5 575.6406 3 23.063 2008 1 257 271 N 11 IPI00490216 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1758 1770 N 11 IPI00490216 K.KALQEAHQQTLDDLQSEEDKVNTLTK.A N 35.43 0.1 746.3807 4 19.372 1663 2 997 1022 N 11 IPI00490216 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1864 1870 N 11 IPI00490216 K.IQLEAK.V N 28.41 0.7 351.213 2 11.787 932 1 913 918 N 11 IPI00490216 R.KLQHELEEAEERADIAESQVNKLR.A Y 19.69 0.4 567.8975 5 20.67 1785 2 1898 1921 N 11 IPI00490216 K.ALQEAHQQTLDDLQSEEDKVNTLTKAK.V N 14.47 0.3 764.1403 4 20.368 1757 1 998 1024 N 11 IPI00490216 K.ALQEAHQQTLDDLQSEEDKVNTLTK.A N 12.54 2.2 952.1425 3 20.534 1772 1 998 1022 N 11 IPI00490216 R.ARYETDGIQRTEELEDAK.K Y 7.05 2.2 531.7617 4 37.165 3161 1 1373 1390 N 30 IPI00616127 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1764 1778 N 30 IPI00616127 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1765 1778 N 30 IPI00616127 K.KQADSVAELGEQIDNLQR.V N 99.26 0.2 1007.513 2 20.724 1790 4 1202 1219 N 30 IPI00616127 K.QADSVAELGEQIDNLQR.V N 87.89 1.2 943.4673 2 22.248 1933 3 1203 1219 N

PAGE 208

208 30 IPI00616127 R.KKQADSVAELGEQIDNLQR.V N 87.29 0.9 1071.562 2 18.889 1617 7 1201 1219 N 30 IPI00616127 K.KDIDDLELTLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 959 970 N 30 IPI00616127 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1765 1778 Y 30 IPI00616127 K.AGLLGQLEEMR.D N 81.62 2.9 608.8231 2 23.178 2017 1 771 781 N 30 IPI00616127 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1765 1777 Y 30 IPI00616127 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1764 1778 Y 30 IPI00616127 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1764 1778 Y 30 IPI00616127 K.DIDDLELTLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 960 970 N 30 IPI00616127 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1382 1389 N 30 IPI00616127 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1765 1778 Y 30 IPI00616127 R.LQDLVDKLQLK.V N 54.78 0.3 656.8951 2 19.19 1646 54 1871 1881 N 30 IPI00616127 R.SLSTELFK.L N 52.49 0.6 462.7557 2 35.763 3049 41 1483 1490 N 30 IPI00616127 K.LEQQVDDLEGSLEQEKK.I N 48.54 0.6 663.3325 3 18.209 1550 1 1034 1050 N 30 IPI00616127 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1765 1777 N 30 IPI00616127 K.IRMDLER.A N 38.21 0.1 311.5042 3 14.197 1145 1 1051 1057 N 30 IPI00616127 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 662 667 N 30 IPI00616127 K.KALQEAHQQTLDDLQSEEDKVNTLTK.A N 35.43 0.1 746.3807 4 19.372 1663 2 1004 1029 N 30 IPI00616127 R.LQDLVDK.L N 32.39 1.5 415.7339 2 13.587 1084 1 1871 1877 N 30 IPI00616127 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 662 667 Y 30 IPI00616127 K.ALQEAHQQTLDDLQSEEDKVNTLTKAK.V N 14.47 0.3 764.1403 4 20.368 1757 1 1005 1031 N 30 IPI00616127 K.ALQEAHQQTLDDLQSEEDKVNTLTK.A N 12.54 2.2 952.1425 3 20.534 1772 1 1005 1029 N 20 IPI00504207 R.HQGVMVGMGQKDSYVGDEAQSKR.G Y 103.92 1 627.549 4 14.468 1174 1 42 64 N 20 IPI00504207 R.KDLYANNVLSGGTTMYPGIADR.M Y 100.76 0.7 1178.583 2 21.288 1845 2 293 314 N 20 IPI00504207 K.SYELPDGQVITIGNER.F Y 100.71 0.1 895.9495 2 22.503 1957 2 241 256 N 20 IPI00504207 R.HQGVMVGMGQK.D Y 91.85 1.2 586.2885 2 13.11 1041 1 42 52 N 20 IPI00504207 R.VAPEEHPTLLTEAPLNPK.A Y 90.71 0 652.686 3 18.147 1544 1 98 115 N 20 IPI00504207 K.EITALAPSTMK.I Y 86.06 0 581.3128 2 15.944 1322 3 318 328 N 20 IPI00504207 K.DLYANNVLSGGTTMYPGIADR.M Y 84.13 0.9 1114.537 2 23.043 2006 2 294 314 N 20 IPI00504207 K.EITALAPSTM(+15.99)K.I Y 78.98 0.2 589.3104 2 14.312 1157 1 318 328 Y 20 IPI00504207 K.AGFAGDDAPR.A Y 76.81 0.7 488.7281 2 12.815 1015 2 21 30 N 20 IPI00504207 R.AVFPSIVGRPR.H Y 74.08 1.7 599.8574 2 16.645 1394 18 31 41 N

PAGE 209

209 20 IPI00504207 K.IWHHTFYNELR.V Y 69.78 0.1 505.9212 3 15.964 1325 1 87 97 N 20 IPI00504207 R.DLTDYLMK.I Y 67.37 0.1 499.7467 2 21.275 1843 2 186 193 N 20 IPI00504207 R.GYSFVTTAER.E Y 59.04 1 1130.547 1 15.907 1319 1 199 208 N 20 IPI00504207 R.HQGVM(+15.99)VGMGQK.D Y 52.64 1.5 396.5262 3 13.117 1042 1 42 52 Y 20 IPI00504207 K.IIAPPER.K Y 39.34 0.5 398.2395 2 13.228 1051 1 331 337 N 20 IPI00504207 K.DSYVGDEAQSKR.G Y 38.38 0.7 452.2123 3 3.858 308 1 53 64 N 20 IPI00504207 R.GILTLK.Y Y 30 0.1 322.7207 2 15.272 1257 1 65 70 N 20 IPI00504207 K.QEYDEAGPSIVHRK.C Y 17.8 0.2 543.6056 3 13.72 1097 2 362 375 N 20 IPI00504207 R.LDLAGRDLTDYLMK.I Y 17.51 0 541.9518 3 23.525 2051 1 180 193 N 20 IPI00504207 R.GYSFVTTAEREIVR.D Y 16.72 0.3 543.2859 3 22.009 1912 1 199 212 N 21 IPI00507230 R.HQGVMVGMGQKDSYVGDEAQSKR.G Y 103.92 1 627.549 4 14.468 1174 1 42 64 N 21 IPI00507230 R.KDLYANNVLSGGTTMYPGIADR.M Y 100.76 0.7 1178.583 2 21.288 1845 2 293 314 N 21 IPI00507230 K.SYELPDGQVITIGNER.F Y 100.71 0.1 895.9495 2 22.503 1957 2 241 256 N 21 IPI00507230 R.HQGVMVGMGQK.D Y 91.85 1.2 586.2885 2 13.11 1041 1 42 52 N 21 IPI00507230 R.VAPEEHPTLLTEAPLNPK.A Y 90.71 0 652.686 3 18.147 1544 1 98 115 N 21 IPI00507230 K.EITALAPSTMK.I Y 86.06 0 581.3128 2 15.944 1322 3 318 328 N 21 IPI00507230 K.DLYANNVLSGGTTMYPGIADR.M Y 84.13 0.9 1114.537 2 23.043 2006 2 294 314 N 21 IPI00507230 K.EITALAPSTM(+15.99)K.I Y 78.98 0.2 589.3104 2 14.312 1157 1 318 328 Y 21 IPI00507230 K.AGFAGDDAPR.A Y 76.81 0.7 488.7281 2 12.815 1015 2 21 30 N 21 IPI00507230 R.AVFPSIVGRPR.H Y 74.08 1.7 599.8574 2 16.645 1394 18 31 41 N 21 IPI00507230 K.IWHHTFYNELR.V Y 69.78 0.1 505.9212 3 15.964 1325 1 87 97 N 21 IPI00507230 R.DLTDYLMK.I Y 67.37 0.1 499.7467 2 21.275 1843 2 186 193 N 21 IPI00507230 R.GYSFVTTAER.E Y 59.04 1 1130.547 1 15.907 1319 1 199 208 N 21 IPI00507230 R.HQGVM(+15.99)VGMGQK.D Y 52.64 1.5 396.5262 3 13.117 1042 1 42 52 Y 21 IPI00507230 K.IIAPPER.K Y 39.34 0.5 398.2395 2 13.228 1051 1 331 337 N 21 IPI00507230 K.DSYVGDEAQSKR.G Y 38.38 0.7 452.2123 3 3.858 308 1 53 64 N 21 IPI00507230 R.GILTLK.Y Y 30 0.1 322.7207 2 15.272 1257 1 65 70 N 21 IPI00507230 K.QEYDEAGPSIVHRK.C Y 17.8 0.2 543.6056 3 13.72 1097 2 362 375 N 21 IPI00507230 R.LDLAGRDLTDYLMK.I Y 17.51 0 541.9518 3 23.525 2051 1 180 193 N 21 IPI00507230 R.GYSFVTTAEREIVR.D Y 16.72 0.3 543.2859 3 22.009 1912 1 199 212 N 26 IPI00509458 R.HQGVMVGMGQKDSYVGDEAQSKR.G Y 103.92 1 627.549 4 14.468 1174 1 42 64 N

PAGE 210

210 26 IPI00509458 R.KDLYANNVLSGGTTMYPGIADR.M Y 100.76 0.7 1178.583 2 21.288 1845 2 293 314 N 26 IPI00509458 K.SYELPDGQVITIGNER.F Y 100.71 0.1 895.9495 2 22.503 1957 2 241 256 N 26 IPI00509458 R.HQGVMVGMGQK.D Y 91.85 1.2 586.2885 2 13.11 1041 1 42 52 N 26 IPI00509458 R.VAPEEHPTLLTEAPLNPK.A Y 90.71 0 652.686 3 18.147 1544 1 98 115 N 26 IPI00509458 K.EITALAPSTMK.I Y 86.06 0 581.3128 2 15.944 1322 3 318 328 N 26 IPI00509458 K.DLYANNVLSGGTTMYPGIADR.M Y 84.13 0.9 1114.537 2 23.043 2006 2 294 314 N 26 IPI00509458 K.EITALAPSTM(+15.99)K.I Y 78.98 0.2 589.3104 2 14.312 1157 1 318 328 Y 26 IPI00509458 K.AGFAGDDAPR.A Y 76.81 0.7 488.7281 2 12.815 1015 2 21 30 N 26 IPI00509458 R.AVFPSIVGRPR.H Y 74.08 1.7 599.8574 2 16.645 1394 18 31 41 N 26 IPI00509458 K.IWHHTFYNELR.V Y 69.78 0.1 505.9212 3 15.964 1325 1 87 97 N 26 IPI00509458 R.DLTDYLMK.I Y 67.37 0.1 499.7467 2 21.275 1843 2 186 193 N 26 IPI00509458 R.GYSFVTTAER.E Y 59.04 1 1130.547 1 15.907 1319 1 199 208 N 26 IPI00509458 R.HQGVM(+15.99)VGMGQK.D Y 52.64 1.5 396.5262 3 13.117 1042 1 42 52 Y 26 IPI00509458 K.IIAPPER.K Y 39.34 0.5 398.2395 2 13.228 1051 1 331 337 N 26 IPI00509458 K.DSYVGDEAQSKR.G Y 38.38 0.7 452.2123 3 3.858 308 1 53 64 N 26 IPI00509458 R.GILTLK.Y Y 30 0.1 322.7207 2 15.272 1257 1 65 70 N 26 IPI00509458 K.QEYDEAGPSIVHRK.C Y 17.8 0.2 543.6056 3 13.72 1097 2 362 375 N 26 IPI00509458 R.LDLAGRDLTDYLMK.I Y 17.51 0 541.9518 3 23.525 2051 1 180 193 N 26 IPI00509458 R.GYSFVTTAEREIVR.D Y 16.72 0.3 543.2859 3 22.009 1912 1 199 212 N 22 IPI00551966 R.HQGVMVGMGQKDSYVGDEAQSKR.G Y 103.92 1 627.549 4 14.468 1174 1 42 64 N 22 IPI00551966 R.KDLYANNVLSGGTTMYPGIADR.M Y 100.76 0.7 1178.583 2 21.288 1845 2 293 314 N 22 IPI00551966 K.SYELPDGQVITIGNER.F Y 100.71 0.1 895.9495 2 22.503 1957 2 241 256 N 22 IPI00551966 R.HQGVMVGMGQK.D Y 91.85 1.2 586.2885 2 13.11 1041 1 42 52 N 22 IPI00551966 R.VAPEEHPTLLTEAPLNPK.A Y 90.71 0 652.686 3 18.147 1544 1 98 115 N 22 IPI00551966 K.EITALAPSTMK.I Y 86.06 0 581.3128 2 15.944 1322 3 318 328 N 22 IPI00551966 K.DLYANNVLSGGTTMYPGIADR.M Y 84.13 0.9 1114.537 2 23.043 2006 2 294 314 N 22 IPI00551966 K.EITALAPSTM(+15.99)K.I Y 78.98 0.2 589.3104 2 14.312 1157 1 318 328 Y 22 IPI00551966 K.AGFAGDDAPR.A Y 76.81 0.7 488.7281 2 12.815 1015 2 21 30 N 22 IPI00551966 R.AVFPSIVGRPR.H Y 74.08 1.7 599.8574 2 16.645 1394 18 31 41 N 22 IPI00551966 K.IWHHTFYNELR.V Y 69.78 0.1 505.9212 3 15.964 1325 1 87 97 N 22 IPI00551966 R.DLTDYLMK.I Y 67.37 0.1 499.7467 2 21.275 1843 2 186 193 N

PAGE 211

211 22 IPI00551966 R.GYSFVTTAER.E Y 59.04 1 1130.547 1 15.907 1319 1 199 208 N 22 IPI00551966 R.HQGVM(+15.99)VGMGQK.D Y 52.64 1.5 396.5262 3 13.117 1042 1 42 52 Y 22 IPI00551966 K.IIAPPER.K Y 39.34 0.5 398.2395 2 13.228 1051 1 331 337 N 22 IPI00551966 K.DSYVGDEAQSKR.G Y 38.38 0.7 452.2123 3 3.858 308 1 53 64 N 22 IPI00551966 R.GILTLK.Y Y 30 0.1 322.7207 2 15.272 1257 1 65 70 N 22 IPI00551966 K.QEYDEAGPSIVHRK.C Y 17.8 0.2 543.6056 3 13.72 1097 2 362 375 N 22 IPI00551966 R.LDLAGRDLTDYLMK.I Y 17.51 0 541.9518 3 23.525 2051 1 180 193 N 22 IPI00551966 R.GYSFVTTAEREIVR.D Y 16.72 0.3 543.2859 3 22.009 1912 1 199 212 N 28 IPI00570197 R.HQGVMVGMGQKDSYVGDEAQSKR.G Y 103.92 1 627.549 4 14.468 1174 1 42 64 N 28 IPI00570197 R.KDLYANNVLSGGTTMYPGIADR.M Y 100.76 0.7 1178.583 2 21.288 1845 2 293 314 N 28 IPI00570197 K.SYELPDGQVITIGNER.F Y 100.71 0.1 895.9495 2 22.503 1957 2 241 256 N 28 IPI00570197 R.HQGVMVGMGQK.D Y 91.85 1.2 586.2885 2 13.11 1041 1 42 52 N 28 IPI00570197 R.VAPEEHPTLLTEAPLNPK.A Y 90.71 0 652.686 3 18.147 1544 1 98 115 N 28 IPI00570197 K.EITALAPSTMK.I Y 86.06 0 581.3128 2 15.944 1322 3 318 328 N 28 IPI00570197 K.DLYANNVLSGGTTMYPGIADR.M Y 84.13 0.9 1114.537 2 23.043 2006 2 294 314 N 28 IPI00570197 K.EITALAPSTM(+15.99)K.I Y 78.98 0.2 589.3104 2 14.312 1157 1 318 328 Y 28 IPI00570197 K.AGFAGDDAPR.A Y 76.81 0.7 488.7281 2 12.815 1015 2 21 30 N 28 IPI00570197 R.AVFPSIVGRPR.H Y 74.08 1.7 599.8574 2 16.645 1394 18 31 41 N 28 IPI00570197 K.IWHHTFYNELR.V Y 69.78 0.1 505.9212 3 15.964 1325 1 87 97 N 28 IPI00570197 R.DLTDYLMK.I Y 67.37 0.1 499.7467 2 21.275 1843 2 186 193 N 28 IPI00570197 R.GYSFVTTAER.E Y 59.04 1 1130.547 1 15.907 1319 1 199 208 N 28 IPI00570197 R.HQGVM(+15.99)VGMGQK.D Y 52.64 1.5 396.5262 3 13.117 1042 1 42 52 Y 28 IPI00570197 K.IIAPPER.K Y 39.34 0.5 398.2395 2 13.228 1051 1 331 337 N 28 IPI00570197 K.DSYVGDEAQSKR.G Y 38.38 0.7 452.2123 3 3.858 308 1 53 64 N 28 IPI00570197 R.GILTLK.Y Y 30 0.1 322.7207 2 15.272 1257 1 65 70 N 28 IPI00570197 K.QEYDEAGPSIVHRK.C Y 17.8 0.2 543.6056 3 13.72 1097 2 362 375 N 28 IPI00570197 R.LDLAGRDLTDYLMK.I Y 17.51 0 541.9518 3 23.525 2051 1 180 193 N 28 IPI00570197 R.GYSFVTTAEREIVR.D Y 16.72 0.3 543.2859 3 22.009 1912 1 199 212 N 23 IPI00628880 R.HQGVMVGMGQKDSYVGDEAQSKR.G Y 103.92 1 627.549 4 14.468 1174 1 42 64 N 23 IPI00628880 R.KDLYANNVLSGGTTMYPGIADR.M Y 100.76 0.7 1178.583 2 21.288 1845 2 293 314 N 23 IPI00628880 K.SYELPDGQVITIGNER.F Y 100.71 0.1 895.9495 2 22.503 1957 2 241 256 N

PAGE 212

212 23 IPI00628880 R.HQGVMVGMGQK.D Y 91.85 1.2 586.2885 2 13.11 1041 1 42 52 N 23 IPI00628880 R.VAPEEHPTLLTEAPLNPK.A Y 90.71 0 652.686 3 18.147 1544 1 98 115 N 23 IPI00628880 K.EITALAPSTMK.I Y 86.06 0 581.3128 2 15.944 1322 3 318 328 N 23 IPI00628880 K.DLYANNVLSGGTTMYPGIADR.M Y 84.13 0.9 1114.537 2 23.043 2006 2 294 314 N 23 IPI00628880 K.EITALAPSTM(+15.99)K.I Y 78.98 0.2 589.3104 2 14.312 1157 1 318 328 Y 23 IPI00628880 K.AGFAGDDAPR.A Y 76.81 0.7 488.7281 2 12.815 1015 2 21 30 N 23 IPI00628880 R.AVFPSIVGRPR.H Y 74.08 1.7 599.8574 2 16.645 1394 18 31 41 N 23 IPI00628880 K.IWHHTFYNELR.V Y 69.78 0.1 505.9212 3 15.964 1325 1 87 97 N 23 IPI00628880 R.DLTDYLMK.I Y 67.37 0.1 499.7467 2 21.275 1843 2 186 193 N 23 IPI00628880 R.GYSFVTTAER.E Y 59.04 1 1130.547 1 15.907 1319 1 199 208 N 23 IPI00628880 R.HQGVM(+15.99)VGMGQK.D Y 52.64 1.5 396.5262 3 13.117 1042 1 42 52 Y 23 IPI00628880 K.IIAPPER.K Y 39.34 0.5 398.2395 2 13.228 1051 1 331 337 N 23 IPI00628880 K.DSYVGDEAQSKR.G Y 38.38 0.7 452.2123 3 3.858 308 1 53 64 N 23 IPI00628880 R.GILTLK.Y Y 30 0.1 322.7207 2 15.272 1257 1 65 70 N 23 IPI00628880 K.QEYDEAGPSIVHRK.C Y 17.8 0.2 543.6056 3 13.72 1097 2 362 375 N 23 IPI00628880 R.LDLAGRDLTDYLMK.I Y 17.51 0 541.9518 3 23.525 2051 1 180 193 N 23 IPI00628880 R.GYSFVTTAEREIVR.D Y 16.72 0.3 543.2859 3 22.009 1912 1 199 212 N 18 IPI00501288 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1766 1780 N 18 IPI00501288 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1767 1780 N 18 IPI00501288 K.AITDAAMMAEELKKEQDTSSHLER.M Y 91.67 1.2 902.101 3 19.858 1709 3 1767 1790 N 18 IPI00501288 K.KDLDDLEITLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 961 972 N 18 IPI00501288 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1767 1780 Y 18 IPI00501288 R.IEELEEELEAERAAR.S N 82.3 0.2 893.9443 2 18.439 1573 2 1124 1138 N 18 IPI00501288 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1767 1779 Y 18 IPI00501288 R.IEELEEELEAER.A N 78.43 0 744.8568 2 19.27 1654 1 1124 1135 N 18 IPI00501288 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1766 1780 Y 18 IPI00501288 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1766 1780 Y 18 IPI00501288 R.EQFEEEQEAK.S N 73.74 0 633.7778 2 12.289 973 1 1354 1363 N 18 IPI00501288 K.DLDDLEITLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 962 972 N 18 IPI00501288 K.YETDAIQR.T N 63.72 0.8 498.2428 2 12.604 999 1 1384 1391 N 18 IPI00501288 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1767 1780 Y

PAGE 213

213 18 IPI00501288 R.HDCDLLR.E N 60.31 0.4 436.208 2 13.626 1087 1 1347 1353 N 18 IPI00501288 R.SLSTELFK.L N 52.49 0.6 462.7557 2 35.763 3049 41 1485 1492 N 18 IPI00501288 K.LEQQVDDLEGSLEQEKK.V N 48.54 0.6 663.3325 3 18.209 1550 1 1036 1052 N 18 IPI00501288 K.AITDAAMM(+15.99)AEELKKEQDTSSHLER.M Y 43.81 1.1 544.8637 5 19.334 1660 1 1767 1790 Y 18 IPI00501288 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1767 1779 N 18 IPI00501288 K.CASLEK.T N 39.15 0.1 325.6625 2 3.599 287 3 1420 1425 N 18 IPI00501288 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 667 672 N 18 IPI00501288 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 667 672 Y 29 IPI00800858 K.KAITDAAMMAEELKK.E N 105.35 0.7 825.4331 2 16.959 1425 23 1758 1772 N 29 IPI00800858 K.AITDAAMMAEELKK.E N 103.63 0.4 761.3865 2 18.57 1586 28 1759 1772 N 29 IPI00800858 K.KDIDDLEITLAK.V N 86.12 1.2 687.3806 2 19.01 1629 2 953 964 N 29 IPI00800858 K.AITDAAM(+15.99)MAEELKK.E N 83.25 0.5 769.3832 2 17.929 1523 2 1759 1772 Y 29 IPI00800858 K.AGLLGQLEEMR.D N 81.62 2.9 608.8231 2 23.178 2017 1 768 778 N 29 IPI00800858 K.AITDAAMM(+15.99)AEELK.K N 80.4 0.3 705.3364 2 17.921 1522 1 1759 1771 Y 29 IPI00800858 K.KAITDAAMM(+15.99)AEELKK.E N 76.52 1 555.957 3 15.05 1234 1 1758 1772 Y 29 IPI00800858 K.KAITDAAM(+15.99)MAEELKK.E N 73.76 0.2 555.9564 3 16.714 1401 1 1758 1772 Y 29 IPI00800858 K.DIDDLEITLAK.V N 73.16 0.6 623.3318 2 22.33 1941 1 954 964 N 29 IPI00800858 K.AITDAAMM(+15.99)AEELKK.E N 63.56 0.2 769.3835 2 16.173 1347 3 1759 1772 Y 29 IPI00800858 R.HDCDLLR.E N 60.31 0.4 436.208 2 13.626 1087 1 1339 1345 N 29 IPI00800858 K.LEQQVDDLEGSLEQEKK.L N 48.54 0.6 663.3325 3 18.209 1550 1 1028 1044 N 29 IPI00800858 K.AITDAAMMAEELK.K N 43.28 0.4 465.228 3 21.127 1829 1 1759 1771 N 29 IPI00800858 K.LRMDLER.S N 38.21 0.1 311.5042 3 14.197 1145 1 1045 1051 N 29 IPI00800858 K.LMTNLR.S N 35.48 0 374.2127 2 13.689 1093 1 659 664 N 29 IPI00800858 K.LM(+15.99)TNLR.S N 29.79 0.6 382.2099 2 11.371 898 2 659 664 Y 29 IPI00800858 K.IQLEAK.V N 28.41 0.7 351.213 2 11.787 932 1 914 919 N 112 IPI00508152 K.TIDDLEDELYAQKLK.Y N 99.53 0.4 897.4616 2 21.679 1881 2 252 266 N 112 IPI00508152 R.SKQLEDDLVALQK.K Y 77.87 0.8 743.9086 2 17.666 1497 2 36 48 N 112 IPI00508152 R.IQLVEEELDRAQER.L N 59.48 1.4 864.4485 2 18.716 1601 2 92 105 N 112 IPI00508152 K.HIAEEADRKYEEVAR.K N 56.25 0.3 454.7302 4 13.696 1094 1 153 167 N 112 IPI00508152 K.MELQEIQLK.E N 55.68 0.4 566.3073 2 18.934 1621 1 141 149 N 112 IPI00508152 K.LEEAEKAADESERGMK.V N 54.93 0.2 598.2841 3 13.642 1089 1 113 128 N

PAGE 214

214 112 IPI00508152 R.RIQLVEEELDRAQER.L N 49.68 0.5 628.669 3 17.712 1501 1 91 105 N 112 IPI00508152 K.HIAEEADRKYEEVARK.L N 47.43 0.4 486.7536 4 13.596 1085 1 153 168 N 112 IPI00508152 K.KATDAEGDVASLNR.R N 14.82 0.6 482.9106 3 14.017 1127 1 77 90 N 111 IPI00506010 K.TIDDLEDELYAQKLK.Y N 99.53 0.4 897.4616 2 21.679 1881 2 252 266 N 111 IPI00506010 R.IQLVEEELDRAQER.L N 59.48 1.4 864.4485 2 18.716 1601 2 92 105 N 111 IPI00506010 K.HIAEEADRKYEEVAR.K N 56.25 0.3 454.7302 4 13.696 1094 1 153 167 N 111 IPI00506010 K.MELQEIQLK.E N 55.68 0.4 566.3073 2 18.934 1621 1 141 149 N 111 IPI00506010 K.LEEAEKAADESERGMK.V N 54.93 0.2 598.2841 3 13.642 1089 1 113 128 N 111 IPI00506010 R.RIQLVEEELDRAQER.L N 49.68 0.5 628.669 3 17.712 1501 1 91 105 N 111 IPI00506010 K.HIAEEADRKYEEVARK.L N 47.43 0.4 486.7536 4 13.596 1085 1 153 168 N 111 IPI00506010 K.YSQKEDKYEEEIK.I Y 18.84 1.4 422.9552 4 13.447 1071 1 214 226 N 63 IPI00488248 K.GTYDDYVEGLR.V Y 92.5 0 644.2962 2 32.479 2783 24 84 94 N 63 IPI00488248 K.EGNGTVMGAELR.I Y 89.38 0.5 617.2985 2 14.807 1209 1 99 110 N 63 IPI00488248 R.VFDKEGNGTVMGAELR.I Y 89.03 0.8 861.9282 2 16.517 1382 38 95 110 N 63 IPI00488248 R.VFDKEGNGTVM(+15.99)GAELR.I Y 72.86 0 580.2858 3 14.625 1189 1 95 110 Y 63 IPI00488248 R.IVLSTLGEK.M Y 62.39 0 480.2922 2 36.216 3085 36 111 119 N 45 IPI00488085 K.EAFTIIDQNR.D N 87.34 0 603.8093 2 17.077 1437 1 33 42 N 45 IPI00488085 R.DVLASMGQLNVK.N Y 86.8 1.1 637.8416 2 20.165 1737 4 53 64 N 45 IPI00488085 K.EAFTIIDQNRDGIISKDDLR.D N 84.35 0.3 773.7358 3 20.604 1779 2 33 52 N 45 IPI00488085 R.DGIISKDDLR.D N 65.68 0.3 377.8715 3 14.639 1191 2 43 52 N 45 IPI00488085 K.EAFTIIDQNRDGIISK.D N 21.29 0.1 607.3231 3 19.438 1669 1 33 48 N 51 IPI00919778 K.EAFTIIDQNR.D N 87.34 0 603.8093 2 17.077 1437 1 12 21 N 51 IPI00919778 K.EAFTIIDQNRDGIISKDDLR.D N 84.35 0.3 773.7358 3 20.604 1779 2 12 31 N 51 IPI00919778 R.DGIISKDDLR.D N 65.68 0.3 377.8715 3 14.639 1191 2 22 31 N 51 IPI00919778 K.NEELEAMVK.E Y 63.75 0.8 531.7609 2 15.606 1288 2 44 52 N 51 IPI00919778 K.EAFTIIDQNRDGIISK.D N 21.29 0.1 607.3231 3 19.438 1669 1 12 27 N 52 IPI00496651 K.EAFTIIDQNR.D N 87.34 0 603.8093 2 17.077 1437 1 33 42 N 52 IPI00496651 K.EAFTIIDQNRDGIISKDDLR.D N 84.35 0.3 773.7358 3 20.604 1779 2 33 52 N 52 IPI00496651 R.DGIISKDDLR.D N 65.68 0.3 377.8715 3 14.639 1191 2 43 52 N 52 IPI00496651 K.NEELEAMVK.E Y 63.75 0.8 531.7609 2 15.606 1288 2 65 73 N 52 IPI00496651 K.EAFTIIDQNRDGIISK.D N 21.29 0.1 607.3231 3 19.438 1669 1 33 48 N

PAGE 215

215 98 IPI00508395 K.GGDDLDPNYVLSSR.V Y 100.7 0.9 754.3541 2 18.834 1612 1 116 129 N 98 IPI00508395 K.FEEILTR.L Y 49.04 0.9 454.2482 2 15.642 1291 1 307 313 N 98 IPI00508395 R.DWPDGR.G Y 13.09 1.8 373.1661 2 12.987 1030 1 209 214 N 99 IPI00482319 K.GGDDLDPNYVLSSR.V Y 100.7 0.9 754.3541 2 18.834 1612 1 117 130 N 99 IPI00482319 K.FEEILTR.L Y 49.04 0.9 454.2482 2 15.642 1291 1 308 314 N 5441 IPI00487267 R.AMKDEEKMEIQEIQLK.E Y 60.71 1.2 655.0014 3 18.079 1537 2 98 113 N 5441 IPI00487267 R.IQLVEEELDRAQER.L N 59.48 1.4 864.4485 2 18.716 1601 2 56 69 N 5441 IPI00487267 K.MEIQEIQLK.E N 55.68 0.4 566.3073 2 18.934 1621 1 105 113 N 5441 IPI00487267 R.RIQLVEEELDRAQER.L N 49.68 0.5 628.669 3 17.712 1501 1 55 69 N 70 IPI00615483 K.VLDTPGAPQNLFVK.D Y 81.42 0.8 749.9162 2 20.661 1784 1 23747 23760 N 70 IPI00615483 K.LLPGNEYIFR.V Y 54.23 0.1 611.335 2 21.104 1826 1 24501 24510 N 70 IPI00615483 R.IFVPIK.G N 22.57 0.3 358.7388 2 16.7 1399 1 20432 20437 N 70 IPI00615483 K.LPT(+79.97)SQTTGNLR.I Y 12.49 0.4 423.2061 3 10.802 851 1 12252 12262 Y 73 IPI01016913 K.VLDTPGAPQNLFVK.D Y 81.42 0.8 749.9162 2 20.661 1784 1 10056 10069 N 73 IPI01016913 K.LLPGNEYIFR.V Y 54.23 0.1 611.335 2 21.104 1826 1 8646 8655 N 73 IPI01016913 R.IFVPIK.G N 22.57 0.3 358.7388 2 16.7 1399 1 6741 6746 N 5442 IPI00493235 R.VDQSILTGESVSVIK.H Y 77.28 1.1 787.9363 2 20.478 1767 1 169 183 N 5442 IPI00493235 R.SSM(+15.99)GKMFVK.G Y 15.74 1.3 1030.505 1 13.872 1112 1 499 507 Y 5460 IPI00852114 K.IAFEYGITDLR.G Y 84.38 0.6 649.3433 2 22.576 1964 1 199 209 N 5461 IPI00786523 K.IAFEYGITDLR.G Y 84.38 0.6 649.3433 2 22.576 1964 1 203 213 N 4648 IPI00497753 R.VPTPNVSVVDLTVR.L Y 82.82 0.9 748.4282 2 21.625 1876 1 233 246 N 4649 IPI00963432 R.VPTPNVSVVDLTVR.L Y 82.82 0.9 748.4282 2 21.625 1876 1 486 499 N 5449 IPI00900800 R.VMGGLPDVVTIMEK.K Y 82.05 0.8 744.893 2 25.168 2194 1 1187 1200 N 5449 IPI00900800 R.VMGGLPDVVTIMEKK.S Y 5.08 0.1 539.6298 3 23.854 2081 1 1187 1201 N 5450 IPI01004767 R.VMGGLPDVVTIMEK.K Y 82.05 0.8 744.893 2 25.168 2194 1 1316 1329 N 5450 IPI01004767 R.VMGGLPDVVTIMEKK.S Y 5.08 0.1 539.6298 3 23.854 2081 1 1316 1330 N 108 IPI00501538 K.YGYTHLSSGDLLR.A Y 80.28 0.3 741.373 2 17.852 1515 2 32 44 N 5451 IPI00817940 R.KKEEEELIALK.D Y 62.77 0.1 665.3848 2 14.595 1187 2 75 85 N 5452 IPI00993469 R.KKEEEELIALK.D Y 62.77 0.1 665.3848 2 14.595 1187 2 56 66 N 5453 IPI00817723 R.KKEEEELIALK.D Y 62.77 0.1 665.3848 2 14.595 1187 2 58 68 N 5454 IPI00510978 R.KKEEEELIALK.D Y 62.77 0.1 665.3848 2 14.595 1187 2 62 72 N

PAGE 216

216 5455 IPI00817598 R.KKEEEELIALK.D Y 62.77 0.1 665.3848 2 14.595 1187 2 118 128 N 5456 IPI00817728 R.KKEEEELIALK.D Y 62.77 0.1 665.3848 2 14.595 1187 2 75 85 N 5457 IPI00972437 R.KKEEEELIALK.D Y 62.77 0.1 665.3848 2 14.595 1187 2 112 122 N 5458 IPI00817813 R.KKEEEELIALK.D Y 62.77 0.1 665.3848 2 14.595 1187 2 114 124 N 5459 IPI00817433 R.KKEEEELIALK.D Y 62.77 0.1 665.3848 2 14.595 1187 2 124 134 N 437 IPI00901053 K.ALQDELSELK.E Y 61.62 0.6 573.3057 2 17.45 1475 3 487 496 N 175 IPI00890560 R.IAGYLIEMQPK.G Y 44.27 0.2 631.8444 2 19.279 1655 1 19983 19993 N 175 IPI00890560 R.LFVPIK.G N 22.57 0.3 358.7388 2 16.7 1399 1 17600 17605 N 175 IPI00890560 R.RVDTAR.L Y 13.48 2 359.2044 2 4.402 353 1 27300 27305 N 175 IPI00890560 K.EYLSM(+15.99)KIT(+79.97)EEERLK.L Y 11.17 0.4 622.2966 3 39.677 3363 2 27726 27739 Y 175 IPI00890560 K.YVIEKKEKVGT(+79.97)R.W Y 9.21 0.7 510.6081 3 31.263 2685 1 9940 9951 Y 175 IPI00890560 K.NVT(+79.97)GVITENIK.V Y 7.82 0.3 634.3181 2 19.643 1689 1 25439 25449 Y 175 IPI00890560 K.QEDHFKTEVPTIAEEPK.V Y 7.03 1.5 666.6643 3 27.741 2404 2 596 612 N 164 IPI00993122 R.IAGYLIEMQPK.G Y 44.27 0.2 631.8444 2 19.279 1655 1 18410 18420 N 164 IPI00993122 R.LFVPIK.G N 22.57 0.3 358.7388 2 16.7 1399 1 16027 16032 N 164 IPI00993122 R.RVDTAR.L Y 13.48 2 359.2044 2 4.402 353 1 25727 25732 N 164 IPI00993122 K.EYLSM(+15.99)KIT(+79.97)EEERLK.L Y 11.17 0.4 622.2966 3 39.677 3363 2 26153 26166 Y 164 IPI00993122 K.YVIEKKEKVGT(+79.97)R.W Y 9.21 0.7 510.6081 3 31.263 2685 1 8367 8378 Y 164 IPI00993122 K.NVT(+79.97)GVITENIK.V Y 7.82 0.3 634.3181 2 19.643 1689 1 23866 23876 Y 5467 IPI00902219 K.FDIEIGR.G Y 45.05 0.5 425.2271 2 15.95 1323 1 204 210 N 5468 IPI00968820 K.FDIEIGR.G Y 45.05 0.5 425.2271 2 15.95 1323 1 216 222 N 5469 IPI00901954 K.FDIELGR.G Y 45.05 0.5 425.2271 2 15.95 1323 1 171 177 N 5464 IPI00490239 K.YEVTTLR.R Y 38.21 0.1 441.2399 2 14.296 1155 1 256 262 N 5463 IPI00832038 K.VIFVIGGPGSGK.A Y 36.68 0.2 565.8319 2 17.982 1528 1 379 390 N 1228 IPI00802686 R.VLGESAIAVR.T Y 21.3 0.1 338.8695 3 15.102 1239 2 1796 1805 N 1228 IPI00802686 K.NSNNKDEKRGGENK.N Y 15.19 1.2 530.5918 3 30.591 2632 3 933 946 N 5443 IPI00897175 R.VLGESAIAVR.T Y 21.3 0.1 338.8695 3 15.102 1239 2 1822 1831 N 5443 IPI00897175 K.NSNNKDEKRGGENK.N Y 15.19 1.2 530.5918 3 30.591 2632 3 983 996 N 5474 IPI00899172 R.AVLLTADLQQMK.S Y 26.4 0.5 444.2513 3 38.608 3277 32 243 254 N 5474 IPI00899172 R.AVLLTADLQQM(+15.99)K.S Y 16.52 0.7 449.5828 3 18.225 1552 2 243 254 Y 5475 IPI00961853 R.AVLLTADLQQMK.S Y 26.4 0.5 444.2513 3 38.608 3277 32 627 638 N

PAGE 217

217 5475 IPI00961853 R.AVLLTADLQQM(+15.99)K.S Y 16.52 0.7 449.5828 3 18.225 1552 2 627 638 Y 5477 IPI00501623 R.YPDIFMR.E Y 26.36 1.4 471.2304 2 19.767 1700 14 62 68 N 2304 IPI00487236 K.VKVSGK.G Y 25.75 2.4 309.2034 2 6.825 546 13 2058 2063 N 5476 IPI00960403 K.YHFIRDAVSK.G Y 25.54 0.2 618.33 2 44.126 3729 16 1124 1133 N 288 IPI00859309 K.ILSQKLMEDK.K Y 21.19 0.2 602.8338 2 26.267 2284 28 1232 1241 N 288 IPI00859309 K.ILSQKLM(+15.99)EDK.K Y 8.66 0.3 610.8315 2 18.319 1561 1 1232 1241 Y 5486 IPI00501009 R.EMLVTNLK.K Y 20.85 0.1 474.2652 2 46.468 3921 1 354 361 N 5487 IPI00932925 R.EMLVTNLK.K Y 20.85 0.1 474.2652 2 46.468 3921 1 354 361 N 5488 IPI00510504 K.GAGS(+79.97)GGGAR.R Y 20.51 0.9 385.1534 2 10.56 831 4 2243 2251 Y 5490 IPI00999083 R.ERNAGSETITDLQGRIYGLEGELK.H Y 20.19 1.5 663.0934 4 16.233 1353 1 622 645 N 5466 IPI01007404 K.AATQKS(+79.97)PSALHTTPVK.Q Y 20.07 1.3 429.973 4 28.196 2440 3 1035 1050 Y 5466 IPI01007404 K.GKSAGKAGGVGSATR.E Y 11.38 2.2 435.2417 3 25.302 2205 1 273 287 N 5491 IPI00998552 K.S(+79.97)LPNLAVSSLR.N Y 20.07 1.6 618.82 2 26.856 2332 1 368 378 Y

PAGE 218

218 APPENDIX I PEAKS DATABASE SEARC H RESULTS FOR ELASTA SE Database s earch s ummary r eport (generated by Peaks DB software)

PAGE 219

219

PAGE 220

220 Protein r esults for e lastase digested m yosin generated by PEAKS DB s oftware Protein Group Protein ID Accession 10lgP Coverage (%) #Peptides #Unique Mass Best Unique Peptide Description 3 2807 IPI00499162 40.75 4 1 1 24305.3887 1411 Tax_Id=7955 Gene_Symbol=zgc:153311 Zgc:153311 27 2806 IPI00486512 40.06 1 1 1 180109.9062 4232 Tax_Id=7955 Gene_Symbol=igsf9 Uncharacterized protein 2 2835 IPI00919967 30.77 2 1 1 153236.1406 2872 Tax_Id=7955 Gene_Symbol=insra Tyrosine protein kinase receptor 28 2838 IPI01007137 25.48 10 1 1 40731.543 3908 Tax_Id=7955 Gene_Symbol=LOC791501 GTPase IMAP family member 4 like 29 2839 IPI00610175 24.8 5 1 1 73875.4609 1672 Tax_Id=7955 Gene_Symbol=kcnc3a Uncharacterized protein 20 2825 IPI00508301 24.65 2 1 1 134940.7188 2036 Tax_Id=7955 Gene_Symbol=si:ch211 199g17.1 Protein FAM83H 4 1239 IPI00897295 24.42 1 2 2 498144.5938 2889 Tax_Id=7955 Gene_Symbol=huwe1 Uncharacterized protein 21 2841 IPI00898531 24.14 6 1 1 55323.8945 3139 Tax_Id=7955 Gene_Symbol=lmbr1 Uncharacterized protein 31 2842 IPI00836127 23.88 2 1 1 147269.875 1984 Tax_Id=7955 Gene_Symbol=atp8b2 Uncharacterized protein 31 2843 IPI01016807 23.88 3 1 1 105114.5938 1984 Tax_Id=7955 Gene_Symbol=LOC100537096 probable phospholipid transporting ATPase ID like, partial 100 3252 IPI00961375 22.79 0 1 1 184626.1094 3512 Tax_Id=7955 Gene_Symbol= calcium channel, voltage dependent, L type, alpha 1S subunit, a like, partial 100 3279 IPI00928857 22.79 0 1 1 202427.7656 3512 Tax_Id=7955 Gene_Symbol=cacna1sa Voltage dependent calcium channel alpha 1S subunit isoform alpha 1S a 34 2848 IPI00914430 21.85 5 1 1 82679.6094 3968 Tax_Id=7955 Gene_Symbol=slc26a3 Anion exchanger SLC26A3 15 2811 IPI00868169 21.75 8 1 1 58593.7812 1412 Tax_Id=7955 Gene_Symbol=ugt1a2;ugt1a1 UDP glucuronosyltransferase 1 family, polypeptide A2 precursor 39 2855 IPI00495163 21.51 0 1 1 528853.75 4236 Tax_Id=7955 Gene_Symbol=herc2 Uncharacterized protein 35 2851 IPI00963281 21.46 2 1 1 181994.4062 1413 Tax_Id=7955 Gene_Symbol=nup214 nuclear pore complex protein Nup214, partial 7 175 IPI00890560 21.16 0 1 1 3200993.75 3219 Tax_Id=7955 Gene_Symbol=ttnb titin 7 164 IPI00993122 21.16 0 1 1 3026089.5 3219 Tax_Id=7955 Gene_Symbol= Uncharacterized protein (Fragment) 41 2857 IPI00631596 20.21 3 1 1 159963.7969 1741 Tax_Id=7955 Gene_Symbol=LOC100003785 alpha 2 macroglobulin like total 19 proteins

PAGE 221

221 Peptide r esults for e lastase digested m yosin generated by PEAKS DB s oftware Protein ID Protein Accession Peptide isUnique 10lgP ppm m/z z RT Scan #Spectra Start End hasPTM 2807 IPI00499162 W.LSRSTELF.A Y 40.75 0.3 476.7587 2 18.724 1411 4 34 41 N 2806 IPI00486512 Y.SEM(+15.99)SVDGPDF.E Y 40.06 0.4 550.2162 2 53.33 4232 1 1212 1221 Y 2835 IPI00919967 Y.IADGGCKLRVVHPGNYTVRIRATSLAGNGSW.T Y 30.77 0.6 545.625 6 36.329 2872 7 883 913 N 2838 IPI01007137 F.RSGRSLSAVTDTSSIEKSVTNGRSVSVIDTPGFF.S Y 25.48 2 593.8081 6 49.165 3908 1 134 167 N 2839 IPI00610175 W.SGM(+15.99)LVGALCALAGVLTIAM(+15.99)PVPVIVNNFGMYY.S Y 24.8 1.2 553.6209 6 21.674 1672 1 430 461 Y 2825 IPI00508301 F.LGELVATF.D Y 24.65 0.2 849.4714 1 25.802 2036 1 264 271 N 2825 IPI00508301 F.TDVDIFSDLLEAAARHVPVY.I Y 5.07 0.9 558.5385 4 29.525 2332 1 160 179 N 1239 IPI00897295 Y.RLTRQGS(+79.97)DF.D Y 16.37 0.9 387.1804 3 36.549 2889 2 2077 2085 Y 1239 IPI00897295 Y.SS(+79.97)IEHLTTLLASCDM(+15.99)QVVLSVLNLLYVF.S Y 16.08 2.8 641.727 5 48.769 3877 1 114 141 Y 2841 IPI00898531 F.TLAVS(+79.97)GGAVLLLPFSIISNEILLSLPKNY.Y Y 24.14 1.5 625.348 5 39.689 3139 1 65 93 Y 2841 IPI00898531 F.T(+79.97)LAVSGGAVLLLPFSIISNEILLSLPKNY.Y Y 13.51 0.5 625.3492 5 32.142 2536 1 65 93 Y 2842 IPI00836127 Y.AFAHQEGFGELITSGKNMRLSSLALATF.A Y 23.88 2.6 749.8859 4 25.172 1984 1 1172 1199 N 2843 IPI01016807 Y.AFAHQEGFGELITSGKNMRLSSLALATF.A Y 23.88 2.6 749.8859 4 25.172 1984 1 796 823 N 3252 IPI00961375 W.VKSKLF.Y Y 22.79 0.3 361.2341 2 44.293 3512 1 292 297 N 3279 IPI00928857 W.VKSKLF.Y Y 22.79 0.3 361.2341 2 44.293 3512 1 439 444 N 2848 IPI00914430 Y.TLVEVFSRITS(+79.97)T(+79.97)NVADLVTSIAIM(+15.99)ALVLIVKEINDRF.K Y 21.85 0.9 854.2486 5 49.933 3968 1 248 284 Y 2811 IPI00868169 Y.TKVELEAVLAS(+79.97)ELNALLSIDVSTDLAKF.Q Y 21.75 0.8 512.4399 6 18.731 1412 1 75 102 Y 2811 IPI00868169 Y.EGICNGVPMVMLPLF.G Y 7.4 1.9 810.4048 2 34.797 2751 1 373 387 N 2855 IPI00495163 F.CKS(+79.97)IDTDDY(+79.97).A Y 21.51 2.3 610.1835 2 53.387 4236 1 4786 4794 Y 2851 IPI00963281 F.SKVSSPAAAAAAPVISASPEPPKAAKPSTGETLGSF.S Y 21.46 1.2 676.7615 5 18.739 1413 1 1042 1077 N 175 IPI00890560 Y.KVTKLLSGDEY(+79.97)IFRVMAVNKYGIGEPLF.S Y 21.16 0.5 654.3433 5 40.699 3219 1 20600 20627 Y 175 IPI00890560 Y.ASDEGQY.K Y 10.91 1.6 385.153 2 3.639 249 2 1817 1823 N 175 IPI00890560 W.DEPLIDGGSEITGY.I Y 10.39 2.2 489.2268 3 32.351 2553 1 15531 15544 N 175 IPI00890560 F.LAKQREIDSIY(+79.97).Y Y 9.94 2.8 708.3521 2 23.075 1800 1 2980 2990 Y 175 IPI00890560 F.RVVAENRYGKGAPLDSKSIVVQYPY.K Y 8.21 0.2 562.7056 5 38.255 3027 1 20217 20241 N 175 IPI00890560 W.TKLNKTLITDT(+79.97)VF.K Y 7.97 1.3 787.4165 2 39.256 3105 1 20291 20303 Y 175 IPI00890560 W.LHDGKPLAAANRLRM(+15.99)VNEF.G Y 7.18 2.2 542.7915 4 25.441 2006 1 1044 1062 Y 164 IPI00993122 Y.KVTKLLSGDEY(+79.97)IFRVMAVNKYGIGEPLF.S Y 21.16 0.5 654.3433 5 40.699 3219 1 19027 19054 Y

PAGE 222

222 164 IPI00993122 Y.ASDEGQY.K Y 10.91 1.6 385.153 2 3.639 249 2 244 250 N 164 IPI00993122 W.DEPLIDGGSEITGY.I Y 10.39 2.2 489.2268 3 32.351 2553 1 13958 13971 N 164 IPI00993122 F.LAKQREIDSIY(+79.97).Y Y 9.94 2.8 708.3521 2 23.075 1800 1 1407 1417 Y 164 IPI00993122 F.RVVAENRYGKGAPLDSKSIVVQYPY.K Y 8.21 0.2 562.7056 5 38.255 3027 1 18644 18668 N 164 IPI00993122 W.TKLNKTLITDT(+79.97)VF.K Y 7.97 1.3 787.4165 2 39.256 3105 1 18718 18730 Y 2857 IPI00631596 F.NGTPVYNKSVYLLEGRSWSSQLLLNLTTDRNGLAVF.S Y 20.21 2.2 806.0257 5 22.43 1741 1 370 405 N

PAGE 223

223 APPENDIX J PEAKS DATABASE SEARC H RESULTS FOR CEM LO W Database s earch s ummary r eport (generated by Peaks DB software)

PAGE 224

224

PAGE 225

225 Protein r esults for CEM low digested m yosin generated by PEAKS DB s oftware Protein Group Protein ID Accession 10lgP Coverage (%) #Peptides #Unique Mass Best Unique Peptide Description 1 2 IPI00773363 228.08 16 46 0 222157.875 Tax_Id=7955 Gene_Symbol=myhz1.2 Novel myosin family protein 3 4 IPI00858466 227.83 16 45 0 222215.1094 Tax_Id=7955 Gene_Symbol=myhz1.3 Uncharacterized protein 2 6 IPI00500057 226.91 17 46 0 222199.0312 Tax_Id=7955 Gene_Symbol=LOC100149148 myosin heavy chain, fast skeletal muscle 4 1 IPI00933204 224.35 15 43 0 221878.8125 Tax_Id=7955 Gene_Symbol=myhz2 Myosin, heavy polypeptide 2, fast muscle specific 5 8 IPI00961738 197.99 14 38 1 221423.5469 1197 Tax_Id=7955 Gene_Symbol=wu:fd14a01 myosin heavy chain, fast skeletal muscle 6 13 IPI00484075 175.16 10 25 0 222841.5781 Tax_Id=7955 Gene_Symbol=myhb Uncharacterized protein 7 45 IPI00488085 163.3 33 15 2 18865.3379 978 Tax_Id=7955 Gene_Symbol=mylz2 Myosin, light polypeptide 2, skeletal muscle 9 52 IPI00496651 162.09 36 15 2 19122.625 1186 Tax_Id=7955 Gene_Symbol=zgc:103639 Zgc:103639 8 11 IPI00490216 161.15 6 16 1 222803.3594 789 Tax_Id=7955 Gene_Symbol=myh6 Myosin, heavy polypeptide 6, cardiac muscle, alpha 16 20 IPI00504207 160.77 19 9 9 41972.9648 826 Tax_Id=7955 Gene_Symbol=actc1b Skeletal alpha1 actin 16 21 IPI00507230 160.77 19 9 9 41974.9375 826 Tax_Id=7955 Gene_Symbol=hm:zewp0073;actc1a Actin, alpha, cardiac muscle like 16 22 IPI00551966 160.77 19 9 9 41983.0039 826 Tax_Id=7955 Gene_Symbol=actc1b Actin, alpha 1, skeletal muscle 16 23 IPI00628880 160.77 19 9 9 41974.9375 826 Tax_Id=7955 Gene_Symbol=acta1b Actin, alpha 1b, skeletal muscle 11 14 IPI00934366 155.87 6 16 2 223043.4375 844 Tax_Id=7955 Gene_Symbol=smyhc1 Uncharacterized protein 14 18 IPI00501288 137.82 4 9 0 226660.125 Tax_Id=7955 Gene_Symbol=myh7;myh7bb Uncharacterized protein 15 29 IPI00800858 135.36 3 8 2 225510.3594 831 Tax_Id=7955 Gene_Symbol=myh7b myosin 7 13 30 IPI00616127 129.67 4 11 1 224164 3826 Tax_Id=7955 Gene_Symbol=vmhcl Uncharacterized protein 23 106 IPI00923343 54.99 15 2 2 13757.6289 1677 Tax_Id=7955 Gene_Symbol=mylz3 Myosin, light polypeptide 3, skeletal muscle 23 63 IPI00488248 54.99 12 2 2 16767.8711 1677 Tax_Id=7955 Gene_Symbol=mylz3 Myosin, light polypeptide 3, skeletal muscle 65 64 IPI00499941 42.52 4 1 1 20931.7656 1242 Tax_Id=7955 Gene_Symbol=zgc:77231 Zgc:77231 10 6190 IPI00492089 36.47 2 1 1 58051.4805 2345 Tax_Id=7955 Gene_Symbol=syt14b synaptotagmin 14 47 955 IPI00512746 30.81 2 1 1 162126.6719 1211 Tax_Id=7955 Gene_Symbol=atp7a Uncharacterized protein 17 963 IPI00742506 28.49 1 1 1 158533.75 2346 Tax_Id=7955 Gene_Symbol=abcc9 Sulfonylurea receptor subunit 2 17 964 IPI00500513 28.49 1 1 1 175241.0156 2346 Tax_Id=7955 Gene_Symbol=abcc9 ATP binding cassette, sub family C (CFTR/MRP), member 9 67 114 IPI00901816 28 1 1 1 153645.0312 1200 Tax_Id=7955 Gene_Symbol=LOC100329883 FYVE and coiled coil domain containing protein 1 like 67 115 IPI00933229 28 1 1 1 156622.4375 1200 Tax_Id=7955 Gene_Symbol=LOC100329883 Uncharacterized protein (Fragment) 34 1288 IPI00833554 26.96 2 1 1 128405.4844 626 Tax_Id=7955 Gene_Symbol=LOC100005948 hypothetical protein LOC100005948 46 147 IPI00993424 25.93 1 1 1 176522 648 Tax_Id=7955 Gene_Symbol=zgc:63611 Uncharacterized protein

PAGE 226

226 48 6192 IPI00962988 23.92 1 1 1 189127.5 1775 Tax_Id=7955 Gene_Symbol=kif1ab kinesin family member 1Ab isoform 2 48 982 IPI00962792 23.92 1 1 1 189137.0781 1775 Tax_Id=7955 Gene_Symbol=kif1a kinesin like protein KIF1A like 90 6212 IPI00516018 23.19 0 1 1 892770.1875 711 Tax_Id=7955 Gene_Symbol=si:dkey 30j22.1 Novel EGF domain containing protein (Fragment) 90 698 IPI00515924 23.19 0 1 1 934051.375 711 Tax_Id=7955 Gene_Symbol=si:dkey 30j22.2 hypothetical protein LOC565101 39 990 IPI00994665 22.72 2 1 1 84553.4922 2149 Tax_Id=7955 Gene_Symbol=LOC796535 Uncharacterized protein 82 794 IPI00829298 22.7 0 1 1 149104.875 2055 Tax_Id=7955 Gene_Symbol=pds5a Uncharacterized protein 20 1029 IPI00489045 22.41 1 1 1 158960.4844 2956 Tax_Id=7955 Gene_Symbol=grin2ab Uncharacterized protein 76 465 IPI00897430 21.86 0 1 1 191104.3906 967 Tax_Id=7955 Gene_Symbol=LOC100151026 Uncharacterized protein 80 1051 IPI00961772 21.04 1 1 1 45651.3594 2127 Tax_Id=7955 Gene_Symbol=LOC100330782 transmembrane protein 79 75 6197 IPI00484190 20.87 1 1 1 78034.4766 1315 Tax_Id=7955 Gene_Symbol=acox3 Acyl Coenzyme A oxidase 3, pristanoyl 77 6199 IPI00931483 20.41 0 1 1 187310.5 1747 Tax_Id=7955 Gene_Symbol= Uncharacterized protein 29 6198 IPI00919826 20.26 2 1 1 34934.3125 2158 Tax_Id=7955 Gene_Symbol= Uncharacterized protein 51 6194 IPI00899042 20.04 1 1 1 176629.5625 26 Tax_Id=7955 Gene_Symbol=LOC799109 Uncharacterized protein 51 6201 IPI00928833 20.04 2 1 1 49252.9141 26 Tax_Id=7955 Gene_Symbol=LOC799109 Uncharacterized protein total 42 proteins

PAGE 227

227 Peptide r esults for CEM low digested m yosin generated by PEAKS DB s oftware Protein ID Protein Accession Peptide isUnique 10lgP ppm m/z z RT Scan #Spectra Start End hasPTM 2 IPI00773363 K.GGSMQTVSSQFR.E N 67.71 0.3 642.8038 2 15.401 1134 1 643 654 N 2 IPI00773363 K.GGSM(+15.99)QTVSSQFR.E N 63.76 0 650.8011 2 15.41 1135 1 643 654 Y 2 IPI00773363 L.REQFEEEQEAK.A N 56.47 0.3 711.8286 2 12.056 825 2 1346 1356 N 2 IPI00773363 R.STHPHFV.R N 56.21 0.2 412.7062 2 12.081 828 1 666 672 N 2 IPI00773363 K.YETDAIQR.T N 56.12 0.5 498.2435 2 12.745 886 1 1377 1384 N 2 IPI00773363 R.MEAPPHIF.S N 55.47 0.1 471.2311 2 18.565 1435 1 150 157 N 2 IPI00773363 L.GLNSADMLK.A N 54.57 0.3 474.7447 2 15.21 1116 1 393 401 N 2 IPI00773363 R.EQFEEEQEAK.A N 54.1 0.3 633.7776 2 12.558 870 1 1347 1356 N 2 IPI00773363 A.LEEAEGTLEHEESK.I N 54.03 0.2 534.2493 3 13.656 971 1 1546 1559 N 2 IPI00773363 K.KGGSMQTVSSQF.R N 53.35 0.1 628.8007 2 15.597 1152 1 642 653 N 2 IPI00773363 R.M(+15.99)EAPPHI.F N 53.08 1.2 405.6948 2 14.837 1080 1 150 156 Y 2 IPI00773363 F.M(+15.99)LTDRENQSV.L N 50.22 1.6 604.7834 2 13.544 960 1 167 176 Y 2 IPI00773363 R.TLEDQLSEIK.S N 49.7 1.2 588.3121 2 18.507 1429 4 1253 1262 N 2 IPI00773363 F.MLTDRENQSV.L N 48.64 1.2 596.7857 2 13.519 957 1 167 176 N 2 IPI00773363 K.TPGLMENFL.V N 48.45 1.7 1021.501 1 25.514 2064 1 682 690 N 2 IPI00773363 R.ENLGKLMTNL.R N 44.92 1 566.8057 2 21.507 1707 1 655 664 N 2 IPI00773363 K.LYDQHLGK.C N 44.19 0.9 325.1746 3 12.41 857 1 556 563 N 2 IPI00773363 F.MLTDRENQSVL.I N 42.19 0.5 653.3267 2 16.331 1221 1 167 177 N 2 IPI00773363 K.SAETEKELA.T N 41.66 0.2 489.243 2 11.271 760 1 844 852 N 2 IPI00773363 K.GGSM(+15.99)QTV.S N 41.34 0.4 695.3026 1 11.134 749 1 643 649 Y 2 IPI00773363 A.GLLGTLEEMR.D N 40.92 1.7 559.7983 2 23.413 1885 1 770 779 N 2 IPI00773363 R.SLSTELFK.M N 40.83 0.3 462.7553 2 18.193 1399 1 1478 1485 N 2 IPI00773363 R.MEAPPHI.F N 40.72 1.7 397.6962 2 34.622 2803 15 150 156 N 2 IPI00773363 K.DFETSQLL.S N 40.1 0.4 952.4618 1 21.779 1735 4 1086 1093 N 2 IPI00773363 V.DASERVGL.L N 36.18 2.2 846.4334 1 13.895 993 1 1710 1717 N 2 IPI00773363 L.QHRLDEAENL.A N 35.46 0.3 612.8022 2 13.78 983 1 1796 1805 N 2 IPI00773363 R.LQDLVDK.L N 33.03 0.4 415.7347 2 13.264 933 2 1866 1872 N 2 IPI00773363 K.MEGDLNEMEI.Q N 32.94 0.3 1180.487 1 21.265 1684 1 1620 1629 N

PAGE 228

228 2 IPI00773363 A.RHDCDL.L N 32.55 1 379.6657 2 7.595 492 1 1339 1344 N 2 IPI00773363 R.LQGEVEDL.M N 32.25 0.7 902.4459 1 16.842 1269 1 1423 1430 N 2 IPI00773363 R.TLEDQLSEI.K N 31.38 0.7 1047.52 1 21.659 1722 2 1253 1261 N 2 IPI00773363 R.LDEAENL.A N 29.69 1 402.1931 2 15.129 1108 1 1799 1805 N 2 IPI00773363 L.LHSQNTSL.L N 29.48 0.1 450.2327 2 11.627 790 1 1718 1725 N 2 IPI00773363 L.DEAENL.A N 29.44 0.5 690.2936 1 12.335 850 1 1800 1805 N 2 IPI00773363 L.RRDLEESTL.Q N 28.64 0.2 559.7938 2 13.414 948 1 1177 1185 N 2 IPI00773363 R.KVAEQEL.V N 27.77 0.3 408.7266 2 12.275 845 1 1702 1708 N 2 IPI00773363 K.NLEVTVK.D N 27.56 0.7 802.4663 1 13.609 966 9 1787 1793 N 2 IPI00773363 A.ANPLLEA.Y N 26.73 1 727.3977 1 17.041 1288 1 227 233 N 2 IPI00773363 R.QLEEKEAL.V N 26.51 0.1 480.2559 2 13.643 969 2 1292 1299 N 2 IPI00773363 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 465 471 N 2 IPI00773363 K.NLQQEI.S N 22.83 0.2 744.3887 1 15.658 1158 1 1506 1511 N 2 IPI00773363 L.RSTHPHFV.R N 22.18 1.3 327.5064 3 11.007 739 1 665 672 N 2 IPI00773363 I.SDLTEQI.G N 21.64 1.1 805.3928 1 16.48 1236 1 1512 1518 N 2 IPI00773363 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1761 1768 N 2 IPI00773363 K.VQHELEEA.E N 20.12 1.5 477.7307 2 12.149 834 1 1901 1908 N 2 IPI00773363 A.IDILGF.N N 17.98 0.8 677.3862 1 26.223 2122 1 340 345 N 2 IPI00773363 K.AGLLGTL.E N 17.74 0.7 644.3981 1 21.877 1744 1 769 775 N 2 IPI00773363 K.GGSMQTV.S N 17.26 0.7 679.3074 1 11.125 748 1 643 649 N 2 IPI00773363 L.RMDLER.A N 16.37 0.4 410.2105 2 11.207 755 1 1047 1052 N 2 IPI00773363 K.NLEVTV.K N 15.56 0.5 674.3723 1 17.292 1312 1 1787 1792 N 2 IPI00773363 K.ELTYQTEEDKK.N N 11.13 2 692.3369 2 12.566 871 1 1851 1861 N 4 IPI00858466 K.GGSMQTVSSQFR.E N 67.71 0.3 642.8038 2 15.401 1134 1 643 654 N 4 IPI00858466 K.GGSM(+15.99)QTVSSQFR.E N 63.76 0 650.8011 2 15.41 1135 1 643 654 Y 4 IPI00858466 L.REQFEEEQEAK.A N 56.47 0.3 711.8286 2 12.056 825 2 1346 1356 N 4 IPI00858466 R.STHPHFV.R N 56.21 0.2 412.7062 2 12.081 828 1 666 672 N 4 IPI00858466 K.YETDAIQR.T N 56.12 0.5 498.2435 2 12.745 886 1 1377 1384 N 4 IPI00858466 R.MEAPPHIF.S N 55.47 0.1 471.2311 2 18.565 1435 1 150 157 N 4 IPI00858466 L.GLNSADMLK.A N 54.57 0.3 474.7447 2 15.21 1116 1 393 401 N 4 IPI00858466 R.EQFEEEQEAK.A N 54.1 0.3 633.7776 2 12.558 870 1 1347 1356 N

PAGE 229

229 4 IPI00858466 A.LEEAEGTLEHEESK.I N 54.03 0.2 534.2493 3 13.656 971 1 1546 1559 N 4 IPI00858466 K.KGGSMQTVSSQF.R N 53.35 0.1 628.8007 2 15.597 1152 1 642 653 N 4 IPI00858466 R.M(+15.99)EAPPHI.F N 53.08 1.2 405.6948 2 14.837 1080 1 150 156 Y 4 IPI00858466 F.M(+15.99)LTDRENQSV.L N 50.22 1.6 604.7834 2 13.544 960 1 167 176 Y 4 IPI00858466 R.TLEDQLSEIK.S N 49.7 1.2 588.3121 2 18.507 1429 4 1253 1262 N 4 IPI00858466 F.MLTDRENQSV.L N 48.64 1.2 596.7857 2 13.519 957 1 167 176 N 4 IPI00858466 K.TPGLMENFL.V N 48.45 1.7 1021.501 1 25.514 2064 1 682 690 N 4 IPI00858466 R.ENLGKLMTNL.R N 44.92 1 566.8057 2 21.507 1707 1 655 664 N 4 IPI00858466 K.LYDQHLGK.C N 44.19 0.9 325.1746 3 12.41 857 1 556 563 N 4 IPI00858466 F.MLTDRENQSVL.I N 42.19 0.5 653.3267 2 16.331 1221 1 167 177 N 4 IPI00858466 K.SAETEKELA.T N 41.66 0.2 489.243 2 11.271 760 1 844 852 N 4 IPI00858466 K.GGSM(+15.99)QTV.S N 41.34 0.4 695.3026 1 11.134 749 1 643 649 Y 4 IPI00858466 A.GLLGTLEEMR.D N 40.92 1.7 559.7983 2 23.413 1885 1 770 779 N 4 IPI00858466 R.SLSTELFK.M N 40.83 0.3 462.7553 2 18.193 1399 1 1478 1485 N 4 IPI00858466 R.MEAPPHI.F N 40.72 1.7 397.6962 2 34.622 2803 15 150 156 N 4 IPI00858466 K.DFETSQLL.S N 40.1 0.4 952.4618 1 21.779 1735 4 1086 1093 N 4 IPI00858466 V.DASERVGL.L N 36.18 2.2 846.4334 1 13.895 993 1 1710 1717 N 4 IPI00858466 L.QHRLDEAENL.A N 35.46 0.3 612.8022 2 13.78 983 1 1796 1805 N 4 IPI00858466 R.LQDLVDK.L N 33.03 0.4 415.7347 2 13.264 933 2 1866 1872 N 4 IPI00858466 K.MEGDLNEMEI.Q N 32.94 0.3 1180.487 1 21.265 1684 1 1620 1629 N 4 IPI00858466 A.RHDCDL.L N 32.55 1 379.6657 2 7.595 492 1 1339 1344 N 4 IPI00858466 R.LQGEVEDL.M N 32.25 0.7 902.4459 1 16.842 1269 1 1423 1430 N 4 IPI00858466 R.TLEDQLSEI.K N 31.38 0.7 1047.52 1 21.659 1722 2 1253 1261 N 4 IPI00858466 R.LDEAENL.A N 29.69 1 402.1931 2 15.129 1108 1 1799 1805 N 4 IPI00858466 L.LHSQNTSL.L N 29.48 0.1 450.2327 2 11.627 790 1 1718 1725 N 4 IPI00858466 L.DEAENL.A N 29.44 0.5 690.2936 1 12.335 850 1 1800 1805 N 4 IPI00858466 L.RRDLEESTL.Q N 28.64 0.2 559.7938 2 13.414 948 1 1177 1185 N 4 IPI00858466 R.KVAEQEL.V N 27.77 0.3 408.7266 2 12.275 845 1 1702 1708 N 4 IPI00858466 K.NLEITVK.D N 26.89 0.7 408.7446 2 14.997 1096 1 1787 1793 N 4 IPI00858466 A.ANPLLEA.Y N 26.73 1 727.3977 1 17.041 1288 1 227 233 N 4 IPI00858466 R.QLEEKEAL.V N 26.51 0.1 480.2559 2 13.643 969 2 1292 1299 N

PAGE 230

230 4 IPI00858466 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 465 471 N 4 IPI00858466 Y.TIQYNIR.S N 25.79 0.2 454.2535 2 14.31 1029 1 815 821 N 4 IPI00858466 K.NLQQEI.S N 22.83 0.2 744.3887 1 15.658 1158 1 1506 1511 N 4 IPI00858466 L.RSTHPHFV.R N 22.18 1.3 327.5064 3 11.007 739 1 665 672 N 4 IPI00858466 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1761 1768 N 4 IPI00858466 K.VQHELEEA.E N 20.12 1.5 477.7307 2 12.149 834 1 1901 1908 N 4 IPI00858466 A.IDILGF.N N 17.98 0.8 677.3862 1 26.223 2122 1 340 345 N 4 IPI00858466 K.AGLLGTL.E N 17.74 0.7 644.3981 1 21.877 1744 1 769 775 N 4 IPI00858466 K.GGSMQTV.S N 17.26 0.7 679.3074 1 11.125 748 1 643 649 N 4 IPI00858466 L.RMDLER.A N 16.37 0.4 410.2105 2 11.207 755 1 1047 1052 N 4 IPI00858466 K.ELTYQTEEDKK.N N 11.13 2 692.3369 2 12.566 871 1 1851 1861 N 6 IPI00500057 K.GGSMQTVSSQFR.E N 67.71 0.3 642.8038 2 15.401 1134 1 641 652 N 6 IPI00500057 K.GGSM(+15.99)QTVSSQFR.E N 63.76 0 650.8011 2 15.41 1135 1 641 652 Y 6 IPI00500057 L.REQFEEEQEAK.A N 56.47 0.3 711.8286 2 12.056 825 2 1344 1354 N 6 IPI00500057 R.STHPHFV.R N 56.21 0.2 412.7062 2 12.081 828 1 664 670 N 6 IPI00500057 K.YETDAIQR.T N 56.12 0.5 498.2435 2 12.745 886 1 1375 1382 N 6 IPI00500057 R.MEAPPHIF.S N 55.47 0.1 471.2311 2 18.565 1435 1 150 157 N 6 IPI00500057 R.EQFEEEQEAK.A N 54.1 0.3 633.7776 2 12.558 870 1 1345 1354 N 6 IPI00500057 A.LEEAEGTLEHEESK.I N 54.03 0.2 534.2493 3 13.656 971 1 1544 1557 N 6 IPI00500057 K.KGGSMQTVSSQF.R N 53.35 0.1 628.8007 2 15.597 1152 1 640 651 N 6 IPI00500057 R.M(+15.99)EAPPHI.F N 53.08 1.2 405.6948 2 14.837 1080 1 150 156 Y 6 IPI00500057 F.M(+15.99)LTDRENQSV.L N 50.22 1.6 604.7834 2 13.544 960 1 167 176 Y 6 IPI00500057 R.TLEDQLSEIK.S N 49.7 1.2 588.3121 2 18.507 1429 4 1251 1260 N 6 IPI00500057 F.MLTDRENQSV.L N 48.64 1.2 596.7857 2 13.519 957 1 167 176 N 6 IPI00500057 K.TPGLMENFL.V N 48.45 1.7 1021.501 1 25.514 2064 1 680 688 N 6 IPI00500057 R.ENLGKLMTNL.R N 44.92 1 566.8057 2 21.507 1707 1 653 662 N 6 IPI00500057 K.LYDQHLGK.C N 44.19 0.9 325.1746 3 12.41 857 1 556 563 N 6 IPI00500057 F.MLTDRENQSVL.I N 42.19 0.5 653.3267 2 16.331 1221 1 167 177 N 6 IPI00500057 K.SAETEKELA.N N 41.66 0.2 489.243 2 11.271 760 1 842 850 N 6 IPI00500057 K.GGSM(+15.99)QTV.S N 41.34 0.4 695.3026 1 11.134 749 1 641 647 Y 6 IPI00500057 A.GLLGTLEEMR.D N 40.92 1.7 559.7983 2 23.413 1885 1 768 777 N

PAGE 231

231 6 IPI00500057 R.SLSTELFK.M N 40.83 0.3 462.7553 2 18.193 1399 1 1476 1483 N 6 IPI00500057 R.MEAPPHI.F N 40.72 1.7 397.6962 2 34.622 2803 15 150 156 N 6 IPI00500057 K.DFETSQLL.S N 40.1 0.4 952.4618 1 21.779 1735 4 1084 1091 N 6 IPI00500057 I.ELIEKPMGIF.S N 36.19 0.2 588.8201 2 22.857 1835 1 526 535 N 6 IPI00500057 V.DASERVGL.L N 36.18 2.2 846.4334 1 13.895 993 1 1708 1715 N 6 IPI00500057 L.QHRLDEAENL.A N 35.46 0.3 612.8022 2 13.78 983 1 1794 1803 N 6 IPI00500057 R.LQDLVDK.L N 33.03 0.4 415.7347 2 13.264 933 2 1864 1870 N 6 IPI00500057 K.MEGDLNEMEI.Q N 32.94 0.3 1180.487 1 21.265 1684 1 1618 1627 N 6 IPI00500057 A.RHDCDL.L N 32.55 1 379.6657 2 7.595 492 1 1337 1342 N 6 IPI00500057 R.LQGEVEDL.M N 32.25 0.7 902.4459 1 16.842 1269 1 1421 1428 N 6 IPI00500057 R.TLEDQLSEI.K N 31.38 0.7 1047.52 1 21.659 1722 2 1251 1259 N 6 IPI00500057 R.LDEAENL.A N 29.69 1 402.1931 2 15.129 1108 1 1797 1803 N 6 IPI00500057 L.LHSQNTSL.L N 29.48 0.1 450.2327 2 11.627 790 1 1716 1723 N 6 IPI00500057 L.DEAENL.A N 29.44 0.5 690.2936 1 12.335 850 1 1798 1803 N 6 IPI00500057 L.RRDLEESTL.Q N 28.64 0.2 559.7938 2 13.414 948 1 1175 1183 N 6 IPI00500057 R.KVAEQEL.V N 27.77 0.3 408.7266 2 12.275 845 1 1700 1706 N 6 IPI00500057 K.NLEITVK.D N 26.89 0.7 408.7446 2 14.997 1096 1 1785 1791 N 6 IPI00500057 A.ANPLLEA.Y N 26.73 1 727.3977 1 17.041 1288 1 227 233 N 6 IPI00500057 R.QLEEKEAL.V N 26.51 0.1 480.2559 2 13.643 969 2 1290 1297 N 6 IPI00500057 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 465 471 N 6 IPI00500057 Y.TIQYNIR.S N 25.79 0.2 454.2535 2 14.31 1029 1 813 819 N 6 IPI00500057 K.NLQQEI.S N 22.83 0.2 744.3887 1 15.658 1158 1 1504 1509 N 6 IPI00500057 L.RSTHPHFV.R N 22.18 1.3 327.5064 3 11.007 739 1 663 670 N 6 IPI00500057 I.SDLTEQI.G N 21.64 1.1 805.3928 1 16.48 1236 1 1510 1516 N 6 IPI00500057 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1759 1766 N 6 IPI00500057 K.VQHELEEA.E N 20.12 1.5 477.7307 2 12.149 834 1 1899 1906 N 6 IPI00500057 A.IDILGF.T N 17.98 0.8 677.3862 1 26.223 2122 1 340 345 N 6 IPI00500057 K.AGLLGTL.E N 17.74 0.7 644.3981 1 21.877 1744 1 767 773 N 6 IPI00500057 K.GGSMQTV.S N 17.26 0.7 679.3074 1 11.125 748 1 641 647 N 6 IPI00500057 L.RMDLER.A N 16.37 0.4 410.2105 2 11.207 755 1 1045 1050 N 6 IPI00500057 K.ELTYQTEEDKK.N N 11.13 2 692.3369 2 12.566 871 1 1849 1859 N

PAGE 232

232 6 IPI00500057 A.CIELIEKPMGI.F N 8.61 0.5 623.333 2 22.329 1786 1 524 534 N 1 IPI00933204 K.GGSMQTVSSQFR.E N 67.71 0.3 642.8038 2 15.401 1134 1 643 654 N 1 IPI00933204 K.GGSM(+15.99)QTVSSQFR.E N 63.76 0 650.8011 2 15.41 1135 1 643 654 Y 1 IPI00933204 L.REQFEEEQEAK.A N 56.47 0.3 711.8286 2 12.056 825 2 1346 1356 N 1 IPI00933204 R.STHPHFV.R N 56.21 0.2 412.7062 2 12.081 828 1 666 672 N 1 IPI00933204 K.YETDAIQR.T N 56.12 0.5 498.2435 2 12.745 886 1 1377 1384 N 1 IPI00933204 R.MEAPPHIF.S N 55.47 0.1 471.2311 2 18.565 1435 1 150 157 N 1 IPI00933204 L.GLNSADMLK.A N 54.57 0.3 474.7447 2 15.21 1116 1 393 401 N 1 IPI00933204 R.EQFEEEQEAK.A N 54.1 0.3 633.7776 2 12.558 870 1 1347 1356 N 1 IPI00933204 A.LEEAEGTLEHEESK.I N 54.03 0.2 534.2493 3 13.656 971 1 1546 1559 N 1 IPI00933204 K.KGGSMQTVSSQF.R N 53.35 0.1 628.8007 2 15.597 1152 1 642 653 N 1 IPI00933204 R.M(+15.99)EAPPHI.F N 53.08 1.2 405.6948 2 14.837 1080 1 150 156 Y 1 IPI00933204 F.M(+15.99)LTDRENQSV.L N 50.22 1.6 604.7834 2 13.544 960 1 167 176 Y 1 IPI00933204 F.MLTDRENQSV.L N 48.64 1.2 596.7857 2 13.519 957 1 167 176 N 1 IPI00933204 K.TPGLMENFL.V N 48.45 1.7 1021.501 1 25.514 2064 1 682 690 N 1 IPI00933204 R.ENLGKLMTNL.R N 44.92 1 566.8057 2 21.507 1707 1 655 664 N 1 IPI00933204 K.LYDQHLGK.C N 44.19 0.9 325.1746 3 12.41 857 1 556 563 N 1 IPI00933204 F.MLTDRENQSVL.I N 42.19 0.5 653.3267 2 16.331 1221 1 167 177 N 1 IPI00933204 K.SAETEKELA.T N 41.66 0.2 489.243 2 11.271 760 1 844 852 N 1 IPI00933204 K.GGSM(+15.99)QTV.S N 41.34 0.4 695.3026 1 11.134 749 1 643 649 Y 1 IPI00933204 A.GLLGTLEEMR.D N 40.92 1.7 559.7983 2 23.413 1885 1 770 779 N 1 IPI00933204 R.SLSTELFK.M N 40.83 0.3 462.7553 2 18.193 1399 1 1478 1485 N 1 IPI00933204 R.MEAPPHI.F N 40.72 1.7 397.6962 2 34.622 2803 15 150 156 N 1 IPI00933204 V.DASERVGL.L N 36.18 2.2 846.4334 1 13.895 993 1 1710 1717 N 1 IPI00933204 L.QHRLDEAENL.A N 35.46 0.3 612.8022 2 13.78 983 1 1796 1805 N 1 IPI00933204 R.LQDLVDK.L N 33.03 0.4 415.7347 2 13.264 933 2 1866 1872 N 1 IPI00933204 K.MEGDLNEMEI.Q N 32.94 0.3 1180.487 1 21.265 1684 1 1620 1629 N 1 IPI00933204 A.RHDCDL.L N 32.55 1 379.6657 2 7.595 492 1 1339 1344 N 1 IPI00933204 R.LQGEVEDL.M N 32.25 0.7 902.4459 1 16.842 1269 1 1423 1430 N 1 IPI00933204 R.LDEAENL.A N 29.69 1 402.1931 2 15.129 1108 1 1799 1805 N 1 IPI00933204 L.LHSQNTSL.L N 29.48 0.1 450.2327 2 11.627 790 1 1718 1725 N

PAGE 233

233 1 IPI00933204 L.DEAENL.A N 29.44 0.5 690.2936 1 12.335 850 1 1800 1805 N 1 IPI00933204 L.RRDLEESTL.Q N 28.64 0.2 559.7938 2 13.414 948 1 1177 1185 N 1 IPI00933204 R.KVAEQEL.V N 27.77 0.3 408.7266 2 12.275 845 1 1702 1708 N 1 IPI00933204 K.NLEVTVK.D N 27.56 0.7 802.4663 1 13.609 966 9 1787 1793 N 1 IPI00933204 A.ANPLLEA.Y N 26.73 1 727.3977 1 17.041 1288 1 227 233 N 1 IPI00933204 R.QLEEKEAL.V N 26.51 0.1 480.2559 2 13.643 969 2 1292 1299 N 1 IPI00933204 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 465 471 N 1 IPI00933204 Y.TIQYNIR.S N 25.79 0.2 454.2535 2 14.31 1029 1 815 821 N 1 IPI00933204 K.NLQQEI.S N 22.83 0.2 744.3887 1 15.658 1158 1 1506 1511 N 1 IPI00933204 L.RSTHPHFV.R N 22.18 1.3 327.5064 3 11.007 739 1 665 672 N 1 IPI00933204 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1761 1768 N 1 IPI00933204 K.VQHELEEA.E N 20.12 1.5 477.7307 2 12.149 834 1 1901 1908 N 1 IPI00933204 A.IDILGF.T N 17.98 0.8 677.3862 1 26.223 2122 1 340 345 N 1 IPI00933204 K.AGLLGTL.E N 17.74 0.7 644.3981 1 21.877 1744 1 769 775 N 1 IPI00933204 K.GGSMQTV.S N 17.26 0.7 679.3074 1 11.125 748 1 643 649 N 1 IPI00933204 L.RMDLER.A N 16.37 0.4 410.2105 2 11.207 755 1 1047 1052 N 1 IPI00933204 K.NLEVTV.K N 15.56 0.5 674.3723 1 17.292 1312 1 1787 1792 N 1 IPI00933204 K.ELTYQTEEDKK.N N 11.13 2 692.3369 2 12.566 871 1 1851 1861 N 8 IPI00961738 L.REQFEEEQEAK.A N 56.47 0.3 711.8286 2 12.056 825 2 1344 1354 N 8 IPI00961738 R.STHPHFV.R N 56.21 0.2 412.7062 2 12.081 828 1 664 670 N 8 IPI00961738 K.YETDAIQR.T N 56.12 0.5 498.2435 2 12.745 886 1 1375 1382 N 8 IPI00961738 R.EQFEEEQEAK.A N 54.1 0.3 633.7776 2 12.558 870 1 1345 1354 N 8 IPI00961738 A.LEEAEGTLEHEESK.I N 54.03 0.2 534.2493 3 13.656 971 1 1544 1557 N 8 IPI00961738 F.M(+15.99)LTDRENQSV.L N 50.22 1.6 604.7834 2 13.544 960 1 165 174 Y 8 IPI00961738 R.TLEDQLSEIK.T N 49.7 1.2 588.3121 2 18.507 1429 4 1251 1260 N 8 IPI00961738 F.MLTDRENQSV.L N 48.64 1.2 596.7857 2 13.519 957 1 165 174 N 8 IPI00961738 K.TPGLMENFL.V N 48.45 1.7 1021.501 1 25.514 2064 1 680 688 N 8 IPI00961738 R.ENLGKLMTNL.R N 44.92 1 566.8057 2 21.507 1707 1 653 662 N 8 IPI00961738 F.MLTDRENQSVL.I N 42.19 0.5 653.3267 2 16.331 1221 1 165 175 N 8 IPI00961738 A.GLLGTLEEMR.D N 40.92 1.7 559.7983 2 23.413 1885 1 768 777 N 8 IPI00961738 R.SLSTEIFK.M N 40.83 0.3 462.7553 2 18.193 1399 1 1476 1483 N

PAGE 234

234 8 IPI00961738 I.ELIEKPMGIF.S N 36.19 0.2 588.8201 2 22.857 1835 1 524 533 N 8 IPI00961738 V.DASERVGL.L N 36.18 2.2 846.4334 1 13.895 993 1 1708 1715 N 8 IPI00961738 L.QHRLDEAENL.A N 35.46 0.3 612.8022 2 13.78 983 1 1794 1803 N 8 IPI00961738 R.LQDLVDK.L N 33.03 0.4 415.7347 2 13.264 933 2 1864 1870 N 8 IPI00961738 K.MEGDLNEMEI.Q N 32.94 0.3 1180.487 1 21.265 1684 1 1618 1627 N 8 IPI00961738 A.RHDCDL.L N 32.55 1 379.6657 2 7.595 492 1 1337 1342 N 8 IPI00961738 R.LQGEVEDL.M N 32.25 0.7 902.4459 1 16.842 1269 1 1421 1428 N 8 IPI00961738 R.TLEDQLSEI.K N 31.38 0.7 1047.52 1 21.659 1722 2 1251 1259 N 8 IPI00961738 R.LDEAENL.A N 29.69 1 402.1931 2 15.129 1108 1 1797 1803 N 8 IPI00961738 L.LHSQNTSL.I N 29.48 0.1 450.2327 2 11.627 790 1 1716 1723 N 8 IPI00961738 L.DEAENL.A N 29.44 0.5 690.2936 1 12.335 850 1 1798 1803 N 8 IPI00961738 R.NVQGQL.K N 28.73 0 658.3519 1 12.598 873 1 1645 1650 N 8 IPI00961738 L.RRDLEESTL.Q N 28.64 0.2 559.7938 2 13.414 948 1 1175 1183 N 8 IPI00961738 R.KVAEQEL.V N 27.77 0.3 408.7266 2 12.275 845 1 1700 1706 N 8 IPI00961738 K.NLEVTVK.D N 27.56 0.7 802.4663 1 13.609 966 9 1785 1791 N 8 IPI00961738 A.ANPLLEA.Y N 26.73 1 727.3977 1 17.041 1288 1 225 231 N 8 IPI00961738 R.QLEEKEAL.V N 26.51 0.1 480.2559 2 13.643 969 2 1290 1297 N 8 IPI00961738 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 463 469 N 8 IPI00961738 K.NLQQEI.S N 22.83 0.2 744.3887 1 15.658 1158 1 1504 1509 N 8 IPI00961738 L.RSTHPHFV.R N 22.18 1.3 327.5064 3 11.007 739 1 663 670 N 8 IPI00961738 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1759 1766 N 8 IPI00961738 R.SLSTEI.F Y 19.95 0 649.3403 1 16.076 1197 1 1476 1481 N 8 IPI00961738 A.IDILGF.T N 17.98 0.8 677.3862 1 26.223 2122 1 338 343 N 8 IPI00961738 K.AGLLGTL.E N 17.74 0.7 644.3981 1 21.877 1744 1 767 773 N 8 IPI00961738 L.RMDLER.A N 16.37 0.4 410.2105 2 11.207 755 1 1045 1050 N 8 IPI00961738 K.NLEVTV.K N 15.56 0.5 674.3723 1 17.292 1312 1 1785 1790 N 8 IPI00961738 R.VLDAMQSTL.D Y 12.69 0.3 977.4969 1 33.607 2719 3 1593 1601 N 8 IPI00961738 K.ELTYQTEEDKK.N N 11.13 2 692.3369 2 12.566 871 1 1849 1859 N 8 IPI00961738 A.CIELIEKPMGI.F N 8.61 0.5 623.333 2 22.329 1786 1 522 532 N 13 IPI00484075 R.LEEAGGATSA.Q N 56.89 0.5 453.2139 2 11.348 767 3 1152 1161 N 13 IPI00484075 R.STHPHFV.R N 56.21 0.2 412.7062 2 12.081 828 1 666 672 N

PAGE 235

235 13 IPI00484075 K.YETDAIQR.T N 56.12 0.5 498.2435 2 12.745 886 1 1377 1384 N 13 IPI00484075 L.GLNSADMLK.A N 54.57 0.3 474.7447 2 15.21 1116 1 391 399 N 13 IPI00484075 K.TPGLMENFL.V N 48.45 1.7 1021.501 1 25.514 2064 1 682 690 N 13 IPI00484075 R.ENLGKLMTNL.R N 44.92 1 566.8057 2 21.507 1707 1 655 664 N 13 IPI00484075 A.GLLGTLEEMR.D N 40.92 1.7 559.7983 2 23.413 1885 1 770 779 N 13 IPI00484075 R.SLSTELFK.M N 40.83 0.3 462.7553 2 18.193 1399 1 1478 1485 N 13 IPI00484075 I.ELIEKPMGIF.S N 36.19 0.2 588.8201 2 22.857 1835 1 524 533 N 13 IPI00484075 R.LQDLVDK.L N 33.03 0.4 415.7347 2 13.264 933 2 1868 1874 N 13 IPI00484075 K.MEGDLNEMEI.Q N 32.94 0.3 1180.487 1 21.265 1684 1 1622 1631 N 13 IPI00484075 L.LHSQNTSL.I N 29.48 0.1 450.2327 2 11.627 790 1 1720 1727 N 13 IPI00484075 R.NVQGQL.K N 28.73 0 658.3519 1 12.598 873 1 1649 1654 N 13 IPI00484075 L.RRDLEESTL.Q N 28.64 0.2 559.7938 2 13.414 948 1 1177 1185 N 13 IPI00484075 R.KVAEQEL.V N 27.77 0.3 408.7266 2 12.275 845 1 1704 1710 N 13 IPI00484075 K.NLEVTVK.D N 27.56 0.7 802.4663 1 13.609 966 9 1789 1795 N 13 IPI00484075 A.ANPLLEA.Y N 26.73 1 727.3977 1 17.041 1288 1 225 231 N 13 IPI00484075 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 463 469 N 13 IPI00484075 L.RSTHPHFV.R N 22.18 1.3 327.5064 3 11.007 739 1 665 672 N 13 IPI00484075 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1763 1770 N 13 IPI00484075 K.VQHELEEA.Q N 20.12 1.5 477.7307 2 12.149 834 1 1903 1910 N 13 IPI00484075 A.IDILGF.N N 17.98 0.8 677.3862 1 26.223 2122 1 338 343 N 13 IPI00484075 K.AGLLGTL.E N 17.74 0.7 644.3981 1 21.877 1744 1 769 775 N 13 IPI00484075 L.RMDLER.A N 16.37 0.4 410.2105 2 11.207 755 1 1047 1052 N 13 IPI00484075 K.NLEVTV.K N 15.56 0.5 674.3723 1 17.292 1312 1 1789 1794 N 13 IPI00484075 K.ELTYQTEEDKK.N N 11.13 2 692.3369 2 12.566 871 1 1853 1863 N 13 IPI00484075 A.CIELIEKPMGI.F N 8.61 0.5 623.333 2 22.329 1786 1 522 532 N 45 IPI00488085 F.EQSQIQEYKEA.F N 59.89 0.5 676.8197 2 13.455 951 1 24 34 N 45 IPI00488085 F.SMFEQSQIQEY.K N 59.75 1.3 695.3041 2 20.104 1578 1 21 31 N 45 IPI00488085 L.ASM(+15.99)GQLNVK.N Y 57.45 0.5 482.2498 2 13.727 978 2 56 64 Y 45 IPI00488085 L.ASMGQLNVK.N Y 50.95 0.5 474.2523 2 13.714 976 2 56 64 N 45 IPI00488085 I.KEASGPINF.T N 46.83 0.6 481.7504 2 16.302 1219 1 73 81 N 45 IPI00488085 K.EASGPINF.T N 41.24 1.2 834.4001 1 18.473 1425 2 74 81 N

PAGE 236

236 45 IPI00488085 F.LTMFGEKL.K N 37.65 0.3 469.7543 2 21.636 1719 1 85 92 N 45 IPI00488085 F.TVFLTMF.G N 37.52 0.9 858.4422 1 27.316 2211 1 82 88 N 45 IPI00488085 F.LTM(+15.99)FGEK.L N 36.81 1.5 421.2092 2 15.769 1169 1 85 91 Y 45 IPI00488085 L.TM(+15.99)FGEK.L N 34.63 0.1 364.6678 2 12.693 882 1 86 91 Y 45 IPI00488085 F.SMFEQSQI.Q N 34.49 1 969.4355 1 18.488 1427 1 21 28 N 45 IPI00488085 F.LTMFGEK.L N 32.38 1.6 413.2117 2 15.753 1167 2 85 91 N 45 IPI00488085 R.DGIISKDDL.R N 32.24 0.5 488.253 2 17.23 1306 1 43 51 N 45 IPI00488085 L.TMFGEK.L N 31.66 0.1 356.6703 2 12.686 881 1 86 91 N 45 IPI00488085 F.EQSQIQEYK.E N 30.14 1 576.7808 2 12.548 869 1 24 32 N 45 IPI00488085 R.DVLASMGQL.N Y 30.14 0.3 933.4713 1 22.129 1767 1 53 61 N 45 IPI00488085 A.SGPINF.T N 23.77 0.4 634.3197 1 18.066 1386 1 76 81 N 45 IPI00488085 F.EQSQIQEY.K N 21.44 1.7 1024.46 1 14.045 1006 2 24 31 N 52 IPI00496651 F.EQSQIQEYKEA.F N 59.89 0.5 676.8197 2 13.455 951 1 24 34 N 52 IPI00496651 F.SMFEQSQIQEY.K N 59.75 1.3 695.3041 2 20.104 1578 1 21 31 N 52 IPI00496651 K.NEELEAM(+15.99)VK.E Y 47.88 1.2 539.7585 2 15.958 1186 1 65 73 Y 52 IPI00496651 K.NEELEAMVK.E Y 47.42 1.4 531.7612 2 15.951 1185 1 65 73 N 52 IPI00496651 V.KEASGPINF.T N 46.83 0.6 481.7504 2 16.302 1219 1 73 81 N 52 IPI00496651 Y.VITHGEEKEEE Y 44.43 0.9 650.3062 2 7.037 459 1 160 170 N 52 IPI00496651 K.EASGPINF.T N 41.24 1.2 834.4001 1 18.473 1425 2 74 81 N 52 IPI00496651 F.LTMFGEKL.K N 37.65 0.3 469.7543 2 21.636 1719 1 85 92 N 52 IPI00496651 F.TVFLTMF.G N 37.52 0.9 858.4422 1 27.316 2211 1 82 88 N 52 IPI00496651 F.LTM(+15.99)FGEK.L N 36.81 1.5 421.2092 2 15.769 1169 1 85 91 Y 52 IPI00496651 L.TM(+15.99)FGEK.L N 34.63 0.1 364.6678 2 12.693 882 1 86 91 Y 52 IPI00496651 F.SMFEQSQI.Q N 34.49 1 969.4355 1 18.488 1427 1 21 28 N 52 IPI00496651 F.LTMFGEK.L N 32.38 1.6 413.2117 2 15.753 1167 2 85 91 N 52 IPI00496651 R.DGIISKDDL.R N 32.24 0.5 488.253 2 17.23 1306 1 43 51 N 52 IPI00496651 L.TMFGEK.L N 31.66 0.1 356.6703 2 12.686 881 1 86 91 N 52 IPI00496651 F.EQSQIQEYK.E N 30.14 1 576.7808 2 12.548 869 1 24 32 N 52 IPI00496651 A.SGPINF.T N 23.77 0.4 634.3197 1 18.066 1386 1 76 81 N 52 IPI00496651 F.EQSQIQEY.K N 21.44 1.7 1024.46 1 14.045 1006 2 24 31 N 11 IPI00490216 R.LEEAGGATSA.Q N 56.89 0.5 453.2139 2 11.348 767 3 1150 1159 N

PAGE 237

237 11 IPI00490216 L.REQFEEEQEAK.A N 56.47 0.3 711.8286 2 12.056 825 2 1344 1354 N 11 IPI00490216 R.EQFEEEQEAK.A N 54.1 0.3 633.7776 2 12.558 870 1 1345 1354 N 11 IPI00490216 Y.M(+15.99)LTDRENQSV.L N 50.22 1.6 604.7834 2 13.544 960 1 165 174 Y 11 IPI00490216 Y.MLTDRENQSV.L N 48.64 1.2 596.7857 2 13.519 957 1 165 174 N 11 IPI00490216 K.VGNEYVTK.G Y 47.22 0.1 455.2374 2 11.618 789 2 405 412 N 11 IPI00490216 Y.MLTDRENQSVL.I N 42.19 0.5 653.3267 2 16.331 1221 1 165 175 N 11 IPI00490216 A.GLLGTLEEMR.D N 40.92 1.7 559.7983 2 23.413 1885 1 768 777 N 11 IPI00490216 R.SLSTELFK.L N 40.83 0.3 462.7553 2 18.193 1399 1 1476 1483 N 11 IPI00490216 R.LQDLVDK.L N 33.03 0.4 415.7347 2 13.264 933 2 1864 1870 N 11 IPI00490216 K.MEGDLNEMEI.Q N 32.94 0.3 1180.487 1 21.265 1684 1 1618 1627 N 11 IPI00490216 A.RHDCDL.L N 32.55 1 379.6657 2 7.595 492 1 1337 1342 N 11 IPI00490216 I.RRDLEESTL.Q N 28.64 0.2 559.7938 2 13.414 948 1 1175 1183 N 11 IPI00490216 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 460 466 N 11 IPI00490216 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1759 1766 N 11 IPI00490216 K.AGLLGTL.E N 17.74 0.7 644.3981 1 21.877 1744 1 767 773 N 11 IPI00490216 V.RMDLER.S N 16.37 0.4 410.2105 2 11.207 755 1 1045 1050 N 20 IPI00504207 K.DSYVGDEAQSK.R Y 72.12 0.3 599.7649 2 12.064 826 1 53 63 N 20 IPI00504207 I.GMESAGIHETA.Y Y 58.64 1.7 551.7462 2 13.342 941 1 270 280 N 20 IPI00504207 K.AGFAGDDAPR.A Y 55.9 0.6 488.728 2 12.892 900 1 21 30 N 20 IPI00504207 A.GFAGDDAPR.A Y 52.25 2 453.2101 2 12.478 863 1 22 30 N 20 IPI00504207 K.SYELPDGQVI.T Y 51.24 0.5 1120.552 1 22.719 1822 1 241 250 N 20 IPI00504207 L.TEAPLNPK.A Y 40.59 0.7 435.2397 2 11.4 771 2 108 115 N 20 IPI00504207 Y.ELPDGQVITI.G Y 35.61 0.3 1084.588 1 22.283 1782 1 243 252 N 20 IPI00504207 R.HQGVM(+15.99)VGM(+15.99)GQK.D Y 28.73 1.2 602.2848 2 12.962 906 1 42 52 Y 20 IPI00504207 K.IIAPPERK.Y Y 17.49 0.6 308.5271 3 12.014 822 1 331 338 N 21 IPI00507230 K.DSYVGDEAQSK.R Y 72.12 0.3 599.7649 2 12.064 826 1 53 63 N 21 IPI00507230 I.GMESAGIHETA.Y Y 58.64 1.7 551.7462 2 13.342 941 1 270 280 N 21 IPI00507230 K.AGFAGDDAPR.A Y 55.9 0.6 488.728 2 12.892 900 1 21 30 N 21 IPI00507230 A.GFAGDDAPR.A Y 52.25 2 453.2101 2 12.478 863 1 22 30 N 21 IPI00507230 K.SYELPDGQVI.T Y 51.24 0.5 1120.552 1 22.719 1822 1 241 250 N 21 IPI00507230 L.TEAPLNPK.A Y 40.59 0.7 435.2397 2 11.4 771 2 108 115 N

PAGE 238

238 21 IPI00507230 Y.ELPDGQVITI.G Y 35.61 0.3 1084.588 1 22.283 1782 1 243 252 N 21 IPI00507230 R.HQGVM(+15.99)VGM(+15.99)GQK.D Y 28.73 1.2 602.2848 2 12.962 906 1 42 52 Y 21 IPI00507230 K.IIAPPERK.Y Y 17.49 0.6 308.5271 3 12.014 822 1 331 338 N 22 IPI00551966 K.DSYVGDEAQSK.R Y 72.12 0.3 599.7649 2 12.064 826 1 53 63 N 22 IPI00551966 I.GMESAGIHETA.Y Y 58.64 1.7 551.7462 2 13.342 941 1 270 280 N 22 IPI00551966 K.AGFAGDDAPR.A Y 55.9 0.6 488.728 2 12.892 900 1 21 30 N 22 IPI00551966 A.GFAGDDAPR.A Y 52.25 2 453.2101 2 12.478 863 1 22 30 N 22 IPI00551966 K.SYELPDGQVI.T Y 51.24 0.5 1120.552 1 22.719 1822 1 241 250 N 22 IPI00551966 L.TEAPLNPK.A Y 40.59 0.7 435.2397 2 11.4 771 2 108 115 N 22 IPI00551966 Y.ELPDGQVITI.G Y 35.61 0.3 1084.588 1 22.283 1782 1 243 252 N 22 IPI00551966 R.HQGVM(+15.99)VGM(+15.99)GQK.D Y 28.73 1.2 602.2848 2 12.962 906 1 42 52 Y 22 IPI00551966 K.IIAPPERK.Y Y 17.49 0.6 308.5271 3 12.014 822 1 331 338 N 23 IPI00628880 K.DSYVGDEAQSK.R Y 72.12 0.3 599.7649 2 12.064 826 1 53 63 N 23 IPI00628880 I.GMESAGIHETA.Y Y 58.64 1.7 551.7462 2 13.342 941 1 270 280 N 23 IPI00628880 K.AGFAGDDAPR.A Y 55.9 0.6 488.728 2 12.892 900 1 21 30 N 23 IPI00628880 A.GFAGDDAPR.A Y 52.25 2 453.2101 2 12.478 863 1 22 30 N 23 IPI00628880 K.SYELPDGQVI.T Y 51.24 0.5 1120.552 1 22.719 1822 1 241 250 N 23 IPI00628880 L.TEAPLNPK.A Y 40.59 0.7 435.2397 2 11.4 771 2 108 115 N 23 IPI00628880 Y.ELPDGQVITI.G Y 35.61 0.3 1084.588 1 22.283 1782 1 243 252 N 23 IPI00628880 R.HQGVM(+15.99)VGM(+15.99)GQK.D Y 28.73 1.2 602.2848 2 12.962 906 1 42 52 Y 23 IPI00628880 K.IIAPPERK.Y Y 17.49 0.6 308.5271 3 12.014 822 1 331 338 N 14 IPI00934366 L.REQFEEEQEAK.A N 56.47 0.3 711.8286 2 12.056 825 2 1347 1357 N 14 IPI00934366 R.STHPHFV.R N 56.21 0.2 412.7062 2 12.081 828 1 667 673 N 14 IPI00934366 K.YETDAIQR.T N 56.12 0.5 498.2435 2 12.745 886 1 1378 1385 N 14 IPI00934366 R.EQFEEEQEAK.A N 54.1 0.3 633.7776 2 12.558 870 1 1348 1357 N 14 IPI00934366 A.GLLGTLEEMR.D N 40.92 1.7 559.7983 2 23.413 1885 1 771 780 N 14 IPI00934366 R.SLSTELFK.L N 40.83 0.3 462.7553 2 18.193 1399 1 1479 1486 N 14 IPI00934366 R.LQDLVDK.L N 33.03 0.4 415.7347 2 13.264 933 2 1867 1873 N 14 IPI00934366 K.MEGDLNEMEI.Q N 32.94 0.3 1180.487 1 21.265 1684 1 1621 1630 N 14 IPI00934366 L.LHSQNTSL.L N 29.48 0.1 450.2327 2 11.627 790 1 1719 1726 N 14 IPI00934366 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 461 467 N

PAGE 239

239 14 IPI00934366 Y.TQQIEDLK.R Y 23.78 0.1 487.7612 2 12.267 844 1 1312 1319 N 14 IPI00934366 L.RSTHPHFV.R N 22.18 1.3 327.5064 3 11.007 739 1 666 673 N 14 IPI00934366 Y.TQQIEDLKR.Q Y 21.31 0.3 565.812 2 11.94 816 2 1312 1320 N 14 IPI00934366 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1762 1769 N 14 IPI00934366 K.AGLLGTL.E N 17.74 0.7 644.3981 1 21.877 1744 1 770 776 N 14 IPI00934366 L.RMDLER.A N 16.37 0.4 410.2105 2 11.207 755 1 1048 1053 N 14 IPI00934366 A.CIELIEKPMGI.M N 8.61 0.5 623.333 2 22.329 1786 1 520 530 N 18 IPI00501288 L.REQFEEEQEAK.S N 56.47 0.3 711.8286 2 12.056 825 2 1353 1363 N 18 IPI00501288 K.YETDAIQR.T N 56.12 0.5 498.2435 2 12.745 886 1 1384 1391 N 18 IPI00501288 R.EQFEEEQEAK.S N 54.1 0.3 633.7776 2 12.558 870 1 1354 1363 N 18 IPI00501288 A.LEEAEGTLEHEESK.T N 54.03 0.2 534.2493 3 13.656 971 1 1553 1566 N 18 IPI00501288 R.SLSTELFK.L N 40.83 0.3 462.7553 2 18.193 1399 1 1485 1492 N 18 IPI00501288 L.THLNEASVL.F N 32.56 1.3 492.2621 2 15.514 1144 1 95 103 N 18 IPI00501288 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 466 472 N 18 IPI00501288 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1768 1775 N 18 IPI00501288 V.RMDLER.V N 16.37 0.4 410.2105 2 11.207 755 1 1054 1059 N 18 IPI00501288 R.EFGEAA.T Y 8.2 0.4 623.2673 1 10.319 684 1 9 14 N 29 IPI00800858 K.KALQESHQQTL.D Y 60 2 641.8424 2 12.121 831 2 998 1008 N 29 IPI00800858 R.LEEAGGATSA.Q N 56.89 0.5 453.2139 2 11.348 767 3 1151 1160 N 29 IPI00800858 A.LEEAEGTLEHEESK.T N 54.03 0.2 534.2493 3 13.656 971 1 1545 1558 N 29 IPI00800858 K.ALQESHQQTL.D Y 52.09 2.9 577.7953 2 13.005 909 1 999 1008 N 29 IPI00800858 L.THLNEASVL.F N 32.56 1.3 492.2621 2 15.514 1144 1 95 103 N 29 IPI00800858 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 458 464 N 29 IPI00800858 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1760 1767 N 29 IPI00800858 L.RMDLER.S N 16.37 0.4 410.2105 2 11.207 755 1 1046 1051 N 30 IPI00616127 R.STHPHFV.R N 56.21 0.2 412.7062 2 12.081 828 1 668 674 N 30 IPI00616127 K.YETDAIQR.T N 56.12 0.5 498.2435 2 12.745 886 1 1382 1389 N 30 IPI00616127 R.SLSTELFK.L N 40.83 0.3 462.7553 2 18.193 1399 1 1483 1490 N 30 IPI00616127 R.LQDLVDK.L N 33.03 0.4 415.7347 2 13.264 933 2 1871 1877 N 30 IPI00616127 K.MEGDLNEMEI.Q N 32.94 0.3 1180.487 1 21.265 1684 1 1625 1634 N 30 IPI00616127 L.LHSQNTSL.I N 29.48 0.1 450.2327 2 11.627 790 1 1723 1730 N

PAGE 240

240 30 IPI00616127 L.DIAGFEI.F N 26.37 0.3 764.3822 1 23.78 1918 1 463 469 N 30 IPI00616127 L.RSTHPHFV.R N 22.18 1.3 327.5064 3 11.007 739 1 667 674 N 30 IPI00616127 A.ITDAAMMA.E N 20.53 0.3 823.3686 1 38.929 3154 3 1766 1773 N 30 IPI00616127 L.QSALESETRSR.N Y 17.18 2.1 632.3193 2 47.113 3826 1 1605 1615 N 30 IPI00616127 I.RMDLER.A N 16.37 0.4 410.2105 2 11.207 755 1 1052 1057 N 106 IPI00923343 K.GTYDDYVEGL.R Y 43.87 0.1 1131.484 1 21.195 1677 1 108 117 N 106 IPI00923343 F.EAFLPM(+15.99)LK.T Y 22.25 0.1 482.7622 2 37.014 2998 8 93 100 Y 63 IPI00488248 K.GTYDDYVEGL.R Y 43.87 0.1 1131.484 1 21.195 1677 1 84 93 N 63 IPI00488248 F.EAFLPM(+15.99)LK.T Y 22.25 0.1 482.7622 2 37.014 2998 8 69 76 Y 64 IPI00499941 Y.NQIADIM(+15.99)R.A Y 42.52 2.7 488.749 2 16.539 1242 1 69 76 Y 6190 IPI00492089 L.TM(+15.99)LDS(+79.97)KGKEMSK.C Y 36.47 1.3 725.8205 2 28.99 2345 20 428 439 Y 6190 IPI00492089 L.TM(+15.99)LDS(+79.97)KGKEM(+15.99)SK.C Y 7.28 1.4 733.818 2 19.296 1504 1 428 439 Y 955 IPI00512746 V.MVGTGVGAQNGI.L Y 30.81 1.5 552.2802 2 16.218 1211 1 998 1009 N 955 IPI00512746 I.HIQVSLEQNNA.T Y 6.01 0.5 418.214 3 15.7 1162 1 38 48 N 963 IPI00742506 L.QELDDSTQLPL.L Y 28.49 0.6 629.8113 2 29.001 2346 14 981 991 N 964 IPI00500513 L.QELDDSTQLPL.L Y 28.49 0.6 629.8113 2 29.001 2346 14 1170 1180 N 114 IPI00901816 I.ELDQSELKQQQL.Q Y 28 0.3 729.8755 2 16.098 1200 1 245 256 N 115 IPI00933229 I.ELDQSELKQQQL.Q Y 28 0.3 729.8755 2 16.098 1200 1 246 257 N 1288 IPI00833554 R.MPETCI.T Y 26.96 2.1 693.2932 1 9.569 626 1 230 235 N 1288 IPI00833554 A.NQITTTASIPLI.E Y 6.94 0.1 424.5783 3 51.141 4150 2 599 610 N 1288 IPI00833554 A.NQITTTASIPL.I Y 5.82 0.1 579.8219 2 41.259 3343 1 599 609 N 147 IPI00993424 A.APGEEEQV.L Y 25.93 1.9 858.3823 1 9.841 648 1 768 775 N 147 IPI00993424 K.M(+15.99)PNQIS(+79.97)S(+79.97)L.D Y 13.42 0.3 533.19 2 51.665 4192 1 705 712 Y 6192 IPI00962988 I.EMTNAMTGM(+15.99)SPSPSLSAL.T Y 23.92 2.1 614.2744 3 22.211 1775 1 393 410 Y 6192 IPI00962988 R.FY(+79.97)QFTS(+79.97)L.R Y 13.15 0.3 533.1903 2 5.279 346 1 716 722 Y 982 IPI00962792 I.EMTNAMTGM(+15.99)SPSPSLSAL.S Y 23.92 2.1 614.2744 3 22.211 1775 1 393 410 Y 6212 IPI00516018 I.NNTCSCI.S Y 23.19 0.8 377.6469 2 10.663 711 1 89 95 N 698 IPI00515924 I.NNTCSCI.S Y 23.19 0.8 377.6469 2 10.663 711 1 142 148 N 990 IPI00994665 A.TLDDINQQQETQR.S Y 22.72 0.7 530.2565 3 26.546 2149 3 92 104 N 794 IPI00829298 L.WFM(+15.99)LEV.L Y 22.7 0.9 840.3952 1 25.41 2055 1 1028 1033 Y 1029 IPI00489045 Y.GKPGGAGS(+79.97)I.A Y 22.41 2.7 823.3687 1 36.495 2956 6 1164 1172 Y

PAGE 241

241 465 IPI00897430 R.DCLTLQTA.S Y 21.86 0.8 864.4125 1 13.616 967 1 1642 1649 N 1051 IPI00961772 F.SFLPML.V Y 21.04 0.1 707.3797 1 26.284 2127 1 363 368 N 6197 IPI00484190 L.SHGSNTRAL.R Y 20.87 2.4 942.4774 1 17.318 1315 1 154 162 N 6199 IPI00931483 L.MCVEEIEL.L Y 20.41 0.1 965.4319 1 21.906 1747 1 1658 1665 N 6198 IPI00919826 L.DMILTPF.F Y 20.26 0.4 836.4225 1 26.659 2158 3 244 250 N 6194 IPI00899042 I.NT(+79.97)ACIPA.Q Y 20.04 2 385.1519 2 0.324 26 1 88 94 Y 6194 IPI00899042 L.HRDNGLR.R Y 6.43 1.8 434.23 2 51.829 4205 1 792 798 N 6201 IPI00928833 I.NT(+79.97)ACIPA.Q Y 20.04 2 385.1519 2 0.324 26 1 69 75 Y

PAGE 242

242 APPENDIX K PEAKS DATABASE SEARC H RESULTS FOR CEM HI GH Database s earch s ummary r eport (generated by Peaks DB software)

PAGE 243

243

PAGE 244

244 Protein r esults for CEM high digested m yosin generated by PEAKS DB s oftware Protein Group Protein ID Accession 10lgP Coverage (%) #Peptides #Unique Mass Best Unique Peptide Description 2 2 IPI00773363 226.22 17 54 0 222157.875 Tax_Id=7955 Gene_Symbol=myhz1.2 Novel myosin family protein 1 6 IPI00500057 225.53 17 53 0 222199.0312 Tax_Id=7955 Gene_Symbol=LOC100149148 myosin heavy chain, fast skeletal muscle 4 1 IPI00933204 224.54 17 51 1 221878.8125 886 Tax_Id=7955 Gene_Symbol=myhz2 Myosin, heavy polypeptide 2, fast muscle specific 3 8 IPI00961738 214.5 15 45 0 221423.5469 Tax_Id=7955 Gene_Symbol=wu:fd14a01 myosin heavy chain, fast skeletal muscle 5 13 IPI00484075 185.65 10 30 0 222841.5781 Tax_Id=7955 Gene_Symbol=myhb Uncharacterized protein 7 11 IPI00490216 181 7 22 1 222803.3594 770 Tax_Id=7955 Gene_Symbol=myh6 Myosin, heavy polypeptide 6, cardiac muscle, alpha 6 14 IPI00934366 172.63 8 19 0 223043.4375 Tax_Id=7955 Gene_Symbol=smyhc1 Uncharacterized protein 13 18 IPI00501288 153.97 4 11 0 226660.125 Tax_Id=7955 Gene_Symbol=myh7;myh7bb Uncharacterized protein 9 30 IPI00616127 151.38 5 14 0 224164 Tax_Id=7955 Gene_Symbol=vmhcl Uncharacterized protein 10 31 IPI00882712 148.98 5 13 0 223229.7812 Tax_Id=7955 Gene_Symbol=vmhc Ventricular myosin heavy chain 8 32 IPI00914342 146.65 7 15 1 223276.7812 1275 Tax_Id=7955 Gene_Symbol=smyhc3 Slow myosin heavy chain 3 8 33 IPI00960836 146.65 6 15 1 223154.7188 1275 Tax_Id=7955 Gene_Symbol=LOC100329670 myosin 7 like 8 34 IPI00771791 146.65 6 15 1 223953.75 1275 Tax_Id=7955 Gene_Symbol=LOC567740 Uncharacterized protein 8 35 IPI00962033 146.65 6 15 1 223951.7188 1275 Tax_Id=7955 Gene_Symbol=LOC100329813 Uncharacterized protein 15 19 IPI00656493 141.25 26 12 12 41837.8594 819 Tax_Id=7955 Gene_Symbol=zgc:123289 Zgc:123289 15 24 IPI00482295 141.25 23 12 12 41766.7812 819 Tax_Id=7955 Gene_Symbol=bactin1 Actin, cytoplasmic 1 15 25 IPI00490006 141.25 23 12 12 41752.7539 819 Tax_Id=7955 Gene_Symbol=bactin2 Actin, cytoplasmic 2 14 29 IPI00800858 139.99 4 8 0 225510.3594 Tax_Id=7955 Gene_Symbol=myh7b myosin 7 11 44 IPI00817902 101.06 34 10 3 16317.5605 1762 Tax_Id=7955 Gene_Symbol=mylz2 Uncharacterized protein 11 45 IPI00488085 101.06 30 10 3 18865.3379 1762 Tax_Id=7955 Gene_Symbol=mylz2 Myosin, light polypeptide 2, skeletal muscle 12 51 IPI00919778 88.49 31 8 1 15343.418 1230 Tax_Id=7955 Gene_Symbol=zgc:103639 Uncharacterized protein 12 52 IPI00496651 88.49 25 8 1 19122.625 1230 Tax_Id=7955 Gene_Symbol=zgc:103639 Zgc:103639 18 63 IPI00488248 71.01 13 3 3 16767.8711 939 Tax_Id=7955 Gene_Symbol=mylz3 Myosin, light polypeptide 3, skeletal muscle 53 95 IPI00516071 29.66 5 1 1 19612.8594 1502 Tax_Id=7955 Gene_Symbol=ckbb Creatine kinase, brain 53 96 IPI00919917 29.66 3 1 1 29424.5078 1502 Tax_Id=7955 Gene_Symbol=ckba Novel protein 53 97 IPI00919712 29.66 3 1 1 30369.5625 1502 Tax_Id=7955 Gene_Symbol=ckba Novel protein 53 98 IPI00508395 29.66 2 1 1 42851.7188 1502 Tax_Id=7955 Gene_Symbol=ckmb Ckmb protein

PAGE 245

245 53 99 IPI00482319 29.66 2 1 1 42814.6055 1502 Tax_Id=7955 Gene_Symbol=ckma Muscle specific creatine kinase 53 100 IPI00497388 29.66 2 1 1 42883.6133 1502 Tax_Id=7955 Gene_Symbol=ckbb Creatine kinase, brain b 53 101 IPI00506249 29.66 2 1 1 42866.0625 1502 Tax_Id=7955 Gene_Symbol=ckba Zgc:154095 53 102 IPI00485952 29.66 2 1 1 46294.6992 1502 Tax_Id=7955 Gene_Symbol=ckmt2 Ckmt2 protein 53 103 IPI00817153 29.66 2 1 1 46296.7305 1502 Tax_Id=7955 Gene_Symbol=ckmt2 Creatine kinase, mitochondrial 2 53 104 IPI00490232 29.66 2 1 1 46706.293 1502 Tax_Id=7955 Gene_Symbol=ckmt1 Creatine kinase, mitochondrial 1 53 105 IPI00960817 29.66 2 1 1 46895.7109 1502 Tax_Id=7955 Gene_Symbol= Uncharacterized protein 41 109 IPI00995606 29.46 3 1 1 55640.6172 1084 Tax_Id=7955 Gene_Symbol=sybu Syntabulin 54 117 IPI00996774 29.25 1 1 1 224356.5156 4111 Tax_Id=7955 Gene_Symbol=dscam Uncharacterized protein (Fragment) 55 108 IPI00501538 27.84 4 1 1 21441.8359 1684 Tax_Id=7955 Gene_Symbol=zgc:91930 Zgc:91930 56 94 IPI00505794 27.07 1 1 1 110157.4219 1815 Tax_Id=7955 Gene_Symbol=atp2a1 Atp2a1 protein 28 1453 IPI00799120 26.97 1 2 2 178741.9531 1071 Tax_Id=7955 Gene_Symbol=abcc8 Uncharacterized protein 57 110 IPI00515939 24.81 4 1 1 28624.9531 1726 Tax_Id=7955 Gene_Symbol=tpma Alpha tropomyosin 57 111 IPI00506010 24.81 3 1 1 32889.8633 1726 Tax_Id=7955 Gene_Symbol=tpm3 Zgc:77592 57 112 IPI00508152 24.81 3 1 1 32722.6777 1726 Tax_Id=7955 Gene_Symbol=tpma Tropomyosin alpha 1 chain 57 113 IPI00634377 24.81 3 1 1 32749.6426 1726 Tax_Id=7955 Gene_Symbol=tpm1;zgc:171719 Tpm1 protein 58 3679 IPI00512597 24.71 2 1 1 39775.2461 668 Tax_Id=7955 Gene_Symbol=LOC557297 potassium channel subfamily K member 1 like 59 114 IPI00901816 24.04 1 1 1 153645.0312 1220 Tax_Id=7955 Gene_Symbol=LOC100329883 FYVE and coiled coil domain containing protein 1 like 59 115 IPI00933229 24.04 1 1 1 156622.4375 1220 Tax_Id=7955 Gene_Symbol=LOC100329883 Uncharacterized protein (Fragment) 39 3685 IPI00995577 20.81 2 1 1 58895.25 964 Tax_Id=7955 Gene_Symbol= Uncharacterized protein 33 547 IPI00997640 20.8 2 1 1 35660.6797 3094 Tax_Id=7955 Gene_Symbol=LOC100537387 neuronal acetylcholine receptor subunit alpha 7 like 61 3684 IPI00972163 20.74 5 1 1 26039.873 1197 Tax_Id=7955 Gene_Symbol=si:ch1073 75f15.2 Uncharacterized protein (Fragment) 19 3694 IPI01005517 20.34 1 1 1 117360.5547 3323 Tax_Id=7955 Gene_Symbol=LOC100333514 hypothetical protein LOC100333514 total 50 proteins

PAGE 246

246 Peptide r esults for CEM high digested m yosin generated by PEAKS DB s oftware Protein ID Protein Accession Peptide isUnique 10lgP ppm m/z z RT Scan #Spectra Start End hasPTM 2 IPI00773363 I.SDLTEQIGETGK.S N 61.48 0.1 639.3146 2 15.248 1114 1 1512 1523 N 2 IPI00773363 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1030 1044 N 2 IPI00773363 K.VQHELEEAEER.A N 58.54 0.4 684.8228 2 12.936 900 2 1901 1911 N 2 IPI00773363 Y.KMEIDDLSSNMEA.V N 57.36 0.1 741.8262 2 19.452 1510 1 1227 1239 N 2 IPI00773363 L.EEAEGTLEHEESK.I N 56.67 0.4 744.3281 2 12.385 850 2 1547 1559 N 2 IPI00773363 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1034 1045 N 2 IPI00773363 L.REQFEEEQEAK.A N 50.07 0.1 711.8284 2 11.96 812 3 1346 1356 N 2 IPI00773363 V.AELGEQIDNL.Q N 49.46 0.4 551.2745 2 20.331 1592 2 1203 1212 N 2 IPI00773363 K.QRLQGEVEDL.M N 49.24 0.2 593.8068 2 16.686 1251 2 1421 1430 N 2 IPI00773363 R.EQFEEEQEAK.A N 46.36 0.1 633.7778 2 12.635 872 2 1347 1356 N 2 IPI00773363 L.DDLQAEEDKV.N N 45.2 0.1 581.2672 2 15.669 1155 2 1010 1019 N 2 IPI00773363 K.ETTERLEDEEEI.N N 44.7 0.7 746.8355 2 16.482 1232 1 923 934 N 2 IPI00773363 R.M(+15.99)EAPPHI.F N 44.65 0.2 405.6942 2 15.108 1101 1 150 156 Y 2 IPI00773363 L.SKIEDEQSLGA.Q N 44.27 0.4 588.7905 2 13.767 974 1 1094 1104 N 2 IPI00773363 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1034 1044 N 2 IPI00773363 L.REQFEEEQEA.K N 42.96 0.6 647.7812 2 13.24 926 1 1346 1355 N 2 IPI00773363 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1149 1158 N 2 IPI00773363 R.KVQHELEEA.E N 41.01 0.3 541.7773 2 11.051 734 1 1900 1908 N 2 IPI00773363 L.DDLQAEEDK.V N 40.39 0.7 1062.458 1 11.353 760 1 1010 1018 N 2 IPI00773363 R.MEAPPHI.F N 39.66 0.2 397.6968 2 15.102 1100 26 150 156 N 2 IPI00773363 R.TLEDQLSEIK.S N 38.88 0.5 588.3116 2 19.91 1554 31 1253 1262 N 2 IPI00773363 K.SAETEKELA.T N 38.2 0.5 489.2426 2 11.061 735 2 844 852 N 2 IPI00773363 L.EEAEERADI.A N 37.38 0.2 531.2408 2 12.981 904 1 1906 1914 N 2 IPI00773363 K.MEIDDLSSNMEAV.A N 37.22 0.4 727.3126 2 22.774 1814 1 1228 1240 N 2 IPI00773363 L.GLNSADM(+15.99)LK.A N 36.24 1.7 482.7429 2 15.496 1138 1 393 401 Y 2 IPI00773363 K.YEEGQAEL.E N 35.9 0.1 938.4102 1 15.193 1109 1 1462 1469 N 2 IPI00773363 K.NLTEEM(+15.99)A.A N 35.37 0.1 823.3502 1 15.316 1121 1 979 985 Y 2 IPI00773363 K.DFETSQLL.S N 34.7 0.5 952.4617 1 21.964 1744 2 1086 1093 N

PAGE 247

24 7 2 IPI00773363 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1620 1629 N 2 IPI00773363 K.VQHELEEA.E N 33.91 0.1 477.7299 2 12.024 818 2 1901 1908 N 2 IPI00773363 L.GTLEEMRDEK.L N 33.34 0.9 403.1927 3 13.171 920 1 773 782 N 2 IPI00773363 R.TLEDQLSEI.K N 30.97 0.6 524.2642 2 21.769 1725 2 1253 1261 N 2 IPI00773363 R.LQGEVEDL.M N 30.84 1 902.4456 1 34.524 2794 30 1423 1430 N 2 IPI00773363 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1866 1872 N 2 IPI00773363 L.GTLEEM(+15.99)RDEK.L N 26.47 1.1 612.2829 2 13.199 923 1 773 782 Y 2 IPI00773363 K.SAETEKEL.A N 26.36 0.5 453.7245 2 10.981 728 1 844 851 N 2 IPI00773363 R.IEELEEEI.E N 25.63 0.1 1003.483 1 20.041 1566 1 1117 1124 N 2 IPI00773363 I.DFGMDL.A N 25.26 0.9 697.2867 1 22.099 1755 1 516 521 N 2 IPI00773363 F.QLPDER.G N 24.98 0.8 379.1953 2 10.106 657 1 280 285 N 2 IPI00773363 K.NLEVTVK.D N 23.21 0.5 401.7372 2 13.894 986 7 1787 1793 N 2 IPI00773363 I.DFGMDLA.A N 22.78 0.7 768.3238 1 21.581 1708 1 516 522 N 2 IPI00773363 I.SDLTEQI.G N 21.65 2.3 805.3956 1 16.549 1238 2 1512 1518 N 2 IPI00773363 A.ANPLLEA.Y N 21.19 0.5 727.3988 1 17.347 1312 1 227 233 N 2 IPI00773363 A.SIDDKEEL.V N 20.54 1 474.7301 2 13.962 993 1 326 333 N 2 IPI00773363 Y.KMEIDDL.S N 20.38 1.1 432.213 2 17.593 1335 1 1227 1233 N 2 IPI00773363 K.NLEVTV.K N 19.16 0.7 674.3724 1 17.586 1334 1 1787 1792 N 2 IPI00773363 R.LDEAENL.A N 19.08 0.7 803.3776 1 15.167 1106 1 1799 1805 N 2 IPI00773363 R.LEDEEEI.N N 18.85 0.8 876.384 1 15.355 1124 1 928 934 N 2 IPI00773363 K.NLQQEI.S N 18.52 2 744.3871 1 16.043 1190 1 1506 1511 N 2 IPI00773363 V.AELGEQI.D N 18.17 2.5 759.3864 1 16.106 1196 1 1203 1209 N 2 IPI00773363 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 465 471 N 2 IPI00773363 K.MEIDDL.S N 17.34 0.2 735.3228 1 19.769 1540 2 1228 1233 N 2 IPI00773363 F.IDFGMDL.A N 17.16 1.2 810.3692 1 24.425 1955 1 515 521 N 2 IPI00773363 R.SLSTELFK.M N 16.4 1.2 462.756 2 18.957 1462 1 1478 1485 N 2 IPI00773363 Y.EEGQAEL.E N 16.08 0.7 775.3463 1 12.661 875 1 1463 1469 N 2 IPI00773363 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 769 775 N 2 IPI00773363 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 461 466 N 2 IPI00773363 L.QGEVEDLMI.D N 12.86 0.2 1033.487 1 20.398 1599 1 1424 1432 N 2 IPI00773363 W.LDKNKDPL.N N 12.69 1 471.7659 2 12.257 839 2 598 605 N

PAGE 248

248 2 IPI00773363 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 467 472 N 2 IPI00773363 L.EEEIEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1121 1129 N 2 IPI00773363 L.SRELEEI.S N 9.38 0.2 438.2271 2 14.679 1059 1 1142 1148 N 6 IPI00500057 I.SDLTEQIGETGK.S N 61.48 0.1 639.3146 2 15.248 1114 1 1510 1521 N 6 IPI00500057 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1028 1042 N 6 IPI00500057 K.VQHELEEAEER.A N 58.54 0.4 684.8228 2 12.936 900 2 1899 1909 N 6 IPI00500057 Y.KMEIDDLSSNMEA.V N 57.36 0.1 741.8262 2 19.452 1510 1 1225 1237 N 6 IPI00500057 L.EEAEGTLEHEESK.I N 56.67 0.4 744.3281 2 12.385 850 2 1545 1557 N 6 IPI00500057 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1032 1043 N 6 IPI00500057 L.REQFEEEQEAK.A N 50.07 0.1 711.8284 2 11.96 812 3 1344 1354 N 6 IPI00500057 V.AELGEQIDNL.Q N 49.46 0.4 551.2745 2 20.331 1592 2 1201 1210 N 6 IPI00500057 K.QRLQGEVEDL.M N 49.24 0.2 593.8068 2 16.686 1251 2 1419 1428 N 6 IPI00500057 R.EQFEEEQEAK.A N 46.36 0.1 633.7778 2 12.635 872 2 1345 1354 N 6 IPI00500057 L.DDLQAEEDKV.N N 45.2 0.1 581.2672 2 15.669 1155 2 1008 1017 N 6 IPI00500057 K.ETTERLEDEEEI.N N 44.7 0.7 746.8355 2 16.482 1232 1 921 932 N 6 IPI00500057 R.M(+15.99)EAPPHI.F N 44.65 0.2 405.6942 2 15.108 1101 1 150 156 Y 6 IPI00500057 L.SKIEDEQSLGA.Q N 44.27 0.4 588.7905 2 13.767 974 1 1092 1102 N 6 IPI00500057 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1032 1042 N 6 IPI00500057 L.REQFEEEQEA.K N 42.96 0.6 647.7812 2 13.24 926 1 1344 1353 N 6 IPI00500057 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1147 1156 N 6 IPI00500057 R.KVQHELEEA.E N 41.01 0.3 541.7773 2 11.051 734 1 1898 1906 N 6 IPI00500057 L.DDLQAEEDK.V N 40.39 0.7 1062.458 1 11.353 760 1 1008 1016 N 6 IPI00500057 R.MEAPPHI.F N 39.66 0.2 397.6968 2 15.102 1100 26 150 156 N 6 IPI00500057 R.TLEDQLSEIK.S N 38.88 0.5 588.3116 2 19.91 1554 31 1251 1260 N 6 IPI00500057 K.SAETEKELA.N N 38.2 0.5 489.2426 2 11.061 735 2 842 850 N 6 IPI00500057 L.EEAEERADI.S N 37.38 0.2 531.2408 2 12.981 904 1 1904 1912 N 6 IPI00500057 K.MEIDDLSSNMEAV.A N 37.22 0.4 727.3126 2 22.774 1814 1 1226 1238 N 6 IPI00500057 K.YEEGQAEL.E N 35.9 0.1 938.4102 1 15.193 1109 1 1460 1467 N 6 IPI00500057 K.NLTEEM(+15.99)A.S N 35.37 0.1 823.3502 1 15.316 1121 1 977 983 Y 6 IPI00500057 K.DFETSQLL.S N 34.7 0.5 952.4617 1 21.964 1744 2 1084 1091 N 6 IPI00500057 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1618 1627 N

PAGE 249

249 6 IPI00500057 K.VQHELEEA.E N 33.91 0.1 477.7299 2 12.024 818 2 1899 1906 N 6 IPI00500057 L.GTLEEMRDEK.L N 33.34 0.9 403.1927 3 13.171 920 1 771 780 N 6 IPI00500057 R.TLEDQLSEI.K N 30.97 0.6 524.2642 2 21.769 1725 2 1251 1259 N 6 IPI00500057 R.LQGEVEDL.M N 30.84 1 902.4456 1 34.524 2794 30 1421 1428 N 6 IPI00500057 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1864 1870 N 6 IPI00500057 L.GTLEEM(+15.99)RDEK.L N 26.47 1.1 612.2829 2 13.199 923 1 771 780 Y 6 IPI00500057 K.SAETEKEL.A N 26.36 0.5 453.7245 2 10.981 728 1 842 849 N 6 IPI00500057 L.IEKPMGIF.S N 26.01 0.4 467.7567 2 20.21 1581 1 528 535 N 6 IPI00500057 R.IEELEEEI.E N 25.63 0.1 1003.483 1 20.041 1566 1 1115 1122 N 6 IPI00500057 I.DFGMDL.A N 25.26 0.9 697.2867 1 22.099 1755 1 516 521 N 6 IPI00500057 F.QLPDER.G N 24.98 0.8 379.1953 2 10.106 657 1 280 285 N 6 IPI00500057 I.ELIEKPMGI.F N 23.73 0 515.2861 2 31.019 2502 9 526 534 N 6 IPI00500057 I.DFGMDLA.A N 22.78 0.7 768.3238 1 21.581 1708 1 516 522 N 6 IPI00500057 I.SDLTEQI.G N 21.65 2.3 805.3956 1 16.549 1238 2 1510 1516 N 6 IPI00500057 A.ANPLLEA.Y N 21.19 0.5 727.3988 1 17.347 1312 1 227 233 N 6 IPI00500057 A.SIDDKEEL.V N 20.54 1 474.7301 2 13.962 993 1 326 333 N 6 IPI00500057 Y.KMEIDDL.S N 20.38 1.1 432.213 2 17.593 1335 1 1225 1231 N 6 IPI00500057 R.LDEAENL.A N 19.08 0.7 803.3776 1 15.167 1106 1 1797 1803 N 6 IPI00500057 R.LEDEEEI.N N 18.85 0.8 876.384 1 15.355 1124 1 926 932 N 6 IPI00500057 K.NLQQEI.S N 18.52 2 744.3871 1 16.043 1190 1 1504 1509 N 6 IPI00500057 V.AELGEQI.D N 18.17 2.5 759.3864 1 16.106 1196 1 1201 1207 N 6 IPI00500057 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 465 471 N 6 IPI00500057 K.MEIDDL.S N 17.34 0.2 735.3228 1 19.769 1540 2 1226 1231 N 6 IPI00500057 F.IDFGMDL.A N 17.16 1.2 810.3692 1 24.425 1955 1 515 521 N 6 IPI00500057 R.SLSTELFK.M N 16.4 1.2 462.756 2 18.957 1462 1 1476 1483 N 6 IPI00500057 Y.EEGQAEL.E N 16.08 0.7 775.3463 1 12.661 875 1 1461 1467 N 6 IPI00500057 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 767 773 N 6 IPI00500057 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 461 466 N 6 IPI00500057 L.QGEVEDLMI.D N 12.86 0.2 1033.487 1 20.398 1599 1 1422 1430 N 6 IPI00500057 W.LDKNKDPL.N N 12.69 1 471.7659 2 12.257 839 2 598 605 N 6 IPI00500057 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 467 472 N

PAGE 250

250 6 IPI00500057 L.EEEIEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1119 1127 N 6 IPI00500057 L.SRELEEI.S N 9.38 0.2 438.2271 2 14.679 1059 1 1140 1146 N 1 IPI00933204 I.SDLTEQLGETGK.S N 61.48 0.1 639.3146 2 15.248 1114 1 1512 1523 N 1 IPI00933204 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1030 1044 N 1 IPI00933204 K.VQHELEEAEER.A N 58.54 0.4 684.8228 2 12.936 900 2 1901 1911 N 1 IPI00933204 Y.KMEIDDLSSNMEA.V N 57.36 0.1 741.8262 2 19.452 1510 1 1227 1239 N 1 IPI00933204 L.EEAEGTLEHEESK.I N 56.67 0.4 744.3281 2 12.385 850 2 1547 1559 N 1 IPI00933204 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1034 1045 N 1 IPI00933204 L.REQFEEEQEAK.A N 50.07 0.1 711.8284 2 11.96 812 3 1346 1356 N 1 IPI00933204 V.AELGEQIDNL.Q N 49.46 0.4 551.2745 2 20.331 1592 2 1203 1212 N 1 IPI00933204 K.QRLQGEVEDL.M N 49.24 0.2 593.8068 2 16.686 1251 2 1421 1430 N 1 IPI00933204 R.EQFEEEQEAK.A N 46.36 0.1 633.7778 2 12.635 872 2 1347 1356 N 1 IPI00933204 L.DDLQAEEDKV.N N 45.2 0.1 581.2672 2 15.669 1155 2 1010 1019 N 1 IPI00933204 K.ETTERLEDEEEI.N N 44.7 0.7 746.8355 2 16.482 1232 1 923 934 N 1 IPI00933204 R.M(+15.99)EAPPHI.F N 44.65 0.2 405.6942 2 15.108 1101 1 150 156 Y 1 IPI00933204 L.SKIEDEQSLGA.Q N 44.27 0.4 588.7905 2 13.767 974 1 1094 1104 N 1 IPI00933204 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1034 1044 N 1 IPI00933204 L.AEKDEEMEQIK.R Y 43.96 0.1 450.5465 3 12.787 886 1 1579 1589 N 1 IPI00933204 L.REQFEEEQEA.K N 42.96 0.6 647.7812 2 13.24 926 1 1346 1355 N 1 IPI00933204 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1149 1158 N 1 IPI00933204 R.KVQHELEEA.E N 41.01 0.3 541.7773 2 11.051 734 1 1900 1908 N 1 IPI00933204 L.DDLQAEEDK.V N 40.39 0.7 1062.458 1 11.353 760 1 1010 1018 N 1 IPI00933204 R.MEAPPHI.F N 39.66 0.2 397.6968 2 15.102 1100 26 150 156 N 1 IPI00933204 K.SAETEKELA.T N 38.2 0.5 489.2426 2 11.061 735 2 844 852 N 1 IPI00933204 L.EEAEERADI.A N 37.38 0.2 531.2408 2 12.981 904 1 1906 1914 N 1 IPI00933204 K.MEIDDLSSNMEAV.A N 37.22 0.4 727.3126 2 22.774 1814 1 1228 1240 N 1 IPI00933204 L.GLNSADM(+15.99)LK.A N 36.24 1.7 482.7429 2 15.496 1138 1 393 401 Y 1 IPI00933204 K.YEEGQAEL.E N 35.9 0.1 938.4102 1 15.193 1109 1 1462 1469 N 1 IPI00933204 K.NLTEEM(+15.99)A.S N 35.37 0.1 823.3502 1 15.316 1121 1 979 985 Y 1 IPI00933204 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1620 1629 N 1 IPI00933204 K.VQHELEEA.E N 33.91 0.1 477.7299 2 12.024 818 2 1901 1908 N

PAGE 251

251 1 IPI00933204 L.GTLEEMRDEK.L N 33.34 0.9 403.1927 3 13.171 920 1 773 782 N 1 IPI00933204 R.LQGEVEDL.M N 30.84 1 902.4456 1 34.524 2794 30 1423 1430 N 1 IPI00933204 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1866 1872 N 1 IPI00933204 L.GTLEEM(+15.99)RDEK.L N 26.47 1.1 612.2829 2 13.199 923 1 773 782 Y 1 IPI00933204 K.SAETEKEL.A N 26.36 0.5 453.7245 2 10.981 728 1 844 851 N 1 IPI00933204 R.IEELEEEI.E N 25.63 0.1 1003.483 1 20.041 1566 1 1117 1124 N 1 IPI00933204 I.DFGMDL.A N 25.26 0.9 697.2867 1 22.099 1755 1 516 521 N 1 IPI00933204 F.QLPDER.G N 24.98 0.8 379.1953 2 10.106 657 1 280 285 N 1 IPI00933204 K.NLEVTVK.D N 23.21 0.5 401.7372 2 13.894 986 7 1787 1793 N 1 IPI00933204 I.DFGMDLA.A N 22.78 0.7 768.3238 1 21.581 1708 1 516 522 N 1 IPI00933204 A.ANPLLEA.Y N 21.19 0.5 727.3988 1 17.347 1312 1 227 233 N 1 IPI00933204 A.SIDDKEEL.V N 20.54 1 474.7301 2 13.962 993 1 326 333 N 1 IPI00933204 Y.KMEIDDL.S N 20.38 1.1 432.213 2 17.593 1335 1 1227 1233 N 1 IPI00933204 K.NLEVTV.K N 19.16 0.7 674.3724 1 17.586 1334 1 1787 1792 N 1 IPI00933204 R.LDEAENL.A N 19.08 0.7 803.3776 1 15.167 1106 1 1799 1805 N 1 IPI00933204 R.LEDEEEI.N N 18.85 0.8 876.384 1 15.355 1124 1 928 934 N 1 IPI00933204 K.NLQQEI.S N 18.52 2 744.3871 1 16.043 1190 1 1506 1511 N 1 IPI00933204 V.AELGEQI.D N 18.17 2.5 759.3864 1 16.106 1196 1 1203 1209 N 1 IPI00933204 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 465 471 N 1 IPI00933204 K.MEIDDL.S N 17.34 0.2 735.3228 1 19.769 1540 2 1228 1233 N 1 IPI00933204 F.IDFGMDL.A N 17.16 1.2 810.3692 1 24.425 1955 1 515 521 N 1 IPI00933204 R.SLSTELFK.M N 16.4 1.2 462.756 2 18.957 1462 1 1478 1485 N 1 IPI00933204 Y.EEGQAEL.E N 16.08 0.7 775.3463 1 12.661 875 1 1463 1469 N 1 IPI00933204 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 769 775 N 1 IPI00933204 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 461 466 N 1 IPI00933204 L.QGEVEDLMI.D N 12.86 0.2 1033.487 1 20.398 1599 1 1424 1432 N 1 IPI00933204 W.LDKNKDPL.N N 12.69 1 471.7659 2 12.257 839 2 598 605 N 1 IPI00933204 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 467 472 N 1 IPI00933204 L.EEEIEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1121 1129 N 1 IPI00933204 L.SRELEEI.S N 9.38 0.2 438.2271 2 14.679 1059 1 1142 1148 N 8 IPI00961738 I.SDLTEQLGETGK.S N 61.48 0.1 639.3146 2 15.248 1114 1 1510 1521 N

PAGE 252

252 8 IPI00961738 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1028 1042 N 8 IPI00961738 Y.KMEIDDLSSNMEA.V N 57.36 0.1 741.8262 2 19.452 1510 1 1225 1237 N 8 IPI00961738 L.EEAEGTLEHEESK.I N 56.67 0.4 744.3281 2 12.385 850 2 1545 1557 N 8 IPI00961738 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1032 1043 N 8 IPI00961738 L.REQFEEEQEAK.A N 50.07 0.1 711.8284 2 11.96 812 3 1344 1354 N 8 IPI00961738 V.AELGEQIDNL.Q N 49.46 0.4 551.2745 2 20.331 1592 2 1201 1210 N 8 IPI00961738 K.QRLQGEVEDL.M N 49.24 0.2 593.8068 2 16.686 1251 2 1419 1428 N 8 IPI00961738 R.EQFEEEQEAK.A N 46.36 0.1 633.7778 2 12.635 872 2 1345 1354 N 8 IPI00961738 L.DDLQAEEDKV.N N 45.2 0.1 581.2672 2 15.669 1155 2 1008 1017 N 8 IPI00961738 K.ETTERLEDEEEI.N N 44.7 0.7 746.8355 2 16.482 1232 1 921 932 N 8 IPI00961738 L.SKIEDEQSLGA.Q N 44.27 0.4 588.7905 2 13.767 974 1 1092 1102 N 8 IPI00961738 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1032 1042 N 8 IPI00961738 L.REQFEEEQEA.K N 42.96 0.6 647.7812 2 13.24 926 1 1344 1353 N 8 IPI00961738 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1147 1156 N 8 IPI00961738 L.DDLQAEEDK.V N 40.39 0.7 1062.458 1 11.353 760 1 1008 1016 N 8 IPI00961738 R.TLEDQLSEIK.T N 38.88 0.5 588.3116 2 19.91 1554 31 1251 1260 N 8 IPI00961738 K.MEIDDLSSNMEAV.A N 37.22 0.4 727.3126 2 22.774 1814 1 1226 1238 N 8 IPI00961738 K.YEEGQAEL.E N 35.9 0.1 938.4102 1 15.193 1109 1 1460 1467 N 8 IPI00961738 K.NLTEEM(+15.99)A.S N 35.37 0.1 823.3502 1 15.316 1121 1 977 983 Y 8 IPI00961738 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1618 1627 N 8 IPI00961738 L.GTLEEMRDEK.L N 33.34 0.9 403.1927 3 13.171 920 1 771 780 N 8 IPI00961738 R.TLEDQLSEI.K N 30.97 0.6 524.2642 2 21.769 1725 2 1251 1259 N 8 IPI00961738 R.LQGEVEDL.M N 30.84 1 902.4456 1 34.524 2794 30 1421 1428 N 8 IPI00961738 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1864 1870 N 8 IPI00961738 L.GTLEEM(+15.99)RDEK.L N 26.47 1.1 612.2829 2 13.199 923 1 771 780 Y 8 IPI00961738 L.IEKPMGIF.S N 26.01 0.4 467.7567 2 20.21 1581 1 526 533 N 8 IPI00961738 R.IEELEEEI.E N 25.63 0.1 1003.483 1 20.041 1566 1 1115 1122 N 8 IPI00961738 I.DFGMDL.A N 25.26 0.9 697.2867 1 22.099 1755 1 514 519 N 8 IPI00961738 I.ELIEKPMGI.F N 23.73 0 515.2861 2 31.019 2502 9 524 532 N 8 IPI00961738 K.NLEVTVK.D N 23.21 0.5 401.7372 2 13.894 986 7 1785 1791 N 8 IPI00961738 R.NVQGQL.K N 22.81 0.5 658.3516 1 12.575 867 1 1645 1650 N

PAGE 253

253 8 IPI00961738 I.DFGMDLA.A N 22.78 0.7 768.3238 1 21.581 1708 1 514 520 N 8 IPI00961738 A.ANPLLEA.Y N 21.19 0.5 727.3988 1 17.347 1312 1 225 231 N 8 IPI00961738 Y.KMEIDDL.S N 20.38 1.1 432.213 2 17.593 1335 1 1225 1231 N 8 IPI00961738 K.NLEVTV.K N 19.16 0.7 674.3724 1 17.586 1334 1 1785 1790 N 8 IPI00961738 R.LDEAENL.A N 19.08 0.7 803.3776 1 15.167 1106 1 1797 1803 N 8 IPI00961738 R.LEDEEEI.N N 18.85 0.8 876.384 1 15.355 1124 1 926 932 N 8 IPI00961738 K.NLQQEI.S N 18.52 2 744.3871 1 16.043 1190 1 1504 1509 N 8 IPI00961738 V.AELGEQI.D N 18.17 2.5 759.3864 1 16.106 1196 1 1201 1207 N 8 IPI00961738 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 463 469 N 8 IPI00961738 K.MEIDDL.S N 17.34 0.2 735.3228 1 19.769 1540 2 1226 1231 N 8 IPI00961738 F.IDFGMDL.A N 17.16 1.2 810.3692 1 24.425 1955 1 513 519 N 8 IPI00961738 R.SLSTEIFK.M N 16.4 1.2 462.756 2 18.957 1462 1 1476 1483 N 8 IPI00961738 Y.EEGQAEL.E N 16.08 0.7 775.3463 1 12.661 875 1 1461 1467 N 8 IPI00961738 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 767 773 N 8 IPI00961738 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 459 464 N 8 IPI00961738 L.QGEVEDLMI.D N 12.86 0.2 1033.487 1 20.398 1599 1 1422 1430 N 8 IPI00961738 W.LDKNKDPL.N N 12.69 1 471.7659 2 12.257 839 2 596 603 N 8 IPI00961738 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 465 470 N 8 IPI00961738 L.EEEIEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1119 1127 N 8 IPI00961738 L.SRELEEI.S N 9.38 0.2 438.2271 2 14.679 1059 1 1140 1146 N 13 IPI00484075 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1030 1044 N 13 IPI00484075 K.NSYEETLDHL.E N 57.59 1.9 610.7739 2 19.706 1534 1 1488 1497 N 13 IPI00484075 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1034 1045 N 13 IPI00484075 V.AELGEQIDNL.Q N 49.46 0.4 551.2745 2 20.331 1592 2 1203 1212 N 13 IPI00484075 L.DDLQAEEDKV.N N 45.2 0.1 581.2672 2 15.669 1155 2 1010 1019 N 13 IPI00484075 R.LEEAGGATSA.Q N 44.9 0.7 905.4203 1 11.194 746 1 1152 1161 N 13 IPI00484075 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1034 1044 N 13 IPI00484075 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1149 1158 N 13 IPI00484075 R.KVQHELEEA.Q N 41.01 0.3 541.7773 2 11.051 734 1 1902 1910 N 13 IPI00484075 L.DDLQAEEDK.V N 40.39 0.7 1062.458 1 11.353 760 1 1010 1018 N 13 IPI00484075 L.GLNSADM(+15.99)LK.A N 36.24 1.7 482.7429 2 15.496 1138 1 391 399 Y

PAGE 254

254 13 IPI00484075 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1622 1631 N 13 IPI00484075 K.VQHELEEA.Q N 33.91 0.1 477.7299 2 12.024 818 2 1903 1910 N 13 IPI00484075 L.GTLEEMRDEK.L N 33.34 0.9 403.1927 3 13.171 920 1 773 782 N 13 IPI00484075 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1868 1874 N 13 IPI00484075 L.GTLEEM(+15.99)RDEK.L N 26.47 1.1 612.2829 2 13.199 923 1 773 782 Y 13 IPI00484075 L.IEKPMGIF.S N 26.01 0.4 467.7567 2 20.21 1581 1 526 533 N 13 IPI00484075 R.IEELEEEI.E N 25.63 0.1 1003.483 1 20.041 1566 1 1117 1124 N 13 IPI00484075 I.DFGMDL.A N 25.26 0.9 697.2867 1 22.099 1755 1 514 519 N 13 IPI00484075 I.ELIEKPMGI.F N 23.73 0 515.2861 2 31.019 2502 9 524 532 N 13 IPI00484075 K.NLEVTVK.D N 23.21 0.5 401.7372 2 13.894 986 7 1789 1795 N 13 IPI00484075 R.NVQGQL.K N 22.81 0.5 658.3516 1 12.575 867 1 1649 1654 N 13 IPI00484075 I.DFGMDLA.A N 22.78 0.7 768.3238 1 21.581 1708 1 514 520 N 13 IPI00484075 A.ANPLLEA.Y N 21.19 0.5 727.3988 1 17.347 1312 1 225 231 N 13 IPI00484075 K.NLEVTV.K N 19.16 0.7 674.3724 1 17.586 1334 1 1789 1794 N 13 IPI00484075 R.LEDEEEI.N N 18.85 0.8 876.384 1 15.355 1124 1 928 934 N 13 IPI00484075 V.AELGEQI.D N 18.17 2.5 759.3864 1 16.106 1196 1 1203 1209 N 13 IPI00484075 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 463 469 N 13 IPI00484075 F.IDFGMDL.A N 17.16 1.2 810.3692 1 24.425 1955 1 513 519 N 13 IPI00484075 R.SLSTELFK.M N 16.4 1.2 462.756 2 18.957 1462 1 1478 1485 N 13 IPI00484075 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 769 775 N 13 IPI00484075 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 459 464 N 13 IPI00484075 W.LDKNKDPL.N N 12.69 1 471.7659 2 12.257 839 2 596 603 N 13 IPI00484075 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 465 470 N 13 IPI00484075 L.EEEIEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1121 1129 N 11 IPI00490216 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1028 1042 N 11 IPI00490216 K.NSYEETLDHL.E N 57.59 1.9 610.7739 2 19.706 1534 1 1486 1495 N 11 IPI00490216 V.DDLEGSLEQEKK.V N 56.5 1.3 695.8375 2 14.576 1050 2 1032 1043 N 11 IPI00490216 L.REQFEEEQEAK.A N 50.07 0.1 711.8284 2 11.96 812 3 1344 1354 N 11 IPI00490216 V.AELGEQIDNL.Q N 49.46 0.4 551.2745 2 20.331 1592 2 1201 1210 N 11 IPI00490216 R.EQFEEEQEAK.A N 46.36 0.1 633.7778 2 12.635 872 2 1345 1354 N 11 IPI00490216 R.LEEAGGATSA.Q N 44.9 0.7 905.4203 1 11.194 746 1 1150 1159 N

PAGE 255

255 11 IPI00490216 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1032 1042 N 11 IPI00490216 L.REQFEEEQEA.K N 42.96 0.6 647.7812 2 13.24 926 1 1344 1353 N 11 IPI00490216 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1147 1156 N 11 IPI00490216 K.VGNEYVTK.G Y 42.29 0.9 455.237 2 11.471 770 1 405 412 N 11 IPI00490216 L.EEAEERADI.A N 37.38 0.2 531.2408 2 12.981 904 1 1904 1912 N 11 IPI00490216 K.NITEEM(+15.99)A.S N 35.37 0.1 823.3502 1 15.316 1121 1 977 983 Y 11 IPI00490216 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1618 1627 N 11 IPI00490216 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1864 1870 N 11 IPI00490216 I.DFGMDL.Q N 25.26 0.9 697.2867 1 22.099 1755 1 511 516 N 11 IPI00490216 R.IEDEEEI.N N 18.85 0.8 876.384 1 15.355 1124 1 926 932 N 11 IPI00490216 V.AELGEQI.D N 18.17 2.5 759.3864 1 16.106 1196 1 1201 1207 N 11 IPI00490216 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 460 466 N 11 IPI00490216 F.IDFGMDL.Q N 17.16 1.2 810.3692 1 24.425 1955 1 510 516 N 11 IPI00490216 R.SLSTELFK.L N 16.4 1.2 462.756 2 18.957 1462 1 1476 1483 N 11 IPI00490216 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 767 773 N 11 IPI00490216 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 456 461 N 11 IPI00490216 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 462 467 N 14 IPI00934366 I.SDLTEQLGETGK.S N 61.48 0.1 639.3146 2 15.248 1114 1 1513 1524 N 14 IPI00934366 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1031 1045 N 14 IPI00934366 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1035 1046 N 14 IPI00934366 L.REQFEEEQEAK.A N 50.07 0.1 711.8284 2 11.96 812 3 1347 1357 N 14 IPI00934366 R.EQFEEEQEAK.A N 46.36 0.1 633.7778 2 12.635 872 2 1348 1357 N 14 IPI00934366 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1035 1045 N 14 IPI00934366 L.REQFEEEQEA.K N 42.96 0.6 647.7812 2 13.24 926 1 1347 1356 N 14 IPI00934366 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1150 1159 N 14 IPI00934366 K.NLTEEM(+15.99)A.A N 35.37 0.1 823.3502 1 15.316 1121 1 980 986 Y 14 IPI00934366 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1621 1630 N 14 IPI00934366 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1867 1873 N 14 IPI00934366 L.MVDVER.S N 28.78 0.2 374.6865 2 11.968 813 1 1432 1437 N 14 IPI00934366 L.M(+15.99)VDVER.S N 28.24 0.2 382.6839 2 11.993 816 1 1432 1437 Y 14 IPI00934366 I.DFGMDL.Q N 25.26 0.9 697.2867 1 22.099 1755 1 512 517 N

PAGE 256

256 14 IPI00934366 I.ELIEKPMGI.M N 23.73 0 515.2861 2 31.019 2502 9 522 530 N 14 IPI00934366 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 461 467 N 14 IPI00934366 F.IDFGMDL.Q N 17.16 1.2 810.3692 1 24.425 1955 1 511 517 N 14 IPI00934366 Y.TQQIEDLK.R N 16.62 0.8 487.7609 2 12.234 836 1 1312 1319 N 14 IPI00934366 R.SLSTELFK.L N 16.4 1.2 462.756 2 18.957 1462 1 1479 1486 N 14 IPI00934366 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 770 776 N 14 IPI00934366 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 457 462 N 14 IPI00934366 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 463 468 N 14 IPI00934366 V.DY(+79.97)NIS(+79.97)NW.L N 12.67 1.3 536.1653 2 45.848 3737 1 587 593 Y 14 IPI00934366 L.EEELEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1122 1130 N 14 IPI00934366 L.SRELEEI.S N 9.38 0.2 438.2271 2 14.679 1059 1 1143 1149 N 18 IPI00501288 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1037 1051 N 18 IPI00501288 L.EEAEGTLEHEESK.T N 56.67 0.4 744.3281 2 12.385 850 2 1554 1566 N 18 IPI00501288 V.DDLEGSLEQEKK.V N 56.5 1.3 695.8375 2 14.576 1050 2 1041 1052 N 18 IPI00501288 L.REQFEEEQEAK.S N 50.07 0.1 711.8284 2 11.96 812 3 1353 1363 N 18 IPI00501288 R.EQFEEEQEAK.S N 46.36 0.1 633.7778 2 12.635 872 2 1354 1363 N 18 IPI00501288 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1041 1051 N 18 IPI00501288 L.REQFEEEQEA.K N 42.96 0.6 647.7812 2 13.24 926 1 1353 1362 N 18 IPI00501288 L.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1156 1165 N 18 IPI00501288 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 466 472 N 18 IPI00501288 R.SLSTELFK.L N 16.4 1.2 462.756 2 18.957 1462 1 1485 1492 N 18 IPI00501288 K.DLDDLEI.T N 16.28 0.7 832.3929 1 22.166 1761 1 962 968 N 18 IPI00501288 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 462 467 N 18 IPI00501288 K.KDLDDLEI.T N 13.39 1.7 480.7486 2 19.102 1476 1 961 968 N 18 IPI00501288 I.AGFEIF.E N 12.68 1.1 683.3391 1 24.56 1966 1 468 473 N 18 IPI00501288 L.EEELEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1128 1136 N 30 IPI00616127 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1035 1049 N 30 IPI00616127 V.DDLEGSLEQEKK.I N 56.5 1.3 695.8375 2 14.576 1050 2 1039 1050 N 30 IPI00616127 V.AELGEQIDNL.Q N 49.46 0.4 551.2745 2 20.331 1592 2 1208 1217 N 30 IPI00616127 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1039 1049 N 30 IPI00616127 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1154 1163 N

PAGE 257

257 30 IPI00616127 K.NLTEEM(+15.99)A.A N 35.37 0.1 823.3502 1 15.316 1121 1 984 990 Y 30 IPI00616127 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1625 1634 N 30 IPI00616127 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1871 1877 N 30 IPI00616127 L.MVDVER.S N 28.78 0.2 374.6865 2 11.968 813 1 1436 1441 N 30 IPI00616127 L.M(+15.99)VDVER.S N 28.24 0.2 382.6839 2 11.993 816 1 1436 1441 Y 30 IPI00616127 I.DFGMDL.Q N 25.26 0.9 697.2867 1 22.099 1755 1 514 519 N 30 IPI00616127 V.AELGEQI.D N 18.17 2.5 759.3864 1 16.106 1196 1 1208 1214 N 30 IPI00616127 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 463 469 N 30 IPI00616127 F.IDFGMDL.Q N 17.16 1.2 810.3692 1 24.425 1955 1 513 519 N 30 IPI00616127 R.SLSTELFK.L N 16.4 1.2 462.756 2 18.957 1462 1 1483 1490 N 30 IPI00616127 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 459 464 N 30 IPI00616127 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 465 470 N 30 IPI00616127 L.EEELEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1126 1134 N 31 IPI00882712 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1030 1044 N 31 IPI00882712 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1034 1045 N 31 IPI00882712 V.AELGEQIDNL.Q N 49.46 0.4 551.2745 2 20.331 1592 2 1203 1212 N 31 IPI00882712 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1034 1044 N 31 IPI00882712 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1149 1158 N 31 IPI00882712 K.NLTEEM(+15.99)A.A N 35.37 0.1 823.3502 1 15.316 1121 1 979 985 Y 31 IPI00882712 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1620 1629 N 31 IPI00882712 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1866 1872 N 31 IPI00882712 I.DFGMDL.Q N 25.26 0.9 697.2867 1 22.099 1755 1 511 516 N 31 IPI00882712 V.AELGEQI.D N 18.17 2.5 759.3864 1 16.106 1196 1 1203 1209 N 31 IPI00882712 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 460 466 N 31 IPI00882712 F.IDFGMDL.Q N 17.16 1.2 810.3692 1 24.425 1955 1 510 516 N 31 IPI00882712 Y.TQQIEDLK.R N 16.62 0.8 487.7609 2 12.234 836 1 1311 1318 N 31 IPI00882712 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 456 461 N 31 IPI00882712 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 462 467 N 31 IPI00882712 L.EEELEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1121 1129 N 32 IPI00914342 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1030 1044 N 32 IPI00914342 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1034 1045 N

PAGE 258

258 32 IPI00914342 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1034 1044 N 32 IPI00914342 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1149 1158 N 32 IPI00914342 K.NLTEEM(+15.99)A.A N 35.37 0.1 823.3502 1 15.316 1121 1 979 985 Y 32 IPI00914342 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1620 1629 N 32 IPI00914342 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1866 1872 N 32 IPI00914342 L.MVDVER.S N 28.78 0.2 374.6865 2 11.968 813 1 1431 1436 N 32 IPI00914342 L.M(+15.99)VDVER.S N 28.24 0.2 382.6839 2 11.993 816 1 1431 1436 Y 32 IPI00914342 I.DFGMDL.Q N 25.26 0.9 697.2867 1 22.099 1755 1 510 515 N 32 IPI00914342 A.DLTEQI.G Y 17.96 0.1 718.3617 1 16.956 1275 1 1513 1518 N 32 IPI00914342 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 459 465 N 32 IPI00914342 F.IDFGMDL.Q N 17.16 1.2 810.3692 1 24.425 1955 1 509 515 N 32 IPI00914342 Y.TQQIEDLK.R N 16.62 0.8 487.7609 2 12.234 836 1 1311 1318 N 32 IPI00914342 R.SLSTELFK.L N 16.4 1.2 462.756 2 18.957 1462 1 1478 1485 N 32 IPI00914342 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 769 775 N 32 IPI00914342 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 455 460 N 32 IPI00914342 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 461 466 N 32 IPI00914342 L.EEELEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1121 1129 N 32 IPI00914342 L.SRELEEI.S N 9.38 0.2 438.2271 2 14.679 1059 1 1142 1148 N 32 IPI00914342 V.QTEQDNLCDAEER.C Y 6.86 0.1 775.8229 2 13.576 957 1 894 906 N 33 IPI00960836 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1030 1044 N 33 IPI00960836 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1034 1045 N 33 IPI00960836 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1034 1044 N 33 IPI00960836 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1149 1158 N 33 IPI00960836 K.NLTEEM(+15.99)A.A N 35.37 0.1 823.3502 1 15.316 1121 1 979 985 Y 33 IPI00960836 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1620 1629 N 33 IPI00960836 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1866 1872 N 33 IPI00960836 L.MVDVER.S N 28.78 0.2 374.6865 2 11.968 813 1 1431 1436 N 33 IPI00960836 L.M(+15.99)VDVER.S N 28.24 0.2 382.6839 2 11.993 816 1 1431 1436 Y 33 IPI00960836 I.DFGMDL.Q N 25.26 0.9 697.2867 1 22.099 1755 1 510 515 N 33 IPI00960836 A.DLTEQI.G Y 17.96 0.1 718.3617 1 16.956 1275 1 1513 1518 N 33 IPI00960836 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 459 465 N

PAGE 259

259 33 IPI00960836 F.IDFGMDL.Q N 17.16 1.2 810.3692 1 24.425 1955 1 509 515 N 33 IPI00960836 Y.TQQIEDLK.R N 16.62 0.8 487.7609 2 12.234 836 1 1311 1318 N 33 IPI00960836 R.SLSTELFK.L N 16.4 1.2 462.756 2 18.957 1462 1 1478 1485 N 33 IPI00960836 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 769 775 N 33 IPI00960836 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 455 460 N 33 IPI00960836 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 461 466 N 33 IPI00960836 L.EEELEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1121 1129 N 33 IPI00960836 L.SRELEEI.S N 9.38 0.2 438.2271 2 14.679 1059 1 1142 1148 N 34 IPI00771791 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1030 1044 N 34 IPI00771791 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1034 1045 N 34 IPI00771791 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1034 1044 N 34 IPI00771791 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1149 1158 N 34 IPI00771791 K.NLTEEM(+15.99)A.A N 35.37 0.1 823.3502 1 15.316 1121 1 979 985 Y 34 IPI00771791 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1620 1629 N 34 IPI00771791 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1866 1872 N 34 IPI00771791 L.MVDVER.S N 28.78 0.2 374.6865 2 11.968 813 1 1431 1436 N 34 IPI00771791 L.M(+15.99)VDVER.S N 28.24 0.2 382.6839 2 11.993 816 1 1431 1436 Y 34 IPI00771791 I.DFGMDL.Q N 25.26 0.9 697.2867 1 22.099 1755 1 510 515 N 34 IPI00771791 A.DLTEQI.G Y 17.96 0.1 718.3617 1 16.956 1275 1 1513 1518 N 34 IPI00771791 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 459 465 N 34 IPI00771791 F.IDFGMDL.Q N 17.16 1.2 810.3692 1 24.425 1955 1 509 515 N 34 IPI00771791 Y.TQQIEDLK.R N 16.62 0.8 487.7609 2 12.234 836 1 1311 1318 N 34 IPI00771791 R.SLSTELFK.L N 16.4 1.2 462.756 2 18.957 1462 1 1478 1485 N 34 IPI00771791 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 769 775 N 34 IPI00771791 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 455 460 N 34 IPI00771791 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 461 466 N 34 IPI00771791 L.EEELEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1121 1129 N 34 IPI00771791 L.SRELEEI.S N 9.38 0.2 438.2271 2 14.679 1059 1 1142 1148 N 35 IPI00962033 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1031 1045 N 35 IPI00962033 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1035 1046 N 35 IPI00962033 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1035 1045 N

PAGE 260

260 35 IPI00962033 I.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1150 1159 N 35 IPI00962033 K.NLTEEM(+15.99)A.A N 35.37 0.1 823.3502 1 15.316 1121 1 980 986 Y 35 IPI00962033 K.MEGDLNEMEI.Q N 34.11 0.1 1180.486 1 21.369 1688 3 1621 1630 N 35 IPI00962033 R.LQDLVDK.L N 30.84 0.2 415.7346 2 24.837 1989 20 1867 1873 N 35 IPI00962033 L.MVDVER.S N 28.78 0.2 374.6865 2 11.968 813 1 1432 1437 N 35 IPI00962033 L.M(+15.99)VDVER.S N 28.24 0.2 382.6839 2 11.993 816 1 1432 1437 Y 35 IPI00962033 I.DFGMDL.Q N 25.26 0.9 697.2867 1 22.099 1755 1 511 516 N 35 IPI00962033 A.DLTEQI.G Y 17.96 0.1 718.3617 1 16.956 1275 1 1514 1519 N 35 IPI00962033 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 460 466 N 35 IPI00962033 F.IDFGMDL.Q N 17.16 1.2 810.3692 1 24.425 1955 1 510 516 N 35 IPI00962033 Y.TQQIEDLK.R N 16.62 0.8 487.7609 2 12.234 836 1 1312 1319 N 35 IPI00962033 R.SLSTELFK.L N 16.4 1.2 462.756 2 18.957 1462 1 1479 1486 N 35 IPI00962033 K.AGLLGTL.E N 15.71 0.1 644.3976 1 22.303 1773 2 770 776 N 35 IPI00962033 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 456 461 N 35 IPI00962033 I.AGFEIF.D N 12.68 1.1 683.3391 1 24.56 1966 1 462 467 N 35 IPI00962033 L.EEELEAERA.A N 11.64 1.1 538.2481 2 12.736 882 1 1122 1130 N 35 IPI00962033 L.SRELEEI.S N 9.38 0.2 438.2271 2 14.679 1059 1 1143 1149 N 19 IPI00656493 K.DSYVGDEAQSK.R Y 58.22 0 599.7647 2 12.031 819 1 52 62 N 19 IPI00656493 L.SGGTTMYPGIADR.M Y 53.71 1.9 663.3101 2 16.05 1191 1 301 313 N 19 IPI00656493 L.SGGTTM(+15.99)YPGIADR.M Y 49.58 1.7 671.3076 2 16.058 1192 1 301 313 Y 19 IPI00656493 K.AGFAGDDAPR.A Y 48.2 0.4 488.7275 2 12.965 902 1 20 29 N 19 IPI00656493 K.SYELPDGQV.I Y 44.38 0.5 1007.468 1 18.521 1421 1 240 248 N 19 IPI00656493 A.GFAGDDAPR.A Y 40.61 0.2 453.2093 2 12.518 862 1 21 29 N 19 IPI00656493 L.TEAPLNPK.A Y 36.69 0.6 435.2397 2 11.332 758 2 107 114 N 19 IPI00656493 K.SYELPDGQVI.T Y 35.81 0.8 560.7792 2 22.795 1816 1 240 249 N 19 IPI00656493 Y.ELPDGQVI.T Y 22.91 0.8 870.4559 1 18.36 1406 1 242 249 N 19 IPI00656493 R.LDLAGR.D Y 18.26 0.5 322.6901 2 13.063 911 1 179 184 N 19 IPI00656493 Y.DESGPSI.V Y 17.79 0.3 704.3095 1 12.404 852 1 364 370 N 19 IPI00656493 A.VFPSIV.G Y 17.45 0.7 661.3924 1 21.589 1709 1 31 36 N 19 IPI00656493 K.IIAPPER.K Y 16.86 0.2 398.2398 2 13.249 927 1 330 336 N 19 IPI00656493 R.AVFPSIV.G Y 11.82 1.5 732.4301 1 22.854 1821 3 30 36 N

PAGE 261

261 19 IPI00656493 W.IGGSIL.A Y 11.15 0.4 559.3452 1 17.403 1317 1 342 347 N 19 IPI00656493 K.EITALAPSTMK.I Y 7.75 0 581.3128 2 23.978 1917 1 317 327 N 24 IPI00482295 K.DSYVGDEAQSK.R Y 58.22 0 599.7647 2 12.031 819 1 51 61 N 24 IPI00482295 L.SGGTTMYPGIADR.M Y 53.71 1.9 663.3101 2 16.05 1191 1 300 312 N 24 IPI00482295 L.SGGTTM(+15.99)YPGIADR.M Y 49.58 1.7 671.3076 2 16.058 1192 1 300 312 Y 24 IPI00482295 K.AGFAGDDAPR.A Y 48.2 0.4 488.7275 2 12.965 902 1 19 28 N 24 IPI00482295 K.SYELPDGQV.I Y 44.38 0.5 1007.468 1 18.521 1421 1 239 247 N 24 IPI00482295 A.GFAGDDAPR.A Y 40.61 0.2 453.2093 2 12.518 862 1 20 28 N 24 IPI00482295 L.TEAPLNPK.A Y 36.69 0.6 435.2397 2 11.332 758 2 106 113 N 24 IPI00482295 K.SYELPDGQVI.T Y 35.81 0.8 560.7792 2 22.795 1816 1 239 248 N 24 IPI00482295 Y.ELPDGQVI.T Y 22.91 0.8 870.4559 1 18.36 1406 1 241 248 N 24 IPI00482295 R.LDLAGR.D Y 18.26 0.5 322.6901 2 13.063 911 1 178 183 N 24 IPI00482295 Y.DESGPSI.V Y 17.79 0.3 704.3095 1 12.404 852 1 363 369 N 24 IPI00482295 A.VFPSIV.G Y 17.45 0.7 661.3924 1 21.589 1709 1 30 35 N 24 IPI00482295 K.IIAPPER.K Y 16.86 0.2 398.2398 2 13.249 927 1 329 335 N 24 IPI00482295 R.AVFPSIV.G Y 11.82 1.5 732.4301 1 22.854 1821 3 29 35 N 24 IPI00482295 W.IGGSIL.A Y 11.15 0.4 559.3452 1 17.403 1317 1 341 346 N 25 IPI00490006 K.DSYVGDEAQSK.R Y 58.22 0 599.7647 2 12.031 819 1 51 61 N 25 IPI00490006 L.SGGTTMYPGIADR.M Y 53.71 1.9 663.3101 2 16.05 1191 1 300 312 N 25 IPI00490006 L.SGGTTM(+15.99)YPGIADR.M Y 49.58 1.7 671.3076 2 16.058 1192 1 300 312 Y 25 IPI00490006 K.AGFAGDDAPR.A Y 48.2 0.4 488.7275 2 12.965 902 1 19 28 N 25 IPI00490006 K.SYELPDGQV.I Y 44.38 0.5 1007.468 1 18.521 1421 1 239 247 N 25 IPI00490006 A.GFAGDDAPR.A Y 40.61 0.2 453.2093 2 12.518 862 1 20 28 N 25 IPI00490006 L.TEAPLNPK.A Y 36.69 0.6 435.2397 2 11.332 758 2 106 113 N 25 IPI00490006 K.SYELPDGQVI.T Y 35.81 0.8 560.7792 2 22.795 1816 1 239 248 N 25 IPI00490006 Y.ELPDGQVI.T Y 22.91 0.8 870.4559 1 18.36 1406 1 241 248 N 25 IPI00490006 R.LDLAGR.D Y 18.26 0.5 322.6901 2 13.063 911 1 178 183 N 25 IPI00490006 Y.DESGPSI.V Y 17.79 0.3 704.3095 1 12.404 852 1 363 369 N 25 IPI00490006 A.VFPSIV.G Y 17.45 0.7 661.3924 1 21.589 1709 1 30 35 N 25 IPI00490006 K.IIAPPER.K Y 16.86 0.2 398.2398 2 13.249 927 1 329 335 N 25 IPI00490006 R.AVFPSIV.G Y 11.82 1.5 732.4301 1 22.854 1821 3 29 35 N

PAGE 262

262 25 IPI00490006 W.IGGSIL.A Y 11.15 0.4 559.3452 1 17.403 1317 1 341 346 N 29 IPI00800858 L.EQQVDDLEGSLEQEK.K N 61.12 0.5 873.9046 2 18.378 1408 1 1029 1043 N 29 IPI00800858 L.EEAEGTLEHEESK.T N 56.67 0.4 744.3281 2 12.385 850 2 1546 1558 N 29 IPI00800858 V.DDLEGSLEQEKK.L N 56.5 1.3 695.8375 2 14.576 1050 2 1033 1044 N 29 IPI00800858 R.LEEAGGATSA.Q N 44.9 0.7 905.4203 1 11.194 746 1 1151 1160 N 29 IPI00800858 V.DDLEGSLEQEK.K N 44.18 0.6 631.7913 2 29.467 2374 6 1033 1043 N 29 IPI00800858 L.SERLEEAGGA.T N 42.68 0.1 509.7437 2 11.752 794 1 1148 1157 N 29 IPI00800858 L.DIAGFEI.F N 17.47 0.7 764.3819 1 23.765 1899 2 458 464 N 29 IPI00800858 K.DIDDLEI.T N 16.28 0.7 832.3929 1 22.166 1761 1 954 960 N 29 IPI00800858 F.IGVLDI.A N 14.33 0.3 629.387 1 23.19 1850 2 454 459 N 29 IPI00800858 K.KDIDDLEI.T N 13.39 1.7 480.7486 2 19.102 1476 1 953 960 N 29 IPI00800858 W.LDKNKDPL.N N 12.69 1 471.7659 2 12.257 839 2 592 599 N 29 IPI00800858 I.AGFEIF.E N 12.68 1.1 683.3391 1 24.56 1966 1 460 465 N 29 IPI00800858 L.M(+15.99)ATDHA.M Y 9.93 1.3 661.2618 1 2.659 176 1 327 332 Y 44 IPI00817902 R.DVLASMGQL.N Y 40.15 0.5 933.4705 1 22.175 1762 2 29 37 N 44 IPI00817902 K.LKGADPEDV.I N 39.93 0.3 472.24 2 13.391 940 1 68 76 N 44 IPI00817902 R.DGIISKDDL.R N 35.8 0.6 975.4987 1 17.46 1322 33 19 27 N 44 IPI00817902 L.ASMGQLNV.K Y 33.82 0.9 819.4036 1 17.269 1304 1 32 39 N 44 IPI00817902 F.TIIDQNR.D N 33.34 0.6 430.235 2 11.628 784 2 12 18 N 44 IPI00817902 K.GADPEDV.I N 24.63 0.2 702.2941 1 11.929 810 1 70 76 N 44 IPI00817902 L.ASMGQL.N Y 21.68 0.3 606.2914 1 14.162 1011 1 32 37 N 44 IPI00817902 K.NEELEA.M N 20.45 0.5 704.3093 1 12.299 842 1 41 46 N 44 IPI00817902 K.GADPEDVIV.S N 19.61 0.1 914.4464 1 18.304 1401 1 70 78 N 44 IPI00817902 K.EASGPI.N N 19.5 0.1 573.2878 1 10.255 669 1 50 55 N 45 IPI00488085 R.DVLASMGQL.N Y 40.15 0.5 933.4705 1 22.175 1762 2 53 61 N 45 IPI00488085 K.LKGADPEDV.I N 39.93 0.3 472.24 2 13.391 940 1 92 100 N 45 IPI00488085 R.DGIISKDDL.R N 35.8 0.6 975.4987 1 17.46 1322 33 43 51 N 45 IPI00488085 L.ASMGQLNV.K Y 33.82 0.9 819.4036 1 17.269 1304 1 56 63 N 45 IPI00488085 F.TIIDQNR.D N 33.34 0.6 430.235 2 11.628 784 2 36 42 N 45 IPI00488085 K.GADPEDV.I N 24.63 0.2 702.2941 1 11.929 810 1 94 100 N 45 IPI00488085 L.ASMGQL.N Y 21.68 0.3 606.2914 1 14.162 1011 1 56 61 N

PAGE 263

263 45 IPI00488085 K.NEELEA.M N 20.45 0.5 704.3093 1 12.299 842 1 65 70 N 45 IPI00488085 K.GADPEDVIV.S N 19.61 0.1 914.4464 1 18.304 1401 1 94 102 N 45 IPI00488085 K.EASGPI.N N 19.5 0.1 573.2878 1 10.255 669 1 74 79 N 51 IPI00919778 K.LKGADPEDV.I N 39.93 0.3 472.24 2 13.391 940 1 71 79 N 51 IPI00919778 R.DGIISKDDL.R N 35.8 0.6 975.4987 1 17.46 1322 33 22 30 N 51 IPI00919778 F.TIIDQNR.D N 33.34 0.6 430.235 2 11.628 784 2 15 21 N 51 IPI00919778 K.GADPEDV.I N 24.63 0.2 702.2941 1 11.929 810 1 73 79 N 51 IPI00919778 K.NEELEAMVK.E Y 23.68 0.8 531.76 2 16.451 1230 1 44 52 N 51 IPI00919778 K.NEELEA.M N 20.45 0.5 704.3093 1 12.299 842 1 44 49 N 51 IPI00919778 K.GADPEDVIV.S N 19.61 0.1 914.4464 1 18.304 1401 1 73 81 N 51 IPI00919778 K.EASGPI.N N 19.5 0.1 573.2878 1 10.255 669 1 53 58 N 52 IPI00496651 K.LKGADPEDV.I N 39.93 0.3 472.24 2 13.391 940 1 92 100 N 52 IPI00496651 R.DGIISKDDL.R N 35.8 0.6 975.4987 1 17.46 1322 33 43 51 N 52 IPI00496651 F.TIIDQNR.D N 33.34 0.6 430.235 2 11.628 784 2 36 42 N 52 IPI00496651 K.GADPEDV.I N 24.63 0.2 702.2941 1 11.929 810 1 94 100 N 52 IPI00496651 K.NEELEAMVK.E Y 23.68 0.8 531.76 2 16.451 1230 1 65 73 N 52 IPI00496651 K.NEELEA.M N 20.45 0.5 704.3093 1 12.299 842 1 65 70 N 52 IPI00496651 K.GADPEDVIV.S N 19.61 0.1 914.4464 1 18.304 1401 1 94 102 N 52 IPI00496651 K.EASGPI.N N 19.5 0.1 573.2878 1 10.255 669 1 74 79 N 63 IPI00488248 R.VFDKEGNGTV.M Y 46.48 0.2 533.264 2 13.383 939 1 95 104 N 63 IPI00488248 K.GTYDDYVEGL.R Y 32.78 0.5 1131.484 1 21.259 1678 2 84 93 N 63 IPI00488248 Y.DDYVEGL.R Y 24.43 0.2 810.3517 1 18.824 1449 1 87 93 N 95 IPI00516071 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 132 140 N 96 IPI00919917 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 194 202 N 97 IPI00919712 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 203 211 N 98 IPI00508395 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 192 200 N 99 IPI00482319 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 193 201 N 100 IPI00497388 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 193 201 N 101 IPI00506249 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 193 201 N 102 IPI00485952 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 222 230 N 103 IPI00817153 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 222 230 N

PAGE 264

264 104 IPI00490232 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 227 235 N 105 IPI00960817 F.LFDKPVSPL.L Y 29.66 0.2 508.2948 2 19.369 1502 1 226 234 N 109 IPI00995606 R.HVSHGPDT Y 29.46 0.1 849.3849 1 14.933 1084 1 499 506 N 109 IPI00995606 R.ESEIEELK.S Y 12.99 0 488.7453 2 14.997 1090 1 150 157 N 117 IPI00996774 A.SNSAGPGPASSEV.R Y 29.25 2.7 387.1801 3 50.407 4111 1 1074 1086 N 108 IPI00501538 L.DTVLDMIK.D Y 27.84 0.1 467.7493 2 21.323 1684 1 70 77 N 94 IPI00505794 R.EIVPGDIVEV.S Y 27.07 1.3 1069.576 1 22.785 1815 1 144 153 N 1453 IPI00799120 I.ITEGGENF.S Y 18.34 0.4 866.3893 1 14.798 1071 1 1487 1494 N 1453 IPI00799120 A.IITEGGENF.S Y 17.26 0.5 979.4726 1 18.233 1394 1 1486 1494 N 1453 IPI00799120 I.TEGGENF.S Y 8.02 0.3 753.3047 1 11.771 796 1 1488 1494 N 110 IPI00515939 K.TIDDLEDEL.Y Y 24.81 0.1 1062.484 1 21.776 1726 1 216 224 N 111 IPI00506010 K.TIDDLEDEL.Y Y 24.81 0.1 1062.484 1 21.776 1726 1 252 260 N 112 IPI00508152 K.TIDDLEDEL.Y Y 24.81 0.1 1062.484 1 21.776 1726 1 252 260 N 113 IPI00634377 K.TIDDLEDEL.Y Y 24.81 0.1 1062.484 1 21.776 1726 1 252 260 N 3679 IPI00512597 L.EQPEENL.L Y 24.71 1.6 858.3826 1 10.245 668 1 39 45 N 114 IPI00901816 I.ELDQSELKQQQL.Q Y 24.04 0.2 729.8752 2 16.355 1220 1 245 256 N 115 IPI00933229 I.ELDQSELKQQQL.Q Y 24.04 0.2 729.8752 2 16.355 1220 1 246 257 N 3685 IPI00995577 K.ESSPESLSA.L Y 20.81 0.8 906.4043 1 13.648 964 2 339 347 N 3685 IPI00995577 K.ESSPESLSAL.L Y 11.38 0.1 1019.489 1 19.406 1506 1 339 348 N 547 IPI00997640 K.EPYPDV.T Y 20.8 0 719.3246 1 38.14 3094 2 21 26 N 3684 IPI00972163 L.TTPAPAAPSDPA.E Y 20.74 1.9 548.2684 2 16.113 1197 1 125 136 N 3694 IPI01005517 V.TNVLDMA.F Y 20.34 0.4 763.3652 1 40.881 3323 14 940 946 N 3694 IPI01005517 V.TNVLDM(+15.99)A.F Y 5.63 0.3 779.3601 1 16.693 1252 1 940 946 Y

PAGE 265

265 APPENDIX L DE NOVO SEQUENCING R ESULTS FOR CHYMOTRYP SIN De novo s ummary r eport (generated by Peaks DB software)

PAGE 266

266 Peptide r esults for c hymotrypsin digested m yosin derived by De novo sequencing with PEAKS DB s oftware Scan Sequence TLC ALC (%) m/z z RT ppm local confidence (%) tag (>=80%) 1146 STLESEKF 7.6 95 470.7346 2 15.093 0.3 87 88 97 97 96 97 98 99 STLESEKF 1206 LLEKSRVTF 8.5 94 546.8241 2 15.72 0.1 98 99 98 98 97 89 83 87 96 LLEKSRVTF 1477 TGEELKNMW 8.3 92 554.2598 2 18.649 1.3 81 81 94 99 97 95 94 96 88 TGEELKNMW 1047 CRGKEDEDGWHY 11 92 747.8086 2 14.05 2.2 79 79 85 85 95 98 98 98 97 93 94 94 [259.1]GKEDEDGWHY 4027 TGEELKNMW 8 89 554.2612 2 48.09 1.2 73 73 90 98 97 94 93 95 88 [158.1]EELKNMW 1334 TSEPTVKSF 8 89 498.2565 2 17.069 1.3 95 95 95 96 79 78 86 86 86 TSEP[200.1]KSF 1093 KSANWVAQW 7.9 88 545.2769 2 14.522 0.9 71 77 90 87 97 98 94 95 81 [215.1]ANWVAQW 1085 VHQAM(+15.99)CAKSF 8.8 88 569.2626 2 14.446 0 97 97 89 98 98 97 96 85 85 34 VHQAM(+15.99)CAKS[147.1] 2291 TGEELKNMW 7.9 88 554.2614 2 27.651 1.4 70 69 88 99 98 92 91 92 88 [158.1]EELKNMW 1160 TNSDGEVAQAF 9.6 87 569.7544 2 15.243 0.3 77 73 89 86 85 90 94 97 92 98 72 [215.1]SDGEVAQA[147.1] 3013 LTLTSNPY 7 87 908.4726 1 36.312 0.3 67 67 91 93 94 92 98 92 [214.1]LTSNPY 1994 FPPDVAGRGDYQNLVY(+79.97) 13.9 87 945.9254 2 24.225 0.7 93 91 80 90 96 96 92 82 85 94 96 53 61 85 94 94 FPPDVAGRGDY[242.1]LVY(+79.97) 2423 TGEELKNMW 7.8 87 554.2609 2 29.239 0.7 64 63 83 98 97 94 94 94 87 [158.1]EELKNMW 1304 VKEASGPLNF 8.6 86 1061.5601 1 16.745 2.3 93 81 81 95 97 95 82 75 80 82 VKEASGP[113.1]NF 2555 GTEELKNMW 7.7 86 554.2608 2 30.829 0.4 70 75 90 97 93 88 85 89 79 [158.1]EELKNM[186.1] 1005 T(+79.97)SNAKEENHF 8.6 86 628.7492 2 13.577 2.5 96 96 84 92 92 95 89 70 78 57 T(+79.97)SNAKEE[398.2] 1399 FGTSEDKVGLY 9.4 85 608.2974 2 17.805 1.2 74 80 93 94 94 96 95 94 93 92 28 [147.1]GTSEDKVGL[163.1] 4219 LPTELS(+79.97)QF 6.8 85 1014.4531 1 50.497 1.2 74 72 87 95 96 80 93 80 [210.1]TELS(+79.97)QF 1764 GSPELLTTQM(+15.99)M(+15.99)RF 11.1 85 771.8678 2 21.744 0.4 30 59 75 95 98 99 98 97 89 96 87 89 89 [241.1]ELLTTQM(+15.99)M(+15.99)RF 2553 TLLTSNPY 6.8 85 908.4717 1 30.799 0.7 39 75 95 95 94 90 97 90 [214.1]LTSNPY 3018 TGEELKNMW 7.6 85 554.2608 2 36.373 0.4 76 75 91 98 95 83 81 83 78 [158.1]EELKNM[186.1] 1115 MKADKKLGKSTY 10.2 85 685.3811 2 14.757 3.1 77 87 95 97 97 97 92 92 93 82 74 28 [131.0]KADKKLGKS[264.1] 2489 ASEELKNMW 7.6 85 554.2606 2 30.036 0.1 60 67 90 97 94 90 88 92 78 [158.1]EELKNM[186.1] 1350 QTGSGLVQAGF 9.3 84 532.7733 2 17.247 2.2 66 65 94 96 96 96 98 90 97 97 28 [229.1]GSGLVQAG[147.1] 1159 SKADGEVAQW 8.4 84 545.762 2 15.236 0.3 69 77 86 80 80 86 96 91 93 79 [215.1]ADGEVAQ[186.1] 1697 SQVADLMKF 7.6 84 519.769 2 21.037 1.9 77 67 96 96 97 97 97 99 28 [215.1]VADLMK[147.1] 1661 MKPRLVLGW 7.5 84 550.3273 2 20.647 2.7 94 93 86 86 94 96 86 86 28 MKPRLVLG[186.1] 1782 FPPDVAGPSGSYKNLCY 14.2 84 907.9252 2 21.934 0.7 80 80 73 90 96 96 92 86 80 82 95 97 89 54 79 80 67 FP[97.1]DVAGPSGSYK[227.1]C[163.1]

PAGE 267

267 997 LTSNPY 5 84 694.3405 1 13.486 0.2 28 98 96 89 98 90 [113.1]TSNPY 1859 VETVKDLSMF 8.4 84 584.7997 2 22.748 0.4 73 78 91 90 69 63 73 98 98 99 [228.1]TV[356.2]SMF 1175 MVNWFGHLF 7.5 84 575.7787 2 15.412 0.1 97 97 92 98 91 92 77 77 28 MVNWFG[397.2] 1746 KNHLEELTDTMESY 11.6 83 855.3877 2 21.552 0.4 91 87 93 96 98 97 93 94 96 81 70 59 60 43 KNHLEELTDT[510.2] 1262 MKADKLKGHW 8.3 83 607.3302 2 16.309 1.7 87 87 90 90 93 91 85 84 90 28 MKADKLKGH[186.1] 2952 ASEELKNMW 7.4 83 554.261 2 35.585 0.8 63 68 91 97 96 88 81 82 72 [158.1]EELKNM[186.1] 2420 LTLTSNPY 6.6 83 908.4731 1 29.197 0.8 49 49 95 93 92 91 98 91 [214.1]LTSNPY 3126 STELF 4.1 83 596.2928 1 37.657 0.3 95 95 95 97 28 STEL[147.1] 2013 TLLAKEVASDLEDAKY 13.2 82 883.4644 2 24.431 0.2 29 29 81 92 96 96 98 98 97 96 94 94 94 95 96 28 [214.1]LAKEVASDLEDAK[163.1] 1427 AWSKLAGYEGAEAF 11.5 82 750.3632 2 18.111 1.7 85 85 75 77 84 97 97 97 97 82 76 79 89 28 AW[215.1]LAGYEG[200.1]A[147.1] 3457 STELF 4.1 82 596.2929 1 41.388 0.5 95 96 94 96 28 STEL[147.1] 2466 STELF 4.1 82 596.2916 1 29.75 1.6 94 95 95 97 28 STEL[147.1] 1211 MNKRCEALGW 8.2 82 604.2891 2 15.775 0.1 89 89 88 82 86 98 95 86 79 28 MNKRCEAL[243.1] 2683 TLLTSNPY 6.6 82 908.4724 1 32.375 0.1 29 61 95 95 95 92 97 90 [214.1]LTSNPY 1910 WVEAPAFDGGAPLKGY 13.2 82 839.418 2 23.281 0.9 28 98 98 99 94 97 97 96 82 73 80 87 83 84 86 28 [186.1]VEAPAFDG[57.0]APLKG[163.1] 1351 MEAGMVTGHKPY 9.9 82 660.8092 2 17.255 2.9 93 93 95 96 98 96 94 93 83 53 46 39 MEAGMVTGH[388.2] 971 MHNAQEEAETPHF 10.7 82 770.8287 2 13.165 1.2 91 92 89 98 89 97 99 97 94 83 76 28 28 MHNAQEEAET[381.2] 3984 STELF 4.1 82 596.2927 1 47.579 0.2 94 95 94 97 28 STEL[147.1] 2985 MAKLGHVVMF 8.2 82 566.8047 2 35.973 1.5 93 93 96 89 85 88 81 81 81 28 MAKLGHVVM[147.1] 1416 STELF 4.1 82 596.2932 1 17.991 0.9 94 95 94 97 28 STEL[147.1] 1004 M(+15.99)QGQEDENGSVHY 10.7 82 755.2993 2 13.567 0.2 61 52 87 71 96 98 96 88 82 81 76 85 85 [275.1]G[128.1]EDENGS[99.1]HY 1349 STELF 4.1 82 596.2939 1 17.241 2.1 93 94 94 97 28 STEL[147.1] 2862 STELF 4.1 82 596.2925 1 34.518 0.1 94 94 94 96 28 STEL[147.1] 1001 MVSKPAGWW 7.3 82 531.2651 2 13.541 0.7 96 96 96 94 89 85 74 72 28 MVSKPA[429.2] 2059 DGLMVPSVVW 8.2 82 1102.5612 1 24.954 1 67 80 91 96 96 96 86 86 86 28 [115.0]GLMVPSVV[186.1] 3618 WSHYM(+15.99)KF 5.7 81 507.7302 2 43.234 2.9 28 86 86 86 89 99 92 [186.1]SHYM(+15.99)KF 1249 GSLDVSYNQY 8.1 81 1145.5132 1 16.17 1.9 74 73 83 99 99 97 94 59 77 54 [144.1]LDVSY[405.2] 1248 WLLSSADLETY 8.9 81 649.319 2 16.163 0.2 29 90 74 95 95 93 94 96 97 98 28 [186.1]L[113.1]SSADLET[163.1] 3523 STELF 4.1 81 596.2927 1 42.129 0.2 93 94 93 96 28 STEL[147.1] 3791 SKVADLERW 7.3 81 552.2973 2 45.267 2.7 28 98 97 97 97 97 92 92 28 [87.0]KVADLER[186.1] 2599 STELF 4.1 81 596.2927 1 31.353 0.1 92 93 93 97 28 STEL[147.1]

PAGE 268

268 3689 ASEELKNMW 7.3 81 554.2604 2 44.066 0.2 54 61 86 97 94 84 83 87 79 [158.1]EELKNM[186.1] 1760 DMLTPF 4.9 81 723.3391 1 21.698 1.3 91 91 97 91 86 28 DMLTP[147.1] 3493 SAEELKNMW 7.3 81 554.2607 2 41.791 0.3 58 58 89 97 94 85 82 88 72 [158.1]EELKNM[186.1] 3193 STELF 4.1 81 596.2928 1 38.445 0.3 92 93 93 97 28 STEL[147.1] 2796 STELF 4 81 596.2932 1 33.748 1 93 93 93 96 28 STEL[147.1] 3323 MDLPTF 4.9 81 723.3384 1 39.978 0.3 95 95 96 84 84 28 MDLPT[147.1] 2400 STELF 4 81 596.2928 1 28.955 0.4 92 93 93 96 28 STEL[147.1] 1823 DMLTPF 4.9 81 723.3391 1 22.367 1.4 92 92 97 90 84 28 DMLTP[147.1] 2000 SM(+15.99)HRGVNKVAAF 9.7 81 666.8475 2 24.287 2.8 55 55 55 78 80 87 78 91 94 95 98 98 [527.2]GV[114.0]KVAAF 2929 STELF 4 81 596.2936 1 35.312 1.7 93 94 92 95 28 STEL[147.1] 1958 FQPSFLGMESAGLHETAY 14.5 81 992.9575 2 23.831 1.5 67 62 83 84 93 98 98 98 97 96 96 90 88 84 76 55 51 28 [275.1]PSFLGMESAGLH[464.2] 3720 STELF 4 81 596.2928 1 44.436 0.3 91 93 93 96 28 STEL[147.1] 3918 STELF 4 81 596.2927 1 46.785 0.1 92 93 92 95 28 STEL[147.1] 1062 QLPDERGY 6.4 81 489.2382 2 14.209 0.6 69 79 96 98 93 88 89 28 [241.1]PDERG[163.1] 1382 LTLTSNEF 6.4 81 924.4678 1 17.613 0.5 43 43 92 93 96 89 96 88 [214.1]LTSNEF 3258 STELF 4 81 596.2927 1 39.225 0.1 91 93 92 96 28 STEL[147.1] 1041 MQANEDENGSVHY 10.4 80 747.3012 2 13.988 0.7 59 43 54 54 97 99 97 92 94 93 85 87 87 [444.2]EDENGSVHY 1163 HANGKLSSADLETY 11.2 80 753.3659 2 15.281 1 94 93 87 79 78 85 86 65 64 77 92 92 94 28 HAN[185.1]LS[273.1]LET[163.1] 1482 SAEELQNM(+15.99)AF 8 80 1155.4976 1 18.706 1.1 60 60 84 99 99 83 74 81 82 74 [158.1]EELQ[114.0]M(+15.99)A[147.1] 2646 MVSKGGCNHLLF 9.6 80 653.3268 2 31.917 1.7 92 92 93 94 84 73 84 73 74 78 90 28 MVSKG[57.0]C[364.2]L[147.1] 1637 KMKNSYEEVDDHLPTY 12.8 80 984.9564 2 20.387 2.4 35 72 81 86 92 95 96 89 96 97 97 91 86 69 63 28 [259.1]KNSYEEVDDHL[361.2] 2333 STELF 4 80 596.2922 1 28.144 0.6 90 92 92 96 28 STEL[147.1] 3654 STELF 4 80 596.2927 1 43.657 0.2 90 92 91 96 28 STEL[147.1] 1290 AENADLF 5.6 80 779.3585 1 16.601 2 80 80 78 97 95 96 28 AE[114.0]ADL[147.1] 3917 MDLTPF 4.8 80 723.3381 1 46.776 0.1 89 90 96 89 84 28 MDLTP[147.1] 2309 QSVAM(+15.99)DRTVALW 9.6 80 696.8488 2 27.861 2.6 73 73 89 97 99 80 80 82 79 77 94 28 [215.1]VAM(+15.99)DRT[170.1]L[186.1] 4014 VSSDQGFQF 7.2 80 507.7303 2 47.938 0.8 92 93 88 78 65 81 98 91 28 VSS[243.1]GFQ[147.1] 1341 KLLDEPATGSLKRTF 12 80 838.4711 2 17.145 1.7 43 76 97 98 99 92 86 83 76 74 76 94 87 81 28 [241.2]LDEPAT[257.1]KRT[147.1] 2305 CPQACAFKF 7.2 80 1014.4526 1 27.814 1 92 92 80 83 82 88 83 85 28 CPQACAFK[147.1] 2688 TGEELKNMW 7.2 80 554.261 2 32.438 0.9 62 61 81 98 95 80 77 87 72 [158.1]EELK[114.0]M[186.1] 3876 DYGKSDGVRPVAF 10.4 80 705.8548 2 46.27 0.9 40 47 57 80 94 94 91 90 84 88 88 88 88 [335.1]KSDGVRPVAF

PAGE 269

269 1481 ASEELKNMW 7.2 80 1107.5123 1 18.697 1.4 54 58 82 96 97 85 79 88 74 [158.1]EELK[114.0]M[186.1] 2687 HVVQSDGVVGDLW 10.3 80 705.8544 2 32.429 0.3 28 97 96 86 96 89 88 87 75 69 73 78 65 [137.1]VVQSDGV[570.3] 3851 DMLTPF 4.8 80 723.3377 1 45.984 0.6 92 91 95 88 80 28 DMLTP[147.1] 847 CLVQF 4 79 305.1569 2 11.625 0.2 89 89 69 57 90 CL[227.1]F 4194 STELF 4 79 596.2928 1 50.178 0.4 89 91 91 96 28 STEL[147.1] 2994 STELF 4 79 596.2936 1 36.089 1.7 89 91 91 95 28 STEL[147.1] 3174 VFQGGDGTSF 7.9 79 507.7301 2 38.231 0.3 86 86 54 71 73 87 78 79 84 92 VF[242.1]D[158.1]SF 3455 MDLTPF 4.8 79 723.3383 1 41.37 0.2 91 92 95 87 80 28 MDLTP[147.1] 3257 DMLTPF 4.8 79 723.3384 1 39.217 0.3 91 91 95 88 81 28 DMLTP[147.1] 2621 ASEELKNMW 7.1 79 554.2608 2 31.622 0.4 55 62 86 97 93 81 79 80 74 [158.1]EELK[114.0]M[186.1] 2185 MVSKGHSGMKPF 9.5 79 653.3273 2 26.423 2.3 92 92 92 90 86 82 85 84 67 66 81 28 MVSKGHSG[259.1]P[147.1] 4050 STELF 4 79 596.2921 1 48.372 0.8 90 91 91 94 28 STEL[147.1] 1769 DMLTPF 4.8 79 723.3375 1 21.803 0.8 91 91 94 87 82 28 DMLTP[147.1] 1913 QNPDKGVLTLGNERF 11.9 79 844.4395 2 23.322 2.6 56 57 84 81 61 63 93 95 94 96 98 87 92 94 28 [242.1]PD[185.1]VLTLGNER[147.1] 2795 DMLTPF 4.7 79 723.3389 1 33.74 1 90 89 95 87 82 28 DMLTP[147.1] 2676 FGKAVDAGKKSGHY(+79.97) 11.1 79 772.868 2 32.287 1.9 73 83 94 96 96 94 89 87 84 87 86 74 28 28 [147.1]GKAVDAGKKS[437.1] 1080 TSEDKRLY 6.3 79 506.2596 2 14.394 1.4 98 98 97 95 93 91 28 28 TSEDKR[276.1] 3588 TSELF 3.9 79 596.2927 1 42.886 0.2 85 91 91 98 28 TSEL[147.1] 2611 GFQAVDANAKSNHW 11.1 79 772.8682 2 31.493 3.2 80 85 83 97 97 88 87 75 81 84 87 60 61 35 GFQAVDA[114.0]AKS[437.2] 991 HSEPDLNRF 7.1 79 372.1808 3 13.413 0.4 69 71 71 67 80 90 88 91 79 [450.2]DLNR[147.1] 2622 S(+79.97)PAKSTAVGVPVAF 11 79 705.8541 2 31.63 1.4 45 51 58 83 94 77 75 81 87 88 90 89 89 89 [335.1]KS[172.1]VGVPVAF 2927 DMLTPF 4.7 79 723.3394 1 35.296 1.8 90 88 95 87 82 28 DMLTP[147.1] 3308 MVSKNCNHLLF 8.7 79 653.3265 2 39.796 1.2 91 91 92 95 75 77 75 79 82 77 28 MVSK[468.2]L[260.2] 3719 MDLPTF 4.7 79 723.338 1 44.426 0.3 95 94 95 80 78 28 MDLP[248.1] 3786 STELF 3.9 79 596.292 1 45.207 1 91 92 88 92 28 STEL[147.1] 1397 MKPAREKEALVAAW 11 79 800.4381 2 17.786 1 94 93 72 64 73 91 62 82 85 93 87 87 84 28 MK[324.2]E[128.1]EALVAA[186.1] 1310 TPDGVKLF 6.3 79 438.7459 2 16.813 2.4 94 94 92 77 72 82 87 28 TPD[156.1]KL[147.1] 4193 ASEELKNMW 7.1 79 554.2609 2 50.166 0.6 71 74 90 97 94 71 68 71 68 [158.1]EEL[559.3] 3192 DMLTPF 4.7 79 723.3381 1 38.437 0 89 89 94 87 82 28 DMLTP[147.1] 3225 MDLTPF 4.7 79 723.3386 1 38.841 0.7 86 87 94 87 87 28 MDLTP[147.1] 2487 LTLTSNPY 6.3 79 908.471 1 30.005 1.5 39 39 92 92 93 87 97 86 [214.1]LTSNPY

PAGE 270

270 1357 YPAGM(+15.99)VTGNGPAW 10.2 79 668.806 2 17.318 4.3 95 96 94 94 93 87 78 81 75 70 62 61 28 YPAGM(+15.99)V[101.0]G[525.2] 4058 ARCACVGPVAF 8.6 79 547.2681 2 48.463 0.9 51 55 69 72 76 76 95 96 92 92 86 [603.3]GPVAF 2023 MAKLMGLKAPW 8.6 79 623.3476 2 24.548 2.7 96 95 97 96 95 84 74 73 59 60 28 MAKLMG[595.3] 3480 VHVQSDGVVGDLW 10.2 79 705.8544 2 41.648 0.3 28 99 97 81 94 94 94 94 73 66 66 71 57 [99.1]HVQSDGV[570.3] 3587 MDLTPF 4.7 78 723.3382 1 42.877 0.1 91 92 94 87 75 28 MDLT[244.1] 3983 DMLTPF 4.7 78 723.3384 1 47.57 0.3 90 89 95 87 80 28 DMLTP[147.1] 2262 KLLDPEATGSLKKEF 11.8 78 559.3145 3 27.315 1.5 80 77 82 82 93 89 89 94 76 62 61 86 70 70 55 K[113.1]LDPEAT[257.1]K[404.2] 4074 DYGKSDGVRPVAF 10.2 78 705.8542 2 48.649 0.1 36 42 52 72 94 93 93 93 89 87 87 87 88 [463.2]SDGVRPVAF 1837 MDLPTF 4.7 78 723.3384 1 22.506 0.4 91 91 95 82 81 28 MDLPT[147.1] 1099 FPGNTHNNF 7 78 524.2347 2 14.584 2 28 96 95 79 85 86 81 91 57 [147.1]PG[114.0]THNN[147.1] 2202 STELF 3.9 78 596.2929 1 26.625 0.5 86 89 89 96 28 STEL[147.1] 3216 GTEELKNMW 7 78 554.261 2 38.737 0.8 67 72 88 97 95 75 68 69 68 [158.1]EEL[559.3] 3894 SAEELKGGMW 7.8 78 554.2614 2 46.491 1.4 59 59 87 98 95 93 84 81 93 28 [158.1]EELKGGM[186.1] 1511 MAEKEELKRGFGLLVY(+79.97) 12.5 78 981.9922 2 19.024 0.7 96 95 93 93 98 98 96 94 82 76 74 44 43 43 66 52 MAEKEELKR[829.4] 1505 EASELAGNMAF 8.6 78 570.256 2 18.962 1 46 51 50 91 97 91 88 83 83 90 83 [287.1]ELAGNMAF 1825 MMHGSLKTGVDNPFKY 12.5 78 912.9423 2 22.382 0.1 94 96 94 81 83 96 98 98 96 88 88 85 42 39 32 30 MMHGSLKTGVDN[535.3] 1057 RM(+15.99)VM(+15.99)AF 4.7 78 393.6865 2 14.16 2.6 28 82 84 84 94 93 [156.1]M(+15.99)VM(+15.99)AF 2225 SAEELKNMW 7 78 554.2609 2 26.883 0.6 64 64 91 98 95 72 69 73 71 [158.1]EEL[559.3] 3785 DMLTPF 4.7 78 723.3376 1 45.198 0.8 85 87 95 87 82 28 DMLTP[147.1] 1829 ASFPPDVAGNVDYKNLCY 14 78 986.959 2 22.43 0 59 67 91 95 89 90 96 97 88 71 86 96 90 67 48 60 61 41 [158.1]FPPDVAG[114.0]VDY[621.3] 1133 VLEQEEY 5.5 78 909.419 1 14.953 1.1 81 88 86 81 87 92 28 VLEQEE[163.1] 2885 TYAQSDGVRPVAF 10.1 78 705.8546 2 34.797 0.5 37 46 55 74 90 94 91 91 85 86 86 86 85 [463.2]SDGVRPVAF 3159 DMLTPF 4.7 78 723.3383 1 38.048 0.2 85 85 90 88 87 28 DMLTP[147.1] 1361 LTLTSNPY 6.2 78 908.4727 1 17.368 0.3 32 32 92 90 90 92 98 93 [214.1]LTSNPY 2617 LTLTSNPY 6.2 78 908.472 1 31.567 0.4 28 28 94 94 94 91 97 90 [214.1]LTSNPY 1199 KFGHTKVFF 7 78 555.8082 2 15.656 0.2 96 96 96 96 91 82 82 28 28 KFGHTKV[294.1] 3083 TYAQSDGVRPVAF 10.1 78 705.8543 2 37.158 0.2 36 44 53 74 90 94 89 87 79 90 89 89 89 [463.2]SDGV[156.1]PVAF 2679 MAKLPPVVDY 7.8 78 566.8059 2 32.32 2.3 91 90 91 87 87 28 90 90 90 28 MAKLP[97.1]VVD[163.1] 3125 DMLTPF 4.7 78 723.3383 1 37.649 0.3 87 87 95 86 79 28 DMLT[244.1] 2268 LGVLDLAGF 7 78 904.5143 1 27.379 0.6 54 60 63 78 86 82 82 92 98 [382.3]DLAGF 1668 KMGLGEMSEGAELLW 11.6 78 825.899 2 20.718 2.5 35 49 58 88 87 89 95 94 91 88 88 85 89 94 28 [316.2]LGEMSEGAELL[186.1]

PAGE 271

271 3969 RDGVGASDVAF 8.5 78 547.268 2 47.394 1.3 74 64 63 69 83 81 74 77 79 94 90 [427.2]GA[301.1]AF 1260 TSNAAGGGAVLW 9.3 78 552.2792 2 16.294 2.8 89 90 86 96 96 91 76 61 69 75 68 28 TSNAAG[583.3] 4205 TYAQSDGVRPVAF 10.1 77 705.8544 2 50.32 0.3 36 44 54 68 84 94 90 90 82 90 90 90 89 [463.2]SDGVRPVAF 2282 LSFLSMF 5.4 77 844.4268 1 27.54 0.6 66 60 59 86 86 91 91 [347.2]LSMF 1813 MAKLMGKPAW 7.7 77 566.8055 2 22.259 2.9 88 90 95 93 91 89 77 61 58 28 MAKLMG[482.3] 3524 AFCHDFKF 6.2 77 1014.4521 1 42.138 2 28 96 96 96 92 89 89 28 [71.0]FCHDFK[147.1] 3947 EGSDQGFKF 7 77 507.7306 2 47.127 1.2 90 90 77 72 60 78 98 99 28 EG[387.1]FK[147.1] 1686 LKVVDTAMGCLKEDYVLW 13.9 77 1042.0338 2 20.915 0 55 55 87 97 97 97 96 94 87 70 66 58 58 79 74 91 92 28 [241.2]VVDTAMG[751.3]VL[186.1] 2352 DVLTSNLF 6.2 77 908.4723 1 28.371 0.1 28 28 93 91 91 92 98 93 [214.1]LTSNLF 3521 DMLPTF 4.6 77 723.3382 1 42.111 0.1 87 90 94 87 75 28 DMLP[248.1] 930 KRVTPEPCGGSCANSY 12.4 77 834.8765 2 12.652 0.7 77 73 65 58 85 96 86 85 93 85 61 63 77 73 85 64 [484.3]PEPCGG[375.1]S[163.1] 4268 ATSGQEDENGWHY 10 77 747.3013 2 51.125 1.7 30 42 44 84 72 91 96 93 90 93 86 86 87 [259.1]G[128.1]EDENGWHY 4047 FFGVAGMLPNY 8.5 77 608.2976 2 48.33 1.1 90 90 89 88 88 85 61 60 62 71 59 FFGVAG[618.3] 1809 MAGALGGRRPF 8.5 77 566.806 2 22.214 0.2 96 96 97 97 93 92 92 95 28 28 28 MAGALGGR[400.2] 2580 MVSKSGHGKMPF 9.2 77 653.3275 2 31.126 2.6 92 92 92 90 72 63 78 86 72 71 82 28 MVSK[281.1]G[259.1]P[147.1] 3852 STELF 3.9 77 596.2922 1 45.993 0.7 84 88 87 95 28 STEL[147.1] 2001 DMLTPF 4.6 77 723.3382 1 24.295 0.1 86 86 94 85 79 28 DMLT[244.1] 3349 HVVQSDGVVGDLW 10 77 705.856 2 40.25 2.6 28 98 97 85 93 96 96 92 56 48 59 79 66 [137.1]VVQSDGV[570.3] 1479 SAEELKNM(+15.99)W 6.9 77 562.2572 2 18.667 1.4 58 58 87 98 97 67 74 67 81 [158.1]EEL[389.2]W 2515 GFFGNAGGGRLY 9.2 77 608.2987 2 30.334 0.3 91 92 92 82 73 81 71 64 80 80 81 28 GFFG[114.0]A[114.0]GRL[163.1] 1081 KALGFPDTY 6.9 77 1011.5125 1 14.4 2 65 72 89 93 94 86 80 78 28 [199.1]LGFPD[264.1] 1548 STEDRVATAKW 8.4 77 632.3204 2 19.434 0.6 89 91 91 87 79 77 83 82 69 63 28 STED[255.2]AT[385.2] 1740 LADLPVLPGKPY 9.2 77 641.8737 2 21.491 0.2 72 74 88 86 85 28 98 92 87 70 74 60 [184.1]DLP[99.1]LPG[388.2] 2886 ASEELKNMW 6.9 77 554.261 2 34.805 0.9 53 60 84 97 91 75 72 78 74 [158.1]EEL[559.3] 2820 SAEELKNMW 6.9 77 554.261 2 34.036 0.8 58 58 88 97 92 78 75 77 63 [158.1]EEL[559.3] 3017 TYAQSDGVRPVAF 10 77 705.8544 2 36.363 0.3 38 46 55 73 88 92 86 85 77 88 88 88 86 [463.2]SDGV[156.1]PVAF 1844 QSVAFLVGVGPW 9.2 77 630.3423 2 22.578 0.7 73 73 94 98 99 98 92 83 74 73 28 28 [215.1]VAFLVG[439.2] 3182 QSVAFVLPGW 7.6 76 552.2978 2 38.318 0 74 74 88 86 86 83 88 75 77 28 [215.1]VAFVL[340.2] 4259 KLLDPEATGSLKKEF 11.5 76 559.314 3 51.017 0.7 32 72 91 90 91 91 90 93 94 83 83 90 49 49 40 [241.2]LDPEATGSLK[404.2] 4131 STELF 3.8 76 596.2925 1 49.361 0.1 84 87 87 94 28 STEL[147.1] 3012 DMLPTF 4.6 76 723.3386 1 36.303 0.6 85 87 92 86 76 28 DMLP[248.1]

PAGE 272

272 980 MLPAPHATF 6.9 76 492.7536 2 13.274 2.9 90 89 85 85 28 91 91 94 28 MLPA[97.1]HAT[147.1] 3888 T(+79.97)LGVWGLRAY 7.6 76 608.2985 2 46.417 2.1 82 85 95 96 94 90 71 62 56 28 T(+79.97)LGVWG[503.3] 2709 DMLTPF 4.6 76 723.3387 1 32.684 0.8 88 89 93 83 74 28 DMLT[244.1] 2576 MDLTPF 4.6 76 723.3381 1 31.076 0.1 80 79 91 88 88 28 M[115.0]LTP[147.1] 2021 HVVAAGGKALVDVW 10.7 76 711.3993 2 24.531 0.9 28 74 76 77 90 72 67 85 90 96 94 92 92 28 [406.2]A[114.0]KALVDV[186.1] 1839 WTANKKVAAFGW 9.1 76 689.8669 2 22.521 0.1 65 64 83 88 93 97 80 80 70 77 84 28 [287.1]ANKKVA[218.1]G[186.1] 1187 KRPNAKEEAGGDCMLY 12.2 76 891.4207 2 15.528 1.8 54 74 72 68 90 94 98 96 91 87 80 61 54 55 79 58 [495.3]AKEEAGG[625.2] 4321 DRVASDNVAF 7.6 76 547.2673 2 51.785 0.1 85 85 70 58 62 83 70 78 87 79 DR[257.1]D[213.1]A[147.1] 3942 YDKGSDGVRPVAF 9.9 76 705.8538 2 47.064 0.5 30 35 33 41 93 95 94 93 89 98 96 96 93 [463.2]SDGVRPVAF 2861 MDLTPF 4.6 76 723.3382 1 34.511 0.1 88 89 92 82 75 28 MDLT[244.1] 2322 SGPSDDDMAGGKRLNF 12.2 76 833.8784 2 28.01 0.3 29 65 71 66 48 94 98 93 92 87 89 93 78 65 73 67 [443.2]DDMAGGK[530.3] 1710 VSSNADFQF 6.8 76 507.7305 2 21.175 1.1 92 93 70 38 39 69 87 95 95 VS[387.1]FQF 3551 VSSANDFQF 6.8 76 507.7303 2 42.467 0.7 89 90 71 67 60 86 98 91 28 VS[272.1]DFQ[147.1] 1669 YPDVGGHQAHMLPY 10.6 76 792.8652 2 20.726 2 69 66 61 75 86 92 95 83 78 71 79 83 91 28 [474.2]GGHQ[339.1]LP[163.1] 1337 VVRDLLATGSLKQEF 11.4 76 559.3171 3 17.109 0.5 28 66 66 76 89 93 94 95 92 82 81 61 50 84 73 [469.3]LLATGSL[256.2]E[147.1] 2226 TYQASDGVRPVAF 9.9 76 705.8541 2 26.894 0.2 37 37 39 59 80 90 89 88 86 97 94 94 90 [463.2]SDGVRPVAF 2118 KYEDSAGVGVAMYFYF 12.1 76 923.9186 2 25.638 3 85 84 78 71 86 85 86 64 68 75 86 75 77 50 67 67 KY[244.1]SAG[255.2]A[751.3] 2594 LTENVSFGHLF 8.3 76 632.3213 2 31.293 1.1 81 85 92 79 84 86 88 80 61 63 28 LTE[114.0]VSFG[397.2] 2951 HVVQSDGVGVDLW 9.8 76 705.8544 2 35.576 0.3 28 97 96 84 93 94 95 92 65 61 66 61 44 [137.1]VVQSDGV[570.3] 4181 DMLTPF 4.5 76 723.3382 1 50.014 0.1 86 86 92 83 75 28 DMLT[244.1] 3073 GSPSDDDMANKRLNF 11.3 76 833.8777 2 37.034 0.4 30 68 86 80 52 93 99 94 92 87 92 72 60 64 60 [144.1]PS[115.0]DDMANK[530.3] 1200 NKLKSRVSF 6.8 76 539.8225 2 15.663 1 37 37 40 96 95 96 92 92 92 [355.2]KSRVSF 1094 NTAGGWVAQAF 8.3 76 561.2719 2 14.528 0.7 42 42 63 57 58 94 98 98 94 99 79 [400.2]WVAQA[147.1] 887 MKKKAEATHDFVF 9.8 76 776.4032 2 12.125 0.2 78 78 95 97 97 96 94 85 79 52 54 42 28 [259.1]KKAEAT[645.3] 3611 KSTM(+15.99)SDGVRPVAF 9.8 75 705.8542 2 43.156 2.4 42 39 40 28 97 94 85 84 77 98 97 97 95 [463.2]SDGV[156.1]PVAF 2289 LTLTSNPY 6 75 908.4736 1 27.62 1.4 36 36 89 80 81 87 98 93 [214.1]LTSNPY 3079 MDLTPF 4.5 75 723.3384 1 37.109 0.4 79 80 91 85 86 28 [131.0]DLTP[147.1] 2993 MDLPTF 4.5 75 723.3395 1 36.082 1.9 89 89 92 76 74 28 MDL[345.2] 3325 STELF 3.8 75 596.2925 1 39.995 0.1 81 85 85 94 28 STEL[147.1] 2064 DMLTPF 4.5 75 723.338 1 25.017 0.3 87 87 89 83 74 28 DMLT[244.1] 4049 MDLPTF 4.5 75 723.3375 1 48.362 0.9 89 89 92 77 73 28 MDL[345.2]

PAGE 273

273 3284 TYAQSDGVRPVAF 9.8 75 705.8543 2 39.522 0.2 40 43 56 43 93 95 94 94 90 77 80 80 88 [463.2]SDGVR[97.1]VAF 3677 YDGKSDGVRPVAF 9.8 75 705.8541 2 43.931 0.2 36 36 38 40 95 95 92 92 88 89 89 89 91 [463.2]SDGVRPVAF 2462 LTENVSFGHLF 8.3 75 632.3205 2 29.697 2.3 68 80 90 85 90 92 95 84 53 55 28 [113.1]TENVSFG[397.2] 3115 NTVAPLGWVF 7.5 75 552.2977 2 37.526 0.1 75 82 92 94 83 75 85 76 28 55 [114.0]TVAP[113.1]G[432.2] 2946 DMLTPF 4.5 75 723.3385 1 35.513 0.5 75 78 84 91 91 28 [246.1]LTP[147.1] 2424 TYAQSDGVRPVAF 9.7 75 705.8546 2 29.247 0.6 47 46 53 44 87 92 92 91 89 80 81 81 86 [463.2]SDGVRPVAF 790 VNTM(+15.99)DSETLKF 8.2 75 650.8079 2 10.889 0.2 59 57 74 89 92 85 84 81 81 88 28 [314.2]M(+15.99)DSETLK[147.1] 2214 MDLLTPF 5.2 75 836.4216 1 26.758 0.7 75 62 71 96 94 94 28 [359.2]LTP[147.1] 1905 MDLPTF 4.5 75 723.3383 1 23.224 0.2 87 87 92 77 75 28 MDL[345.2] 1677 FGTSESVGVGLF 9 75 600.3017 2 20.81 1.6 62 69 86 96 96 82 65 66 72 84 86 28 [204.1]TSES[255.2]GL[147.1] 1812 MAQLGGRRPF 7.5 75 1132.603 1 22.25 1.3 97 96 88 95 94 95 94 28 28 28 MAQLGGR[400.2] 1352 TSELY 3.7 75 612.2889 1 17.264 2.4 87 85 85 86 28 TSEL[163.1] 1617 YAS(+79.97)VPSAKHAGAF 9.7 75 693.3167 2 20.17 0.9 89 90 74 95 73 73 75 77 69 70 70 82 28 YA[167.0]V[648.3]A[147.1] 1919 WM(+15.99)DLEKESMKPAGPF 11.2 75 891.4188 2 23.385 3.7 28 95 94 96 91 90 93 92 92 91 60 43 41 81 28 [186.1]M(+15.99)DLEKESMK[225.1]P[147.1] 1087 SVSDNAF 5.2 75 739.326 1 14.46 0.5 89 91 86 80 72 28 73 SVSD[332.1] 1196 LLEKGKMLF 6.7 75 360.2149 3 15.618 2.5 96 97 90 90 94 57 52 63 28 LLEKG[519.3] 2382 FGTSEVSGVGLY 9 75 608.2991 2 28.732 1.5 73 75 88 91 92 74 67 65 70 84 84 28 [204.1]TSE[342.2]GL[163.1] 3117 ASM(+15.99)PDPVAGRGDYKNLVY(+79.97) 13.5 75 1024.9585 2 37.548 2.5 49 53 82 81 36 92 96 93 77 63 75 95 96 59 47 70 93 80 [158.1]M(+15.99)P[115.0]PVA[270.1]DY[355.2]VY(+79.97) 1373 QMGQEDENGSVHYEAF 12 75 920.8777 2 17.508 2.1 44 45 75 69 95 98 90 86 80 83 86 94 83 66 66 28 [444.2]EDENGSVHY[347.1] 1403 VPNGVATAAPGDY 9.7 75 616.3007 2 17.854 1.1 90 89 87 97 92 82 72 68 78 64 62 56 28 VPNGVA[675.3] 2330 LTENVSFGLHF 8.2 75 632.3206 2 28.103 2.2 83 87 94 75 73 72 77 89 72 66 28 LTE[447.2]G[397.2] 2529 LTENVSFGLHF 8.2 75 632.3201 2 30.502 2.9 74 77 89 87 90 86 85 78 62 61 28 [214.1]ENVSF[454.2] 3000 M(+15.99)GTPLVVAGNVDYQNLCY 13.4 75 986.9603 2 36.16 0.4 31 44 58 93 95 98 97 95 71 55 80 96 94 44 51 66 89 78 [305.1]PLVVA[171.1]VDY[355.2]C[163.1] 1879 SLAAGLW 5.2 75 717.3922 1 22.956 1.1 28 85 94 95 94 94 28 [87.0]LAAGL[186.1] 2976 GESAATGFQF 7.5 75 507.7302 2 35.872 0.5 87 82 60 58 68 79 91 96 91 28 GE[330.2]GFQ[147.1] 1956 MKSVLAEQEELKVGGFLRLY(+79.97) 14.9 75 1195.6127 2 23.81 0.4 39 34 34 95 97 97 97 88 98 98 96 91 80 79 82 88 85 33 37 33 [346.2]VLAEQEELKV[57.0]GFL[512.2] 1992 T(+79.97)YGPPPKLKVNLSFVY 11.9 75 951.9934 2 24.208 1.6 72 89 77 98 97 81 62 66 48 48 59 78 94 94 94 28 [181.0]Y[57.0]PPP[695.5]SFV[163.1] 2319 FEPGLVQAGF 7.5 75 532.7728 2 27.967 2.5 73 70 70 84 87 88 70 84 86 28 [373.2]GLV[128.1]AG[147.1] 2721 TGFT(+79.97)KVAGNVDYKCVKY 12.7 74 986.9631 2 32.826 2.4 73 78 92 91 81 80 97 86 70 85 94 95 66 48 43 51 28 [158.1]FT(+79.97)KVAG[114.0]VDY[621.3] 1711 MVANKHSF 6 74 933.4603 1 21.182 0.8 94 87 80 63 65 67 67 67 MVA[613.3] 1484 MLTPHCLLPVALYF 10.4 74 809.432 2 18.725 2.2 85 54 52 64 97 97 94 90 90 82 78 65 60 28 M[311.2]HCLLPV[494.3]

PAGE 274

274 1388 LVDDNVGFLGW 8.2 74 617.808 2 17.679 1.3 28 28 98 96 87 96 96 93 83 79 28 [212.2]DDNVGFL[243.1] 1386 MSLKADKLKGKTSY 10.4 74 785.4385 2 17.66 1.9 38 37 44 80 94 96 96 98 96 96 91 79 63 28 [331.2]KADKLKGK[351.1] 2642 DMLTPF 4.5 74 723.3381 1 31.869 0.1 74 77 87 88 90 28 [246.1]LTP[147.1] 1902 MMNQFANALW 7.4 74 613.2798 2 23.201 2.5 94 92 87 80 79 94 57 61 66 28 MMNQ[147.1]A[484.2] 3569 DMLTPF 4.5 74 723.3378 1 42.673 0.5 85 86 92 81 72 28 DMLT[244.1] 2267 VFTLTMF 5.2 74 858.4438 1 27.372 0.9 70 70 66 92 95 96 28 [347.2]LTM[147.1] 3393 ADSGKDFQF 6.7 74 1014.454 1 40.694 1.3 90 89 81 70 59 88 46 78 65 ADS[185.1]D[422.2] 1491 EAAEEM(+15.99)ASY 6.7 74 1016.3898 1 18.803 2 81 79 73 74 71 73 71 75 67 E[868.3] 1784 QLQNLTTQM(+15.99)M(+15.99)VGF 9.7 74 771.8685 2 21.952 0.4 58 63 67 81 88 98 97 87 78 72 68 73 28 [369.2]NLTTQ[597.2] 2208 LLGLNSADLAKPF 9.7 74 679.8884 2 26.697 1.3 96 95 96 96 93 94 87 85 57 45 35 50 28 LLGLNSAD[556.3] 1986 DEPDVAGPCKYKCVKY 11.9 74 907.9254 2 24.144 0.9 30 63 72 87 96 97 92 74 70 85 94 74 78 69 70 28 [341.1]DVAG[200.1]KY[621.3] 2439 MEAGMPFALPAW 8.9 74 660.81 2 29.422 0.9 79 79 86 90 96 98 28 78 73 75 75 28 [260.1]AGMP[685.4] 2909 SVDSKSGGMF 7.4 74 507.7302 2 35.086 2.9 84 85 82 84 84 64 66 75 85 28 SVDSK[201.1]M[147.1] 4172 NPAPLPAYGGVPTMF 11.1 74 511.2579 3 49.886 1.5 56 49 50 72 73 76 76 72 74 81 86 87 87 90 75 [880.4]GVPTM[147.1] 3955 T(+79.97)LGVAPARGFF 8.1 74 608.2986 2 47.22 1.8 97 95 94 87 86 59 47 54 73 86 28 T(+79.97)LGVA[381.2]F[147.1] 3398 RSAADLARPF 7.4 74 552.3019 2 40.751 0.8 46 61 77 97 97 97 85 79 68 28 [314.2]ADLA[400.2] 3285 SAEELKGGMW 7.4 74 554.2604 2 39.532 0.2 53 53 83 96 94 91 79 73 85 28 [158.1]EELK[114.0]M[186.1] 1400 WWPPCDLLDAVQF 9.6 74 530.5875 3 17.813 1.6 28 51 51 51 91 90 95 93 90 87 80 69 80 [566.3]CDLLDAV[128.1]F 2454 LQSDDDMANQRLNF 10.4 74 833.878 2 29.604 0.1 56 53 74 90 97 99 97 93 83 77 60 47 50 53 [328.2]DDDMAN[658.4] 3392 QNGLGGSM(+15.99)LLW 8.1 74 596.2944 2 40.683 1 59 57 61 65 75 80 94 96 96 97 28 [469.2]GSM(+15.99)LL[186.1] 2259 GSPSDDDMANKRLNF 11.1 74 833.8789 2 27.275 1 29 46 60 69 64 95 98 96 92 86 94 77 63 68 64 [443.2]DDMANK[530.3] 3414 HVVQSDGVRDLW 8.9 74 705.8587 2 40.94 1.6 28 96 94 70 87 92 92 87 74 57 58 46 [137.1]VV[128.1]SDGV[570.3] 2819 YTAQSDGVRPVAF 9.6 74 705.8547 2 34.027 0.7 37 42 50 55 87 92 85 84 72 87 88 88 88 [463.2]SDGV[156.1]PVAF 1077 HDVSVTQVPHSY 8.9 74 456.8909 3 14.355 2.8 28 55 59 59 70 71 70 86 95 96 96 96 [766.4]VPHSY 2579 DASDQGFKF 6.6 74 507.7304 2 31.118 0.8 87 89 67 62 55 79 96 97 28 DA[387.1]FK[147.1] 1639 CWAVKNDGGPTDLW 10.3 74 781.3609 2 20.407 2.7 28 95 95 95 92 82 94 93 70 55 57 63 65 41 [103.0]WAVKNDG[669.3] 1116 MLPPTGRSW 6.6 74 522.7696 2 14.764 2.3 73 71 84 83 81 85 78 77 28 [244.1]PPTG[429.2] 1613 SADKVEDFQEAF 8.8 74 693.3167 2 20.133 3.2 39 44 62 85 95 99 98 98 68 69 95 28 [273.1]KVEDF[257.1]A[147.1] 2219 VTFLTMEGKLF 8.1 74 643.3469 2 26.812 0.4 94 95 94 95 95 96 59 51 47 52 28 VTFLTM[574.3] 2537 TGDQVEDFKEAF 8.8 74 693.3151 2 30.608 0.9 45 51 63 56 92 97 97 97 89 71 93 28 [401.2]VEDFK[129.0]A[147.1] 2593 KLHKAKNF 5.9 74 493.3015 2 31.282 1.7 61 68 72 86 88 70 85 56 [378.2]KA[128.1]N[147.1]

PAGE 275

275 2357 SAEELKNMW 6.6 74 554.2612 2 28.434 1.1 63 63 90 99 97 67 60 61 59 [158.1]EEL[559.3] 2735 ASDKVEDM(+15.99)VTGAF 9.6 74 693.3148 2 33.013 2 37 43 58 70 95 98 99 83 58 55 67 90 98 [401.2]VEDM(+15.99)[257.1]AF 3545 VHVQSDGVYLFF 8.8 74 705.8542 2 42.396 2.9 28 99 98 85 93 96 96 94 87 46 28 28 [99.1]HVQSDGVY[407.2] 2556 HVVQSDGVGVDLW 9.6 74 705.8546 2 30.838 0.5 28 97 96 76 91 91 91 91 66 62 60 57 44 [137.1]VV[128.1]SDGV[570.3] 2881 MDLTPF 4.4 74 723.3385 1 34.744 0.5 78 77 86 86 84 28 [246.1]LTP[147.1] 2798 QMGKELMNGSVHY 9.6 74 747.3474 2 33.765 0.1 67 76 69 67 81 55 54 69 88 88 80 78 78 [444.2]E[358.2]GSV[300.1] 3623 TGEELKGGMW 7.3 73 554.2609 2 43.293 0.6 59 56 70 99 98 94 75 63 86 28 [287.1]ELK[114.0]M[186.1] 1067 AKEQEQEY 5.9 73 1024.4591 1 14.264 1 65 55 77 70 96 64 89 67 [456.2]E[128.1]E[163.1] 1261 DRVGDSQVAF 7.3 73 1093.5271 1 16.301 0.2 96 94 92 85 78 77 48 57 60 42 DRVG[647.3] 3309 DMLTPF 4.4 73 723.3377 1 39.806 0.6 65 77 80 94 92 28 [246.1]LTP[147.1] 1332 VNLVSPSGGGEY 8.8 73 589.7883 2 17.053 0.4 65 61 95 98 88 88 77 50 55 60 80 56 [213.1]LVSP[258.1]E[163.1] 3881 YLGHCM(+15.99)KF 5.9 73 507.7296 2 46.334 1.5 47 52 61 67 97 86 86 84 [470.2]CM(+15.99)KF 2982 SQVLWLPNF 6.6 73 552.2975 2 35.941 0.4 69 64 89 90 49 67 76 76 74 [215.1]VL[657.3] 3653 MDLPTF 4.4 73 723.3384 1 43.647 0.3 87 87 90 73 71 28 MDL[345.2] 1045 TTQS(+79.97)PWF 5.1 73 473.6894 2 14.035 0.9 92 92 81 94 94 28 28 TTQS(+79.97)P[333.1] 2501 AHCFDFKF 5.9 73 1014.4527 1 30.178 2.5 28 91 91 91 85 83 83 28 [71.0]HCFDFK[147.1] 2250 CTTSVSVSVGLY 8.8 73 608.2987 2 27.178 1.9 47 47 82 89 82 78 78 84 88 85 84 28 [204.1]TSV[186.1]SVGL[163.1] 3429 SAEELKNMW 6.6 73 554.2617 2 41.086 2 63 63 89 96 94 63 58 61 67 [158.1]EEL[559.3] 1793 MAKAADRRPF 7.3 73 581.8101 2 22.052 1.7 93 91 93 97 91 87 90 28 28 28 MAKAADR[400.2] 2111 MMLSLEELPKW 8 73 688.8501 2 25.558 1.7 94 82 50 50 95 99 28 96 87 88 28 MM[200.1]LE[129.0]LPK[186.1] 3042 MVSKNHSMKPF 8 73 653.3271 2 36.661 2.1 94 94 94 93 63 67 60 60 61 85 28 MVSK[597.3]P[147.1] 1885 MAVGAALLPNF 8 73 1103.5896 1 23.019 2 92 83 59 55 72 89 93 82 59 60 53 MA[227.1]ALL[358.2] 2845 TESKPGAPAGFPF 9.5 73 653.3268 2 34.317 0.8 77 87 85 92 79 73 80 89 77 74 71 28 28 [101.0]ESK[154.1]AP[519.2] 2381 MVSQNLALGEPF 8.7 73 653.3281 2 28.723 1.5 94 93 93 78 59 66 69 69 66 70 84 28 MVS[725.4]P[147.1] 1104 MMGKVKRY 5.8 73 1012.5418 1 14.637 1.2 98 93 70 55 67 83 85 28 MM[284.2]KR[163.1] 3054 T(+79.97)LRAVVSGFW 7.3 73 608.2993 2 36.804 0.7 85 81 61 77 78 79 76 76 81 28 T(+79.97)L[569.3]F[186.1] 3810 TYAQSDGVRPVAF 9.4 73 705.8557 2 45.484 2.2 32 36 40 43 90 92 92 93 90 79 81 81 88 [463.2]SDGVR[97.1]VAF 1561 FLGGAGWCGPPLLF 10.2 73 717.8665 2 19.569 1.4 89 86 89 72 64 63 64 74 83 86 71 67 74 28 FLG[474.2]GP[470.3] 3669 RAEAGASDVAF 8 73 547.2665 2 43.828 1.3 40 47 54 74 77 74 74 80 88 93 92 [642.3]DVAF 2033 ASFPPDVAGGGVDYKNLCY 13.8 73 986.9601 2 24.66 1.1 31 41 53 93 86 86 95 96 92 76 77 89 96 96 63 44 57 58 41 [305.1]PPDVAG[114.0]VDY[621.3] 1776 ADSSVGGFQF 7.3 73 507.7304 2 21.874 0.9 81 82 82 59 55 53 93 97 91 28 ADS[243.1]GFQ[147.1]

PAGE 276

276 2406 WEAVGGAANWVAQW 10.1 72 772.8675 2 29.029 0.2 84 78 61 60 77 64 69 88 61 75 89 74 77 50 W[484.2]A[300.1]V[385.2] 2100 QLLFLFEKKLSGTALLQHW 13.8 72 1136.6438 2 25.433 2.1 34 34 38 54 90 77 89 90 90 76 75 71 77 87 92 94 70 77 52 [501.3]L[147.1]EKK[358.2]ALL[451.2] 2163 FTSQSDGVRPVAF 9.4 72 705.853 2 26.16 1.6 36 37 33 34 88 91 93 92 89 83 84 84 90 [463.2]SDGVRPVAF 2051 MVAKNFPVRPW 8 72 672.8649 2 24.869 1.5 96 82 77 85 87 92 92 91 32 28 28 MV[71.0]KNFPV[439.2] 1095 VDVFPLPW 5.8 72 486.7649 2 14.537 3.8 99 99 98 98 97 28 28 28 VDVFP[396.2] 3570 VHEQCNSSVHVF 8.7 72 693.3148 2 42.682 3.1 92 92 78 71 91 76 85 96 98 28 28 28 VH[257.1]C[114.0]SSV[383.2] 2223 VLELTNLLGSKSAF 10.1 72 746.4254 2 26.851 1.2 49 48 44 48 48 68 82 95 87 85 87 88 92 85 [669.4]LLGSKSAF 2325 KVAKCGCWF 6.5 72 521.2554 2 28.043 2.5 47 41 52 66 90 95 86 86 86 [426.3]CGCWF 1176 EAFVGAHLF 6.5 72 495.7581 2 15.418 4.6 28 99 99 97 89 87 91 28 28 [129.0]AFVGAH[260.2] 1849 VVYPEENSSVTMVPRT(+79.97)Y 12.3 72 1025.9602 2 22.632 3 60 69 66 73 76 92 76 78 73 83 93 95 73 68 49 47 50 [587.3]E[288.1]VTM[696.3] 2115 LGYGGPSVSSGF 8.7 72 564.2729 2 25.597 1.5 51 49 54 66 65 64 87 86 86 84 84 84 [544.3]SVSSGF 1275 GQHFAPLLY 6.5 72 523.2761 2 16.437 1.5 79 51 65 45 93 92 93 97 28 [469.2]APLL[163.1] 3900 MVSMGRDHLLF 7.9 72 653.3268 2 46.567 1.7 87 87 87 57 55 55 87 67 87 92 28 MVS[344.2]D[137.1]LL[147.1] 2832 VHEQESGALQEAWAFY 11.5 72 932.9264 2 34.172 2.4 86 86 86 88 96 81 60 57 80 79 92 84 76 41 28 28 VHEQES[128.1]L[128.1]EA[567.2] 1968 KAVVNCVAGGRDYCKCTW 13 72 986.9612 2 23.944 1.9 51 44 51 50 51 92 95 96 85 73 76 96 81 85 59 69 79 55 [511.3]CVAG[213.1]DYC[518.2] 4128 GTEELKNMW 6.5 72 554.2605 2 49.327 0.1 52 61 73 93 83 76 74 75 58 [287.1]EL[559.3] 2358 HVVQSDGGTPGPLF 10.1 72 705.8547 2 28.442 0.8 28 97 96 81 93 94 93 87 77 68 60 54 44 28 [137.1]VVQSDGG[612.3] 3954 FVAVPKAFSGCTPEPLKEY 13.7 72 695.0236 3 47.209 0.3 59 64 67 79 68 61 67 67 60 63 84 92 89 70 64 70 83 84 65 [1003.5]CTP[339.2]KE[163.1] 3992 VSNGTDFQF 6.5 72 1014.4529 1 47.668 0.3 28 87 79 85 85 93 86 71 28 [99.1]S[114.0]GTDF[275.1] 2138 NKLADLWVW 6.5 72 572.8108 2 25.874 0.5 85 85 95 97 97 98 28 28 28 NKLADL[471.2] 1046 WKLTRGGAKAF 7.9 72 617.8545 2 14.042 3.1 66 94 85 97 96 83 46 46 57 86 28 [186.1]KLTRG[256.2]A[147.1] 1514 TGEELKNM(+15.99)W 6.5 72 1123.5092 1 19.052 0.3 58 58 75 98 97 59 67 57 74 [287.1]EL[575.2] 1532 GEAALLY 5 72 736.3893 1 19.255 2.4 54 53 77 95 95 98 28 [257.1]ALL[163.1] 4256 TLENGEFPLPF 7.9 72 632.3199 2 50.973 5.7 79 80 89 81 86 88 99 99 28 28 28 [101.0]LENGEFP[357.2] 1178 LTEGGGEF 5.7 72 809.3684 1 15.431 1.1 88 86 83 72 65 69 78 28 LTE[447.2] 4145 DASDQGFKF 6.5 72 507.7301 2 49.544 0.2 88 89 72 52 47 67 98 99 28 DA[387.1]FK[147.1] 2511 DMLTPF 4.3 72 723.338 1 30.284 0.3 73 76 88 83 79 28 [246.1]LT[244.1] 1603 VRVVAPVGEKLNF 9.3 72 476.6172 3 20.023 0.1 28 28 56 72 78 98 99 95 91 67 61 78 75 [524.3]PVGE[502.3] 2315 MVSQAGPLKDPY 8.6 72 653.3275 2 27.929 2.4 91 89 89 81 79 59 67 69 60 59 82 28 MVSQ[581.3]P[163.1] 843 YGKAVSYNGF 7.2 72 553.2679 2 11.568 2.4 85 87 95 89 86 78 50 49 41 52 YGKAV[568.2] 1309 YSNAVT(+79.97)GVWVAQAY 10 72 804.8563 2 16.804 2.5 56 60 58 88 84 62 59 71 85 86 85 64 75 62 [364.1]AV[337.1]WVA[362.2]

PAGE 277

277 1103 HGTVKFF 5 72 418.2266 2 14.63 0.1 88 91 95 86 83 28 28 HGTVK[294.1] 1065 EPATGSLKKEF 7.9 72 603.8219 2 14.233 0.1 28 97 96 94 62 54 60 93 64 64 70 [129.0]PAT[257.1]K[404.2] 2876 LQSDDDMAGGQRLNF 10.7 72 833.8788 2 34.681 0.8 44 43 44 67 94 97 93 90 65 69 72 80 66 74 68 [443.2]DDMA[242.1]R[374.2] 1135 SKVAGGNTW 6.4 72 460.2363 2 14.97 2.3 28 96 95 95 92 66 60 79 28 [87.0]KVAG[458.2] 3721 GESNADFKF 6.4 72 1014.4521 1 44.444 0.5 87 86 83 54 54 72 87 88 28 GES[300.1]FK[147.1] 3356 TGEEKARMW 6.4 72 554.2646 2 40.321 2.9 70 70 90 88 75 68 65 84 28 [158.1]EE[355.2]M[186.1] 1189 VVKLLEHNYF 7.2 72 631.3504 2 15.543 0.2 28 74 65 73 87 94 96 73 73 47 [439.3]LEH[424.2] 3749 WMAQGFQF 5.7 72 507.7302 2 44.772 2.8 64 56 55 61 72 72 89 99 [720.3]QF 1969 QLVDYNVTGW 7.2 72 1194.5815 1 23.954 2 56 68 83 95 87 59 68 77 90 28 [241.1]VDY[314.2]G[186.1] 2469 ECYPY(+79.97) 3.6 71 377.6135 2 29.78 5.9 82 79 79 88 28 E[266.1]P[243.0] 2342 WQGNGAGANEGVAKW 10.7 71 772.8669 2 28.248 1.6 76 57 58 58 73 57 71 89 86 74 74 84 86 93 28 [670.3]AN[186.1]VAK[186.1] 1478 MQM(+15.99)NSNPY 5.7 71 1000.3917 1 18.658 5.4 91 87 78 66 72 59 69 46 MQ[722.3] 2447 MVSKPALGENPY 8.6 71 653.3273 2 29.527 2.6 91 91 91 86 59 47 58 72 63 53 83 57 MVSK[581.3]P[163.1] 1898 MAARKTAALGNAW 9.3 71 680.8619 2 23.156 1 79 79 92 96 81 62 68 92 89 58 40 32 53 [202.1]ARK[172.1]AL[428.2] 1056 NMEAEDLKKF 7.1 71 612.8013 2 14.153 1.9 69 75 94 96 96 75 72 78 28 28 [245.1]EAE[631.4] 937 WWWASWLGM(+15.99)EYW 8.6 71 572.9152 3 12.733 0.4 28 28 90 84 84 67 71 85 90 82 70 70 [372.2]WAS[299.2]GM(+15.99)E[349.1] 4008 VAFDRVGDSQVAF 9.3 71 705.8543 2 47.864 0.2 34 34 45 76 73 74 86 79 77 60 92 95 95 [687.4]G[330.1]VAF 2804 MDLTPF 4.3 71 723.3387 1 33.838 0.8 76 75 88 81 76 28 [246.1]LT[244.1] 3263 SADQVEDFKEAF 8.6 71 693.3143 2 39.282 0.3 37 43 57 58 93 98 96 96 85 66 90 28 [401.2]VEDFK[129.0]A[147.1] 965 S(+79.97)YNVT(+79.97)CDM(+15.99)DF 7.1 71 457.4615 3 13.087 1.3 28 86 62 68 67 80 96 74 74 74 [167.0]Y[394.1]CD[409.1] 2270 ALLTYMF 5 71 858.4438 1 27.399 0.9 29 72 82 67 64 87 93 [184.1]L[264.1]MF 3294 ADSNADFKF 6.4 71 1014.454 1 39.636 1.3 91 91 82 50 59 75 81 81 28 ADS[300.1]FK[147.1] 3066 GTDQVEDFKEAF 8.6 71 693.3146 2 36.947 0.2 39 44 52 58 95 98 96 96 85 66 92 28 [401.2]VEDFK[129.0]A[147.1] 1961 YTAKSHGGATSLAF 10 71 705.855 2 23.872 1.2 59 67 77 94 97 90 82 71 74 58 48 52 91 28 [335.1]KSHG[429.2]A[147.1] 4147 MVSQQPGVSLPY 8.5 71 653.3272 2 49.565 2.8 92 91 91 75 52 58 85 89 89 71 28 28 MVS[353.2]GVS[373.2] 2831 ADSNADFKF 6.4 71 1014.4535 1 34.163 0.8 89 89 73 51 57 74 87 87 28 AD[387.1]FK[147.1] 1495 ESAELQNM(+15.99)AF 7.1 71 578.2538 2 18.851 1.5 35 38 39 86 98 79 76 88 90 78 [287.1]EL[242.1]M(+15.99)A[147.1] 2766 VYCQESQLKEAGAEYF 11.4 71 932.9254 2 33.392 0.7 88 83 83 80 95 89 58 86 67 93 79 52 41 51 56 28 VYCQES[128.1]L[128.1]E[638.3] 2754 TGEELGKGMW 7.1 71 554.261 2 33.253 0.9 74 73 88 98 95 84 81 57 28 28 [158.1]EELGK[374.1] 1832 MAPLKGSVKPW 7.8 71 607.3427 2 22.456 1.5 85 93 95 96 85 72 71 68 54 28 28 MAPLK[654.3] 2292 VHVQSHGGARCLF 9.2 71 705.8549 2 27.661 2.5 28 99 97 95 96 96 93 85 79 50 37 35 28 [99.1]HVQSHGG[590.3]

PAGE 278

278 3209 LQSDDDMANQRLNF 9.9 71 833.8776 2 38.649 0.6 43 42 43 63 93 98 94 93 86 68 69 59 68 65 [443.2]DDMAN[658.4] 3486 VSSDNAFQF 6.4 71 507.73 2 41.713 0.1 76 76 79 73 57 62 96 88 28 [573.2]FQ[147.1] 1947 AS(+79.97)PKFGGVRPVAF 9.2 71 706.8564 2 23.698 2 37 37 54 79 75 81 83 83 83 75 75 75 78 [610.3]GGVR[414.2] 4332 MQGQEDENGSVHY 9.2 71 747.3021 2 51.925 0.6 46 40 71 64 96 97 89 80 73 72 62 63 63 [444.2]EDEN[543.2] 1355 DNGVASVKAGF 7.8 71 1064.537 1 17.302 0.1 94 87 58 47 52 75 90 85 82 76 28 DN[314.2]VKA[204.1] 3705 MVSM(+15.99)PVGAGRVW 8.5 71 653.327 2 44.247 1.9 92 91 90 88 89 85 83 60 50 47 42 28 MVSM(+15.99)PVG[569.3] 1873 EFLDF 3.5 71 670.3082 1 22.891 0.1 99 99 99 28 28 EFL[262.1] 1836 SSNALQKCRKPF 8.5 71 689.8669 2 22.499 0.4 55 65 61 83 96 68 70 73 72 83 91 28 [288.1]AL[515.3]KP[147.1] 3777 M(+15.99)SM(+15.99)VAAVTRPVAF 9.2 71 706.3565 2 45.091 1 51 52 51 55 73 88 66 67 85 85 83 83 75 [551.2]A[200.1]RPVA[147.1] 1842 SAM(+15.99)PDPVAGNVDYKNLVY(+79.97) 12.7 71 1024.9575 2 22.56 2 31 36 40 86 28 95 98 95 78 68 84 93 94 58 45 66 92 79 [305.1]P[115.0]PVA[171.1]VDY[355.2]V[243.0] 3185 KLLDPEATGSKLKEF 10.6 71 559.3135 3 38.361 0.2 28 31 88 94 96 92 92 94 92 78 64 55 54 54 43 [241.2]LDPEATG[732.4] 2486 EQSQLAGYESLGAF 9.9 71 750.3538 2 29.994 0.5 56 49 40 39 80 87 91 94 94 61 57 61 87 88 [472.2]LAGYE[257.1]AF 4031 MVSVPGVGGPRCF 9.2 71 653.3263 2 48.145 0.8 93 92 92 94 28 52 77 84 93 65 63 52 28 MVSV[253.1]GG[503.2] 1169 VPVGVKAY 5.7 71 416.7505 2 15.35 1.4 28 28 92 94 95 98 98 28 [196.1]VGVKA[163.1] 3045 SAFT(+79.97)KVASPSNYKNLVY(+79.97) 12 71 1024.9591 2 36.692 1.1 55 59 85 61 58 58 96 79 69 65 67 94 55 50 74 91 75 [158.1]F[408.2]A[385.2]Y[355.2]V[243.0] 2385 DNGSGLVKAGF 7.8 71 532.7728 2 28.761 1.3 57 64 81 85 82 84 91 83 71 44 28 [229.1]GSGLVK[275.1] 2664 QNGSYPGGLLW 7.8 71 596.293 2 32.135 0.5 53 57 80 84 84 61 61 74 93 96 28 [242.1]GSY[211.1]LL[186.1] 1605 SLNEAELEGSLKEAVAW 12 71 923.4626 2 20.039 2.6 35 35 43 49 78 95 98 97 94 92 93 95 95 73 52 38 29 [514.2]ELEGSLKE[427.2] 1916 QLRGGAGVLTLGY(+79.97)RF 10.6 71 844.4395 2 23.348 2.3 41 42 55 57 44 57 85 92 93 97 98 98 72 60 59 [582.3]GVLTLG[546.2] 1632 KLDLAGDAKLLF 8.5 71 435.2592 3 20.335 0.8 57 54 55 59 62 75 93 90 88 89 91 28 [597.3]DAKLL[147.1] 1872 AFFQESGALQEAEYGAF 12 70 932.925 2 22.882 2.2 48 48 53 87 84 69 55 56 95 83 93 86 76 76 76 75 28 [365.2]QE[215.1]LQEA[567.2] 1151 QLSDDDM(+15.99)ANGARLNF 10.6 70 841.8746 2 15.149 1.1 42 42 42 53 91 96 86 86 85 89 89 66 58 64 61 [443.2]DDM(+15.99)ANGA[530.3] 4202 HVEKEYKTTGSMYEY 10.6 70 932.9249 2 50.277 0.1 78 77 77 88 76 68 81 95 92 80 69 59 53 28 28 [365.2]K[292.1]KTTG[673.2] 1509 QEQEQHGKASSKASLLVKRF 14.1 70 757.7456 3 18.994 1 41 41 33 37 42 77 71 76 84 86 81 81 86 93 93 94 89 83 82 28 [964.4]ASSKASLLVKR[147.1] 1895 TGM(+15.99)PPDVAGGGVDYKCVKY 13.4 70 986.9613 2 23.129 0.6 31 41 44 89 46 88 95 95 90 73 77 90 94 94 71 57 54 71 28 [305.1]P[97.1]DVAG[114.0]VDY[621.3] 3305 WGVKCM(+15.99)QF 5.6 70 507.7297 2 39.767 1.4 28 54 65 63 84 75 94 94 [470.3]C[147.0]QF 2669 ASDQVEDFKEAF 8.4 70 693.3148 2 32.199 0.4 38 43 64 56 91 98 95 95 79 60 90 28 [401.2]VEDF[257.1]A[147.1] 3962 ASEELKNMW 6.3 70 554.2589 2 47.307 3 45 49 66 95 90 64 63 71 85 [287.1]EL[373.2]W 1843 FGMNKLEEASFRTS(+79.97)VY 11.3 70 979.941 2 22.569 1.5 30 36 39 63 95 99 99 98 94 92 92 91 54 44 52 40 [449.2]KLEEASFR[530.2] 1272 QM(+15.99)APDDMANKRLNF 9.8 70 833.889 2 16.413 2 34 32 32 65 92 98 97 94 87 94 70 57 63 61 [443.2]DDMANK[530.3] 2347 RVFDMAGNGGVVMALW 11.2 70 861.9279 2 28.308 1.8 37 75 68 90 75 72 76 89 86 71 76 86 74 60 52 28 [402.2]D[259.1]NG[156.1]V[501.2]

PAGE 279

279 1392 KLKNPTNKEVLPGW 9.8 70 812.4629 2 17.726 1.9 29 70 81 90 96 94 83 82 84 98 49 46 48 28 [241.2]KNPTNKEV[453.2] 2413 MEKMVGVLWMDVVW 9.8 70 861.926 2 29.112 1.9 48 47 58 96 92 79 75 79 58 67 65 93 91 28 [388.2]MV[701.3]VV[186.1] 1273 QTSMLWLQLW 7 70 653.3359 2 16.421 1 59 66 88 88 88 58 62 48 80 61 [229.1]SML[427.2]L[186.1] 2751 LFAGMTVGNGGVTDVVW 11.9 70 861.9282 2 33.212 1.7 55 60 62 71 93 66 59 63 71 82 62 67 74 92 92 89 28 [388.2]M[371.2]G[257.1]DVV[186.1] 1181 QKVGRCDLVAHQPEY 10.5 70 581.6262 3 15.465 0 56 57 50 52 52 77 86 96 94 86 81 73 79 79 28 [671.4]DLVAH[517.2] 3684 ADDSQGFKF 6.3 70 507.7304 2 44.007 1 55 55 75 73 54 90 98 98 28 [516.2]GFK[147.1] 1076 TYTGNGEQPRVF 8.4 70 684.8326 2 14.347 2.8 29 52 72 87 87 94 93 84 90 91 28 28 [365.2]GNGEQPR[246.1] 2635 M(+15.99)SMQESGALGAETVYKF 11.9 70 932.9254 2 31.786 1.1 45 54 54 70 91 81 75 79 92 89 89 94 56 47 53 67 47 [493.2]ES[128.1]LGAE[638.3] 1297 WKAPPFAFLCNCY 9.1 70 780.3637 2 16.666 1.9 49 50 60 63 72 72 91 91 88 84 69 60 55 [726.4]AFLC[380.1] 1987 APHPPDVAGNVDYQNLVY(+79.97) 12.6 70 1024.9601 2 24.152 0.7 29 30 30 91 50 89 95 96 87 74 84 95 94 44 40 59 89 77 [305.1]P[97.1]DVAG[114.0]VDY[355.2]V[243.0] 372 WS(+79.97)CVY 3.5 70 369.1218 2 4.962 0.2 28 89 78 89 63 [186.1]S(+79.97)[103.0]V[163.1] 2479 YPKMVTGGGGEKDVVW 11.2 70 861.928 2 29.907 1.8 50 50 50 90 67 57 61 67 67 75 83 93 91 91 90 28 [388.2]M[428.2]EKDVV[186.1] 1340 TPLVSPAPAMY 7.7 70 1146.5842 1 17.135 1.9 85 86 86 28 88 88 76 60 67 70 28 TPL[99.1]SP[533.2] 1278 LSLKEPEPF 6.3 70 530.2883 2 16.474 2.5 78 83 97 94 92 95 28 28 28 [113.1]SLKEP[373.2] 2053 MGRVLGRPF 6.3 70 516.7926 2 24.886 0.8 79 65 78 93 96 77 45 63 28 [344.2]VL[457.2] 2739 NYGKSGGVPSQVAF 9.8 70 705.8543 2 33.057 0.2 32 45 51 86 90 89 84 79 84 50 46 72 85 79 [334.1]KSGG[99.1]P[314.2]A[147.1] 1957 MWVGVNSPNKSALDDKRNY 13.3 70 1097.5374 2 23.821 1.6 43 75 69 97 96 92 97 78 61 77 57 56 74 87 87 58 44 35 35 [416.2]GVNS[610.3]DD[561.3] 3131 GTDQVEDFKEAF 8.4 70 693.3147 2 37.714 0.3 41 48 61 61 88 97 94 94 74 56 89 28 [401.2]VEDF[257.1]A[147.1] 2765 ADSNADFKF 6.3 70 1014.4529 1 33.382 0.3 91 90 80 45 50 75 82 82 28 ADS[300.1]FK[147.1] 2983 GDGGSGLVKAGF 8.4 70 532.7723 2 35.953 0.2 30 52 85 83 83 85 87 93 84 70 49 28 [172.0]GGSGLVK[275.1] 1826 TEFNVPAMY 6.3 70 1071.4825 1 22.391 0.8 28 77 76 60 92 89 87 85 28 [491.2]VPAM[163.1] 2393 KLLDPEATGSKLKEF 10.4 70 559.3138 3 28.87 0.3 30 31 75 87 92 93 92 94 94 80 68 59 50 51 40 [354.3]DPEATGS[645.4] 1946 S(+79.97)FKMFKMF 5.6 70 1145.4923 1 23.688 0.1 94 95 95 85 53 75 28 28 S(+79.97)FKM[553.3] 2228 KPESTALLGEVGGSVKGGTDY 14.6 70 1033.0275 2 26.913 1.4 72 67 50 57 77 80 92 93 89 80 80 88 85 85 82 74 54 38 36 44 28 [542.3]ALLGEVGGSV[621.3] 3198 M(+15.99)HLNCVAGGGVDYCKVKY 12.5 70 986.96 2 38.508 2.6 50 53 52 61 88 92 94 91 78 80 90 97 91 53 52 46 47 28 [511.2]CVAG[57.0]GVDY[621.3] 2791 M(+15.99)HLNKYDVNGAVDPPTW 11.8 70 986.9619 2 33.684 2.8 48 52 50 58 87 59 84 75 55 71 93 90 83 71 84 85 28 [511.2]K[163.1]D[270.1]AVD[97.1]PT[186.1] 929 HLDAVAHSHGNFNSY 10.4 70 556.9205 3 12.644 2.6 56 51 55 58 66 65 66 75 86 89 60 61 76 92 82 [830.4]HG[375.2]SY 1830 KVVDTAYAKPSDDYVEGLRVF 14.6 69 791.4091 3 22.438 0.2 29 66 81 71 65 69 64 58 57 74 75 87 97 97 95 94 66 62 56 55 28 [227.2]V[833.4]DDYVE[572.3] 2942 SGPSDDDMANKRLNF 10.4 69 833.8781 2 35.458 0 31 43 49 51 50 92 98 97 93 85 93 70 58 62 62 [443.2]DDMANK[530.3] 3059 MDLTPF 4.2 69 723.338 1 36.87 0.2 82 84 84 75 61 28 MDL[345.2] 2777 SVDVGYGGNF 6.9 69 507.7306 2 33.525 1.3 72 79 78 87 86 87 75 49 48 28 [301.1]VGY[375.2]

PAGE 280

280 2293 Y(+79.97)VFTVGGSSPKKFF 9.7 69 822.3993 2 27.671 2.7 28 92 93 86 77 66 41 63 87 87 89 99 28 28 [243.0]VFT[300.1]SPKK[294.1] 3108 MVSLPAAGGGADLF 9.7 69 653.3271 2 37.447 2.7 94 94 94 55 56 63 88 90 86 49 45 55 67 28 MVS[281.2]AGG[503.2] 1307 YGQAHGGANGEVAQAF 11.1 69 788.8611 2 16.785 0.7 54 53 72 81 77 69 72 72 55 62 63 84 84 68 89 48 [348.1]A[622.2]VA[128.1]A[147.1] 1797 NHQVVAAAAPTM(+15.99)Y(+79.97) 9 69 734.8199 2 22.09 2.4 52 54 50 68 69 83 81 80 79 80 76 72 49 [577.3]AAA[71.0]P[491.1] 3215 YTAKSHGGATSLAF 9.7 69 705.8543 2 38.729 0.2 34 52 68 94 96 89 77 74 83 70 52 55 92 28 [335.1]KSH[114.0]A[301.2]A[147.1] 1742 VYYMPNVSALKERVY 10.4 69 611.32 3 21.507 2.4 28 62 70 44 61 57 76 86 93 97 89 87 63 89 28 [866.4]SALKE[156.1]V[163.1] 1215 LTTGM(+15.99)CDRF 6.2 69 530.2338 2 15.804 0.6 51 86 85 58 50 88 85 88 28 [113.1]TT[204.1]CDR[147.1] 1063 LLAVDGSQKEF 7.6 69 402.8837 3 14.216 0.2 71 70 55 57 64 78 85 58 58 67 93 [568.3]S[385.2]F 2521 SGPSDDDMANKRLNF 10.4 69 833.8784 2 30.405 0.3 29 45 52 52 46 96 96 94 91 81 92 72 59 63 62 [443.2]DDMANK[530.3] 4201 SADQVEDFKEAF 8.3 69 693.3145 2 50.266 0.1 45 49 60 53 90 95 94 94 72 54 90 28 [401.2]VEDF[257.1]A[147.1] 2283 AKPFHPY 4.8 69 859.4459 1 27.55 0.1 41 69 84 28 86 86 86 [199.1]P[147.1]HPY 1563 DPGSGLVAGAGF 8.3 69 1047.511 1 19.587 0.5 39 38 38 92 95 96 95 81 75 61 87 28 [269.1]SGLVA[128.1]G[147.1] 1383 LTLTSNPY 5.5 69 454.7404 2 17.622 1.3 30 30 84 78 79 77 90 80 [214.1]L[302.1]PY 1089 GYKAVCHAAW 6.9 69 553.2675 2 14.475 2.5 88 93 98 98 98 98 28 28 28 28 GYKAVC[465.2] 3067 YFSNKYDGVGGAVDPPTW 12.4 69 986.9599 2 36.958 2.6 37 34 34 50 91 77 84 84 74 71 82 92 84 78 69 83 84 28 [511.2]K[163.1]DG[156.1]GAV[212.1]PT[186.1] 3097 DCFKESGALKEEAYQF 11.1 69 932.926 2 37.316 1.3 28 82 81 93 74 86 73 74 90 91 91 56 43 41 43 49 [115.0]CFK[129.0]S[128.1]LKE[638.3] 1333 M(+15.99)YGNGGVEPRLY 8.3 69 686.3225 2 17.061 1.2 84 82 68 58 72 81 73 57 57 78 84 28 M(+15.99)Y[228.1]G[481.3]L[163.1] 1499 DLDLRKDLY 6.2 69 575.8095 2 18.901 1.3 28 28 95 94 86 80 84 93 28 [228.1]DLRKDL[163.1] 2388 QLSDDDMANQRLNF 9.7 69 833.8784 2 28.803 0.3 47 47 43 53 93 99 96 93 79 73 69 53 56 59 [443.2]DDMA[772.4] 2383 DADSQGFKF 6.2 69 507.7305 2 28.741 1.1 55 56 77 60 51 93 98 98 28 [516.2]GFK[147.1] 1886 KSVAEVMLHF 6.9 69 580.8091 2 23.026 1.9 28 80 77 76 81 81 89 73 73 28 [128.1]S[170.1]EVM[397.2] 2285 AVLTNWDDMEKLW 9 69 810.8907 2 27.58 0.9 31 40 55 87 84 67 82 76 81 81 82 97 28 [283.2]TN[186.1]D[115.0]MEKL[186.1] 2076 LGLFDRVGDASGVAF 10.3 69 762.3972 2 25.155 1.4 34 32 38 66 89 95 95 90 80 68 65 71 86 89 28 [430.3]DRVGD[215.1]VA[147.1] 1629 KCCAKDVGRVRGW 9 69 739.3797 2 20.298 0.5 33 33 96 96 95 95 91 91 89 65 34 43 28 [231.1]CAKDVGR[498.3] 1251 TVDVNGGTYY 6.9 69 544.7498 2 16.191 2.6 28 98 96 93 78 71 62 62 68 28 [101.0]VDV[655.3] 925 QLELGSLRQHF 7.6 69 664.3579 2 12.587 2.3 59 63 69 85 86 81 74 74 67 67 28 [370.2]LGS[681.4] 2264 LTENVSFGHLF 7.6 69 632.3212 2 27.332 1.2 68 74 87 62 61 61 83 91 68 68 28 [214.1]E[300.1]FG[397.2] 1518 MLKSEEFGGEQSKPF 10.3 69 857.4123 2 19.101 1.3 47 59 84 96 97 84 78 84 82 51 46 58 59 72 28 [244.1]KSEE[147.1]GG[716.3] 1274 DRARGSDVAF 6.9 69 547.2744 2 16.43 2.7 53 53 43 47 53 73 79 92 96 94 [757.3]VAF 1217 NSNRLKVGTKHW 8.3 69 720.3986 2 15.834 2.4 58 64 73 86 72 65 77 92 82 68 54 28 [315.1]R[340.2]GT[451.2] 2760 FLEFDTVLMAFNLY 9.6 69 574.9545 3 33.319 2.4 71 76 76 55 53 55 76 82 82 84 64 51 80 51 [851.4]LMA[261.1]L[163.1]

PAGE 281

281 4081 EGDSGAGFKF 6.9 69 507.7305 2 48.736 1.1 43 48 67 62 68 76 96 97 98 28 [516.2]GFK[147.1] 2913 SAM(+15.99)PPDVAGNVDYKNLVY(+79.97) 12.4 69 1024.9583 2 35.122 2.7 34 37 46 77 36 80 90 95 85 63 77 93 94 53 44 61 90 74 [499.2]DVAG[213.1]DY[355.2]V[243.0] 446 CCNTS(+79.97)F 4.1 69 377.6002 2 5.941 0.6 73 73 57 62 69 76 [735.2] 1230 WGVLADWKKKY 7.6 69 697.3854 2 15.972 0.6 28 98 98 98 96 96 94 58 28 28 28 [186.1]GVLADW[547.3] 3915 HRAFYGFAEEYAWAF 10.3 69 932.925 2 46.742 0.8 44 48 52 64 81 86 81 90 98 98 96 92 34 31 28 [511.3]YGFAEEYA[404.2] 2405 GTDQVEDFKEAF 8.2 69 693.3151 2 29.019 0.9 43 48 59 52 94 98 89 89 74 56 88 28 [401.2]VEDF[257.1]A[147.1] 3296 HVGAEESGALKESRCEY 11.7 69 932.9263 2 39.651 2.1 28 86 82 86 90 93 85 65 51 67 94 94 74 52 37 45 28 [137.1]VGAEES[241.1]KE[638.2] 3828 SAKTSCLPDW 6.9 69 554.26 2 45.704 1 58 58 63 60 76 95 93 75 75 28 [474.2]CL[398.2] 2525 M(+15.99)FKLKSGTALLPPAW 10.3 69 559.3134 3 30.46 1 66 56 54 64 70 80 86 89 87 87 83 83 49 37 28 [663.4]SGTALLP[354.2] 1909 APHPPDVAGNVDYQNLVY(+79.97) 12.3 69 1024.9591 2 23.27 0.2 30 30 30 91 35 85 94 96 71 57 75 94 93 52 47 81 91 74 [305.1]P[97.1]DVA[270.1]DY[242.1]LV[243.0] 1601 TNEKLQKM(+15.99)F 6.2 69 577.7957 2 20.008 2.9 82 73 93 60 50 44 64 61 86 T[114.0]E[644.4]F 3084 TGEELKACAW 6.9 69 554.2608 2 37.167 0.4 71 68 84 97 94 78 59 47 53 28 [158.1]EEL[559.3] 1955 KWNSAVAMGEELALW 10.3 69 852.922 2 23.802 2.6 50 71 52 82 82 83 85 83 79 84 75 58 57 52 28 [428.2]SAVAM[57.0]E[612.3] 3505 GTDKVEDFQEAF 8.2 69 693.3179 2 41.926 4.8 46 52 67 72 96 99 96 73 53 45 89 28 [401.2]VED[404.2]A[147.1] 2713 MVSQSPPGKDLF 8.2 68 653.3278 2 32.729 1.9 93 93 93 54 55 55 90 86 56 52 61 28 MVS[312.1]PG[503.3] 4214 FTGPPDVANGVDYQCVKY 12.3 68 986.96 2 50.43 0.9 36 40 41 88 77 88 94 94 78 83 84 92 88 45 56 54 57 28 [305.1]P[97.1]DVA[114.0]GVDY[621.3] 932 VVLAAKEEAGGDEDCY 11 68 834.8765 2 12.671 2.1 28 43 42 64 95 92 92 92 93 93 91 80 73 54 28 28 [382.3]AKEEAGGD[510.1] 1387 LTNMVCLF 5.5 68 940.4613 1 17.67 1.9 59 57 74 88 78 77 82 28 [328.2]M[202.1]L[147.1] 3120 LLKDPPSGTAFRARF 10.3 68 559.3138 3 37.59 0.4 33 52 47 66 91 89 82 84 88 94 83 73 57 52 28 [469.3]PPSGTAF[530.3] 2945 Y(+79.97)LVSKANWVAQW 8.2 68 772.8678 2 35.502 0.9 63 63 28 93 91 90 60 64 67 71 75 50 [455.2]SKA[784.4] 2029 VHVQSDGTPGPAVF 9.6 68 705.8534 2 24.614 1.1 28 97 91 77 93 94 92 82 74 60 38 37 45 43 [99.1]HV[128.1]SDGT[568.3] 933 KRNAQEVGGTSSS(+79.97)HF 10.2 68 842.8733 2 12.682 2.7 82 85 83 88 82 92 81 70 73 79 89 28 28 28 28 KRNAQEV[215.1]S[538.2] 2471 SADQVEDFKEAF 8.2 68 693.3149 2 29.812 0.5 37 41 57 47 94 97 95 95 75 56 91 28 [401.2]VEDF[257.1]A[147.1] 2723 KLLDAPLGTATATKEF 10.9 68 559.314 3 32.859 0.7 30 34 78 85 81 68 61 74 83 92 85 66 68 62 65 51 [354.3]DA[267.2]TAT[576.3] 912 YRVPKVEEFLLTY 8.9 68 552.9725 3 12.422 2.1 29 29 70 92 96 97 98 98 91 83 34 34 28 [418.2]PKVEEFL[377.2] 1019 RARAEEVRW 6.1 68 391.5471 3 13.751 1.2 30 30 72 80 93 92 92 93 28 [383.2]AEEVR[186.1] 2094 FVLCSHGGASDVAF 9.6 68 705.3282 2 25.361 1.8 28 82 75 75 76 92 83 80 83 56 53 48 61 57 [147.1]V[303.1]HGGA[519.2] 1147 KLVVDTAPGKTY 8.2 68 431.2465 3 15.101 0.4 66 53 50 58 70 92 95 87 67 61 84 28 [554.3]TAP[185.1]T[163.1] 2011 LVPAVGFAASDLEWKY 10.9 68 589.3119 3 24.413 2.9 28 38 41 42 59 57 61 76 85 84 88 92 95 73 93 72 [754.4]ASDLE[186.1]K[163.1] 1862 TPEWPSLKY 6.1 68 1120.5704 1 22.773 2.7 28 28 96 97 97 75 70 91 28 [198.1]EWP[200.1]K[163.1] 2700 MFSQESGALGAESLYGAF 12.3 68 932.9236 2 32.582 1.2 45 42 42 77 93 76 55 56 90 86 88 95 65 57 75 74 72 28 [493.2]E[215.1]LGAE[638.3]

PAGE 282

282 3903 RAQEADSVAF 6.8 68 547.2671 2 46.6 0.3 37 52 58 77 88 63 63 64 89 86 [484.2]A[301.1]AF 3176 MVSQQPPASTLF 8.2 68 653.3273 2 38.248 2.7 83 84 84 69 46 54 92 67 62 64 79 28 MVS[353.2]P[519.3] 4154 ADSDNAFKF 6.1 68 1014.4528 1 49.656 0.1 93 93 86 44 41 49 84 89 28 ADS[300.1]FK[147.1] 2897 VSSNADFQF 6.1 68 1014.4537 1 34.935 1.1 89 91 86 55 57 67 74 62 28 VSS[722.3] 2031 EYGLTDLRGPF 7.5 68 634.3204 2 24.63 1.4 66 59 47 52 92 81 74 74 83 89 28 [462.2]TD[269.2]GP[147.1] 1871 M(+15.99)GNMKLEETGFRDSSMW 11.6 68 1017.9399 2 22.874 0.4 31 31 32 42 96 98 99 95 86 82 90 93 53 57 57 79 28 [449.1]KLEETGFR[606.2] 2249 MVSQGGGVVPDLF 8.8 68 653.3278 2 27.168 2 96 95 95 82 79 69 65 66 63 42 43 55 28 MVSQ[841.4] 1430 FLKMVVGMNGKDPTW 10.2 68 861.9376 2 18.136 1.6 36 55 68 94 91 81 79 45 42 51 94 90 84 74 28 [388.2]MVV[359.1]KDP[287.1] 1331 KPTPGVPT(+79.97)GMKF 8.2 68 670.3276 2 17.046 0 78 78 78 89 91 28 80 79 73 57 50 28 [326.2]PG[99.1]P[644.2] 2719 LQSDDDMANQRLNF 9.5 68 833.879 2 32.805 1 50 49 50 60 93 98 91 85 80 74 62 47 49 56 [443.2]DDMAN[658.4] 2933 SADKVEDM(+15.99)KEAF 8.1 68 693.3151 2 35.355 1.6 37 44 62 90 95 98 96 72 52 44 90 28 [273.1]KVED[404.2]A[147.1] 1453 TLYFGRAW 5.4 68 507.2642 2 18.388 0.8 70 70 81 65 80 75 71 28 [214.1]Y[147.1]G[413.2] 3315 QSTFSDGVRPVAF 8.8 68 705.8557 2 39.876 2.1 36 37 56 82 80 71 69 78 75 84 72 72 63 [316.1]FS[427.2]P[317.2] 2057 LSTVTVAGPMGTFKF 10.2 68 778.4122 2 24.934 1.1 44 43 83 91 82 78 74 73 75 76 64 63 68 69 28 [200.1]TVT[1035.5] 2888 EPRGGPYVF 6.1 68 511.2588 2 34.823 0.3 28 89 85 80 85 90 92 28 28 [129.0]PRGGPY[246.1] 2435 NSKEDFQF 5.4 68 1014.4537 1 29.382 1 28 94 86 86 92 69 54 28 [114.0]SKED[422.2] 3899 SADKVEDFEAGAF 8.8 68 693.3148 2 46.556 0.4 40 42 57 69 93 99 99 28 75 74 83 88 28 [401.2]VED[347.1]GA[147.1] 3007 QLSDDDMANQRLNF 9.5 68 833.8795 2 36.242 1.6 34 34 34 66 93 97 88 86 75 69 72 61 68 66 [443.2]DDMA[772.4] 1068 YRVLTTRGSFTSPF 9.5 68 544.6223 3 14.271 1 35 42 37 46 62 52 55 59 92 92 94 92 92 90 [946.5]SFTSPF 3197 GTDQVEDFKEAF 8.1 68 693.3153 2 38.498 1.1 42 45 57 49 93 98 96 95 63 50 90 28 [401.2]VEDF[257.1]A[147.1] 867 Y(+79.97)HECGEEY(+79.97) 5.4 68 595.15 2 11.869 1.3 76 76 81 85 67 65 60 28 [380.1]EC[558.1] 2603 GTDKVEDFQEAF 8.1 68 693.3145 2 31.404 0.1 43 48 58 79 94 99 97 75 51 43 92 28 [401.2]VED[404.2]A[147.1] 2911 MVSPGGDAAAGLLF 9.5 68 653.3276 2 35.103 2 89 89 89 35 57 68 69 71 69 61 59 72 85 28 MVS[709.3]L[147.1] 1097 EWALDQMGKVAQW 8.8 68 521.2552 3 14.568 2.7 53 52 59 59 60 45 58 79 80 82 83 87 77 [930.4]KVAQ[186.1] 2859 FSAPPDVAGGGVDYKCVQY 12.9 68 986.9604 2 34.478 1.4 40 37 37 71 60 77 89 95 90 80 79 88 95 93 63 42 40 46 52 [614.3]VAGG[57.0]VDY[621.3] 1411 LTWSGAGKTVNAASVGVLKYF 14.2 68 1085.0889 2 17.935 0.1 62 62 46 67 59 60 83 85 90 95 86 66 61 60 71 66 76 88 65 31 31 [615.3]GKTVN[484.3]L[438.2] 1922 TKNKVPMYAFATVAAF 10.8 68 586.9811 3 23.412 2.3 36 34 34 35 45 69 71 76 93 72 72 83 82 86 92 94 [961.5]A[218.1]TVAAF 4267 T(+79.97)LAATKSLVY 6.8 68 573.7933 2 51.114 1.1 92 92 91 75 62 62 70 71 28 28 T(+79.97)LA[762.4] 2394 LTENGVGSARPY 8.1 68 632.3198 2 28.878 0.3 81 84 91 85 82 77 72 71 52 46 34 28 LTENG[730.4] 2586 KSVAPSVVMW 6.8 68 552.2979 2 31.197 3 28 98 97 84 85 61 59 59 71 28 [128.1]SVAP[602.3] 4261 SAEELGGKMW 6.8 68 554.2609 2 51.039 0.6 60 60 90 98 95 84 81 45 28 28 [158.1]EELGG[445.2]

PAGE 283

283 1883 KSVADLWVW 6.1 68 552.2988 2 23.004 1.9 28 99 98 98 97 98 28 28 28 [128.1]SVADL[471.2] 1920 LVRTTKVSPSKPF 8.8 67 487.2915 3 23.394 2 41 38 42 43 73 77 82 95 92 87 85 86 28 [698.4]VSPSKP[147.1] 2545 FGKAVCAAHW 6.7 67 545.2695 2 30.705 1.9 39 49 68 94 96 90 89 87 28 28 [332.2]AVCAA[323.1] 1722 KMPVGQLLW 6.1 67 536.3058 2 21.295 2.2 69 76 91 96 82 58 75 28 28 [259.1]PVG[540.3] 3251 KLLGHDSGTLLAKHW 10.1 67 559.3132 3 39.15 1.6 29 57 61 47 47 60 84 82 80 79 86 89 87 88 28 [663.4]SGT[113.1]LAKH[186.1] 1610 NAKYNPVGASELRDLY 10.8 67 905.4605 2 20.093 0.4 34 39 43 94 85 96 95 93 90 92 94 79 38 36 36 28 [313.2]YNPVGASE[660.4] 1362 STHHF 3.4 67 628.283 1 17.377 1.3 82 75 75 75 28 S[522.2] 2378 YDSLYGDAAKTPF 8.8 67 724.3423 2 28.678 2.4 28 77 71 76 83 74 68 77 72 67 71 78 28 [478.2]Y[787.4] 2162 M(+15.99)APTLTSANW 6.7 67 554.2598 2 26.149 1.3 64 63 68 75 91 83 57 54 57 57 [416.2]LT[458.2] 3923 KSVADLVWW 6.1 67 552.298 2 46.845 0.4 28 99 98 97 97 99 28 28 28 [128.1]SVADL[471.2] 2935 M(+15.99)HMAKVAGGGVDYKCVQY 12.1 67 986.9595 2 35.373 2 28 58 43 48 61 92 93 87 67 74 82 94 95 72 58 50 51 51 [614.3]VAG[114.0]VDY[621.3] 2017 S(+79.97)HPNVVAATVNYENLVGW 12.1 67 1025.4727 2 24.485 2.5 28 90 83 67 74 91 92 60 52 70 82 86 51 45 68 70 67 28 [167.0]HP[213.1]VA[271.2]NY[698.3] 1658 LDKNKDPQVDSVVQLY 10.8 67 930.9875 2 20.608 1.3 46 39 39 54 89 93 61 57 84 95 95 90 87 46 56 40 [470.2]KD[225.1]VDSVV[404.2] 2882 LTETPVGGGRNY 8.1 67 632.3203 2 34.753 0.5 72 70 87 93 28 77 78 74 71 62 62 28 [214.1]ET[800.4] 3815 EGKSGDFGAF 6.7 67 507.7305 2 45.548 1.1 47 46 60 55 69 87 93 90 91 28 [458.2]DFGA[147.1] 3659 KSVADLVWW 6 67 552.2975 2 43.716 0.6 28 99 98 97 97 97 28 28 28 [128.1]SVADL[471.2] 1890 MKWLAEKENKQRGFRLY(+79.97) 11.4 67 1139.0719 2 23.068 0.1 74 39 55 57 97 96 96 95 67 51 48 44 75 82 63 49 47 [558.3]AEKE[583.3]F[512.2] 2666 WAGMGHF 4.7 67 403.1755 2 32.155 1.4 67 67 73 79 74 78 28 [786.3] 2129 KLLDLLATGSGPSKEF 10.7 67 559.3139 3 25.774 0.4 31 40 58 77 77 86 87 93 89 83 67 63 76 50 50 40 [582.4]LATGS[645.3] 3529 KSVADLWVW 6 67 552.2982 2 42.202 0.7 28 99 98 97 97 97 28 28 28 [128.1]SVADL[471.2] 1314 RPAMSAGANGEVAQW 10.1 67 772.8657 2 16.863 2.1 52 60 62 67 74 81 83 79 52 48 48 88 75 79 51 [542.3]AG[371.1]V[385.2] 2139 QNGPAATSFLW 7.4 67 596.2923 2 25.881 1.6 53 52 60 63 66 80 76 78 87 89 28 [467.2]A[188.1]FL[186.1] 3303 T(+79.97)KFASVASLGQYQNLVY(+79.97) 11.4 67 1024.9589 2 39.734 1.3 80 59 39 44 51 90 95 68 59 54 61 94 55 43 73 91 76 T(+79.97)[433.2]VA[385.2]Y[355.2]V[243.0] 3638 MVSQNLATPTPF 8.1 67 653.3276 2 43.459 2.2 91 91 91 75 61 68 70 62 56 52 56 28 MVS[969.5] 1154 KNFSPAKATNF 7.4 67 408.8835 3 15.179 0.9 71 64 67 61 60 52 60 70 71 81 77 [944.5]N[147.1] 1553 ETSKNNTGKPVPF 8.7 67 709.8694 2 19.492 2.8 85 89 90 94 74 50 52 74 85 87 28 28 28 ETSK[386.2]KP[343.2] 2187 KPDKGGGPTNKRLLLW 10.7 67 594.0113 3 26.442 1.8 67 68 44 39 40 47 83 88 89 86 96 91 90 81 28 28 [582.3]GPTNKRLL[299.2] 3819 T(+79.97)LPPKGVHTW 6.7 67 608.2985 2 45.588 2 97 94 90 59 65 87 90 28 28 28 T(+79.97)LP[225.1]GV[424.2] 3272 ASFPPDVAGGGVDYKNLCY 12.7 67 986.9586 2 39.386 0.5 29 34 39 79 67 78 91 92 86 78 77 83 92 94 65 41 50 50 37 [614.3]VAG[114.0]VDY[621.3] 2979 SAM(+15.99)PDPVAGNVDYKNLVY(+79.97) 12.1 67 1024.9578 2 35.898 2.3 32 35 40 77 37 94 97 94 71 62 77 92 88 45 41 53 89 73 [517.2]PVA[270.1]DY[355.2]V[243.0] 1221 KDMAEGAELPF 7.4 67 604.2864 2 15.869 0.7 93 93 95 94 88 74 51 46 41 28 28 KDMAE[614.3]

PAGE 284

284 3195 SFTQSDGVRPVAF 8.7 67 705.8542 2 38.465 0.1 44 43 46 39 51 73 89 91 88 74 75 75 79 [665.3]GVR[414.2] 1993 ATSLKLTLPLHF 8 67 670.8996 2 24.217 1.3 29 42 52 96 97 93 93 96 92 51 28 28 [259.1]LKLTLP[397.2] 3858 SKVADLWVW 6 67 552.298 2 46.062 0.4 28 98 97 96 96 98 28 28 28 [87.0]KVADL[471.2] 4200 KSVADLWVW 6 67 552.2975 2 50.254 0.4 28 99 98 97 96 97 28 28 28 [128.1]SVADL[471.2] 3788 SVSDNAFQF 6 67 1014.4512 1 45.224 1.4 76 78 79 61 61 62 82 69 28 [573.2]F[275.1] 2390 KSVAEVWVW 6 67 552.2976 2 28.825 0.3 28 92 89 85 85 79 57 55 28 [128.1]SVAE[570.3] 2451 QTGSLGVAGAGF 8 67 532.7726 2 29.563 0.8 46 46 73 78 66 67 81 85 84 71 73 28 [543.3]VAG[275.1] 3041 DADNTGFKF 6 67 507.7305 2 36.652 1.1 46 51 79 62 62 82 93 95 28 [516.2]GFK[147.1] 1266 MVSQNALTDVPF 8 67 661.3247 2 16.353 2.7 88 87 86 74 73 65 65 85 89 28 28 28 MVS[426.2]TD[343.2] 3594 SKVADLVWW 6 67 552.2977 2 42.953 0.2 28 98 97 96 96 97 28 28 28 [87.0]KVADL[471.2] 3464 KSVADLWVW 6 67 552.298 2 41.462 0.3 28 99 97 97 96 97 28 28 28 [128.1]SVADL[471.2] 2171 FCRLVSTKAATYCKPFRF 12 67 1069.5579 2 26.263 2.2 28 64 75 89 96 90 89 90 57 59 57 81 79 76 56 52 28 28 [406.2]LVSTK[243.1]Y[778.4] 1265 MVSQNLATTPPF 8 67 653.3273 2 16.346 2.6 95 95 95 81 64 62 63 50 47 47 69 28 MVSQ[841.4] 2085 SDVS(+79.97)GLLPF 6 67 507.7296 2 25.251 2.4 63 69 68 71 74 92 80 51 28 [525.2]LL[244.1] 853 WM(+15.99)VSSYY 4.7 67 476.1982 2 11.698 2.8 28 94 94 94 97 28 28 [186.1]M(+15.99)VSS[326.1] 3204 KTGSDPGKAGF 7.3 67 532.7722 2 38.582 0.1 77 78 64 68 78 75 76 72 64 49 28 [1045.5] 2448 VSDNTGFQF 6 67 507.7303 2 29.536 0.7 69 73 65 51 53 88 91 78 28 [516.2]GF[275.1] 3321 NTVVSLGDGSLPM(+15.99)GY 10 67 763.3659 2 39.945 2.9 59 62 62 62 63 70 76 70 68 74 92 88 59 57 32 [929.4]LP[367.1] 2186 GFTSVGSGVELY 8 67 608.2983 2 26.432 0.2 49 52 69 84 91 85 73 64 61 58 81 28 [305.1]SVG[372.2]L[163.1] 1752 MPLRKLW 4.7 67 472.2815 2 21.619 1.3 99 97 91 88 33 28 28 MPLR[427.3] 4057 SKVADLVWW 6 67 552.2982 2 48.451 0.8 28 98 97 96 96 97 28 28 28 [87.0]KVADL[471.2] 1520 RVFDKEGAGPM(+15.99)MLAW 10 67 862.4176 2 19.119 0.9 36 74 59 83 71 64 65 70 81 71 73 81 68 68 28 [402.2]D[385.2]G[244.1]M[370.2] 1628 NMAAGLPVGGVNLPY 10 67 736.8804 2 20.289 2.1 55 55 88 92 78 73 78 95 95 87 43 38 37 49 28 [245.1]AA[267.2]VGG[586.3] 1376 RATGKTVKPVNNDRW 10 67 871.4778 2 17.539 1.6 30 38 42 59 75 95 98 91 85 91 83 73 51 51 31 [513.3]TVKPVN[571.3] 3967 KKVPAKLHLGMMHW 9.3 67 559.314 3 47.372 0.8 53 59 52 54 65 70 71 79 84 84 87 72 67 28 [901.6]LGM[454.2] 1088 SQAVAGTAAQW 7.3 67 1089.5327 1 14.467 0.2 51 49 80 81 78 65 62 74 73 78 37 [215.1]AV[685.3] 2277 SADQVEDFKEAF 8 67 693.3149 2 27.478 0.5 39 44 58 58 90 96 85 84 69 53 89 28 [401.2]VEDF[257.1]A[147.1] 2589 FLKEAGKDGGAEPAFW 10.7 67 861.9276 2 31.228 0.4 76 86 93 97 64 50 43 54 61 68 71 79 81 77 28 28 [147.1]LKE[685.3]P[404.2] 3723 GFTSEGAAVTLY 8 67 608.2979 2 44.462 0.4 52 61 81 94 88 87 74 47 46 51 83 28 [204.1]TSEG[342.2]L[163.1] 3726 SKVADLVWW 6 67 552.2991 2 44.503 2.4 28 98 97 97 95 95 28 28 28 [87.0]KVADL[471.2] 1398 MVTKEELQRGFWYY 9.3 67 925.4493 2 17.795 1.5 43 40 40 89 98 98 88 60 80 83 90 40 41 35 [331.2]KEEL[128.1]RGF[512.2]

PAGE 285

285 835 SPKNDMMY(+79.97) 5.3 67 533.1913 2 11.478 2.6 56 55 52 70 86 92 89 28 [426.2]DMM[243.0] 2730 ELGMFATLFY 6.7 67 596.293 2 32.945 2.8 59 61 77 85 88 70 62 64 68 28 [299.1]MF[595.3] 3990 SKVADLWVW 6 67 552.2979 2 47.648 0.2 28 97 96 95 96 97 28 28 28 [87.0]KVADL[471.2] 2473 WGANGGQAGGGEVAKW 10.6 67 772.8672 2 29.833 2 51 54 64 49 53 75 66 78 65 68 73 72 81 85 94 28 [1041.4]VAK[186.1] 1775 SNKEDFQF 5.3 67 1014.4532 1 21.866 0.5 28 78 78 78 93 48 71 55 [458.2]D[422.2] 3139 KPADSSGKAGF 7.3 66 532.7726 2 37.812 0.9 61 70 72 80 93 71 59 62 66 64 28 [296.2]DS[547.3] 2844 MDNRGFQF 5.3 66 507.7297 2 34.308 5.8 61 61 57 63 81 94 83 28 [516.2]GFQ[147.1] 1213 GKNPKSKEVLPGW 8.6 66 720.4019 2 15.79 2.7 57 79 89 84 70 70 89 89 98 35 35 36 28 [185.1]NP[215.1]KEV[453.2] 4195 RKGKAPLGTAWSKEF 10 66 559.3138 3 50.186 0.5 28 28 66 70 73 73 66 66 66 67 86 82 78 79 62 [979.6]WS[404.2] 2648 VFFFVPTNKLVLLGW 10 66 594.0109 3 31.935 0.7 64 64 58 67 67 85 84 86 94 87 57 41 46 61 28 [639.3]PTNKL[568.3] 2587 LQSDDDMANQRLNF 9.3 66 833.8789 2 31.207 1 37 36 36 43 93 98 95 87 76 76 66 57 62 61 [443.2]DDMA[772.4] 4136 ENGTVEDFKEAF 8 66 693.3152 2 49.424 1 47 46 52 56 83 97 93 90 68 50 81 28 [401.2]VEDF[257.1]A[147.1] 1302 YM(+15.99)NGVQVRPPY 7.3 66 670.3256 2 16.726 1.6 28 80 66 89 85 55 77 76 49 91 28 [163.1]M(+15.99)[114.0]GV[480.3]P[163.1] 1098 SMEACGVPQTVAAQAF 10.6 66 537.2499 3 14.575 0.3 59 58 57 58 64 73 64 58 49 49 49 67 90 87 93 79 [1173.5]AQA[147.1] 4139 HVVQSDASGPAPVF 9.3 66 705.8544 2 49.469 0.3 28 97 96 85 95 88 61 55 56 57 56 60 60 28 [137.1]VVQSD[726.4] 1219 VTDVKELY 5.3 66 483.7596 2 15.85 2.5 28 28 98 97 80 80 87 28 [200.1]DVKEL[163.1] 1887 SKVVSLMPGW 6.6 66 552.2988 2 23.034 1.2 28 28 75 75 81 95 92 83 73 28 [413.3]SLMP[243.1] 2753 VHVQSDGTPGAPVF 9.3 66 705.8546 2 33.245 0.6 28 99 98 86 94 95 95 79 59 48 37 36 38 28 [99.1]HVQSDG[669.3] 1622 VRFPSGGSSGCGAGY 9.9 66 701.3136 2 20.225 1.1 28 28 78 77 75 75 76 64 28 69 68 70 77 83 90 [1162.5]GY 4211 GEDSQGFKF 6 66 507.7303 2 50.397 0.8 46 49 69 68 52 82 98 99 28 [516.2]GFK[147.1] 2963 EGSNADFKF 6 66 1014.4535 1 35.718 0.8 87 87 77 48 49 62 76 77 28 EG[809.4] 1279 QLSDDDM(+15.99)ANGARLNF 9.9 66 841.8736 2 16.481 2.3 44 44 44 58 88 96 70 59 58 78 83 74 61 65 64 [443.2]DD[389.1]A[530.3] 2571 MSFQYEQLAGSTVEQF 10.6 66 932.926 2 31.014 1.4 48 47 47 78 87 87 55 79 72 72 78 87 68 47 48 51 [493.2]YE[456.2]T[503.2] 2916 WDEAYPAAALATMAW 9.9 66 556.256 3 35.165 2.2 54 60 43 59 60 72 85 84 78 88 92 70 64 49 28 [761.3]AA[71.0]LA[489.2] 4266 GTDKVEDFQEAF 7.9 66 693.3148 2 51.102 0.4 41 47 58 75 88 96 98 75 51 43 88 28 [401.2]VED[404.2]A[147.1] 2649 T(+79.97)KTTKYDVGGGAVDPPTW 11.9 66 986.9576 2 31.946 1.4 45 46 39 83 87 93 74 72 61 46 67 77 79 68 59 78 81 28 [410.2]TKY[864.4]T[186.1] 2653 LQSDDDMANQRLNF 9.3 66 833.8787 2 31.999 0.7 49 48 46 52 91 98 95 90 58 47 63 57 61 63 [443.2]DDMA[772.4] 2784 SKVADLWVW 6 66 552.2981 2 33.605 0.6 28 98 97 95 94 95 28 28 28 [87.0]KVADL[471.2] 1250 KKTTAGKSELELFAACAMRKY 13.9 66 782.7463 3 16.18 2.7 39 34 34 59 64 67 71 83 85 93 95 86 83 81 81 81 74 60 52 28 28 [714.4]SELELFAAC[649.3] 3405 RSGTVEDFQEAF 7.9 66 693.3227 2 40.832 3.5 48 47 55 73 90 98 96 72 50 43 87 28 [401.2]VED[404.2]A[147.1] 926 MS(+79.97)MDVM(+15.99)DF 5.3 66 536.1652 2 12.599 0.1 28 28 28 97 95 88 87 75 [429.1]DVM(+15.99)D[147.1]

PAGE 286

286 2718 KSVAMPLATW 6.6 66 552.2986 2 32.794 1.7 28 99 98 91 50 49 58 68 68 46 [128.1]SVA[699.3] 2168 DRGTTTPQAF 6.6 66 547.2675 2 26.219 0.3 63 63 49 50 82 80 72 59 91 46 [429.2]TT[225.1]A[147.1] 3397 VSSANDFQF 5.9 66 507.7327 2 40.742 5.4 62 73 48 45 44 74 71 86 87 [720.3]QF 1137 NHKPGMNGDW 6.6 66 578.2524 2 14.988 2.1 55 60 70 71 74 82 73 71 71 28 [533.3]M[472.2] 1315 SVLLPTNKEVLPGW 9.2 66 776.942 2 16.872 2.2 28 48 48 92 95 91 87 95 98 99 34 34 41 28 [299.2]LPTNKEV[453.2] 2030 NWDDMEKLW 5.9 66 618.771 2 24.622 0.5 33 33 39 95 88 88 88 97 28 [415.1]DMEKL[186.1] 2126 LWGSDDMSEPRLNF 9.2 66 833.8777 2 25.733 2.8 40 44 38 40 49 94 87 79 73 78 81 67 76 70 [558.2]DM[313.1]R[374.2] 1925 GRTLKQDPDEVLVAAF 10.5 66 879.9706 2 23.452 2.6 29 32 36 70 44 39 79 87 90 85 85 87 70 70 68 76 [798.4]PDEVL[388.2] 3110 VHVQSHGGASAKSF 9.2 66 706.3561 2 37.466 2 28 98 95 94 94 82 73 71 74 50 44 38 37 37 [99.1]HVQSH[705.3] 1007 KRDRLELSKF 6.6 66 323.6924 4 13.609 0 54 41 41 36 46 71 89 91 93 92 [797.5]LSKF 2588 QTGSGLVQAGF 7.2 66 532.7726 2 31.218 0.8 60 60 86 75 69 65 78 54 73 69 28 [229.1]G[759.4] 3770 ASDQVEDFKEAF 7.9 66 693.3143 2 45.013 0.3 37 43 62 61 92 98 96 96 46 40 84 28 [401.2]VEDF[257.1]A[147.1] 3053 KLLDLLATGSGPSKEF 10.5 66 559.3145 3 36.795 1.4 33 36 51 72 74 85 87 92 93 87 63 58 61 52 54 45 [582.4]LATGS[645.3] 3029 AHCFDFKF 5.3 66 1014.4526 1 36.509 2.4 28 80 80 80 76 75 75 28 [71.0]HCF[537.3] 2363 EMKPALSLGGHASVYY 10.5 66 574.9538 3 28.507 3 35 35 37 54 60 64 68 89 88 74 72 80 87 87 85 28 [756.4]LG[194.1]ASVY[163.1] 4277 MVSQQPLNELF 7.2 66 653.3271 2 51.238 2.9 92 91 91 63 50 69 61 49 53 70 28 MVS[969.5] 4293 KCRLAKKNTPLKHGW 9.9 66 594.0114 3 51.429 1.8 31 36 41 69 74 90 91 75 74 75 91 76 64 62 28 [571.3]KK[312.1]L[508.3] 2977 ETSKAATPAWPF 7.9 66 653.3269 2 35.88 0.7 83 89 89 94 83 73 67 62 58 28 28 28 ETSKA[770.4] 3302 LQSDDDMANAGRLNF 9.9 66 833.879 2 39.723 1.1 40 39 39 46 91 99 93 91 60 58 57 70 61 69 65 [443.2]DDMA[772.4] 984 REPAKEEANGGLFNCF 10.5 66 891.4184 2 13.327 1.1 29 43 62 84 94 95 97 95 89 85 48 43 39 40 45 56 [382.2]AKEEANG[681.3] 2316 T(+79.97)LGVAGGGGRKY 7.9 66 608.2987 2 27.939 1.7 71 74 88 93 91 80 64 57 76 29 28 28 [294.1]GVAG[618.3] 3240 WLNCGFAGF 5.9 66 507.7313 2 39.02 5 28 91 68 75 91 75 71 60 28 [186.1]L[217.1]G[422.2] 2402 EKSQLAGYEAGEAF 9.2 66 750.3543 2 28.974 0.2 44 42 56 40 56 76 93 96 95 75 60 65 85 28 [656.3]GYE[257.1]A[147.1] 2802 GTDKVEDM(+15.99)KEAF 7.9 66 693.315 2 33.818 1.8 42 47 58 80 95 98 97 69 43 39 86 28 [273.1]KVED[404.2]A[147.1] 3311 SKVADLWVW 5.9 66 552.2986 2 39.837 1.4 28 98 96 95 92 93 28 28 28 [87.0]KVADL[471.2] 2517 DNGSGLAGVKF 7.2 66 532.7726 2 30.354 0.9 61 58 65 74 86 80 63 62 60 77 28 [373.1]GL[502.3] 2660 LTENVSM(+15.99)PPLF 7.2 66 632.3199 2 32.082 3 67 78 88 87 72 72 73 94 28 28 28 [214.1]EN[333.1]P[357.2] 2964 MSFKESGALGAEAYEGAF 11.8 66 932.9252 2 35.728 0.5 41 44 44 94 76 63 51 55 88 77 78 90 79 66 58 64 73 28 [365.1]K[344.1]L[128.1]E[638.3] 1512 LCAELGGEMAF 7.2 65 570.757 2 19.033 0.4 50 48 52 81 90 89 61 55 57 72 61 [287.1]ELG[535.2] 1497 SAEELQNMAF 6.5 65 1139.5049 1 18.87 1.1 39 39 46 97 96 62 68 69 77 56 [287.1]EL[591.2] 3769 TESQLAPGGWLF 7.8 65 653.3265 2 45.003 1.3 86 90 89 49 50 52 67 79 59 57 74 28 TES[969.5]

PAGE 287

287 3241 MVSQPGAEGGLLF 8.5 65 653.3287 2 39.028 0.5 92 92 92 71 62 52 51 54 58 57 59 77 28 MVS[969.5] 1584 VVLMHEEPAVRAWPF 9.8 65 890.9649 2 19.823 1.2 28 40 52 59 97 99 94 93 94 70 65 49 39 68 28 [442.3]HEEPA[756.4] 2999 GTDKVEDFQEAF 7.8 65 693.3153 2 36.15 1.1 43 46 57 68 93 98 97 74 47 41 88 28 [401.2]VED[404.2]A[147.1] 3224 KPGGGGGLTMF 7.2 65 511.2589 2 38.83 3 55 61 53 39 35 86 90 88 88 91 28 [396.2]GGLTM[147.1] 3089 YPQVAPTLGPPAYWY 9.8 65 574.9547 3 37.224 1.7 67 67 46 56 54 51 61 80 92 92 85 84 51 46 41 [756.4]LGPPA[512.2] 1801 MVDFRGELCGGRW 8.5 65 509.242 3 22.135 5 28 45 45 51 70 76 94 96 92 85 58 74 28 [705.3]ELCG[399.2] 2955 LTENGEAVGARF 7.8 65 632.3203 2 35.615 0.4 70 75 85 77 90 82 75 49 47 42 57 28 [214.1]E[114.0]GE[601.3] 2084 VRVCDMLRKRPVANPF 10.4 65 476.0143 4 25.24 0.4 28 75 70 71 73 60 49 33 37 41 67 86 85 84 91 87 [1353.7]VANPF 1185 MVGY(+79.97)LGRKF 5.9 65 1150.5459 1 15.498 1.7 93 93 92 84 53 48 63 28 28 MVGY(+79.97)[601.4] 1166 HKVKSAGGVGGPTCGY(+79.97) 10.4 65 799.3647 2 15.307 1.8 28 71 71 88 82 71 59 55 72 92 86 71 60 52 51 28 [364.2]KS[284.1]GG[601.2] 2211 TTGALLGGLLLSGW 9.1 65 679.8884 2 26.724 1.3 80 82 84 93 95 65 63 57 59 61 46 45 47 28 TTGAL[896.5] 4315 AYELVFKGYLY(+79.97) 7.2 65 723.3407 2 51.71 0.8 46 46 68 91 91 80 63 60 63 64 40 [363.1]LVF[704.3] 1800 M(+15.99)GMNKKENASTLW 8.5 65 763.3588 2 22.128 2.3 29 38 42 93 98 91 91 83 72 68 55 53 28 [335.1]NKKEN[558.3] 1833 RLPCVAQDYVTAVNY 9.8 65 856.429 2 22.462 2.1 28 56 84 95 94 85 77 85 77 53 53 45 42 46 50 [269.2]PCVA[128.1]D[810.4] 3107 DADGKSFQF 5.9 65 507.7303 2 37.438 0.8 41 50 63 70 72 77 90 92 28 [573.2]FQ[147.1] 3657 T(+79.97)LGVAMGPVKY 7.2 65 608.2984 2 43.683 4.4 74 80 92 94 84 65 54 71 43 28 28 [181.0]LGVA[675.3] 2851 SKVADLWVW 5.9 65 552.2983 2 34.388 1 28 97 96 92 92 94 28 28 28 [87.0]KVADL[471.2] 2067 KLLDGHSGTAFRVKF 9.8 65 559.3136 3 25.048 0.9 28 35 74 81 84 86 86 77 77 82 71 60 41 57 28 [354.3]DGHS[158.1]A[677.4] 1441 RTRSEGY(+79.97)AM(+15.99)GAQVTLQNVF 12.4 65 742.014 3 18.26 2.6 30 47 41 56 56 67 50 71 58 93 97 79 71 70 87 58 61 73 62 [1147.4]GA[328.2]L[488.2] 967 KPKGPNHFPFELLF 9.1 65 418.481 4 13.109 1.7 28 53 55 60 73 61 67 73 92 91 79 81 62 28 [905.5]PF[129.0]L[260.2] 1695 WGPVDTAKPPGKGPDYVLW 12.4 65 1042.0334 2 21.006 2.5 29 35 38 76 89 95 95 78 63 61 59 50 54 77 87 77 70 68 28 [439.2]DTA[661.4]D[561.3] 3141 LQSDDDMANQRLNF 9.1 65 833.8777 2 37.833 0.5 39 39 39 61 94 98 92 91 82 67 57 44 46 55 [443.2]DDMAN[658.4] 2034 STKWAM(+15.99)QNMGGTNVGENKLW 13 65 1134.5328 2 24.669 2 29 29 35 37 71 69 81 84 91 91 89 75 66 62 60 70 71 74 81 28 [720.3]QNMGG[742.4]L[186.1] 2867 SADKVEDM(+15.99)KEAF 7.8 65 693.3153 2 34.581 1.3 36 40 50 78 95 98 96 72 50 42 89 28 [401.2]VED[404.2]A[147.1] 2244 QTGSGLVAGAGF 7.8 65 532.773 2 27.111 1.6 46 46 71 72 63 64 88 84 80 58 76 28 [543.3]VAG[275.1] 1585 MGVRDGPKLVDASLVRW 11 65 633.6816 3 19.831 1.8 54 54 58 55 55 55 58 75 93 97 97 93 87 64 36 36 28 [840.4]LVDAS[554.3] 3149 VHVQSHGSWARF 7.8 65 705.8541 2 37.939 1.2 28 99 97 97 97 99 28 61 55 54 28 28 [99.1]HVQSH[704.3] 4316 NQT(+79.97)TGCCS(+79.97)ACW 7.1 65 667.1765 2 51.722 0.6 56 54 53 53 61 85 81 74 74 89 28 [581.2]CC[238.0]C[186.1] 3212 GTFT(+79.97)KVAGNVDYKNLVY(+79.97) 11 65 1024.958 2 38.683 2.1 30 29 30 36 58 57 94 89 78 90 96 96 51 42 66 85 69 [713.3]AG[114.0]VDY[355.2]V[243.0] 2855 LLKDEPATGSKLKEF 9.7 65 559.314 3 34.438 0.5 29 66 64 92 96 84 87 87 88 54 48 45 44 44 37 [354.3]DEPATG[732.4] 3030 NNHQESGALEQLSYGAF 11 65 932.9253 2 36.519 1.4 36 36 37 79 82 78 66 70 93 90 61 69 66 72 68 62 28 [493.2]E[215.1]LE[766.4]

PAGE 288

288 1653 FFKKPCGGRTHLAVHY 10.4 65 620.9955 3 20.553 1.7 28 58 58 44 49 40 37 50 62 84 90 95 80 75 90 89 [1020.5]THLA[99.1]HY 3399 KLLDPPSGTATATKLY 10.4 65 559.3145 3 40.763 1.5 30 31 60 74 83 76 69 75 84 88 81 73 66 57 53 28 [469.3]P[241.1]TAT[576.3] 3093 HLKFTEPGTGMMYFYF 10.4 65 656.9736 3 37.264 2 75 76 67 64 66 69 64 61 58 59 72 84 28 49 67 67 [1198.6]M[620.3] 4248 S(+79.97)HWGACLLAALRATW 9.7 65 579.276 3 50.87 0.1 28 83 76 68 72 84 85 68 57 60 71 68 54 50 40 [167.0]H[314.1]CL[882.5] 1353 M(+15.99)GGQGPDAMLLW 7.8 65 646.2949 2 17.271 1.2 41 42 46 51 75 70 69 73 89 93 96 28 [729.3]MLL[186.1] 2245 LAGVGAYGLFF 7.1 65 1114.5927 1 27.12 0.5 72 73 79 54 53 57 67 66 70 86 28 [801.4]F[147.1] 2811 KAPMAMLF 5.2 65 908.4756 1 33.923 2.6 34 59 68 85 72 74 93 28 [296.2]M[202.1]L[147.1] 1577 KNHLMESGSEEELTLSF 11 65 975.9568 2 19.748 2.6 52 51 53 79 82 82 70 60 81 93 97 51 50 63 48 49 29 [492.3]ME[144.1]SEE[690.4] 4133 KSVVSLMRAMTERF 9 65 552.298 3 49.393 1.7 28 87 72 72 72 78 79 60 67 54 55 69 75 28 [128.1]S[1420.7] 2373 SYLSALPLGF 6.5 65 1067.5769 1 28.617 0.2 28 28 86 83 81 83 81 70 73 28 [250.1]LSALP[317.2] 1267 NRVTPDSAAY 6.5 65 1093.5282 1 16.36 0.8 79 88 80 76 67 51 45 45 82 28 [114.0]RV[471.2]A[163.1] 2103 LLELCGAGVAF 7.1 65 546.7914 2 25.463 0.1 89 89 83 51 47 48 71 62 63 72 28 LLE[718.3] 1631 YSKNHDLTEVHARRY(+79.97) 9.7 65 656.9734 3 20.326 0.9 48 46 48 48 81 73 75 87 74 67 67 62 59 61 64 [492.2]H[228.1]T[991.4] 1549 LYPPVVGCPVKW 7.7 65 679.3713 2 19.441 1.3 84 83 95 96 77 65 48 46 48 70 28 28 LYPP[868.5] 1524 KQQYEEGKAELEGSLKELKW 12.9 64 798.4155 3 19.166 1.1 35 39 38 45 43 39 48 48 71 84 94 92 81 81 84 91 87 75 77 28 [1061.5]ELEGSLKE[427.3] 3563 KPEKKAEVPKAGAHW 9.7 64 559.3143 3 42.603 0.4 57 56 54 58 61 68 63 59 46 55 88 90 87 88 28 [1134.7]AGAH[186.1] 3153 QLLPCLRREPKHW 8.4 64 419.7369 4 37.975 2.8 34 35 37 71 73 72 75 64 72 92 88 90 28 [1108.6]PKH[186.1] 1824 KPTAVEDAGAVEGLATPYY 12.2 64 976.4869 2 22.373 0.9 56 56 44 57 72 81 90 75 70 83 73 66 47 49 58 63 73 74 28 [496.3]ED[128.1]A[993.5] 2173 M(+15.99)MAVSTLGGVKPAVF 9.7 64 762.4026 2 26.282 1.2 84 87 96 97 74 53 50 50 56 70 67 58 45 41 31 M(+15.99)MAV[1056.6] 2693 NQQWSLLGEFPQLY 9 64 574.9545 3 32.499 0.2 50 49 55 54 51 68 92 84 69 70 71 59 74 47 [756.4]LG[777.4] 3230 YMAQESQLAGEAYEKF 10.3 64 932.9264 2 38.897 1.8 45 44 51 68 93 91 70 57 49 61 92 81 70 55 46 48 [493.2]ES[369.2]EA[567.3] 3965 GTDKVEDFQEAF 7.7 64 693.3145 2 47.351 0.1 42 47 60 74 94 98 91 60 42 39 92 28 [401.2]VED[404.2]A[147.1] 1367 LKLNVQATGSLKEQF 9.7 64 838.4708 2 17.437 2 28 62 72 65 84 69 91 82 67 63 73 45 56 42 61 [468.3]V[128.1]AT[789.4] 2725 LTENVSFGLHF 7.1 64 632.3202 2 32.88 2.8 74 80 90 54 55 57 85 70 62 48 28 [113.1]TE[300.1]F[454.2] 3245 SKVKVPKVADLLDY(+79.97) 9 64 552.2978 3 39.076 1.7 28 60 57 47 52 54 71 89 91 91 92 77 57 28 [766.5]VADL[471.1] 3339 ASDQVEDFKEAF 7.7 64 693.3138 2 40.132 1 48 54 67 59 91 97 64 64 55 50 89 28 [401.2]VE[519.2]A[147.1] 1604 AWLVEECTSAGEAVLW 10.3 64 882.4189 2 20.03 0.1 40 40 50 89 90 67 60 56 74 81 75 67 56 58 92 28 [370.2]VE[420.1]A[356.2]L[186.1] 2651 DDGYPDVAAVRTMAW 9.6 64 556.2546 3 31.979 2.2 74 77 56 56 69 72 83 60 56 59 84 69 63 50 28 [662.2]V[241.1]R[489.2] 3877 MTPPKSF 4.5 64 404.2065 2 46.281 1.4 78 71 69 64 63 51 51 [788.4] 2809 QLSDDDMKGQRPNY 9 64 833.8765 2 33.901 1.9 44 43 44 56 93 98 93 64 74 57 76 50 49 53 [443.2]DDM[843.4] 3096 SNQEDFKF 5.1 64 1014.4537 1 37.306 1 61 57 71 87 69 68 68 28 [329.1]E[537.3]

PAGE 289

289 1231 SRKGNAASSPF 7.1 64 561.2899 2 15.981 2.4 32 32 43 75 66 67 72 90 97 98 28 [684.4]SSP[147.1] 2724 ASFPLVVAGNVDYKNLDKY(+79.97) 12.2 64 1097.0327 2 32.869 2.1 47 51 70 70 59 78 96 93 65 52 65 96 96 53 47 65 37 37 34 [614.3]VA[270.1]DY[841.4] 2972 LLHKTAVPRVNY(+79.97)F 8.3 64 546.624 3 35.822 0.6 46 56 51 44 46 55 63 77 85 84 71 72 76 [859.5]RV[504.1] 4173 YATTNDGVRPVAF 8.3 64 705.8541 2 49.898 0.1 63 52 44 43 45 65 86 86 86 59 61 61 77 [665.3]GVR[414.2] 949 SVFNAARY 5.1 64 464.2379 2 12.884 0.4 78 78 83 51 58 54 80 28 [186.1]F[256.1]R[163.1] 1061 GEAALY 3.9 64 623.3036 1 14.204 0.2 46 46 78 92 92 28 [257.1]AL[163.1] 1064 RERPLEPPPVKGRLPY(+79.97) 10.3 64 662.0214 3 14.223 1.5 28 49 37 48 56 80 79 71 53 60 76 83 89 90 91 28 [651.4]E[518.3]GRLP[243.0] 3943 YNGLPPF 4.5 64 404.206 2 47.074 1.5 82 80 83 72 73 28 28 YNG[454.3] 1545 FLALGCNGF 5.8 64 471.2315 2 19.395 0.8 28 93 87 77 77 64 68 28 51 [147.1]LA[591.2] 1394 DVEEQPGLGRF 7.1 64 623.8069 2 17.747 0.4 83 82 79 66 47 63 66 64 60 61 28 DV[1013.5] 1032 VKGNDACGSNVF 7.7 64 605.7811 2 13.898 2.4 46 45 45 52 65 72 76 86 85 72 91 28 [687.3]GS[114.0]V[147.1] 1609 VVRGLPLGDKLNF 8.3 64 714.4221 2 20.085 0 28 71 71 76 78 80 59 38 40 44 75 87 79 [524.3]P[526.3]N[147.1] 1299 CHMANGVWGPTHEF 9 64 793.3397 2 16.685 2.9 28 66 59 59 61 81 90 94 92 69 52 46 64 28 [556.2]GVWG[611.3] 2169 NQKVSAELGGHASVYY 10.3 64 574.9536 3 26.229 1 36 35 40 55 53 53 72 89 90 87 82 77 74 74 71 28 [756.4]LGGH[583.3] 1431 RVFDKEGNGTVFPSW 9.6 64 869.9351 2 18.144 4.7 33 72 62 86 90 86 66 48 60 60 84 67 63 50 28 [402.2]DKE[329.1]V[517.2] 2581 T(+79.97)VAELVDLLY 6.4 64 608.2983 2 31.135 1.2 60 59 58 64 73 84 62 62 88 28 [593.2]V[228.1]L[163.1] 1051 KTALTSTTKHLNAKRY 10.2 64 611.6838 3 14.099 1.6 35 39 49 65 75 58 46 78 91 93 92 71 71 61 63 28 [803.4]KHL[632.3] 950 KKSSAAHLPTTW 7.7 64 442.9092 3 12.893 2.5 45 31 58 72 72 77 67 67 77 73 73 50 [1307.7] 1953 S(+79.97)EKPPTFPY 5.8 64 573.2504 2 23.769 1.9 82 93 91 97 95 28 28 28 28 S(+79.97)EKPP[508.2] 3002 RRDLVPTNKKVKYY 8.9 64 594.0116 3 36.181 1.3 28 60 40 48 61 83 82 88 97 94 74 53 53 28 [639.4]PTNKK[553.3] 2459 KLLDAPLGTATATKEF 10.2 64 559.3141 3 29.67 0.9 31 31 69 80 75 67 65 73 90 94 85 62 57 47 48 39 [354.3]D[338.2]TAT[576.3] 3132 YAAPPDVAGNVDYQCVKY 11.5 64 986.9597 2 37.724 0.7 29 29 36 86 76 79 89 94 70 55 58 89 94 46 58 58 67 28 [305.1]P[212.1]VA[270.1]DY[621.3] 1059 TRSSTKGY 5.1 64 450.2322 2 14.174 1 51 56 75 89 71 71 67 28 [344.2]S[449.2] 1940 MLFETF 3.8 64 787.3691 1 23.625 0.5 28 99 99 99 28 28 [131.0]LFE[248.1] 2318 KPGKGTAVVNKERPLW 10.2 64 594.0117 3 27.957 1.1 53 58 49 59 60 58 65 86 87 85 94 88 52 53 37 28 [639.4]VVNKE[552.3] 1313 LMAPSKPKKPNRW 8.3 64 518.2983 3 16.855 1.5 92 90 74 70 54 53 66 88 87 52 33 34 29 LM[480.3]KK[553.3] 1338 LLQPCLALKEPKHW 8.9 64 419.7391 4 17.12 0.4 50 48 44 60 63 71 52 50 52 87 95 92 93 28 [979.6]EPKH[186.1] 2220 MVLRGKTRHF 6.4 64 622.8557 2 26.823 0.3 28 81 83 83 84 87 59 46 54 28 [131.0]VLRGK[541.3] 2105 MLLPTLDPF 5.7 64 1046.556 1 25.494 2.9 91 91 81 54 51 53 52 68 28 MLL[670.3] 1927 LKLDWARVGAYDMFVEGLRVF 13.4 64 829.1055 3 23.469 1.5 29 51 56 56 53 78 59 70 52 52 69 84 76 95 95 88 60 58 59 59 28 [1272.7]D[131.0]FVE[572.3] 1109 MEPVKGW 4.5 64 846.4202 1 14.694 2.8 28 97 97 83 53 56 28 [131.0]EPV[371.2]

PAGE 290

290 2778 MVSLPAAGGQLDF 8.3 64 653.3277 2 33.535 2.1 92 92 92 36 40 49 89 89 68 41 46 59 28 MVS[281.2]AG[560.3] 3051 TQQALTAGAGF 7 64 532.7731 2 36.763 1.8 50 47 50 71 75 92 86 84 56 56 28 [541.3]TAG[275.1] 3963 FLSKSCGFGHGAHVLY 10.2 64 574.9511 3 47.317 1.8 56 51 45 49 61 66 76 82 90 81 78 75 75 69 28 28 [722.3]FGH[640.3] 1751 LTRGFPTF 5.1 64 938.5096 1 21.611 0.3 92 91 87 77 75 28 28 28 LTR[549.3] 3163 YMAQESGALQEAYEKF 10.2 64 932.9246 2 38.097 0.1 35 35 37 79 93 64 52 52 91 84 91 67 63 57 53 57 [493.2]E[215.1]LQE[638.3] 2271 VM(+15.99)VMPAPAACVGHF 8.9 64 723.34 2 27.406 0.7 64 64 73 95 85 75 55 62 51 50 65 88 28 28 [345.2]MP[512.2]G[284.1] 2789 KLLPPFATVAPAQHW 9.5 64 559.3146 3 33.667 1.4 31 35 78 64 64 64 83 78 55 52 67 92 62 77 45 [695.4]A[368.2]A[451.2] 2969 HVHKLAACSGMVPTVAYLW 12.1 64 695.0252 3 35.792 0.2 28 50 41 43 64 68 70 64 51 56 86 80 78 82 54 54 81 86 64 [1003.5]MV[97.1]T[170.1]YL[186.1] 3890 MRKSNSAGVGKPF 8.3 64 460.248 3 46.438 2.4 87 68 54 69 53 66 60 55 57 83 69 71 28 M[799.4]G[372.2] 3961 T(+79.97)CNAAY(+79.97)Y(+79.97) 4.5 64 523.1121 2 47.295 0.5 71 64 46 51 90 91 28 [469.1]AY(+79.97)[243.0] 2379 FMPAGALAVGWGY 8.3 64 670.3268 2 28.69 2.9 28 92 87 81 50 44 48 89 90 86 42 44 36 [147.1]MPA[241.1]AVG[406.2] 4209 TLPHALVPPTSSLY(+79.97)F 9.5 64 574.9541 3 50.362 1.5 30 55 60 58 61 60 61 86 92 92 97 60 60 45 28 [731.4]PPTS[590.2] 1074 RVM(+15.99)DEQGNLKF 7 64 676.8353 2 14.331 0.5 28 94 94 94 70 54 79 56 47 49 28 [156.1]VM(+15.99)D[816.4] 3542 MDAVM(+15.99)VNGVAKLASGALKEY 12.7 64 695.0251 3 42.351 2.3 44 46 48 48 43 36 35 40 75 81 89 94 93 92 87 84 72 55 55 42 [932.4]AKLASGA[533.3] 2079 QNHLCALSSVPF 7.6 63 658.3269 2 25.182 0.3 53 51 58 69 82 77 77 82 76 76 28 28 [492.2]C[184.1]S[430.2] 3822 M(+15.99)VAPQCTSVAKLAGSALKEY 12.7 63 695.0245 3 45.63 1.4 82 68 67 62 45 51 48 50 51 51 90 92 82 68 62 59 62 60 62 46 M(+15.99)[856.4]KLA[748.4] 4212 MVSKGGLGAEPPY 8.2 63 653.3273 2 50.407 2.5 92 92 92 84 58 53 66 60 62 77 28 28 28 MVSK[841.4] 1381 MQQSQSLEY 5.7 63 1113.4897 1 17.603 1.5 55 51 81 93 56 60 61 81 28 [259.1]QS[328.2]E[163.1] 1371 FMAKTHKF 5.1 63 505.267 2 17.478 2.1 93 89 61 43 46 57 85 28 FM[437.2]K[147.1] 2633 GESNADFKF 5.7 63 1014.4531 1 31.768 0.4 89 89 80 55 57 55 57 57 28 GES[722.3] 212 QEPHY 3.2 63 337.15 2 2.834 1.9 28 28 86 86 86 [257.1]PHY 2276 LGPGMSAGAWGGVAQW 10.1 63 772.8677 2 27.467 2.1 29 30 56 56 55 54 59 65 89 83 81 82 84 66 72 45 [670.3]AWGGV[385.2] 1069 EGATNLQEY 5.7 63 512.7332 2 14.279 1 45 45 57 55 51 59 75 94 84 [713.3]EY 1467 GLNSAPDF 5.1 63 820.387 1 18.544 4.2 66 64 78 73 75 91 28 28 [442.2]P[262.1] 1472 LGNSAMPF 5.1 63 836.3967 1 18.594 0.5 76 76 81 92 94 28 28 28 [170.1]NSA[375.2] 1513 WRPTTFAKGDGDFHRW 10.1 63 659.6569 3 19.042 2.5 36 47 39 63 65 73 75 56 56 59 91 86 86 58 71 44 [1159.6]GDF[479.2] 4129 M(+15.99)PPKAPLGTCLKKLY 9.5 63 559.3136 3 49.339 0.7 28 81 84 83 69 56 53 58 71 72 78 83 59 37 28 [147.0]PPK[655.3]K[404.2] 4028 T(+79.97)S(+79.97)ACGGFY(+79.97) 5.1 63 523.1138 2 48.101 2.8 28 69 69 73 74 78 83 28 [636.1]F[243.0] 2197 M(+15.99)PPKALLTGSLKKEF 9.5 63 559.3212 3 26.565 2.4 28 43 75 79 85 87 89 95 88 57 47 45 42 42 37 [469.2]ALLTG[732.4] 1889 TLPNLF 3.8 63 704.3978 1 23.062 0.2 36 81 93 77 28 61 [101.0]LP[374.2] 1317 DLLSSLMGFPPY 7.6 63 447.2248 3 16.887 0.2 29 40 42 47 78 65 67 82 87 92 92 28 [759.4]GFPP[163.1]

PAGE 291

291 2005 ALLSPGM(+15.99)DAGSLTLY 9.5 63 762.8824 2 24.343 2.6 54 63 67 70 57 60 80 53 51 72 65 66 70 80 28 [538.3]M(+15.99)[544.2]L[163.1] 1723 EPGSPCGSASNT(+79.97)W 8.2 63 686.7466 2 21.303 1.1 43 43 51 73 75 71 72 85 88 77 45 54 36 [627.2]SA[568.2] 2744 WEARQANEGVAQW 8.2 63 772.8673 2 33.122 2.1 55 53 61 65 53 84 55 64 66 83 64 69 42 [670.3]A[300.1]V[385.2] 1911 WPMPKYDS(+79.97)CAVVLVVW 10.1 63 986.9608 2 23.291 2.2 28 78 52 68 75 85 50 78 94 92 93 95 28 28 28 28 [639.3]Y[282.0]CAVV[497.3] 1891 GTATAVLVWW 6.3 63 1103.5883 1 23.077 0.1 64 64 76 72 73 93 99 28 28 28 [401.2]VL[471.2] 2455 KSVSKSATLLPALPY(+79.97) 9.4 63 552.3 3 29.615 2.3 28 93 93 93 74 54 54 70 73 61 60 52 52 53 28 [128.1]SVS[1234.6] 2922 KLLDPEATVAKSKEF 9.4 63 559.3143 3 35.234 1.1 30 35 79 87 92 96 94 91 51 43 51 60 43 43 40 [354.3]DPEAT[789.4] 1322 AKMYTASVLY 6.3 63 1146.5874 1 16.942 0.9 66 67 86 55 66 71 75 82 28 28 [199.1]M[422.2]V[276.1] 4326 DGACCY 3.8 63 316.0966 2 51.85 1.4 83 82 75 79 28 28 DG[440.1] 1153 HRESPPAF 5 63 940.4616 1 15.17 2 28 98 95 95 98 28 28 28 [137.1]RESP[315.2] 2241 ACHFAGVYF 5.7 63 1014.4529 1 27.068 2.8 28 87 87 86 77 69 71 28 28 [71.0]CHF[537.3] 2041 LANPKGCRAF 6.3 63 1076.5665 1 24.751 0.3 60 58 69 78 82 67 57 59 65 28 [395.2]K[534.2] 2655 QTGSAVVQAGF 6.9 63 532.7725 2 32.019 0.7 51 51 79 77 55 57 76 57 72 83 28 [841.4]G[147.1] 4247 VFVMPDACRNFF 7.5 63 723.3381 2 50.858 0.9 28 28 98 96 88 80 79 60 59 53 28 50 [246.1]VMPD[738.3] 3762 ESAELGGKMW 6.3 63 554.2605 2 44.922 0.1 57 62 75 96 96 79 73 29 28 28 [287.1]EL[559.3] 972 T(+79.97)SPEVEKPRVF 6.9 63 684.8318 2 13.176 0.4 28 73 71 64 70 74 75 82 91 28 28 [850.4]PR[246.1] 3945 M(+15.99)VDVPF 3.8 63 723.338 1 47.095 0.2 97 97 97 28 28 28 M(+15.99)VD[343.2] 2070 YPGLGSAVGANW 7.5 63 596.2941 2 25.089 1.3 83 88 68 67 57 50 46 52 66 54 56 60 YP[912.4] 3507 MVSQPQEGGLLF 7.5 63 653.3303 2 41.945 2 91 90 89 57 56 52 47 44 52 54 86 28 MVS[709.3]L[147.1] 2675 DVRLLPLRTF 6.3 63 615.3717 2 32.276 0.3 62 58 58 84 87 65 59 57 63 28 [370.2]LL[614.4] 2583 KPGNAATPTNKRLLLW 10 63 594.0115 3 31.155 1.4 49 45 39 37 43 48 58 84 84 85 95 93 92 87 28 28 [639.3]PTNKRLL[299.2] 2940 YCPGFACACDGCHGGFNY(+79.97) 11.3 63 655.5476 3 35.438 1.2 44 47 54 51 50 66 75 80 74 68 70 74 77 86 57 45 46 55 [741.3]A[515.1]G[561.2] 2294 YSPAKLHLRKATAGY 9.4 63 419.7371 4 27.682 0.7 28 81 77 74 50 45 39 39 35 55 68 83 80 82 95 [163.1]S[1014.6]TAGY 2340 SADKVEDM(+15.99)KEAF 7.5 63 693.3144 2 28.226 2.6 34 38 52 67 86 98 92 64 53 45 88 28 [401.2]VED[404.2]A[147.1] 3559 TWELELMW 5 63 554.2627 2 42.55 0.1 29 76 62 93 51 56 59 73 [416.2]L[559.2] 2121 VVKKANPTNKEVPGLW 10 63 594.0104 3 25.669 2.9 28 49 59 69 67 55 72 74 80 91 87 87 61 49 38 28 [837.5]NKEV[453.2] 1496 FNHMAADVCLVSAAMQRY(+79.97) 11.3 63 1053.9547 2 18.858 2.9 62 42 43 59 59 48 47 55 68 70 72 91 91 93 87 51 41 40 [1200.5]SAAM[527.2] 2640 YGRAAPLQAREF 7.5 63 460.2466 3 31.849 1.9 51 48 58 55 58 62 73 62 76 87 88 28 [927.5]RE[147.1] 2894 EMKVAVVLGHGAEGYY 10 63 574.9546 3 34.895 1.6 37 36 40 71 52 49 71 94 95 76 66 77 67 63 72 28 [756.4]LG[777.3] 4333 HVVWGDCLHVVF 7.5 63 705.8546 2 51.936 2.2 28 95 86 76 75 84 93 95 28 28 28 28 [137.1]VV[243.1]DCL[482.3] 2947 YTAKSTANTHVAF 8.1 63 705.8547 2 35.522 0.8 36 42 53 73 55 47 48 55 60 82 85 85 85 [937.5]HVAF

PAGE 292

292 2449 T(+79.97)LGVAGGGKRGY 7.5 63 608.2986 2 29.544 1.6 69 72 87 86 83 74 61 48 61 47 28 28 [294.1]GVA[675.3] 4314 CCDLACPVEF 6.3 63 550.2169 2 51.698 0.8 28 75 71 78 80 74 66 60 60 28 [434.1]A[575.2] 1789 CFEETDLHMVPF 7.5 63 734.3189 2 22.007 1.5 28 28 99 97 90 69 69 85 62 45 45 28 [250.1]EET[228.1]H[474.2] 3590 SVSNAAGDFF 6.3 63 1014.4529 1 42.903 0.2 88 88 88 49 62 69 45 45 59 28 SVS[722.3] 1326 DLLTGAVFF 5.6 63 491.7659 2 16.989 0.2 28 30 84 93 69 62 67 96 28 [228.1]LT[227.1]F[147.1] 1675 DEKGLYNY 5 63 1001.4582 1 20.792 0.8 78 74 82 76 43 43 43 58 [244.1]K[610.3] 2066 YLTKLMTARAEKF 8.1 63 524.6238 3 25.038 2.7 44 46 63 70 62 61 72 88 88 51 45 48 67 [850.5]AR[475.2] 3763 YLVTALM(+15.99)TLLAKHW 8.8 63 559.3137 3 44.932 1.5 28 51 46 46 55 56 57 89 87 85 85 77 78 28 [807.4]TLLA[451.2] 1194 KTDLPVVAFVGRAYTQF 10.6 63 638.0162 3 15.6 0.8 43 42 55 80 94 65 66 65 80 80 86 76 69 41 34 34 44 [344.2]LP[269.2]FVG[766.4] 2279 VKKKAAHLATY 6.9 63 615.3713 2 27.51 0.9 35 35 60 86 86 68 68 82 68 66 28 [355.3]KA[208.1]L[335.1] 2516 WLKLVPTNKEVGLPW 9.4 63 594.011 3 30.344 1.6 33 33 38 59 62 84 82 85 93 90 88 65 52 38 28 [639.4]PTNKEV[453.2] 1543 LETPAVVPAF 6.2 62 522.2908 2 19.377 2.6 65 63 73 75 67 70 63 57 57 28 [1024.6] 1359 KQVNGVAAACVPANGNF 10.6 62 830.4151 2 17.336 2.5 62 53 56 60 53 45 59 76 80 81 87 71 64 62 61 50 33 [767.4]ACV[600.3] 2865 KPDGKGGPTNKRLLLW 10 62 594.0115 3 34.548 1.5 51 51 41 43 45 57 62 71 74 84 94 89 88 86 28 28 [837.4]NKRLL[299.2] 2022 WELYKAVRPLF 6.9 62 474.602 3 24.54 1.7 53 52 43 56 66 91 78 66 73 76 28 [719.4]A[612.4] 2401 NTTVGGGVAQW 6.9 62 545.2699 2 28.962 0.1 50 49 67 69 59 53 70 73 67 74 50 [1070.5] 2097 MLPGAKACMW 6.2 62 554.2613 2 25.391 0.4 61 55 61 72 75 53 59 74 82 28 [771.4]M[186.1] 2387 MVWMHGYSKAFYF 8.1 62 556.2548 3 28.795 2.9 28 28 68 71 54 78 79 73 72 80 60 57 57 [1119.5]A[457.2] 2007 M(+15.99)VALFFTSPY 6.2 62 596.2927 2 24.363 2.3 40 40 40 88 78 75 73 76 80 28 [317.1]L[482.2]P[163.1] 1038 LESTHGKSLF 6.2 62 559.794 2 13.961 2.8 84 57 61 74 75 75 62 46 42 41 L[986.5] 3146 VMPFLT(+79.97)CCPDGMAEDKY 10.6 62 1000.392 2 37.895 2.9 86 86 86 50 58 42 55 84 87 62 43 43 47 52 60 61 45 VMP[544.2]CP[909.4] 1323 FFHNSAAVGSRY 7.5 62 678.3278 2 16.952 0.5 28 92 80 60 54 56 89 94 66 54 40 28 [147.1]FH[272.1]AV[463.2] 2591 KLLDAPETGSKLKEF 9.3 62 559.3149 3 31.261 2.2 30 32 74 84 77 65 82 93 87 58 50 49 51 52 41 [354.3]D[168.1]ETG[732.4] 2658 LLKDAPLGTATATKEF 9.9 62 559.3137 3 32.062 0 31 57 52 74 71 64 64 74 87 92 80 57 48 42 50 43 [807.5]TAT[576.3] 2919 MFKCKVKLRTW 6.8 62 480.6049 3 35.196 0.8 28 28 41 54 60 80 86 90 90 91 28 [637.3]VKLRT[186.1] 2639 LWAMSPHKAGAAPNVAYLW 11.8 62 695.0247 3 31.838 0.7 40 39 45 48 62 68 60 55 60 58 71 72 52 48 63 75 87 93 75 [1601.8]YL[186.1] 4125 ETAMPMTHFLVGM(+15.99)W 8.7 62 556.2538 3 49.285 2.6 53 55 61 59 61 59 63 83 83 93 63 44 56 30 [761.3]HFL[489.2] 2335 FTVLTMF 4.3 62 858.4425 1 28.162 0.6 43 43 43 91 90 92 28 [347.2]LTM[147.1] 961 LLHSSATPRY 6.2 62 382.2087 3 13.034 0.6 62 62 62 82 49 42 53 85 91 28 [363.2]S[259.1]PR[163.1] 2898 M(+15.99)MSKESGALKESDAFAF 10.5 62 932.9263 2 34.944 0.1 38 42 42 62 85 81 78 81 93 92 92 55 40 44 47 45 28 [493.2]ES[57.0]ALKE[638.3] 2543 KKKVLTASHAF 6.8 62 615.3711 2 30.685 1.3 28 44 64 67 76 69 63 67 86 85 28 [855.6]HA[147.1]

PAGE 293

293 4320 YLLFCHERPVY(+79.97)F 7.4 62 556.2553 3 51.774 1.6 29 39 43 65 86 86 68 50 50 74 74 74 [536.3]CH[871.4] 2987 LLKDPEATGSKLKEF 9.3 62 559.3141 3 36.007 0.8 30 41 38 48 92 89 88 87 83 75 64 62 43 43 37 [469.3]PEATG[732.4] 1745 LTMDAKLF 5 62 469.7544 2 21.546 0 96 96 96 41 40 40 54 28 LTM[574.3] 893 KRSLTHGTKNY 6.8 62 435.5738 3 12.196 0.1 49 43 45 48 84 87 91 76 62 63 28 [484.3]THG[506.2] 1442 RRAAPYGFKVVAEY(+79.97) 8.7 62 569.6174 3 18.269 2.1 49 51 65 79 78 66 64 64 84 91 59 40 41 29 [918.5]KV[542.2] 2389 RWM(+15.99)GAHLLAPVVW 8 62 517.9465 3 28.814 0.2 34 63 51 77 62 46 43 85 91 94 96 28 28 [867.4]LAPV[285.1] 2018 QSKRCAAVGVF 6.8 62 583.3119 2 24.493 1.6 44 50 47 60 60 66 66 73 86 94 28 [843.4]GV[147.1] 2624 T(+79.97)CCAMSM(+15.99)Y 5 62 503.1325 2 31.65 0.8 28 28 28 95 94 94 95 28 [387.0]AMSM(+15.99)[163.1] 1130 LEVRGGAEKLGAW 8 62 693.3788 2 14.915 2.3 88 73 63 63 69 63 64 65 66 56 47 50 28 L[1253.7] 3246 TTVEVECDPNARFW 8.7 62 556.2552 3 39.088 1.1 49 54 53 48 46 64 76 78 69 68 87 72 67 28 [1087.4]A[489.2] 1218 TVDVLGTVNNKFF 8 62 485.2619 3 15.841 1.8 42 46 80 84 69 68 77 77 64 55 52 55 28 [200.1]DV[1020.5] 817 SCNPAMF 4.3 62 385.1531 2 11.246 2.2 57 65 60 91 74 41 41 [304.1]P[349.1] 3261 T(+79.97)VKNAGGGRLY 6.8 62 608.2987 2 39.251 1.7 28 61 65 54 83 72 62 66 74 80 28 [522.2]A[327.2]L[163.1] 2729 MDVLDMTYLPTF 7.4 62 723.3386 2 32.935 0.6 28 28 28 78 71 66 75 83 93 85 71 28 [805.3]YLP[248.1] 3637 SADKVEDM(+15.99)KEAF 7.4 62 693.3143 2 43.448 2.8 36 39 52 71 82 96 96 71 41 37 84 28 [401.2]VED[404.2]A[147.1] 1779 DVPLGLFGLPF 6.8 62 587.8287 2 21.898 0.3 28 28 78 69 78 88 75 63 62 76 28 [481.3]L[561.3] 1209 VTKFKLVTKDKY 7.4 62 735.4394 2 15.743 0.7 46 50 78 92 78 87 53 46 48 48 60 47 [328.2]F[128.1]L[734.4] 3228 SNKEDFQF 4.9 62 1014.4537 1 38.88 1 28 70 70 70 88 77 58 28 [458.2]D[422.2] 4249 WEARQANADVAQW 8 62 772.8669 2 50.881 1.7 62 59 43 46 46 82 55 61 61 83 70 73 52 [670.3]A[300.1]V[385.2] 2672 VEHKEYGAMAFAF 8 62 750.3543 2 32.231 1.8 37 35 46 68 83 64 86 91 79 78 70 28 28 [493.3]E[163.1]GA[567.3] 2450 LRVVCEGALKAVVFLY 9.8 62 594.0114 3 29.553 0.3 56 51 37 37 37 67 68 76 79 79 84 94 97 41 38 34 [1068.6]AVV[423.2] 3540 RVFAGAGPNGKCFVHY 9.8 62 574.9545 3 42.331 2.5 29 50 41 57 75 69 63 68 67 67 64 60 62 61 72 72 [1703.8] 3547 DVKVRDQLCRF 6.8 62 460.2466 3 42.417 0.6 34 33 34 68 77 72 64 86 87 88 28 [840.4]LCR[147.1] 3673 YFKFPHRRLAGSAMCLW 10.5 61 695.0248 3 43.877 4.1 28 65 65 38 47 78 88 75 75 82 62 57 60 61 60 67 28 [819.4]R[269.2]A[748.3] 4253 DDAELM(+15.99)AAAPGTFRW 9.2 61 556.2547 3 50.938 2 65 68 58 46 38 43 62 83 72 67 76 89 92 28 28 [761.3]A[225.1]TF[342.2] 3782 WGCVHGLVLY 6.1 61 573.7933 2 45.152 2.7 64 52 52 61 76 77 83 88 28 28 [639.3]LV[276.1] 3525 M(+15.99)MSKNMVLEAGLHSDW 9.8 61 932.9245 2 42.147 1.4 48 49 49 55 61 63 82 90 89 81 76 72 74 28 28 28 [738.3]VLEA[695.3] 2327 LLKPEARTAEPKHW 8.6 61 559.3145 3 28.076 0.7 34 66 58 65 44 50 63 91 93 61 62 63 76 28 [807.5]TA[677.3] 1796 Y(+79.97)CVMAMGTGGPLPGGLLTWW 12.3 61 1095.4834 2 22.078 1.2 28 77 68 92 93 68 61 55 58 68 87 91 72 58 51 51 53 32 28 28 [445.1]MA[403.2]PL[910.5] 1434 HLTHGSGCKAFATTLF 9.8 61 564.2849 3 18.183 1.8 61 58 62 63 81 81 77 78 55 48 52 76 74 48 31 28 [488.2]GS[1039.5] 2715 KNRLKPTNKEVGPLW 9.2 61 594.0119 3 32.75 0.8 42 43 42 43 62 80 81 82 93 86 84 58 50 40 28 [639.4]PTNKEV[453.2]

PAGE 294

294 1572 RAVDTAPQGAPNPDYVLW 11 61 985.4921 2 19.689 0.2 35 37 40 71 95 95 66 43 59 52 44 42 57 78 84 84 87 28 [441.2]TA[776.3]YVL[186.1] 3317 QLLGGARATGPLAPAPW 10.4 61 559.3141 3 39.908 0.1 38 38 46 56 47 47 73 93 92 87 72 74 91 88 32 32 28 [695.4]ATG[210.1]AP[354.2] 1190 SLKNGPVGVFPF 7.4 61 421.2357 3 15.55 1 30 30 31 34 75 78 90 90 83 80 80 28 [596.3]VGVFP[147.1] 2575 RWTTALYLAHF 6.7 61 460.2466 3 31.066 0.8 41 66 53 61 64 77 74 70 67 68 28 [1359.7] 1100 CTKAVGKAKAMSTCY 9.2 61 781.3784 2 14.591 2.7 31 31 33 96 95 91 89 91 49 57 57 56 55 28 53 [332.2]AVGKA[784.3] 2391 MTLGVTSFW 5.5 61 521.2568 2 28.836 0.9 49 56 63 83 69 66 67 67 28 [345.2]G[620.3] 1640 KYAPPPVWLKNF 7.4 61 487.2747 3 20.416 0.1 36 41 50 70 69 89 94 90 53 40 53 43 [556.3]PVW[502.3] 3049 NTVNGPALVALDLPNF 9.8 61 552.298 3 36.74 0.2 51 51 52 59 53 56 83 88 91 67 60 52 58 48 53 51 [582.3]ALV[770.4] 4137 QAEM(+15.99)FSQLKEYQAEF 9.2 61 932.9264 2 49.435 1.8 55 60 63 74 54 73 55 92 86 87 72 34 38 39 28 [837.3]LKE[638.3] 1884 KSVLLCPEVYKMAAANLVT(+79.97)F 12.3 61 759.7183 3 23.011 0.8 37 37 45 52 54 52 66 68 60 59 55 41 48 53 60 80 85 87 88 87 [1603.8]NLVT(+79.97)F 2142 RWLADWKVFSSKEGKAATKAGSLKEALY(+79.97) 17.2 61 1074.2209 3 25.922 2.2 28 53 40 45 46 57 59 52 65 84 67 67 88 75 76 87 67 59 58 60 60 54 55 84 86 49 48 32 [1201.6]S[215.1]E[185.1]A[628.4]KE[427.2] 4146 T(+79.97)KVCKYDVGNASAPRHF 10.4 61 986.9601 2 49.554 1.6 82 54 39 50 70 82 73 78 58 51 83 56 49 49 55 74 28 T(+79.97)[458.3]Y[385.2]A[695.4] 2880 YATKSTAVASGHAF 8.6 61 705.8545 2 34.734 0.4 94 92 74 54 48 64 68 74 46 46 44 50 68 28 YA[1157.6] 1082 LRKPM(+15.99)RGHERKKSVY 9.2 61 951.0336 2 14.407 2.6 67 70 45 53 44 86 61 60 79 96 72 29 29 61 61 [641.4]R[323.1]R[605.4] 1157 REEGKAPGATFPF 8 61 703.855 2 15.22 2.5 28 94 73 67 62 58 79 83 61 60 67 28 28 [156.1]E[482.2]G[563.3] 776 MS(+79.97)FGNCADF 5.5 61 536.17 2 10.686 1.6 28 66 73 84 75 80 84 28 28 [445.1]G[114.0]CA[262.1] 3024 QPLSGALEGSRAM(+15.99)NLY 9.8 61 574.9543 3 36.442 0.3 57 60 50 49 44 47 54 67 78 69 68 81 57 55 79 57 [1095.6]A[537.2] 1242 RTDVYGGNTY 6.1 61 573.2645 2 16.101 0.4 80 80 94 28 37 63 79 53 54 38 RTD[754.3] 3500 LLKANVGATGPLAGAHW 10.4 61 559.314 3 41.866 0.1 34 46 46 51 49 50 54 80 84 81 67 71 89 79 58 61 28 [695.4]ATG[210.1]A[451.2] 4339 ACMPNSF 4.3 61 385.1538 2 52.01 0.4 28 67 67 81 73 79 28 [305.1]P[348.1] 4251 DCSPVLVCGPAQYELLVY(+79.97) 11 61 1024.9586 2 50.903 0.5 28 28 28 28 28 98 95 70 54 42 51 81 91 69 65 85 84 65 [501.2]LV[328.1]QY[242.1]LV[243.0] 3062 VHAKSRLF 4.9 61 479.2858 2 36.897 1.5 71 63 52 52 67 70 80 28 [678.4]L[147.1] 2912 LWAYNGMF 4.9 61 1001.4579 1 35.113 2.9 53 53 61 83 71 66 70 28 [370.2]Y[449.2] 1643 GKSVLESSNKVHKPTDLLSTF 12.8 61 763.0811 3 20.458 0.2 72 82 93 96 86 60 54 49 47 76 44 37 43 80 46 40 41 88 55 50 31 [57.0]KSVL[909.5]P[329.2]L[335.1] 1363 WSLDLLCPTKKKEF 8.5 61 854.4604 2 17.384 0.1 28 86 86 92 86 51 48 56 60 64 80 38 38 35 [186.1]SLDL[542.3]K[404.2] 572 M(+15.99)WECY(+79.97) 3.1 61 414.11 2 7.738 1.5 28 82 82 82 28 [147.0]WEC[243.0] 1028 LRTFAVGGGGNALY 8.5 61 698.3745 2 13.848 2.7 52 52 48 47 61 79 77 75 61 58 58 68 83 28 [1100.6]L[163.1] 3168 LWLS(+79.97)PVVEKLASGAAYLW 11 61 695.025 3 38.158 2.9 28 28 28 28 28 85 84 74 75 87 79 72 59 58 71 74 77 53 [676.3]VV[257.1]L[819.4] 4245 LLKSNKGSVF 6.1 61 364.8854 3 50.824 0.7 67 75 67 45 38 41 54 58 71 88 [926.6]F 1602 EES(+79.97)TVLMKFVGVLKW 9.1 61 615.9775 3 20.015 2.3 28 93 82 56 49 55 48 47 28 96 94 83 66 54 28 [129.0]ES(+79.97)[719.4]VGV[427.3] 1303 LSLTPDF 4.3 61 396.7096 2 16.736 2.2 28 28 79 81 88 91 28 [313.2]TPD[147.1]

PAGE 295

295 4149 LLPSAGLRTAEPKHW 9.1 61 419.7367 4 49.588 1.6 28 65 69 56 49 32 32 41 55 83 90 95 92 92 28 [908.5]AEPKH[186.1] 3735 EM(+15.99)QAM(+15.99)SQLEKYKEAF 9.1 61 932.9258 2 44.604 0.5 28 65 50 53 58 94 83 93 83 83 60 37 37 54 28 [622.2]SQLEK[638.3] 3956 MPLVYATGRKGW 7.3 61 460.2468 3 47.23 2.9 68 57 57 90 85 68 61 66 87 28 28 28 [341.2]VY[229.1]R[371.2] 1428 FLKVNEPVKHSMMY 8.5 61 574.9609 3 18.119 1.4 48 56 73 65 45 52 54 58 73 75 75 72 72 28 [1703.9] 1292 MVAPQW 3.7 61 731.3566 1 16.615 2.9 85 78 57 48 46 47 M[581.3] 1735 FDQGLNGLKRLSDF 8.5 61 805.422 2 21.433 2.2 51 61 57 98 95 71 46 44 65 58 44 43 57 56 [390.2]GL[1030.6] 1374 QMQSQEALY 5.5 61 1097.4958 1 17.519 2.4 51 58 60 89 57 61 63 74 28 [387.2]S[604.3] 1345 MTSGGLLF 4.9 61 413.2126 2 17.191 0.4 28 94 92 93 91 28 28 28 [131.0]TSGG[373.2] 2864 TAMKAMEPKPKF 7.3 61 460.2463 3 34.538 1.7 55 59 69 61 64 76 81 82 80 33 33 28 [633.3]EPK[372.2] 1405 CQLGVAPGVAMGY 7.9 61 633.3032 2 17.871 2.1 70 58 62 62 66 67 75 56 61 64 62 52 28 [1246.6] 1122 STAAPAAGNSKLKW 8.5 61 701.3768 2 14.833 1.6 36 40 49 77 81 74 65 64 63 78 81 79 28 28 [330.2]P[400.2]K[427.3] 3213 MRPLVVFLGLLSKDDKKPY(+79.97) 11.5 61 767.0815 3 38.695 0.7 54 39 38 41 45 28 83 75 62 66 82 78 75 76 85 76 56 45 38 [695.4]F[283.2]L[330.2]D[596.3] 2840 LDAVRMHAGRHSTVAYLW 10.9 61 695.025 3 34.257 2.4 40 41 47 51 52 67 54 63 67 79 78 79 68 50 50 72 74 51 [2064.0] 2561 Y(+79.97)CALVKLVSTVGNLY 9.1 61 574.955 3 30.899 1.8 28 67 55 56 76 86 93 96 28 44 42 43 53 80 54 [629.2]KLV[458.2]L[163.1] 1869 EERQDEEVAEELNQMW 9.7 61 678.9619 3 22.844 0.1 28 45 38 31 34 66 75 75 90 97 96 89 46 45 51 58 [1014.4]AEEL[559.2] 2595 RLLLVFKPSCLF 7.3 61 479.2872 3 31.303 1.5 40 40 58 53 53 28 81 79 80 91 91 28 [741.5]K[97.1]SCL[147.1] 1254 RCKKAGFGPVELEEHRKY 10.9 61 716.3774 3 16.229 0.1 44 43 59 57 46 43 67 56 53 64 85 89 95 97 90 38 28 28 [1043.6]ELEEH[447.3] 2465 VM(+15.99)VLDS(+79.97)DLLTPF 7.3 61 723.3372 2 29.74 2.6 65 68 68 86 28 28 37 89 90 72 63 28 [345.2]L[397.1]LL[345.2] 3834 SADKVEDM(+15.99)KEAF 7.3 61 693.3151 2 45.78 1.7 34 36 44 53 84 98 93 64 54 46 87 28 [401.2]VED[404.2]A[147.1] 2091 FFRASFLLLTGTKGY 9.1 61 574.3191 3 25.318 0.4 28 76 67 58 57 64 82 93 90 87 67 37 35 32 28 [755.4]LLLT[506.2] 1685 STPTAPTARGS(+79.97)VLLAYVLW 11.5 61 695.025 3 20.906 0.8 58 58 51 43 34 37 45 54 72 75 80 66 42 73 77 78 83 88 28 [939.5]S(+79.97)[559.3]VL[186.1] 1680 LKVGKSVLLVGKFGGGGHPVMRVEY 15.1 61 876.4979 3 20.847 2.3 28 32 36 55 57 64 75 96 81 74 74 72 80 71 59 72 82 91 80 52 41 32 32 33 34 [711.5]LL[284.2]F[171.1]GHP[777.4] 956 KGSSSDT(+79.97)TY(+79.97) 5.4 61 369.1219 3 12.971 2.5 59 50 52 81 81 68 56 60 35 [272.1]SS[640.1] 1838 MNQPVGQPSAEELQNMW 10.3 61 653.6295 3 22.512 0.3 43 41 41 42 43 66 57 67 65 76 95 97 94 48 45 59 41 [1009.5]EEL[559.2] 3071 TRLLPAGQVKF 6.7 60 615.3713 2 37.013 1 73 70 78 78 74 73 56 39 46 45 28 [1210.7] 1040 QLLVGNEQAF 6 60 373.5317 3 13.979 2.9 62 62 69 59 63 64 73 50 60 38 [1099.6] 2298 RKALLKFRSEY(+79.97)F 7.3 60 546.6241 3 27.735 1 34 39 43 59 67 68 73 57 76 89 87 28 [1099.7]EY(+79.97)[147.1] 2227 VFLTMF 3.6 60 757.3952 1 26.904 0.1 28 28 92 91 92 28 [246.1]LTM[147.1] 2384 RALMAPPTNKKLRHF 9.1 60 594.0118 3 28.75 2.6 50 56 61 59 64 81 71 71 81 97 75 41 34 28 28 [542.3]P[198.1]NK[681.4] 1835 MQHLHEVLKPF 6.6 60 460.2473 3 22.492 1.7 63 43 45 46 78 78 69 67 73 69 28 [1359.7] 1571 LYAFTHLGMGKLGY(+79.97)NW 9.7 60 650.9703 3 19.681 0.4 55 59 63 60 62 69 44 43 61 76 83 66 61 43 50 63 [1090.5]K[713.3]

PAGE 296

296 1614 YVGLRVDGNQVCY 7.8 60 743.3625 2 20.14 1.5 66 46 44 52 83 77 71 75 66 49 52 53 44 [432.2]R[878.4] 3831 LKLT(+79.97)KSASALLKHW 8.5 60 559.3131 3 45.737 2.7 29 29 37 39 40 76 75 78 86 87 83 73 77 28 [908.5]ALL[451.2] 1379 MQPSTHATLCASPYY 9.1 60 557.2484 3 17.583 2.5 55 50 42 38 39 69 75 70 73 80 83 90 78 28 28 [966.5]CAS[423.2] 4135 RRLVCAGLGYASHRY 9.1 60 574.6402 3 49.414 2.7 28 42 37 46 45 53 66 78 89 90 85 84 59 54 40 [868.5]GYAS[456.2] 4190 M(+15.99)VDVPF 3.6 60 723.3382 1 50.122 0.1 92 92 92 28 28 28 M(+15.99)VD[343.2] 882 MKQKAEATTGSRPF 8.4 60 517.9379 3 12.061 2.8 42 38 37 63 80 86 89 86 62 60 67 70 28 28 [515.3]AEAT[645.3] 2119 MLWGVGLCQLW 6.6 60 653.3259 2 25.649 2.8 36 70 55 74 58 57 53 52 46 88 68 [987.5]L[186.1] 2519 VMAHAPGVAAAM(+15.99)QCFF 9.6 60 556.2547 3 30.385 2.5 45 46 48 58 64 58 63 69 72 78 84 78 47 57 60 28 [904.5]A[672.2] 278 RLATAW 3.6 60 359.2038 2 3.699 5.4 68 75 84 54 46 31 [269.2]A[358.2] 3897 KVALGKVLTPKAHS(+79.97)F 9 60 559.3143 3 46.523 0.5 39 37 42 45 42 43 54 79 75 69 72 87 92 92 28 [1134.7]AHS(+79.97)[147.1] 592 WCS(+79.97)VY 3 60 369.1218 2 7.996 0.2 28 81 81 81 28 [186.1]CS(+79.97)V[163.1] 2193 WKEDDSGVGSGKLCW 9 60 833.8798 2 26.511 0.4 29 48 42 89 95 77 75 71 72 69 68 46 43 45 28 [443.2]DD[974.5] 4299 MKARGVGKPRGPLW 8.4 60 518.3 3 51.501 2.5 86 68 48 46 59 73 76 74 72 71 50 47 39 28 M[1402.8] 2253 SVDTGNM(+15.99)KF 5.4 60 507.7306 2 27.209 2.2 70 70 71 48 48 50 48 83 48 [720.3]K[147.1] 1208 KDTSGRGKFF 6 60 381.5374 3 15.735 2.2 43 40 43 66 70 78 79 74 77 28 [1123.6] 1580 Y(+79.97)WVQLTTTVMALEANY 9.6 60 991.9512 2 19.774 0.9 30 40 38 40 82 84 89 69 67 71 65 67 77 49 49 38 [656.2]LTT[992.5] 3889 M(+15.99)YQLGASQESPY 7.2 60 695.3037 2 46.426 0.8 28 94 83 80 64 46 47 60 63 64 58 28 [147.0]YQL[819.3] 2113 MMKGACPTNF 6 60 550.2396 2 25.576 1.3 91 88 76 43 48 73 61 38 41 37 MM[818.4] 1853 FHERGVLRLF 6 60 637.3613 2 22.679 0.8 28 28 57 56 67 73 83 85 91 28 [725.4]LRL[147.1] 2981 ETHVAGS(+79.97)AAVRM(+15.99)RW 8.4 60 556.2543 3 35.932 2.1 49 50 57 53 52 71 78 80 78 78 86 48 28 28 [761.3]A[170.1]R[489.2] 2732 LM(+15.99)GVGVLF 4.8 60 426.2387 2 32.968 0.7 61 60 59 51 56 78 84 28 [572.3]L[147.1] 2659 LHFMTDDVTGGPAREHW 10.2 60 656.9733 3 32.071 1.7 28 28 61 60 69 79 82 69 39 39 58 80 77 64 60 47 73 [744.3]D[314.2]P[679.3] 1664 RPMKLVVAW 5.4 60 367.2204 3 20.671 2.1 55 61 55 57 73 87 59 59 30 [625.4]V[356.2] 3300 NQPSENSLGTRLMLY 9 60 574.9545 3 39.701 0.6 50 36 37 37 47 44 46 77 95 88 85 66 49 79 59 [869.4]GTR[520.3] 1439 AHY(+79.97)PKGYNVKDLLVS(+79.97)FF 10.2 60 540.2514 4 18.243 1.4 29 57 47 48 53 72 53 39 40 82 87 90 92 86 39 59 39 [1109.5]KDLLV[461.1] 2108 LEGALLW 4.2 60 801.4517 1 25.521 1.5 48 53 54 77 78 78 28 [782.4] 3279 KVLVTVPTNKEYLLY 9 60 594.0131 3 39.468 0.3 38 38 57 58 58 28 86 85 85 92 87 57 38 57 28 [639.4]PTNKE[552.3] 3645 MTAPKSCGVLKPF 7.8 60 460.2468 3 43.54 2.7 44 43 50 65 70 70 78 80 60 57 63 65 28 [718.3]G[584.4] 931 T(+79.97)SPAPGGSHKGVFDTY 9.6 60 567.5829 3 12.66 1.5 28 73 68 61 50 55 58 46 63 67 90 79 67 59 59 28 [999.4]G[625.3] 3891 Y(+79.97)TVALELGKGKGMLY 9 60 574.9547 3 46.448 2.3 51 40 35 48 50 64 89 91 92 70 50 51 55 61 44 [756.3]LGK[649.3] 2513 VYGGSQEQF 5.4 60 507.7302 2 30.315 0.5 28 63 72 80 74 47 80 62 28 [319.2]G[215.1]E[275.1]

PAGE 297

297 2828 KNHTKPKMMAM(+15.99)NLY 8.4 60 574.9551 3 34.121 1.2 38 37 48 52 45 45 70 78 85 84 60 52 82 56 [964.5]MA[261.1]L[163.1] 1440 RTLCKDSKAEKENTLQTY(+79.97) 10.8 60 736.6822 3 18.251 2.1 37 39 49 52 56 57 56 58 97 96 90 87 40 41 55 55 56 46 [931.5]AEKE[800.3] 2875 FCKLVGPGVRGCLCHCNY 10.8 60 656.9734 3 34.669 0.4 55 55 52 49 56 64 63 59 64 56 57 67 70 61 61 65 67 47 [1949.9] 2705 VFPLGQYGAAQLASGAAYLW 12 60 695.025 3 32.646 1.9 54 54 46 35 35 37 61 64 71 75 60 79 80 51 47 53 76 79 77 54 [1244.7]A[748.4] 3489 KVSAVCY 4.2 60 385.2003 2 41.742 2.8 28 61 57 55 74 77 65 [750.4] 2883 VPLVGVFGTF 6 60 518.2985 2 34.763 2.4 28 28 59 73 87 96 72 58 60 34 [408.3]GV[452.2] 1663 AKPVLGAAMTDY 7.2 60 618.8165 2 20.663 2.9 28 31 35 99 97 96 91 76 51 44 35 28 [296.2]VLGA[581.2] 2475 TNANEGVAKW 6 60 545.27 2 29.855 0.3 44 43 60 59 53 57 70 86 94 28 [685.3]AK[186.1] 2900 GPKGDVVGTGPASKPKY 10.2 60 829.4488 2 34.966 0.3 65 67 56 51 43 48 71 59 58 72 58 61 73 68 53 58 45 [1638.9] 2430 HLHFTGTSCGSYSAHKAF 10.8 60 650.9702 3 29.321 2.3 28 28 86 83 77 75 45 44 49 82 86 78 67 59 57 49 45 28 [250.1]HF[449.2]GS[804.4] 4311 Y(+79.97)PKGAS(+79.97)SY(+79.97)HATDPW 8.4 60 607.2104 3 51.652 0 28 69 40 45 49 53 79 86 88 84 64 58 57 28 [850.3]Y(+79.97)HA[499.2] 3597 GLLASSKY 4.8 60 419.7368 2 42.985 0.7 28 94 75 71 70 80 28 28 [57.0]L[271.2]S[291.2] 2657 HLKALLLVLRLF 7.2 60 479.3214 3 32.05 0.9 37 49 61 79 82 65 45 48 54 74 89 28 [449.3]L[594.4]L[147.1] 1227 YGAVVYANALLPPY 8.4 60 504.2708 3 15.934 2.5 56 49 44 45 72 80 79 72 77 76 53 49 48 28 [489.3]Y[839.5] 1739 FFM(+15.99)ALELLDMTGNKAW 9.5 60 634.9755 3 21.483 0.4 28 69 34 34 47 73 74 88 88 58 50 51 85 71 68 28 [867.4]LD[289.1]N[385.2] 2493 T(+79.97)PSQEQSLKETQVYF 8.9 60 932.9234 2 30.075 1.7 28 88 88 81 88 52 47 49 93 90 55 33 33 35 28 [181.0]PSQE[328.2]KE[638.3] 4262 TSKNSGGGGQLW 7.2 60 596.2924 2 51.05 1.9 43 48 59 60 63 50 64 51 55 65 85 68 [873.4]L[186.1] 2231 KSMQSVPLPQAM(+15.99)NLY 8.9 60 574.9565 3 26.958 0.3 37 34 38 36 54 56 89 88 51 45 74 77 68 85 57 [660.3]PL[557.2]L[163.1] 2645 VSDSGAGFQF 6 60 507.7299 2 31.909 0.1 40 42 50 70 74 74 86 72 55 28 [516.2]G[422.2] 1773 GKFQAAGCGDAVTMFAY 10.1 60 868.8944 2 21.834 2.6 34 33 57 57 93 75 61 67 83 87 74 63 65 46 46 37 28 [460.2]A[231.1]GD[783.4] 3835 ETSQQGLLWPF 6.6 60 653.3269 2 45.79 0.7 85 89 87 57 44 51 63 89 28 28 28 ETS[426.2]L[430.2] 872 RRPGRKLHGSRY 7.2 60 741.93 2 11.933 1 28 55 32 32 51 77 75 71 85 86 88 28 [1000.6]GSR[163.1] 2585 S(+79.97)AGRGAPPAASRTMAW 9.5 60 556.2552 3 31.188 0.5 35 35 39 60 61 66 84 55 65 78 80 92 64 58 45 28 [579.2]P[239.1]SR[489.2] 3005 KLELLLAPFW 6 60 615.3717 2 36.223 5.7 47 44 49 71 94 82 75 73 28 28 [483.3]LL[501.2] 2720 QTGSGLVQAGF 6.6 60 532.7732 2 32.816 1.9 45 38 38 76 84 85 89 51 54 63 28 [373.2]GLV[403.2] 2461 RLVCRGLAKYNF 7.1 60 480.604 3 29.686 2.5 43 45 49 62 75 84 77 59 55 47 53 59 [627.4]G[736.4] 1325 VELTQVFF 4.8 60 328.1792 3 16.983 1.4 30 41 55 78 61 82 98 28 [570.3]VF[147.1] 2123 QLS(+79.97)KPGASGSSPVDAW 9.5 60 556.2545 3 25.701 1 36 36 34 55 53 58 61 69 67 88 88 88 57 55 57 40 [905.4]SSP[471.2] 1917 KCKFTANDGSAEELKNMW 10.7 60 691.3255 3 23.356 2.2 28 49 51 45 47 57 53 51 58 83 87 94 76 73 59 52 56 43 [964.4]SAE[801.4] 1286 Y(+79.97)HATQPTVPPGPTF 8.3 59 796.8591 2 16.551 2.2 81 73 69 57 54 83 86 28 75 42 52 48 50 28 Y(+79.97)[437.2]PT[695.4] 2907 WWPNHLKGKVSGPACRHPF 11.3 59 739.7137 3 35.052 0.9 28 59 41 37 38 61 67 54 45 47 55 66 77 84 82 80 82 87 28 [1486.8]ACRHP[147.1]

PAGE 298

298 3980 ES(+79.97)SKYYLKEYKEAF 8.3 59 932.925 2 47.527 1.4 35 35 53 74 87 62 75 67 87 70 47 45 61 28 [511.2]Y[404.2]E[638.3] 2943 FLKGSLAQTGAMDTPW 9.5 59 861.9284 2 35.469 1.4 54 65 82 70 52 49 41 38 44 58 58 70 90 82 61 28 [260.2]K[816.4]DT[283.1] 2984 GKNMVVRGYRLF 7.1 59 480.6034 3 35.963 1.2 38 56 55 67 70 57 66 70 88 85 28 28 [841.5]YR[260.2] 2252 KLKLECAFY 5.3 59 557.8005 2 27.198 2.3 28 59 79 84 77 74 74 28 28 [369.3]L[613.2] 2712 VTTTNGSGMF 5.9 59 507.7306 2 32.72 2.1 36 36 66 76 75 72 58 67 76 28 [995.4] 2623 FPRVVPNHPKKGHY 8.3 59 419.737 4 31.639 4.9 28 28 28 28 85 85 63 64 62 67 86 73 74 52 [499.3]VP[476.2]K[357.1] 3571 MVSKAPGDTTLW 7.1 59 653.3264 2 42.692 4.1 86 86 61 58 56 53 67 63 65 46 36 28 MV[1056.5] 2748 FGKNSVARMHLLQRPF 9.5 59 476.0149 4 33.179 2.7 40 48 65 59 74 58 55 58 41 34 53 81 78 81 86 28 [1240.7]L[128.1]RP[147.1] 2288 WALPGPVKEGEAMF 8.3 59 511.2588 3 27.609 0.4 49 47 47 55 58 65 59 61 73 70 60 60 71 49 [1512.7] 1305 LWGSDDSDNKGVNLF 8.9 59 833.8904 2 16.755 1.7 41 44 43 44 63 92 84 77 72 81 53 41 42 51 55 [558.2]DS[229.1]K[530.3] 4023 Y(+79.97)RLLKSFKPF 5.9 59 460.2468 3 48.039 1.8 38 44 38 69 75 82 91 95 28 28 [753.4]SFK[244.1] 2570 GHCRKY 3.6 59 763.3663 1 31.005 0.6 28 87 81 65 63 28 [57.0]HC[447.3] 1256 RALGKNKSPKEVLGPW 9.5 59 890.5126 2 16.247 2.7 67 68 72 74 78 69 53 48 49 56 84 82 41 37 32 28 [1079.7]EV[453.2] 4185 RHKSGPTAAGLCRY(+79.97) 8.3 59 532.9216 3 50.053 2.4 31 31 54 78 77 72 62 60 63 78 70 63 54 28 [1577.7] 1515 LENQVQMGHGDFLLW 8.9 59 596.2925 3 19.062 2.7 51 47 49 36 38 36 48 67 69 81 90 83 79 78 28 [1036.5]GDF[412.2] 1220 TTPPTAGKEVGPLW 8.3 59 727.3894 2 15.859 2.1 44 44 49 72 62 56 60 68 70 83 79 53 53 28 [882.4]V[453.2] 3145 VQSPALTGTGLDM(+15.99)GY 8.9 59 763.3657 2 37.883 2.6 40 39 39 67 71 60 58 58 77 81 91 64 53 49 34 [854.4]GL[482.1] 2514 MVSQNLALADPF 7.1 59 653.3275 2 30.324 2.3 91 89 88 66 35 36 50 47 45 47 80 28 MVS[725.4]P[147.1] 2334 MDVLMDTYLPTF 7.1 59 723.34 2 28.151 2.5 28 28 73 63 57 51 69 82 89 76 59 28 [805.3]YL[345.2] 1500 HHVRKLPMLNDAKERTLLTPHF 13 59 885.1528 3 18.908 2.5 28 92 84 84 78 52 51 39 40 39 42 43 74 86 61 80 85 51 44 45 62 28 [137.1]HVR[1010.6]E[156.1]TL[595.3] 1501 VTFGGPPSLLY 6.5 59 384.2087 3 18.916 2.1 72 73 62 69 77 78 84 33 33 33 28 [558.3]P[476.3] 911 KNKSVSVPGKKPSDW 8.9 59 414.9812 4 12.413 2.3 56 45 49 64 75 75 59 45 46 60 83 83 84 28 28 [1024.6]KPS[301.1] 2609 KLELLLAWPF 5.9 59 615.3715 2 31.474 5.3 46 44 54 53 94 85 76 76 28 28 [483.3]LL[501.2] 2359 TVLSPGVLGREPHKW 8.8 59 419.7371 4 28.452 0.6 31 31 34 87 73 67 57 55 66 55 51 68 86 88 28 [313.2]S[805.4]HK[186.1] 4350 SENPGGM(+15.99)PF 5.3 59 476.1986 2 52.148 2.4 38 38 49 60 83 75 76 78 28 [427.2]G[448.2] 1014 RKLGTLNTNKF 6.5 59 646.3775 2 13.689 0.2 73 74 68 38 37 43 62 57 51 76 65 [1272.7] 2336 SVQVNASAQW 5.9 59 545.27 2 28.171 0.3 37 37 37 83 69 72 72 65 70 43 [314.2]V[657.3] 2727 SYPKPGDTVDDRTFWW 9.4 59 657.3072 3 32.901 0.5 28 67 52 51 60 66 67 55 45 48 87 86 82 42 42 55 [1059.5]DRT[519.2] 3307 LLKPCPYRKAMLGW 8.2 59 419.7364 4 39.785 3.8 68 79 75 66 62 58 54 34 38 48 49 69 87 28 [1413.8]G[186.1] 4286 RKAKAAEPLVF 6.5 59 615.3714 2 51.346 0.6 61 58 63 75 90 91 91 28 28 28 28 [483.3]AAE[456.3] 2684 EWCM(+15.99)YPDAATCFWDVF 9.4 59 1000.3922 2 32.384 3.6 55 55 55 36 70 55 65 64 63 65 84 93 29 44 38 61 [1183.4]CF[547.2]

PAGE 299

299 1043 WKLTRGQKAF 5.9 59 412.2389 3 14.019 2.8 70 84 69 88 68 56 39 38 43 28 [186.1]K[113.1]T[687.4] 2741 VKKKAAHLTAY 6.5 59 615.3716 2 33.09 0.4 33 33 42 93 93 80 77 65 56 42 28 [355.3]KAA[585.3] 4287 KKSKPLLGLF 5.9 59 377.5803 3 51.357 2.7 56 55 57 58 61 68 63 67 71 28 [1111.7] 2006 APKKAAVFGGSHRYY 8.8 59 826.4375 2 24.352 1.6 53 44 44 59 66 67 67 75 69 66 59 51 56 50 48 [1632.9] 1182 KACPPVAGTF 5.9 59 330.8401 3 15.473 1.8 33 32 32 28 87 88 86 62 59 76 [399.2]PVA[305.1] 1724 YLCHGFQF 4.7 59 507.7303 2 21.312 3.1 28 28 28 28 96 79 90 89 [516.2]G[147.1]QF 2060 DDHVAHSWNPFRW 7.6 59 556.2554 3 24.964 0.4 71 57 60 48 44 59 58 68 63 85 89 28 28 [1061.4]PF[342.2] 2141 LHWCTVMAHLFF 7.1 59 752.8643 2 25.913 1 29 29 62 81 72 64 57 63 92 95 28 28 [436.2]C[402.2]HL[294.1] 1092 YYGSVGFKTSNSQAVEPRW 11.2 59 726.0189 3 14.512 1.5 52 51 46 51 52 50 55 67 42 39 39 82 87 97 91 72 59 47 28 [1203.6]SQAV[568.3] 2592 YSCDSAFKGVPLAPTYSY 10.6 59 656.9728 3 31.27 0.4 91 91 91 69 52 48 48 60 61 72 53 59 72 51 37 32 32 28 YSC[1596.8] 4257 YLPAEPGPVKLW 7 59 457.2563 3 50.983 2.1 42 45 53 90 90 85 72 28 58 53 54 28 [373.2]AEP[680.4] 3696 KLLDGHTHLGAKVTW 8.8 59 559.3127 3 44.148 2.5 29 38 57 59 61 64 76 89 82 77 68 56 44 43 28 [764.4]HL[642.3] 1915 KWNKDLSYSKPRKF 8.2 59 898.9946 2 23.339 0.7 43 44 46 71 73 71 85 87 76 68 46 42 34 28 [784.4]SY[743.4] 1709 VRDPAM(+15.99)YSNFQM(+15.99)DFKF 9.4 59 1014.4536 2 21.167 0.5 33 32 32 50 72 80 86 54 52 58 79 90 76 48 61 28 [538.3]M(+15.99)Y[476.2]M(+15.99)[537.3] 2337 EKALGSAGYEQEAF 8.2 59 750.3537 2 28.183 0.7 39 39 76 44 43 44 80 84 88 84 46 54 64 28 [585.3]AGYE[475.2] 1233 KPMVSVSKTRNY 7 59 470.5909 3 16 0.7 44 48 46 64 65 82 69 62 60 65 65 28 [542.3]V[749.4] 3020 VHVESHGSSGRLF 7.6 59 706.356 2 36.393 2.2 28 98 96 91 91 95 28 28 49 43 40 40 28 [99.1]HVESH[704.4] 920 KKLGCPTCHVTVSF 8.2 59 380.7 4 12.522 1.6 28 52 39 39 51 61 57 54 68 68 28 90 90 90 [1167.6]VSF 1075 LLRASGRKLWPAAGMPF 10 59 468.5183 4 14.339 2.3 47 61 63 68 67 51 44 44 37 34 46 64 79 79 86 89 28 [1476.9]MP[147.1] 4280 LETLTHMTKHSVYY 8.2 59 574.954 3 51.27 2.5 31 41 45 53 55 68 55 57 67 89 83 71 71 28 [1054.5]HS[425.2] 2495 NKLAHSMAMHAHVLY 8.8 59 574.9568 3 30.109 0.3 40 39 43 46 59 57 62 74 74 73 80 83 83 28 28 [1120.5]AHV[276.1] 4323 GS(+79.97)YRQAMHHRY 6.4 59 743.3159 2 51.807 2.6 39 40 40 76 59 94 95 95 33 36 33 [671.2]AMH[456.2] 1991 QWKWKCDGGLEAKGM(+15.99)AGSLKELKW 14 59 922.4648 3 24.199 3.6 42 46 37 42 34 35 39 59 67 88 62 61 44 60 37 46 88 88 88 87 81 65 68 28 [1088.5]L[603.3]GSLKE[427.3] 1435 VRM(+15.99)MQLADEM(+15.99)VPRF 8.2 58 877.9235 2 18.192 0.6 30 30 36 62 55 62 57 58 85 92 92 96 28 28 [960.4]EM(+15.99)VP[303.2] 1662 MADLEQESMKVLAW 8.2 58 825.8979 2 20.654 1.2 54 59 62 96 93 59 61 43 48 66 56 48 40 28 [317.1]LE[1072.5] 1112 AFWPNGCNVAALQW 8.2 58 526.2505 3 14.716 0.3 28 28 75 65 60 62 50 46 68 88 80 52 52 57 [988.4]AA[427.2] 2040 RQTYMQTPWEFRVLTHF 9.9 58 747.3738 3 24.742 0.1 39 38 52 55 46 33 35 42 69 51 52 69 59 87 89 93 76 [1722.8]LTH[147.1] 2240 TFFSVY 3.5 58 763.3656 1 27.059 0.6 52 52 57 79 79 28 [744.3] 2803 DNVNM(+15.99)KVF 4.7 58 982.4672 1 33.828 0.9 89 82 80 65 38 38 43 28 DNV[635.3] 2647 T(+79.97)VAGNGKGRLY 6.4 58 608.2979 2 31.927 0.3 61 58 60 72 57 41 37 67 76 78 28 [1196.6] 3743 VHVKSTAVLET(+79.97)F 7 58 705.8552 2 44.705 0.3 28 28 28 71 72 83 84 85 80 79 28 28 [550.3]TAVL[457.1]

PAGE 300

300 3201 KPDVTVPTNKRHKLF 8.8 58 594.0115 3 38.537 1.5 66 65 57 45 45 28 77 77 83 93 94 43 32 35 28 [837.5]NKR[525.3] 3266 FKRNGATTSHLF 7 58 460.2466 3 39.312 2.1 32 61 49 81 78 62 60 72 72 72 28 28 [431.3]N[814.4] 3147 ELLLGKMALAFAY 7.6 58 480.6038 3 37.907 0.1 28 28 77 74 57 63 79 84 79 61 63 28 28 [784.5]A[565.3] 2274 LALGVLDGF 5.2 58 904.5139 1 27.448 0.1 31 39 47 54 84 76 73 87 28 [354.2]V[228.1]G[147.1] 3999 VLLPVF 3.5 58 344.2253 2 47.746 1 28 89 86 86 28 28 [99.1]LLP[246.1] 1335 HTVAAGGGDGMRPY 8.1 58 694.8217 2 17.078 1.1 28 42 41 69 75 70 71 51 52 60 73 73 75 28 [1369.6] 2906 WLKPFGRWAYLVGPSTKY 10.5 58 543.0472 4 35.041 1.2 61 54 48 62 62 60 66 64 33 34 48 63 83 81 73 62 56 28 [1516.8]GP[479.2] 1998 T(+79.97)KVCKYDRGGAVRGGYY 9.9 58 986.9597 2 24.269 1.2 42 42 35 51 74 90 70 55 55 65 87 85 73 54 40 34 28 [639.3]Y[385.2]AV[596.3] 2737 HKFTTGAVGGGLLSKKCRLYY 12.2 58 767.0833 3 33.034 1.1 29 35 32 53 75 65 53 52 55 68 74 77 94 94 94 54 50 51 52 28 28 [1125.6]LSK[826.4] 1013 YSNMTKKMTGFTM(+15.99)PSY 9.3 58 634.9538 3 13.677 1.8 75 72 53 39 38 49 44 39 39 87 93 57 55 71 83 28 [1084.5]GF[345.1]S[163.1] 1725 S(+79.97)RTMQPVNLPLGDNGVDCM(+15.99)Y(+79.97) 11.6 58 1193.4694 2 21.318 0 31 55 32 36 36 66 75 59 75 77 79 86 89 55 55 50 57 56 57 28 [1316.6]GD[878.2] 1344 VVRDPEAGSVMKKLY 8.7 58 564.6445 3 17.183 2.6 28 61 58 60 68 76 81 77 62 57 56 65 48 38 28 [695.4]A[906.5] 2528 KGGSTPSVAPKKPW 8.1 58 480.6038 3 30.49 2.5 86 86 62 52 59 64 48 45 44 69 70 56 37 28 KG[1235.7] 1239 YTLVSVTNRSVVGKHPF 9.9 58 635.3495 3 16.065 2.5 69 68 68 64 84 41 40 44 50 84 70 69 67 51 44 39 28 [476.3]S[470.3]S[764.4] 2630 LTEEGVGKAMKKLAVSVDFF 11.6 58 543.0474 4 31.725 2.6 51 54 62 59 59 57 62 66 52 46 45 54 56 46 46 53 80 88 88 28 [1641.9]VDF[147.1] 2025 KFQVVLAKVGVS(+79.97)GTHDHNS(+79.97)W 11.6 58 1185.0521 2 24.564 5.6 34 31 31 52 47 41 50 76 86 70 71 79 82 58 49 62 67 63 46 57 [913.6]V[323.1]G[957.3] 1037 M(+15.99)HLLQLLQAGSAFVPF 9.3 58 596.6556 3 13.953 0.5 41 41 44 46 43 64 57 52 68 75 79 74 72 69 68 28 [1768.9] 794 LVMAWHHWGY 5.8 58 433.8733 3 10.942 2.8 28 94 59 58 69 28 28 77 78 56 [113.1]V[1068.4] 1443 HAGARSKPDFDSVLGVRCY(+79.97) 11 58 720.0013 3 18.279 0.3 40 37 39 43 45 53 68 72 73 46 49 62 89 82 64 57 60 87 28 [1268.6]VL[312.2]C[243.0] 1155 RSHAVNGGKVY 6.4 58 594.3166 2 15.189 1.6 28 88 85 54 54 52 64 52 59 69 28 [156.1]SH[788.4] 3925 ADSNAAGVYF 5.8 58 1014.4533 1 46.868 0.7 90 89 71 47 51 69 51 51 28 28 AD[809.4] 3057 LTRMDVKKSLLVANGGKTT(+79.97)W 11.6 58 766.7385 3 36.836 1.3 41 37 37 48 44 55 57 84 85 88 63 45 45 63 83 84 70 46 36 39 [843.5]KSL[397.2]GG[596.2] 1490 NKNPAGGLACY(+79.97) 6.4 58 594.2489 2 18.794 0.7 64 54 50 55 52 62 69 65 65 68 28 [1168.5] 2991 KWDGKMARSLLGLNGTLLYY 11.6 58 767.0812 3 36.047 1.1 41 39 33 44 45 47 46 62 89 93 68 57 79 74 60 56 67 62 60 28 [972.5]SL[1107.6] 1611 RCELPGMPPGGGLFY 8.7 58 797.3809 2 20.101 0.4 42 41 48 67 81 61 58 63 78 64 69 65 51 43 28 [501.2]P[976.4] 2699 AEEEARYF 4.6 58 1014.4523 1 32.572 0.3 28 28 28 93 86 83 85 28 [329.1]EARY[147.1] 3631 LLKDAPLGTATATKEF 9.3 58 559.3136 3 43.381 0.1 30 40 38 48 79 71 60 61 84 92 83 66 60 37 37 34 [807.5]TAT[576.3] 1506 LTY(+79.97)NAMTGTVLEKKKW 9.3 58 654.998 3 18.969 2 70 69 44 37 37 49 53 51 53 64 91 81 81 82 28 28 [1131.5]LEKK[314.2] 1319 RHDVSASVLY 5.8 58 573.7971 2 16.919 3 30 30 43 71 71 80 95 97 28 28 [594.3]ASV[276.1] 3207 M(+15.99)DS(+79.97)CHNY(+79.97) 4 58 523.1132 2 38.616 0 28 28 28 92 79 79 67 [429.1]C[494.1] 1131 KSDLAWGALLFY 6.9 58 461.9161 3 14.924 2.2 55 54 58 59 65 75 73 69 64 44 43 28 [1364.7]

PAGE 301

301 762 YGPPGAM(+15.99)NY(+79.97) 5.2 58 533.1903 2 10.499 1.3 30 53 73 66 57 55 54 64 63 [1046.4] 2568 AEEEARYF 4.6 58 1014.4537 1 30.986 1 28 28 28 92 85 83 86 28 [329.1]EARY[147.1] 2145 LAGNWLLPNF 5.8 58 1144.6139 1 25.954 1 86 79 48 41 39 54 51 57 60 57 L[1012.5] 2527 LHCSDHSTEVKPPFWW 9.2 58 656.973 3 30.479 0.9 50 50 70 28 28 86 61 54 53 56 83 65 65 57 54 54 [555.2]H[416.2]K[713.3] 2042 WTTRKAPART(+79.97)T(+79.97)CVGVFKW 10.4 58 756.6909 3 24.76 1.5 42 41 48 55 61 66 69 72 62 46 59 79 84 71 51 42 42 37 [1532.6]V[617.3] 3137 TLRLLGKGPQF 6.3 58 615.3716 2 37.79 0.5 40 39 48 90 78 72 64 62 57 51 28 [370.2]L[727.4] 1446 EESRTSEEKTVERRKT(+79.97)Y 9.8 58 552.7642 4 18.318 2.7 66 58 51 53 58 64 70 73 73 37 35 43 71 48 56 59 56 [2189.0] 979 Y(+79.97)CFCT(+79.97)GACS(+79.97)F 5.8 58 447.741 3 13.262 55.5 28 28 28 66 67 77 82 84 83 28 [834.2]ACS(+79.97)[147.1] 1921 T(+79.97)Y(+79.97)GDAS(+79.97)MEPCCTDW 8.1 58 606.7988 3 23.403 39.4 41 41 41 42 59 64 72 49 52 93 82 67 67 28 [1191.3]CC[402.2] 1179 EFAVKPHF 4.6 58 325.5093 3 15.438 4.1 28 88 87 82 87 28 28 28 [129.0]FAVK[381.2] 959 YSNASSVRTSKLSYPSY 9.8 58 637.3133 3 13.011 1.8 76 70 61 59 61 64 74 73 59 57 72 53 53 55 28 28 28 [1890.9] 992 HY(+79.97)LKFSKAAGPKLGLKHLKYHF 12.6 57 888.4866 3 13.423 3.1 53 51 40 39 39 48 63 69 53 57 76 95 88 69 56 56 51 49 47 42 44 68 [1279.6]KL[1123.6] 1693 MPPAGPPGMF 5.7 57 501.2323 2 20.99 1 28 28 76 74 84 80 53 51 66 28 [396.2]GP[432.2] 951 DAFQKRY 4 57 309.8274 3 12.904 0.7 28 90 84 73 68 28 28 [115.0]AF[575.3] 3161 AEEEARYF 4.6 57 1014.4523 1 38.079 0.3 28 28 28 92 84 82 85 28 [329.1]EARY[147.1] 1568 LRAKGGAMGGGNTLAFLVSW 11.5 57 669.36 3 19.641 0.7 39 44 55 49 40 41 46 56 52 48 67 58 40 40 60 91 93 73 73 73 [1354.7]FL[372.2] 1145 WVPNSKKPCLTKVCKKY 9.8 57 506.2798 4 15.084 2.6 68 51 54 48 56 57 75 79 60 53 49 57 75 54 55 47 28 [2003.1] 1025 KKVNCPKF 4.6 57 321.8521 3 13.82 2.8 67 54 47 47 89 93 28 28 [469.3]CP[275.2] 4215 EPKVTAAKRKPKGCY 8.6 57 419.7373 4 50.441 2.1 61 61 54 56 52 53 43 38 48 49 89 82 72 66 28 [1108.7]PK[323.1] 2120 LTENWFLPPF 5.7 57 632.3248 2 25.659 1.2 69 73 81 73 76 84 28 28 28 28 [214.1]E[300.1]F[454.3] 2627 YVT(+79.97)LNSLVSTRNLY 8 57 574.9546 3 31.694 1.8 28 47 45 51 40 52 79 28 87 74 61 62 83 58 [969.5]S[371.2]L[163.1] 2574 YFRVGSGALAGALHAMYLW 10.9 57 695.0241 3 31.055 0.1 28 52 44 42 60 60 53 48 45 49 55 70 59 57 68 86 85 59 59 [1470.8]MY[299.2] 687 YGWSYEF 4 57 476.1989 2 9.436 2.4 28 28 28 95 95 95 28 [406.2]SYE[147.1] 2498 VLKSGRTHMKKNHKEVNY 10.3 57 543.049 4 30.137 1.6 37 38 47 47 60 74 67 58 49 47 54 48 57 90 76 57 57 58 [1516.8]K[505.2] 2531 EMCLQVVHGMLW 6.9 57 723.3384 2 30.534 3 28 68 70 72 42 46 48 64 66 66 67 43 [1426.7] 1039 RKLLSSMGTFRHAHF 8.6 57 894.4796 2 13.969 1.8 73 70 43 32 40 84 77 76 76 81 48 42 51 28 28 [597.4]S[289.1]F[648.3] 2229 LLKDPLKTATLANDY 8.6 57 419.7369 4 26.924 0.3 37 58 47 50 61 44 43 50 63 84 86 79 54 56 37 [979.6]TL[463.2] 1676 VRSLVLTDVGMAPWEY 9.1 57 612.6492 3 20.801 1.6 28 61 43 43 51 52 56 65 66 72 72 70 77 67 28 54 [1816.9] 2399 YPCLPMANPVGHF 7.4 57 723.3383 2 28.944 0.7 69 69 69 96 72 41 44 42 73 77 28 28 28 [363.1]L[950.4] 3156 LENAPAGQALMAFNLY 9.1 57 574.9546 3 38.016 1.6 39 37 39 53 63 50 43 38 63 80 76 76 72 57 73 46 [851.4]L[739.3] 1808 TLWTLDEPAVLSKPDVRPVY 11.4 57 1150.1179 2 22.205 2 28 28 29 68 74 95 91 87 63 61 71 64 68 79 64 39 35 30 30 28 [614.3]DEP[1324.8]

PAGE 302

302 3301 WTKGPALGREW 6.3 57 650.8419 2 39.712 2.3 31 60 51 77 92 72 53 49 52 57 28 [472.2]P[712.4] 1269 NTGGSGATNSLF 6.8 57 563.2621 2 16.377 0 47 43 50 57 53 61 56 46 45 61 72 87 [959.4]F 2346 KLNKLGKDKW 5.7 57 615.3714 2 28.298 0.8 45 43 53 68 87 78 45 42 60 43 [483.3]L[614.3] 3447 VMADCAGNRGLATMAW 9.1 57 556.2548 3 41.273 0 36 37 41 53 52 56 77 76 59 56 74 89 68 57 42 28 [1087.5]A[489.2] 1562 LMESKVPGVVVCKY 8 57 517.9479 3 19.579 1.3 40 39 36 43 49 66 74 95 94 84 48 47 48 28 [784.4]GVV[493.2] 3092 LWPAGSVPLGEQMF 8 57 511.2585 3 37.252 0.2 29 37 45 40 46 61 87 48 63 66 73 57 79 58 [611.3]V[802.4] 1703 MRKTALCPNMRVAF 8 57 546.6184 3 21.103 1.8 29 48 38 47 45 46 52 74 67 70 45 64 83 82 [1400.7]AF 2873 VKKKLGTTHAF 6.3 57 615.3716 2 34.65 0.5 32 32 47 94 68 63 74 72 56 55 28 [355.3]K[727.4] 989 TLRLLVFVWVEAESRW 9.1 57 501.7832 4 13.391 2.4 53 53 52 48 76 83 28 42 41 40 43 74 87 75 78 28 [596.4]V[731.4]E[429.2] 1734 VTSSKFRVSGLHEY 8 57 537.2839 3 21.426 2.5 28 28 28 72 64 53 32 63 79 79 91 61 61 50 [1048.6]L[429.2] 1556 LPTFVRGKTNAVGRRY 9.1 57 612.3511 3 19.517 0.5 53 54 62 78 61 61 58 46 47 62 39 39 54 74 86 28 [1496.9]R[163.1] 2124 KLKLGTRSAM(+15.99)ALEKWYF 9.7 57 686.7134 3 25.71 2.7 29 29 55 59 62 65 67 70 52 46 58 62 64 63 47 57 73 [2039.1] 2003 Y(+79.97)LERKAPGFAVRNVQLY 9.7 57 702.0283 3 24.325 1.7 46 53 42 61 42 50 47 50 55 82 82 80 51 52 56 62 47 [1141.5]AVR[617.3] 2901 TNELQAKNGGLLSKETKGPKW 11.9 57 767.0836 3 34.977 1.8 46 44 55 45 32 35 35 60 73 62 65 89 94 85 75 72 56 46 41 47 28 [1125.6]LSK[826.4] 4118 MDVCRVHGSTEFTMPLTPF 10.8 57 723.3378 3 49.194 0.7 46 49 63 64 48 45 50 56 50 49 49 54 80 63 66 84 69 58 28 [1361.6]T[228.1]L[345.2] 3912 TTPAMGCEDPRFRW 8 57 556.2545 3 46.712 1.5 65 66 62 67 59 41 39 47 89 80 79 39 28 28 [790.3]DP[645.3] 2210 KLFCLGFDPLVRAKLVEW 10.2 57 712.0665 3 26.713 1.5 53 53 74 51 50 53 56 57 58 70 52 48 49 44 39 44 80 81 [1800.0]EW 2597 MDVYMTDLLPTF 6.8 57 723.3383 2 31.337 0.1 28 28 28 68 68 68 57 72 91 72 67 28 [968.4]L[345.2] 1682 KDKHGLSHLVTAEGY 8.5 57 552.2913 3 20.865 2.9 44 40 49 67 72 66 63 28 76 60 60 62 57 60 38 [1635.8] 1369 AWLVPELQGFQKLY 7.9 57 846.4636 2 17.457 2.7 43 43 58 89 77 66 45 39 61 88 47 45 59 28 [370.2]V[524.3]F[532.3] 1551 FKYGTTAGVPAQRW 7.9 57 791.4107 2 19.459 1.9 29 57 43 51 53 76 69 71 80 73 46 41 47 52 [825.4]V[638.3] 4086 WKKAKKGRATRTKELRTLES(+79.97)W 11.9 57 531.4936 5 48.799 2.2 54 53 40 51 63 44 40 39 35 34 45 76 88 75 58 60 88 92 75 28 42 [1411.9]K[398.2]TL[482.1] 4218 LT(+79.97)HTSRKVLPF 6.2 57 460.2468 3 50.487 1.1 74 74 42 40 49 64 74 74 72 28 28 [1359.7] 2849 CCRLGAGGEVF 6.2 57 556.2554 2 34.369 1 28 76 60 53 55 76 66 58 58 60 28 [1092.5] 1857 VWRYGYLVS(+79.97)GYQFF 7.9 57 622.2855 3 22.716 2 30 31 43 44 61 67 57 61 55 59 78 86 87 28 [1423.6]QF[147.1] 1952 VYKYTWMRLALPVVNRAPKYRWT(+79.97)Y 13.6 57 1052.2057 3 23.758 5.9 29 29 40 44 61 46 46 50 47 53 65 83 81 81 62 61 63 74 88 88 59 33 33 33 [1424.8]PVV[438.2]KY[686.3] 2049 WDRSFCKRTAPKLSNKTRKEALY(+79.97) 13 57 720.3701 4 24.838 1.4 30 52 44 64 65 66 64 62 56 39 37 40 49 50 53 82 83 84 82 61 48 47 33 [1789.9]KTRK[556.2] 1731 WKWLGGDNKDYGVTKGKKF 10.8 57 743.0591 3 21.385 1.2 37 37 34 37 47 61 81 87 94 82 59 47 34 33 38 73 77 77 28 [727.4]DNKD[1008.6] 1339 VGHVSADSVLY 6.2 57 573.7961 2 17.128 5.1 28 28 28 89 73 72 77 83 82 28 28 [293.1]V[273.1]SV[276.1] 2856 KKKVDSCTGS(+79.97)SVNVKY 9 57 608.2982 3 34.447 1.8 28 84 43 42 42 81 84 55 54 52 72 71 62 48 49 28 [128.1]K[342.2]SC[1015.4] 1557 SAALMF 3.4 57 639.3172 1 19.526 0.3 28 69 73 66 71 28 [620.3]

PAGE 303

303 909 MY(+79.97)GCLAECPF 5.7 57 607.21 2 12.378 0 29 29 52 55 78 78 89 94 28 28 [718.2]EC[244.1] 2547 KWWSM(+15.99)GPANGGVGNLS(+79.97)Y(+79.97) 9.6 56 1000.3925 2 30.727 1.6 42 42 37 77 55 47 53 77 89 89 76 48 47 38 42 55 39 [959.4]NG[850.3] 2772 LWTTLAGNFKPSSGAAYLW 10.7 56 695.0254 3 33.465 1.4 30 53 44 61 45 43 47 53 65 52 45 45 62 56 61 72 84 84 62 [1601.8]YL[186.1] 232 DDDS(+79.97)VY(+79.97) 3.4 56 437.1 2 3.066 2.7 28 28 84 84 84 28 [230.1]DS(+79.97)V[243.0] 2937 NLLVTVPTNKKNPRW 8.5 56 594.0112 3 35.394 2.2 45 45 61 39 39 28 87 86 86 94 78 40 40 41 28 [639.4]PTNK[681.4] 3026 CFKYPLASRGTVPGVMY(+79.97) 9.6 56 656.9733 3 36.464 2.9 78 77 40 35 46 75 66 65 43 41 42 59 59 70 64 63 28 [1949.9] 3105 WTAFSKLRSHVAVRKYGY 10.2 56 543.0474 4 37.404 1.7 52 45 45 58 62 60 55 63 65 51 60 47 53 87 71 46 57 28 [1482.8]R[511.2] 4250 T(+79.97)ECCT(+79.97)GAMDCCGY(+79.97) 7.3 56 532.7722 3 50.892 0.3 36 36 28 85 83 85 69 57 56 76 43 43 28 [413.1]CT(+79.97)G[823.2] 3150 TGEELGKGMW 5.6 56 554.2606 2 37.947 0 38 38 44 95 94 76 76 41 28 28 [287.1]EL[559.3] 938 WY(+79.97)VTGHTFVPMPW 7.3 56 850.871 2 12.744 1 28 28 35 38 44 87 87 83 80 64 59 65 28 [686.3]HTFV[511.2] 2858 YRKMKALTTLEVGFPF 9 56 476.0143 4 34.466 0.1 28 28 37 51 57 56 53 55 74 71 58 63 77 77 79 28 [1882.0] 2822 CPRGRNRY 4.5 56 511.2588 2 34.056 0.5 28 82 67 66 74 73 28 28 [103.0]P[802.4] 3044 KDALDGANAADVAQW 8.4 56 772.8688 2 36.681 2.3 44 42 49 58 52 55 62 42 48 54 63 81 67 70 50 [1041.5]V[385.2] 468 NPTKAHDGNY 5.6 56 558.7586 2 6.249 2.8 64 63 46 46 55 63 74 61 57 28 [1097.5] 1771 KSVAYLAHRPFLYGGHRYY 10.7 56 575.3044 4 21.817 1.4 49 54 62 59 65 75 58 52 46 45 38 40 34 39 77 73 73 60 62 [2279.2] 2750 MVVVANRKYGRLF 7.3 56 518.2988 3 33.201 2.4 79 70 68 59 59 51 56 64 59 49 42 42 28 [1533.9] 2133 KYVVSKANRLPGGTW 8.4 56 419.737 4 25.816 0.8 41 52 65 79 66 41 41 50 47 43 46 81 77 79 28 [1255.7]G[344.1] 1781 WANALVTLLVPLSAPW 9 56 584.3337 3 21.926 1.3 79 74 36 36 63 48 39 36 44 61 28 83 82 70 86 28 [1177.7]LS[71.0]P[186.1] 2313 KEDKEVSAGGGGGRNPLF 10.1 56 909.4629 2 27.897 2.5 54 43 39 39 67 65 50 46 58 75 46 61 73 83 54 59 63 28 [1171.5]R[471.2] 1201 RKRKGGYRQAY 6.2 56 461.5961 3 15.671 1.8 33 33 30 32 80 82 94 85 41 61 41 [568.4]GGYR[362.2] 1105 VHKAHMGAGGPNAPCY 9 56 805.3725 2 14.644 0.9 28 75 81 89 71 63 47 40 41 52 50 50 69 78 28 28 [236.1]KA[1155.5] 1207 KLAVGTF 3.9 56 368.2234 2 15.727 0.6 28 28 28 80 80 82 63 [312.2]VGT[147.1] 1827 Y(+79.97)VQDRNM(+15.99)LLYRGTPF 8.4 56 492.982 4 22.4 1.2 28 55 47 53 58 38 34 64 84 89 58 68 60 70 28 [1115.4]LY[558.3] 4278 LLGATVVRGLEPQHW 8.4 56 419.7375 4 51.248 0.3 66 67 44 41 47 51 32 30 31 32 65 91 78 89 70 [1108.7]P[128.1]H[186.1] 2453 DDYNRVAAPYAEPW 7.8 56 556.2546 3 29.594 0 74 77 44 43 41 61 62 70 90 60 52 47 28 28 [904.4]P[646.3] 3206 YSFANGVGYTDRAYLSW 9.5 56 657.3069 3 38.604 0.9 58 53 53 58 55 65 46 42 43 62 87 82 82 44 39 36 38 [1059.5]DRA[549.3] 3584 DDPT(+79.97)RPAAVRM(+15.99)RW 7.3 56 556.2541 3 42.833 2.5 85 85 68 53 48 53 55 47 47 79 45 28 28 DD[1417.7] 4281 VFKGVADLY 5 56 506.2792 2 51.281 0.2 28 75 79 86 60 47 45 51 28 [374.2]G[561.3] 2539 Y(+79.97)LVSAKNGAGVAQW 7.8 56 772.369 2 30.63 0.2 59 59 62 54 43 47 63 56 49 48 50 64 73 51 [1524.7] 2077 CNKLEGPGAAKYGAAVRKY 10.6 56 666.0201 3 25.164 1.4 42 40 50 55 63 48 49 58 62 61 56 56 74 83 88 56 49 36 28 [1288.6]AA[546.3] 1854 MLKPLSSAVTSTS(+79.97)AAYVY(+79.97) 10.1 56 683.6413 3 22.688 2.1 35 36 46 59 56 57 73 63 57 58 74 87 85 45 39 36 62 28 [1114.6]TS(+79.97)[647.2]

PAGE 304

304 1459 VVLQATGFVFY(+79.97)PF 7.3 56 523.2582 3 18.456 0.3 28 76 57 43 46 53 67 76 95 95 28 28 28 [815.5]VF[487.2] 2078 VKFNLVRGYTRTF 7.3 56 534.305 3 25.174 3 28 71 68 56 53 49 55 66 74 63 39 72 28 [1581.9] 3199 WVRSPKSSFVW 6.1 56 460.2472 3 38.519 0.4 28 28 28 54 53 54 74 89 74 74 52 [840.5]S[432.2] 2520 WKSVLPCSAVPKGPW 8.4 56 552.2978 3 30.394 0.9 52 52 28 28 76 75 75 76 74 61 50 48 50 56 28 [1635.9] 1892 HRTKFGRGRTAGYLTPPQY 10.6 56 736.0609 3 23.086 2.5 36 39 45 46 50 56 54 53 54 58 76 75 77 84 61 51 45 46 45 [1487.8]L[586.3] 1244 LPLTVAMVHSLTNLRF 8.9 56 453.7613 4 16.115 2 28 70 65 57 50 51 64 78 28 54 50 48 49 75 89 28 [1489.8]R[147.1] 2652 VMKVRPSCALPYKY 7.8 56 552.2976 3 31.988 1.5 43 45 56 66 71 78 73 73 73 58 38 36 37 28 [1635.9] 2323 MLRVAGALHTGLKW 7.8 56 518.2983 3 28.021 1.5 67 44 39 47 76 66 47 48 56 63 63 57 72 28 [1533.9] 2559 LETDASPNGGASNFW 8.4 56 783.3456 2 30.867 1.7 51 52 50 51 67 61 57 48 66 54 58 50 49 50 63 [1546.7] 3222 LHNGYGAFMNDLAHMLF 9.5 56 650.9698 3 38.811 2 42 41 49 65 64 71 67 58 53 44 58 52 53 56 60 64 43 [1931.9] 2058 EWALTMDALAKWNTPLVW 10 56 715.7012 3 24.944 2.5 37 36 50 70 71 68 68 74 64 68 78 62 39 38 56 47 42 28 [2126.1] 2190 EEDVAM(+15.99)AAAVRTMAW 8.4 56 556.2556 3 26.483 2.4 28 78 70 45 40 42 47 71 69 69 79 63 57 41 28 [1647.7] 963 WMFTSGWWHKPTKAF 8.4 56 478.2365 4 13.052 1.9 54 49 42 73 52 49 62 28 86 70 65 61 56 54 28 [1081.4]H[672.4] 1507 DKLGDLGLNGKSSKW 8.4 56 539.9584 3 18.977 0.9 35 35 37 55 75 85 75 69 58 59 62 76 51 28 28 [528.3]L[957.5] 2442 YLLAYVVDYLF 6.1 56 460.2469 3 29.464 2.2 29 44 62 65 68 69 68 67 54 54 28 [1359.7] 1806 VLCGLASRSGVTAKTPDRPW 11.1 56 705.377 3 22.19 0.5 79 73 58 60 72 64 58 60 62 60 43 42 51 50 46 45 50 49 53 28 [2095.1] 2221 M(+15.99)DPLVVF 3.9 56 836.4226 1 26.832 0.4 28 89 89 96 28 28 28 [147.0]DPL[345.2] 2429 T(+79.97)LNVGTGELGVAGAVVW 9.5 56 574.9545 3 29.312 1.6 53 61 37 49 66 51 49 63 82 69 65 73 64 43 44 40 28 [851.3]L[739.4] 1389 YVRNGVGLGSGVTGKFY 9.5 56 887.4702 2 17.686 2.8 28 58 43 42 46 82 87 42 41 49 87 69 65 65 50 49 35 [589.3]VG[257.1]G[695.4] 2175 RRKPAAM(+15.99)AAPQLFPDLLY(+79.97) 10 56 718.7054 3 26.304 4.2 28 59 45 59 50 52 40 45 56 64 42 43 48 90 82 71 69 49 [1453.8]PD[469.2] 1989 WWKGSGNSKFGKAELDDRQELKW 12.8 56 692.0995 4 24.17 1.1 28 61 45 55 59 61 58 62 56 49 40 56 61 56 50 54 66 71 74 53 62 63 28 [2746.4] 2468 Y(+79.97)NVVAMAATGSDHANRY(+79.97) 9.5 56 1000.3909 2 29.768 1.1 41 49 43 83 52 50 51 71 67 54 57 63 55 47 48 57 48 [456.1]V[1425.6] 845 M(+15.99)TES(+79.97)MQMT(+79.97)W 5 56 660.6917 2 11.591 1.1 43 44 36 39 59 80 87 79 28 [675.2]QM[367.1] 4009 CGPTGLLF 4.4 56 404.2066 2 47.874 1.1 28 83 81 80 84 28 28 28 [103.0]GPTG[373.2] 3543 QNHYPGNGPASGAVKFCGF 10.5 55 650.9698 3 42.362 1.7 61 61 65 65 76 63 51 49 50 47 47 56 44 44 58 55 54 69 28 [1931.9] 1652 DLLVGGALAFY 6.1 55 569.8114 2 20.546 1.2 31 31 51 67 70 66 68 84 81 28 28 [625.3]LA[310.1] 1818 SAM(+15.99)PPDVQPSSGYKAREGWKYKY 12.8 55 887.763 3 22.311 0.8 39 40 67 73 85 84 58 41 47 52 61 82 67 60 46 48 67 74 43 37 32 28 33 [402.2]PD[498.2]G[1472.8] 1167 RHQGAFDGYPNLF 7.2 55 507.9118 3 15.318 1.6 45 53 35 48 58 71 84 82 71 39 35 37 57 [696.3]DG[634.3] 3320 GDVANYSLY 5 55 1001.4586 1 39.936 1.2 28 79 54 53 59 81 84 28 28 [456.2]YS[276.1] 1229 WGVLADKWKKY 6.1 55 465.2594 3 15.965 0.7 28 54 59 73 79 80 81 61 33 28 28 [526.3]DK[605.3] 2868 LLKVGAGGRKF 6.1 55 573.3614 2 34.592 0.2 57 56 43 49 69 72 76 82 42 28 28 [638.4]G[431.3]

PAGE 305

305 3102 FYKLMS(+79.97)TAKAPKRYLW 8.9 55 695.0253 3 37.374 0.7 28 49 61 42 53 41 59 49 48 63 61 63 83 59 59 59 [1445.7]R[462.2] 1716 KHDGKGQANETYPY 7.8 55 804.3742 2 21.232 2.3 32 31 32 47 48 71 48 76 64 69 69 74 79 28 [1588.7] 1235 KKKSRGVPGW 5.5 55 571.8428 2 16.031 0.7 28 50 59 67 72 83 75 60 28 28 [627.4]G[439.2] 2957 WWNDGVLVSTGVNLY 8.3 55 574.9545 3 35.649 0.3 28 67 52 48 59 63 90 28 50 50 43 43 57 87 59 [757.3]L[557.3]L[163.1] 2418 VLPSADPHW 5 55 511.2586 2 29.177 0.1 28 28 63 67 69 90 93 28 28 [467.3]DP[323.1] 4327 NKGLCMNKHF 5.5 55 596.2925 2 51.86 1.4 58 62 54 44 44 60 60 69 69 28 [1172.6] 1124 EEVLPPY 3.9 55 846.4222 1 14.852 2.5 28 89 89 94 28 28 28 [129.0]EVL[357.2] 2365 VVLPLTSAVGPSLS(+79.97)AF 8.8 55 546.6244 3 28.528 2.2 28 28 52 49 49 53 67 78 71 74 79 72 39 38 49 49 [1618.8] 1923 KPVFDRDLRRKALPGWHAF 10.5 55 578.0745 4 23.42 0.5 50 56 58 66 68 37 31 30 32 39 43 53 54 69 78 85 83 80 28 [1749.0]WHA[147.1] 1346 KPLNAKLSGDTLKLY 8.3 55 554.3274 3 17.201 2.8 33 48 47 52 57 57 63 63 63 68 66 59 54 64 28 [1641.9] 1569 Y(+79.97)QTRRATRY(+79.97)TKVLKRAAHQW 11 55 674.0902 4 19.65 2 43 41 34 43 43 63 68 70 37 36 36 49 63 71 89 82 60 53 55 56 [1925.0]RA[522.2] 2577 KVTPLM(+15.99)F 3.9 55 426.2386 2 31.085 0.6 51 50 73 81 52 38 38 [328.2]P[407.2] 2061 KVSVSLMMS(+79.97)LMMFGLLF 9.4 55 1007.4885 2 24.974 0.7 30 30 30 34 45 57 85 93 53 69 71 95 57 53 44 53 28 [613.4]MM[411.1]M[577.3] 4046 S(+79.97)DS(+79.97)PLFVPGVTKLF 7.7 55 556.2551 3 48.319 1.3 28 28 28 28 28 92 85 82 81 82 66 59 51 28 [659.2]FVPGV[489.3] 2154 VFLM(+15.99)PMPSSGWAMFVADPWW 11 55 791.0273 3 26.062 3 28 69 68 50 60 47 54 52 59 65 46 44 46 51 62 40 40 56 77 81 [2166.0]W 1721 RTLLS(+79.97)ASGGNGMKPKGLKEEVTGAFRF 14.9 55 733.6265 4 21.287 2.3 45 44 61 65 60 60 57 48 42 38 39 48 57 40 34 36 48 59 72 92 77 74 71 67 60 54 28 [2005.0]E[778.4] 2265 KGLKNASLGKYNF 7.2 55 480.604 3 27.341 2 38 37 45 47 49 61 46 49 83 59 54 66 76 [811.5]G[552.3] 2697 WKKKDDVHKWPVPPVFY 9.4 55 543.0475 4 32.539 1.9 64 64 42 47 47 56 50 44 46 41 43 79 28 83 83 83 28 [1643.9]PVF[163.1] 2481 LLEVSRTKF 5 55 364.8851 3 29.93 0.3 74 73 76 79 38 43 53 28 28 [1073.6] 2421 KKDGVKVHLFVFVTY 8.3 55 445.7604 4 29.206 2.4 45 43 41 51 77 85 28 28 28 90 90 69 46 63 34 [527.3]K[349.2]FV[510.2] 3921 T(+79.97)DCCT(+79.97)GSSGSSNVY(+79.97) 7.7 55 810.666 2 46.81 48.4 41 41 52 66 61 62 63 28 28 68 57 56 70 72 [1601.4] 1385 MSLKDAKLGKRHW 7.2 55 523.9619 3 17.652 1.9 37 37 47 46 43 49 70 88 84 82 46 37 46 [773.4]LGK[479.2] 2682 ELYKPPVTRGRGLGNPF 9.4 55 476.0145 4 32.364 1.5 28 28 44 50 73 37 39 46 54 44 71 83 74 60 55 73 68 [1296.7]G[528.3] 1635 Y(+79.97)TPFVGGHASLGLY 7.7 55 521.2431 3 20.358 3.9 29 29 36 67 70 80 64 64 75 74 56 48 44 28 [687.3]G[798.4] 1645 HLVMHRMRGGRGY(+79.97)MGF 8.8 55 662.3047 3 20.475 1.3 28 78 63 61 30 38 55 64 88 81 78 74 41 36 28 28 [1060.6]GG[791.3] 3277 WPKLVPHKFDLRHSVYF 9.4 55 543.0508 4 39.447 2.7 28 66 51 71 72 58 41 40 35 41 37 38 70 88 81 81 28 [1653.9]SVY[147.1] 3237 LLVT(+79.97)PPDAQTLVKY 7.7 55 546.6247 3 38.98 2.8 39 48 46 57 63 67 52 45 43 68 81 66 61 28 [1115.5]L[390.2] 2096 RTLVEPATGSLMNLLLKPRY 11 55 758.0999 3 25.382 0.3 37 39 45 51 47 48 58 67 65 71 72 75 62 91 86 45 38 34 32 28 [1369.7]LL[657.4] 1608 LGM(+15.99)APVRSGKTSCY 7.7 55 495.9102 3 20.077 2 57 58 46 41 38 40 89 83 82 63 56 53 28 28 [584.3]RSG[582.2]

PAGE 306

306 APPENDIX M DE NOVO SEQUENCING R ESULTS FOR TRYPSIN De novo s ummary r eport (generated by Peaks DB software)

PAGE 307

307 Peptide r esults for t rypsin digested m yosin derived by De novo sequencing with PEAKS DB s oftware Scan Sequence TLC ALC (%) m/z z RT ppm local confidence (%) tag (>=80%) 208 M(+15.99)YTGAAK 3.9 56 379.18 2 2.639 2.8 31 50 51 73 79 74 31 [738.3] 287 CASLEK 4.9 82 325.6625 2 3.599 0.1 97 96 89 88 89 31 CASLE[128.1] 293 NSLAHVGGSAAR 8.1 67 380.5354 3 3.674 0.1 84 92 62 50 49 72 92 75 59 68 71 31 NS[420.2]G[442.2] 294 YPYAAGNSGAKPEQSGK 11.6 69 862.9133 2 3.684 2.5 31 56 57 83 91 91 87 94 79 79 57 58 59 67 60 75 31 [423.2]AAGNS[882.5] 299 VGPLKAGNPAGCGALS(+79.97)MK 13 72 875.922 2 3.751 0.6 68 52 53 70 75 92 92 86 91 90 90 88 83 63 61 53 51 31 [494.3]AGNPAGCG[610.3] 300 KGLAHAAGNER 8.1 74 562.3019 2 3.762 0.1 73 81 83 96 97 89 70 60 55 56 45 [128.1]GLAHA[527.2] 301 LATSSRNEALHK 9.6 80 442.9095 3 3.772 1.1 71 70 70 70 96 93 85 87 93 93 94 31 [372.2]SRNEALH[128.1] 304 QVNDLSAQR 7.1 79 515.7675 2 3.816 0.1 31 96 86 92 94 96 95 89 31 [128.1]VNDLSAQ[156.1] 305 KKPNFR 3.8 63 395.2402 2 3.825 0.4 31 63 63 73 77 68 [770.5] 308 WT(+79.97)PGDVALPYR 6.6 60 452.2123 3 3.858 2.4 32 44 40 52 56 78 68 68 67 80 71 [1016.4]Y[156.1] 323 CM(+15.99)FNAHGR 5.1 64 476.1986 2 4.039 2.6 54 54 61 67 90 75 72 31 [511.2]A[350.2] 330 SHCCGTPDS(+79.97)AR 6.9 63 607.2104 2 4.124 0.9 31 31 67 75 75 79 76 69 65 65 48 [1194.4] 343 T(+79.97)GMHSHGHR 5.1 56 550.2175 2 4.275 2.3 60 36 35 31 31 93 89 93 31 [593.2]HGH[156.1] 407 HLLGFHAPPK 5.6 56 558.8198 2 5.07 0.9 31 31 75 88 94 31 31 69 69 31 [363.2]GF[530.3] 415 KVVGSK 3.6 59 309.2031 2 5.175 1.3 31 76 71 71 73 31 [598.4] 419 CATLDK 3.6 60 325.6622 2 5.215 0.9 31 89 63 62 77 31 [103.0]A[457.3] 433 HDVVS(+79.97)HK 4 57 451.2 2 5.398 0.1 31 92 71 71 69 31 31 [137.1]D[630.3] 454 YAGLLLGVLTR 6.5 59 588.36 2 5.653 1.6 52 52 45 45 35 82 80 60 58 77 58 [517.3]LG[469.3] 457 VGNESLYK 6 75 455.2373 2 5.695 0.3 96 94 77 86 94 85 31 31 VG[114.0]ESL[291.2] 459 T(+79.97)LHANCGR 5.2 64 476.1981 2 5.717 2.4 32 32 64 90 84 88 91 31 [431.2]ANCG[156.1] 499 MCVKNALLPK 5.8 58 558.8163 2 6.238 1.2 90 81 37 36 34 72 72 59 59 31 MC[863.6] 520 TPNCY(+79.97)CEAGS(+79.97)R 6.5 60 680.71 2 6.499 2.2 79 79 45 50 32 88 85 65 50 44 31 [658.2]CE[451.2] 523 VGNEYVTK 6.4 80 455.2374 2 6.542 0.1 97 97 88 91 85 84 31 62 VGNEYV[229.1] 568 LLTLYANT(+79.97)K 5.4 60 558.7896 2 7.118 1.6 31 31 31 47 61 94 86 87 65 [603.4]ANT(+79.97)[128.1] 585 MEGCM(+15.99)SNVGR 5.6 56 550.22 2 7.337 0.1 49 49 67 31 89 75 57 50 60 31 [420.1]M(+15.99)[513.3] 595 VGNEYVTK 6.3 78 455.237 2 7.466 0.9 97 96 88 92 88 80 31 50 VGNEYV[229.1] 616 KVVGSK 4.3 71 309.2032 2 7.725 1.9 31 92 90 90 90 31 [128.1]VVGS[128.1] 618 HDCNSPAK 5.3 66 436.1901 2 7.745 0.3 31 96 91 76 67 67 63 31 [137.1]DC[497.3]

PAGE 308

308 626 GY(+79.97)STLHK 4.4 63 443.1978 2 7.876 2.1 31 31 77 80 92 96 31 [387.1]TLH[128.1] 657 CCMVPDGAR 6.2 69 476.1973 2 8.274 2.9 31 75 79 79 81 79 78 84 31 [436.1]P[172.0]A[156.1] 664 S(+79.97)S(+79.97)DAVPK 5 71 432.15 2 8.367 2.3 31 91 91 84 84 83 31 [167.0]S(+79.97)DAVP[128.1] 671 M(+15.99)YEKY(+79.97)NR 3.9 56 550.2178 2 8.454 0.4 31 31 83 83 54 73 31 [310.1]EK[513.2] 687 KVVGSK 4.3 72 309.2033 2 8.658 2.2 31 94 92 92 91 31 [128.1]VVGS[128.1] 718 NS(+79.97)LVNK 3.5 58 377.679 2 9.118 1.7 56 57 58 76 69 31 [735.3] 747 T(+79.97)PGCEYPPR 6 67 550.2169 2 9.493 1 34 41 41 71 93 93 97 97 31 [438.1]EYPP[156.1] 754 VMSMQPAQPK 6.1 61 558.78 2 9.591 1.1 32 32 34 56 54 86 86 73 85 70 [576.2]PA[128.1]P[128.1] 766 HDGYEHK 4 56 443.1973 2 9.739 2.8 92 89 50 47 51 31 31 HD[614.3] 767 HDCSGKTR 4.5 56 452.21 2 9.75 2.9 31 31 31 77 76 81 84 31 [499.1]KT[156.1] 774 WST(+79.97)S(+79.97)Y(+79.97)HAK 4.4 55 610.1855 2 9.85 1.2 31 31 31 31 97 87 97 31 [621.1]Y(+79.97)HA[128.1] 785 QASPSPER 5.3 67 436.217 2 9.998 0.1 57 49 49 59 94 94 94 31 [383.2]SPE[156.1] 788 RPLEAGNSQS(+79.97)LMGRR 8.5 57 876.4227 2 10.028 0.6 32 43 50 83 91 82 66 62 58 52 41 40 58 55 31 [366.2]EAG[1109.5] 795 QNEWGSPTK 5.2 58 523.75 2 10.111 2.4 65 67 86 75 31 54 53 54 31 [242.1]E[656.3] 797 YMVVCT(+79.97)R 4.5 64 476.1983 2 10.145 6.9 31 69 78 75 75 87 31 [595.2]T(+79.97)[156.1] 814 M(+15.99)ANNCS(+79.97)K 4.8 68 432.1441 2 10.351 2.7 70 70 63 76 82 84 31 [446.2]CS(+79.97)[128.1] 819 NLNDLSAQR 6.5 73 515.7679 2 10.412 1.1 31 90 88 90 93 85 77 64 31 [114.0]LNDLS[355.2] 821 KT(+79.97)TFADT(+79.97)R 4.9 61 550.2175 2 10.434 5.1 71 65 50 31 80 74 80 31 [557.2]A[115.0]T(+79.97)[156.1] 831 QGT(+79.97)NNR 3.6 60 385.1534 2 10.56 0.9 73 71 74 76 31 31 [750.3] 836 HDMDDLR 4.9 70 451.1953 2 10.627 0.2 31 88 57 57 83 90 79 [137.1]D[246.1]DL[156.1] 839 WVYQGLSHNK 5.7 57 616.3127 2 10.658 3 31 47 39 38 51 87 84 78 75 31 [633.3]LS[379.2] 850 WLY(+79.97)PT(+79.97)CDR 4.5 56 607.2097 2 10.791 2.3 76 76 55 31 72 52 52 31 [1194.4] 854 MPHEAGNSELHCGLKK 10.6 66 875.9218 2 10.844 0.1 31 31 31 97 96 94 86 90 78 78 69 66 67 53 51 31 [365.2]EAGNS[908.5] 866 QEAAMVER 6.4 80 467.2263 2 10.982 0.6 56 58 82 94 94 84 84 83 [257.1]AAMVER 868 ELTGCK 3.7 61 325.662 2 11.005 1.6 66 61 67 68 69 31 [631.3] 875 TT(+79.97)PGFNGHHR 6.6 66 602.2556 2 11.089 1.3 31 51 62 82 80 62 60 65 80 84 [379.1]GF[308.1]HR 878 VGNEYVTK 6.6 83 455.2365 2 11.131 2.1 98 97 90 93 90 92 31 69 VGNEYV[229.1] 879 CNCQST(+79.97)K 4.7 68 432.1443 2 11.142 3 53 60 67 82 72 90 45 [320.1]Q[87.0]T(+79.97)[128.1] 881 RYAWCDNKNR 6.1 61 663.3132 2 11.164 1.9 33 33 34 31 97 90 87 76 78 46 [576.3]CDN[398.2] 883 MDLER 4.6 91 332.16 2 11.198 0.3 97 97 90 94 77 MDLE[156.1] 884 AVGNDLSAQR 7.2 72 515.7673 2 11.207 0.1 40 47 50 82 91 94 96 93 86 31 [227.1]NDLSAQ[156.1]

PAGE 309

309 886 M(+15.99)DLER 3.4 68 340.1574 2 11.225 0.5 31 31 94 96 83 [262.1]LER 887 M(+15.99)M(+15.99)SDAYGHR 5.2 58 550.2169 2 11.234 2.8 40 40 45 66 66 82 73 73 31 [567.2]Y[350.2] 892 VQTGAAGAYR 8 80 497.2593 2 11.3 0.2 81 69 92 94 96 97 85 72 74 31 V[128.1]TGAAG[390.2] 898 LM(+15.99)TNLR 4.3 71 382.2099 2 11.371 0.6 31 96 81 73 82 61 [113.1]M(+15.99)T[114.0]L[156.1] 901 HDM(+15.99)ANKR 4.9 70 444.21 2 11.415 2.7 93 93 64 64 55 70 49 HD[616.3] 902 KALQLEAK 5.8 72 450.779 2 11.426 0.6 90 89 95 55 62 63 86 31 KAL[370.2]A[128.1] 905 YQRGELHSNK 6.4 64 616.3123 2 11.456 0.5 68 43 43 55 63 81 91 67 75 46 [633.3]LH[329.2] 908 RSALHNGAADK 6.4 58 380.5355 3 11.501 0.3 35 41 43 64 57 57 87 88 64 63 31 [678.4]GA[314.2] 914 NTVADLM(+15.99)R 5.9 73 468.234 2 11.573 0.8 68 75 94 95 94 93 31 31 [215.1]VADL[303.1] 916 VGAAGAAGAYR 9.7 88 482.254 2 11.591 0.1 88 87 93 97 97 97 98 94 91 92 31 VGAAGAAGAY[156.1] 917 NALAHRQDAK 6.7 67 562.3015 2 11.601 0.9 53 53 88 97 97 88 50 42 68 31 [185.1]LAHR[442.2] 920 NTPAVPR 4.5 64 377.7144 2 11.641 1.1 31 79 76 76 76 74 31 [735.4] 921 RNSHAGNSKGHGCNRR 11.6 72 875.9216 2 11.652 0.8 63 56 62 73 92 83 77 92 96 90 75 73 80 50 55 31 [494.2]AG[114.0]SKG[194.1]C[426.2] 932 LQLEAK 3.6 59 351.213 2 11.787 0.7 31 86 87 87 31 31 [113.1]QLE[199.1] 933 FEDKHLGK 6 75 325.1748 3 11.796 0.2 31 78 74 82 88 81 84 76 [391.1]KHLG[128.1] 934 KNLEVTVK 6 75 465.7848 2 11.806 0.5 96 91 96 91 88 64 31 38 KNLEV[328.2] 937 LYDQHLGK 7.3 92 487.258 2 11.849 1.4 97 96 97 74 94 91 94 88 LYD[128.1]HLGK 943 QSYEDTALKR 8.1 81 605.8065 2 11.923 0.4 50 54 95 98 94 94 96 95 95 31 [215.1]YEDTALK[156.1] 944 QSYETDALKR 6.6 66 404.2068 3 11.933 0.1 43 40 40 46 73 93 96 97 98 31 [608.2]DALK[156.1] 947 NRS(+79.97)NTLSLEPR 6.1 55 456.2198 3 11.964 1.7 46 46 49 55 45 45 87 88 82 31 31 [765.3]SLE[253.2] 949 SKYENCALGVK 8.5 77 606.3084 2 11.997 0.6 83 83 95 79 68 74 90 91 78 70 31 SKY[346.1]AL[284.2] 950 RT(+79.97)WTDALKR 5.8 64 409.5387 3 12.007 2.2 45 40 37 62 71 94 95 96 31 [739.3]ALK[156.1] 952 QNYGM(+15.99)S(+79.97)ALQR 6.7 67 421.8441 3 12.025 0.7 53 39 40 49 77 85 85 89 78 72 [609.2]S(+79.97)AL[284.2] 953 LLDTQEER 7 88 502.2564 2 12.035 0.2 95 96 96 93 68 74 84 89 LLDT[257.1]ER 955 T(+79.97)AHPPPTGTKR 7.1 64 414.8701 3 12.068 2.7 47 47 63 46 50 61 77 89 92 97 31 [781.3]GTK[156.1] 956 RMQYNNVQTEVPR 9.1 70 545.6067 3 12.078 0.8 32 47 41 63 66 88 92 83 93 89 89 89 31 [692.3]NVQTEVP[156.1] 957 SSGYETDALRK 8.5 77 613.8045 2 12.089 0.6 31 69 70 76 93 96 94 94 80 79 56 [394.1]ETDAL[284.2] 958 KNLHELEEAEER 7.4 61 499.5826 3 12.099 0.4 38 37 40 65 85 96 31 31 31 96 96 86 [492.3]EL[329.1]EER 959 TAHMFLCTLR 5.7 57 398.2032 3 12.109 1.2 32 35 36 49 31 90 87 75 76 49 [587.3]LC[370.2] 961 WTPCHCGCRVR 6.5 59 439.8642 3 12.142 1.5 58 51 63 52 31 51 81 80 63 78 31 [727.3]GC[411.3] 962 T(+79.97)SNAKEEAEQPEK 10.2 78 770.8289 2 12.152 1.3 88 88 86 96 94 94 98 96 91 53 42 54 31 T(+79.97)SNAKEEAE[482.2]

PAGE 310

310 963 KALQLEAK 5.9 73 300.8551 3 12.163 0.5 63 63 79 73 90 88 93 31 [440.3]LEA[128.1] 964 VVKSGK 3.5 59 309.2032 2 12.173 1.9 31 31 92 82 83 31 [198.1]KSG[128.1] 967 WFYHVLFAEER 7.9 71 374.9385 4 12.214 0.2 31 31 78 78 78 61 60 80 97 97 89 [992.5]AEER 968 HM(+15.99)CPMLR 4.8 69 452.2029 2 12.225 1.5 31 31 96 93 85 86 57 [284.1]CPML[156.1] 969 KVQHELEEAEER 8.5 71 748.8698 2 12.234 1 63 64 61 97 98 99 31 31 31 94 94 80 [355.2]HEL[329.1]EER 970 HDLAPER 4 57 419.2138 2 12.245 1.1 31 88 68 66 82 31 31 [137.1]D[184.1]P[285.1] 973 KEM(+15.99)EEEQEAK 6.8 68 633.7778 2 12.289 2.6 49 49 41 31 99 96 88 91 95 31 [533.2]EEQEA[128.1] 974 ELTYQTEEDKK 9.6 88 692.3353 2 12.299 0.4 64 68 89 93 87 95 96 95 94 95 82 [242.1]TYQTEEDKK 975 Y(+79.97)LLLM(+15.99)T(+79.97)GPSGPAGRRR 10.3 64 640.968 3 12.309 1 32 32 37 36 49 59 95 93 92 95 87 79 79 57 57 45 [910.3]GPSGP[596.4] 980 VQELTYKTEEDKK 9.4 72 537.6138 3 12.375 0.1 54 50 50 61 72 77 81 93 95 74 72 85 67 [733.4]KTE[244.1]K[128.1] 982 SQVADLM(+15.99)R 5.7 71 468.2342 2 12.398 0.3 72 65 92 95 92 85 31 31 [215.1]VADL[303.1] 983 CPGM(+15.99)EQMKEAK 7.2 65 634.2794 2 12.407 2.8 32 42 42 73 94 72 93 67 82 83 31 [404.1]E[128.1]M[128.1]EA[128.1] 986 ET(+79.97)LAAGNSQLGPSGQLK 12.1 71 875.9214 2 12.448 0.9 31 48 43 85 96 95 90 95 86 94 91 74 68 73 46 47 39 [423.1]AAGNSQLG[610.3] 989 KTGTDAPAPNK 6.9 63 367.1959 3 12.476 0.8 75 75 62 45 42 48 56 78 90 80 31 [741.4]PN[128.1] 991 GFLGSDTHDK 7.1 71 538.754 2 12.509 0 78 83 94 94 92 90 58 50 39 31 [57.0]FLGSD[481.2] 992 CCPPAGCLR 5.4 61 460.2002 2 12.519 1.7 31 31 31 90 88 74 75 88 31 [303.1]PA[160.0]L[156.1] 994 HDNEANGDVLGKGGVNR 10.5 62 876.4225 2 12.539 2.4 68 67 66 63 59 45 46 62 68 90 82 78 67 56 44 43 38 [951.4]LG[611.4] 995 LY(+79.97)KRPGFGAAPAGGDNHK 10.9 61 645.9804 3 12.549 2.2 37 55 41 41 61 68 61 72 77 71 49 66 72 92 77 50 52 38 [1365.7]G[494.2] 997 EFDKHLGK 5.6 70 325.1747 3 12.584 0.7 31 72 69 76 85 70 76 75 [519.2]H[298.2] 998 AAPSEAAAAAGTSPTK 12.5 78 700.8541 2 12.594 0.5 31 61 60 60 65 85 95 97 98 95 94 95 94 84 92 31 [455.2]AAAAAGTSPT[128.1] 999 YETDALQR 7.4 92 498.2428 2 12.604 0.8 94 95 96 94 94 94 87 81 YETDALQR 1001 VQDPAGSSGPSGPQGSR 11.5 67 792.3734 2 12.627 0.8 37 37 46 49 56 92 96 96 90 81 80 89 65 57 60 74 31 [510.2]GSSGPSG[525.3] 1003 FLTY(+79.97)TVSSKFR 6.8 62 476.9013 3 12.661 2.1 36 36 44 38 39 67 97 92 82 86 55 [804.3]SSKF[156.1] 1004 EKEHNHPMR 5 56 393.1884 3 12.671 2.2 38 36 38 72 66 93 91 31 31 [637.3]HP[287.1] 1009 WRLFNYEVKCPR 6.8 56 403.462 4 12.738 0.3 34 34 48 52 52 50 42 60 83 92 93 31 [1107.6]KCP[156.1] 1010 QNDSGSSNVFR 8.4 76 605.7758 2 12.749 0.3 59 55 91 97 98 97 94 88 93 31 31 [242.1]DSGSSNV[303.2] 1011 VVWT(+79.97)RTPACNHVR 8.2 63 540.259 3 12.759 3.1 44 44 39 39 48 51 94 92 90 76 83 84 31 [822.4]PAC[114.0]HV[156.1] 1013 EY(+79.97)PFWNNLR 5.3 59 330.3959 4 12.782 0.4 31 31 31 31 69 78 73 96 85 [1030.4]LR 1015 QFAGDDAPR 7 78 488.7281 2 12.815 0.7 63 86 95 98 98 96 96 31 31 [128.1]FAGDDA[253.2] 1018 LY(+79.97)NFKGTAGGPGSPNAQR 11.5 64 638.9659 3 12.845 1.3 31 38 36 36 56 92 94 87 74 62 67 82 91 73 67 52 61 39 [745.3]GTA[211.1]GS[566.3] 1021 KSTKSTECAEER 8.7 72 456.8844 3 12.889 2.7 32 32 33 40 57 86 97 98 98 98 98 90 [531.3]TECAEER

PAGE 311

311 1022 FQAGDDAPR 6.3 70 488.728 2 12.897 0.5 55 57 81 91 94 92 91 31 31 [275.1]AGDDA[253.2] 1024 VQHELEEAEER 8 73 684.8228 2 12.917 0.4 73 68 95 98 99 31 31 31 94 94 81 [227.1]HEL[329.1]EER 1025 M(+15.99)DNM(+15.99)MCPR 5.7 71 515.1833 2 12.927 2.5 68 65 63 88 87 80 80 31 [376.1]M(+15.99)MCP[156.1] 1029 Y(+79.97)CKM(+15.99)VRYQSWNASLQMGPR 11.2 59 805.3587 3 12.977 0.5 32 57 34 35 37 31 42 45 62 68 90 77 78 89 74 85 74 72 31 [1440.6]N[158.1]L[128.1]M[310.2] 1033 KLAEQDEEMEKLKR 10.7 76 582.9733 3 13.029 0.1 84 64 67 75 65 90 95 31 95 91 91 86 73 55 K[441.2]DE[129.0]MEKL[284.2] 1035 RRWWEMGVMDLKR 7.4 57 588.3045 3 13.048 0.1 31 32 31 47 74 75 81 77 74 55 53 62 42 [944.4]G[742.4] 1036 KVVGNEYVTK 7.7 77 379.5482 3 13.057 1 31 85 89 88 86 93 91 96 31 76 [128.1]VVGNEYV[229.1] 1037 KLAEKDEEMEQLKR 10.6 76 873.9559 2 13.064 0.5 74 79 89 95 96 97 98 31 95 92 50 59 52 45 [241.2]AEKDE[129.0]ME[525.3] 1039 WEHSSKGAVCR 6.9 62 315.6548 4 13.095 1.8 50 53 53 57 49 45 53 59 85 91 85 [882.4]VCR 1040 RLST(+79.97)AM(+15.99)CLLR 6.4 64 420.5373 3 13.102 2.2 34 39 40 83 58 60 94 94 96 31 [356.2]T(+79.97)[218.1]CLL[156.1] 1041 HQGVMVGMGQK 9.1 83 586.2885 2 13.11 1.1 92 90 96 96 96 96 92 88 61 62 38 HQGVMVGM[313.2] 1042 M(+15.99)HHFVGNTTK 5.7 57 396.5262 3 13.117 1.3 31 31 31 31 97 93 72 75 76 31 [568.2]VG[444.2] 1043 RMLS(+79.97)TSLLCR 6.2 62 630.3022 2 13.126 2.3 50 46 58 59 84 82 90 81 33 31 [567.2]TSLL[259.1] 1046 T(+79.97)SNAQEEANNAR 9 75 692.777 2 13.166 1.4 97 97 93 97 92 98 97 89 37 33 33 31 T(+79.97)SNAQEEA[455.2] 1047 CAQDDPTGGQSVAR 12.1 86 702.8106 2 13.176 2.3 70 75 72 96 98 97 94 80 83 87 93 92 93 72 [302.1]DDPTGGQSVA[156.1] 1048 Y(+79.97)YFEVGSPTGDTRARK 10.3 64 642.9645 3 13.185 2.4 31 31 35 41 41 76 88 95 94 96 89 87 87 58 37 35 [838.3]SPTGDTR[355.2] 1051 LLAPEPR 4.9 70 398.2395 2 13.228 0.6 98 98 97 98 31 31 31 LLAP[382.2] 1052 FTQVLHHGNMK 6.6 60 328.6709 4 13.235 0.5 45 45 38 40 56 91 89 86 57 61 41 [588.3]HHG[373.2] 1053 RHT(+79.97)LHAPGTTR 6.1 56 442.8869 3 13.242 2.7 31 31 31 67 53 81 85 67 66 61 31 [724.3]AP[415.2] 1054 TFQVLHHGNMK 8.8 80 656.3344 2 13.25 0.7 72 72 66 96 98 98 95 80 67 73 53 [376.2]VLHHG[373.2] 1055 T(+79.97)TTLLASLGTKR 7.9 66 447.9084 3 13.26 2.2 32 32 48 65 71 74 89 93 83 84 85 31 [680.3]SLGTK[156.1] 1059 WLYWFDGGKR 6 60 332.6693 4 13.307 1.9 32 32 35 37 52 79 82 81 84 83 [910.4]GGKR 1060 HHLQEMALLEQNK 9 69 530.9395 3 13.317 1.1 31 91 86 56 69 84 73 74 95 90 50 55 40 [137.1]HL[257.1]M[184.1]LE[370.2] 1061 LHSQLTGSGLNSK 8.9 69 671.3593 2 13.327 0.6 31 98 93 70 69 70 78 44 44 49 82 91 67 [113.1]HS[656.3]NS[128.1] 1063 KAEPAPEPVAAPAPK 10.8 72 736.9088 2 13.359 0.3 92 92 94 31 31 31 93 86 86 88 95 81 54 85 31 KAE[265.1]EPVAAP[71.0]P[128.1] 1064 NAEPTASPLR 7.5 75 528.2776 2 13.368 0 68 72 90 92 91 91 92 84 31 31 [185.1]EPTASP[269.2] 1065 SPLGSPSDDDFANKR 10.3 69 803.3801 2 13.376 1.7 31 81 83 92 94 97 93 77 97 31 72 49 44 46 39 [87.0]PLGSPS[115.0]D[731.4] 1066 TLKSGECDPTK 8.9 81 589.7896 2 13.387 0.2 84 90 97 97 90 76 73 92 78 78 31 TLKSG[232.1]D[326.2] 1067 KYSSHFSASPK 7.5 68 413.5424 3 13.396 3 38 38 41 93 93 88 83 80 77 81 31 [378.2]SHFSA[87.0]P[128.1] 1069 WRWLTPAEAAGDSARR 9.7 61 461.4888 4 13.428 1.3 34 33 32 46 51 51 46 51 65 77 85 92 92 89 91 31 [1181.6]GDSAR[156.1] 1071 HLKT(+79.97)Y(+79.97)RGQRELK 6.8 57 422.9552 4 13.447 2.5 32 33 42 44 44 58 65 86 87 66 88 31 [1015.4]QR[129.0]L[128.1]

PAGE 312

312 1076 RKMQEMPESKAQR 7.9 60 540.275 3 13.509 2.9 33 35 35 37 86 94 94 88 75 45 53 48 55 [543.3]EMPE[570.3] 1077 RFPVKWCSSAGFR 7.9 61 385.9527 4 13.516 3.2 33 36 34 37 41 64 71 94 86 86 85 86 31 [916.5]SSAGF[156.1] 1078 NSM(+15.99)QTVSSQFR 9.2 84 650.8007 2 13.526 0.6 55 56 60 86 96 97 99 95 94 97 82 [348.1]QTVSSQFR 1079 LTENADFGR 7.3 81 511.7485 2 13.533 0.4 97 97 97 91 93 94 88 31 31 LTENADF[213.1] 1082 LNMKWFPGHYWR 6.9 57 545.6062 3 13.569 0.4 77 36 36 36 35 54 73 78 83 53 80 42 [973.5]H[163.1]W[156.1] 1083 LAEKDM(+15.99)NGAEQLGVK 11.4 76 809.9083 2 13.578 0.7 54 65 80 72 97 70 83 86 88 92 86 89 75 67 31 [184.1]E[128.1]D[147.0]NGAEQL[284.2] 1084 LQDLVDK 4 58 415.7339 2 13.587 1.5 31 88 93 94 31 31 31 [113.1]QDL[342.2] 1085 KHQWRRLRCDDGFAR 8.5 57 486.7536 4 13.596 2.2 37 38 38 58 56 32 43 46 73 82 91 81 71 63 31 [1263.7]DDG[374.2] 1087 HDCDLLR 4.2 60 436.208 2 13.626 0.4 31 31 31 95 95 98 31 [355.1]DLL[156.1] 1088 T(+79.97)PRDWATVPQPTSGTK 10.8 68 607.9549 3 13.633 1.5 31 44 36 50 52 86 96 96 94 84 90 89 83 59 55 31 [735.3]ATVPQPTS[286.2] 1089 T(+79.97)Y(+79.97)RRVPALSAVPM(+15.99)R 7.9 57 598.2841 3 13.642 2.7 31 31 31 31 62 50 46 47 71 92 92 81 90 31 [1203.5]AVPM(+15.99)[156.1] 1090 GSPLGMSGPR 6.6 66 479.7424 2 13.652 0.1 31 31 94 94 96 92 82 57 43 31 [144.1]PLGMS[310.2] 1093 MLTNLR 4.7 78 374.2127 2 13.689 0 88 88 90 73 74 53 MLT[383.2] 1094 RFEM(+15.99)RWKYEEVAR 7.5 57 454.7302 4 13.696 1.6 33 33 31 85 33 37 37 44 82 79 89 90 65 [432.2]M(+15.99)[633.3]E[129.0]VA[156.1] 1095 MCPGPVPKR 5.9 65 492.7608 2 13.703 2.6 89 89 89 90 91 31 35 33 34 MCPGP[480.3] 1099 TGEKTEELANMK 7.7 64 450.8902 3 13.751 0.5 37 43 49 42 41 42 93 96 90 83 84 61 [645.3]ELANM[128.1] 1100 LDEAENLAM(+15.99)K 9.2 92 575.2762 2 13.758 0.3 94 95 97 98 96 86 92 93 97 71 LDEAENLAM(+15.99)[128.1] 1101 ASETEKELANMK 10.6 88 675.8317 2 13.765 0.5 62 67 88 97 97 97 96 97 95 92 93 74 [158.1]ETEKELANM[128.1] 1102 LLKDPEATGSLKK 8.1 62 467.2762 3 13.772 0.9 34 46 44 58 81 96 95 91 60 48 52 63 31 [469.3]PEAT[513.3] 1105 NAGEVAQWR 7.8 87 515.7569 2 13.807 0.1 56 62 92 94 97 98 92 97 90 [185.1]GEVAQWR 1107 NLEVTVK 5.1 73 401.7369 2 13.821 0.3 31 99 96 96 90 31 61 [114.0]LEVT[227.2] 1108 QY(+79.97)NLWLMTLEK 6.5 59 380.4313 4 13.827 1.8 55 58 57 50 46 40 48 70 92 93 31 [1129.5]LE[128.1] 1111 FLKVMNY(+79.97)SSNHDAVKPK 9.8 58 686.6672 3 13.863 0.4 31 42 50 87 58 54 41 55 92 83 73 62 56 56 52 51 31 [388.2]V[575.1]SN[775.4] 1112 ANGEVAQWR 7.5 84 1030.505 1 13.872 1.8 72 73 87 88 94 94 79 88 72 [185.1]GEVA[128.1]W[156.1] 1113 NAGQVAEWR 6.7 74 515.7562 2 13.881 1.3 36 37 55 58 91 96 97 97 95 [370.2]VAEWR 1114 LAEKDEEMEQLK 7.3 61 488.2408 3 13.888 1.1 37 35 37 37 64 67 31 97 91 76 87 61 [814.4]ME[128.1]L[128.1] 1115 GQGLAANLDK 7 70 493.7662 2 13.895 1.3 50 58 90 94 95 54 50 78 92 31 [185.1]GLA[298.2]D[128.1] 1117 AEPAPELGPAAPPK 8.6 61 672.8615 2 13.923 0.1 31 31 31 31 31 95 83 66 61 91 91 84 89 31 [465.2]EL[154.1]AAPP[128.1] 1118 AGRGNYSAGTYPR 8.5 65 457.2248 3 13.93 0.5 63 45 37 38 47 85 66 62 67 72 93 93 78 [455.2]Y[316.1]YP[156.1] 1119 M(+15.99)T(+79.97)VAGTSKTPGRKR 9.6 68 793.3996 2 13.937 2.5 44 67 56 93 94 94 96 96 84 63 46 42 39 35 [427.1]AGTSKT[594.4] 1120 LMAENGAGVGPTSSTSR 12.3 72 817.8937 2 13.946 0 48 54 82 90 89 92 91 96 97 93 78 73 88 31 59 31 31 [244.1]AENGAGVG[198.1]S[431.2]

PAGE 313

313 1121 Y(+79.97)KPAKSDR 4.8 60 522.7463 2 13.956 1.8 63 62 50 92 66 55 56 31 [468.2]A[486.3] 1123 KMM(+15.99)RCPRPFAGLVR 8.5 61 420.2283 4 13.986 3.1 35 34 33 49 51 61 56 78 76 87 85 83 84 31 [1162.6]AGLV[156.1] 1124 KGKAYTQQVEELQR 10.1 72 559.9685 3 13.993 0.4 31 87 58 53 56 64 59 73 95 96 92 83 85 66 [128.1]G[719.4]VEELQ[156.1] 1125 KNCVWVPLYR 6.4 64 426.566 3 14.001 0.9 32 39 41 80 89 91 81 74 76 31 [345.1]VWVP[432.2] 1126 M(+15.99)TQKVEELKR 7.6 76 639.3458 2 14.008 3 84 84 60 71 95 97 91 67 68 41 M(+15.99)T[256.2]VEE[397.3] 1130 QVS(+79.97)PPTVSSKFR 9.4 78 471.5697 3 14.055 0.9 50 50 50 85 79 70 99 99 97 92 94 71 [394.1]P[198.1]VSSKF[156.1] 1131 KGGSMQTVSSQFR 11.9 92 706.8507 2 14.062 0.6 96 91 88 87 87 88 96 96 98 93 91 96 81 KGGSMQTVSSQFR 1132 LLDPEATGSLKK 9.2 77 636.3634 2 14.069 0.7 96 97 97 98 87 68 68 78 60 59 75 31 LLDPE[685.4] 1135 RWPLY(+79.97)Y(+79.97)KKY(+79.97)RQHLSAKR 9.7 57 507.442 5 14.103 0.4 34 37 35 45 37 43 45 39 41 41 60 61 93 94 91 92 71 [1958.8]LSAK[156.1] 1137 NLPDLGDNR 6.4 71 1013.501 1 14.12 0.2 67 76 82 91 97 80 64 44 31 [227.1]PDLG[385.2] 1138 GSNAMKTVSSQFR 9.6 74 706.8511 2 14.126 0 37 42 41 44 50 93 94 95 98 94 89 96 79 [460.2]KTVSSQF[156.1] 1141 RRHYSEVDNEQR 8.4 70 530.2571 3 14.163 0.5 31 33 45 45 67 75 95 97 89 86 87 86 [828.4]VDNEQR 1142 RVDLESEVDNEQR 11.2 86 794.8818 2 14.171 0.2 91 90 95 96 95 92 92 95 96 69 63 66 75 RVDLESEVD[527.2] 1144 SFACAVK 5.6 80 363.1862 2 14.189 0.1 90 90 97 83 82 82 31 SFACAV[128.1] 1145 LRMDLER 4.9 71 311.5042 3 14.197 0.1 32 32 72 78 91 97 89 [515.3]LER 1147 HDM(+15.99)FPER 6.1 87 474.2076 2 14.224 4.1 96 96 96 96 96 96 31 HDM(+15.99)FPE[156.1] 1148 NSVGGSSGCMR 6.1 55 1054.443 1 14.232 2.8 31 95 93 92 84 42 31 35 33 33 31 [114.0]SVGG[621.2] 1149 KVAEQELVDASER 11.7 90 737.3809 2 14.239 0.2 95 95 97 98 91 97 98 99 98 92 77 73 49 KVAEQELVDA[372.2] 1150 KKDFETSQLLSK 10.3 85 712.3934 2 14.246 0.3 98 97 96 97 94 92 68 59 71 90 91 68 KKDFET[328.2]LS[128.1] 1151 S(+79.97)PNSSGRNR 7 78 527.7253 2 14.253 0.8 93 94 89 95 94 76 63 58 31 S(+79.97)PNSS[483.3] 1153 LLAEEKNVDASER 11.3 87 737.3815 2 14.281 0.9 90 94 94 97 97 95 90 96 98 87 72 68 50 LLAEEKNVDA[372.2] 1154 QSEEYKKALLSK 7.2 60 356.7002 4 14.288 0 37 37 39 47 32 32 59 82 93 94 94 74 [892.4]ALLS[128.1] 1155 EYVTTLR 4.5 64 441.2399 2 14.296 0.1 88 88 77 70 50 38 33 EY[570.3] 1156 GPAGPLGATGM(+15.99)SGPAGR 13.3 78 735.3608 2 14.303 1.4 83 91 92 97 98 96 94 94 96 94 94 34 41 45 67 71 31 GPAGPLGATGM(+15.99)[525.3] 1157 ELTALASLECK 8.7 79 589.3104 2 14.312 0.2 73 81 93 95 97 97 94 93 78 31 31 [129.0]LTALASL[360.1] 1160 WRGRELVDASER 8.2 69 491.9232 3 14.345 0.2 39 38 36 40 44 68 98 99 95 90 90 81 [797.4]VDASER 1161 VLADWK 3.8 63 366.2079 2 14.352 0 31 97 93 93 31 31 [99.1]LAD[314.2] 1165 NTVADLMR 7 88 460.2368 2 14.392 0.2 70 77 95 96 95 94 94 76 [215.1]VADLM[156.1] 1166 VLADWK 3.8 63 731.4083 1 14.398 0.4 31 95 94 94 31 31 [99.1]LAD[314.2] 1167 SPLGSPSDDSVMNKR 9.1 61 795.3829 2 14.405 0.1 31 68 67 73 74 90 92 31 95 78 42 41 38 48 36 [441.2]PS[115.0]D[715.4] 1168 SQVADLMR 6.6 82 919.4656 1 14.412 1 74 62 76 89 93 93 94 74 [314.2]ADLM[156.1]

PAGE 314

314 1169 LMVMAEK 4.1 58 411.2163 2 14.419 0.7 31 31 94 94 91 31 31 [244.1]VMA[257.1] 1171 LLWM(+15.99)YPVAVHKK 7 58 500.9521 3 14.446 1.5 31 52 31 31 31 96 94 91 92 80 31 31 [722.3]PVAVH[256.2] 1173 SQVADLM(+15.99)R 5.4 68 468.2341 2 14.462 0.5 72 64 94 86 86 76 31 31 [215.1]VAD[416.2] 1175 KAEPAPEPVAVPAPK 11 73 750.9243 2 14.476 0.4 90 89 92 31 31 31 87 84 86 87 93 95 83 82 31 KAE[265.1]EPVAVPAP[128.1] 1179 HNYLACQEQANSYLSK 11 69 623.6251 3 14.522 0.6 57 63 48 41 37 37 40 90 71 97 91 92 92 88 88 62 [829.4]E[128.1]ANSYLS[128.1] 1180 Y(+79.97)NTVLLTWM(+15.99)PR 7.8 71 745.347 2 14.53 2.7 70 76 74 90 97 97 94 79 31 31 31 [458.1]VLLT[586.3] 1181 KFAYSNAQEEAEEQPK 12.5 78 934.9341 2 14.537 2.6 62 46 74 96 97 94 97 90 96 97 96 93 67 43 56 38 [346.2]YSNAQEEAE[482.2] 1183 LYVHMELLALK 8.7 79 443.9255 3 14.566 1.5 31 91 91 91 95 93 89 79 79 91 31 [113.1]YVHMEL[184.1]L[128.1] 1184 HGVKMNGPR 5.2 58 498.2631 2 14.573 1.5 31 86 86 88 67 48 48 33 31 [137.1]GVK[555.3] 1185 LSAKSPSM(+15.99)DAK 8.9 81 575.7905 2 14.581 3 98 98 97 97 96 70 70 65 89 31 71 LSAKS[331.1]D[199.1] 1186 NRCSPDDKDRQR 7.7 64 745.3486 2 14.588 1.6 64 54 55 31 76 79 81 87 90 59 54 31 [672.3]DKD[440.3] 1187 KKEEEELLALK 9.1 83 665.3848 2 14.595 0.1 98 97 97 99 31 89 93 94 88 85 31 KKEE[129.0]ELLAL[128.1] 1189 VFMGKM(+15.99)HTVM(+15.99)GAELR 9.7 65 580.2858 3 14.625 0.5 31 39 38 38 37 38 42 91 95 93 92 91 87 87 68 [846.4]TVM(+15.99)GAEL[156.1] 1190 MSADAMLK 5.8 72 433.709 2 14.632 0.3 98 96 94 86 61 52 48 37 MSAD[443.3] 1191 DGLLSKDDLR 6.5 65 377.8715 3 14.639 0.2 34 34 47 69 63 67 86 87 87 69 [613.3]DDL[156.1] 1192 EVGLSKDDLR 7.3 73 566.3035 2 14.645 0.4 36 36 51 59 87 86 86 93 98 92 [398.2]SKDDLR 1195 FFRFYTWVAGLVR 7.6 58 416.2304 4 14.68 2.9 31 34 34 33 36 83 66 88 84 85 76 70 31 [760.4]T[186.1]VAG[368.3] 1196 QGQAFTKQVEELKR 9.3 66 554.6375 3 14.687 0.7 51 43 42 55 79 69 55 55 85 87 91 77 78 51 [888.4]VEE[397.3] 1197 QPLAANLDQK 8.7 87 549.3017 2 14.695 1.1 65 81 87 98 97 95 95 94 80 77 [128.1]PLAANLDQ[128.1] 1199 SLNSADMLK 8.1 90 489.7499 2 14.707 0.1 89 89 88 96 94 92 91 92 71 SLNSADML[128.1] 1201 LWSLNFAPY(+79.97)TLRR 7.4 57 572.9611 3 14.734 3.9 31 31 59 59 47 54 55 48 67 77 78 94 31 [1385.6]R[156.1] 1203 KGQAFTQQVEELKR 10.9 78 831.4519 2 14.75 0.2 39 52 49 97 98 97 85 83 94 97 92 76 77 48 [313.2]AFTQQVEE[397.3] 1204 SLNSADLMK 6.8 76 978.4919 1 14.757 0.5 85 85 82 91 90 87 63 59 36 SLNSAD[372.2] 1205 NLELTVK 4.1 59 408.7448 2 14.765 0.3 31 92 74 71 66 31 41 [114.0]L[570.3] 1207 LDEAENLAMK 9 90 567.2798 2 14.792 1.5 95 95 98 98 96 91 95 95 96 31 LDEAENLAM[128.1] 1208 SSREPAEQARHHRR 9.3 67 858.9393 2 14.799 2.1 31 92 90 85 67 72 88 76 87 72 71 34 31 31 [87.0]SRE[168.1]E[128.1]A[742.4] 1209 EGNGTVMGAELR 9.5 79 617.2985 2 14.807 0.4 34 34 49 90 93 96 97 95 94 93 93 79 [300.1]GTVMGAEL[156.1] 1210 LDEAENLAMK 7.2 72 1133.551 1 14.813 0.2 86 87 94 92 83 76 61 54 51 31 LDEAE[557.3] 1213 LGNSADMLK 7.8 87 474.745 2 14.849 1 79 79 89 96 94 93 90 90 67 [170.1]NSADML[128.1] 1214 YMLDSLTYK 6.7 74 1133.552 1 14.855 2.4 91 86 71 93 88 78 64 59 31 YM[113.1]DS[505.3] 1215 GLNSADLMK 6.1 68 948.4825 1 14.862 0.7 65 63 76 89 88 84 55 50 33 [284.1]SAD[372.2]

PAGE 315

315 1220 ELDEQSLGAQLKQK 10.8 77 793.9225 2 14.913 0.3 61 61 78 83 89 97 97 93 93 69 86 60 73 31 [357.2]EQSLGA[128.1]L[384.2] 1223 FVKALNSS(+79.97)R 5.4 60 551.2749 2 14.939 2.3 31 61 63 71 78 78 93 31 31 [672.4]S[323.1] 1225 SNMQTVSSQFR 9.1 83 642.8033 2 14.967 0.5 49 48 50 86 96 97 99 97 96 98 87 [332.1]QTVSSQFR 1226 LLTRAENGEFGR 6.9 58 454.9086 3 14.974 0.8 33 33 33 36 51 72 89 95 95 88 31 31 [683.4]NGEF[213.1] 1227 RALMTKPWM(+15.99)GR 8.2 75 681.8593 2 14.981 1.4 94 94 92 90 92 94 96 31 55 31 43 RALMTKP[546.2] 1228 VAVLHSQNTSLLNSKK 10.9 68 869.9937 2 14.988 0.5 32 34 35 53 99 97 89 80 58 56 77 94 84 81 83 31 [382.3]HSQN[301.2]LNSK[128.1] 1229 NCNETVSSKFR 8.6 78 642.8033 2 14.996 0.5 44 48 46 68 96 98 99 98 93 94 71 [460.1]TVSSKF[156.1] 1231 VAEQELVDASER 10.8 90 673.3336 2 15.024 0.5 68 72 89 88 96 96 97 99 97 94 94 87 [170.1]EQELVDASER 1233 NSM(+15.99)QTVSSQFR 8.4 76 650.8011 2 15.042 0.1 49 49 50 82 95 97 99 95 71 85 61 [348.1]QTVSS[128.1]F[156.1] 1234 RRLCAAMM(+15.99)AEELKK 9.2 66 555.957 3 15.05 1.8 31 55 36 40 45 74 84 93 96 96 80 74 77 31 [670.4]MM(+15.99)AEE[369.3] 1235 WTTEKELANMFHSYSR 9.2 58 667.3141 3 15.057 2.7 40 40 46 45 44 56 64 66 59 91 85 51 67 63 70 31 [1072.5]MF[630.3] 1237 AADYLAAGAQEPVER 11.6 78 520.9278 3 15.087 2.5 81 80 56 59 79 93 82 62 70 61 74 89 90 89 90 AA[391.2]AA[385.2]PVER 1238 SSPDLKEQAAMVER 12.1 86 780.8879 2 15.094 0.1 64 64 72 94 96 83 97 78 97 97 95 88 88 87 [271.1]DLKE[128.1]AAMVER 1239 DEKLAALVR 5.9 66 338.8695 3 15.102 0.1 38 37 41 57 90 98 98 99 31 [485.2]AALV[156.1] 1240 DEKLAALVR 8 89 507.8008 2 15.108 0.2 94 91 93 97 98 96 94 97 31 DEKLAALV[156.1] 1241 ALLGSPSDDDMANK 11.4 82 717.3321 2 15.115 0.5 32 86 94 97 97 98 98 31 90 89 89 87 88 61 [71.0]LLGSPS[115.0]DDMAN[128.1] 1243 WQLKELLDASER 8.7 73 496.6005 3 15.144 1.2 52 36 38 38 56 89 98 97 96 92 91 83 [684.4]LLDASER 1244 FYRKPS(+79.97)PAFVER 8.1 67 526.2592 3 15.151 2.4 31 38 38 40 60 80 92 91 92 80 80 79 [691.4]S(+79.97)PAFVE[156.1] 1245 KVAEQELLDALCR 11.4 88 744.3958 2 15.16 2.8 96 95 97 98 92 97 98 98 97 89 75 69 31 KVAEQELLDA[372.2] 1246 DHRHKSVGNHWR 6.7 56 510.2583 3 15.167 1.6 31 33 33 32 31 87 83 82 72 62 68 49 [673.3]SVG[593.3] 1247 NRDLEEKAAMVER 11.4 87 780.8947 2 15.175 1.6 49 67 81 94 97 96 95 96 96 94 88 88 87 [270.1]DLEEKAAMVER 1249 TDLAAALAK 6.9 77 437.2562 2 15.204 1.3 95 95 97 96 89 85 57 40 31 TDLAAA[312.2] 1250 QVLELNKLQK 6.4 64 404.9155 3 15.21 1 54 61 62 74 86 81 59 63 51 45 [469.3]LN[497.3] 1251 FALPNRR 4.4 62 873.5052 1 15.217 0.1 31 93 92 95 59 31 31 [147.1]ALP[426.2] 1252 VSKYSNNDAVR 6.8 62 418.2148 3 15.223 1.3 31 46 40 46 59 72 75 82 80 84 58 [792.4]DAV[156.1] 1253 ARCYLEQTR 6 66 570.285 2 15.229 0.1 65 66 90 80 95 57 45 54 41 [227.1]CYL[514.2] 1255 DAQLHLDDAVR 9.2 84 626.818 2 15.259 0.7 85 77 62 95 97 97 97 93 81 83 49 D[199.1]LHLDDAV[156.1] 1256 KTTAAAMTPLK 8.3 75 378.2181 3 15.265 0.3 31 75 85 89 95 94 90 86 71 72 31 [229.1]TAAAMT[338.2] 1257 AVLTLK 3.7 61 322.7207 2 15.272 0.1 31 31 95 88 88 31 [170.1]LTL[128.1] 1258 KDFETSQLLSK 10.2 93 648.3456 2 15.278 0 96 96 98 98 97 93 82 92 94 94 75 KDFETSQLLS[128.1] 1259 YLSGQEGGAAELEGSLK 12.7 74 854.9232 2 15.284 0.1 86 76 68 70 78 83 81 80 91 95 94 92 87 52 45 46 31 Y[385.2]EGGAAELE[385.2]

PAGE 316

316 1261 LAENHLDDAVR 8.1 73 626.8175 2 15.313 0.1 37 51 59 84 96 96 97 92 74 76 41 [313.2]NHLDD[326.2] 1262 LQEAEEQLEAVNSK 11.9 85 794.3963 2 15.32 0.5 67 63 91 93 97 89 84 97 97 96 95 76 88 48 [241.1]EAEEQLEAV[114.0]S[128.1] 1263 RQRVFS(+79.97)TGSGYPR 7.5 58 398.443 4 15.328 2.1 48 41 35 39 45 36 37 47 65 79 91 96 86 [1155.5]YPR 1265 DTLAAALAK 6.7 74 873.5033 1 15.347 0.8 80 85 90 92 95 93 62 33 31 DTLAAA[312.2] 1267 RSTEPSVTMK 8 80 1135.575 1 15.375 2.8 88 88 93 96 96 96 79 63 64 31 RSTEPS[459.3] 1268 RPSAPGQVLSEK 9 75 634.8512 2 15.382 0.5 31 97 96 95 76 70 62 87 92 72 72 43 [156.1]PSA[282.1]VL[344.2] 1269 AEPAPEPVAVAPPK 9 65 686.8773 2 15.39 0.2 31 31 31 31 31 85 83 85 88 94 96 89 90 31 [465.2]EPVAVAPP[128.1] 1270 WTFCDNPGLREPR 8 62 530.9222 3 15.397 2.4 31 37 35 56 73 47 52 85 85 88 88 90 31 [863.3]GLREP[156.1] 1271 Y(+79.97)KKGFLYALTNTNM(+15.99)LKMVR 10.9 57 1194.101 2 15.405 2.7 73 64 46 41 41 56 40 46 55 58 77 82 87 59 65 51 53 50 31 [1378.7]TN[774.4] 1273 LLTENGEFGR 7.3 73 568.2912 2 15.438 0.9 98 98 97 83 55 62 79 87 31 31 LLTE[300.1]F[213.1] 1277 KHSARSK 4.1 58 407.2392 2 15.48 2.6 31 80 77 77 48 50 39 [128.1]H[529.3] 1279 LLTENGEGFR 7.9 79 1135.575 1 15.509 0.3 94 94 94 95 92 90 88 74 31 31 LLTENGE[360.2] 1282 SGCPEAKEKADSYPCK 11.6 73 856.8842 2 15.538 0.3 58 68 84 93 59 54 54 80 91 89 82 85 81 65 81 31 [144.1]CP[328.2]EKADSY[97.1]C[128.1] 1285 QLEAEEQLEAVNSK 12.3 88 794.3971 2 15.579 0.5 68 73 94 97 99 96 89 96 97 97 96 81 92 52 [241.1]EAEEQLEAVNS[128.1] 1287 NEELEAMVK 7 78 1062.514 1 15.598 0.1 66 71 93 96 94 87 70 86 31 [243.1]ELEA[131.0]V[128.1] 1288 NEELEAMVK 7.4 83 531.7609 2 15.606 0.8 66 71 97 97 95 94 92 96 31 [243.1]ELEAMV[128.1] 1289 EEQYPFAATNRGLSK 10 67 570.9527 3 15.613 0.5 41 41 41 53 57 41 81 92 90 88 88 89 82 82 31 [793.3]AATNRGLS[128.1] 1291 FEELLTR 5.1 73 454.2482 2 15.642 0.9 31 31 96 97 92 89 72 [276.1]ELLT[156.1] 1292 QAYTAGQVEELK 9.4 79 668.8413 2 15.649 0.8 70 82 90 93 89 88 84 88 96 95 31 31 [128.1]AYTAGQVEE[241.2] 1293 VLDSPGPPVNVK 8.4 70 611.3458 2 15.656 0.5 31 31 31 31 95 94 94 87 87 81 94 80 [414.2]PGPPVNVK 1294 SM(+15.99)M(+15.99)EQSQLKEYK 10.4 87 767.3484 2 15.663 1.8 94 94 94 98 90 95 74 96 88 95 87 31 SM(+15.99)M(+15.99)EQS[128.1]LKEY[128.1] 1295 VVVAPM(+15.99)YSVAPPK 10.8 83 687.3793 2 15.671 1.2 66 79 80 92 96 94 85 90 89 92 89 90 31 [198.1]VAPM(+15.99)YSVAPP[128.1] 1297 LVDSM(+15.99)QATLDSEVR 12.8 91 790.3858 2 15.7 0.8 70 78 91 97 96 88 97 97 98 97 94 89 89 88 [212.2]DSM(+15.99)QATLDSEVR 1298 QSEEAEEQANSYSLK 10.9 73 856.884 2 15.707 0.1 47 48 76 90 31 98 96 89 96 91 93 77 58 55 39 [344.1]E[71.0]EEQANS[491.3] 1299 DPDSFKATLDSEVR 11.6 83 790.3858 2 15.716 2.9 51 50 56 72 75 95 97 97 97 97 94 89 89 88 [561.2]KATLDSEVR 1304 KGQAM(+15.99)TQKVEELK 9.1 70 753.4042 2 15.771 1.2 54 68 61 96 94 91 49 52 86 94 93 31 31 [313.2]AM(+15.99)T[256.2]VEE[241.2] 1305 KGKMSNDKVEELK 7.8 60 502.6051 3 15.778 1.1 31 78 40 38 40 64 81 83 87 88 79 31 31 [645.3]DKVE[370.2] 1306 LVLVGHGHK 5.1 56 959.5801 1 15.785 1.7 31 31 84 83 85 55 50 52 31 [212.2]LVG[459.2] 1311 LEDEQSLGAQLQK 11.6 89 729.8746 2 15.833 0.9 82 81 95 96 88 94 94 96 96 86 91 78 75 LEDEQSLGAQL[256.2] 1313 EGAVDSMLPAQK 8.6 72 623.3103 2 15.849 0.7 38 45 71 88 96 94 92 93 77 66 63 31 [257.1]VDSML[424.2] 1316 LDEANELALK 8 80 558.3004 2 15.885 0.7 96 96 98 95 50 51 89 94 90 31 LDEA[243.1]LAL[128.1]

PAGE 317

317 1318 TGLSNMGSYNSSHLQK 12.1 75 862.4061 2 15.899 1.1 34 36 45 86 91 97 97 92 70 64 93 98 94 72 76 53 [271.2]SNMGS[277.1]SSH[369.2] 1319 GYSFVTTAER 7.6 76 1130.547 1 15.907 0.9 74 73 89 92 93 93 87 59 60 34 [220.1]SFVTT[356.2] 1321 M(+15.99)TANEEVKAALKR 8.8 67 492.9318 3 15.937 2.1 33 33 34 43 84 92 93 95 95 81 70 71 46 [433.2]EEVKAA[397.3] 1322 ELTALAALECK 8.5 77 581.3128 2 15.944 0 65 76 90 95 97 98 94 89 76 31 31 [242.1]TALAAL[360.1] 1323 FDELLGR 4.9 69 425.2271 2 15.95 0.6 31 31 96 98 98 96 31 [262.1]ELLG[156.1] 1324 KAM(+15.99)TQQVEELKR 9.4 78 738.8939 2 15.957 2.3 51 63 61 95 87 83 85 94 94 79 80 56 [346.2]TQQVEE[113.1]K[156.1] 1325 WLHHTFYNELR 8.1 73 505.9212 3 15.964 0.1 37 37 62 91 91 93 79 82 63 89 75 [436.2]HTF[163.1]N[129.0]L[156.1] 1327 MVSLLQEK 6.8 85 474.2655 2 15.993 0.8 99 99 99 31 96 83 92 80 MVS[113.1]LQEK 1328 EALVSQLTR 6.3 70 1016.574 1 15.999 0.1 94 92 93 90 81 46 45 45 37 EALVS[498.3] 1329 EALVSQLTR 7.6 85 508.7907 2 16.005 0.7 55 70 84 97 94 85 94 96 86 [200.1]LVSQLTR 1330 MVSLLQEK 6.3 78 947.523 1 16.011 0 93 93 93 31 93 70 84 63 MVS[113.1]L[128.1]E[128.1] 1331 LQDAEEQLEAVNSK 11.9 85 787.3887 2 16.017 0.2 52 48 89 96 98 97 90 97 97 96 95 80 91 53 [241.1]DAEEQLEAVNS[128.1] 1333 MVSLLQEK 6.4 80 474.265 2 16.046 0.3 97 97 97 31 93 73 76 69 MVS[113.1]L[385.2] 1334 ELTALAPSTMK 8.6 78 1161.617 1 16.052 1.4 92 91 89 91 97 97 83 74 55 56 31 ELTALAP[447.2] 1335 QALVSENKK 6 66 1016.572 1 16.06 1 78 92 93 95 82 43 38 38 33 [128.1]ALVS[499.3] 1336 KLTANAAMWR 6.7 67 581.3125 2 16.066 1.8 63 73 89 93 95 94 45 38 38 39 [241.2]TANA[544.3] 1337 QAFTEQVEKNKR 9.2 77 739.3947 2 16.073 4.2 68 80 89 94 85 60 61 90 88 70 79 55 [128.1]AFTE[227.1]EK[398.2] 1339 EYEGQAELEGSLK 10.3 79 726.8455 2 16.101 1 31 98 97 96 90 97 98 97 94 70 66 61 31 [129.0]YEGQAELE[385.2] 1340 LLTEDGEFGR 7.5 75 568.7823 2 16.109 0.9 95 97 96 94 75 68 76 83 31 31 LLTE[301.1]F[213.1] 1341 YTAGDPAK 5.3 66 822.3978 1 16.115 1.6 69 69 86 86 84 67 31 31 [264.1]AGD[296.2] 1342 TTKDPMM(+15.99)CLVQVR 7.2 55 513.257 3 16.122 1.9 64 69 52 44 45 63 56 55 55 60 45 64 42 [1518.7] 1343 YLVDDNVGMR 7 70 591.2838 2 16.129 1.4 31 31 31 98 95 90 96 94 94 31 [375.2]DDNVGM[156.1] 1345 QVTEEMASQDESVAK 11.5 76 826.3782 2 16.157 0.7 48 50 88 96 98 98 98 97 91 97 93 61 47 47 31 [227.1]TEEMASQDE[385.2] 1346 SEVSSPMASQDESVAK 11.7 73 826.3782 2 16.165 0.7 56 59 88 75 74 79 95 97 94 83 95 92 58 42 42 31 [216.1]V[271.1]MASQDE[385.2] 1347 SPTDAAMLFSELQK 9.5 68 769.3835 2 16.173 2.1 46 48 54 74 90 93 90 72 60 63 77 67 66 49 [400.2]AAM[845.5] 1349 YEEGQAKDEKTR 9.2 77 727.3478 2 16.19 2.3 31 99 97 94 75 91 79 92 93 65 67 35 [163.1]EEG[128.1]A[128.1]DE[385.2] 1352 LLTEPADM(+15.99)GR 7.2 72 559.7777 2 16.226 2.5 97 97 97 97 38 36 42 78 79 54 LLTE[643.3] 1355 NSPLYDK 5.1 72 836.4146 1 16.249 0.2 64 71 86 90 79 81 31 [201.1]PL[163.1]D[128.1] 1357 RHWRVNTSLLNSK 8.6 66 537.6339 3 16.277 0.2 33 33 32 71 61 82 93 94 91 83 62 77 45 [734.4]NTSLL[329.2] 1358 AVVLHSQNTSLLNSK 10.6 71 805.9462 2 16.285 0.5 38 38 38 31 99 95 84 78 83 82 86 93 73 87 49 [382.3]HSQ[114.0]TSLL[114.0]S[128.1] 1359 VAEQELLDASER 10.8 90 680.3406 2 16.293 0.8 63 68 88 88 96 97 98 97 97 94 95 90 [170.1]EQELLDASER

PAGE 318

318 1361 YFAPKKNTSLLNSK 10.9 78 805.9462 2 16.306 3 31 31 92 91 94 91 84 86 91 92 88 72 87 52 [310.1]APKKNTSLL[114.0]S[128.1] 1363 SPEDKLSELKAK 9.6 80 672.8718 2 16.335 0.4 85 85 92 97 94 66 58 72 92 92 93 31 SPEDK[329.2]LKA[128.1] 1364 Y(+79.97)EHLPVLWKAPSGESKGK 10.9 61 702.6874 3 16.344 2.7 78 37 35 36 54 57 83 56 39 40 50 72 88 89 85 76 76 31 [818.3]L[569.3]GES[313.2] 1366 EQM(+15.99)EEEQEAKAELKR 12.2 81 932.4387 2 16.361 2.7 56 60 60 71 99 97 89 95 97 97 97 94 75 76 44 [533.2]EEQEAKAE[397.3] 1367 HHGSEGTLLVSQNERQWK 13.6 75 1053.527 2 16.369 0.1 70 78 82 94 92 84 89 98 99 94 92 63 79 73 52 36 38 37 [274.1]GSEGTLLVS[969.5] 1369 KPEVAAY(+79.97)R 5.6 70 1013.479 1 16.398 2.6 63 62 62 97 91 78 71 31 [354.2]VA[470.2] 1370 SPPGAANLDK 6.7 67 969.4993 1 16.404 0.6 31 32 71 71 97 97 87 75 76 31 [338.2]AAN[356.2] 1371 ALQDETVELKAK 8.4 70 672.8719 2 16.41 0.2 37 36 37 92 88 84 77 82 93 91 90 31 [312.2]DET[99.1]ELKA[128.1] 1373 MFFSPANKR 5.2 58 549.2812 2 16.425 0.9 31 31 31 97 97 91 55 53 32 [425.2]SPA[398.2] 1375 QFM(+15.99)ELPAWDEANLQR 8.9 59 621.9625 3 16.453 1.9 36 36 41 73 55 52 62 49 50 66 88 82 68 69 53 [1262.5]AN[397.2] 1376 VTVSLLTTK 5.5 61 481.3002 2 16.461 0.4 31 31 31 31 98 96 96 97 31 [386.2]LLTT[128.1] 1377 GPPCVAQGER 6.8 68 507.2439 2 16.467 2.7 31 31 91 94 94 97 79 48 80 31 [154.1]PCVA[185.1]E[156.1] 1378 MRFVCLSNK 5.1 57 366.5236 3 16.474 3 31 31 44 45 49 52 83 86 84 [749.4]SNK 1381 Y(+79.97)YRKRTVMGAELR 8.6 66 574.9548 3 16.51 0.4 33 31 32 37 51 74 92 96 89 86 84 84 66 [947.4]VMGAEL[156.1] 1382 CALEKMNGTREVCLR 10.9 73 861.9282 2 16.517 2.6 53 55 73 84 91 94 97 95 95 96 90 46 43 41 31 [287.1]EKMNGTRE[471.3] 1383 FVWGEGNGHGHKELR 10.6 70 861.9282 2 16.525 1.9 31 37 48 53 67 97 91 85 78 84 84 73 72 85 65 [618.3]GNG[137.1]GH[257.1]L[156.1] 1387 YNDKRPNANMKECTTSMKK 11.4 60 753.6929 3 16.571 1.5 59 50 46 45 41 40 44 58 64 87 94 94 90 82 55 51 49 54 31 [1072.5]MKECT[575.3] 1393 LLYADFK 5.4 78 869.4783 1 16.639 1.9 97 97 96 94 94 31 31 LLYAD[275.2] 1394 VAFPSLVGRPR 9.1 83 599.8574 2 16.645 1.6 56 56 93 99 99 98 96 93 90 94 31 [170.1]FPSLVGRP[156.1] 1395 KGLM(+15.99)DGLAAGPK 8.2 69 587.3167 2 16.652 2.9 90 91 79 63 59 62 77 74 69 59 63 31 KG[969.5] 1396 YVRLNVHK 4.8 60 514.8043 2 16.66 1.4 31 61 56 52 62 89 90 31 [645.4]VH[128.1] 1400 YELLGFK 5.1 73 869.4764 1 16.707 0.3 31 83 86 91 92 95 31 [163.1]ELLGF[128.1] 1401 HHLEEAMM(+15.99)AAKLLR 10.4 75 555.9564 3 16.714 1.1 31 93 80 80 73 72 75 84 85 85 83 84 81 31 [137.1]HLE[331.1]M(+15.99)AAKLL[156.1] 1402 Y(+79.97)FRFVRVMGAELR 8.8 68 575.2884 3 16.722 0.3 31 39 39 35 31 92 92 95 89 87 88 88 70 [792.3]RVMGAEL[156.1] 1403 SHEVAEWR 7.1 88 1013.48 1 16.73 0.1 83 83 89 95 93 88 88 84 SHEVAEWR 1405 MDVTKQVEELQR 9.3 78 738.3778 2 16.759 2.6 31 68 74 87 84 79 97 98 96 75 78 57 [345.1]TK[128.1]VEE[397.2] 1408 WYVYLPTKSAM(+15.99)R 7.2 60 510.9313 3 16.784 1.3 49 49 49 60 50 51 66 78 79 63 83 41 [1208.6]M(+15.99)[156.1] 1411 WRRFSLLGLNPNDDLR 11 69 658.0199 3 16.821 3 35 35 40 55 70 94 94 92 91 76 51 49 71 86 87 67 [732.4]LLGL[440.2]DL[156.1] 1412 WHYSYHWLGRAKVLR 9.4 62 493.7668 4 16.829 0.1 31 54 54 60 62 62 51 76 75 78 81 67 66 81 31 [1385.6]A[227.2]L[156.1] 1415 WM(+15.99)LLHTAGVLEGLR 9.4 67 537.9616 3 16.856 1.7 31 38 38 55 74 81 88 89 95 90 83 61 75 38 [696.3]TAGVLE[326.2] 1417 LLYADFK 5.3 76 435.2421 2 16.885 0.2 98 98 96 86 85 31 31 LLYAD[275.2]

PAGE 319

319 1418 GQLELEDLK 7.1 78 522.7822 2 16.891 0.1 54 49 85 97 97 97 96 96 31 [185.1]LELEDL[128.1] 1419 MLEDDLSSNM(+15.99)EAVSK 11.2 75 842.8737 2 16.898 0.2 40 39 51 91 97 97 98 94 70 75 80 81 82 87 31 [373.2]DDLSS[261.1]EAVS[128.1] 1420 YEAGPSYVDLR 9.2 84 635.3089 2 16.906 0.4 31 95 94 94 94 84 84 84 89 92 73 [163.1]EAGPSYVDL[156.1] 1423 RRTWAMMAEELKK 9.7 75 550.6251 3 16.944 0.2 31 57 58 57 87 95 97 97 97 89 82 84 31 [599.3]AMMAEELK[128.1] 1424 QGTVPKVLDWSAPSK 10.1 67 806.9363 2 16.951 2.4 44 43 57 88 94 94 94 86 83 57 61 57 52 59 31 [286.1]VPKVLD[656.3] 1425 KALTDAAMMAEELKK 13.6 90 825.4331 2 16.959 0.7 91 92 95 97 97 97 98 98 97 95 96 91 86 87 31 KALTDAAMMAEELK[128.1] 1426 VFY(+79.97)ERVRMGAELR 9.4 72 569.2783 3 16.967 2.4 31 31 31 89 87 74 75 95 94 87 83 84 69 [489.2]ER[255.2]MGAEL[156.1] 1427 GKTVPQVLDWSAPSK 9.3 62 806.9363 2 16.975 2.4 38 41 41 68 83 71 91 95 96 64 53 49 47 52 31 [385.2]P[128.1]VLD[656.3] 1429 T(+79.97)RAM(+15.99)SLVTAK 6.6 66 391.8608 3 17.004 1.5 46 48 43 89 92 91 84 67 65 31 [408.2]M(+15.99)SLV[300.2] 1431 GM(+15.99)LGLKGGMEGHK 10.1 78 665.8343 2 17.019 0.6 52 56 89 91 92 95 86 82 84 81 80 84 31 [204.1]LGLKGGMEGH[128.1] 1433 MPSNPFVTGLLR 7.6 64 444.5765 3 17.034 0.7 33 57 53 60 59 59 71 92 82 83 76 31 [772.4]TGL[269.2] 1435 VQLELNQLK 7.1 79 542.822 2 17.062 0.7 60 55 79 95 97 84 79 90 65 [340.2]ELN[128.1]L[128.1] 1437 EAM(+15.99)TLLDKNR 9 90 603.8093 2 17.077 2.8 86 89 88 96 97 98 89 87 90 70 EAM(+15.99)TLLDKN[156.1] 1438 QAFTQQVEELK 8.2 75 660.8431 2 17.084 0.3 70 82 73 95 72 74 96 97 96 31 31 [128.1]A[147.1]T[256.1]VEE[241.2] 1439 YWFFWAFQELQLSHANR 10.6 62 748.3684 3 17.091 3.9 43 43 39 31 42 60 43 60 66 95 88 95 94 86 60 60 43 [1304.6]LQLSH[341.2] 1441 QVLELNQLK 6.4 71 1084.635 1 17.12 0.7 63 66 93 96 95 64 49 65 42 [227.1]LEL[483.3] 1442 DVEDKLSELKAK 9.9 83 687.877 2 17.126 0.5 93 93 95 90 90 95 91 67 67 83 92 31 DVEDKLS[242.1]KA[128.1] 1443 EPLKNDKLK 6.4 71 542.822 2 17.133 0.8 31 94 86 84 68 71 85 88 31 [129.0]PLK[229.1]KL[128.1] 1444 YLQVLRHR 5.7 72 1084.635 1 17.14 2 92 93 65 85 91 81 31 31 YL[128.1]VLR[293.2] 1445 TLEKKHGKDYR 6.2 56 458.9204 3 17.147 1.4 36 39 42 39 38 62 88 86 83 66 31 [736.4]GKD[319.2] 1447 FHYVM(+15.99)HLKHPCTAAALR 12.4 73 671.0118 3 17.177 2.7 31 62 62 70 86 76 76 88 95 85 83 87 94 89 76 36 31 [546.3]M(+15.99)[250.1]KHPCTAA[340.2] 1448 T(+79.97)TELGKNR 4.8 60 998.4672 1 17.185 0.6 91 85 67 74 50 41 35 33 T(+79.97)T[697.4] 1450 SGAELELSELKAK 10.5 81 687.8775 2 17.2 0.2 52 59 75 89 92 94 94 94 93 92 90 88 31 [215.1]ELELSELKA[128.1] 1455 ACPLEESTLKHEATAAALR 14.1 74 1006.015 2 17.252 2.8 31 69 84 83 90 97 94 93 93 95 95 93 76 63 55 61 58 41 31 [174.0]PLEESTLKHE[654.4] 1456 VFDKEGDGTVMQELR 11.6 77 862.4194 2 17.26 0.2 50 65 64 91 93 90 90 94 86 58 58 61 82 91 74 [361.2]KEGDGT[358.2]EL[156.1] 1457 LSLFPK 3.9 65 352.7206 2 17.268 0.3 31 98 98 98 31 31 [113.1]SLF[225.1] 1459 VQLELNKLQGEVDKR 11.3 75 884.9996 2 17.296 0.3 47 45 87 93 92 88 74 95 72 93 90 73 56 58 57 [227.1]LELN[128.1]L[128.1]GE[498.3] 1460 DRKSSPFDARSYR 9.5 73 792.8986 2 17.304 1.5 46 45 57 96 98 95 95 92 92 91 78 31 31 [399.2]SSPFDAR[406.2] 1461 DDEEQSQLKEYK 9.1 76 756.347 2 17.312 0.5 43 43 84 96 86 90 71 95 86 94 86 31 [230.1]EEQS[128.1]LKEY[128.1] 1462 ARY(+79.97)LNKLKWTLRK 8.3 64 885.5009 2 17.319 0.3 31 31 51 69 69 90 95 95 80 53 45 59 52 [697.3]KLKW[498.3] 1463 YRY(+79.97)AKAEATEANLQR 8.9 60 621.9623 3 17.327 1.4 32 31 31 35 47 69 58 56 70 92 91 83 69 69 53 [1133.5]EAN[397.2]

PAGE 320

320 1465 WRREEALVSQLTR 9 70 548.6364 3 17.357 1.8 33 33 32 31 56 83 90 96 96 87 92 92 76 [756.4]ALVSQLT[156.1] 1466 QLEEQEALVSKLTR 11.5 82 822.4509 2 17.365 1 61 63 83 95 86 94 93 94 97 94 89 76 73 46 [241.1]EEQEALVSK[370.2] 1467 YAMEAGSQLQEYK 10.4 80 759.3501 2 17.374 0.7 62 57 58 88 94 94 95 82 94 90 96 92 31 [365.1]EAGSQLQEY[128.1] 1468 QM(+15.99)HRT(+79.97)RRWCPLLHTK 8.4 56 515.5062 4 17.382 1.9 52 52 41 40 40 43 50 31 59 79 91 84 70 69 31 [1447.6]LL[366.2] 1469 ALEDQLSELK 8.8 88 573.3052 2 17.391 1.3 85 89 96 96 89 97 97 96 98 31 ALEDQLSEL[128.1] 1472 ALEDQLSELK 7.5 75 1145.604 1 17.426 1.1 75 80 90 96 87 91 69 63 64 31 [71.0]LEDQL[457.3] 1473 RYLREALKYYLGDVFWHT(+79.97)R 10.7 56 856.0954 3 17.434 1.4 31 31 48 52 64 60 59 62 56 59 59 77 80 81 80 53 44 31 31 [1525.8]DVF[660.3] 1474 QAHAPVLADQVSK 8.3 64 455.2499 3 17.442 1.8 60 52 46 52 70 81 97 96 89 46 47 57 31 [504.2]VLAD[442.3] 1475 SPKDELSELK 8.5 85 573.3057 2 17.45 0.5 86 87 81 89 89 96 97 96 98 31 SPKDELSEL[128.1] 1477 KMSGQEGAKELAPCDK 10.8 67 846.4092 2 17.478 1.3 60 56 55 71 82 96 92 60 60 77 94 87 83 32 31 31 [403.2]QEG[328.2]LAP[346.1] 1478 ASFPPDVAGNVDYK 10.4 74 740.3593 2 17.485 0.1 34 45 58 96 98 98 96 95 91 80 85 92 31 31 [305.1]PPDVAGNVD[291.2] 1481 MVAELEELR 8.1 90 545.2842 2 17.513 0.3 98 98 97 97 97 31 97 98 91 MVAEL[129.0]ELR 1483 VVREDVCARTSHK 8.5 65 500.5964 3 17.541 0 31 46 40 40 69 85 74 74 88 86 87 91 31 [598.3]V[174.0]RTSH[128.1] 1484 LLGSLDVPHEEYK 8.8 68 750.3903 2 17.548 0.4 82 82 71 74 91 97 31 31 83 83 83 31 31 LL[144.1]LD[196.1]HEE[291.2] 1485 AKVSECAHK 5.3 59 486.75 2 17.556 0.4 33 33 35 95 91 92 80 31 31 [298.2]SECA[265.2] 1486 CWTWLY(+79.97)MELKLSHVNK 10.4 65 711.0015 3 17.562 0.2 50 50 50 35 35 42 70 74 95 96 95 95 87 54 59 39 [1192.4]LKLSH[341.2] 1487 HHKWWTGVVVSR 7.5 62 497.9365 3 17.572 1.2 31 51 50 40 77 91 92 85 69 65 61 31 [774.4]TGV[441.3] 1489 VTSTELFK 6.3 78 462.7556 2 17.6 0.4 31 93 95 94 93 90 96 31 [99.1]TSTELF[128.1] 1490 SLSTELFK 6.1 77 924.5031 1 17.606 0.6 31 90 90 91 90 88 96 31 [87.0]LSTELF[128.1] 1491 AKENGLHR 5.3 66 924.5031 1 17.612 2.3 70 67 81 75 68 66 69 31 [199.1]E[577.3] 1492 VVSTEVYK 5.2 65 462.7556 2 17.618 0.4 89 89 86 68 55 50 51 31 VVS[620.3] 1493 LLGSLDVPEHEYK 9.5 73 750.3901 2 17.624 0.6 66 60 54 58 85 97 98 98 90 86 86 31 31 [370.2]LDVPEHE[291.2] 1496 HHRRDVGAVAVNR 7.9 61 496.275 3 17.659 0.4 31 57 57 44 42 51 79 86 88 64 59 61 66 [857.4]AV[440.2] 1497 QSKLEDDLVALQK 11.2 86 743.9086 2 17.666 0.7 62 67 89 97 97 98 97 94 92 90 86 72 68 [215.1]KLEDDLVAL[256.2] 1498 LVDSMQANLDSEVR 12.5 89 788.8846 2 17.674 1.1 71 79 92 95 95 91 96 83 91 96 94 86 86 85 [212.2]DSMQANLDSEVR 1499 RRRCFMTSLKTGR 7.6 58 537.9609 3 17.683 0 31 31 31 31 54 76 88 92 86 74 58 58 40 [849.4]TSL[442.3] 1501 FFHARDLEEPTPLRR 9.7 64 628.669 3 17.712 2.6 31 31 45 53 61 76 81 91 96 92 67 55 69 78 31 [773.4]LEEP[623.4] 1502 VKGPVSRWR 5 56 542.8211 2 17.72 2.2 64 59 59 54 31 31 66 66 66 [1065.6] 1503 DTSLDDMLPAQK 8.6 71 667.3182 2 17.727 0.8 56 60 67 70 91 92 89 90 72 66 63 31 [416.2]DDML[424.2] 1504 SPETMVTNLKK 9.1 83 624.3365 2 17.735 0.6 83 83 89 94 94 82 79 83 91 93 31 SPETMV[101.0]NLK[128.1] 1505 STELFK 4.7 78 724.3877 1 17.743 0.2 86 77 83 89 98 31 S[101.0]ELF[128.1]

PAGE 321

321 1510 APAT(+79.97)LNPTAELEGSLQEVK 13 68 683.3358 3 17.798 0.8 31 71 75 83 36 34 35 42 83 94 96 94 63 57 59 80 91 93 72 [239.1]T(+79.97)[425.2]AELE[257.1]QEV[128.1] 1511 RWKKWEM(+15.99)SAGGVGPLSHK 10.1 56 690.6935 3 17.806 1.9 31 39 37 37 41 40 50 72 80 83 87 78 65 67 70 59 31 31 [1147.6]AGG[718.4] 1513 T(+79.97)VNQVLSSGDLLR 8.8 68 494.5846 3 17.836 2.2 83 44 43 38 40 92 31 94 94 94 95 96 31 T(+79.97)[440.2]L[87.0]SGDLL[156.1] 1514 LRTLDVFTDEYKFGHTK 11.1 66 1035.537 2 17.843 0.8 34 38 46 75 93 98 82 79 90 95 64 61 55 67 51 47 31 [483.3]DVF[101.0]DE[861.4] 1515 SSLLDGSSLHYFR 9.2 71 741.373 2 17.852 0.3 31 82 82 91 84 84 92 31 95 89 48 64 42 [87.0]SLLDGS[87.0]LH[466.2] 1516 KNDDRHNLVLHQLR 8 57 586.6542 3 17.861 2.2 36 36 37 54 55 49 50 89 95 92 54 49 53 43 [879.4]LVL[534.3] 1517 KLWYM(+15.99)WTLVVFQK 7.5 58 440.2427 4 17.869 2.4 38 34 40 42 45 50 58 45 63 89 75 89 74 [1236.6]V[147.1]Q[128.1] 1520 FGLSDLPQSDR 8.9 81 617.8065 2 17.906 0.3 79 84 92 97 95 73 71 82 87 94 31 [147.1]GLSD[210.1]QSD[156.1] 1522 SPTDAAMFAEELK 9.1 70 705.3364 2 17.921 2.9 61 64 68 82 91 95 95 96 95 31 62 31 31 [285.1]DAAMFA[499.3] 1523 LATDAAM(+15.99)MAEELKK 12.2 87 769.3832 2 17.929 0.5 68 77 91 95 96 97 96 94 92 93 95 93 94 31 [184.1]TDAAM(+15.99)MAEELK[128.1] 1525 VGMNYQLTYLLPK 9 69 770.4169 2 17.959 1.7 52 58 65 92 77 71 89 92 93 87 52 34 31 [287.1]N[291.1]LTYL[338.2] 1526 VGAGEYLELR 9.3 93 553.7953 2 17.967 0.6 93 90 89 91 95 96 94 87 97 89 VGAGEYLELR 1527 HRFFVYT(+79.97)CEANLKR 8.3 59 621.9619 3 17.974 0.7 31 31 53 63 88 51 42 60 71 91 79 60 63 39 [587.3]V[576.1]A[511.3] 1528 LLFVVGGPGSGK 7.8 65 565.8319 2 17.982 0.1 31 31 31 99 97 97 94 67 33 80 82 31 [373.2]VVGG[154.1]SG[128.1] 1531 DFETLSQLSK 6.7 67 584.2984 2 18.021 0.4 31 31 98 95 49 48 48 94 95 79 [262.1]ET[328.2]LS[128.1] 1532 VFT(+79.97)KECKHEATAAKVLK 9.5 56 661.6765 3 18.027 0.8 31 74 40 36 36 51 50 60 59 72 85 88 83 56 47 38 31 [1252.5]TAA[468.3] 1533 DFETNTLLSK 6.4 64 1167.589 1 18.035 0 31 31 97 93 80 84 81 53 52 37 [262.1]ETNTL[328.2] 1535 YSLELTNEAK 6.7 67 1167.589 1 18.051 0 31 96 96 85 72 74 60 50 66 31 [163.1]SLE[656.3] 1537 HHWENKMELQELQLK 9.4 63 655.0014 3 18.079 2.2 31 31 65 39 39 44 92 92 91 71 88 80 58 68 45 [831.4]MEL[128.1]EL[369.2] 1540 CNHTNLR 4.8 68 429.2065 2 18.105 1.3 54 59 66 84 74 78 57 [354.1]T[383.2] 1541 ENLGKLMTNLR 10 91 644.8564 2 18.112 1.1 93 88 95 97 98 94 94 94 86 87 65 ENLGKLMTNL[156.1] 1543 QLDLVDQLKMK 6.3 57 444.2516 3 18.14 0.2 51 45 46 55 97 93 59 53 47 49 31 [469.3]VD[628.4] 1544 WYM(+15.99)VKHLLTEAPLNPK 9.1 57 652.686 3 18.147 1.2 40 40 34 35 34 37 51 93 95 95 94 50 47 48 65 47 [973.5]LTEA[549.3] 1545 LLGTLEEMR 8.3 92 531.2866 2 18.155 0.1 93 93 92 96 96 97 91 93 75 LLGTLEEM[156.1] 1546 KKFYDGSVVQLYEK 8.2 58 568.637 3 18.164 2.3 31 31 31 37 48 57 76 90 95 87 94 68 31 31 [825.4]VVQL[420.2] 1547 ELDPLNDWVKLYQK 11.3 81 880.9621 2 18.172 2.8 78 87 95 96 95 91 96 78 89 96 94 50 31 49 [129.0]LDPLND[186.1]VKL[419.2] 1551 KEYFQTSVVQLYQK 8.8 63 587.6443 3 18.217 2 41 38 36 43 56 68 70 98 96 87 94 55 31 55 [883.4]VVQL[419.2] 1552 RHKLKMDQYK 5.7 57 449.5828 3 18.225 1.6 34 47 40 66 84 84 76 45 57 38 [534.3]KM[534.2] 1553 Y(+79.97)NCWPAVMFGVLEKFLK 10.1 59 709.0066 3 18.232 0.1 42 39 37 38 47 41 42 65 84 94 92 91 87 59 48 64 31 [1044.4]FGVLE[516.3] 1555 TVSTELFK 5.2 65 462.7548 2 18.261 1.5 31 31 94 88 79 74 89 31 [200.1]ST[242.1]F[128.1] 1557 FVVPDLK 4.1 59 409.2441 2 18.276 1 31 31 31 94 93 96 31 [345.2]PDL[128.1]

PAGE 322

322 1558 KNDPLNGSVVQLYEK 11.6 77 852.4506 2 18.282 1.3 87 78 94 70 67 82 93 93 95 90 83 92 65 31 31 K[114.0]D[210.1]NGSVVQL[420.2] 1559 VSFQLPDER 7.2 80 545.7794 2 18.291 1 94 95 93 84 96 95 94 31 31 VSFQLPD[285.1] 1561 LLSLNSADM(+15.99)LK 9.3 85 610.8315 2 18.319 0.3 95 95 95 96 94 94 95 92 68 72 31 LLSLNSAD[388.2] 1562 SLSTELFK 6.2 78 924.5034 1 18.326 0.3 31 90 89 92 92 92 97 31 [87.0]LSTELF[128.1] 1563 VVDTAPKGTYDDYVEGLR 13.8 77 999.4945 2 18.334 0.2 46 48 50 61 87 96 96 96 95 95 96 95 84 75 77 60 76 37 [414.2]APKGTYDDY[554.3] 1565 QLDLVDKLQM(+15.99)K 8 73 673.8715 2 18.35 0.7 69 77 89 95 96 96 72 47 42 49 65 [241.1]DLVD[644.4] 1567 Y(+79.97)FTPFRRVFMVEGLR 8.4 56 666.6654 3 18.379 0.1 31 46 46 44 45 58 44 31 31 99 96 88 65 76 37 [1293.6]MVE[326.2] 1568 MNRAFGSWKGS(+79.97)LPKK 8.6 57 596.2988 3 18.388 0.2 76 36 35 36 46 36 36 39 85 85 88 88 66 66 31 [949.4]KGS(+79.97)L[353.2] 1569 WWLPKGTFMDYVEPTK 11 69 999.4943 2 18.395 0.7 31 83 86 94 94 74 65 70 71 95 64 63 58 58 55 31 [186.1]WLPK[436.2]D[717.4] 1570 MFFSPANK 5.6 70 471.2308 2 18.404 0.6 31 31 31 97 96 96 90 82 [425.2]SPANK 1571 VKRLHASDLGR 7.5 68 626.369 2 18.41 2.2 40 53 64 90 75 90 94 88 51 65 34 [383.3]L[137.1]ASD[326.2] 1573 LEELEEELEAERAAR 11.3 75 893.9443 2 18.439 0.1 58 59 78 74 55 79 94 92 91 77 77 80 91 87 31 [742.3]ELE[200.1]RAA[156.1] 1574 CAKASYEETLDHLETRMK 13.9 77 1063.006 2 18.447 0.1 74 74 90 77 73 75 94 88 96 96 96 96 95 92 55 37 38 31 [174.0]K[321.1]EETLDHLE[516.3] 1575 M(+15.99)ELDDLSSNMEAVSK 11.6 77 842.8731 2 18.456 0.9 95 95 94 95 93 92 94 90 60 62 68 60 61 61 31 M(+15.99)ELDDLSS[759.4] 1576 WKKARKPGNSVELHR 10.1 67 602.679 3 18.465 1.1 42 42 45 62 59 60 52 58 81 91 92 94 94 98 31 [951.6]NSVELH[156.1] 1577 TGLDYNPEPFK 7.9 71 640.8112 2 18.473 0.4 40 43 71 90 89 85 94 81 78 78 31 [271.2]DYNPE[372.2] 1579 RTWDATASPSR 7.3 66 624.3085 2 18.502 2.4 38 33 50 53 81 93 91 86 85 83 31 [558.3]ATASPS[156.1] 1580 GFKLSTCGTRVWK 8.5 65 741.8981 2 18.511 0.2 33 42 52 88 92 83 66 70 84 83 59 39 48 [332.2]LST[160.0]TR[413.2] 1581 TLEDQLSELK 7.3 73 1175.613 1 18.519 2.3 74 82 92 96 84 91 60 55 58 31 [101.0]LEDQL[457.3] 1582 VDEDLKSELK 8.5 85 588.3104 2 18.526 1.6 94 94 95 91 77 77 94 94 97 31 VDED[241.2]SEL[128.1] 1583 MTKLSNDGVACLKK 8.8 63 503.2708 3 18.532 0.5 72 55 35 33 35 58 73 86 84 85 82 72 67 31 [789.4]GVAC[369.3] 1585 ALTDAAMMAEELKK 9.3 66 507.9273 3 18.562 1.6 39 40 47 53 78 82 83 91 90 92 71 60 63 31 [471.2]AMMAE[498.3] 1586 LATDAAMMAEELKK 12.3 88 761.3865 2 18.57 0.4 73 81 93 96 97 98 98 97 97 97 90 85 86 31 [113.1]ATDAAMMAEELK[128.1] 1587 M(+15.99)CNYEEKANSYLSK 11 79 848.3708 2 18.577 0.6 80 72 67 84 76 84 95 96 92 96 88 66 61 37 M(+15.99)[217.1]Y[129.0]EKANSY[328.2] 1588 LATDAAMMAEELKK 10.6 76 761.3865 2 18.585 0.4 42 44 55 58 70 95 96 96 95 97 93 89 89 31 [471.2]AMMAEELK[128.1] 1589 KFWPQAELEELR 7.8 65 515.9398 3 18.593 0.7 32 32 31 80 68 87 91 96 31 77 91 63 [461.2]P[128.1]AEL[258.1]L[156.1] 1591 KVRMFSLAGDFTLR 7.7 55 547.6365 3 18.622 0.6 35 35 35 46 46 66 77 75 77 87 63 47 39 36 [989.5]D[517.3] 1594 RHY(+79.97)QRGRRNSK 6.3 57 513.2571 3 18.646 2.5 37 69 50 51 50 67 60 78 49 65 45 [1518.7] 1595 VKLELHMSKWVDR 10.8 83 820.9515 2 18.653 1.1 74 83 93 97 98 96 89 90 92 83 52 74 52 [99.1]KLELHMSKW[370.2] 1597 EPNKLDKLKGEVDR 11 79 820.9517 2 18.683 0.2 82 81 74 92 94 83 71 73 96 89 87 63 63 46 EP[114.0]KLD[241.2]KGE[370.2] 1599 M(+15.99)LAPAKS(+79.97)K 4.8 59 941.454 1 18.698 1.6 31 98 98 94 42 41 36 31 [147.0]LAP[494.2]

PAGE 323

323 1600 TDAAMMAEELKK 10.3 86 669.3251 2 18.707 0.8 68 74 88 97 98 97 96 97 94 92 93 31 [216.1]AAMMAEELK[128.1] 1601 RFKARMPEARM(+15.99)YR 9.5 73 864.4485 2 18.716 2.8 53 71 59 84 93 86 84 91 90 89 80 31 31 [431.3]ARMPEARM(+15.99)[319.2] 1605 LLLKMKKSLGGMS(+79.97)R 8 57 547.9708 3 18.767 2.2 31 87 56 55 50 36 40 43 60 66 77 81 82 31 [113.1]L[942.6]MS(+79.97)[156.1] 1606 TGYDDYVEGLR 9.6 87 644.2958 2 18.774 0.6 62 74 88 96 97 98 98 96 90 93 62 [158.1]YDDYVEGL[156.1] 1607 FLAYDADK 6.3 78 471.7325 2 18.782 1 31 96 92 78 74 88 92 71 [147.1]LA[278.1]AD[128.1] 1610 DWEQKVEELRK 8.2 75 730.3799 2 18.82 0.9 31 48 62 78 93 97 98 96 80 81 54 [558.2]KVEELR[128.1] 1611 CRKKNGVGPFPK 7.3 61 444.2512 3 18.827 1.6 69 67 58 39 47 57 64 80 70 70 70 31 [785.4]G[469.3] 1612 DNDLDPNYVLSSR 8.6 66 754.3541 2 18.834 0.9 41 51 69 92 98 95 89 95 98 31 31 31 31 [344.1]LDPNYV[443.2] 1615 WLRWWELGEQLDNLRK 10.1 63 714.7109 3 18.872 2.8 31 31 32 32 41 61 60 88 89 87 91 91 82 67 71 49 [1069.5]GEQLDN[397.3] 1616 WVWWFWKHKLDNLQR 9.6 64 536.2849 4 18.88 0.3 34 35 35 36 31 78 60 56 90 84 85 86 86 88 72 [1255.6]KLDNLQ[156.1] 1617 KKQWSVAEMPAQLDNLQR 11.9 66 1071.562 2 18.889 2.2 32 58 55 60 90 96 90 78 73 62 61 55 60 90 58 56 58 45 [570.3]SVA[669.3]D[511.3] 1618 YRMTLDGDYSGLEFAK 9.2 58 622.6285 3 18.897 1.4 31 43 36 43 45 45 45 84 90 85 72 71 75 84 31 31 [836.4]DYS[299.1]F[199.1] 1621 MELQELQLK 8.2 91 566.3073 2 18.934 0.4 95 96 98 90 96 96 83 89 67 MELQELQL[128.1] 1622 YNSEETLDHLETMKR 11.7 78 933.438 2 18.941 0.6 52 58 59 90 96 96 96 96 96 96 95 72 60 62 42 [364.1]EETLDHLE[516.3] 1623 DWKEQVEELRK 6.9 63 730.3802 2 18.949 0.5 31 31 50 55 63 82 96 87 70 70 53 [686.3]VEE[397.3] 1624 RM(+15.99)NLDLQATKAQLDNLQR 11.6 65 1072.564 2 18.956 2 39 40 35 38 76 90 82 90 74 56 90 62 91 91 55 50 50 42 [645.3]LQA[229.1]A[128.1]LD[511.3] 1625 KWLGFKHDRMR 7.3 67 737.4005 2 18.965 2.9 57 89 78 92 82 71 57 81 41 41 38 [128.1]W[113.1]GF[265.2]D[443.2] 1627 KNHRT(+79.97)KSSNMEAVSK 9.9 66 599.619 3 18.995 2.7 38 37 39 42 41 42 92 96 92 93 86 82 85 88 31 [844.4]SSNMEAVS[128.1] 1628 RRKRLECEQR 7.1 71 458.5893 3 19.003 0.5 31 32 50 62 90 96 95 82 82 82 [596.4]LECEQR 1629 KDLDDLELTLAK 10.7 89 687.3806 2 19.01 1.2 96 96 97 98 98 97 96 94 90 82 85 31 KDLDDLELTLA[128.1] 1630 KMELDDLSSNMEAVSK 12.8 80 898.9247 2 19.018 1 90 90 92 97 98 98 97 97 85 66 72 76 65 58 59 31 KMELDDLSS[759.4] 1631 LVDSMQATLDSEVR 12.8 92 782.3877 2 19.026 0.1 71 79 92 94 94 90 98 98 98 97 95 90 90 89 [212.2]DSMQATLDSEVR 1633 MFFSPANK 5.6 70 471.2312 2 19.055 0.2 31 31 31 95 96 95 91 83 [425.2]SPANK 1634 QMEGDLNEMELKLSHANR 15 84 1058.003 2 19.061 1.2 82 94 91 84 87 95 89 94 86 86 94 98 97 96 78 51 52 40 QMEGDLNEMELKLS[478.2] 1635 RTSGSGQATLDSEVR 11.8 79 782.3878 2 19.07 2.5 32 33 34 45 93 95 91 97 97 98 97 95 89 89 88 [401.2]SGQATLDSEVR 1636 VLDSVFGTRDAFPR 10.8 77 790.4152 2 19.078 0.2 64 72 88 93 96 97 95 95 94 91 91 31 31 31 [212.2]DSVFGTRDA[400.2] 1639 RLVRM(+15.99)FNS(+79.97)CCKLSHANR 11 65 533.5024 4 19.118 0.5 31 32 32 34 34 41 51 64 86 93 94 95 95 90 80 80 61 [1099.5]CCKLSHAN[156.1] 1640 YRWS(+79.97)FPM(+15.99)ELKLSHANR 10.3 64 711.0007 3 19.127 3 46 35 33 33 49 49 72 81 88 95 95 95 87 60 61 43 [1063.4]ELKLSH[341.2] 1641 HPRWRAPPKTCGHK 7.9 56 557.6302 3 19.136 2.8 36 36 36 33 56 59 86 59 53 54 77 81 82 31 [803.4]P[429.2]GH[128.1] 1642 FYWLVYMGLTDR 6.9 58 521.9276 3 19.145 1.2 31 64 64 50 31 84 87 79 55 54 59 31 [708.4]YM[542.3] 1645 QLDLVDQLKLK 6.9 63 438.2661 3 19.183 0.2 52 49 51 53 94 94 64 79 64 53 31 [469.3]VD[610.4]

PAGE 324

324 1646 QLDLVDQLKLK 9.1 83 656.8951 2 19.19 0.3 72 81 95 96 98 97 76 93 83 84 31 [128.1]LDLVD[128.1]LKL[128.1] 1647 KLNLVDELQLK 9.4 85 656.8951 2 19.197 0.3 75 74 83 94 98 96 89 88 79 87 67 [241.2]NLVDEL[128.1]L[128.1] 1649 YELFGSFPLK 6.3 63 600.8179 2 19.212 1.1 31 78 69 61 69 89 90 79 31 31 [609.3]SF[338.2] 1652 Y(+79.97)PWQVVPALVNR 7.5 63 507.9266 3 19.25 2.5 31 31 83 64 64 85 95 79 51 50 51 60 [340.1]W[227.1]VP[553.3] 1655 TYNDRQLKPK 6.8 68 631.8444 2 19.279 2.7 60 54 53 64 88 73 86 75 92 31 [493.2]R[128.1]L[128.1]P[128.1] 1657 QVTEEMASENESVAKLTK 14.7 82 997.4914 2 19.31 0.5 52 51 59 84 97 98 97 94 93 89 95 94 91 90 90 81 78 31 [328.2]EEMASENESVAKL[229.1] 1659 QLLGTLEEM(+15.99)R 8.7 87 603.3138 2 19.327 0.9 50 52 92 97 97 98 98 95 95 95 [241.1]LGTLEEM(+15.99)R 1661 KPFWT(+79.97)HGNLEGAFVRR 9.4 59 665.6642 3 19.343 1.7 82 82 82 40 56 43 57 58 82 83 71 47 42 42 31 31 KPF[675.2]LE[686.4] 1665 WRFS(+79.97)FWWAKLDKGFTSGGWKRKK 13 57 994.8386 3 19.389 2.2 32 32 49 57 72 73 48 50 65 87 86 53 49 61 83 88 85 41 41 38 39 31 32 [1374.6]LD[332.2]TSG[783.5] 1667 KFYQKFVMRGHSRGHK 9.5 59 669.3603 3 19.408 0.5 32 32 40 44 44 40 59 70 86 92 89 89 79 65 50 31 [1071.6]RGHS[478.3] 1669 T(+79.97)REGRDLLAALLQQR 8.4 56 607.3231 3 19.438 0.5 40 42 37 37 37 41 60 60 56 70 89 92 59 63 51 [1162.6]LL[412.2] 1670 TLEDLQSELK 7.8 78 588.3113 2 19.446 0 88 91 97 86 52 45 91 93 97 31 TLED[241.1]SEL[128.1] 1671 LVNASVLPDLVVGNEYR 11.1 65 620.0069 3 19.453 0.3 45 45 44 95 98 99 82 62 61 58 61 64 61 65 65 62 31 [326.2]ASVL[1142.6] 1672 KDPTLLPPLKR 6.8 61 426.6026 3 19.461 0.6 93 92 64 53 47 59 41 81 51 51 37 KD[521.3]P[397.3] 1673 RMLKLYKGLESM(+15.99)R 7.8 60 547.6364 3 19.469 1.7 66 38 36 45 36 51 57 87 84 80 76 83 31 [932.6]GLE[87.0]M(+15.99)[156.1] 1676 MLSTLLLTFDK 7.9 71 641.3616 2 19.507 2.8 91 89 92 94 94 90 87 39 39 34 31 MLSTLLL[491.2] 1677 KDRSSASSNKVTAAYVAWR 14.8 78 1049.047 2 19.514 1 53 51 59 92 97 94 94 93 86 79 76 86 86 85 80 74 66 88 31 [399.2]SSASSN[227.2]TAAY[170.1]W[156.1] 1678 KHHSALY(+79.97)MELQLSHANR 10.8 63 705.67 3 19.523 0.1 32 48 48 65 53 50 39 63 67 92 90 95 95 84 55 55 40 [1176.5]LQLSH[341.2] 1681 DLEESTLQHEATAAALR 14.5 85 927.963 2 19.562 0.3 82 66 76 90 92 96 97 92 98 97 95 95 95 95 88 60 31 D[242.1]ESTLQHEATAAA[269.2] 1682 RKWLMKKAGKGCSHNK 9.1 57 624.6785 3 19.57 0.2 31 40 36 36 37 46 60 65 90 70 68 68 88 58 70 39 [1041.6]G[288.1]S[379.2] 1683 FNVWGLADVSK 8 73 412.552 3 19.578 0.1 31 56 58 67 84 86 91 95 97 97 31 [546.3]GLADVS[128.1] 1684 QTFAGVLWASR 8.1 73 618.33 2 19.585 0.2 36 36 35 86 95 96 97 97 95 97 31 [376.2]AGVLWAS[156.1] 1685 EPPASVLQLCHNVYER 12.9 81 927.963 2 19.593 1.1 31 79 86 86 93 97 97 88 93 89 90 88 84 70 79 31 [226.1]PASVLQLCHNV[448.2] 1688 Y(+79.97)KKYLRYVLGNSEGLSWRR 11 58 823.4247 3 19.634 0 58 58 42 35 34 36 55 64 91 68 51 57 82 78 67 51 50 42 65 [1193.6]L[258.1]E[755.4] 1689 FNWGVLWMSK 7.8 78 634.3181 2 19.643 0.1 78 70 59 72 91 93 95 74 86 61 [504.2]VLW[131.0]S[128.1] 1690 LVDTPGPPPVGSKPR 11.1 74 758.9279 2 19.651 0.2 41 44 59 72 94 94 88 86 85 73 63 65 85 88 65 [428.2]PGPPP[243.1]KP[156.1] 1691 GFLLDGYPR 8.2 91 519.2742 2 19.662 0.2 75 75 92 98 96 96 96 97 87 [204.1]LLDGYPR 1693 LVDSMQATLDSEVR 12.7 91 782.3859 2 19.691 2.3 70 77 91 92 93 90 98 98 98 97 95 90 90 89 [212.2]DSMQATLDSEVR 1694 HCY(+79.97)LTM(+15.99)TDPSPEMRHR 9.5 59 1035.425 2 19.699 1.9 31 32 32 64 70 75 75 90 93 75 69 68 67 36 31 31 [945.3]DP[893.4] 1696 Y(+79.97)S(+79.97)FFEFAQNDLTRLR 9.1 61 1033.94 2 19.718 2.2 31 50 50 50 31 85 85 79 86 91 81 59 49 44 31 [833.2]FA[128.1]NDL[526.3] 1697 RTLLYDVEKPPK 7.5 62 486.9489 3 19.73 0.4 36 36 41 62 65 80 91 90 81 83 45 31 [646.4]DVEKP[225.1]

PAGE 325

325 1699 GRDSMKATLDSEVR 11.5 82 782.8889 2 19.759 2.8 43 46 60 67 86 92 96 96 97 97 94 90 90 90 [415.2]MKATLDSEVR 1700 MEASPAAHK 5.4 60 471.2304 2 19.767 2.9 31 98 93 76 70 65 42 31 31 [131.0]EA[591.3] 1701 HWWKQPETR 5.4 60 423.2148 3 19.774 2.5 31 31 36 59 47 88 86 86 67 [765.4]PET[156.1] 1702 FNDKVLWDSK 7.3 73 626.3204 2 19.782 2.5 86 72 86 92 92 91 87 57 31 31 F[114.0]DKVLW[330.2] 1707 GSVVHNGVR 6.5 72 462.7549 2 19.838 1.6 69 59 59 74 95 89 79 90 31 [342.2]HN[57.0]V[156.1] 1708 FQPDVNENEGSLERTK 11.9 75 931.9495 2 19.848 2.1 73 65 72 91 95 91 92 88 92 92 85 80 57 40 40 32 [372.2]DVNENEGSL[514.3] 1711 KDEPVSGVLKLK 7.2 60 438.2657 3 19.887 0.5 40 38 39 54 60 76 76 80 81 76 64 31 [712.3]VL[369.3] 1712 FLLT(+79.97)Y(+79.97)RPGAALEWK 8.1 58 608.9539 3 19.895 0.7 31 31 94 36 35 53 59 83 84 82 70 53 42 43 [260.2]L[677.2]GAA[556.3] 1714 SAFPPDVAGVNDYK 9.6 68 740.3586 2 19.915 1 37 37 55 96 96 93 89 83 61 47 47 85 92 31 [305.1]PPDVA[270.1]DY[128.1] 1715 ETEAFAALQR 6.5 65 568.2901 2 19.924 1.1 88 86 85 89 31 65 64 45 51 40 ETEA[686.4] 1717 QLDLVDKLQLK 9.1 83 656.8961 2 19.953 1.1 79 91 96 94 96 95 79 85 53 79 57 [128.1]LDLVD[128.1]L[369.2] 1718 QYVKEKVLPDGKM(+15.99)LDNKK 10.5 59 717.0607 3 19.961 0.3 63 65 41 33 32 33 50 88 94 87 52 45 47 91 82 52 54 36 [874.5]LPD[332.1]LD[370.2] 1719 WLLLYLWDNGVDSVSLKK 10.2 57 538.048 4 19.97 0.5 34 34 33 40 40 35 38 47 57 91 94 92 88 87 67 53 54 31 [1216.6]GVDSV[456.3] 1720 ELSQLDDPLK 7 70 1157.605 1 19.979 0.4 94 92 91 82 83 69 51 49 57 31 ELSQL[568.3] 1721 VNLTTGTDYYFR 9.8 81 725.3544 2 19.989 0.4 57 47 52 95 98 96 95 95 94 76 77 91 [326.2]TTGTDY[310.1]R 1723 HHQKWPVQVQGEVDDSVKEVK 14.3 68 824.7568 3 20.019 2.9 31 52 41 41 36 37 40 60 90 85 94 94 95 97 96 94 83 64 63 76 52 [1040.5]VQGEVDDSV[484.3] 1724 LFKDNASVLPDFGKNLDKK 12.2 64 1075.085 2 20.029 1.2 32 46 49 89 86 92 96 98 98 84 84 74 61 40 35 34 36 40 40 [388.2]DNASVLPD[930.5] 1725 CLLFDGSFKK 6.1 61 579.3057 2 20.038 1.6 43 43 64 92 83 67 53 54 71 31 [329.2]FD[547.3] 1726 T(+79.97)RLYTTLYQFR 6.9 63 771.3826 2 20.045 4.4 66 64 53 60 76 75 76 89 45 43 38 [928.4]Y[431.2] 1727 LNAGVSPPATLAQPVTVR 13.4 75 896.009 2 20.055 0.7 40 39 50 89 93 98 91 76 80 92 95 96 87 91 91 52 31 41 [298.2]GVSP[97.1]ATLAQPV[356.2] 1729 VFFKQLDEAEGGLACR 9.6 60 594.9655 3 20.086 1.2 56 56 56 48 41 69 85 95 93 86 64 43 39 40 48 31 [762.4]DEAE[557.3] 1730 YNALNEAELLMRAM(+15.99)K 9.7 64 891.9449 2 20.094 2.9 67 62 91 94 89 95 96 94 61 37 35 34 34 36 34 [277.1]ALNEAE[859.5] 1731 CRKKTASMVRLVSANDTLR 12.8 68 1075.088 2 20.102 0.5 35 34 35 49 74 90 83 63 63 93 98 96 92 88 82 79 45 45 32 [616.3]AS[230.1]RLVSAN[485.3] 1733 YNANNEAESSKKSTLK 10.2 64 892.4463 2 20.119 1.8 62 57 86 76 74 85 92 79 78 71 78 43 33 33 37 31 [277.1]A[228.1]EA[988.6] 1735 CS(+79.97)WT(+79.97)S(+79.97)NCCQVQEAR 8.4 60 618.825 3 20.148 45.4 31 31 69 33 52 50 69 68 62 87 84 70 76 49 [1252.2]VQ[356.2] 1736 KRLSVLS(+79.97)KGGKGSWFR 9 56 629.3422 3 20.156 2.1 33 35 36 46 31 77 58 46 71 89 85 79 78 48 43 35 [1048.6]GK[633.3] 1737 DVLASMGQLNVK 10.6 89 637.8416 2 20.165 1.1 31 98 98 97 97 97 94 83 95 89 93 84 [115.0]VLASMGQLNVK 1739 MM(+15.99)VLRHT(+79.97)VNNCVLNK 8.5 57 623.2973 3 20.181 1.9 31 36 36 34 35 31 63 66 88 72 60 60 84 78 67 [1063.5]N[316.1]L[242.1] 1742 LLGSLDVTTSGT(+79.97)K 10.1 78 686.3436 2 20.219 2.4 95 96 96 96 97 98 97 95 81 40 39 39 37 LLGSLDVTT[453.2] 1743 MLNLEGSGLNVK 9.7 80 637.843 2 20.226 1.1 57 57 84 89 73 73 84 88 93 87 92 83 [244.1]NL[186.1]SGLNVK 1744 HQM(+15.99)TSSLLM(+15.99)SLLRGYYR 10.5 62 1044.524 2 20.233 2.2 59 56 56 61 31 65 66 78 83 84 84 71 52 48 50 52 49 [913.4]M(+15.99)SL[808.4]

PAGE 326

326 1747 FNVWGLADVSK 8.1 73 412.5523 3 20.271 0.6 31 56 58 66 90 88 90 95 97 97 31 [546.3]GLADVS[128.1] 1748 NFDAGVLWVSK 9.9 90 618.3253 2 20.278 1.2 87 94 96 96 95 94 97 98 98 98 31 NFDAGVLWVS[128.1] 1749 MVSLLQEENVK 9.1 83 645.3422 2 20.287 0.1 96 96 72 73 89 80 94 89 72 80 66 MV[200.1]LQEE[114.0]V[128.1] 1751 LNARSPAQALAQPVTVR 10.8 64 896.5115 2 20.302 1.6 34 33 33 91 98 94 46 41 44 84 94 84 88 88 53 31 41 [298.2]RSP[270.1]LAQPV[356.2] 1753 LLLLQDLK 5 62 478.3135 2 20.334 1.2 31 31 31 95 85 91 95 31 [339.3]LQDL[128.1] 1754 QPGSLDVTTYYK 8.4 70 686.3439 2 20.341 1 62 68 72 76 86 95 94 92 82 40 31 31 [369.2]LDVTT[454.2] 1755 MKNSYEETLDHLETMK 13.6 85 984.9568 2 20.348 1.2 75 73 85 96 97 97 84 83 84 95 96 96 93 84 80 31 [259.1]NSYEETLDHLETM[128.1] 1756 FFMRLKHTLSM(+15.99)LNMLANWK 11.7 62 799.7526 3 20.358 1.8 31 32 32 32 37 42 42 49 64 93 93 91 84 87 92 89 59 64 48 [1173.6]SM(+15.99)LNMLA[428.2] 1759 LVDSMQATLDSEVR 12.6 90 782.387 2 20.399 1 64 73 88 93 94 91 97 97 98 97 94 89 89 89 [212.2]DSMQATLDSEVR 1760 YAVFDLAEGK 8.7 87 556.7844 2 20.408 0.5 98 98 98 98 92 90 91 87 87 31 YAVFDLAEG[128.1] 1761 EWGNYDLSLQNVGRK 11.3 75 889.9485 2 20.415 4.4 40 40 52 67 94 97 97 96 96 87 83 91 71 66 41 [486.2]YDLSLQNV[341.2] 1762 TVLYTAAVRM(+15.99)DK 8.2 69 692.3666 2 20.423 2.9 66 63 79 93 84 81 78 83 76 52 31 31 [313.2]YTA[71.0]V[546.3] 1763 GFLLDGYPR 7.8 86 519.2739 2 20.433 0.8 63 65 85 97 97 95 94 94 82 [204.1]LLDGYPR 1767 VDQSLLTGESVSVLK 11.5 77 787.9363 2 20.478 1.2 58 57 54 84 93 98 97 91 88 90 93 93 86 31 31 [342.2]SLLTGESVSV[241.2] 1768 QFWYQS(+79.97)HGTFVAKYK 8.9 60 657.3076 3 20.487 4.4 56 56 45 49 41 47 50 75 89 89 75 66 56 57 35 [1113.4]TF[589.4] 1769 WMFPKLNEYVFR 7.4 61 543.9473 3 20.496 1.6 46 46 38 47 65 71 78 91 88 98 31 31 [916.5]EYV[303.2] 1772 HKFYRWEEAKLDDLTKKFTY(+79.97)R 12.4 59 952.1425 3 20.534 1.9 31 31 32 39 32 53 54 57 79 81 96 96 81 75 76 88 76 47 44 31 34 [1246.6]KLDD[214.1]K[775.3] 1774 Y(+79.97)KEWRLCCQLSHVNK 10.1 67 662.9729 3 20.55 1.7 67 42 38 37 45 43 63 76 78 87 94 93 83 84 70 [1289.5]LSHVN[128.1] 1775 WWFLPLLNSGCESVR 8.7 58 602.9725 3 20.558 1.9 31 31 31 74 61 72 76 50 61 66 82 61 61 71 31 [1213.6]C[471.2] 1777 MELDDLSSNMEAVSK 13.2 88 834.8765 2 20.588 0.1 82 82 93 98 98 97 98 93 84 91 94 91 87 89 31 MELDDLSSNMEAVS[128.1] 1778 MEGDLNEMELQLSHANR 13.2 78 993.9541 2 20.596 0.1 42 43 51 63 69 88 95 97 97 96 89 97 98 92 72 72 50 [545.2]NEMELQLSH[341.2] 1779 DWEMTWKGLRGLLSKDDLR 11.7 61 773.7358 3 20.604 0.7 31 39 42 45 72 49 47 68 59 63 74 77 93 84 56 56 56 83 63 [1472.7]LS[358.1]L[156.1] 1781 MKNDNNSSSSAEAVSK 13.8 86 834.8765 2 20.621 2 75 74 87 92 93 94 98 99 94 91 89 90 86 86 87 31 [259.1]NDNNSSSSAEAVS[128.1] 1784 VLDTPGALPQNVFK 11.3 81 749.9162 2 20.661 0.8 69 77 89 96 96 95 94 83 83 63 73 83 96 31 [212.2]DTPGALP[242.1]VF[128.1] 1786 QPSAPWTGMLK 8.5 77 608.3126 2 20.678 0.9 70 87 92 97 94 91 79 64 59 67 46 [128.1]PSAPW[530.3] 1787 WTAADDEMELQLSHANR 12.9 76 993.9539 2 20.685 1.5 63 63 83 44 44 60 93 96 96 97 88 96 97 88 63 63 45 [287.1]A[301.1]EMELQLSH[341.2] 1789 WVY(+79.97)FPLEGLALDNLRK 11.2 70 672.0113 3 20.716 0.2 32 32 32 31 71 72 84 83 87 94 94 94 90 79 82 57 [885.4]EGLALDN[113.1]R[128.1] 1790 QQADWAELWQLDNLKR 12.4 77 1007.513 2 20.724 2.7 62 62 82 84 91 98 98 98 84 73 86 95 66 53 56 40 [256.1]ADWAELW[128.1]LD[511.3] 1791 TAEPVLAFYEGR 10 83 676.8455 2 20.734 0.5 64 64 90 98 98 99 99 31 96 92 92 71 [172.1]EPVLA[147.1]YEG[156.1] 1793 DNDLDPAYVLSSR 8.8 68 732.8512 2 20.749 0.9 40 56 85 94 98 95 91 92 97 31 31 31 31 [229.1]DLDPAYV[443.2] 1795 GFGDKVLAEWK 8.8 80 625.3323 2 20.777 0.1 35 69 83 92 92 95 94 93 93 94 31 [204.1]GDKVLAEW[128.1]

PAGE 327

327 1796 WREKQVDDLEGSLETRQK 12.5 69 739.7126 3 20.785 1.1 32 32 48 41 45 63 83 91 94 96 92 88 89 87 69 62 69 56 [826.4]DDLEGSLE[513.3] 1797 EPTYLSYK 5.5 69 1000.499 1 20.794 0.2 31 93 94 90 92 84 31 31 [129.0]PTYLS[291.2] 1798 VTAAHNVGR 6 67 462.7555 2 20.803 3 31 81 81 81 85 59 64 86 31 [99.1]TAAH[213.1]G[156.1] 1799 VRADSVAELEGQNDSKAPK 13.4 71 1007.514 2 20.81 0.3 38 39 44 65 93 92 90 91 95 94 93 78 80 91 88 53 44 34 31 [441.2]SVAELEG[128.1]NDS[424.3] 1802 CCKATGVYNSPGASNPFKNFR 12.4 59 1131.032 2 20.85 1.1 33 58 64 87 43 37 36 44 83 81 68 78 92 95 89 59 37 35 34 36 38 [334.1]A[420.2]NS[154.1]ASN[789.4] 1803 EGMLQQVEELK 7.2 65 652.33 2 20.859 2.6 40 41 42 80 79 84 94 95 93 31 31 [317.1]L[128.1]QVEE[241.2] 1804 DVLASMGQLNVK 10.4 86 637.8423 2 20.867 0.2 31 95 95 94 92 92 92 77 93 89 94 86 [115.0]VLASMG[128.1]LNVK 1805 QHLYYRNGSYVEGLR 10 67 618.9782 3 20.876 2.4 60 58 49 48 46 55 57 88 94 95 87 77 61 74 41 [974.5]GSYV[455.2] 1807 KFHRPREECYGSSNKLK 9.7 57 693.6901 3 20.907 0.3 32 32 32 33 43 47 89 84 92 91 82 69 48 45 53 54 31 [821.5]EECYG[657.4] 1808 WWLWLEELSER 6.7 61 516.2625 3 20.916 2.7 31 34 33 32 32 31 99 97 95 94 90 [913.4]ELSER 1809 MKPLVSGVLGRR 8.7 72 438.2664 3 20.924 2.6 81 49 46 43 94 93 93 92 82 76 79 31 M[338.2]VSGVL[369.2] 1810 FYSSVAGLGVPSMDVRHR 13.1 73 989.5029 2 20.931 1.1 51 47 47 61 80 89 92 94 96 94 90 91 90 83 70 58 31 31 [484.2]VAGLGVPSMD[548.3] 1811 WLEALPLTK 6.1 68 535.8166 2 20.941 1.4 57 92 80 95 94 69 43 44 31 [186.1]LEAL[439.3] 1813 RDRSMVVLEEAMREELK 10.8 64 697.6956 3 20.969 1.9 34 39 43 59 48 48 64 93 94 96 80 79 78 72 64 53 31 [843.4]LEEA[786.4] 1814 FNGWVLADVSK 7.7 70 412.5523 3 20.978 0.5 53 40 36 36 95 93 91 94 97 97 31 [504.2]VLADVS[128.1] 1815 NFDAGVLWVSK 9.6 87 618.3252 2 20.985 1.1 76 80 94 95 95 94 94 97 97 97 31 [114.0]FDAGVLWVS[128.1] 1817 TLVNSPNKGTLDDYVEGLR 15.6 82 1046.041 2 21.002 1.1 67 72 88 87 95 92 88 95 94 93 93 95 96 84 78 84 52 68 32 [214.1]VNSPNKGTLDDY[99.1]E[326.2] 1820 NYSEETLDHLEMTK 11.8 84 855.3885 2 21.042 0.6 68 76 89 95 98 97 97 97 96 94 89 75 68 31 [277.1]SEETLDHLE[360.2] 1821 VY(+79.97)FYFAVLVADLSSNMEAWK 12.1 61 811.7106 3 21.05 2.6 31 31 32 36 37 50 58 91 49 48 76 94 96 92 88 87 60 52 53 41 [969.4]L[285.1]LSSNM[514.3] 1822 YNSEETLDHLETMK 11.2 80 855.3885 2 21.059 0.6 78 62 64 76 95 96 96 94 93 93 92 78 69 31 [493.2]ETLDHLE[360.2] 1823 T(+79.97)LQVVSDNKKHR 9 75 752.8851 2 21.066 0.1 47 88 68 97 97 98 94 90 90 64 34 33 [181.0]L[128.1]VVSDNK[421.3] 1825 VLNASVLPDYTKGPVEYR 11 61 674.3617 3 21.095 0.2 90 87 43 37 37 38 80 57 52 50 51 66 72 90 80 61 73 31 VL[371.2]L[661.3]PV[448.2] 1826 LLPGNEYLFR 6.5 65 611.335 2 21.104 0.1 31 96 93 90 74 81 73 42 31 31 [113.1]LPG[114.0]E[579.3] 1827 RFHS(+79.97)CLVSKLTR 7.6 63 509.5938 3 21.111 0.6 32 32 31 43 58 58 94 88 87 84 85 60 [823.3]VSKLT[156.1] 1828 NGLM(+15.99)VAELEELR 9.2 77 695.3558 2 21.118 0.1 43 47 54 95 98 98 98 98 31 89 90 72 [284.1]M(+15.99)VAEL[129.0]EL[156.1] 1829 LPPQARGMSQT(+79.97)K 7.2 60 465.228 3 21.127 2.8 31 81 65 59 53 53 65 92 57 43 64 45 [113.1]P[509.3]M[524.2] 1831 RMEELEAVAKPTR 8.2 63 765.4086 2 21.157 0.4 92 92 31 31 97 95 87 80 56 42 38 39 31 RM[258.1]LEAV[553.3] 1832 WVMELEAVAAAALR 10.9 78 510.6083 3 21.164 2.6 31 93 94 94 97 96 94 88 72 65 62 75 86 31 [186.1]VMELEAV[284.1]L[156.1] 1833 NSLGLNLLQELNHK 8.8 63 796.9411 2 21.172 0.3 57 49 48 52 57 75 95 89 66 66 63 46 67 38 [598.3]LL[749.4] 1834 RPQQHLT(+79.97)LYKLR 6.7 56 544.9629 3 21.18 0.6 64 59 40 40 40 80 53 52 52 57 63 61 [646.3]L[854.4] 1835 RLGNMVAELEELR 9.6 74 765.4086 2 21.188 0.4 64 59 54 52 68 80 87 91 95 31 95 96 83 [571.3]VAEL[129.0]ELR

PAGE 328

328 1837 SSWREKRTSGGTTMYPGLWR 12 60 786.0591 3 21.217 0.7 66 66 52 35 49 46 45 53 73 55 53 70 95 94 94 90 42 39 39 31 [1332.7]TMYP[512.3] 1838 ADSKGDFM(+15.99)K 6.6 74 1014.453 1 21.226 2.7 90 89 81 66 72 91 80 31 58 ADS[185.1]DF[275.1] 1839 LLSLNSADMLK 9.7 89 602.8346 2 21.232 1.1 95 95 95 96 92 94 93 91 83 82 54 LLSLNSADML[128.1] 1840 NNTEDFFK 5.3 66 507.7308 2 21.239 1.7 80 80 80 94 96 31 31 31 NNTED[422.2] 1841 WRMWLRKLEGSTDVQAEPRK 12.1 60 622.3333 4 21.246 1.3 31 31 35 36 35 35 48 58 93 93 77 72 86 92 80 83 84 52 45 31 [1169.7]EG[188.1]DVQAE[381.2] 1843 EVTDYLMK 6 75 499.7467 2 21.275 0.1 67 67 95 93 90 86 31 66 [228.1]TDYL[259.1] 1844 LLSLNSADMLK 9.5 87 602.8339 2 21.281 0.1 91 91 87 88 86 92 92 89 86 85 59 LLSLNSADML[128.1] 1845 ERAYANNVLSNTTMYPGLWR 15 75 1178.583 2 21.288 3.5 35 34 35 52 92 90 91 96 97 97 89 93 96 95 97 80 56 57 77 31 [519.2]ANNVLSNTTMYP[512.3] 1847 NVFRFYDDLEGSLEKEKKLR 11.6 58 829.4404 3 21.306 1.2 40 40 40 41 35 36 56 80 78 80 57 53 65 87 62 62 85 68 50 40 [941.4]D[113.1]E[257.1]E[257.1]K[397.3] 1849 DLTDYLMK 6.3 78 998.4861 1 21.336 0.2 94 93 94 94 95 80 31 41 DLTDYL[259.1] 1850 ALVVGQVFK 6.2 69 480.7975 2 21.343 0.2 92 92 94 84 62 42 44 77 31 ALVV[559.3] 1851 RPAHYRDKFK 6 60 439.9114 3 21.35 1.7 43 40 46 59 56 74 66 88 89 31 [895.4]KF[128.1] 1853 SSGKWQATLDDEVK 11.2 80 782.3875 2 21.366 1.8 31 91 91 92 92 70 94 95 96 97 90 67 51 50 [87.0]SGKW[128.1]ATLDD[356.2] 1855 KKERY(+79.97)LKDDLEGSLEKEKK 11.9 63 806.0897 3 21.397 2.6 75 47 42 39 33 44 43 71 83 96 96 87 65 64 66 55 55 68 52 [1140.6]DLEG[842.5] 1856 LM(+15.99)HSVLRLVLSCNDK 10.7 71 872.4675 2 21.406 1.9 59 66 79 93 98 98 84 58 74 88 69 65 46 50 31 [397.2]SVLR[212.2]L[547.2] 1857 CPETKQLEELRK 9.1 76 737.3882 2 21.416 2.5 31 66 71 74 83 79 96 97 95 77 78 52 [430.2]K[128.1]LEE[397.3] 1859 KLEKTRT(+79.97)ATAPKYR 8.7 62 581.6475 3 21.435 1.9 39 38 44 57 58 59 53 54 89 89 91 71 74 43 [1007.5]TAP[447.3] 1861 QLESDLVQVQGEVDDWKEVK 14.9 75 1172.586 2 21.467 0.7 55 44 45 85 93 95 95 89 97 90 93 92 95 98 98 70 42 36 37 32 [370.2]SDLVQVQGEVDD[670.4] 1862 KKLHKMLQALMK 8.2 68 490.2997 3 21.478 0.6 31 34 48 56 92 90 87 75 76 80 84 58 [506.3]KML[199.1]LM[128.1] 1863 TRRSWPVDSTVLR 7.8 60 524.9578 3 21.487 1.2 72 57 39 46 51 72 90 84 77 52 48 59 31 [783.4]VD[556.3] 1867 LVNASVLPDANFLDNK 12.4 78 865.4604 2 21.535 1.1 48 48 47 88 95 98 98 94 91 77 75 90 89 86 77 31 [326.2]ASVLPD[185.1]FLD[242.1] 1868 MKHSVLAHELVSHNK 12.3 82 865.4604 2 21.542 1.8 62 72 87 94 97 95 86 86 98 98 99 78 62 66 46 [259.1]HSVLAHELV[466.2] 1869 FLDKNASVLPDYGPLPFK 13.4 74 1011.04 2 21.55 1 73 78 92 91 89 95 96 98 97 82 78 85 69 54 45 39 39 32 [260.2]DKNASVLP[115.0]Y[639.4] 1870 RPSGWLFLHFLDNK 8.2 58 577.3092 3 21.559 2.3 33 35 36 38 44 50 62 90 31 96 93 89 81 31 [843.4]L[137.1]FLDN[128.1] 1871 FFRT(+79.97)RANMPLTLSR 9.3 67 597.303 3 21.567 0.8 31 32 43 41 49 58 91 91 74 72 89 91 92 71 [858.4]NM[210.1]TLS[156.1] 1875 WMRYKGPDNM(+15.99)LDNK 8 57 595.2816 3 21.616 2.7 47 41 37 50 47 54 49 52 62 77 84 85 78 31 [1294.6]LD[242.1] 1876 VPTPNVSVVDLTVR 10.9 78 748.4282 2 21.625 0.9 31 84 94 92 87 96 96 93 93 91 76 59 52 38 [99.1]PTPNVSVVD[469.3] 1877 LCYWSDLALDMSNMEAVSK 13.7 72 725.9984 3 21.633 2.2 50 47 49 41 40 54 65 77 94 94 94 94 81 83 93 90 88 90 31 [951.4]LDMSNMEAVS[128.1] 1879 SHEEKELAVSKLEK 10.5 75 813.9379 2 21.663 0.6 34 38 45 72 91 95 86 83 95 97 94 91 92 31 [482.2]KELAVSKLE[128.1] 1880 NHQKMELDDLSSNMEAWK 14.1 78 1088.493 2 21.67 0.3 53 53 41 49 94 96 97 98 98 95 95 94 87 91 86 65 66 44 [507.3]MELDDLSSNME[385.2] 1881 VDDDLEDELYAKKLK 11.9 80 897.4616 2 21.679 0.4 31 31 95 95 95 97 98 96 96 85 95 94 84 62 31 [214.1]DDLEDELYAKK[241.2]

PAGE 329

329 1883 ETQRGWTM(+15.99)LPQK 8.2 68 745.8739 2 21.698 0.9 67 66 64 69 69 86 76 61 89 56 67 40 [571.3]W[248.1]L[353.2] 1886 HSKEEEALVSKLEK 10.5 75 813.9382 2 21.737 0.2 32 44 45 83 93 94 79 79 92 97 94 90 91 31 [352.2]EEE[184.1]VSKLE[128.1] 1888 EAWHLLR 4.6 66 462.7549 2 21.753 2.6 92 92 92 51 51 51 31 EAW[519.3] 1889 ETWFGQFYM(+15.99)ATLLK 8.1 58 584.29 3 21.76 2.6 31 31 32 34 36 57 64 80 92 90 77 75 70 31 [895.4]YM(+15.99)A[455.3] 1891 KTLELNGPSQGELEK 10.2 68 821.9361 2 21.79 0.1 58 66 83 91 91 86 75 65 67 84 56 54 56 54 31 [229.1]LELN[241.1]Q[556.3] 1893 RWTQMAELEELR 8.5 71 521.2656 3 21.812 2 32 32 36 37 58 89 95 98 97 93 96 81 [702.3]AELEELR 1895 LWEWWQLVDLEGSLTREKKLR 13.5 64 895.8193 3 21.832 2.9 31 44 42 46 63 39 38 49 82 90 90 82 80 77 82 92 86 66 70 48 39 [1140.6]DLEGS[113.1]TRE[525.4] 1898 RQTWVAELEELR 8.6 72 510.6083 3 21.87 2.2 42 41 48 48 90 90 95 97 31 94 96 82 [571.3]VAEL[129.0]ELR 1899 WPENALGVWTGLVVVM(+15.99)YK 12 66 1039.544 2 21.878 1.2 31 75 41 44 85 96 94 80 73 77 68 70 77 70 70 73 31 31 [526.2]ALGV[1192.6] 1900 LLGLNSADMLK 9.8 89 587.8284 2 21.889 0.4 98 97 97 97 91 93 92 93 84 83 53 LLGLNSADML[128.1] 1901 LLTEENGFGR 7 70 568.2906 2 21.895 0.1 91 94 93 93 51 42 47 82 72 31 LLTE[300.1]F[213.1] 1903 LDLDPLLSDR 7 70 578.814 2 21.925 0.1 32 32 97 98 95 94 95 94 31 31 [228.1]LDPLLS[271.1] 1904 LLGLNSADMLK 9.5 87 587.8287 2 21.932 0 89 89 90 91 90 90 89 92 85 85 58 LLGLNSADML[128.1] 1906 LLGLNSADMLK 8.2 75 1174.649 1 21.947 0.8 93 89 92 91 84 84 82 67 51 46 36 LLGLNSA[487.2] 1907 LMVAELEELR 7.8 78 601.8254 2 21.955 1.1 31 94 90 90 96 97 31 87 91 71 [113.1]MVAEL[129.0]EL[156.1] 1909 CPPWDVM(+15.99)VVSKLTR 7.9 57 549.6186 3 21.984 1.2 31 37 37 37 78 53 47 47 55 89 84 72 71 45 [1042.5]SK[370.2] 1910 KFQFLYDDLEGSLEQTR 11.4 67 697.014 3 21.992 1.9 32 42 41 57 55 43 60 82 88 96 96 94 93 89 59 65 44 [941.5]DLEGSLE[385.2] 1913 VCMKSTK 4.3 61 796.4078 1 22.017 2.9 79 78 87 59 51 38 31 [202.1]M[444.3] 1915 YNFDNGLLYTHDDLFK 12.4 78 987.9679 2 22.045 2.8 80 72 57 88 86 96 96 92 80 73 58 92 92 71 71 31 Y[261.1]DNGLLY[238.1]DD[388.2] 1916 VLDSMQATLDSDLR 11.4 81 782.3874 2 22.055 0.5 65 71 88 88 89 84 93 93 95 93 74 67 69 61 [212.2]DSMQATLD[471.2] 1917 MTGKELFLK 5.7 63 533.8021 2 22.064 0.6 76 75 77 82 64 65 58 31 31 [289.1]K[630.4] 1918 LQQSKALAAARR 7.5 63 438.266 3 22.075 2.1 87 55 45 40 43 47 75 85 90 82 63 31 L[655.4]AAA[312.2] 1922 AELGNHR 4.5 64 796.4084 1 22.123 3 31 97 85 83 83 31 31 [71.0]ELGN[293.2] 1924 FLFDMGNLMDRLDSFR 10.3 65 988.969 2 22.141 2.5 35 65 57 87 76 76 86 88 82 73 56 75 57 42 39 32 [407.2]D[188.1]NLM[889.4] 1925 VNRKPAFK 4.6 58 480.2921 2 22.15 1.5 59 39 42 70 93 92 31 31 [497.3]PA[275.2] 1928 RCWQLDVADDLHLAPK 9.7 61 627.3223 3 22.189 2.2 31 31 39 59 59 81 63 62 84 94 94 90 59 52 35 31 [686.3]D[170.1]DDLH[409.3] 1929 NVVLDLPGAPQDLK 10.7 77 739.9147 2 22.198 0.7 60 62 81 96 97 98 96 93 91 66 55 60 77 31 [213.1]VLDLPGA[581.3] 1930 Y(+79.97)RVVKLLYPSALTPLLKNR 10.7 56 775.4465 3 22.205 0.2 32 32 32 35 34 41 87 90 86 44 43 54 76 81 94 73 47 47 33 [838.5]LYP[372.2]PL[511.3] 1933 CNPWAELGEQLDNLKR 13.6 85 943.4673 2 22.248 2.5 59 65 74 92 97 97 98 96 95 89 96 96 86 78 81 57 [314.1]WAELGEQLDN[113.1]K[156.1] 1934 CALY(+79.97)NLKWMAVPLQR 10 66 629.3137 3 22.256 2.6 39 39 42 38 46 48 91 78 73 85 86 96 80 83 64 [757.3]K[317.1]AVPLQ[156.1] 1935 AARKNAAGLSWAPASPFYK 14 73 1003.534 2 22.265 0.2 31 32 39 50 83 89 94 93 93 94 88 83 85 96 95 95 85 31 31 [426.3]NAAGLSWAPASPF[291.2]

PAGE 330

330 1936 SCKT(+79.97)AELFAPLDNLKR 13 81 943.4673 2 22.274 1.7 61 61 84 78 95 96 96 95 80 84 94 96 85 68 71 47 [190.0]K[181.0]AELFAPLDN[397.3] 1940 S(+79.97)FEKWQWGT(+79.97)VNLQR 8.1 58 646.9499 3 22.321 2.7 33 33 38 46 41 48 64 77 64 83 84 70 71 55 [1309.5]VN[397.2] 1941 VEDDLELTLAK 9 82 623.3318 2 22.33 0.6 31 70 96 96 95 96 97 96 92 93 31 [228.1]DDLELTLA[128.1] 1943 SDWYQGQAENQTQR 7.9 56 570.9219 3 22.347 2.8 31 86 43 39 38 43 43 89 91 85 54 47 49 42 [87.0]D[662.3]AEN[513.3] 1945 EELWGAVNKT(+79.97)KLVK 10.7 76 847.9459 2 22.377 1.9 76 76 91 84 96 96 96 95 95 62 54 49 63 31 [258.1]LWGAVNK[649.4] 1947 FCKLPVTEALTLGY(+79.97)R 10.8 72 895.9489 2 22.394 0.3 39 53 69 92 95 73 56 61 89 96 97 97 95 31 31 [378.2]LP[329.2]ALTLG[399.1] 1949 DLGM(+15.99)VAELEELR 9.3 77 695.8465 2 22.409 1.8 38 49 60 90 98 98 98 98 31 91 92 75 [285.1]M(+15.99)VAEL[129.0]EL[156.1] 1952 VGDLEEGKLYFFR 8.4 65 524.9407 3 22.447 1.3 96 95 78 72 65 55 53 57 93 77 31 31 31 VG[671.3]L[613.3] 1953 DEMQQGLPVNGSLGY(+79.97)R 9.9 62 615.2736 3 22.455 1.1 38 41 46 47 48 70 79 75 73 66 74 87 91 87 31 31 [1168.5]SLG[399.1] 1954 LLDTPSAPATSM(+15.99)ARK 11.6 77 787.9161 2 22.465 2.6 91 94 95 97 98 96 95 70 48 57 81 86 57 52 34 LLDTPSA[269.1]SM(+15.99)[355.2] 1955 T(+79.97)KLRRNTSLSAKR 7.6 58 537.6339 3 22.473 1.4 59 44 39 54 68 64 92 93 78 42 40 46 36 [848.4]TS[555.3] 1957 SYELPDGQVLTLGNER 12.8 80 895.9495 2 22.503 0 77 77 86 86 96 92 82 45 54 92 97 96 91 72 78 53 [250.1]ELPDG[227.1]LTLG[399.2] 1960 AFFQESQLKEAT(+79.97)EEK 10.9 73 932.9243 2 22.528 2.7 86 86 86 88 87 92 69 91 76 90 67 55 47 31 31 AFFQES[128.1]L[128.1]E[638.2] 1961 Y(+79.97)YPKRNKHFGDTRTLRR 9.5 56 572.7958 4 22.537 2.3 33 40 35 35 35 41 49 50 46 67 78 78 87 87 73 71 31 [1586.7]RT[425.3] 1963 WWEKGTGLCPKTR 7.6 59 521.2681 3 22.569 3 31 81 35 35 39 45 57 89 74 66 71 78 53 [186.1]W[472.2]L[585.3] 1964 LAFEYGLTDLR 8.4 77 649.3433 2 22.576 0.6 31 31 31 98 98 95 93 94 93 94 79 [331.2]EYGLTDL[156.1] 1966 Y(+79.97)QKWWRTLEGAGGPVR 8.9 55 496.7463 4 22.592 2.3 49 41 39 37 37 58 49 77 81 80 79 63 59 51 48 31 [1241.6]EG[537.3] 1967 QLHQAVFER 5.9 65 564.301 2 22.6 0.9 67 74 67 55 83 86 88 31 31 [506.3]AVF[285.1] 1969 EGNRRGSWR 5.7 63 1117.562 1 22.629 1.1 88 84 83 85 45 53 60 31 31 EGNR[642.3] 1970 LLTENWEGR 6.7 74 559.2849 2 22.638 1.1 95 94 92 91 88 67 51 49 35 LLTEN[528.2] 1972 DGT(+79.97)GTLEENSS(+79.97)YK 8.7 67 780.78 2 22.654 1.6 39 49 62 89 92 96 95 84 64 73 51 31 36 [353.1]GTLEE[659.2] 1975 MKEEATLYCPKHK 8.8 68 526.5995 3 22.692 1.7 57 56 75 58 55 67 75 80 86 86 74 72 31 [802.4]YCP[393.2] 1977 LLTEGNEFGR 6.8 68 568.2911 2 22.715 0.8 94 97 96 89 48 45 56 93 31 31 LLTE[300.1]F[213.1] 1981 YAVFNFKGEALGCFNR 10.7 67 612.6356 3 22.762 1.5 86 54 54 58 58 58 66 71 83 89 78 64 62 63 70 49 Y[763.4]EA[690.3] 1982 HPTSLVM(+15.99)PNRTR 8.5 71 712.8732 2 22.77 2.4 31 85 75 55 72 98 97 90 64 66 76 31 [137.1]P[301.2]VM(+15.99)P[527.3] 1983 LVDTPGSPLNLMVK 10.2 73 742.4119 2 22.78 1.6 31 95 95 96 96 95 94 53 51 58 69 73 78 31 [113.1]VDTPGS[795.5] 1984 LQGPLSEVSDYYR 10.3 80 763.8762 2 22.788 2.2 54 51 87 95 97 97 97 97 99 97 94 31 31 [241.1]GPLSEVSDY[319.2] 1985 SSCHMKATLDTLTR 9.9 71 782.3859 2 22.797 1.8 31 31 31 97 96 96 96 95 95 88 76 51 55 45 [277.1]HMKATLD[471.3] 1987 LPY(+79.97)MRVKSLTENDQYLFR 10.9 61 785.0515 3 22.828 0.3 31 82 61 41 33 36 41 55 60 94 92 86 91 84 68 68 31 31 [113.1]P[957.5]TENDQ[579.3] 1989 VFFPWYEACTLDR 8.3 64 412.4475 4 22.85 0.7 61 61 61 31 42 49 43 81 80 79 81 84 68 [968.4]AC[101.0]LD[156.1] 1990 YRPLLPVLYKFPDPLLHDK 12.7 67 1162.664 2 22.858 1.8 31 56 49 92 98 97 96 97 98 63 41 46 46 75 90 58 46 47 31 [416.2]LLPVLY[584.3]L[493.3]

PAGE 331

331 1991 WLGLVSGVVARR 7.7 64 438.2655 3 22.87 2.2 39 39 46 49 69 91 79 83 73 79 82 31 [568.3]S[57.0]V[170.1]R[156.1] 1993 MRNKLPVLYPKLPGRCSPVR 11.3 56 581.8369 4 22.899 2.3 31 33 34 39 44 66 76 94 91 78 53 34 35 43 87 91 93 31 31 31 [838.5]LY[492.3]RCS[352.2] 1994 RRREKLLYPPVVSSLGYYK 13 68 775.4459 3 22.908 0.2 31 31 31 35 34 36 88 92 96 98 93 81 81 81 88 83 77 78 54 [838.5]LYPPVVSSLG[454.2] 1995 WEKMFPM(+15.99)NGTFMLKR 9.2 61 644.6496 3 22.916 0.8 55 36 36 41 53 82 80 60 63 68 69 88 67 68 43 [721.3]PM(+15.99)[419.2]M[397.3] 1997 SSVT(+79.97)LSPLLKVALSPHGK 12.8 71 957.5248 2 22.933 1.8 84 89 80 87 97 98 97 92 68 56 46 49 79 79 67 38 38 31 SSVT(+79.97)LSPL[1030.6] 1999 LVSQGLVKELDLM(+15.99)NHK 10.3 64 920.5018 2 22.964 1.9 31 88 60 39 44 78 82 88 77 81 91 61 59 46 61 36 [113.1]V[385.2]VK[129.0]LD[639.3] 2000 YSENDGPTLDSNNR 10.3 73 791.3403 2 22.973 2.5 95 95 93 88 69 57 64 90 89 62 57 58 60 42 YSEN[269.1]TL[586.2] 2002 EVQLVDKCGVLK 7.4 62 444.2513 3 22.993 0.5 60 59 53 69 73 80 82 76 55 49 51 31 [568.3]DK[500.3] 2003 LLYGTLYWFK 5.6 56 435.2417 3 23.003 1.7 39 44 40 41 45 89 79 52 62 67 [547.3]L[624.3] 2005 CAMLYFQAFSKVADLMR 11.4 67 665.3305 3 23.035 3.7 60 59 55 46 35 45 63 89 92 92 95 92 91 84 56 47 32 [856.4]AFSKVAD[400.2] 2006 HLKLGPYT(+79.97)GTGTMYPGLWR 12.8 67 1114.537 2 23.043 2.3 32 32 38 43 47 62 90 80 72 64 65 93 97 98 93 78 72 82 31 [645.4]YT(+79.97)[215.1]TMYP[170.1]W[156.1] 2007 Y(+79.97)YRKVHCLLFLSNPVVAR 12.8 71 753.3943 3 23.052 0.7 32 32 37 42 68 75 67 69 85 95 95 95 84 88 85 80 83 57 [1142.5]LFLSNPVVA[156.1] 2008 VTWKAFWSSELKSR 7.8 56 575.6406 3 23.063 2.5 31 46 33 34 36 46 95 94 82 79 59 52 48 38 [732.4]WSS[613.4] 2009 LLDTPSAMPQLLLK 9.8 70 770.4442 2 23.071 0.3 82 90 90 94 95 90 87 52 50 42 59 81 31 31 LLDTPSA[469.2]L[241.2] 2011 SSMLDAVKSM(+15.99)AVQSDRPR 12.8 71 997.4928 2 23.103 0.6 74 77 77 89 94 89 85 51 64 52 87 82 51 56 82 74 50 31 [305.1]LDAV[362.2]AV[215.1]D[409.3] 2012 M(+15.99)VYFAYMPKPPPESGRADR 12.8 67 743.3607 3 23.114 2.2 31 84 85 59 79 92 70 58 57 84 80 81 72 71 54 53 55 64 43 [147.0]VY[218.1]Y[356.2]PPP[771.4] 2013 MQSDGLDDTVVPLR 9.2 65 773.3831 2 23.124 0.7 57 46 56 83 91 90 92 86 82 82 31 49 31 31 [346.1]DGLDDTV[465.3] 2015 T(+79.97)KWWNFNCCTAAELEGSLK 11.3 59 571.0004 4 23.145 0.9 49 41 38 35 38 36 43 52 87 86 91 95 95 94 82 46 40 41 31 [1159.4]CTAAELE[385.2] 2017 QLLGQLEEMR 8.8 88 608.8231 2 23.178 2.9 55 59 95 98 91 97 99 96 97 87 [241.1]LGQLEEMR 2019 QLGEVEDLMVDVER 12.5 89 816.4031 2 23.194 2.8 49 52 92 94 97 97 97 97 96 98 98 92 90 90 [241.1]GEVEDLMVDVER 2020 VRRTWPYLTKSLLYK 8.3 56 642.0449 3 23.202 1.9 32 32 31 48 48 77 51 49 59 83 85 82 73 45 31 [1172.6]KSL[404.2] 2021 MTWKLEPVELER 7.2 60 510.9379 3 23.211 0.4 32 32 32 49 52 78 79 80 88 65 79 52 [885.4]VE[398.2] 2023 LLPLYVPPVAPPDLLYK 10.3 61 636.7121 3 23.242 1.4 31 89 37 33 33 47 88 86 77 73 65 63 65 87 72 45 31 [113.1]L[472.3]PP[479.2]L[404.2] 2024 VAMVAELEELR 8.9 80 630.3371 2 23.25 0.4 51 60 85 97 98 98 98 31 92 93 77 [170.1]MVAEL[129.0]EL[156.1] 2025 KKY(+79.97)VLVEDLMVDVER 11.7 78 639.3229 3 23.257 3.1 31 63 52 52 86 81 88 95 96 96 97 97 84 81 61 [598.3]LVEDLMVDVE[156.1] 2026 RT(+79.97)DS(+79.97)VKVAVVELR 8.2 63 544.6034 3 23.266 2.5 48 43 42 50 74 56 53 49 59 82 85 94 80 [1115.5]VELR 2027 LLRWFWM(+15.99)AGAVHR 7.6 59 553.6296 3 23.276 0.4 31 31 31 31 31 31 84 84 90 90 91 97 31 [901.5]M(+15.99)AGAVH[156.1] 2029 NGLMVAELEELR 8.9 75 687.3586 2 23.306 0.6 40 41 45 93 97 98 97 98 31 88 89 70 [284.1]MVAEL[129.0]EL[156.1] 2030 NSTVDSLLFLR 9.5 86 632.8486 2 23.313 0.3 73 78 94 98 98 94 93 97 94 91 31 [201.1]TVDSLLFL[156.1] 2031 QGVMVAELEELR 8.7 72 687.3586 2 23.32 0.6 35 36 36 88 95 95 94 97 31 90 92 73 [284.1]MVAEL[129.0]EL[156.1] 2032 M(+15.99)GTGSQLEM(+15.99)LR 8.9 81 627.7952 2 23.327 1.2 92 88 87 71 68 83 96 96 87 88 31 M(+15.99)GT[144.1]QLEM(+15.99)L[156.1]

PAGE 332

332 2033 WMPGLLFYKGGVGLHK 9.9 62 601.665 3 23.334 1.7 46 40 38 41 41 58 62 75 92 85 81 87 80 66 61 31 [1007.5]KGGVG[378.2] 2035 FRLKFFLELVPYVAYYK 11.6 68 732.7475 3 23.364 1.1 31 33 33 36 37 73 94 95 93 82 81 93 90 85 82 83 31 [838.5]LELVPYVAYY[128.1] 2036 LWTVEGLMK 5.2 58 538.7944 2 23.373 0.7 42 42 76 86 61 55 53 57 42 [400.2]V[558.3] 2037 RKFNDHGDTT(+79.97)R 6.5 59 476.2121 3 23.38 0.4 31 37 36 40 73 73 78 89 79 79 31 [854.4]D[438.2] 2039 WDQFYEVPLPR 8.9 81 725.3615 2 23.4 0.3 76 90 63 77 73 98 98 98 89 89 31 [186.1]D[438.2]EVPLP[156.1] 2041 SSPSQVAFSQVADLMR 13.6 85 861.9272 2 23.429 0.4 59 60 61 72 80 95 98 98 97 91 96 96 95 92 92 68 [358.1]QVAFSQVADLM[156.1] 2042 NKDEVAFSQVADLMR 11.5 77 861.9272 2 23.437 0.4 35 34 35 50 92 96 97 95 85 95 96 95 90 89 63 [486.2]VAFSQVADLM[156.1] 2043 LRYMFDVLVAAFK 8.5 65 524.9591 3 23.445 1.4 32 32 32 32 81 97 96 97 95 95 94 31 31 [563.3]FDVLVAA[275.2] 2044 VHVQSDGVGVEER 9.1 70 705.8533 2 23.453 1.5 31 99 97 84 89 91 91 87 63 47 43 44 39 [99.1]HVQSDGV[570.3] 2045 VNWTKDVLSEPSKSLR 9.5 60 620.3385 3 23.461 0.6 64 62 58 44 39 53 55 77 92 91 77 67 45 40 44 39 [955.5]SE[668.4] 2047 LKGADPEDVLVAAFK 13 86 786.9348 2 23.492 0.4 83 72 83 86 97 98 97 96 95 94 89 89 92 85 31 L[128.1]GADPEDVLVAAF[128.1] 2048 VTFLTMNFVTLK 8 66 471.9318 3 23.5 0.1 53 51 54 74 87 90 85 79 67 57 62 31 [460.3]TMN[588.4] 2049 LSFLTMFGEKLK 9.1 76 707.3937 2 23.507 0.6 88 91 92 96 90 89 92 56 53 57 66 31 LSFLTMF[555.3] 2051 LDPSNLPVVEEHFK 10.8 77 541.9518 3 23.525 2.1 68 52 60 68 44 45 88 99 97 96 96 93 85 85 [639.3]PVVEEHFK 2053 QLLGTLEEMR 8.7 87 595.3156 2 23.555 0.4 50 53 95 97 97 97 98 96 97 87 [241.1]LGTLEEMR 2054 QLLGTLEEMR 7.9 79 595.3156 2 23.562 0.4 45 46 77 94 94 94 96 85 88 69 [354.2]GTLEEM[156.1] 2055 KAFLTMFDAK 7.4 74 586.3148 2 23.568 3.7 80 80 95 96 95 95 96 35 31 33 KAFLTMF[314.2] 2056 AGLLGTLEEMR 9 82 1189.623 1 23.575 1.2 80 79 87 95 93 91 90 93 63 78 50 A[57.0]LLGTLE[416.2] 2057 LLPVLYPWRALLYYK 9.6 64 954.5621 2 23.582 1.3 31 68 68 98 97 95 95 33 39 35 56 89 89 31 31 [323.2]VLYP[526.3]LY[291.2] 2059 EPKGTLEEFR 7 70 603.3131 2 23.612 2.5 74 74 74 95 94 95 96 31 31 31 [354.2]GTLE[432.2] 2060 KEPGTLEPYR 7.3 73 1189.624 1 23.621 2.7 63 62 74 83 93 94 89 56 65 41 [354.2]GTLE[416.2] 2061 WYFCEGGQPR 5.8 58 414.8499 3 23.629 0.6 58 58 58 68 61 64 61 50 55 46 [1223.5] 2062 NSLPNHWK 5.4 68 995.5044 1 23.638 1.3 65 73 90 90 71 72 49 31 [201.1]LP[565.3] 2063 NKKLVS(+79.97)R 5.9 84 462.7552 2 23.647 0.6 66 66 80 90 93 95 95 [242.1]KLVS(+79.97)R 2066 FVVEKTTGETYVFR 9.6 69 838.4379 2 23.688 0.2 31 82 65 44 44 93 94 81 82 92 92 92 31 31 [147.1]V[356.2]TTGETYV[303.2] 2067 EPGVGRTEYK 6.9 69 568.2905 2 23.699 0.4 58 58 45 74 90 84 79 80 82 31 [382.2]GR[101.0]EY[128.1] 2068 KLGADPEKSLVAAM(+15.99)K 12 80 787.4365 2 23.707 2.5 83 82 85 89 96 58 54 68 82 91 89 89 84 84 56 KLGAD[354.2]SLVAAM(+15.99)[128.1] 2069 HHRVLPVLYM(+15.99)KYLLNQR 10.9 64 1098.616 2 23.716 1.4 31 72 72 77 79 84 95 97 98 51 48 42 45 56 45 46 38 [642.4]PVLY[1062.6] 2071 KEGNEKDSGELEELK 10.6 71 852.9201 2 23.749 2.6 78 76 70 68 81 89 93 92 90 90 75 46 41 33 31 [428.2]EKDSGE[612.3] 2072 FDDKVLADWK 7.8 78 618.8156 2 23.758 1.7 31 94 94 93 93 82 75 89 91 31 [147.1]DDKVL[71.0]DW[128.1] 2075 NGLMMAELEELR 9.2 76 703.3426 2 23.786 2.4 42 46 54 95 97 96 96 97 31 90 92 74 [284.1]MMAEL[129.0]EL[156.1]

PAGE 333

333 2077 MRADLETYLLEK 9.6 80 741.387 2 23.816 0 72 78 89 87 85 88 90 90 94 87 69 31 [287.1]ADLETYLL[257.1] 2078 RHVYLLSLNSPM(+15.99)R 7.2 55 534.6254 3 23.824 2.3 31 39 39 36 49 38 40 59 82 89 90 90 31 [981.6]NSPM(+15.99)[156.1] 2079 KEDSTEKAGELYAHK 9.5 63 853.423 2 23.835 0.2 63 62 79 69 71 79 83 68 64 84 72 36 39 39 31 [689.3]K[128.1]E[612.3] 2083 AKSWNETYLLTR 9.8 82 741.3895 2 23.885 2 66 66 90 80 87 88 95 95 96 83 75 54 [199.1]SWNETYLL[257.1] 2084 RRRAWLLYPPPYVAYYK 10.2 60 738.0784 3 23.892 1.4 31 32 31 34 33 36 80 94 93 69 69 69 70 68 83 87 31 [838.5]LYP[527.3]YY[128.1] 2086 VPLYPPVVEEVGQKK 10 66 561.3229 3 23.911 1.2 31 56 55 59 92 96 96 93 87 64 58 70 46 54 31 [472.3]PPVVE[669.4] 2089 EPPVLYPPVVKKVMRR 9.4 59 636.7131 3 23.953 0.2 31 31 31 91 91 90 90 93 31 65 65 76 43 37 33 34 [323.1]VLYPP[996.6] 2090 NFADALVAMAPK 9.2 77 624.3252 2 23.961 1.7 76 80 94 93 89 81 70 69 82 74 78 31 [114.0]FADAL[170.1]M[296.2] 2091 Y(+79.97)RY(+79.97)FVM(+15.99)RSMVHGNLVLQEYK 12.1 60 903.744 3 23.969 2 31 31 31 38 40 42 49 61 64 71 92 86 62 63 82 93 85 81 66 31 [1508.6]HG[227.1]VLQE[291.2] 2093 QWQLVMLTRR 6 60 444.2512 3 23.99 1.5 53 53 54 58 62 75 67 68 72 31 [1311.7] 2095 ATRSNLPVLYPPVYLLHSR 14.1 74 1098.617 2 24.021 1.2 44 36 42 51 79 97 97 96 97 97 97 91 88 88 94 90 57 31 31 [529.3]LPVLYPPVYLL[380.2] 2096 Y(+79.97)WRYCVRVAKNDVANK 9.9 62 688.9995 3 24.03 0.2 32 32 32 37 36 40 84 90 91 89 82 85 80 62 72 41 [950.4]RVAKNDV[313.2] 2097 RWGKKPHLTTLGTNKAK 9.5 56 646.0453 3 24.04 1.2 42 45 56 52 45 46 56 57 67 90 88 86 49 45 41 41 31 [1103.6]TLG[542.3] 2098 FNPGAVELEELR 8.7 73 687.3569 2 24.05 0.4 95 92 95 81 64 60 86 93 31 60 61 46 FNPG[170.1]EL[527.3] 2099 EFTPAQATMARNAR 9 64 782.3873 2 24.059 1.3 31 31 56 64 70 76 88 89 91 88 61 56 51 39 [673.3]ATMA[497.3] 2101 HHRVLLVPELYVPVAYYK 11.5 64 732.7477 3 24.091 1.7 31 33 34 35 37 33 45 58 92 93 72 91 90 89 86 83 83 60 [951.6]EL[163.1]VPVAYY[128.1] 2103 MEAPYALFWSDNAFKFR 11.4 67 698.335 3 24.11 2 37 44 52 60 48 43 47 66 31 95 94 89 94 96 94 72 72 [1108.5]SDNAFK[303.2] 2105 RWHVRNTSLLNSK 9.2 71 537.6332 3 24.132 1.5 80 80 31 67 66 62 85 95 94 81 58 74 43 RW[506.3]TSLL[329.2] 2107 HHRECLPHAYLVPLKKPK 10.6 59 722.7431 3 24.162 1.4 31 73 53 43 44 42 42 53 63 90 92 92 91 83 66 32 32 31 [1080.5]YLVPL[481.3] 2108 LTSVSLPPK 5.3 59 941.5657 1 24.172 1 74 63 72 97 97 31 31 31 31 [301.2]VS[435.3] 2110 MFRKFELYPVPTLSLAATR 11.8 62 747.4125 3 24.19 1.2 31 31 31 36 36 36 54 66 91 67 55 59 74 84 90 89 79 76 85 [1114.6]P[410.3]SLA[172.1]R 2111 RT(+79.97)ARNQASLR 6.3 63 418.2136 3 24.201 0.4 48 41 37 39 55 64 85 85 92 74 [806.4]ASL[156.1] 2113 KHGTMVAELEELR 9.5 73 756.8955 2 24.232 0.1 32 32 40 49 91 95 96 97 98 31 96 97 86 [423.2]MVAEL[129.0]ELR 2114 KVSPDM(+15.99)NGVVR 6.5 59 609.3195 2 24.24 1 31 31 31 31 97 89 77 79 78 72 31 [411.2]DM(+15.99)[525.3] 2115 VQLELNQLK 6.4 72 542.8218 2 24.247 0.3 89 85 94 73 69 55 58 69 49 VQL[725.4] 2116 NRKFLEAS(+79.97)GVRR 7.2 60 504.9328 3 24.257 2.9 32 33 33 45 62 92 93 92 76 69 55 31 [658.4]EAS(+79.97)[468.3] 2117 SSNGPLVAELEELR 10.7 77 757.3971 2 24.267 0.9 83 80 71 46 44 62 91 94 95 97 31 95 96 84 SS[381.2]VAEL[129.0]ELR 2119 QLLGTLEEMR 8.6 86 595.3162 2 24.297 0.6 48 52 95 96 95 97 98 95 97 85 [241.1]LGTLEEMR 2120 M(+15.99)PPGVAELEELR 8.6 72 678.8455 2 24.305 0.6 31 32 32 81 96 97 97 98 31 91 93 75 [341.1]GVAEL[129.0]EL[156.1] 2121 QLDDELPPVLSLMK 10.1 72 799.4292 2 24.312 0.4 47 48 86 97 97 98 99 99 31 91 59 55 57 41 [241.1]DDELPP[99.1]L[459.3] 2122 LLPVLYPS(+79.97)KKCLKVVK 12 75 954.5641 2 24.322 2.9 31 89 89 98 98 98 95 76 84 60 79 85 74 72 31 31 [113.1]LPVLYP[167.0]K[231.1]L[454.3]

PAGE 334

334 2126 SPALVGMLKAAAR 10.8 83 642.8767 2 24.374 0.5 52 61 67 90 96 97 96 96 97 97 98 98 31 [255.1]LVGMLKAAA[156.1] 2127 DWPVAELEELR 8.4 76 678.8456 2 24.382 3.3 31 31 97 96 96 96 97 31 90 92 73 [301.1]PVAEL[129.0]EL[156.1] 2128 KKFVNTLGYLLEK 7.9 61 518.3077 3 24.39 0.6 31 31 39 43 43 48 88 92 91 91 83 69 31 [717.4]LGYLL[257.1] 2129 LVNAWLKKDCPSVAWK 9 56 620.0081 3 24.402 2.9 81 80 52 55 81 77 56 56 45 45 31 47 44 44 66 31 LV[185.1]W[1255.7] 2131 LLTEGNEFGR 7.5 75 568.2903 2 24.434 0.6 96 96 96 90 68 62 78 94 31 31 LLTE[300.1]F[213.1] 2132 QDPEDVLVAAFK 10.1 84 666.3452 2 24.441 0.6 78 91 97 96 96 96 98 95 95 95 31 31 [128.1]DPEDVLVAA[275.2] 2133 MSDPLAALDPTEFER 10.4 69 846.3998 2 24.45 1.2 35 35 45 89 91 97 98 98 96 87 81 83 31 31 31 [333.1]PLAALDPTE[432.2] 2134 QLVDYNVTGWLDK 10.5 81 775.8952 2 24.46 1.1 65 71 89 96 97 93 95 94 94 94 94 31 31 [241.1]VDYNVTGWL[243.1] 2135 QDNSGSSVNFVFFK 11.3 81 788.3746 2 24.469 1.2 63 69 85 96 97 97 87 62 58 84 96 98 98 31 [243.1]NSGSS[213.1]FVFF[128.1] 2137 NGLMMAELEELR 9.3 77 703.3439 2 24.501 0.6 45 48 56 95 98 97 97 97 31 90 91 74 [284.1]MMAEL[129.0]EL[156.1] 2138 VPNLVDSEGYFFR 10.9 84 771.882 2 24.511 1.3 93 89 79 85 97 98 96 95 95 95 96 31 31 VP[114.0]LVDSEGYF[303.2] 2139 RPGVPGMR 5.3 66 435.2415 2 24.521 1.8 86 81 81 31 64 64 84 31 RPG[253.1]M[156.1] 2140 WFRERGSQMGAELR 9 64 574.9538 3 24.532 1.4 31 35 35 44 47 62 62 64 95 93 88 84 85 67 [1046.5]MGAEL[156.1] 2141 LPFDFSPHVSKLTR 7.8 56 548.6367 3 24.543 3.1 31 69 69 68 38 38 36 31 31 92 87 71 69 43 [1039.5]SK[370.2] 2143 ELPEDVNVAAFK 8 67 666.3464 2 24.576 1.1 31 31 31 87 91 90 90 94 94 94 31 31 [339.2]EDVNVAA[275.2] 2144 STVSPMTVLPLPK 7.9 61 685.39 2 24.583 2.2 31 31 31 91 94 77 75 75 95 81 37 31 31 [287.1]SP[331.2]LP[338.2] 2145 RYNYY(+79.97)FAAVLVCVAAM(+15.99)K 12 71 693.3253 3 24.592 1.2 32 39 36 37 40 72 97 95 93 88 73 71 85 92 90 89 64 [986.4]AAVL[202.1]VAAM(+15.99)[128.1] 2146 WAMNAFQFMLTDR 10.4 80 815.8806 2 24.604 2.2 65 56 56 82 95 96 88 87 88 96 94 94 31 [388.2]NAFQFMLTD[156.1] 2151 DEKKRMNS(+79.97)FAKR 7.6 63 530.5911 3 24.665 1.8 69 68 86 80 44 48 46 50 68 74 72 49 [244.1]KK[1070.5] 2152 LLPVLYLTPAELYYK 9.4 63 898.5132 2 24.676 2.9 31 55 55 96 96 96 61 54 56 70 72 76 51 31 31 [323.2]VLY[1078.6] 2155 HWVLYPPVVKAGKGKTK 11.1 65 636.7117 3 24.719 0.6 31 31 83 86 93 94 95 31 82 79 81 82 86 43 34 34 31 [323.1]VLYPP[99.1]V[128.1]AGK[414.3] 2156 Y(+79.97)YKLVPMLPK 6.6 66 444.5661 3 24.729 0.3 31 42 83 71 95 87 75 66 69 31 [406.1]K[113.1]VP[469.3] 2157 VLLGPAPHR 5.4 60 480.2921 2 24.737 1.7 31 95 88 77 73 73 31 31 31 [99.1]LL[615.3] 2158 CSRHAELGEQLDNLQR 12.2 76 934.9531 2 24.746 2.2 36 35 57 83 93 94 93 90 86 73 84 92 82 75 77 62 [346.1]HAELGE[128.1]LDN[397.2] 2159 KHGTMMAELEELR 9.8 75 772.8814 2 24.757 0.3 32 37 45 76 92 96 95 95 96 31 96 97 86 [423.2]MMAEL[129.0]ELR 2161 LLPVLYPDGLLLYYK 9.8 65 890.5162 2 24.789 2.5 31 84 84 98 96 89 88 54 35 35 39 87 87 31 31 [113.1]LPVLYP[398.2]LY[291.2] 2162 LVDSMQATLDSEVR 12.6 90 782.3882 2 24.798 0.6 71 77 91 91 92 90 97 96 96 95 91 89 90 89 [212.2]DSMQATLDSEVR 2163 QTFVAGLADASR 7.5 62 412.5522 3 24.809 3.3 33 34 33 38 40 76 92 89 89 90 93 31 [603.3]LADAS[156.1] 2165 LSKSQSEK 4.7 59 906.4916 1 24.829 2.8 73 73 75 49 45 64 31 58 [887.5] 2167 KPRHLCNTSLLNSK 9.3 67 537.6328 3 24.861 2.7 68 70 55 57 38 44 53 84 94 93 82 63 78 46 [848.4]TSLL[329.2] 2168 RHKLYPAKSYLLYK 8.5 61 890.5154 2 24.87 1.8 31 45 41 85 79 84 42 39 47 92 92 82 56 31 [421.3]L[163.1]P[286.2]YLL[291.2]

PAGE 335

335 2169 QNWPHVVGNVANK 8.1 62 488.2562 3 24.879 0.5 50 55 55 85 31 80 76 48 45 47 83 82 63 [428.2]P[137.1]V[369.2]AN[128.1] 2170 HHHLWKLYPMVRGPRLR 10.1 60 732.7462 3 24.889 0.2 31 65 48 43 35 36 57 81 96 94 88 73 69 61 53 43 31 [951.5]YPMV[735.5] 2171 LQLGTSSYFR 7.1 71 586.3099 2 24.899 1.7 88 77 89 93 92 92 38 41 41 50 L[128.1]LGTS[553.3] 2173 VWTEAELEELR 8.4 76 687.8499 2 24.931 2 31 82 77 66 96 97 98 31 89 92 72 [99.1]W[230.1]AEL[129.0]EL[156.1] 2174 VHAVLVWAGAT(+79.97)LK 9.8 75 722.8873 2 24.938 2.7 91 93 89 91 96 94 94 86 69 50 46 42 31 VHAVLVWA[550.3] 2175 VSPMTAELEELR 9.5 80 687.8499 2 24.947 0.5 31 72 85 89 96 98 97 98 31 88 91 71 [186.1]PMTAEL[129.0]EL[156.1] 2176 ETNLMAYHYLFR 8.1 68 779.3801 2 24.955 0.6 49 48 49 67 81 97 89 88 89 90 31 31 [457.2]MAYHYL[303.2] 2177 DRRHNNDGLR 6.1 61 418.2139 3 24.966 1.3 32 32 31 70 65 85 83 67 89 52 [678.3]ND[57.0]L[156.1] 2179 VRLMY(+79.97)M(+15.99)LVLHKLR 9.3 71 589.9907 3 24.996 2.8 35 35 54 54 61 77 93 96 96 93 87 84 57 [889.4]LVLHKL[156.1] 2180 YAVSEPLLSQMVLAK 11.7 78 824.952 2 25.004 0.7 51 54 57 92 97 96 96 96 94 81 86 86 75 73 31 [333.2]SEPLLSQMV[312.2] 2181 MNATLSDLVMGNLYK 12.9 86 835.4176 2 25.014 0.5 69 64 86 95 96 94 93 94 97 98 96 87 91 93 31 [245.1]ATLSDLVMGNLY[128.1] 2182 VQLELNQLK 6.3 71 542.8216 2 25.025 0 62 57 92 79 77 64 58 83 58 [227.1]L[484.2]L[128.1] 2183 MAT(+79.97)KFFVHSHWTVFFK 10 63 698.335 3 25.033 1.9 45 44 42 42 38 41 52 78 78 78 84 79 80 91 93 31 [1265.5]W[101.0]VFF[128.1] 2185 LLPVLYPPVVEEVGQK 10.9 68 594.0129 3 25.066 0.7 31 40 40 55 58 63 78 88 97 94 94 90 85 62 66 40 [795.5]PVVEEV[313.2] 2186 YNGSEPLELAALPLLK 13.2 83 864.4821 2 25.076 0.5 59 61 70 90 95 96 95 96 97 98 97 89 83 73 87 31 [334.1]SEPLELAALP[113.1]L[128.1] 2188 TPGLMENFLVLHQLR 11.4 76 884.4821 2 25.096 0.3 57 58 51 54 90 89 86 96 97 95 97 77 59 81 46 [368.2]MENFLVL[265.1]L[156.1] 2189 RPM(+15.99)MHHGVAKWR 7.2 60 507.9264 3 25.107 2.1 31 31 31 66 40 37 65 90 94 88 86 60 [862.4]VAKW[156.1] 2191 SLSTELFK 6.2 77 462.7553 2 25.139 0.4 31 96 95 91 88 89 95 31 [87.0]LSTELF[128.1] 2192 Y(+79.97)KGRT(+79.97)KEEFMEVSQLQEYK 12.5 66 851.7112 3 25.146 2.4 57 39 36 39 49 40 40 90 31 94 77 85 86 81 95 89 94 91 31 [1022.4]E[147.1]M[129.0]VSQLQEY[128.1] 2193 VGKMVATLLES(+79.97)K 8.8 73 678.3525 2 25.158 2 69 60 72 82 94 93 94 93 76 53 31 55 [284.2]MVATL[537.2] 2194 VMGGLPDVVTLMEK 11.8 84 744.893 2 25.168 0.8 77 78 82 85 92 94 92 95 94 94 91 83 84 31 [230.1]GGLPDVVTLME[128.1] 2197 LLTEGNEFGR 7.3 73 568.291 2 25.21 0.4 95 96 95 88 62 57 75 92 31 31 LLTE[300.1]F[213.1] 2198 FESFLPLMK 5.3 59 556.2968 2 25.218 0.5 31 31 96 96 97 50 46 47 37 [276.1]SFL[469.3] 2199 KETNNLSLDAASRTKT(+79.97)R 10.6 62 992.9954 2 25.226 1.2 53 50 57 55 65 68 78 91 79 75 78 67 54 53 48 42 41 [786.4]L[1066.5] 2200 WWNPLQPLGKHAPSVK 10.1 63 620.0075 3 25.238 2.3 31 74 48 48 62 51 55 57 90 77 72 85 94 94 31 31 [1034.5]G[265.2]APS[227.2] 2201 Y(+79.97)NLRGLVAAFK 8.2 74 666.3458 2 25.248 2.2 94 79 77 68 72 84 90 91 91 31 31 Y(+79.97)[440.2]LVAA[275.2] 2203 DGLMMAELEELR 8.6 71 703.8358 2 25.28 0.9 36 49 50 80 86 93 93 95 31 83 89 66 [285.1]MMAEL[129.0]EL[156.1] 2205 WRYPRQNKR 5.1 56 435.2417 3 25.302 2 66 35 33 43 61 47 84 63 69 [886.5]N[284.2] 2207 FLYVPRRPANPGRPR 8.3 55 599.3442 3 25.322 0.5 32 39 36 51 62 62 63 57 71 61 79 62 61 52 31 [1777.0] 2210 WRT(+79.97)PKQAVMGAELR 8.8 63 574.9538 3 25.365 2.2 34 41 37 41 38 39 48 74 96 90 87 87 87 70 [1046.5]MGAEL[156.1] 2211 EPPVLYPTKKYLTFK 9.8 65 912.5167 2 25.376 2.4 31 31 31 97 97 98 90 72 72 85 71 57 58 49 31 [323.1]VLYP[229.1]K[652.4]

PAGE 336

336 2212 ELELPEGGLFYFR 10.5 81 785.4001 2 25.387 1 31 91 93 84 86 92 80 77 88 92 82 87 64 [129.0]LELPEG[57.0]LFYF[156.1] 2213 KPPVNYPNVSLLLWR 8.5 57 898.5129 2 25.398 1.7 31 31 79 78 69 88 81 35 35 35 91 96 31 31 31 [535.3]YP[300.1]LL[455.3] 2215 EPPVLYRRAKLYYK 8.4 60 898.5127 2 25.431 2 31 31 31 97 96 97 78 59 56 57 76 61 31 31 [323.1]VLY[1078.6] 2216 LLFNKREPVLLNSCR 9.4 63 601.3414 3 25.441 0.5 37 46 44 48 51 57 51 78 76 84 84 83 74 91 31 [1096.6]LLN[87.0]C[156.1] 2217 RRHM(+15.99)TVVWCLCTGKK 9.4 63 459.2414 4 25.451 2.3 31 32 52 50 79 78 47 47 75 95 92 79 71 73 31 [1184.6]LC[414.3] 2219 M(+15.99)ANQTVSSQFR 9.3 85 642.8044 2 25.474 1.1 60 60 59 86 93 96 98 96 93 97 85 [332.1]QTVSSQFR 2221 YRKLKAFKVVSYFK 8.9 64 889.03 2 25.506 0.3 32 32 31 43 52 56 67 94 95 94 90 79 90 31 [906.5]KVVS[163.1]F[128.1] 2222 S(+79.97)ESFVNGGSTQAR 8 62 710.297 2 25.517 2.3 64 70 93 92 77 66 77 65 41 37 37 40 37 [296.0]SF[870.4] 2224 QPMVMKANKRK 7 64 444.2518 3 25.538 2.7 56 60 61 63 53 56 66 79 83 87 31 [899.4]KR[128.1] 2225 DMT(+79.97)CDLQAMS(+79.97)ELDGMS(+79.97)R 10.1 60 1071.79 2 25.548 44.9 31 31 47 58 89 87 85 89 84 60 62 60 82 38 37 32 31 [530.1]DLQAM[409.1]D[511.2] 2227 LLPVLYPPVTTLYYK 9.8 66 890.518 2 25.581 0.4 31 33 33 97 97 98 98 98 43 43 59 89 93 31 31 [323.2]VLYPP[301.2]LY[291.2] 2228 LVLPKMMK 5.2 65 480.2921 2 25.588 1.1 31 31 97 87 82 80 79 31 [212.2]LPKM[259.1] 2229 EVVSMQATLDSEVR 10.8 77 782.3878 2 25.598 0.1 61 62 62 66 67 73 94 97 97 97 91 70 71 68 [673.3]ATLDS[384.2] 2231 WWYWRGVRYK 6.2 62 500.596 3 25.62 2.6 31 66 69 49 50 66 83 82 62 61 [934.4]VR[291.2] 2233 KPVPLYRVKYLNYK 8.5 61 891.0255 2 25.653 1.9 32 32 32 93 93 95 58 55 69 92 54 52 58 31 [324.2]PLY[383.3]Y[518.3] 2234 VYKCLKNTSLLNSK 9 64 537.6376 3 25.663 3 77 43 38 35 41 59 68 89 92 91 80 60 75 45 [848.5]TSLL[329.2] 2235 HCAEDGS(+79.97)AEEVM(+15.99)K 9.8 75 751.27 2 25.672 0.4 31 85 85 85 91 75 74 89 93 77 77 77 31 [137.1]CAED[224.0]AE[503.2] 2236 RRSM(+15.99)GLADVSK 8.3 75 412.5553 3 25.684 1 48 48 48 88 88 91 90 93 97 97 31 [399.2]M(+15.99)GLADVS[128.1] 2239 YTTFNRHSR 5.9 66 591.2959 2 25.727 3 33 78 97 97 95 93 31 31 31 [264.1]TFNR[380.2] 2240 NSVTKDENFK 6.8 68 1181.584 1 25.736 3.9 71 76 92 94 83 77 45 45 45 50 [201.1]VTK[633.3] 2241 RRDHNNDAVR 6.1 61 418.2142 3 25.746 2.2 31 32 59 59 80 85 73 66 71 48 [564.3]NN[441.2] 2245 VQLELNQLK 6.9 76 542.8209 2 25.797 1.3 62 57 88 83 80 82 75 89 64 [227.1]LELN[128.1]L[128.1] 2246 AEVTENYSLR 7.4 74 1181.582 1 25.805 1.9 94 94 94 96 93 78 78 48 31 32 AEVTE[633.3] 2247 QT(+79.97)MAQFDWK 5.7 63 617.7501 2 25.815 2.7 57 58 58 85 81 85 79 31 31 [440.1]AQF[429.2] 2248 WQFKVNPVSCLR 7.8 65 492.9312 3 25.825 0.7 58 55 55 57 51 50 86 91 83 75 82 31 [802.4]PVS[103.0]L[156.1] 2251 LLPVLYPPVVEEVGQK 11.7 73 594.0131 3 25.867 0.4 31 42 42 69 65 68 90 95 96 89 89 89 87 79 73 53 [698.4]PPVVEEV[313.2] 2252 YEM(+15.99)SHAKVAKWR 7.2 60 507.9265 3 25.878 1.1 31 40 46 45 51 50 54 64 93 88 86 61 [961.4]AKW[156.1] 2253 RRMRGCT(+79.97)KLWSDVLLR 8.9 56 518.2719 4 25.889 2.1 31 36 43 43 52 51 57 43 46 54 88 92 78 73 64 31 [1367.7]SD[481.3] 2254 MPM(+15.99)RTVAGVLR 6.6 60 416.2292 3 25.901 2.2 31 31 49 60 51 74 89 89 78 75 31 [731.3]AG[368.3] 2255 MVSLLQEK 5.9 74 474.2649 2 25.912 0.5 97 97 97 31 84 59 66 57 MVS[113.1]L[385.2] 2257 TVSTELFK 5.5 69 462.7553 2 25.944 0.3 31 31 96 89 86 86 95 31 [200.1]STELF[128.1]

PAGE 337

337 2258 FHHAPWSAEPVAFGR 9.5 63 570.2842 3 25.951 2.4 31 31 31 59 58 75 86 91 94 80 70 64 70 71 31 [775.4]SAEP[530.3] 2259 RRTWAMMAEELKK 8.7 67 550.6245 3 25.962 1.4 31 51 48 47 67 76 95 94 94 75 75 77 31 [801.4]MAE[498.3] 2260 LQEAEEQLEAVNSK 12.2 87 794.3959 2 25.973 0.9 71 66 92 97 98 96 89 96 97 95 95 78 90 50 [241.1]EAEEQLEAV[114.0]S[128.1] 2263 LLTEENGFGR 7.4 74 568.2903 2 26.017 0.6 96 96 96 96 55 46 51 87 81 31 LLTE[300.1]FG[156.1] 2264 RFRFEWLGKHAPWK 8.3 59 620.0068 3 26.024 2 38 31 32 31 39 70 70 90 81 77 85 63 64 49 [1034.5]GK[137.1]A[411.2] 2265 DNKQST(+79.97)RGMGKLKETPK 10.2 60 666.6646 3 26.034 2.4 45 45 38 38 44 58 47 63 66 78 63 66 90 88 79 77 31 [1395.6]KE[326.2] 2266 DFETLSQLSK 7.3 73 584.2982 2 26.045 0 31 31 96 95 75 73 65 92 94 77 [262.1]ET[328.2]LS[128.1] 2267 QLDLVDKLQLK 8.5 78 656.8947 2 26.055 0.9 72 81 93 91 95 92 68 73 52 77 57 [128.1]LDLVD[610.4] 2269 MTRRLDPASSAKHNK 9.3 62 856.454 2 26.088 0.7 81 65 67 80 86 90 83 66 60 43 40 41 43 43 36 M[257.1]RLDP[823.4] 2270 VSLFTLYWFK 6.9 69 435.2419 3 26.098 2.1 31 79 49 48 64 93 87 65 80 87 [547.3]LY[186.1]FK 2271 Y(+79.97)VRESLLVSKLTR 7.8 60 548.6369 3 26.108 5 31 36 36 36 46 46 65 85 88 86 80 79 56 [940.4]VSKL[257.1] 2275 KLDLVSGVVSAPK 8.1 62 438.2659 3 26.164 0.1 42 41 41 34 91 89 75 75 69 80 68 71 31 [469.3]VS[255.2]S[296.2] 2276 FWRWVTGNMGAELR 7.7 55 574.9542 3 26.172 3 31 39 32 32 41 42 41 51 57 87 87 81 81 65 [1177.5]GAEL[156.1] 2277 WKYKFKCLAANPLLEAYELK 13.6 68 810.1077 3 26.183 0.5 44 40 36 37 37 40 58 77 90 96 90 86 87 97 96 95 94 84 31 31 [1096.6]AANPLLEAYE[241.2] 2278 VDPFEWLAVLR 6.3 58 448.9169 3 26.195 3.9 31 55 55 55 69 77 76 71 48 60 31 [1325.7] 2279 LLGLNMGSELK 8.3 76 587.8289 2 26.205 0.4 94 92 94 94 85 58 58 60 73 86 31 LLGLN[404.1]L[128.1] 2282 NMSQTVSSQFR 8.7 79 642.8033 2 26.247 0.5 49 49 49 61 95 96 96 94 93 97 82 [460.2]TVSSQFR 2283 DAQLHLDDAVR 8.8 80 626.8173 2 26.257 0.5 80 80 80 96 97 96 96 91 62 65 33 DAQLHLDD[326.2] 2284 LLSLNSADMLK 8.4 76 602.8338 2 26.267 0.2 95 94 94 95 90 91 73 65 51 52 36 LLSLNS[558.3] 2287 LQDLVDQLKMK 7.6 69 444.2508 3 26.311 1.5 87 59 68 70 94 92 64 69 54 63 31 L[356.2]VD[628.4] 2288 HRFANDSWM(+15.99)LAGMQTR 10.5 66 968.9473 2 26.321 1.7 32 90 81 93 89 95 98 31 88 85 50 38 38 40 50 46 [137.1]RFANDS[186.1]M(+15.99)L[644.3] 2290 RRRY(+79.97)LTLTNTR 6.5 59 510.6075 3 26.339 1.2 31 31 31 33 42 59 91 85 84 89 70 [925.5]LTNT[156.1] 2293 LLPVLYPVPTTLYYK 10.6 71 890.5161 2 26.384 2.5 31 91 91 98 98 98 99 31 56 56 62 89 93 31 31 [113.1]LPVLYP[398.2]LY[291.2] 2294 LVDSMQATLDSEVR 12.6 90 782.3873 2 26.395 0.6 69 76 90 90 91 89 98 97 97 97 94 89 89 88 [212.2]DSMQATLDSEVR 2295 LVLSTLGEK 5.7 63 480.2918 2 26.405 0.8 31 31 96 95 93 86 50 50 33 [212.2]LSTL[314.2] 2296 KELLDVSSGNFYK 8 61 500.596 3 26.414 0.3 35 34 35 59 74 79 79 78 86 69 69 64 31 [871.5]G[552.3] 2299 KPFFSKNTSLLNSK 10 71 537.6343 3 26.459 1 74 74 74 51 51 54 68 87 94 94 84 62 77 45 [848.5]TSLL[329.2] 2300 NFAWLVGDVSK 7.9 72 412.5524 3 26.468 0.8 56 57 52 66 86 89 88 85 86 91 31 [518.2]LVGDVS[128.1] 2305 KNHGQNNWVR 6.2 62 418.2139 3 26.534 1.8 37 35 37 56 68 87 88 86 94 31 [564.3]NNWV[156.1] 2306 CY(+79.97)FRNLRCEANLKR 7.7 55 622.6281 3 26.542 2 57 57 32 44 39 48 53 84 89 82 50 43 48 38 [1032.4]CEA[511.3] 2308 GYSRRVLESGHSELK 10 67 573.3044 3 26.563 0.5 38 38 45 47 73 68 92 91 88 66 64 78 84 92 31 [718.4]LES[281.1]EL[128.1]

PAGE 338

338 2309 RFM(+15.99)YALLVSDTR 7.6 63 496.5949 3 26.575 1.7 32 49 42 52 50 71 93 94 89 79 74 31 [797.4]LVS[372.2] 2311 VQLELNQLK 7.2 81 542.8215 2 26.609 0.1 64 59 89 91 88 88 81 91 69 [227.1]LELNQL[128.1] 2312 LNFEKGTGRVAFK 8.1 63 489.6074 3 26.617 2.6 56 56 65 72 61 63 84 94 83 54 43 44 31 [688.4]TGR[445.3] 2313 KNFWKPVDACLR 7.1 59 492.9317 3 26.627 1.7 36 35 36 51 65 51 83 89 83 73 72 31 [800.4]VDA[372.2] 2314 GTYDDYVEGLR 9.6 87 644.2957 2 26.637 0.9 66 75 90 96 97 98 98 95 89 93 60 [158.1]YDDYVEGL[156.1] 2315 RHHGAGAVEELQR 10.3 79 730.3801 2 26.647 1.3 48 77 67 81 83 94 96 96 97 93 69 73 50 [430.2]GAGAVEE[397.2] 2317 REPT(+79.97)RKNVSAQR 7 58 507.9264 3 26.68 0.1 37 43 46 41 44 46 85 93 84 65 69 42 [847.4]NVS[355.2] 2318 QLLGTLEEMR 8.7 87 595.3154 2 26.689 0.7 54 57 95 97 97 97 97 93 95 81 [241.1]LGTLEEMR 2320 MVSLLQEK 6.6 83 474.2646 2 26.71 1.1 98 98 98 31 92 79 85 77 MVS[113.1]L[128.1]E[128.1] 2321 NCVAGVLR 5.5 68 416.229 2 26.72 0.3 66 68 68 80 85 72 74 31 [316.1]AG[368.3] 2323 VTSTELFK 6.2 77 462.7554 2 26.754 0.1 31 92 93 91 89 89 95 31 [99.1]TSTELF[128.1] 2324 KALTWAMSDEELKK 10.8 77 550.6245 3 26.762 1.3 62 66 76 65 51 74 89 90 92 96 95 93 94 31 [670.4]MSDEELK[128.1] 2325 LYTKLECGVNAKR 8.8 68 498.9421 3 26.772 1.4 76 48 43 49 70 84 89 90 91 86 59 56 34 [618.4]ECGVN[355.2] 2329 LLTEENGFGR 7.3 73 568.2899 2 26.827 1.5 96 96 96 95 47 44 49 88 80 31 LLTE[300.1]FG[156.1] 2330 VLNKKNVLFDCVSHNK 10.9 68 620.006 3 26.835 1.7 89 89 83 49 43 40 67 63 53 68 91 91 91 55 68 38 VLN[844.5]CVS[379.2] 2331 VYESNDLLSK 8.9 89 584.2974 2 26.847 1.3 93 94 88 77 70 91 94 96 96 81 VYE[201.1]DLLSK 2332 FWDRLWWK 5.5 68 618.82 2 26.856 1.2 31 31 89 87 89 70 73 73 [333.1]DRL[500.3] 2333 LQEAEEQLEAVNSK 12.1 86 794.3947 2 26.867 2.5 72 68 94 98 98 96 83 91 95 95 94 78 89 51 [241.1]EAEEQLEAV[114.0]S[128.1] 2336 LKYLTSKCCSKLTR 8.5 61 548.6371 3 26.91 0.2 32 32 39 40 52 47 46 46 91 91 90 88 87 65 [936.5]CSKLT[156.1] 2339 Y(+79.97)LPRWLDLVNCALWR 8.8 58 666.6655 3 26.942 0 37 38 34 35 32 39 72 90 89 85 87 80 61 59 31 [1023.5]LVNCA[455.3] 2341 KLDLVSLAASAPK 8.5 65 438.2653 3 26.975 1.5 43 42 47 45 31 96 95 95 92 86 71 70 31 [568.4]SLAAS[296.2] 2342 Y(+79.97)RYKRSLMGAELR 8 61 574.9534 3 26.984 2.9 33 32 32 37 40 53 61 94 86 82 85 86 70 [1046.5]MGAEL[156.1] 2344 LNFFLCLLEDK 8.6 78 677.8563 2 27.002 1.5 83 76 94 85 93 94 96 83 60 55 31 L[114.0]FFLCLL[372.2] 2345 EPEEKLSDLTEQLWTGK 12.9 76 1001.999 2 27.013 2.9 48 50 50 76 81 95 96 96 96 96 95 87 95 68 49 72 34 [484.2]KLSDLTEQL[472.2] 2347 NCHM(+15.99)KLLAANPLLEAYLEK 14.9 78 1094.068 2 27.047 0.4 57 59 72 64 64 91 98 99 98 90 82 83 94 96 94 93 81 31 31 [629.2]LLAANPLLEAYL[257.1] 2348 NMSQTVSSQFR 8.9 81 642.8038 2 27.058 0.2 53 53 53 67 94 96 98 95 93 97 82 [460.2]TVSSQFR 2349 RGSQQSLALAWK 7 58 448.9169 3 27.068 1.5 41 43 44 58 58 60 67 69 72 73 75 31 [1325.7] 2350 TLEAPLGCMLK 8.2 75 588.3113 2 27.078 0.6 81 85 94 78 70 80 74 69 68 70 49 TLE[168.1]L[532.3] 2351 DAQLHLDDAVR 8.2 74 626.8171 2 27.087 0.7 55 55 53 94 95 94 95 91 69 74 39 [314.1]LHLDD[326.2] 2353 YNQLQDVLPLK 7.1 65 444.2509 3 27.12 1.3 66 56 54 69 70 82 83 79 59 59 31 [646.3]DV[451.3] 2354 LLSLNSADMLK 8.8 80 602.8334 2 27.129 0.9 95 95 95 96 90 91 90 79 57 53 36 LLSLNSA[487.2]

PAGE 339

339 2355 LLFWVEHLESTR 7.6 63 510.6077 3 27.139 1.6 35 35 35 31 91 91 93 79 75 69 85 31 [559.3]VEH[329.2]T[156.1] 2356 LNFESM(+15.99)MKVLK 8.2 75 678.3582 2 27.15 2.2 79 76 94 96 98 98 89 55 51 48 31 [227.1]FESM(+15.99)M[468.3] 2357 QLDLVDQLKLK 7.6 69 656.894 2 27.159 2 70 77 92 95 96 93 41 49 48 61 31 [241.1]DLVD[610.4] 2359 LVLSTLGEK 6 66 480.2916 2 27.191 1.3 31 31 94 90 89 87 65 66 40 [212.2]LSTL[314.2] 2360 LVDSMQATLDSEVR 12.4 88 782.3864 2 27.201 1.8 69 76 91 91 92 89 97 97 97 95 89 82 84 83 [212.2]DSMQATLDSEVR 2361 LKMYVMPADYLR 7.2 60 500.5964 3 27.211 0.1 77 58 58 31 58 57 60 82 79 66 60 31 [862.4]A[547.3] 2363 LLPVLT(+79.97)HVKLLYYK 10.3 74 890.5148 2 27.232 2.8 31 89 89 96 96 94 55 63 80 94 92 86 31 31 [113.1]LPVLT(+79.97)[236.1]KLLY[291.2] 2366 NFGWVLADVSK 8.6 78 412.5522 3 27.275 0.2 67 75 67 31 98 97 94 94 97 97 31 [504.2]VLADVS[128.1] 2368 LLVPLYPPVATGARERR 10.8 63 636.7119 3 27.297 1.8 88 88 88 61 58 66 72 72 48 41 43 73 82 70 57 31 31 LLV[895.5]A[597.3] 2371 SVKYSNNDAVR 6.7 61 418.2146 3 27.344 0.9 31 41 44 55 83 89 80 67 63 67 47 [477.3]SNN[441.2] 2373 EDSLRREDKLSELK 8.9 64 573.3058 3 27.363 2.9 34 41 41 54 55 35 85 66 84 90 91 87 93 31 [756.4]E[115.0]KLSEL[128.1] 2375 DMRRAPALVSSER 8.6 66 496.5953 3 27.383 2.1 32 32 38 47 54 65 86 92 95 92 80 76 61 [726.4]ALVSS[285.1] 2377 VQLELNQLK 7.2 80 542.8223 2 27.416 1.3 64 59 89 90 90 88 78 90 66 [227.1]LELN[128.1]L[128.1] 2378 KHYFKVPDACLR 7.3 61 492.932 3 27.424 2.4 32 50 43 69 87 73 72 80 66 62 61 31 [575.3]K[196.1]D[443.2] 2379 WTPFTKQVEELKR 8 61 554.6376 3 27.434 1.4 36 35 37 81 58 50 52 85 87 81 69 71 48 [384.2]F[357.2]VEE[397.3] 2380 M(+15.99)RKGLEAPT(+79.97)ANK 9.4 79 471.2312 3 27.445 2.1 40 40 58 90 90 95 95 86 85 91 93 75 [431.2]GLEAPT(+79.97)AN[128.1] 2381 SAYDDYVEGLR 9.5 86 644.2964 2 27.457 0.4 67 73 93 96 97 98 98 94 86 90 54 [158.1]YDDYVEGL[156.1] 2383 REWFTQNAKWR 6.9 63 507.9276 3 27.49 1.9 38 47 40 53 54 49 78 93 88 86 61 [961.4]AKW[156.1] 2384 QLLGTLEEMR 8.7 87 595.3165 2 27.5 1 57 60 95 97 96 97 97 93 95 81 [241.1]LGTLEEMR 2386 QWSCKVAGVLR 7.3 66 416.2302 3 27.521 2.8 58 43 45 49 74 84 91 91 80 78 31 [632.3]VAGV[269.2] 2387 KNASAAMMTVELKK 10.6 76 761.4095 2 27.532 0.6 80 72 83 84 90 96 96 93 90 88 57 47 48 31 K[114.0]ASAAMMTV[498.3] 2389 SLSTELFK 6.1 77 462.755 2 27.565 0.9 31 96 94 88 85 90 95 31 [87.0]LSTELF[128.1] 2390 LT(+79.97)VRKNAAELEGDGR 8.3 55 570.2836 3 27.573 0.9 35 34 34 40 40 48 53 92 95 88 80 56 54 39 31 [862.4]AELE[385.2] 2391 RRTWAMMAEELKK 9.2 71 550.6244 3 27.584 1.6 31 77 43 41 58 69 96 95 96 93 91 92 31 [801.4]MAEELK[128.1] 2392 MVSLLQEK 5.8 72 474.2643 2 27.595 1.7 98 98 98 31 71 57 64 56 MVS[611.4] 2395 LLTEGNEFGR 7.2 72 568.2913 2 27.637 1 96 97 96 91 59 53 74 91 31 31 LLTE[300.1]F[213.1] 2396 YYAWLPKLGKGFTWK 8.3 55 620.0078 3 27.645 2 44 42 43 47 59 54 66 83 91 80 59 48 44 31 31 [921.5]LGK[619.3] 2397 QLEAEEQLEAVNSK 12.2 87 794.397 2 27.654 0.5 70 76 94 97 98 95 83 94 97 95 95 79 90 52 [241.1]EAEEQLEAV[114.0]S[128.1] 2398 YNVAGVLWASR 8.7 79 618.33 2 27.665 0.2 65 60 65 84 88 91 95 96 93 95 31 [376.2]AGVLWAS[156.1] 2399 DM(+15.99)ETKSLLSK 7.8 78 584.2985 2 27.677 2.3 31 98 97 95 62 56 64 95 96 80 [115.0]M(+15.99)ET[328.2]LSK 2401 LAHLLLYADM(+15.99)K 6.3 57 435.2412 3 27.709 0.9 42 40 39 38 34 96 92 90 89 31 31 [547.3]LYAD[275.1]

PAGE 340

340 2402 RRRFSKCCSKLTR 7.8 60 547.6364 3 27.72 0 31 31 37 40 45 51 51 83 83 83 86 85 62 [933.5]CSKLT[156.1] 2407 KLDLVSLAASAPK 8.5 65 438.2662 3 27.787 0.5 45 44 51 52 31 95 94 95 92 85 61 67 31 [568.4]SLAAS[296.2] 2408 WFRWQSGVMGAELR 8.8 63 574.9546 3 27.795 2.3 31 35 35 37 36 39 52 91 93 93 90 85 86 68 [947.4]VMGAEL[156.1] 2410 FQLVAGAVY(+79.97)QRK 9.7 81 730.3795 2 27.817 4.1 91 84 86 86 90 93 94 96 93 60 62 33 FQLVAGAVY(+79.97)[412.3] 2413 NSMQTVSSQFR 8.8 80 642.8034 2 27.862 0.4 51 51 51 67 96 97 95 94 93 97 85 [460.2]TVSSQFR 2414 CKTYLVTVVYR 6.1 55 448.9168 3 27.872 1.2 46 46 49 52 59 62 73 60 60 60 31 [1325.7] 2415 EPGLNLLYQK 7.1 71 587.8285 2 27.882 2.6 82 81 75 80 88 91 91 49 31 40 EP[57.0]LNLL[419.2] 2416 MELDDLSSNMEAVSK 12.7 84 834.8765 2 27.892 0.1 76 75 90 95 97 97 98 96 90 94 92 76 72 80 31 [260.1]LDDLSSNME[170.1]S[128.1] 2420 LLSLNSADMLK 9.1 82 602.8334 2 27.947 0.9 96 96 95 96 91 92 87 79 64 63 42 LLSLNSA[487.2] 2421 NAELHLDDAVR 8 73 626.8168 2 27.957 1.2 53 47 47 95 95 91 92 91 69 78 39 [314.1]LHLDD[326.2] 2422 NYRTYKVDTLTR 8.1 67 510.6077 3 27.967 1 55 52 39 40 46 66 92 85 85 81 88 72 [825.4]VDTLT[156.1] 2423 TTFSPAAGQAEPVER 10.4 70 520.9271 3 27.978 1.1 73 68 64 67 67 70 72 55 53 70 87 93 68 65 63 [931.4]EP[384.2] 2425 LVDSMQATLDSEVR 12.5 89 782.3884 2 28.012 0.9 68 75 90 88 89 88 97 97 98 97 93 88 89 88 [212.2]DSMQATLDSEVR 2426 LVLSTLGEK 6.2 68 480.2927 2 28.023 1 31 31 96 94 94 88 67 68 41 [212.2]LSTL[314.2] 2427 EPFYRLGGNRYK 7.5 63 500.5967 3 28.032 0.2 65 65 65 49 64 57 88 57 49 66 61 62 [805.4]G[618.3] 2428 LLPVLYPDAVLLYYK 9.3 62 890.5171 2 28.042 1.4 31 57 57 98 96 89 87 39 39 43 55 84 81 31 31 [323.2]VLYP[398.2]LY[291.2] 2429 QLDLVDQLKLK 8.2 75 656.8961 2 28.053 1.2 71 79 95 96 98 95 57 69 57 70 31 [241.1]DLVD[610.4] 2432 FNAWLVGDVSK 7.8 71 412.5532 3 28.096 2.6 56 55 49 53 84 91 90 88 88 92 31 [518.2]LVGDVS[128.1] 2437 SVKYSNNDAVR 6.8 62 418.2146 3 28.163 0.9 31 42 39 48 61 85 84 86 73 78 49 [564.3]NND[326.2] 2439 KKWWQEDQLSTLR 7.6 58 573.3057 3 28.184 0.3 31 50 31 43 66 66 84 75 87 79 53 49 36 [885.4]D[128.1]L[457.3] 2441 KHPRKALTLR 5.8 58 407.264 3 28.207 2.5 34 33 55 76 66 64 62 68 67 50 [1200.8] 2443 VQLELNQLK 6.5 72 542.8218 2 28.241 0.4 66 61 92 91 89 62 52 76 53 [227.1]LEL[483.3] 2444 FTLNTVAGEGSPKR 7.8 56 492.932 3 28.25 0.7 49 53 41 40 41 41 45 81 83 81 71 55 56 37 [746.4]GEG[468.3] 2445 WKFT(+79.97)NKVPYLVKAPRLR 9.7 57 732.7468 3 28.26 2.4 43 39 36 57 52 51 63 94 89 84 60 54 55 57 53 45 31 [983.5]PYL[820.5] 2446 SAYDDYVEGLR 9.3 84 644.2963 2 28.271 0.1 55 66 90 96 97 97 97 94 85 90 54 [158.1]YDDYVEGL[156.1] 2451 QLLGTLEEMR 8.8 88 595.3157 2 28.335 0.2 61 66 96 96 96 97 98 93 96 81 [241.1]LGTLEEMR 2453 Y(+79.97)Y(+79.97)QTGHYR 4.5 56 416.4801 3 28.353 1.8 31 56 54 54 71 65 66 49 [1228.4] 2455 SLSTELFK 5.9 73 462.7553 2 28.386 0.3 31 94 92 86 79 77 91 31 [87.0]LST[242.1]F[128.1] 2457 RRTWAMMAEELKK 9.1 70 550.6246 3 28.406 1.2 31 52 49 48 70 90 96 93 92 86 83 84 31 [670.4]MMAEELK[128.1] 2459 YESLPWSAELEKEK 9.3 67 570.2842 3 28.427 2.8 50 39 39 59 70 81 82 93 95 92 86 48 51 41 [589.3]WSAELE[385.2] 2461 LLTENGEFGR 7.1 71 568.2913 2 28.461 1 94 96 96 89 60 64 76 63 31 31 LLTE[660.3]

PAGE 341

341 2463 LNFLLM(+15.99)SM(+15.99)PLK 9 82 669.8602 2 28.478 2.1 94 91 97 97 97 97 89 74 66 64 31 LNFLLM(+15.99)S[485.3] 2464 QFTAGVLWASR 8.1 73 618.33 2 28.488 0.2 36 35 37 88 96 96 96 97 93 95 31 [376.2]AGVLWAS[156.1] 2465 MVSLLQEK 6.4 80 474.2656 2 28.499 1 97 97 97 31 88 74 84 72 MVS[113.1]L[128.1]E[128.1] 2467 TLSVFLYWFK 5.8 58 435.2417 3 28.531 1.7 49 49 46 43 43 94 64 50 58 78 [547.3]L[624.3] 2468 LMY(+79.97)KVLLVSQLTR 8.4 64 548.637 3 28.542 0.6 31 31 41 45 45 65 84 93 88 74 84 84 65 [827.4]LVS[128.1]LT[156.1] 2469 LLFLNM(+15.99)CLDLK 8.9 81 669.86 2 28.553 2.5 88 88 94 95 87 92 93 93 85 36 31 LLFLNM(+15.99)CLD[241.2] 2471 DFETLSQLSK 6.8 68 584.298 2 28.573 0.2 31 31 98 97 60 54 52 87 92 71 [262.1]ET[328.2]LS[128.1] 2473 KLDLVSLAASAPK 8.2 63 438.266 3 28.606 0 41 41 44 41 31 96 95 95 89 83 61 65 31 [568.4]SLAAS[296.2] 2474 Y(+79.97)YVKKWVMGAELR 7.8 60 574.954 3 28.615 2.2 35 35 34 42 48 31 85 97 88 83 73 71 54 [947.4]VMGA[398.2] 2475 Y(+79.97)LEFYLDLVDKLKCR 10.6 71 666.6655 3 28.626 0.7 33 53 45 71 82 80 92 89 88 93 89 75 56 62 43 [632.2]YLDLVDK[500.3] 2477 LQEAEEQLEAVNSK 12.1 86 794.3967 2 28.647 0 69 65 92 97 99 97 88 94 95 95 95 78 89 50 [241.1]EAEEQLEAV[114.0]S[128.1] 2479 SNMQTVSSQFR 9 82 642.8026 2 28.68 1.6 51 51 51 82 95 96 98 96 94 97 85 [332.1]QTVSSQFR 2485 EVQLVDQLKMK 7.1 64 444.2511 3 28.754 0.8 85 43 42 54 62 91 63 83 65 81 31 E[439.3]D[128.1]L[128.1]M[128.1] 2486 LLGLNGTDMLK 7.7 70 587.8284 2 28.764 0.5 92 88 83 80 81 61 51 55 55 72 48 LLGLN[645.3] 2487 WNNKKAELEELR 8.5 71 510.6079 3 28.773 1.4 60 55 55 55 64 79 87 94 31 92 95 79 [741.4]EL[129.0]EL[156.1] 2488 LLSLNSGEMLK 8.3 75 602.8335 2 28.784 0.7 96 95 95 96 89 87 54 52 57 60 40 LLSLNS[558.3] 2489 MELDDLSSSGTEAWK 12.2 82 834.8755 2 28.794 1 82 81 92 97 98 97 98 31 69 73 87 93 92 95 31 MELDDLS[231.1]TEAW[128.1] 2491 LVLSTLGEK 6.5 72 480.2928 2 28.828 1.3 31 31 96 93 90 88 81 82 53 [212.2]LSTLGE[128.1] 2492 VLDSMQATLDSEVR 12.8 91 782.3887 2 28.837 1.2 73 80 92 92 93 90 97 97 97 97 95 90 90 90 [99.1]LDSMQATLDSEVR 2493 WWYTGLQVRYK 6.4 58 500.5969 3 28.848 2.1 31 67 67 45 38 39 58 86 85 62 58 [934.4]VR[291.2] 2494 LLPVLYPELVGLYYK 9.3 62 890.5168 2 28.858 1.7 31 34 34 96 96 97 95 84 49 39 45 77 87 31 31 [323.2]VLYPE[382.3]Y[291.2] 2495 NAELHLDDAVR 8 72 626.8182 2 28.869 1 56 48 48 93 96 95 95 85 66 73 38 [314.1]LHLDD[326.2] 2498 FNWGVLADVSK 7.6 69 412.5524 3 28.912 0.7 53 44 41 49 80 87 87 91 97 97 31 [504.2]VLADVS[128.1] 2503 DRRHNNDAVR 6.6 66 418.214 3 28.979 1.7 31 31 31 72 69 90 93 86 87 59 [678.3]NDAV[156.1] 2504 QMLYMPAPTCAGEGLQR 9.8 57 622.6285 3 28.988 0.2 44 45 57 39 37 42 54 59 63 85 78 72 68 65 57 58 45 [1032.5]C[711.4] 2505 M(+15.99)LHSVLWPALSCKTK 10.1 67 865.459 2 29 1.1 81 81 91 31 31 98 87 79 77 84 57 54 58 60 31 M(+15.99)LH[186.1]LW[168.1]L[547.3] 2507 ACRLFKLESHGSELK 10.4 69 573.3057 3 29.022 1.6 41 46 57 52 53 81 92 94 84 70 68 84 86 93 31 [590.3]KLES[194.1]SEL[128.1] 2509 VQLELNQLK 6.8 76 542.8219 2 29.057 0.6 62 58 85 74 72 79 82 92 72 [227.1]L[356.2]QL[128.1] 2510 AQFTDEVKASPKR 7.8 60 492.9318 3 29.065 0.2 32 35 35 88 85 80 85 83 84 42 40 41 40 [346.2]TDEVKA[468.3] 2511 SAYDDYVEGLR 9.1 82 644.2963 2 29.074 0.2 55 66 90 96 97 98 97 93 77 87 44 [158.1]YDDYVE[57.0]L[156.1] 2512 KLDLVDQLQLK 9.6 87 656.895 2 29.084 0.5 88 87 94 95 98 97 84 85 74 87 66 KLDLVDQL[128.1]L[128.1]

PAGE 342

342 2513 FWPGAGAVSAQGRR 10.2 73 730.3804 2 29.094 1.3 31 69 74 75 77 93 95 94 93 89 69 62 60 31 [558.3]GAVSA[497.3] 2515 RHS(+79.97)KMKNAKWR 6.7 60 507.9269 3 29.128 2.8 37 37 34 37 49 61 75 94 88 87 60 [961.4]AKW[156.1] 2516 QLLGTLEEMR 8.6 86 595.3162 2 29.138 0.5 55 58 94 97 96 96 97 91 94 77 [241.1]LGTLEEM[156.1] 2518 KCNWTVAGVLR 6.5 59 416.2296 3 29.156 1.4 34 35 42 63 56 58 84 88 77 74 31 [731.3]AG[368.3] 2519 Y(+79.97)MHPPVDTMLAAYRNK 9 56 662.9717 3 29.167 2.1 34 49 43 76 31 66 63 55 52 54 86 84 71 52 37 41 [1264.5]AA[561.3] 2521 SLSTELFK 5.9 73 462.7555 2 29.201 0.1 31 96 95 88 77 74 90 31 [87.0]LST[242.1]F[128.1] 2522 HHLVLAMMAEQLTR 8.7 62 550.6248 3 29.209 1 31 31 58 46 55 70 91 96 93 83 52 52 54 46 [670.4]MMAE[498.3] 2524 KKRFCEAAELEGDGR 9.2 61 570.2844 3 29.232 2.9 31 60 31 31 48 75 78 95 95 88 81 61 57 45 31 [862.4]AELE[385.2] 2527 LLTEKGDTCR 7.5 75 568.291 2 29.276 2.5 94 96 95 94 56 48 49 79 80 56 LLTE[401.2]C[156.1] 2528 YYAWLQFAKWAALVK 9.1 60 620.0076 3 29.284 1.8 61 61 62 45 62 47 63 69 82 92 92 52 40 40 31 [1042.5]KWA[411.3] 2529 QFTAGVLWASR 8.2 75 618.33 2 29.294 0.2 42 41 51 84 94 94 96 97 93 94 31 [376.2]AGVLWAS[156.1] 2530 MVSLLDAAK 7.3 81 474.2653 2 29.305 0.3 97 97 97 98 94 71 71 64 31 MVSLL[385.2] 2531 DVLASMGQLNVK 10.2 85 637.8425 2 29.315 0.4 31 96 95 95 95 95 94 84 94 79 88 70 [115.0]VLASMGQL[114.0]V[128.1] 2534 WHVYNKLVSQLTR 8 61 548.6376 3 29.36 1.9 31 37 37 37 54 46 68 92 91 76 81 82 61 [940.5]VS[128.1]LT[156.1] 2535 RWNS(+79.97)FLVLLPDT(+79.97)GYKR 9.2 57 532.0072 4 29.37 1.8 32 40 37 46 74 78 33 54 60 68 77 84 68 48 62 49 [1420.7]T(+79.97)[504.3] 2536 DM(+15.99)ETSKLLSK 8.1 81 584.2988 2 29.382 1.8 31 97 97 93 75 71 86 93 93 72 [115.0]M(+15.99)ET[215.1]LLS[128.1] 2537 MFFPSANK 5.2 65 471.2316 2 29.391 1 31 31 31 81 86 85 89 79 [425.2]PSAN[128.1] 2539 KLDLVSLAASAPK 8.4 65 438.266 3 29.425 0 43 42 47 49 31 95 94 95 89 81 68 70 31 [568.4]SLAAS[296.2] 2540 Y(+79.97)YRRKTVMGAELR 8.1 62 574.9543 3 29.434 1.4 34 32 32 34 43 58 72 94 86 83 84 84 66 [1046.5]MGAEL[156.1] 2541 VLTWFFDDLVNCGMLPK 10.4 61 666.665 3 29.445 2.9 32 32 32 32 31 49 82 91 89 89 83 86 84 71 59 61 31 [793.4]DDLVNCG[469.3] 2542 QLEAEEQLEAVNSK 12.1 87 794.3962 2 29.457 0.6 71 79 94 97 98 95 87 95 97 94 93 72 88 46 [241.1]EAEEQLEAV[114.0]S[128.1] 2545 M(+15.99)ANQTVSSQFR 8.8 80 642.8035 2 29.502 0.3 47 47 47 77 94 96 97 95 94 97 86 [460.2]TVSSQFR 2546 RQTQRSASPSVK 6.8 57 448.9169 3 29.512 1.5 48 37 35 34 37 73 78 85 91 93 31 31 [827.4]SPS[227.2] 2547 HMAHS(+79.97)DSCFK 5.8 58 414.8189 3 29.523 0.7 49 41 42 57 62 31 86 86 86 31 [758.2]SCF[128.1] 2548 MKEVWY(+79.97)MELKLSHANR 10.1 63 705.6697 3 29.534 1.5 35 35 37 58 51 38 71 76 96 97 96 95 79 51 51 39 [1176.4]LKLS[478.2] 2549 KEEFQAAQEPVER 7.7 59 520.928 3 29.545 2.8 37 37 41 87 45 43 48 48 61 77 81 80 79 [386.2]F[624.3]VE[156.1] 2551 QLDLVDQMKLK 6.3 57 444.252 3 29.58 1.2 54 52 53 51 94 92 54 50 44 51 31 [469.3]VD[628.4] 2552 RKFARS(+79.97)VLCLTR 7.4 62 510.6089 3 29.588 0.9 33 36 34 45 53 90 84 95 80 62 63 60 [658.4]S(+79.97)VLC[370.2] 2553 MELDDLSSNMEAVSK 12.7 84 834.8768 2 29.599 0.4 78 78 93 97 98 97 98 97 86 89 86 77 75 79 31 [260.1]LDDLSSNME[385.2] 2554 LLSLNSADFPK 9.7 88 602.8349 2 29.61 4.5 96 95 95 96 92 94 94 90 90 90 31 LLSLNSADFP[128.1] 2555 LLGLNSADMLK 7.7 70 587.8292 2 29.62 0.8 93 89 84 84 88 65 56 53 55 54 39 LLGLN[645.3]

PAGE 343

343 2557 FPKLLVCQNM(+15.99)YK 7.2 60 500.5957 3 29.654 1.5 47 49 63 66 77 59 57 55 58 81 68 31 [1042.6]M(+15.99)[291.2] 2558 LVLSTLGEK 6.1 68 480.2916 2 29.664 1.2 31 31 96 94 91 86 68 69 42 [212.2]LSTL[314.2] 2559 LVDSMQATLDSEVR 12.5 89 782.3871 2 29.674 0.9 68 75 90 90 90 89 97 97 97 97 93 87 88 87 [212.2]DSMQATLDSEVR 2561 QPQEQELAVSKLEK 10.9 78 813.937 2 29.696 1.7 52 53 59 69 80 96 90 88 95 95 93 90 92 31 [482.2]QELAVSKLE[128.1] 2563 T(+79.97)KNLKLATSLLNSK 8.7 62 537.634 3 29.73 0 43 47 40 48 43 52 63 86 91 94 75 61 76 46 [848.5]TSL[442.3] 2564 NFVWGLADVSK 7.8 71 412.5524 3 29.739 0.8 31 31 31 93 92 92 91 93 96 96 31 [360.2]WGLADVS[128.1] 2569 RS(+79.97)LKNNWVR 6 67 418.2139 3 29.804 3 31 31 87 85 87 78 76 88 31 [323.1]LKN[300.1]V[156.1] 2571 YPHSVLPWALCSTKK 9.7 65 865.4596 2 29.825 1.5 84 84 84 31 31 97 73 48 51 60 90 82 58 58 31 YPH[186.1]L[467.3]CS[357.2] 2572 AAVFSY(+79.97)LESLLLRR 8.9 64 573.3057 3 29.836 0.5 65 64 46 44 39 39 94 80 80 81 76 73 73 31 [718.3]LESL[538.4] 2575 VQLELNQLK 6.4 71 542.8225 2 29.882 1.7 52 49 89 73 69 74 77 88 64 [227.1]L[484.2]L[128.1] 2576 MM(+15.99)NWPKELKKR 6.8 62 492.9324 3 29.892 0.9 68 68 59 60 63 66 74 79 79 31 31 [1457.8] 2577 QADLHLDDAVR 8 73 626.8183 2 29.903 1.2 54 44 45 87 96 96 96 90 71 77 39 [314.1]LHLDD[326.2] 2578 GTYDDYVEGLR 9.7 88 644.2968 2 29.913 0.9 68 78 91 97 97 97 98 96 89 93 61 [158.1]YDDYVEGL[156.1] 2579 KLDLVDQLQLK 9.6 88 656.8962 2 29.923 1.4 88 87 95 95 97 95 80 88 77 88 68 KLDLVDQL[128.1]L[128.1] 2581 FESKY(+79.97)KVAKWR 6.5 60 507.9267 3 29.956 2.6 45 36 36 40 46 49 64 93 89 86 64 [961.4]AKW[156.1] 2582 QLLGTLEEMR 8.5 85 595.3157 2 29.967 0.2 49 51 93 94 93 95 97 93 95 81 [241.1]LGTLEEMR 2583 CKNSLY(+79.97)RNNYAYRNK 9 60 662.9712 3 29.976 0.6 51 50 54 61 72 50 49 48 83 86 66 62 60 48 55 [1058.4]NY[632.3] 2584 RHNPKVAGDPR 6.9 63 416.2294 3 29.988 2.1 32 56 43 57 66 86 90 85 72 68 31 [632.4]VAG[368.2] 2585 NFYNRFDLGEKLDNLRK 10.5 62 714.7095 3 29.999 2.5 58 58 47 53 44 43 44 55 88 90 91 90 83 62 47 52 39 [1069.5]GEKLD[511.3] 2587 SLSTELFK 6.2 77 462.7559 2 30.034 1 31 96 95 91 87 87 95 31 [87.0]LSTELF[128.1] 2588 KAGMEEAMLKATLEK 10.8 72 550.6255 3 30.042 1.1 59 58 59 59 66 86 83 90 90 91 88 72 68 69 31 [516.2]EAMLKA[471.3] 2593 LLTEGNEFGR 7.3 73 568.2912 2 30.107 0.9 95 96 96 92 63 58 69 92 31 31 LLTE[300.1]F[213.1] 2594 VMS(+79.97)WLKPLGKGLHRR 8.8 59 620.0074 3 30.117 2.4 67 67 67 45 64 42 48 62 83 87 67 61 49 31 31 [1034.5]GK[619.4] 2595 YVAWRMPVSK 7.9 79 618.83 2 30.128 2.4 90 92 92 95 86 78 94 98 31 31 YVAWR[131.0]PV[215.1] 2597 MVSLLQEK 6.5 81 474.2651 2 30.149 0 97 97 97 31 91 73 83 71 MVS[113.1]L[128.1]E[128.1] 2599 KNYMKYLVSQLTR 7.6 59 548.6372 3 30.182 2 32 39 37 37 35 34 31 96 94 80 86 87 67 [940.5]VSQLT[156.1] 2600 LLYASLYWFK 6 60 435.242 3 30.192 2.3 43 45 40 45 50 90 76 56 70 81 [547.3]L[496.2]K 2602 FSLMNMPLSK 8.1 81 584.2983 2 30.214 0.5 94 94 90 80 71 88 92 92 31 70 FSLM[114.0]MPL[215.1] 2603 YVLDLVDAGLKMK 9.4 72 732.9104 2 30.224 0.4 31 31 90 90 91 98 96 92 84 67 64 63 31 [262.1]LDLVDAG[500.3] 2605 QLDLVSGVLGLAK 9.2 71 438.2657 3 30.258 0.6 52 45 45 58 93 92 89 89 88 87 72 73 31 [469.3]VSGVLG[312.2] 2606 TDSLPFTWVMGAELR 8.7 58 574.954 3 30.267 2.7 44 47 46 47 31 39 39 31 97 96 86 71 63 69 56 [947.4]VMG[469.3]

PAGE 344

344 2608 WRWKRPYYNCAETPK 8.4 56 666.6652 3 30.289 0.4 31 31 36 41 42 85 62 64 53 68 69 79 71 71 31 [812.5]P[1069.5] 2609 LQEAEEQLEAVNSK 12.2 87 794.3965 2 30.3 0.2 74 69 95 97 98 95 85 95 97 96 95 77 89 50 [241.1]EAEEQLEAV[114.0]S[128.1] 2611 MNSQTVSSQFR 9.2 84 642.804 2 30.335 0.5 64 59 67 75 94 95 97 94 93 97 82 [460.2]TVSSQFR 2612 RRWLLCSPWK 5.7 57 448.9171 3 30.345 0.6 31 32 31 32 54 81 88 89 92 31 [724.4]CSPW[128.1] 2613 WRMKEAYDANK 7.9 72 471.2311 3 30.355 0.2 32 32 49 53 89 96 93 92 92 85 75 [601.3]EAYDAN[128.1] 2615 YKMLDYVAPLLLRGK 10.5 70 890.5156 2 30.377 2.7 51 64 61 91 90 77 65 72 93 98 93 71 42 42 32 [422.2]LD[333.2]PLL[454.3] 2618 LLSLNSADMLK 9 82 602.8336 2 30.42 0.5 96 95 95 96 89 83 79 79 70 70 43 LLSLNS[558.3] 2619 NKHYKAELEELR 8.4 70 510.6083 3 30.43 2.1 41 41 49 48 68 90 94 96 31 94 96 83 [670.4]AEL[129.0]ELR 2620 LLGLNSADMLK 8.7 79 587.8282 2 30.441 0.7 96 94 96 95 89 84 68 64 64 66 45 LLGLNS[558.3] 2621 MELDDLSSGGMEAVSK 13.6 85 834.8759 2 30.452 0.6 86 85 93 97 97 97 97 92 86 83 90 87 77 73 77 31 MELDDLSSGGME[385.2] 2624 VLDSMQATLDSEVR 12.5 89 782.3877 2 30.496 0.1 75 80 90 93 95 90 97 97 97 97 92 80 81 79 [99.1]LDSMQATLDSEV[156.1] 2625 LVLSTLGEK 5.7 64 480.2922 2 30.507 0.1 31 31 96 95 91 77 55 56 38 [212.2]LST[427.2] 2626 RRRRDVYKFKTALASPGFR 10.6 56 581.8359 4 30.516 0.3 31 31 31 47 45 47 41 35 42 52 86 91 93 91 81 61 56 54 31 [1404.8]TALAS[457.2] 2627 HSEEKELAVSKLEK 10 71 813.9377 2 30.527 0.9 32 34 38 53 88 95 86 85 95 95 89 84 86 31 [482.2]KELAVSKLE[128.1] 2629 RLCHPKNTSLASKR 7.8 56 537.6345 3 30.562 1.2 56 56 75 38 42 43 62 87 92 59 41 39 46 37 [848.4]TS[555.3] 2630 WCSKVLADVSK 7.8 71 412.5527 3 30.572 1.3 54 55 55 65 79 85 79 85 96 97 31 [603.3]L[71.0]DVS[128.1] 2631 LLPVLYPPVNDEVALKK 10.8 64 636.7123 3 30.58 1.1 31 43 43 87 76 73 82 76 76 69 77 79 74 57 51 48 31 [323.2]V[276.1]P[1093.6] 2632 KMLGY(+79.97)LTCSLPQR 7.6 58 530.5918 3 30.591 1.8 42 43 41 42 51 55 55 85 94 71 58 58 57 [886.4]CS[494.3] 2635 DRRHNNDGLR 6.3 63 418.2144 3 30.636 2.5 32 32 31 72 67 91 94 75 88 46 [678.3]ND[57.0]L[156.1] 2636 NHLT(+79.97)TERTCASNALVR 9.1 57 622.6284 3 30.646 1 62 50 50 47 62 36 39 43 77 79 81 69 69 55 50 31 [1206.5]S[553.3] 2637 LVNASVLPDGQFLDNK 11.4 71 865.4598 2 30.656 0.3 54 54 53 90 93 96 97 87 73 59 49 55 90 79 74 31 [326.2]ASVLP[447.2]L[357.2] 2639 LAFYYVEDKLSELK 9.1 65 573.3057 3 30.679 1.2 34 34 36 49 61 51 93 80 80 88 91 87 93 31 [756.4]EDKLSEL[128.1] 2641 VQLELNQLK 6.8 75 542.822 2 30.714 0.8 61 56 90 81 80 77 78 88 64 [227.1]LEL[242.1]L[128.1] 2642 YRFLS(+79.97)GKNKKR 6.2 56 492.9319 3 30.724 1.5 32 32 31 49 65 85 77 64 73 71 31 [746.3]G[654.4] 2643 QLDLVDQLKLK 8.4 76 656.8956 2 30.734 0.5 69 78 92 95 98 95 64 77 64 67 31 [241.1]DLVD[610.4] 2644 GTYDDYVEGLR 9.6 87 644.2961 2 30.744 0.2 66 76 90 96 97 98 98 96 88 93 58 [158.1]YDDYVEGL[156.1] 2647 REQLM(+15.99)CGKAQSVR 7.2 55 507.9269 3 30.789 2.5 38 49 37 42 46 65 65 66 93 55 63 64 31 [961.4]A[470.3] 2648 QLLGTLEEMR 8.7 87 595.316 2 30.799 0.2 55 59 95 96 96 97 98 94 96 81 [241.1]LGTLEEMR 2650 MMLKQVQAAAR 6.9 62 416.2296 3 30.819 1 46 51 50 44 42 82 83 86 86 78 31 [631.3]VQAA[227.1] 2651 FPGEGAGAVEELRK 10.3 73 730.3802 2 30.831 0.5 31 42 48 59 81 85 95 96 96 97 93 73 74 49 [430.2]GAGAVEE[397.3] 2653 SLSTELFK 6 75 462.7553 2 30.864 0.3 31 96 95 88 80 80 93 31 [87.0]LSTELF[128.1]

PAGE 345

345 2655 RRTWAMMAEELKK 9.2 71 550.6246 3 30.885 1.1 31 54 58 58 89 96 97 95 94 71 70 73 31 [599.3]AMMAE[498.3] 2656 DM(+15.99)LRM(+15.99)LAAELEQTR 7.9 57 570.2841 3 30.896 1.2 43 42 43 36 39 42 51 95 94 86 81 43 52 38 [862.4]AELE[385.2] 2657 AANY(+79.97)RSTLVAMKR 7.9 61 520.9277 3 30.907 2 82 81 63 51 47 43 55 84 67 60 55 55 41 AA[701.3]L[585.3] 2659 LLTEEGNFGR 7.5 75 568.2908 2 30.941 0.1 93 96 96 97 57 53 48 87 87 31 LLTE[300.1]FG[156.1] 2660 LVNAWLPLANQGFTWK 9.3 58 620.0073 3 30.949 3.5 81 80 54 58 82 81 54 45 47 59 56 62 57 49 31 31 LV[185.1]WL[1142.6] 2661 NFDARLWVSK 8.5 85 618.33 2 30.959 0.2 73 78 94 94 95 97 89 98 98 31 [261.1]DARLWVS[128.1] 2662 MVSLLQEK 6.5 81 474.2653 2 30.97 0.4 98 98 98 31 92 75 81 73 MVS[113.1]L[128.1]E[128.1] 2665 RMLFLYWFK 5.6 62 435.24 3 31.013 2.7 33 33 32 41 91 87 68 83 89 [547.3]LY[186.1]FK 2666 YT(+79.97)KKRALVSQLTR 7.2 56 548.6389 3 31.023 1.8 31 35 35 35 37 46 68 85 84 71 68 69 53 [940.5]VS[498.3] 2667 RKRLQLSS(+79.97)SRET(+79.97)AYNR 9.1 57 532.0085 4 31.034 2.9 33 33 34 35 37 52 58 71 74 73 77 74 87 53 64 44 [1601.8]A[433.2] 2668 DFETLSQLSK 7.4 74 584.2997 2 31.045 2.6 31 31 96 95 71 70 69 94 95 80 [262.1]ET[328.2]LSK 2669 ELYKLELT(+79.97)DAKLDNLRK 10.5 61 714.7127 3 31.055 1.5 32 32 31 43 43 56 35 65 58 82 91 93 93 85 69 73 53 [1184.5]AKLDN[397.3] 2671 KLDLVSGVVSAPK 8.6 66 438.2657 3 31.089 0.7 41 40 43 51 93 89 81 78 75 83 72 76 31 [469.3]VSG[198.1]S[296.2] 2672 LM(+15.99)YHNMKLMGAELR 8.7 62 574.9536 3 31.099 1.5 32 32 37 65 51 47 49 66 94 88 83 76 77 63 [1046.5]MGA[398.2] 2673 VEWAKT(+79.97)LAKGSVCAETPK 11.2 62 666.6645 3 31.11 1.2 58 52 51 45 39 39 48 64 64 80 77 75 72 79 87 76 75 31 [1106.6]G[360.1]E[326.2] 2675 LQEAEEQLEAVNSK 12.2 87 794.3958 2 31.132 1.2 74 69 95 98 98 94 78 93 96 97 96 80 91 53 [241.1]EAEE[128.1]LEAVNS[128.1] 2677 NSMQTVSSQFR 8.8 80 642.8027 2 31.166 1.5 55 54 55 60 89 95 97 94 92 97 84 [460.2]TVSSQFR 2679 LLFYYRKPYLLYK 8.1 62 890.5156 2 31.187 2.5 31 31 31 59 83 52 56 83 85 92 89 78 31 [536.3]Y[284.2]PYLL[291.2] 2680 MFAYPANK 6.7 84 471.2307 2 31.198 0.8 90 90 90 31 97 95 90 80 MFA[163.1]PANK 2683 MPQLVDKSTALK 7.8 65 444.2512 3 31.243 0.7 86 64 53 56 58 84 82 76 59 57 64 31 M[437.3]DK[500.3] 2684 LLSLNASDMLK 8.8 80 602.8334 2 31.253 0.9 95 93 93 95 89 92 92 73 58 59 39 LLSLNAS[487.2] 2685 RLFELEANGEVPR 8.5 66 510.6081 3 31.263 1.7 32 51 46 71 84 90 87 73 80 67 68 69 31 [545.3]LEA[114.0]G[481.3] 2686 MELDDLSSNMEAVSK 12.5 83 834.8752 2 31.273 1.5 77 75 87 96 98 97 97 88 80 88 92 79 74 79 31 [260.1]LDDLSSNME[385.2] 2689 WPAEDAHKVRYK 7.6 63 500.5966 3 31.316 0.1 31 31 61 61 73 65 61 71 89 84 63 59 [934.4]VR[291.2] 2690 LVDSMQATLDSEVR 12.8 91 782.3876 2 31.325 0.2 69 78 91 94 94 90 98 98 98 97 94 89 90 89 [212.2]DSMQATLDSEVR 2691 LVLSTLGEK 6 67 480.2923 2 31.336 0.2 31 31 96 93 92 88 63 63 38 [212.2]LSTL[314.2] 2693 LLGLNSADMLK 8.6 78 587.829 2 31.357 0.5 95 93 95 95 90 85 71 67 59 63 42 LLGLNS[558.3] 2695 RVVSHRNTSLGTQR 8.6 61 537.6332 3 31.39 1.1 31 68 68 68 44 74 54 88 93 78 45 43 55 45 [848.5]TS[555.3] 2696 NFGWVLADVSK 8.5 77 412.5518 3 31.4 0.7 68 76 64 31 96 96 94 94 97 97 31 [504.2]VLADVS[128.1] 2698 DHTEKELAVSKLEK 10.2 73 813.9377 2 31.421 0.9 32 32 47 73 82 95 85 84 95 94 89 87 89 31 [482.2]KELAVSKLE[128.1] 2699 WY(+79.97)KDKTGDGRKR 6.8 57 530.5906 3 31.433 0.6 31 73 54 45 79 54 50 55 86 67 48 33 [1073.4]G[440.3]

PAGE 346

346 2701 RRDHNNDAVR 6.6 66 418.2143 3 31.468 2.3 31 32 63 63 86 88 86 74 78 49 [564.3]NND[326.2] 2702 NSYERWYHEANLQR 9 64 622.629 3 31.477 2.6 89 95 96 94 51 36 36 37 51 82 69 57 58 44 NSYE[771.3]A[511.3] 2703 LVNASVLPDAALAM(+15.99)SNK 12.2 72 865.4601 2 31.488 1.3 45 45 45 85 95 98 99 95 88 86 88 85 57 51 51 56 45 [326.2]ASVLPDAAL[547.2] 2705 HHHWLKLYPPFPVLRQK 9.5 56 732.7476 3 31.51 2.6 31 31 31 34 34 33 94 85 93 82 81 81 78 43 35 35 36 [838.4]LYPPFP[624.4] 2707 VQLELNQLK 7 78 542.8211 2 31.545 0.9 63 59 87 93 89 82 73 87 62 [227.1]LELN[128.1]L[128.1] 2708 FTWRLVPDACLR 7.2 60 492.9312 3 31.553 0.8 31 34 34 49 53 84 94 89 77 69 68 31 [703.4]VPD[443.2] 2710 NLGMVALEEELR 9.4 79 687.3572 2 31.575 1.4 71 72 89 97 96 96 91 92 31 72 75 55 [227.1]GMVALE[527.3] 2713 QLLGTLEEMR 8.7 87 595.3156 2 31.617 0.4 58 62 94 97 96 97 97 93 95 80 [241.1]LGTLEEMR 2714 RHS(+79.97)KMKNAKWR 7.1 64 507.9265 3 31.626 2 37 37 34 39 56 80 89 93 89 86 62 [719.3]KNAKW[156.1] 2715 LDWMFLMWS(+79.97)LSHVNK 8.6 57 662.9708 3 31.636 1.4 32 32 36 46 42 44 37 35 53 93 93 90 77 79 58 [1289.5]LSH[341.2] 2717 TGYDDYVEGLR 9.7 88 644.296 2 31.656 0.3 68 79 91 97 97 97 98 96 90 93 61 [158.1]YDDYVEGL[156.1] 2719 SLSTELFK 6.3 79 462.7557 2 31.689 0.5 31 96 95 93 92 92 96 31 [87.0]LSTELF[128.1] 2720 RRLCAAMMAEELKK 9.9 71 550.6255 3 31.697 1.7 31 63 40 45 48 76 92 96 96 96 92 89 90 31 [670.4]MMAEELK[128.1] 2722 WKWYAKAELEGDGR 8.4 60 570.2851 3 31.72 2 47 35 36 37 37 67 93 95 93 87 67 61 48 31 [862.4]AELE[385.2] 2723 Y(+79.97)LARYKLKGEMAKKNK 9.5 59 674.362 3 31.731 2.5 35 41 36 40 46 38 67 87 76 76 86 87 71 56 56 41 [987.5]K[186.1]MA[498.3] 2725 LLTENGEFGR 7.1 71 568.2906 2 31.765 0.1 94 95 95 86 57 61 75 81 31 31 LLTE[300.1]F[213.1] 2726 Y(+79.97)LKVLWAVYVLPWK 8.3 60 620.0068 3 31.774 0.3 31 34 35 44 56 56 57 88 81 79 88 64 65 49 [953.5]VY[99.1]L[411.2] 2727 NFAWLRATEK 8.2 82 618.33 2 31.784 0.2 87 94 98 98 97 83 90 74 67 31 NFAWLRA[358.2] 2728 MVSLLQEK 5.6 70 474.2645 2 31.796 1.4 97 97 97 31 79 48 60 43 MVS[611.4] 2731 FTVVTLYWFK 7.6 76 435.24 3 31.838 2.3 72 72 72 59 68 94 92 66 82 81 [547.3]LY[186.1]FK 2732 CRFQHRLVSQLTR 8.1 63 548.6373 3 31.849 3.9 53 36 40 40 39 53 55 89 93 78 84 84 65 [940.5]VS[128.1]LT[156.1] 2735 DFETLSQLSK 7.3 73 584.2982 2 31.878 0.1 31 31 97 95 79 77 67 88 92 71 [262.1]ET[328.2]LS[128.1] 2737 QLDLVSGVLQLK 7.3 61 438.2658 3 31.912 0.3 53 45 43 34 96 91 86 78 51 42 62 48 [469.3]VSG[581.4] 2738 MDMKRLTGNMGAELR 10 67 574.954 3 31.922 1.6 32 58 58 44 40 58 59 58 69 94 89 86 87 88 72 [1046.5]MGAEL[156.1] 2740 VMHHYKNNLVNCGMLPK 10.5 62 666.6656 3 31.944 2.4 31 82 82 47 48 47 53 84 80 62 56 58 87 72 60 63 31 [99.1]MH[542.3]NL[316.1]G[469.3] 2741 KLDLVDQLQLK 9 82 656.8945 2 31.955 1.3 85 85 94 94 96 94 71 71 63 81 60 KLDLVD[369.2]L[128.1] 2743 LLPVLYPDGLLLYYK 9.1 61 890.5157 2 31.988 3 31 49 49 97 96 88 86 52 38 38 41 87 87 31 31 [323.2]VLYP[398.2]LY[291.2] 2744 NMSQTVSSQFR 9 82 642.8034 2 31.999 0.4 59 58 62 69 91 94 96 93 93 97 84 [460.2]TVSSQFR 2745 MFAYPANK 6.7 84 471.2307 2 32.009 0.9 91 91 91 31 97 95 90 79 MFA[163.1]PAN[128.1] 2746 MALLQLSGTPWK 7.2 60 448.9166 3 32.02 0.7 53 54 62 59 53 53 54 61 78 68 68 55 [1325.7] 2747 QLEAEEQLEAVNSK 12.1 86 794.3961 2 32.03 0.7 67 71 92 94 97 94 82 94 95 96 96 80 91 52 [241.1]EAEEQLEAVNS[128.1]

PAGE 347

347 2749 LDQLVDKLQMK 6.3 57 444.2514 3 32.064 0.1 87 54 52 63 64 88 63 35 35 35 46 L[455.2]D[628.4] 2750 WSRQLAELEELR 8.5 71 510.6083 3 32.074 2.2 31 58 57 52 63 87 95 97 31 93 95 81 [670.4]AEL[129.0]ELR 2751 MELDDLSNSMEAVSK 12.4 82 834.8761 2 32.084 0.4 77 77 92 97 98 97 96 67 69 80 93 88 83 86 31 [260.1]LDDLS[201.1]MEAVS[128.1] 2752 LLSLNSADMLK 9 82 602.8336 2 32.095 0.5 96 96 96 96 92 94 91 77 62 60 39 LLSLNSA[487.2] 2753 KMNWATGAVLR 6.4 58 416.2295 3 32.105 1 46 40 41 38 51 75 79 74 73 85 31 [958.5]L[156.1] 2755 LKMPEVCAGSLSHK 8.3 60 500.5962 3 32.139 2.1 76 39 39 47 88 76 80 86 65 62 76 31 31 31 [469.3]E[99.1]CA[609.3] 2756 LVDSMQATLDSEVR 12.7 91 782.3868 2 32.149 1.2 70 77 91 94 94 89 97 97 97 97 94 89 89 88 [212.2]DSMQATLDSEVR 2757 LVLSTLGEK 6.6 74 480.2922 2 32.16 0.1 31 31 96 92 90 90 85 86 58 [212.2]LSTLGE[128.1] 2759 LLGLNSADMLK 9 82 587.8287 2 32.181 0.1 96 94 95 95 91 81 77 76 71 71 45 LLGLNS[558.3] 2761 NM(+15.99)SRVLADVSK 8.4 76 412.5519 3 32.215 0 54 54 75 81 81 85 86 94 96 96 31 [348.1]RVLADVS[128.1] 2762 RRT(+79.97)LKNTSLTGKR 7.3 56 537.6334 3 32.223 0.5 31 67 46 44 45 65 86 94 75 41 41 55 31 [848.4]TS[555.3] 2767 RRDHNNDAVR 6.7 67 418.2141 3 32.288 2 31 32 61 61 85 90 88 80 82 53 [564.3]NNDAV[156.1] 2769 LVNASVLPDAALANSM(+15.99)K 12.3 73 865.4597 2 32.309 1.8 44 44 44 76 92 97 98 92 87 85 88 95 82 61 47 62 31 [397.2]SVLPDAALA[476.2] 2770 HHGVDPPVELYTPPLLKRK 12.6 66 732.7477 3 32.32 0.1 83 85 80 63 52 47 70 68 54 86 77 84 78 84 87 49 35 36 32 HHG[636.3]L[163.1]T[97.1]PL[525.4] 2771 EESHKELAVSKLEK 10.4 74 813.9385 2 32.331 0.1 53 52 45 65 91 94 82 80 92 95 87 79 82 31 [482.2]KELAVSK[113.1]E[128.1] 2773 VKLLFSSYK 6.1 67 542.8233 2 32.366 0.7 70 77 90 97 75 75 56 31 31 [227.2]LL[612.3] 2775 FRCREVAAGSPKR 7.2 55 492.9333 3 32.384 0.2 31 31 37 46 69 75 84 79 69 50 49 49 40 [790.4]A[596.3] 2776 NVAMVAELEELR 9.6 80 687.36 2 32.395 2.6 61 65 77 96 97 97 96 97 31 84 86 66 [284.1]MVAEL[129.0]EL[156.1] 2779 QLLGTLEEMR 8.8 88 595.3159 2 32.44 0 57 62 95 98 97 97 98 94 96 82 [241.1]LGTLEEMR 2780 AEFLKMNQAQWR 7.7 65 507.9265 3 32.45 1.3 31 75 43 40 49 55 73 72 93 78 87 73 [961.5]A[128.1]W[156.1] 2782 MWDLY(+79.97)AAKCQLSHVNK 9.5 59 662.9717 3 32.468 2.1 42 43 48 61 38 37 45 52 88 53 72 87 80 70 72 55 [1058.4]C[241.1]SH[341.2] 2783 GTYDDYVEGLR 9.6 87 644.2962 2 32.479 0 64 75 89 96 97 98 97 96 89 93 58 [158.1]YDDYVEGL[156.1] 2785 SLSTELFK 6.1 76 462.756 2 32.512 1.1 31 96 95 91 86 84 92 31 [87.0]LSTELF[128.1] 2787 WWRAAMSDKKDKK 9.3 72 550.6253 3 32.532 2 31 31 44 56 88 91 96 87 81 79 79 89 72 [599.3]AMSDK[243.1]K[128.1] 2789 VDFATYMKNGRTLDNLRK 10.1 56 714.711 3 32.555 2.9 32 40 39 53 51 55 52 43 59 68 52 58 89 87 64 51 58 43 [1383.7]LD[511.3] 2791 LLTENGEFGR 7.2 72 568.2903 2 32.59 0.6 95 96 95 89 58 62 76 84 31 31 LLTE[300.1]F[213.1] 2792 LHFKLKGLDGM(+15.99)TAPWK 9.1 57 620.0067 3 32.598 0.7 31 31 48 47 62 58 38 38 39 80 84 86 86 63 61 48 [1051.6]GM(+15.99)TA[411.2] 2793 KFTAGVAMPASR 9.7 81 618.33 2 32.609 3 54 61 70 91 94 93 93 94 95 95 96 31 [376.2]AGVAMPAS[156.1] 2794 MVVVDKEK 6.5 81 474.2647 2 32.62 0.8 98 98 92 69 69 69 85 66 MVV[342.2]E[128.1] 2795 RHHQGAVEELQR 9.5 79 730.3792 2 32.63 0 49 49 79 85 94 94 96 97 95 74 76 56 [430.2]QGAVEE[397.2] 2797 RWWGELLVSQLTR 8.3 64 548.6375 3 32.664 2.2 37 37 39 45 53 58 80 92 93 74 76 77 59 [827.4]LVS[498.3]

PAGE 348

348 2798 KPKHGLYADFK 6.1 56 435.2422 3 32.675 2.7 31 32 32 40 58 92 94 83 82 31 31 [547.3]LYAD[275.2] 2799 NYVTQTHEVAYNR 8.1 62 532.2574 3 32.685 2.1 64 63 36 36 37 63 72 95 93 82 65 62 31 [843.4]EVA[433.2] 2800 DM(+15.99)ETKSLLSK 7.8 78 584.2983 2 32.697 2.6 31 97 97 94 62 57 65 94 95 78 [115.0]M(+15.99)ET[328.2]LS[128.1] 2803 LKDLVSLAASPAK 8.9 68 438.2659 3 32.739 0.2 86 60 60 83 31 93 91 88 59 59 69 71 31 L[243.1]L[99.1]SLA[454.3] 2804 Y(+79.97)YRRKTVMGAELR 8.9 69 574.954 3 32.749 1.9 34 31 31 46 59 78 91 97 90 88 86 86 67 [947.4]VMGAEL[156.1] 2806 QVNRWPQNLVNCGMLPK 10.1 59 666.3458 3 32.771 1.1 38 36 41 42 40 46 48 82 85 80 62 66 84 82 69 71 31 [908.5]NLV[217.1]GM[338.2] 2807 HHRGPVARLR 5.5 55 400.2398 3 32.783 1.7 31 55 53 50 59 85 69 59 53 31 [584.3]V[496.3] 2809 LLPVLYPVPTTLYYK 9.3 62 890.5171 2 32.816 1.4 31 47 47 96 96 97 98 31 44 44 50 89 92 31 31 [323.2]VLYP[398.2]LY[291.2] 2810 M(+15.99)ANQTVSSQFR 8.9 81 642.8038 2 32.827 0.2 50 50 49 77 94 95 96 94 94 97 87 [460.2]TVSSQFR 2812 RWREEQAAMVER 7.4 62 520.9285 3 32.848 0.6 49 32 32 45 43 56 86 94 88 70 71 69 [884.4]AAM[384.2] 2813 SPFPKLSGTPWK 8.4 70 448.9174 3 32.859 5.1 92 91 91 84 66 52 50 52 60 68 70 56 SPFP[897.5] 2815 MPKLVDTNTALK 7.4 61 444.2517 3 32.893 0.4 38 39 42 59 87 91 79 74 63 62 66 31 [469.3]VD[628.4] 2816 FPRRLAELEELR 7.9 66 510.2907 3 32.902 1.1 31 32 32 49 61 87 94 96 31 95 97 84 [669.4]AEL[129.0]ELR 2817 LLSLNSADMLK 9.2 83 602.8344 2 32.912 0.7 96 95 95 96 92 91 86 78 69 69 45 LLSLNSA[487.2] 2818 MELDDLSSNMEAVSK 13.1 87 834.877 2 32.922 0.7 81 81 91 97 97 96 97 94 87 92 93 90 85 88 31 MELDDLSSNMEAVS[128.1] 2819 CHYKM(+15.99)LAAELEGSLK 8.9 59 570.2852 3 32.933 1 31 59 45 42 34 38 38 96 95 94 90 78 57 54 31 [862.4]AELE[385.2] 2824 LVLSTLGEK 5.9 65 480.292 2 32.996 0.4 31 31 97 95 92 83 57 58 38 [212.2]LSTL[314.2] 2827 VVAM(+15.99)RYLTSLLNSK 9 64 537.6344 3 33.04 3 78 47 38 40 39 47 60 89 94 92 84 63 79 46 [848.5]TSLL[329.2] 2828 NM(+15.99)SRVLADVSK 8.9 81 412.5525 3 33.049 1.4 70 78 81 75 81 91 92 92 95 95 31 [261.1]S[156.1]VLADVS[128.1] 2830 DEQFRMKVRYK 7 64 500.597 3 33.071 1.5 62 62 54 57 51 56 59 89 85 63 61 [934.4]VR[291.2] 2831 LVDSMQATLDSEVR 12.7 90 782.3886 2 33.082 1.1 67 75 90 94 94 90 98 97 97 97 95 89 89 89 [212.2]DSMQATLDSEVR 2833 NRWWPVLYPTEPVLLGKK 11.2 62 732.7473 3 33.115 2.4 41 38 36 53 48 60 83 95 94 86 80 83 87 61 44 43 48 31 [838.4]LYPTEPV[539.4] 2835 YY(+79.97)KTKLRS(+79.97)AEYKR 7.2 55 622.6285 3 33.138 0 32 74 57 53 54 51 69 66 72 62 47 35 39 [1846.9] 2836 SVKYSNNDAVR 8.2 75 418.2141 3 33.149 0.1 31 74 74 76 78 87 89 90 81 83 55 [564.3]NNDAV[156.1] 2837 FLHSVLWAPLCSQTK 8.7 58 865.4594 2 33.159 1.3 31 31 31 31 31 97 83 74 73 89 63 63 49 70 42 [583.3]LW[168.1]L[547.2] 2839 VQLELNQLK 6.7 75 542.822 2 33.193 0.7 64 59 88 74 72 80 78 89 65 [227.1]L[242.1]N[128.1]L[128.1] 2842 QVGMVAELEELR 9.7 80 687.3585 2 33.221 0.4 55 61 87 97 97 97 96 97 31 85 89 67 [227.1]GMVAEL[129.0]EL[156.1] 2843 LLGLNSADMLK 8.6 78 587.8286 2 33.231 0.2 91 88 84 84 86 87 82 78 65 65 42 LLGLNSA[487.2] 2846 QLLGTLEEMR 8.7 87 595.3159 2 33.272 0 54 58 95 98 97 97 98 93 95 80 [241.1]LGTLEEMR 2847 SMGPVTFKNAQWR 8.3 64 507.9268 3 33.28 1.8 40 40 55 54 45 41 47 73 77 93 86 91 83 [961.5]AQWR 2851 SLSTELFK 6.3 78 462.7557 2 33.33 0.5 31 94 93 92 91 92 97 31 [87.0]LSTELF[128.1]

PAGE 349

349 2853 FQLTRAMMASHTKK 8.9 64 550.6249 3 33.347 0.8 71 70 56 50 50 73 91 95 89 65 51 49 46 31 [716.4]MMA[581.3] 2855 EREFQATLDSMPR 9.2 71 790.3792 2 33.37 1.5 48 48 39 75 74 81 82 95 94 86 79 79 31 [689.3]ATLDS[384.2] 2857 LLTEGNEFGR 6.9 69 568.2911 2 33.404 0.6 93 96 96 90 51 48 54 91 31 31 LLTE[300.1]F[213.1] 2858 LVNAWLWAVFDLPWK 9 60 620.0076 3 33.412 1.7 45 45 45 61 58 62 47 61 81 64 65 85 65 64 47 [953.5]V[262.1]L[411.2] 2859 NFAWLVGATTR 9.4 85 618.33 2 33.423 0.2 76 81 96 98 97 93 91 90 91 87 31 [114.0]FAWLVGATT[156.1] 2863 VMLLY(+79.97)KLVSQLTR 9.3 71 548.6373 3 33.475 1.2 64 64 84 67 50 49 56 94 92 76 81 82 64 [230.1]L[597.3]VS[128.1]LT[156.1] 2864 LLHALLYGEM(+15.99)K 6.2 57 435.2421 3 33.485 2.9 44 42 35 35 48 93 93 83 81 31 31 [547.3]LYGE[275.1] 2866 MCDVAET(+79.97)LEAVNSK 10.7 76 795.3351 2 33.505 2.8 44 56 63 90 93 95 91 80 79 94 92 64 80 41 [349.1]VAET(+79.97)L[129.0]AV[114.0]S[128.1] 2869 QLDLVSGVLQLK 7.4 62 438.2657 3 33.547 0.7 46 44 43 39 96 92 90 88 70 45 46 35 [469.3]VSGV[482.3] 2870 WWWLFEVMGAELR 9.3 71 574.9537 3 33.557 0.2 31 31 46 64 56 84 91 95 91 89 88 88 71 [818.4]EVMGAEL[156.1] 2875 LLPVLYPPVTTLYYK 10.2 68 890.5163 2 33.617 2.3 31 55 55 97 97 98 98 99 51 51 60 78 84 31 31 [323.2]VLYPP[414.2]Y[291.2] 2877 FVPDSQSYLVR 7.2 65 655.8422 2 33.64 2.5 73 73 73 87 77 65 75 77 53 31 31 [343.2]D[833.4] 2878 GTYDDYVEGLR 9 82 644.2965 2 33.65 0.5 70 75 87 95 96 97 97 91 66 82 36 [158.1]YDDYVE[57.0]L[156.1] 2881 YNQLQDVLPLK 6.7 61 444.251 3 33.694 1.5 51 58 54 65 55 87 91 78 45 45 31 [646.3]DV[451.3] 2882 LFVLRTTKTLR 7.6 69 674.4256 2 33.704 2.4 31 31 92 91 89 86 79 62 60 76 54 [260.2]VLRT[599.4] 2883 ALFRRLEY(+79.97)LSLTR 7.6 59 573.3107 3 33.716 1.6 43 42 55 42 62 67 92 70 91 62 51 45 33 [756.5]E[243.0]L[457.3] 2885 KWWAVAELEELR 8.3 69 510.6081 3 33.736 0.8 32 32 41 66 70 90 95 97 31 93 96 82 [670.4]AEL[129.0]ELR 2890 LVLSTLGEK 6.3 70 480.2925 2 33.799 0.7 31 31 96 91 87 83 76 77 50 [212.2]LSTL[314.2] 2891 Y(+79.97)NETRFAQLLLK 7.5 62 788.4032 2 33.808 3.9 88 60 60 65 85 66 69 49 60 75 31 31 Y(+79.97)[344.1]R[813.5] 2894 VT(+79.97)VVLTRTSLLNSK 9.2 66 537.6339 3 33.854 0.3 31 31 31 81 69 63 67 91 94 93 82 59 76 43 [379.2]V[370.2]TSLL[329.2] 2895 NM(+15.99)SRVLADVSK 8.3 76 412.552 3 33.865 0.1 52 52 63 80 79 90 92 95 97 97 31 [348.1]R[99.1]LADVS[128.1] 2897 LVDSMQATLDSEVR 12.7 91 782.3876 2 33.886 0.2 73 78 92 91 91 87 97 97 97 97 94 89 89 88 [212.2]DSMQATLDSEVR 2900 WKPLWKLELPVYGLYYK 9.5 56 732.7479 3 33.931 1.6 42 35 34 36 38 45 47 93 95 84 77 69 56 55 70 31 31 [951.6]ELP[886.5] 2902 RDTYRNEVRYK 6.5 59 500.5957 3 33.954 0.9 48 50 57 58 42 41 60 81 84 63 63 [934.4]VR[291.2] 2903 SPTDAAMMRVSDLK 10.4 74 761.3757 2 33.964 2.7 64 66 62 67 73 96 97 95 80 80 73 63 71 44 [471.2]AMMRV[443.2] 2906 VQLELNQLK 6.8 76 542.8218 2 34.004 0.3 64 60 87 87 86 83 67 86 58 [227.1]LELN[128.1]L[128.1] 2907 FGERSAAKGDSK 7.5 63 418.2142 3 34.014 0.1 31 91 87 54 42 41 63 76 80 76 77 31 [147.1]GE[513.3]G[330.2] 2913 QLLGTLEEMR 8.7 87 595.3156 2 34.078 0.4 53 56 95 97 97 97 98 94 96 82 [241.1]LGTLEEMR 2914 RRRGFQGCAEWR 8.3 69 507.9261 3 34.087 2.2 31 34 48 69 89 84 69 67 88 88 91 67 [525.3]FQ[160.0]AEW[156.1] 2917 GKDNNSR 4 58 790.3797 1 34.129 0.6 31 86 84 51 51 47 51 [57.0]KD[471.2] 2918 LSSTELFK 5.5 68 462.7554 2 34.139 0.2 31 31 93 88 86 88 94 31 [200.1]STELF[128.1]

PAGE 350

350 2919 QVGMVAELEELR 9.2 77 687.3578 2 34.148 0.5 47 51 82 95 97 95 88 88 31 86 88 68 [227.1]GMVAEL[129.0]EL[156.1] 2920 VLNASVLPDANFLDNK 11.9 75 865.459 2 34.158 0.6 52 51 51 63 86 95 98 90 85 78 79 90 86 78 72 31 [397.2]SVLPD[185.1]FL[357.2] 2921 RRTDAAMMANSGLKK 9.6 64 550.6248 3 34.169 1.6 31 74 42 48 54 60 66 93 93 75 58 59 81 92 31 [801.4]MA[258.1]LK[128.1] 2925 LLTENGEFGR 6.9 69 568.2906 2 34.22 0.2 94 96 96 86 51 52 62 84 31 31 LLTE[300.1]F[213.1] 2927 NFWALDRVSK 7.3 73 618.33 2 34.24 0.2 51 50 82 95 95 94 94 98 31 31 [261.1]WALDRV[215.1] 2930 CMDVAET(+79.97)LEAVNSK 10.3 73 795.3352 2 34.283 2.8 35 33 64 88 87 95 93 79 80 95 93 61 79 38 [349.1]VAET(+79.97)[113.1]EAV[329.2] 2931 RANKCPSALVSQLTR 9.3 62 548.6378 3 34.295 1.2 36 38 40 45 52 59 46 45 64 91 93 82 84 85 61 [940.5]VSQLT[156.1] 2932 KKKYLDSFM(+15.99)K 5.9 59 435.242 3 34.306 2.9 31 31 31 76 75 76 73 72 31 87 [1156.6]K 2933 LLSLNSADMLK 8.3 76 602.8345 2 34.317 1 95 95 95 96 91 89 54 47 59 61 43 LLSLNS[558.3] 2935 QLDLVSGVVALAK 8 61 438.2658 3 34.349 0.3 50 44 45 80 87 77 74 77 63 60 49 54 31 [356.2]LV[725.4] 2936 DGDARTR 4.1 59 790.3796 1 34.36 0.8 54 65 67 75 60 56 31 [771.4] 2938 RMMSNLNTVMGAELR 9.1 60 574.954 3 34.377 1.6 41 45 43 52 50 46 45 51 88 96 87 76 64 65 51 [947.4]VMG[469.3] 2941 LLPVLYPTTVPLYYK 10.3 69 890.5163 2 34.423 2.3 31 55 55 97 97 98 84 63 60 57 89 87 89 31 31 [323.2]VLYP[301.2]PLY[291.2] 2943 SSFDDYVEGLR 8.8 80 644.2964 2 34.442 0.3 67 62 62 94 94 97 97 93 76 86 42 [321.1]DDYVE[57.0]L[156.1] 2945 MELDDLSSNMEAVSK 12.5 84 834.8762 2 34.463 0.3 76 74 87 96 98 97 98 96 86 92 90 75 71 77 31 [260.1]LDDLSSNME[385.2] 2947 QLDLVDKMQLK 7.2 65 444.2515 3 34.496 0.1 52 42 42 89 92 90 65 66 52 67 55 [356.2]LVD[628.4] 2948 WSRQLAELEELR 8.7 73 510.6086 3 34.507 2.6 31 69 68 53 58 87 96 97 31 95 97 84 [670.4]AEL[129.0]ELR 2950 LLGLNSADMLK 8.9 81 587.8286 2 34.529 0.1 96 94 96 96 92 91 81 67 62 66 44 LLGLNSA[487.2] 2951 QPQEQELAVSKLEK 10 72 813.9379 2 34.54 0.6 51 51 51 65 83 94 85 84 94 90 73 69 73 31 [482.2]QELAVS[498.3] 2953 LVLSTLGEK 6.6 73 480.2928 2 34.575 1.2 31 31 95 94 93 91 82 82 54 [212.2]LSTLGE[128.1] 2956 MTKWLEMECGGHSHVNK 10.7 63 662.9724 3 34.605 2.2 38 37 42 46 38 38 48 74 81 84 83 86 91 80 69 71 55 [1048.5]CGGHSH[341.2] 2957 YVESNDLLSK 8.8 88 584.299 2 34.616 1.4 94 94 89 75 70 92 92 94 94 78 YVE[201.1]DLLS[128.1] 2960 FNREGLADVSK 7.6 69 412.5518 3 34.662 2.5 53 44 38 38 82 92 91 94 97 97 31 [546.3]GLADVS[128.1] 2961 CALLLTYATSLLNSK 9.5 64 537.6336 3 34.672 2.5 49 49 62 68 34 36 45 64 89 94 93 81 61 76 45 [848.4]TSLL[329.2] 2962 LVDSMQATLDSEVR 12.6 90 782.3876 2 34.683 0.2 70 78 91 93 93 90 97 97 97 97 93 86 87 86 [212.2]DSMQATLDSEVR 2966 FPQYRNEVRYK 6.6 60 500.5962 3 34.734 0.8 56 56 54 69 43 41 70 75 75 58 56 [1480.8] 2967 FKFLRFLELVPYVAYYK 11.2 66 732.7474 3 34.744 0.9 31 33 33 35 32 66 72 95 90 76 77 92 89 87 86 86 31 [951.6]EL[196.1]YVAYY[128.1] 2972 VQLELNQLK 7.1 78 542.8221 2 34.81 0.9 67 62 93 83 78 83 79 90 66 [227.1]LE[113.1]N[128.1]L[128.1] 2974 RDRHNNDAVR 6 60 418.2142 3 34.828 2.1 31 31 31 59 63 86 88 75 79 48 [678.3]ND[326.2] 2978 QLLGTLEEMR 8.8 88 595.3162 2 34.879 0.5 57 62 95 96 96 97 98 94 96 83 [241.1]LGTLEEMR 2979 TWLYRQNAQWR 7 63 507.9271 3 34.888 2.8 57 32 35 32 47 45 79 96 88 93 86 [961.5]AQWR

PAGE 351

351 2983 VTSTELFK 5.1 64 462.7558 2 34.941 0.7 31 92 86 74 62 60 69 31 [99.1]TS[618.3] 2984 YPHSVLWPALAPHNK 9.5 63 865.4602 2 34.95 2.3 76 76 76 31 31 97 75 67 67 93 91 49 36 37 37 [583.3]L[354.2]LA[476.2] 2985 NVAMVAELEELR 9.2 77 687.3586 2 34.961 0.5 50 53 55 93 97 97 96 97 31 88 91 71 [284.1]MVAEL[129.0]EL[156.1] 2986 RRTWAMMAEELKK 8.4 65 550.6251 3 34.972 0.3 31 47 41 41 56 84 97 96 90 71 68 79 31 [670.4]MMAE[498.3] 2987 RVVT(+79.97)KQAAELEGDGR 8.3 55 570.2846 3 34.983 0.9 31 31 37 40 36 36 60 94 95 95 85 60 53 38 31 [862.4]AELE[385.2] 2989 LLTENGEFGR 6.9 69 568.291 2 35.018 0.4 95 95 94 85 53 55 67 82 31 31 LLTE[300.1]F[213.1] 2990 LVGKSVLS(+79.97)NLEGLRHR 9.5 59 620.0076 3 35.026 1.4 72 72 54 51 47 31 76 63 61 82 87 67 65 51 31 31 [977.5]LE[619.4] 2991 VYADRLWWK 7.3 81 618.83 2 35.037 0.4 90 92 88 90 94 94 60 60 60 VYADRL[500.3] 2993 MVSLLQEK 6.6 82 474.2648 2 35.06 0.6 98 98 98 31 94 77 86 74 MVS[113.1]L[128.1]E[128.1] 2995 SVTLFLYASFR 6.9 63 435.24 3 35.092 0.7 31 71 43 42 42 93 93 77 69 70 55 [547.3]LY[461.2] 2996 QVY(+79.97)PFLLVSKLTR 8.9 68 548.6371 3 35.104 2.9 39 39 39 31 62 73 83 84 95 93 88 87 65 [827.4]LVSKLT[156.1] 2997 LLSLNSADMLK 8.9 81 602.8343 2 35.114 0.6 96 95 95 96 87 83 80 77 66 65 42 LLSLNSA[487.2] 2998 MFAPYANK 5.4 67 471.2306 2 35.124 1.1 90 90 90 31 31 92 31 77 MFA[260.1]A[242.1] 3001 KLDLVSGVVSAPK 8.9 69 438.2659 3 35.167 0.1 43 42 45 57 95 92 85 85 81 85 72 75 31 [469.3]VSGVVS[296.2] 3003 QMM(+15.99)RLVTGNMGAELR 9.3 62 574.9545 3 35.185 2.5 42 38 35 38 42 53 60 58 59 75 90 90 86 85 67 [1177.5]GAEL[156.1] 3007 LLPVLYPCCLKVKYK 9.8 65 890.5154 2 35.239 1.6 31 64 64 98 97 98 98 85 63 43 41 40 45 61 45 [323.2]VLYPC[862.5] 3008 ASYDDYVEGLR 8.5 78 644.296 2 35.25 0.4 50 50 83 96 95 96 96 90 71 80 40 [158.1]YDDYVE[57.0]L[156.1] 3011 LFWNMVAAGSKPR 7.7 59 492.9315 3 35.28 1.4 31 31 59 64 64 72 83 77 76 64 51 51 37 [790.4]A[596.3] 3014 WQTRVAELEELR 8.2 69 510.6087 3 35.322 2.9 58 36 36 39 70 87 94 96 31 93 96 81 [670.4]AEL[129.0]ELR 3015 MELDDLSSNMEAVSK 12.9 86 834.8768 2 35.333 0.5 84 82 92 95 98 97 98 95 89 90 89 81 76 81 31 MELDDLSSNMEA[99.1]S[128.1] 3016 LLGLNSADMLK 8.7 79 587.829 2 35.343 0.6 96 95 96 95 90 81 77 67 63 63 43 LLGLNS[558.3] 3017 ACNGHKEALVSKLTR 10.8 72 813.939 2 35.355 2.3 52 49 47 45 56 90 94 81 80 94 95 91 79 77 47 [482.2]KEALVSK[370.2] 3019 LVLSTLGEK 6.1 68 480.292 2 35.389 0.4 31 31 96 93 91 86 66 67 41 [212.2]LSTL[314.2] 3020 RFHRRKY(+79.97)PAESTTCHR 9 56 532.0068 4 35.398 1.5 33 33 32 37 34 70 63 59 56 86 84 80 72 61 63 31 [1291.6]EST[497.2] 3022 SRRWTWWNS(+79.97)TLDGNK 8.5 57 662.9721 3 35.422 2.5 32 32 33 32 34 34 58 58 57 90 89 88 89 84 31 [1339.6]TLDGN[128.1] 3023 DFETLSQLSK 7 70 584.2984 2 35.433 0.4 31 31 97 95 71 70 60 86 90 66 [262.1]ET[328.2]LS[128.1] 3027 NFAWLVGDVSK 8.7 79 412.5522 3 35.488 0.1 72 80 61 62 88 93 93 94 95 96 31 [114.0]F[257.1]LVGDVS[128.1] 3028 VLDSMQATLDSEVR 12.6 90 782.388 2 35.497 0.3 67 74 89 92 93 90 97 97 97 97 93 89 89 88 [212.2]DSMQATLDSEVR 3029 RRPQQQDEPDVLVAAM(+15.99)K 11.1 65 666.3464 3 35.508 0.8 31 76 42 48 55 56 89 68 55 66 80 91 87 82 66 64 42 [793.4]D[341.1]VLVA[346.2] 3033 HLKT(+79.97)KTYELYVPVLRKK 9.8 58 732.7481 3 35.56 0.2 35 35 37 40 37 42 49 92 78 72 90 85 78 62 54 48 37 [951.5]E[276.1]VP[624.4] 3037 VQLELNQLK 7 78 542.8215 2 35.617 0.1 60 57 89 89 88 85 78 89 64 [227.1]LELN[128.1]L[128.1]

PAGE 352

352 3040 GFVFNNWGGVR 8 72 418.2139 3 35.647 4.1 31 83 83 70 70 87 78 88 84 85 31 [57.0]FV[261.1]N[186.1]GGV[156.1] 3044 QLLGTLEEMR 8.7 87 595.3159 2 35.7 0 56 60 96 98 97 97 98 93 95 80 [241.1]LGTLEEMR 3045 LATNACFLQAQWR 10 77 507.9266 3 35.709 1.5 81 85 91 56 57 74 68 62 61 94 87 91 84 LAT[676.3]AQWR 3047 SSLAQVAM(+15.99)SQVADLMR 12.5 78 861.9279 2 35.729 1.6 31 64 54 55 57 91 97 98 91 80 86 94 95 92 92 68 [486.2]VAM(+15.99)SQVADLM[156.1] 3049 SLSTELFK 6.3 79 462.7557 2 35.763 0.5 31 96 95 93 91 91 96 31 [87.0]LSTELF[128.1] 3050 NGLMVAELEELR 9.2 77 687.3588 2 35.771 0.8 51 52 56 94 97 96 96 97 31 87 90 70 [284.1]MVAEL[129.0]EL[156.1] 3051 YYASVLVLANFLDNK 10.8 72 865.4603 2 35.782 1.6 71 70 85 93 96 97 57 57 42 43 90 90 78 73 31 [326.1]ASVL[397.2]FL[357.2] 3052 RRMRAMSDEELKK 8.1 62 550.6251 3 35.793 2.1 31 44 40 45 74 85 93 94 96 57 56 59 31 [670.4]MSDE[498.3] 3053 VT(+79.97)KNRLAAELEDNR 8.2 58 570.2845 3 35.804 0.6 32 41 36 38 46 56 77 95 93 90 78 49 46 31 [862.4]AEL[514.2] 3055 LLTENGEFGR 6.7 67 568.291 2 35.839 0.4 93 94 93 84 48 49 62 81 31 31 LLTE[300.1]F[213.1] 3056 ETFRYKPLGKHAPWK 8.8 59 620.0075 3 35.847 2.3 31 78 32 34 46 43 49 65 89 79 74 80 64 64 49 [1034.6]G[265.2]A[411.2] 3057 M(+15.99)KTAGVLWASR 8.1 73 618.33 2 35.858 3 38 36 39 92 94 95 96 96 90 93 31 [376.2]AGVLWAS[156.1] 3059 QLEAEEQLEAVNSK 12.2 87 794.3968 2 35.881 0.2 69 74 92 95 98 95 86 94 96 94 94 79 90 52 [241.1]EAEEQLEAV[114.0]S[128.1] 3063 WRYKSGYVSKLTR 8.4 64 548.6373 3 35.934 2.6 32 32 36 39 53 59 68 89 94 92 87 86 64 [940.5]VSKLT[156.1] 3065 LLSLNSADMLK 9.2 84 602.8339 2 35.955 0.1 96 96 95 96 91 93 91 81 70 68 41 LLSLNSAD[372.2] 3067 KLDLVSGVVSPAK 9.1 70 438.2658 3 35.989 0.4 49 48 52 42 92 90 83 85 88 90 73 74 31 [469.3]VSGVVS[296.2] 3068 M(+15.99)QMRLQSGVMGAELR 9.8 66 574.954 3 35.999 1.7 52 51 42 37 35 40 55 67 87 91 88 87 87 87 70 [947.4]VMGAEL[156.1] 3069 NSYM(+15.99)VMLNPLVHCSNK 9 56 467.2225 4 36.01 1.4 57 58 65 31 44 42 41 42 44 47 90 90 78 57 64 43 [1178.5]VH[432.2] 3070 MVSLLQEK 5.7 71 474.265 2 36.021 0.2 97 97 97 31 88 49 62 44 MVS[113.1]L[385.2] 3073 LLPVLYPPVTTLYYK 11 74 890.5167 2 36.064 1.9 31 69 69 98 98 98 98 98 61 61 71 89 92 31 31 [323.2]VLYPP[301.2]LY[291.2] 3074 ASYDDYVEGLR 8.7 79 644.2964 2 36.075 0.3 52 52 85 97 97 98 97 92 73 83 40 [158.1]YDDYVE[57.0]L[156.1] 3077 MFAYPANK 6.9 86 471.2312 2 36.104 0.2 95 95 95 31 98 96 92 82 MFA[163.1]PANK 3079 QLDLVDKLQMK 6.8 62 444.2513 3 36.139 0.5 53 51 52 48 88 87 71 71 47 60 46 [469.3]VD[628.4] 3080 RQWTVAELEELR 8.2 68 510.6084 3 36.148 2.3 44 43 39 51 59 84 92 95 31 95 97 84 [670.4]AEL[129.0]ELR 3081 MELDDLSNSMEAVSK 11.9 79 834.876 2 36.159 0.5 78 78 90 96 98 97 96 55 65 82 91 75 71 81 31 [260.1]LDDLS[201.1]ME[170.1]S[128.1] 3082 LLGLNSADMLK 9.5 86 587.8286 2 36.17 0.1 95 92 93 92 90 88 86 86 84 84 55 LLGLNSADML[128.1] 3083 QPQEKEPSVSKLEK 9.9 70 813.9378 2 36.181 0.7 53 53 42 86 67 92 93 92 98 84 65 61 63 31 [353.2]E[128.1]EPSVS[498.3] 3085 LVLSTLGEK 6.6 73 480.2922 2 36.216 0 31 31 97 94 94 92 81 82 53 [212.2]LSTLGE[128.1] 3088 DFETTNLLSK 7.6 76 584.2983 2 36.248 0.3 31 31 92 95 80 80 84 94 94 76 [262.1]ETTNLLS[128.1] 3089 WT(+79.97)MPREAKKPDSQWKR 9.5 60 531.761 4 36.26 0.7 32 32 34 45 66 91 70 69 70 70 80 82 65 49 52 35 [751.3]E[424.3]DS[598.3] 3091 EPPYVLPPVVLPALLYK 9.7 57 636.7129 3 36.295 0.2 31 78 73 42 41 47 87 94 31 31 51 61 64 88 69 43 31 [698.4]PP[479.3]L[404.2]

PAGE 353

353 3092 FNWVGLADVSK 8.7 79 412.5528 3 36.306 1.7 53 69 69 78 89 93 92 93 97 97 31 [546.3]GLADVS[128.1] 3094 VLDSMQATLDSEVR 12.6 90 782.3889 2 36.326 1.5 65 74 88 93 94 89 97 97 98 97 95 91 91 90 [212.2]DSMQATLDSEVR 3095 SKPY(+79.97)KKPLLDVCAEGLR 12.1 71 666.3464 3 36.337 2.1 71 70 88 57 54 50 71 77 81 84 87 82 83 81 60 70 38 [215.1]P[709.4]LDVCAE[326.2] 3097 LRRRWALYPRNAVAYYK 10.3 61 732.7479 3 36.371 0.3 32 32 31 31 38 38 63 96 93 49 56 64 75 89 86 86 64 [951.6]YP[440.2]AYY[128.1] 3098 EPKFPMAARTSHK 9.4 73 500.5967 3 36.383 2 92 91 48 45 50 85 85 81 81 80 81 85 31 EP[372.2]MAARTSH[128.1] 3101 QNMT(+79.97)DENS(+79.97)M(+15.99)ANR 7.9 65 529.5059 3 36.413 1.3 63 64 71 51 68 71 89 84 70 50 63 37 [798.2]NS(+79.97)[488.2] 3103 VQLELNQLK 6.7 74 542.8223 2 36.449 1.3 68 63 93 74 69 76 72 87 62 [227.1]L[484.2]L[128.1] 3104 WQLHNNERR 5.8 64 418.2144 3 36.458 0.5 63 55 55 72 82 78 67 69 31 [564.3]N[555.3] 3109 QLLGTLEEMR 8.8 88 595.3163 2 36.522 0.7 59 63 96 98 98 97 98 93 95 80 [241.1]LGTLEEMR 3111 RFPAFTQNAQWR 6.8 57 507.9271 3 36.54 2.7 37 37 31 44 37 37 40 60 89 86 91 84 [961.5]AQWR 3112 RRRHTGTFWK 6.1 61 448.9171 3 36.55 2 31 31 34 45 60 88 81 71 84 84 [706.4]GT[147.1]WK 3113 WTY(+79.97)KWLTSLKR 6.1 56 521.2689 3 36.561 0.4 63 52 52 52 58 71 72 55 49 47 38 [1542.8] 3115 TVSTELFK 5.5 69 462.7556 2 36.595 0.3 31 31 94 88 86 90 96 31 [200.1]STELF[128.1] 3116 YPHSVLPKQNAPHNK 8.9 59 865.4601 2 36.604 0.2 77 77 77 31 31 98 73 44 43 83 92 50 35 36 34 [583.3]L[353.2]NA[476.2] 3117 NGLMVAELEELR 8.8 73 687.3584 2 36.615 0.3 46 47 52 93 96 94 85 87 31 85 87 66 [284.1]MVAEL[129.0]EL[156.1] 3118 RRTDAAMMLNTNKK 8.6 61 550.6252 3 36.625 2.3 31 63 48 63 75 87 90 95 59 54 50 45 51 38 [599.3]AMM[698.4] 3119 RHAELEGCPK 7.2 72 570.2844 2 36.636 0.9 73 73 92 94 88 82 71 56 58 31 [293.2]AELE[385.2] 3121 LLTEGNEFGR 6.7 67 568.2913 2 36.67 1.1 93 95 95 89 45 43 50 92 31 31 LLTE[300.1]F[213.1] 3122 VLNKKNKFAQCVSNHK 10.3 64 620.0078 3 36.679 1.5 82 81 48 46 42 46 71 58 57 51 82 87 92 60 76 38 VL[958.5]CVS[379.2] 3123 NFDARLWVSK 8.6 86 618.33 2 36.689 0.2 76 81 94 94 95 96 88 98 98 31 [114.0]FDARLWVS[128.1] 3125 WNPYKWLPFLVDAFPK 9.4 59 674.3621 3 36.712 1.7 56 45 46 53 48 50 55 95 31 75 78 90 87 62 31 34 [987.5]P[359.2]DA[372.2] 3128 KSKKFTLCGDFLTR 9.3 67 548.6371 3 36.758 1.8 32 32 33 60 50 62 79 87 95 92 87 80 80 56 [832.5]CGDFLT[156.1] 3129 LLSLNSADMLK 8.8 80 602.834 2 36.769 0.1 94 92 92 95 90 90 88 73 60 57 42 LLSLNSA[487.2] 3131 SSPSQVAFSQVADLMR 12.2 77 861.9275 2 36.787 0.1 55 52 53 60 81 94 94 56 87 57 95 95 95 90 90 65 [358.1]QVA[147.1]S[128.1]VADLM[156.1] 3133 KLDLVSGVVSAPK 8.4 65 438.2654 3 36.821 1.4 42 42 45 45 96 95 88 82 73 72 60 65 31 [469.3]VSGV[482.3] 3134 Y(+79.97)YRKRTVMGAELR 8.5 65 574.9535 3 36.831 2.8 35 31 33 34 45 59 92 95 88 87 87 86 69 [947.4]VMGAEL[156.1] 3136 MVSLLQEK 6.4 81 474.2645 2 36.853 1.3 97 97 97 31 93 73 81 70 MVS[113.1]L[128.1]E[128.1] 3137 KHHRPTEDQLSELK 9 65 573.3046 3 36.862 0.9 32 32 35 41 48 66 93 83 71 89 93 89 95 31 [756.4]ED[128.1]LSEL[128.1] 3139 LLPVLYPVPTTLYYK 10.4 69 890.5166 2 36.897 2 31 82 82 97 97 98 99 31 54 54 60 90 93 31 31 [113.1]LPVLYP[398.2]LY[291.2] 3140 MFHFEVAALQKR 6.7 56 492.9318 3 36.908 1.9 31 31 31 31 77 76 78 86 76 51 58 34 [861.4]A[525.3] 3141 SSFDDYVEGLR 8.6 78 644.2957 2 36.918 0.8 54 58 58 96 95 97 97 92 76 85 43 [321.1]DDYVE[57.0]L[156.1]

PAGE 354

354 3142 MFAPYANK 5.5 69 471.231 2 36.928 0.3 93 93 93 31 31 93 31 79 MFA[260.1]A[242.1] 3145 QLDLVDQLKMK 7.2 65 444.252 3 36.972 1 49 42 42 51 95 94 67 88 69 83 31 [469.3]VD[128.1]L[128.1]M[128.1] 3146 WWKAVAELEELR 7.8 65 510.609 3 36.981 1 31 35 36 42 52 89 94 97 31 93 95 81 [670.4]AEL[129.0]ELR 3147 LLGLNTGDMLK 8.8 80 587.8293 2 36.992 1.1 95 93 95 95 89 72 73 74 72 72 45 LLGLN[645.3] 3148 MELDDLSSNMEAVSK 12.9 86 834.8775 2 37.003 1.3 78 78 93 97 98 97 97 95 83 92 93 88 81 85 31 [260.1]LDDLSSNMEAVS[128.1] 3149 CHKNKEPSVSKLTR 10.8 77 813.9391 2 37.014 2.1 44 41 40 46 91 96 96 96 99 96 93 87 85 60 [482.2]KEPSVSKLT[156.1] 3151 LVLSTLGEK 6.2 69 480.2917 2 37.048 1 31 31 97 95 93 87 69 70 42 [212.2]LSTL[314.2] 3153 DFETNTLLSK 7.3 73 584.298 2 37.066 0.3 31 31 98 92 60 63 80 94 95 77 [262.1]ET[215.1]LLS[128.1] 3154 WRHM(+15.99)RHECNHSHVNK 8.7 58 662.9715 3 37.077 1.7 32 32 31 32 38 34 64 88 69 76 86 80 72 73 57 [1048.5]C[251.1]SH[341.2] 3157 FFKLYPPVVKAGFLGPK 9.8 58 636.7119 3 37.123 3.5 31 38 38 69 64 89 92 31 79 70 72 80 74 49 34 33 31 [698.4]PP[397.3]G[542.3] 3158 KVSWCLADVSK 7.4 68 412.5521 3 37.134 2.7 31 55 42 42 63 94 94 94 96 96 31 [603.3]LADVS[128.1] 3159 VT(+79.97)VVKKNTSLLNSK 8.3 59 537.6339 3 37.144 0.2 31 31 31 66 52 58 56 87 94 92 61 53 66 45 [848.5]TSL[442.3] 3160 LVDSMQATLDSEVR 12.6 90 782.3874 2 37.154 0.5 67 76 90 93 94 90 97 97 98 97 93 88 88 88 [212.2]DSMQATLDSEVR 3163 HHRKKTRHYLVPVAYYK 11.3 66 732.7467 3 37.199 2 31 81 73 46 43 49 56 73 72 76 86 75 66 65 79 84 64 [137.1]H[1082.6]V[430.2]Y[128.1] 3164 VVERDMAARTSHK 8.2 63 500.5962 3 37.211 0.4 36 43 43 68 62 62 85 81 75 72 73 82 31 [729.3]AA[344.2]H[128.1] 3170 VQLELNQLK 7 78 542.8218 2 37.279 0.3 63 58 91 90 89 81 76 88 65 [227.1]LELN[128.1]L[128.1] 3171 EGKLHNNTPDK 6.8 62 418.2139 3 37.289 0.7 35 35 42 63 64 74 86 85 83 77 31 [678.3]NTP[243.1] 3175 QLLGTLEEMR 8.6 86 595.3159 2 37.341 0 49 51 95 98 97 97 98 93 95 81 [241.1]LGTLEEMR 3177 RHS(+79.97)KMKNAKWR 6.4 58 507.9265 3 37.358 2.1 36 36 34 41 48 69 74 89 80 79 50 [961.4]AK[342.2] 3179 QAANSAGHFR 5.8 58 529.76 2 37.377 0.1 53 61 63 76 49 49 77 90 31 31 [599.3]H[303.2] 3181 SLSTELFK 6.1 76 462.7552 2 37.411 0.7 31 96 95 89 85 85 94 31 [87.0]LSTELF[128.1] 3182 NVAMVAELEELR 9 75 687.3578 2 37.42 0.6 44 43 45 90 97 96 95 96 31 89 91 72 [284.1]MVAEL[129.0]EL[156.1] 3184 M(+15.99)LHSVLPDAALANPHK 10.8 68 865.4587 2 37.439 2.8 71 71 87 31 31 97 79 73 73 79 89 78 64 52 69 31 [260.1]H[186.1]L[354.2]L[547.3] 3187 LLTENGEFGR 7.2 72 568.2914 2 37.482 1.2 92 95 95 91 58 62 76 85 31 31 LLTE[300.1]F[213.1] 3188 VLKY(+79.97)LKKVGAM(+15.99)TPWK 8.8 59 620.0077 3 37.491 1.4 70 70 68 51 50 58 84 79 66 45 38 40 42 61 49 [824.5]K[886.4] 3189 FNDARLWVSK 8.7 87 618.33 2 37.502 0.2 85 80 94 96 96 97 88 98 98 31 FNDARLWVS[128.1] 3191 HHLVLAMMAEQLTR 9.5 68 550.6256 3 37.525 0.4 31 31 56 42 50 62 89 97 94 91 78 79 80 62 [670.4]MMAE[241.1]T[156.1] 3193 LLGYTLYWFK 6.7 67 435.2417 3 37.559 1.6 44 46 38 48 67 94 89 69 85 89 [547.3]LY[186.1]FK 3194 YNKS(+79.97)RVLVSKLTR 7.7 59 548.6367 3 37.57 2.1 43 39 36 33 40 42 61 31 96 95 90 89 64 [1039.5]SKLT[156.1] 3195 LLSLNSADMLK 9.1 83 602.8335 2 37.581 0.7 96 95 95 95 90 72 68 84 79 79 52 LLSLN[158.1]D[372.2] 3196 LLDTEHCFFKDLVAAFK 11.8 70 666.3455 3 37.591 0.9 34 34 35 36 64 82 90 90 81 79 79 91 92 93 90 74 31 [571.3]HCFF[243.1]LVAA[275.2]

PAGE 355

355 3197 LKDLVDQLQLK 9.1 82 656.8947 2 37.603 0.9 89 86 93 96 97 95 81 75 56 76 56 LKDLVDQ[482.3] 3199 KLDLVSGVVSAPK 8.6 66 438.266 3 37.636 0 43 42 46 80 90 88 79 79 69 73 64 70 31 [356.2]LVS[638.4] 3200 Y(+79.97)RRKYTVMGAELR 8.1 63 574.9544 3 37.645 1.2 34 34 32 48 48 70 84 94 86 82 72 70 54 [947.4]VMGA[398.2] 3202 MVSLLQEK 6.6 83 474.2649 2 37.667 0.5 97 97 97 31 95 79 85 76 MVS[113.1]L[128.1]E[128.1] 3203 WHYVAFSRAADLMR 11.4 81 861.9279 2 37.677 2.7 31 80 80 92 97 97 96 96 96 95 92 71 69 40 [186.1]HYVAFSRAAD[400.2] 3205 LLPVLYPRQNLSNPR 9.1 61 890.5176 2 37.711 2.9 31 56 56 97 97 98 89 40 43 55 75 47 39 48 35 [323.2]VLYP[965.5] 3212 WEKRAAELEELR 8.5 71 510.6085 3 37.79 2.6 55 44 39 36 73 95 96 97 31 95 97 85 [670.4]AEL[129.0]ELR 3214 LLGLNSADMLK 9.3 84 587.8289 2 37.812 0.3 96 95 96 95 90 88 86 86 72 71 44 LLGLNSAD[372.2] 3215 SSFDDYVEGLR 8.6 78 644.2963 2 37.822 0.2 54 61 61 95 93 97 97 92 73 86 39 [321.1]DDYVE[57.0]L[156.1] 3218 LVLSDVVSK 5.4 59 480.292 2 37.863 0.5 31 31 31 85 83 79 81 78 31 [325.2]SD[99.1]V[215.1] 3219 MELDDLSSNMEAVSK 12.7 85 834.876 2 37.873 0.5 76 75 87 96 98 97 98 96 91 94 92 78 74 79 31 [260.1]LDDLSSNME[385.2] 3220 MNRRQCMTSTMTLDGNK 10.3 61 662.9713 3 37.884 0.8 83 53 47 41 44 64 61 60 62 87 83 60 53 59 61 73 31 M[976.4]TM[628.3] 3224 VT(+79.97)VVKKNTSLLNSK 9 64 537.6339 3 37.94 0.3 31 31 31 70 57 64 57 85 94 93 87 64 79 45 [848.5]TSLL[329.2] 3225 WKMTGLADVSK 7.6 69 412.5521 3 37.951 2.8 34 43 38 51 83 93 93 94 96 96 31 [546.3]GLADVS[128.1] 3226 LVDSMQATLDSEVR 12.6 90 782.3875 2 37.96 0.3 68 77 91 91 91 89 97 97 96 97 94 89 89 88 [212.2]DSMQATLDSEVR 3227 DFETLSQLSK 7 70 584.2985 2 37.971 0.6 31 31 97 95 64 63 49 92 94 78 [262.1]ET[328.2]LS[128.1] 3229 RRVWQLLELVPYVAYYK 11.5 68 732.7477 3 38.006 1.8 31 41 32 37 38 42 82 96 95 92 93 92 73 67 80 84 63 [838.5]LELVPY[170.1]YY[128.1] 3230 TRLLFVAAHT(+79.97)YK 7.2 60 500.5964 3 38.017 1.5 32 32 34 46 61 76 76 84 91 87 31 61 [800.5]AHT(+79.97)[291.2] 3232 QPQEKEALVSQLEK 10.2 73 813.9391 2 38.039 0.8 50 50 43 90 70 95 81 79 94 94 79 71 85 31 [353.2]E[128.1]EA[113.1]VS[241.1]E[128.1] 3236 VQLLENQLK 6.9 76 542.8217 2 38.096 0.1 60 55 85 85 80 85 78 90 65 [227.1]LLEN[128.1]L[128.1] 3238 RDRHNNDAVR 6.1 61 418.2139 3 38.117 1.5 32 32 32 60 63 81 77 77 87 62 [678.3]N[186.1]V[156.1] 3239 MFAPYANK 5.6 70 471.2307 2 38.127 0.9 94 94 94 31 31 94 31 81 MFA[260.1]A[114.0]K 3241 QLLGTLEEMR 8.8 88 595.3159 2 38.16 0.1 56 60 95 98 97 97 97 94 96 83 [241.1]LGTLEEMR 3243 M(+15.99)EEKWKNAKWR 6.9 63 507.9266 3 38.178 1.5 31 56 48 43 39 69 76 93 88 84 58 [961.4]AKW[156.1] 3247 SLSTELFK 6 76 462.7556 2 38.23 0.2 31 95 93 91 84 83 92 31 [87.0]LSTELF[128.1] 3248 VVKASVLPDAALCSDNK 13.5 79 865.4598 2 38.239 1.7 31 52 58 74 91 96 98 95 89 88 91 91 92 92 90 84 31 [397.3]SVLPDAALCSDN[128.1] 3249 VNAMVAELEELR 8.7 73 687.358 2 38.25 0.4 37 36 38 90 97 96 95 96 31 88 90 70 [284.1]MVAEL[129.0]EL[156.1] 3251 LQEAEEQLEAVNSK 12 85 794.3967 2 38.269 0.1 67 61 93 96 98 95 84 95 96 96 95 76 88 49 [241.1]EAEEQLEAV[114.0]S[128.1] 3253 LLTEENGFGR 7.4 74 568.2911 2 38.303 0.8 95 96 96 96 48 45 51 90 85 31 LLTE[300.1]FG[156.1] 3254 FWRNKFRGKHAPWK 8.4 60 620.0075 3 38.312 3.1 31 41 58 44 56 52 61 89 73 67 82 64 64 49 [1034.6]G[265.2]A[411.2] 3256 YNVAGVLWASR 8.7 80 618.33 2 38.33 0.2 67 57 60 91 95 94 94 95 91 93 31 [376.2]AGVLWAS[156.1]

PAGE 356

356 3257 QMS(+79.97)ENENSACGT(+79.97)R 7.3 56 529.5049 3 38.342 0.7 58 58 49 60 54 67 49 42 42 67 66 74 39 [1567.5] 3259 RLMFLYWFK 5.7 63 435.24 3 38.376 2.7 34 34 31 31 96 89 71 88 90 [547.3]LY[186.1]FK 3260 HRYEKNLVSQLTR 7.8 60 548.6368 3 38.388 1 31 31 32 36 36 47 63 92 93 81 84 85 66 [940.5]VSQLT[156.1] 3261 LLSLNSADMLK 9.4 85 602.8339 2 38.399 0.1 97 96 95 95 86 87 85 82 79 78 55 LLSLNSAD[372.2] 3263 WWPVT(+79.97)RNLVNLVAAM(+15.99)K 10.4 65 665.3422 3 38.42 1.9 31 37 37 39 48 51 51 93 89 79 90 89 88 80 79 56 [1019.4]LV[114.0]LVAA[275.1] 3265 QLDLVSGVLQLK 8.1 68 438.2657 3 38.455 0.6 54 53 55 49 96 89 86 82 79 56 63 46 [469.3]VSGV[482.3] 3266 VM(+15.99)RSLTDEVMGAELR 9.8 66 574.9539 3 38.464 2.4 31 31 34 35 38 53 62 73 94 96 91 89 88 88 71 [947.4]VMGAEL[156.1] 3268 KVWWAMMAEELKK 9.9 76 550.6242 3 38.486 2.3 71 71 31 79 78 86 97 96 96 86 79 81 31 [670.4]MMAEE[113.1]K[128.1] 3269 LLPVLYPVVSLYNYK 9.3 62 891.0174 2 38.497 1.6 31 36 36 96 96 96 98 38 38 57 82 72 67 49 31 [323.2]VLYP[285.2]L[568.3] 3271 LLPVLYPVPTTLYYK 9.7 65 890.5165 2 38.532 2.1 31 55 55 97 97 98 99 31 51 51 58 89 92 31 31 [323.2]VLYP[398.2]LY[291.2] 3273 QLDLVDQLKLK 8.8 80 656.8955 2 38.553 0.3 73 84 93 93 98 96 66 88 72 82 31 [128.1]LDLVD[128.1]L[128.1]L[128.1] 3274 MVSLLQEK 6.1 77 474.2648 2 38.563 0.6 98 98 98 31 92 62 73 57 MVS[113.1]L[385.2] 3275 FMPKKENLKGQGPAPHNK 10.7 60 674.3616 3 38.573 2.3 31 68 65 42 38 37 46 61 70 88 64 77 72 67 63 59 68 49 [1115.6]G[829.4] 3277 YNLQQDVLLPK 6.7 61 444.2513 3 38.608 2.1 46 42 45 46 52 89 90 88 81 58 31 [646.3]DVLL[225.1] 3278 WQTRVAELEELR 8.8 73 510.6082 3 38.618 1.9 56 45 45 63 74 91 96 98 31 95 96 84 [670.4]AEL[129.0]ELR 3279 LLGLNSADMLK 8.5 77 587.8289 2 38.628 0.3 96 94 96 95 89 72 67 70 61 61 44 LLGLN[645.3] 3280 TGYDDYVEGLR 9.1 82 644.2961 2 38.638 0.2 66 76 90 96 96 97 97 92 69 84 38 [158.1]YDDYVE[57.0]L[156.1] 3281 SSLAQVAM(+15.99)SQVADLMR 12.8 80 861.9269 2 38.648 2.7 31 79 77 73 68 90 96 97 90 67 81 93 94 88 87 60 [486.2]VAM(+15.99)S[128.1]VADLM[156.1] 3283 LVLSTLGEK 6.2 69 480.2921 2 38.683 0.2 31 31 95 93 92 88 71 72 43 [212.2]LSTL[314.2] 3285 MELDDLSSNMEAVSK 12.6 84 834.8752 2 38.704 1.4 80 79 92 97 98 97 97 90 67 74 89 89 84 87 31 M[129.0]LDDLSS[245.1]EAVS[128.1] 3286 QT(+79.97)YRKKAAMVER 8.1 67 520.9276 3 38.715 2.2 56 59 46 43 39 49 79 88 89 84 84 84 [955.5]AMVER 3289 LLVPLYPPVKTLTYYK 11.3 70 636.7117 3 38.757 2.1 90 90 90 89 81 82 90 69 54 55 56 82 64 65 31 31 LLVPLYP[425.3]L[555.3] 3290 NM(+15.99)RSVLADVSK 8.7 79 412.5521 3 38.767 0.3 72 84 72 31 97 96 93 93 97 96 31 [114.0]M(+15.99)[243.1]VLADVS[128.1] 3291 RRAHAAWTSLLNSK 8.8 63 537.6335 3 38.776 0.8 33 44 44 52 55 60 60 77 93 93 78 61 76 45 [949.5]SL[442.3] 3292 LVDSMQATLDSEVR 12.6 90 782.3873 2 38.786 0.5 69 76 90 92 93 90 97 97 97 97 94 87 88 87 [212.2]DSMQATLDSEVR 3293 DM(+15.99)ETVTKLSK 8.5 85 584.2986 2 38.797 2.2 31 98 98 95 86 84 87 95 95 80 [115.0]M(+15.99)ETVTKLSK 3295 FKKRAAHLELVPYVAYYK 12.3 69 732.747 3 38.832 2.7 32 32 42 46 54 45 63 84 96 91 76 75 90 84 81 85 86 64 [838.5]LEL[196.1]YVAYY[128.1] 3296 WWLLMAARGMHK 7.5 62 500.5962 3 38.843 1.5 31 49 68 58 81 83 82 77 70 56 54 31 [598.3]MAA[609.3] 3298 Y(+79.97)DHYHPRVLLEVANYR 9.9 62 532.007 4 38.865 2.3 41 33 38 45 48 89 60 51 59 82 91 91 84 62 68 43 [795.2]P[368.3]LEVA[433.2] 3299 ESHEKEALVSKELK 10.7 77 813.9376 2 38.877 1 47 57 68 90 95 96 86 84 94 96 86 68 69 31 [353.1]EKEALVSK[370.2] 3301 VQLELNQLK 6.6 74 542.8218 2 38.911 0.4 61 57 89 77 72 76 76 88 64 [227.1]L[484.2]L[128.1]

PAGE 357

357 3302 DRRHNNEGVR 6.1 61 418.2139 3 38.92 1.5 61 61 38 71 65 84 58 61 73 31 [678.3]N[441.2] 3305 MFFSPANK 5.5 68 471.2307 2 38.953 0.8 31 31 31 93 94 93 89 79 [425.2]SPAN[128.1] 3307 QLLGTLEEMR 8.7 87 595.3158 2 38.987 0.1 56 60 95 98 97 97 97 92 95 79 [241.1]LGTLEEM[156.1] 3308 RHS(+79.97)KMKNAKWR 6.7 61 507.9266 3 38.995 2.2 36 36 34 37 50 64 73 94 89 88 61 [961.4]AKW[156.1] 3313 SLSTELFK 6.2 77 462.756 2 39.059 1.1 31 94 93 93 90 88 94 31 [87.0]LSTELF[128.1] 3314 NGLMVAELEELR 9.1 76 687.3591 2 39.067 1.2 47 48 54 93 97 97 96 97 31 86 89 68 [284.1]MVAEL[129.0]EL[156.1] 3315 M(+15.99)LHSVLWPALSCTKK 10.6 71 865.461 2 39.077 1.1 70 70 84 31 31 98 93 91 93 90 91 71 53 53 31 [260.1]H[186.1]LWPALS[460.2] 3317 HRAENKGDGR 7.3 73 570.2855 2 39.097 2.2 44 70 82 92 86 87 86 75 68 31 [293.2]AENKG[328.1] 3319 LLTEGNEFGR 7 70 568.2914 2 39.129 1.3 95 95 95 85 51 50 64 93 31 31 LLTE[300.1]F[213.1] 3320 VLNALWKQM(+15.99)ACVQPLK 10.1 63 620.0078 3 39.138 0.5 97 96 92 91 77 61 41 35 35 40 90 74 46 41 50 31 VLNA[773.4]C[565.4] 3321 YGRAGVLWADK 9 82 618.33 2 39.149 0.2 47 52 65 94 96 96 96 96 93 93 70 [376.2]AGVLWAD[128.1] 3325 LLYASLYWFK 6.5 65 435.2421 3 39.202 2.5 44 48 42 41 44 89 90 71 86 88 [547.3]LY[186.1]FK 3326 KVY(+79.97)M(+15.99)PLLVSKLTR 8.4 64 548.6373 3 39.213 1.1 32 32 31 48 46 49 80 88 95 93 87 86 64 [827.4]LVSKLT[156.1] 3327 LLSLNSADMLK 8.8 80 602.8342 2 39.224 0.5 96 96 95 95 82 88 88 72 64 61 41 LLSLNSA[487.2] 3329 KLYT(+79.97)AHNNLVDLVAAFK 11.8 69 666.3454 3 39.245 1.9 32 32 40 40 51 76 89 84 86 80 85 92 91 92 91 80 31 [793.4]NNLVDLVAAF[128.1] 3331 KLDLVSGVVSAPK 8.1 62 438.2658 3 39.28 0.3 42 41 44 53 94 89 82 78 67 65 56 61 31 [469.3]VSG[581.4] 3332 HYM(+15.99)FKPNLMGAELR 9.6 68 574.9543 3 39.289 1.7 64 64 47 51 43 42 44 75 95 88 85 88 89 74 [1046.5]MGAEL[156.1] 3335 KLATDAAMMAEELKK 10.8 72 550.6248 3 39.323 0.1 82 50 51 53 49 50 74 87 96 95 95 87 86 88 31 K[542.3]MMAEELK[128.1] 3337 LLPVLYPPVTTLYYK 10.5 70 890.5163 2 39.357 2.3 31 51 51 97 97 97 98 98 55 55 67 88 92 31 31 [323.2]VLYPP[301.2]LY[291.2] 3338 RDYRRGELQQR 6.4 58 492.9318 3 39.368 2.2 31 31 32 35 72 91 90 71 57 63 57 [746.4]GE[525.3] 3339 MVSLLQEK 6.6 82 474.2649 2 39.379 0.5 98 98 98 31 93 76 85 74 MVS[113.1]L[128.1]E[128.1] 3340 KLDLVDQLQLK 9.9 90 656.8956 2 39.388 0.4 94 93 96 95 97 95 82 91 82 90 71 KLDLVDQLQL[128.1] 3341 ALFRCKLESHGSELK 9.8 65 573.3056 3 39.398 1.7 35 35 38 36 41 55 92 93 92 80 79 86 88 94 31 [718.4]LESH[57.0]SEL[128.1] 3343 KMKMPNLMLPK 6.8 62 444.2513 3 39.433 1.1 31 62 55 57 55 55 76 80 84 85 31 [842.5]MLP[128.1] 3344 NGLRMVAELEELR 8.8 68 510.6082 3 39.443 0.2 48 44 46 41 47 69 91 96 98 31 92 95 79 [670.4]AEL[129.0]EL[156.1] 3345 LLGLNSADMLK 8.9 81 587.8286 2 39.454 0.2 95 93 95 95 89 83 78 82 67 67 42 LLGLNS[71.0]D[372.2] 3346 TGYDDYVEGLR 8.8 80 644.2958 2 39.465 0.6 47 66 79 95 96 97 97 94 75 86 40 [321.1]DDYVE[57.0]L[156.1] 3352 LVLSTLGEK 5.9 65 480.2921 2 39.537 0.3 31 31 95 90 87 81 63 64 40 [212.2]LSTL[314.2] 3356 NFWALVGDVSK 8.1 74 412.5521 3 39.591 0 50 50 48 71 86 93 92 93 95 97 31 [518.2]LVGDVS[128.1] 3358 VLDSMQATLDSEVR 12.5 90 782.3875 2 39.61 0.4 63 72 87 91 93 90 97 97 97 97 94 89 90 89 [212.2]DSMQATLDSEVR 3359 MELDDLSSNMEAVSK 12.2 81 834.877 2 39.621 0.7 69 69 86 97 97 96 97 95 88 92 85 73 65 71 31 [260.1]LDDLSSNME[385.2]

PAGE 358

358 3361 LERRRQLELVPYVAYYK 11.4 67 732.7474 3 39.655 0.4 36 35 36 31 49 46 90 96 90 76 75 92 87 85 86 87 31 [838.5]LEL[196.1]YVAYY[128.1] 3364 VRLEM(+15.99)EM(+15.99)QCGGHSHVNK 10.3 60 662.9715 3 39.688 2.9 41 43 42 43 56 31 63 52 70 80 73 69 79 80 69 71 54 [1151.5]G[281.1]H[341.2] 3365 QPQEQEALVSKLEK 10.8 77 813.938 2 39.7 0.5 56 58 57 68 69 95 86 83 95 96 93 91 92 31 [610.3]EALVSKLE[128.1] 3367 VQLELNQLK 7.1 79 542.8216 2 39.734 0 65 60 90 93 92 86 74 87 60 [227.1]LELN[128.1]L[128.1] 3369 FGTKMNNWVR 5.5 55 418.214 3 39.754 1.7 57 56 36 36 36 64 75 71 86 31 [978.4]V[156.1] 3370 YVENSDLLSK 8.8 88 584.2983 2 39.764 0.2 94 95 89 68 73 93 97 95 95 77 YVE[201.1]DLLS[128.1] 3373 QLLGTLEEMR 8.8 88 595.316 2 39.811 0.3 58 63 95 98 98 97 98 92 95 79 [241.1]LGTLEEM[156.1] 3375 ALTWM(+15.99)TQNAKWR 8 67 507.9268 3 39.827 1.8 74 74 77 35 43 57 48 77 87 85 83 58 [961.4]AKW[156.1] 3376 WHYVAFSQVADLMR 11.1 79 861.9279 2 39.838 3.8 31 92 92 96 97 54 75 52 93 92 91 88 88 63 [186.1]HYVA[362.2]VADLM[156.1] 3377 MFAYPANK 6.8 85 471.231 2 39.849 0.2 92 92 92 31 97 95 90 82 MFA[163.1]PANK 3379 SLSTELFK 6 75 462.7556 2 39.883 0.3 31 94 91 88 85 86 94 31 [87.0]LSTELF[128.1] 3380 NVAMVAELEELR 8.8 73 687.3582 2 39.892 0 42 41 43 92 97 96 96 96 31 85 87 67 [284.1]MVAEL[129.0]EL[156.1] 3381 QTPASVLPDGKFLDNK 11.3 71 865.4597 2 39.902 0.2 54 43 46 68 86 95 96 80 62 56 57 87 92 90 82 31 [397.2]SVLP[300.1]FLDN[128.1] 3383 YYHRRVLKDAMVLDNK 10.6 66 674.3617 3 39.922 2.2 53 60 43 48 58 76 93 81 75 72 73 71 70 80 73 31 [874.5]LK[529.3]D[242.1] 3385 LLTENGEFGR 6.9 69 568.2907 2 39.957 0 95 96 96 89 52 53 63 82 31 31 LLTE[300.1]F[213.1] 3386 VLNAWLKEVMMLPWK 9.8 65 620.0071 3 39.965 2.7 79 56 53 61 60 71 51 67 86 76 73 73 61 61 48 [953.5]V[786.4] 3387 YRGAGVLWADK 9 82 618.33 2 39.976 0.2 53 55 62 87 91 95 96 96 94 94 74 [376.2]AGVLWAD[128.1] 3391 HRKAKVNCCSKLTR 9.6 68 548.6371 3 40.028 1.3 32 56 42 45 55 70 68 77 95 89 87 85 86 63 [936.5]CSKLT[156.1] 3392 TFSVLLYWFK 7.5 75 435.2419 3 40.038 2 75 74 74 56 76 95 91 61 74 71 [547.3]LY[461.2] 3393 LLSLNSADMLK 8.9 81 602.8337 2 40.049 0.3 97 96 95 95 92 91 88 67 61 60 42 LLSLNSA[487.2] 3394 M(+15.99)MKYNLVAAFK 7.6 69 666.3457 2 40.058 0.6 31 84 82 75 63 89 91 90 87 31 31 [147.0]MK[277.1]LVAA[275.2] 3395 KYWHRS(+79.97)FLETCSPKPR 9.4 59 529.5045 4 40.07 1.4 32 39 37 37 36 47 63 82 89 87 76 72 86 63 46 40 [1084.5]LET[190.0]P[381.2] 3397 KLDLVSLAASAPK 8.5 65 438.2657 3 40.105 0.5 41 40 43 45 31 96 95 95 90 85 73 75 31 [568.4]SLAAS[296.2] 3398 NKWKHSS(+79.97)VMKELR 8.8 67 574.9542 3 40.114 1.6 31 31 32 47 52 86 94 94 94 78 77 85 71 [693.4]SS(+79.97)VM[257.1]L[156.1] 3401 KFEEHMMARSKKK 9.3 72 550.6248 3 40.148 0.8 79 79 48 65 73 91 96 83 79 71 67 67 31 [670.3]MMA[627.4] 3403 LLPVLYPVDALLYYK 9.4 62 890.5159 2 40.182 2.8 31 58 58 98 96 91 91 39 39 43 49 86 86 31 31 [323.2]VLYP[398.2]LY[291.2] 3405 RKHLYAKSPYLLYK 8.3 59 890.5159 2 40.203 1.3 31 48 43 86 75 47 40 42 79 88 86 61 59 31 [421.3]L[546.3]YL[404.2] 3406 MVSLLQEK 6.2 78 474.2647 2 40.215 0.8 98 98 98 31 91 64 77 60 MVS[113.1]L[385.2] 3407 EEQM(+15.99)AAPALTAKER 8.2 59 520.9274 3 40.224 0.6 53 53 43 48 67 65 61 81 89 89 44 40 41 40 [772.3]ALT[484.3] 3409 QLDLVDKMQLK 7.6 69 444.2513 3 40.257 0.3 54 53 58 88 93 91 73 69 51 68 58 [356.2]LVD[628.4] 3410 RKSCPVAELEELR 9.5 73 510.6083 3 40.266 0 53 54 56 53 71 75 88 94 96 31 93 96 81 [670.4]AEL[129.0]ELR

PAGE 359

359 3412 TGYDDYVEGLR 8.9 81 644.2959 2 40.288 0.5 56 69 84 94 95 96 97 93 73 86 40 [158.1]YDDYVE[57.0]L[156.1] 3413 LLGLNSADMLK 9 81 587.8288 2 40.299 0.2 96 95 96 95 89 76 73 84 71 71 44 LLGLN[158.1]D[372.2] 3416 LVLSTLGEK 6 67 480.292 2 40.342 0.4 31 31 97 95 93 86 61 62 40 [212.2]LSTL[314.2] 3422 M(+15.99)NSRVLADVSK 8.6 78 412.5526 3 40.414 1.6 61 58 79 74 83 90 90 93 96 96 31 [504.2]VLADVS[128.1] 3424 LVDSMQATLDSEVR 12.6 90 782.3885 2 40.431 1 69 76 91 92 93 90 96 96 96 97 93 87 88 87 [212.2]DSMQATLDSEVR 3427 HRHVKT(+79.97)LYPPVMVLLGKK 10.3 57 732.7474 3 40.475 1.8 31 41 39 50 40 36 57 82 98 88 77 78 84 59 40 40 46 31 [951.5]YPP[230.1]V[539.4] 3429 LLVLPGHAAHT(+79.97)YK 7.7 59 500.5962 3 40.495 2 43 43 38 56 65 54 55 80 83 82 81 31 55 [729.5]AAHT(+79.97)[291.2] 3430 RCLY(+79.97)FNRCEANLKR 8 57 622.6282 3 40.505 2.1 53 53 53 32 46 53 53 76 88 74 66 52 56 36 [1135.4]E[582.4] 3431 MELDDLSSNMEAVSK 12 80 834.8762 2 40.516 0.3 68 68 86 95 98 97 97 88 60 70 86 86 82 85 31 [260.1]LDDLSS[245.1]EAVS[128.1] 3433 RALRCPQLK 7.6 85 542.8249 2 40.55 1.6 82 86 94 90 82 87 78 90 69 RALRCP[128.1]L[128.1] 3434 WQLHNWNVR 6.2 69 418.2162 3 40.559 0.4 65 59 59 74 87 84 61 72 53 [564.3]NW[369.2] 3436 LKDLVDKLVNR 9.3 85 656.8995 2 40.58 2.2 94 94 97 98 97 95 94 79 61 61 55 LKDLVDK[482.3] 3439 LQLGTLEEMR 8.7 87 595.3176 2 40.624 2.9 59 55 95 98 98 97 98 92 95 79 [241.1]LGTLEEM[156.1] 3441 REWFTQNAKWR 7.2 66 507.9282 3 40.641 0.5 37 53 44 57 58 54 81 94 90 89 63 [847.4]NAKW[156.1] 3442 EKY(+79.97)T(+79.97)KKKGNVAFDGNK 10.2 64 662.9733 3 40.652 1.5 41 47 41 45 37 39 81 84 85 89 89 86 73 67 81 31 [937.4]KGNVAF[172.0]N[128.1] 3445 SLSTELFK 6.3 78 462.7556 2 40.694 0.2 31 97 96 92 89 90 95 31 [87.0]LSTELF[128.1] 3447 NGLMVAELEELR 9 75 687.3577 2 40.711 0.7 41 44 52 93 97 97 97 97 31 86 89 68 [284.1]MVAEL[129.0]EL[156.1] 3448 DFETTGGLLSK 8.1 73 584.298 2 40.722 0.2 31 31 95 95 80 63 62 89 92 92 71 [262.1]ETT[114.0]LLS[128.1] 3449 M(+15.99)LHSVLWPALCSTKK 9.7 65 865.4595 2 40.731 0.6 51 51 70 31 31 98 87 73 73 90 91 79 55 53 31 [583.3]LW[168.1]LC[444.3] 3451 LLTEEGNFGR 7.6 76 568.2908 2 40.765 0.2 93 96 96 96 65 55 49 86 88 31 LLTE[300.1]FG[156.1] 3452 DPNEKLEKVYVLPWK 10.1 68 620.0074 3 40.775 1.8 91 91 37 35 35 57 59 60 89 88 87 89 68 68 52 DP[741.4]VYVL[411.2] 3453 NFDAGVLWVSK 9.7 88 618.3248 2 40.786 0.4 78 84 95 96 96 96 96 98 98 98 31 [114.0]FDAGVLWVS[128.1] 3454 DAQLHLDDAVR 8.1 74 626.8177 2 40.797 0.3 51 51 49 95 96 96 96 87 70 75 38 [314.1]LHLDD[326.2] 3455 M(+15.99)LAYYHK 4.2 61 471.231 2 40.807 0.3 31 96 96 96 36 31 34 [147.0]LAY[428.2] 3457 SVLTFLYWFK 6.6 66 435.2417 3 40.839 1.7 31 73 48 51 68 91 86 60 74 76 [547.3]LY[461.2] 3458 TRFS(+79.97)QKLVSKLTR 8.6 66 548.6366 3 40.85 2.3 32 32 35 45 46 49 81 96 95 93 91 90 70 [827.4]LVSKLT[156.1] 3459 LLSLNSADMLK 9 81 602.8339 2 40.861 0.1 93 91 91 95 94 94 88 76 65 64 41 LLSLNSA[487.2] 3460 LQDLVDLKQMK 7.3 66 665.8737 2 40.871 0.2 70 66 91 97 31 92 55 45 47 71 55 [241.1]DL[99.1]D[628.4] 3463 KLDLVSGVVSAPK 9.3 72 438.2658 3 40.917 0.3 49 48 59 79 89 87 86 87 87 83 70 72 31 [469.3]VSGVVS[296.2] 3465 VYRWRDGNMGAELR 8.4 60 574.954 3 40.934 1.1 31 32 32 32 42 44 65 79 96 94 88 74 72 56 [1046.5]MGA[398.2] 3466 Y(+79.97)YYWYFLVEVRGK 7.6 58 467.2224 4 40.945 1 31 42 36 41 44 65 94 90 86 68 60 52 40 [1065.4]LVE[440.3]

PAGE 360

360 3469 LLPVLYPVPTTLYYK 10 67 890.5161 2 40.987 2.6 31 69 69 95 95 97 98 31 55 55 61 85 91 31 31 [323.2]VLYP[398.2]LY[291.2] 3471 WSRVAAMMAEKLTR 8.2 58 550.6252 3 41.008 0.3 31 31 50 51 67 79 87 96 90 55 45 43 44 40 [670.4]MMA[627.4] 3472 WTFRRGEGSPKR 6.8 56 492.9313 3 41.019 1.5 32 32 32 53 74 92 71 65 62 59 59 42 [746.4]G[654.3] 3475 QLDLVDQLKMK 6.8 62 444.2518 3 41.063 0.7 53 50 51 52 93 92 63 74 53 60 31 [469.3]VD[628.4] 3479 LSELSTFK 6.5 82 924.5044 1 41.102 0.8 86 84 85 93 90 88 92 31 LSELSTF[128.1] 3487 LLPVLYPLRKPGHYNK 10.4 65 636.7115 3 41.206 0.9 31 88 88 71 76 79 70 60 61 78 79 82 46 42 35 44 [113.1]LP[966.6]G[542.3] 3488 NFREGLADVSK 8.9 81 412.552 3 41.217 2.8 73 85 63 72 85 94 95 95 96 96 31 [114.0]F[285.1]GLADVS[128.1] 3490 LVDSMQATLDSEVR 12.3 88 782.3875 2 41.239 0.4 66 74 89 92 92 89 97 97 97 96 90 81 82 82 [212.2]DSMQATLDSEVR 3491 LVLSTLGEK 6 67 480.292 2 41.25 0.4 31 31 94 93 89 82 66 66 42 [212.2]LSTL[314.2] 3493 RLRQWVLELVPYVAYYK 10.9 64 732.7474 3 41.282 2.2 31 35 34 37 39 49 67 92 90 89 92 93 84 70 64 64 48 [951.6]ELVPYV[525.3] 3494 RKTWSEVPEELR 8.7 72 510.6084 3 41.293 2.3 34 33 41 45 73 92 93 95 95 91 94 77 [658.4]EVPEEL[156.1] 3496 LLGSLDMALNGMHK 9 64 500.5959 3 41.312 1.5 91 88 51 49 59 71 83 81 79 58 55 47 49 31 LL[372.2]MA[680.3] 3499 VQLLENQLK 6.8 75 542.8217 2 41.356 0.1 56 52 90 83 79 82 77 88 63 [227.1]LL[129.0]N[128.1]L[128.1] 3500 RRDHNNDAVR 6.6 66 418.2137 3 41.366 1 31 32 64 63 87 89 86 77 78 53 [564.3]NND[326.2] 3502 LLGLNSDAMLK 8.8 80 587.8284 2 41.388 0.5 95 95 95 94 89 90 79 75 63 62 41 LLGLNS[558.3] 3506 QLLGTLEEMR 8.8 88 595.3159 2 41.436 0.1 59 63 96 98 98 97 98 94 96 82 [241.1]LGTLEEMR 3509 QLDLVDQLKLK 8.3 75 656.8958 2 41.463 0.7 71 81 93 92 97 91 59 75 62 73 31 [128.1]LDLVD[610.4] 3511 SLSTELFK 5.1 63 462.7556 2 41.496 0.2 31 95 93 77 55 50 71 31 [87.0]LS[618.3] 3514 T(+79.97)VYYLKNAKWR 6.4 58 507.9265 3 41.521 2.3 31 31 56 49 39 42 59 92 87 86 61 [961.4]AKW[156.1] 3517 LLTENGEFGR 6.8 68 568.2906 2 41.562 0.1 95 96 95 89 49 49 61 84 31 31 LLTE[300.1]F[213.1] 3518 VLNELKKFAQCVSNHK 8.8 55 620.0068 3 41.572 2.9 45 45 44 35 35 36 45 46 58 75 76 76 88 57 73 39 [1372.8]S[379.2] 3520 FDANVKDLASR 7.4 67 618.3243 2 41.593 2.9 31 95 81 69 73 67 51 54 88 90 31 [147.1]DA[569.3]AS[156.1] 3523 KHKGPLYADFK 6.1 56 435.2423 3 41.637 2.7 33 37 34 41 58 92 86 82 80 31 31 [547.3]LYAD[275.2] 3525 YT(+79.97)QARKLVSKLTR 8.5 65 548.637 3 41.656 1.7 32 39 35 43 43 56 75 89 93 92 88 88 64 [940.5]VSKLT[156.1] 3527 QVGMVAELEELR 9.6 80 687.3587 2 41.675 0.7 58 63 86 95 95 95 90 92 31 89 91 72 [227.1]GMVAEL[129.0]EL[156.1] 3529 KLDLVSLAASPAK 8.5 66 438.267 3 41.709 2.3 42 41 44 52 31 92 90 92 91 89 76 75 31 [568.4]SLAAS[296.2] 3531 LLSLNSADMLK 8.8 80 602.8352 2 41.727 2.1 96 95 95 96 90 82 78 70 65 64 42 LLSLNS[558.3] 3533 T(+79.97)WHRVSTVMGTVLR 7.8 55 574.9559 3 41.746 1.2 48 48 31 31 31 31 95 94 90 64 53 53 68 31 [846.4]TVM[526.3] 3535 LLPVLYKPRYLSCSK 8.3 55 890.5156 2 41.78 2.7 31 32 32 86 85 93 50 50 32 62 63 85 62 31 31 [323.2]VLY[657.4]S[318.1] 3536 YLRGLCVNFGS(+79.97)FSCVNK 10.3 61 662.9711 3 41.791 1.2 31 48 45 69 59 58 71 65 59 66 78 64 60 64 61 70 52 [1967.9] 3541 QLDLVDKLQMK 6.7 61 444.2512 3 41.855 0.8 53 49 50 50 89 88 71 65 45 59 47 [469.3]VD[628.4]

PAGE 361

361 3544 SSFDDYVEGLR 8.2 75 644.2959 2 41.882 0.5 51 56 56 95 89 96 97 92 69 82 36 [321.1]DDYVE[57.0]L[156.1] 3545 QLDLVDQLKMK 7.9 71 665.8736 2 41.892 0 69 78 88 94 97 95 58 58 52 60 31 [241.1]DLVD[628.4] 3549 DM(+15.99)ETLSKLSK 8 80 584.2987 2 41.944 2 31 97 97 95 82 67 72 88 92 72 [115.0]M(+15.99)ETL[215.1]LS[128.1] 3551 KMDRDASYVY(+79.97)VNK 9.1 70 834.8772 2 41.966 1.2 81 80 60 52 79 84 94 95 96 31 66 31 51 KM[386.2]ASYV[584.2] 3559 APWLKRMGPGWRR 8 62 537.6335 3 42.067 0.9 31 55 54 45 34 52 55 82 89 87 71 68 75 [882.5]GPG[498.3] 3560 NWFRLWASR 6.8 76 412.552 3 42.078 1.5 70 81 70 85 93 74 84 90 31 [114.0]W[147.1]RL[186.1]AS[156.1] 3561 LVDSMQATLDSEVR 12.6 90 782.3873 2 42.089 0.6 69 76 90 91 92 89 96 95 96 97 94 89 89 89 [212.2]DSMQATLDSEVR 3562 FLRLYYKPYLVPVAYYK 10.2 60 732.7474 3 42.099 1 31 31 31 40 40 46 47 91 94 90 79 77 79 66 66 76 31 [983.6]PYL[820.4] 3563 RQWTVAELEELR 8.2 68 510.6082 3 42.111 2 43 43 39 60 70 90 94 96 31 87 92 71 [670.4]AEL[129.0]EL[156.1] 3565 VQLELNQLK 7.2 80 542.8216 2 42.145 0 68 63 96 86 85 87 78 90 64 [227.1]LELN[128.1]L[128.1] 3566 EQLLNAHGWYLR 7.2 60 500.5962 3 42.155 0.9 43 37 38 67 53 46 62 93 93 63 91 31 [805.4]GW[163.1]L[156.1] 3572 QLLGTLEEMR 8.7 87 595.3156 2 42.222 0.4 56 61 95 98 98 97 98 92 95 79 [241.1]LGTLEEM[156.1] 3575 DRRHNNDAVR 5.6 56 418.2135 3 42.253 0.5 32 32 31 68 64 79 71 65 69 46 [1233.6] 3577 VTSTELFK 4.5 56 462.7558 2 42.286 0.7 31 94 89 65 47 42 47 31 [99.1]TS[618.3] 3579 SPVRLS(+79.97)KNAQWR 7 58 507.9268 3 42.302 1.6 31 31 32 33 33 34 81 65 93 86 91 83 [719.3]K[114.0]AQWR 3583 LLTENGEFGR 6.8 68 568.2901 2 42.356 1.1 96 97 96 85 49 50 58 84 31 31 LLTE[300.1]F[213.1] 3585 NFADGVLKCLR 8.7 79 618.33 2 42.377 3 77 81 95 95 94 93 91 71 65 72 31 [114.0]FADGVL[500.3] 3586 LLGLNMGDLTK 7.5 69 587.8279 2 42.388 1.2 88 88 86 87 93 88 77 43 36 31 31 LLGLNM[514.3] 3587 MVSLLQEK 5.9 74 474.2642 2 42.4 1.9 97 97 97 31 85 54 74 51 MVS[113.1]L[385.2] 3590 LLYADFK 5.1 73 435.2416 2 42.441 0.8 98 97 90 82 80 31 31 LLYAD[275.2] 3591 RAY(+79.97)TKKLVSGALTR 9.1 65 548.6371 3 42.45 1.4 31 31 32 33 33 73 72 94 90 81 81 90 90 70 [940.5]VSGALT[156.1] 3592 LNGMVAELEELR 9 75 687.3575 2 42.461 1.1 47 52 86 96 97 96 96 96 31 69 72 52 [227.1]GMVAEL[527.3] 3595 KLDLVSGVVSPAK 9.7 74 438.2658 3 42.502 0.3 72 72 81 61 82 80 78 80 83 85 74 78 31 [241.2]D[113.1]VS[57.0]VVS[296.2] 3598 LLSLNSAPDFK 9.2 83 602.8338 2 42.532 2.6 94 94 94 95 91 90 87 77 68 91 31 LLSLNSA[212.1]F[128.1] 3599 LFQS(+79.97)HVRVMGAELR 10 72 574.9537 3 42.542 2.3 55 53 52 57 62 31 93 93 95 90 86 80 81 65 [791.3]RVMGAEL[156.1] 3601 LLPVLYPTSPLLYYK 8.9 60 890.5164 2 42.576 2.3 31 49 49 96 95 91 77 32 32 32 68 85 86 31 31 [323.2]VLY[495.3]LY[291.2] 3602 MFFSPANK 5.5 69 471.2309 2 42.587 0.5 31 31 31 95 95 95 90 80 [425.2]SPANK 3604 QLDLVDQLKLK 8.6 78 656.8953 2 42.608 0.1 81 93 96 95 98 95 62 72 61 70 31 QLDLVD[610.4] 3607 LKDLVDQLQMK 8.7 79 444.2516 3 42.65 0.3 94 91 81 81 87 86 68 78 70 74 56 LKDLVD[628.3] 3609 GTYDDYVEGLR 9.1 83 644.2963 2 42.668 0.2 69 78 91 95 93 95 97 91 72 83 39 [158.1]YDDYVE[57.0]L[156.1] 3610 LLRERMMAEELKK 7.5 58 549.6411 3 42.678 0.4 35 40 40 43 39 60 69 91 93 75 65 66 31 [929.5]AE[498.3]

PAGE 362

362 3611 DNAAVPSR 5.2 65 415.2115 2 42.69 0.6 31 69 73 90 93 94 31 31 [300.1]AVP[243.1] 3620 LVLSTLGEK 5.5 61 480.292 2 42.803 0.4 31 31 96 91 84 62 53 54 40 [212.2]LST[427.2] 3623 YPHWLVLANFLSNR 9.4 67 865.4603 2 42.832 2.2 75 75 75 31 96 65 63 40 40 79 82 75 79 55 [583.3]L[544.3]L[357.2] 3625 FTQQVLADASR 6.4 58 412.5522 3 42.866 3.5 35 36 33 36 46 80 86 86 81 84 31 [603.3]LADAS[156.1] 3626 VVS(+79.97)KLKNTSLLNSK 9 65 537.6338 3 42.876 0.5 77 58 57 46 39 46 52 85 94 93 83 56 71 40 [848.5]TSLL[329.2] 3628 LVDSMQATLDSEVR 12.6 90 782.3882 2 42.895 0.5 65 74 90 94 95 91 97 97 97 96 93 89 90 89 [212.2]DSMQATLDSEVR 3629 FFFLRKLELVPYVAYYK 10 59 732.7471 3 42.906 0.6 31 31 32 34 33 47 63 94 88 76 78 76 58 55 76 84 31 [951.6]EL[692.4]Y[128.1] 3631 VQLELNQLK 6.5 73 542.8226 2 42.941 1.9 66 61 94 82 80 64 60 84 60 [227.1]LEL[242.1]L[128.1] 3634 WWLLMAARGMHK 7.6 63 500.597 3 42.967 0 31 57 68 54 66 68 70 86 83 70 71 31 [871.4]RG[396.2] 3635 KWWAVAELEELR 7.9 66 510.6086 3 42.978 0.3 32 32 36 46 53 87 93 97 31 95 96 84 [670.4]AEL[129.0]ELR 3638 LQLGTLEEMR 8.4 84 595.3159 2 43.02 0 48 46 89 96 96 96 96 93 95 79 [241.1]LGTLEEM[156.1] 3641 YVGCAVMPLSK 7.8 71 584.2983 2 43.052 0.6 31 95 86 52 52 58 95 95 95 31 81 [163.1]VG[273.1]MPL[87.0]K 3643 SLSTELFK 6.1 76 462.7551 2 43.085 0.8 31 95 93 88 86 88 95 31 [87.0]LSTELF[128.1] 3645 ALTWQTFNAQWR 8 67 507.9267 3 43.103 3.9 71 71 77 39 34 35 36 71 94 88 92 85 [961.5]AQWR 3650 LLTENGEFGR 7.1 71 568.2908 2 43.165 0.2 92 95 95 93 58 59 63 87 31 31 LLTE[300.1]F[213.1] 3651 WCVNGHPKLGKAHAALR 9.7 57 620.0068 3 43.175 2.3 56 56 55 42 40 41 59 69 87 84 63 50 50 65 65 52 31 [921.4]LG[747.5] 3653 LLGLNSADMLK 8.4 76 587.8284 2 43.197 0.5 98 97 96 96 89 63 51 52 70 74 49 LLGLN[645.3] 3657 LLTTLT(+79.97)K 4.3 62 435.2419 2 43.248 2.5 98 98 95 44 31 31 31 LLT[523.2] 3659 KVY(+79.97)PFLLVSQLTR 8 62 548.6367 3 43.266 2.2 32 32 31 31 54 62 83 93 91 77 77 79 53 [827.4]LVS[498.3] 3662 KLDLVSGVVSPAK 8 61 438.2657 3 43.309 0.5 43 41 41 36 83 68 66 71 86 86 68 70 31 [469.3]V[243.1]VS[296.2] 3663 NYVAGVLWASR 8.2 74 618.33 2 43.319 0.2 40 40 40 91 93 93 95 97 94 96 31 [376.2]AGVLWAS[156.1] 3664 NLGMVAELEELR 9.5 79 687.3578 2 43.33 0.5 51 54 89 97 97 96 92 93 31 87 90 70 [227.1]GMVAEL[129.0]EL[156.1] 3665 Y(+79.97)RYRTVKMGAELR 8.3 64 574.9542 3 43.341 1.5 54 33 34 47 41 47 60 93 91 88 84 83 67 [1046.5]MGAEL[156.1] 3667 HTSSS(+79.97)R 3.4 56 377.6472 2 43.375 1.1 80 80 80 31 31 31 HTS[410.1] 3668 EPPVLYPLALTLQTPK 9.8 62 890.515 2 43.385 1.4 31 31 31 96 96 96 86 80 54 41 54 70 62 50 67 31 [323.1]VLYPL[852.5] 3671 LLSLNSADMLK 8.8 80 602.8339 2 43.417 0 93 92 91 93 90 83 77 73 68 69 46 LLSLNS[558.3] 3673 KLDLVDKMSGPK 7.6 64 444.2514 3 43.451 0.3 75 75 75 34 80 78 77 74 60 50 47 31 [469.3]V[743.4] 3677 QEDRGPK 4.3 62 415.2114 2 43.49 0.8 52 54 55 88 75 74 31 [372.1]R[282.2] 3685 LLRTKSPPVKAVGNWNK 10.1 60 636.712 3 43.592 2 87 87 48 39 39 45 83 62 66 73 47 52 89 67 40 43 39 LL[472.3]P[494.3]G[542.3] 3686 VLLSTLGEK 5.9 66 480.2923 2 43.603 0.2 31 31 96 95 93 88 58 59 36 [212.2]LSTL[314.2] 3687 TGYDDYVEGLR 9 82 644.2971 2 43.613 1.3 59 71 86 94 96 97 98 94 74 87 39 [158.1]YDDYVE[57.0]L[156.1]

PAGE 363

363 3689 YRLCAPVPCSVLR 7.8 60 492.932 3 43.633 0 32 56 40 49 47 58 68 92 92 94 84 31 31 [802.4]PCSV[269.2] 3691 FNGWVLADVSK 7.5 69 412.5522 3 43.667 0.2 54 43 37 38 90 86 84 93 96 96 31 [504.2]VLADVS[128.1] 3692 WFKRKCTSLLNSK 7.5 58 537.6339 3 43.677 2.3 31 33 33 33 38 43 79 95 94 82 61 76 45 [949.5]SLL[329.2] 3693 VLDSMQATLDSEVR 10.5 75 782.3879 2 43.688 0.2 46 47 46 44 50 74 97 97 97 96 92 87 87 87 [673.3]ATLDSEVR 3697 VQLELNQLK 7.4 82 542.8218 2 43.742 0.4 67 62 95 88 88 88 83 92 69 [227.1]LELNQL[128.1] 3699 LLWWVCARGMHK 6.8 57 500.5963 3 43.76 1.3 31 40 31 53 57 55 69 84 80 71 71 31 [871.4]RG[396.2] 3701 RGFNPVAELEELR 8.9 69 510.6084 3 43.78 2.4 37 36 38 40 60 85 93 97 98 31 94 96 82 [571.3]VAEL[129.0]ELR 3704 QLLGTLEEMR 8.5 85 595.3161 2 43.822 0.4 48 50 93 97 96 96 96 93 95 80 [241.1]LGTLEEMR 3709 SLSTELFK 5.6 70 462.7558 2 43.885 0.7 31 95 90 76 68 76 90 31 [87.0]LS[343.2]F[128.1] 3711 RHLHM(+15.99)DGVAKEGR 8.1 63 507.9268 3 43.903 2.9 36 36 42 65 65 78 78 82 90 79 57 59 37 [862.4]VA[470.3] 3715 LLTEQATTCR 7.1 71 568.2916 2 43.956 1.5 97 97 96 96 45 41 42 73 74 49 LLTE[660.3] 3716 WTQRLHRGGKHAPWK 8.8 58 620.0078 3 43.966 0.4 33 40 36 42 44 39 51 72 93 88 77 70 66 66 51 [1034.6]GK[619.3] 3718 LLGLNTGDMLK 7.7 70 587.8294 2 43.986 1.2 96 94 95 94 85 69 68 49 41 40 33 LLGLN[645.3] 3719 MVEALTVGK 5.8 65 474.265 2 43.997 0.3 86 86 82 66 60 50 56 61 31 MVE[569.4] 3722 LLYGEFK 4.8 69 435.2419 2 44.04 0.1 98 97 87 69 63 31 31 LLY[461.2] 3723 QVNWWNLVSKLTR 9.6 74 548.6373 3 44.051 2.4 38 38 49 67 70 80 80 95 96 95 90 89 68 [713.3]NLVSKLT[156.1] 3724 DQLRAVVNASCR 7 58 666.3455 2 44.062 0.7 39 37 73 63 66 86 44 40 70 73 71 31 [583.3]V[630.3] 3725 QLDLVDKLQLK 8.2 74 656.8951 2 44.074 0.3 67 73 86 78 97 96 71 63 48 76 57 [241.1]D[113.1]VD[610.4] 3728 KLDLVSGVVSPAK 8.6 67 438.2663 3 44.116 0.8 50 49 53 43 91 91 79 77 74 84 67 68 31 [469.3]VS[255.2]S[296.2] 3729 YRGAGVLWADK 8.4 76 618.33 2 44.126 0.2 54 59 64 81 86 92 94 90 81 82 51 [376.2]AGVLWAD[128.1] 3730 QVGMVAELEELR 9.4 79 687.3585 2 44.137 0.4 51 56 80 95 97 97 97 97 31 84 87 65 [227.1]GMVAEL[129.0]EL[156.1] 3731 SSWM(+15.99)WPKKMGAELR 8.7 62 574.9545 3 44.148 2.1 62 62 62 31 31 57 72 93 95 78 70 55 52 44 [918.4]KM[526.3] 3734 LLPVLYPGEVLLYYK 9.9 66 890.5165 2 44.19 2.1 31 80 80 97 95 87 83 61 37 36 61 84 81 31 31 [113.1]LPVLYP[398.2]LY[291.2] 3737 CMGCAAAK 4.9 61 377.657 2 44.22 3 48 49 54 58 80 81 81 31 [394.1]AAA[128.1] 3739 YLKMGHLMLPK 6.3 57 444.251 3 44.253 0.9 32 40 35 37 48 73 92 82 74 76 31 [729.4]LM[338.2] 3740 LLSLNSADMLK 8.7 79 602.8337 2 44.264 0.3 95 95 94 95 91 86 83 69 59 56 38 LLSLNSA[487.2] 3742 TQAASSHK 5.2 65 415.2108 2 44.284 2.4 31 69 82 88 89 92 31 31 [229.1]AASS[265.2] 3757 M(+15.99)NEKLRDVSK 6.7 67 412.5518 3 44.472 0.4 53 42 42 46 85 89 91 94 95 31 [518.2]LRDVS[128.1] 3759 LVDSMQATLDSEVR 11.7 83 782.3873 2 44.493 0.6 61 67 82 69 69 76 95 96 97 96 92 86 86 85 [212.2]D[346.1]ATLDSEVR 3761 DFETTNLLSK 6.4 64 584.2974 2 44.516 1.3 31 31 65 87 84 61 61 73 81 58 [391.1]TT[340.2]S[128.1] 3764 VQLELNQLK 7.2 80 542.8225 2 44.557 1.7 68 63 95 88 88 86 76 89 64 [227.1]LELN[128.1]L[128.1]

PAGE 364

364 3767 WTRNLAELEELR 7.4 61 510.6086 3 44.588 2.7 32 47 40 47 48 87 94 97 31 70 82 55 [670.4]AEL[258.1]L[156.1] 3770 QLLGTLEEMR 8.6 86 595.3159 2 44.63 0 51 53 94 97 97 97 98 93 95 80 [241.1]LGTLEEMR 3775 SLSTELFK 5.7 72 462.7556 2 44.693 0.4 31 95 90 78 72 81 91 31 [87.0]LS[230.1]LF[128.1] 3777 RHTM(+15.99)MM(+15.99)VSKLTR 8.4 70 508.2611 3 44.711 2.4 38 45 41 50 64 96 96 91 81 80 87 70 [672.3]M(+15.99)VSKLT[156.1] 3781 LLTEQDGFGR 7.4 74 568.2905 2 44.762 0.3 94 96 95 92 49 49 54 89 86 31 LLTE[300.1]FG[156.1] 3782 LWWKPNDTPDTAPWK 8.6 58 618.9781 3 44.772 1.4 31 31 47 65 41 46 57 62 86 76 67 68 64 65 49 [1040.5]P[698.3] 3788 LLYADFK 5.3 76 435.2417 2 44.842 0.6 98 97 92 90 90 31 31 LLYAD[275.2] 3790 RRGLHCAM(+15.99)VSKLTR 9.4 67 548.6371 3 44.861 1.4 36 43 43 46 48 31 83 84 84 94 94 90 90 63 [722.4]AM(+15.99)VSKLT[156.1] 3794 LKDLVSLAASPAK 8.8 67 438.2664 3 44.911 1 83 49 47 54 31 82 81 88 91 87 73 73 31 L[455.3]SLAAS[296.2] 3797 NLGMVALEEELR 8.5 71 687.3587 2 44.945 0.7 44 45 59 93 97 96 90 91 31 70 77 53 [284.1]MVALE[527.3] 3799 LLVPLYPPSTLLYYK 10.4 70 890.5157 2 44.979 2.9 82 82 82 94 92 90 91 69 38 38 45 86 86 31 31 LLVPLYP[398.2]LY[291.2] 3803 MFAPYANK 5.4 67 471.2315 2 45.02 0.8 90 90 90 31 31 92 31 77 MFA[260.1]A[242.1] 3805 QLYNQDVLLPK 6.7 60 444.2515 3 45.052 2.6 53 44 39 40 63 86 83 82 77 62 31 [646.3]DVL[338.2] 3806 LLSLNSADFPK 9.7 88 602.834 2 45.062 2.9 96 95 95 95 91 89 89 92 92 92 31 LLSLNSADFP[128.1] 3808 CCGMANR 4.1 59 377.6434 2 45.081 0.4 31 33 50 57 88 88 64 [394.1]AN[156.1] 3809 NFDKVLADWK 7.7 77 618.325 2 45.091 0.7 76 82 90 89 82 71 71 86 88 31 [114.0]FDKV[184.1]DW[128.1] 3815 LLGLNSADMLK 8.9 81 587.8284 2 45.163 0.5 92 91 94 94 92 93 80 71 65 66 44 LLGLNSA[487.2] 3817 HNRKKKWKLAGTRER 8.3 55 636.7114 3 45.197 2.5 58 36 35 31 31 48 47 46 54 69 81 88 80 82 31 [1289.8]GTRE[156.1] 3823 RYGQVLADADK 7.4 67 412.5514 3 45.271 1.3 33 35 36 49 64 87 90 93 90 91 66 [603.3]LADAD[128.1] 3825 VLDSMQATLDSEVR 12.2 87 782.3879 2 45.293 0.2 78 83 93 93 93 90 97 97 97 95 87 69 70 68 [99.1]LDSMQATLDS[384.2] 3826 WWFYRLYPTKTLRPLR 9 56 732.7463 3 45.304 0.7 31 31 31 32 32 71 77 86 78 65 67 75 68 61 58 31 [1114.5]P[965.6] 3830 VQLELQQVK 6.2 69 542.8217 2 45.358 0.1 85 79 96 93 81 52 38 53 38 V[128.1]LEL[483.3] 3832 FFVKTK 3.8 63 385.2348 2 45.379 2.3 63 63 67 75 77 31 [750.4] 3833 RQWTVAELEELR 7.9 66 510.6085 3 45.39 2.6 45 44 39 44 55 85 95 97 31 87 91 70 [670.4]AEL[129.0]EL[156.1] 3836 QLLGTLEEMR 8.5 85 595.3159 2 45.432 0 48 50 95 98 97 97 97 91 94 77 [241.1]LGTLEEM[156.1] 3844 WWWM(+15.99)LVNTLTR 8 73 507.9263 3 45.523 1.8 31 31 31 91 91 95 90 92 90 85 65 [558.2]M(+15.99)LVNTLT[156.1] 3847 LLTENGEFGR 7.4 74 568.2905 2 45.569 0.3 92 95 94 92 63 67 81 87 31 31 LLTE[171.1]EF[213.1] 3849 VLKRSLKEYCTGFWK 9.3 62 620.0068 3 45.588 0.9 94 92 59 44 43 66 59 58 43 63 84 62 56 55 46 VL[1007.5]T[518.3] 3853 VLFGMLSVYFK 6.5 59 435.2411 3 45.641 2.4 31 38 41 56 69 90 92 88 80 31 31 [547.3]LSVY[275.2] 3862 NVAMVALEEELR 8.8 73 687.3581 2 45.747 0.2 50 50 52 93 96 94 80 81 31 87 89 69 [284.1]MVALE[129.0]EL[156.1] 3865 LLVPLYPPVTTLYYK 10.4 69 890.5157 2 45.791 2.9 64 64 64 93 93 96 97 98 37 37 50 85 90 31 31 [325.2]PLYPP[301.2]LY[291.2]

PAGE 365

365 3867 VFT(+79.97)QVHRVMGAELR 9.4 67 574.9543 3 45.812 1.4 31 78 42 39 39 65 95 94 92 87 74 67 71 59 [791.3]RVMG[469.3] 3874 MFAYPANK 6.7 83 471.2311 2 45.896 0.1 92 92 92 31 97 94 89 78 MFA[163.1]PAN[128.1] 3875 LLSLLAANM(+15.99)DK 7.7 70 602.8338 2 45.908 0.2 95 93 75 75 76 78 47 45 66 81 31 LL[716.3]D[128.1] 3884 LVLSTLGEK 5.6 62 480.2922 2 46.022 0.1 31 31 95 88 80 71 59 60 39 [212.2]LST[427.2] 3886 LLGLNGTDMLK 8.4 77 587.829 2 46.04 0.6 95 92 90 85 82 79 66 65 66 70 46 LLGLN[645.3] 3889 NM(+15.99)SRVLADVSK 8.8 80 412.5519 3 46.085 0 72 79 81 69 75 89 91 91 96 97 31 [261.1]S[255.2]LADVS[128.1] 3892 LVDSMQATLDSEVR 10.6 76 782.3872 2 46.115 0.7 56 62 78 53 53 67 96 96 96 93 75 68 81 81 [673.3]ATLD[216.1]VR 3893 WRYWFLYPVMPVGLLKK 9.5 56 732.7462 3 46.126 2.2 32 31 37 39 42 88 76 90 58 56 59 76 61 56 55 57 31 [838.4]L[163.1]P[965.6] 3896 VQLELNQLK 6.3 70 542.8214 2 46.169 0.4 59 55 74 94 93 69 54 75 52 [340.2]EL[483.3] 3898 LREFLEANSPPTR 8.5 66 510.6079 3 46.187 1.3 37 36 38 68 86 88 93 90 95 89 49 49 31 [545.3]LEANSP[354.2] 3899 LLKKFNAGHT(+79.97)YK 6.6 55 500.5962 3 46.198 2.1 35 35 35 67 43 44 54 70 93 90 31 62 [871.5]HT(+79.97)[291.2] 3903 QLLGTLEEMR 8.4 84 595.3157 2 46.248 0.3 48 50 93 97 97 97 97 90 92 74 [241.1]LGTLEEM[156.1] 3907 SLSTELFK 5.4 67 462.7552 2 46.301 0.5 31 92 89 85 67 58 78 31 [87.0]LST[517.3] 3909 AELVSQLTR 6.1 68 508.7906 2 46.319 0.5 42 48 54 88 56 52 89 93 81 [313.2]V[215.1]LTR 3913 LLTEEGNFGR 7.4 74 568.2904 2 46.374 0.5 92 94 93 93 55 51 49 86 88 31 LLTE[300.1]FG[156.1] 3915 LVKY(+79.97)HRTNKGLRHR 7.9 56 620.0085 3 46.394 2 75 75 65 53 42 46 51 72 76 58 54 53 31 31 [1839.0] 3916 FNWGVLWWK 7.6 85 618.32 2 46.405 2.6 79 73 72 89 94 94 93 81 83 [447.2]GVLWWK 3920 LLYDAFK 4.5 65 435.2415 2 46.458 1.1 96 95 77 63 57 31 31 LL[624.3] 3923 YPHSVLLVAALCSSNR 11.8 74 865.4572 2 46.49 1 81 81 81 31 94 96 69 46 58 66 89 89 88 72 77 50 YPH[87.0]VL[354.2]LCS[357.2] 3926 LQDLVSLAAAALK 9.4 72 438.266 3 46.533 0.1 90 56 63 76 31 90 90 93 93 88 70 64 31 L[455.2]SLAAA[312.2] 3927 WREREALVSQLTR 8 62 548.6379 3 46.543 0.9 34 34 32 44 42 49 59 92 88 80 87 88 68 [940.5]VSQLT[156.1] 3933 QVGMVALEEELR 8.4 70 687.3582 2 46.62 0 44 46 83 92 94 96 93 94 31 50 65 43 [227.1]GMVALE[527.3] 3938 QLYNPNLDLLK 6.4 58 444.2512 3 46.684 1.9 54 66 46 46 57 60 82 76 49 66 31 [729.3]L[469.3] 3940 HS(+79.97)KEVMRVMKELR 8.3 64 574.9551 3 46.703 2 31 50 40 37 51 51 65 89 91 85 83 85 68 [947.4]VMKEL[156.1] 3953 KVVGSK 3.5 58 309.2034 2 46.852 2.3 31 79 69 69 69 31 [598.4] 3955 WNFGVLADVSK 8.1 74 412.5524 3 46.885 0.7 57 53 53 75 82 88 87 91 95 95 31 [504.2]VLADVS[128.1] 3957 VVS(+79.97)LKKNTSLLNSK 8.2 59 537.6331 3 46.904 1.7 35 35 35 52 55 64 64 93 95 88 63 44 56 36 [848.5]TSL[442.3] 3959 LVLSTLGEK 5.3 59 480.292 2 46.925 0.4 31 31 93 91 88 67 44 44 33 [212.2]LST[427.2] 3963 VQLELNQLK 6.5 72 542.8213 2 46.974 0.6 86 83 96 81 75 60 50 71 45 VQLE[596.4] 3964 VLDSMQATLDSEVR 12.6 90 782.387 2 46.984 0.9 75 76 88 87 88 86 97 97 97 96 94 89 90 89 [212.2]DSMQATLDSEVR 3970 QLLGTLEEMR 8.6 86 595.3152 2 47.054 1 51 53 94 97 96 96 97 94 95 81 [241.1]LGTLEEMR

PAGE 366

366 3971 LLGLNRM(+15.99)WR 6.7 74 587.8286 2 47.063 1.1 96 94 95 94 93 94 31 31 31 LLGLNR[489.2] 3973 SLSTELFK 5.6 70 462.7556 2 47.098 0.2 31 95 94 86 69 65 86 31 [87.0]LST[242.1]F[128.1] 3975 KPKAHHDMLK 6.6 66 602.8355 2 47.116 1.6 31 93 92 92 94 31 68 57 57 39 [128.1]PKAH[624.3] 3980 LLTEQDGFGR 7.2 72 568.2906 2 47.182 0.1 94 95 95 94 47 45 50 86 78 31 LLTE[300.1]F[213.1] 3981 YYAWLALPGGKAHAALR 10.2 60 620.0072 3 47.192 2.8 54 53 48 44 68 47 40 54 71 87 80 74 68 80 66 45 31 [1034.5]GK[208.1]A[340.2] 3983 EALVSQLTR 6.9 77 508.7899 2 47.214 0.9 44 59 63 91 88 77 90 93 81 [313.2]VS[128.1]LTR 3986 LLYADFK 4.5 64 435.242 2 47.257 0 97 97 82 56 50 31 31 LLY[461.2] 3988 LVRDNYACVRYK 6.7 56 500.5968 3 47.278 1.9 32 36 37 50 57 73 51 51 71 84 64 62 [1033.5]R[291.2] 3989 MEAKGFMK 4.5 56 471.2315 2 47.288 2.7 31 96 95 67 39 39 44 31 [131.0]EA[591.3] 3993 EYLMHPGLVSKLTR 9.2 66 548.637 3 47.339 1.6 31 31 38 39 46 55 65 87 95 95 93 89 88 64 [827.4]LVSKLT[156.1] 3994 NFEGRLWVSK 7.7 77 618.33 2 47.35 0.2 70 76 67 74 87 89 81 96 97 31 [447.2]RLWVS[128.1] 3997 LLPVLYSLLPYPTYK 10.3 69 890.5163 2 47.395 2.3 31 32 32 97 97 97 83 81 70 72 85 82 67 64 31 [323.2]VLYSL[210.1]YP[392.2] 4007 SNFADGRLR 5.8 64 518.27 2 47.508 0.1 31 73 79 89 89 81 70 31 31 [348.1]ADG[425.3] 4011 RAGMVALENWAR 9.3 77 687.3574 2 47.563 2.2 55 61 79 95 96 95 81 79 84 75 91 31 [284.2]MVAL[129.0]N[186.1]A[156.1] 4022 QKM(+15.99)TVLADASR 6.4 58 412.5517 3 47.704 0.6 31 33 32 34 56 78 79 89 85 88 31 [787.4]DAS[156.1] 4023 WHLHFKTVTLNSK 8.3 64 537.6331 3 47.715 2.8 31 31 31 31 63 67 74 85 89 88 83 89 63 [949.5]VTLNS[128.1] 4028 QVLELNQLK 6.6 74 542.8214 2 47.777 0.3 60 66 95 92 88 59 57 81 60 [227.1]LEL[242.1]L[128.1] 4030 LVDSMQATLDDTVR 11.3 81 782.3871 2 47.795 0.8 64 71 87 89 89 86 96 96 96 96 71 62 71 49 [212.2]DSMQATLD[471.2] 4036 QLLGTLEEMR 8.4 84 595.3157 2 47.864 0.2 50 52 94 97 95 95 96 91 92 75 [241.1]LGTLEEM[156.1] 4037 ETLSHSR 4 57 415.211 2 47.874 1.8 70 70 81 83 31 31 31 [230.1]LS[380.2] 4039 SLSETLFK 4.4 55 462.7552 2 47.908 0.6 31 96 86 59 48 53 31 31 [87.0]LS[618.3] 4043 LLSTPM(+15.99)SVNVK 8 73 602.8347 2 47.946 1.2 86 88 85 87 89 71 59 51 51 62 67 LLSTP[674.3] 4045 LLTEMNRCR 5.8 65 568.2903 2 47.979 2 85 89 86 87 91 39 38 32 31 LLTEM[529.3] 4046 M(+15.99)VT(+79.97)NEK 3.5 59 409.1618 2 47.988 0.3 31 93 93 66 31 34 [147.0]VT(+79.97)[371.2] 4058 KLDLVSGVVSAPK 9.3 72 438.2662 3 48.136 0.5 74 74 76 36 87 82 81 78 77 77 73 81 31 [469.3]VSG[356.2]P[128.1] 4059 YYTRLPKLGYWRNK 7.8 55 620.0078 3 48.146 1.9 48 46 41 48 65 52 55 63 89 85 59 45 36 36 [1034.6]GY[584.3] 4060 EPM(+15.99)YRLVCVFVK 6.9 58 500.5963 3 48.157 0.4 31 31 31 73 62 56 84 85 87 81 31 31 [805.4]VCVF[227.2] 4061 YERNKHLVSQLTR 8.3 64 548.6368 3 48.168 1.1 31 63 40 39 40 55 61 96 91 82 83 84 61 [940.5]VSQLT[156.1] 4067 FLPLKKKAKLK 6.7 61 657.4569 2 48.245 2.7 31 56 82 89 92 31 31 77 70 73 31 [260.2]PLK[696.5] 4076 S(+79.97)MHT(+79.97)EGQY(+79.97)K 5 56 660.6697 2 48.363 33.8 31 31 31 94 84 83 48 54 42 [435.1]T(+79.97)EG[499.2] 4077 QM(+15.99)MSLVGWGPTGLY(+79.97)R 9 60 896.4 2 48.375 1.7 57 40 35 36 50 68 71 79 63 73 94 88 77 31 31 [1102.5]TG[512.2]

PAGE 367

367 4087 WFNGVLADVSK 7.6 69 412.5526 3 48.506 1.2 31 44 57 71 83 85 79 85 95 96 31 [504.2]VL[71.0]DVS[128.1] 4088 T(+79.97)LLAKKNTSLLNSK 9.1 65 537.6337 3 48.516 0.6 31 31 42 53 75 74 68 80 95 93 83 60 75 43 [848.5]TSLL[329.2] 4089 LVLSTLADK 5.4 60 480.2925 2 48.527 0.6 31 31 96 91 85 73 47 44 32 [212.2]LST[427.2] 4094 VQLELNQLK 6.5 73 542.8212 2 48.589 0.8 63 58 91 79 75 80 65 82 57 [227.1]L[242.1]N[128.1]L[128.1] 4102 QLLGTLEEMR 8.6 86 595.3158 2 48.681 0.1 59 63 93 97 97 97 98 90 91 73 [241.1]LGTLEEM[156.1] 4105 SLSTELFK 5.4 68 462.7552 2 48.725 0.5 31 94 88 69 63 75 87 31 [87.0]LS[343.2]F[128.1] 4106 DATKMNK 4 57 404.2063 2 48.735 2.9 52 52 58 92 55 55 33 [287.1]K[373.2] 4107 VLDSMQATLDSEVR 11 78 782.3868 2 48.746 1.2 54 58 68 53 53 66 95 95 97 97 93 86 87 86 [673.3]ATLDSEVR 4108 MMDS(+79.97)NGMPER 5.5 55 416.4801 3 48.757 0.2 37 34 54 51 67 80 79 81 31 31 [658.2]G[131.0]P[285.1] 4111 LLTEEGNFGR 7 70 568.2899 2 48.803 1.5 89 92 90 90 54 52 51 70 74 31 LLTE[660.3] 4112 LLSLNASDLMK 7.7 70 602.8336 2 48.814 0.6 79 81 81 84 77 76 78 79 47 47 32 [113.1]LSL[759.4] 4115 ASYDDYVEGLR 8.4 77 644.2961 2 48.849 0.1 88 88 83 82 92 96 95 76 49 56 31 ASYDDYV[455.2] 4118 TLYLGLYWFK 6.4 64 435.24 3 48.893 2.3 42 44 48 39 63 92 85 63 79 85 [547.3]LY[333.1]K 4119 EALVSQLTR 7.1 79 508.7904 2 48.904 0.1 54 67 82 93 80 76 88 89 74 [200.1]LVS[128.1]LT[156.1] 4124 LKDLVSLQTAPK 6.9 58 438.266 3 48.967 0.1 80 42 39 39 31 86 85 56 72 63 65 31 L[455.3]SL[525.3] 4125 MVS(+79.97)SVLLAPGGKAHAVLK 11.1 62 620.0066 3 48.977 1.8 76 77 77 83 72 69 49 48 60 69 70 72 60 54 46 43 44 31 [397.1]S[1354.8] 4130 Y(+79.97)RRFGSTVLGTMVR 8.3 59 574.954 3 49.041 2 32 32 44 48 61 64 81 94 90 85 55 53 54 31 [846.4]TVLG[487.3] 4131 KQFRT(+79.97)SLVSKLTR 7.7 60 548.637 3 49.052 1.7 43 43 39 54 36 36 45 31 96 94 90 89 72 [1039.5]SKLT[156.1] 4132 TLWNRAELEELR 7.5 63 510.6084 3 49.063 2.3 32 32 39 42 57 78 91 96 31 87 92 71 [741.4]EL[129.0]EL[156.1] 4136 T(+79.97)PALLKPVTVSDR 8.1 62 492.9318 3 49.119 0.9 73 70 48 48 63 66 70 89 31 73 66 73 31 [800.4]V[558.3] 4138 DM(+15.99)ETTVKLSK 8.1 81 584.2987 2 49.141 2 31 96 95 94 79 74 81 91 93 75 [115.0]M(+15.99)ET[200.1]KLS[128.1] 4142 NYVAGVLWASR 8.6 79 618.33 2 49.195 0.2 59 60 64 86 93 92 93 96 92 94 31 [376.2]AGVLWAS[156.1] 4143 LLGLNSADMLK 7.9 72 587.8292 2 49.206 0.8 95 92 79 76 75 72 62 63 65 66 42 LL[929.5] 4144 YPHSVLPTRLLT(+79.97)PR 9.5 68 865.4593 2 49.218 2 93 93 93 31 31 97 87 83 84 94 45 40 44 31 YPH[186.1]LPTRL[547.3] 4150 NVAMVAELEELR 9.7 81 687.3585 2 49.292 0.4 60 64 73 97 97 97 95 95 31 90 90 73 [284.1]MVAEL[129.0]EL[156.1] 4153 NFGWVLADVSK 8.5 77 412.5521 3 49.335 0.1 69 77 66 31 97 97 93 93 96 96 31 [504.2]VLADVS[128.1] 4155 LVLSTLGEK 5.1 57 480.2921 2 49.356 0.2 31 31 93 84 71 57 50 50 36 [212.2]LS[528.3] 4159 VQLELNQLK 6.6 73 542.8216 2 49.411 0 56 52 85 84 82 79 71 85 58 [227.1]LEL[242.1]L[128.1] 4162 RHKNYSFFLKKRR 8.1 62 890.516 2 49.441 0.3 31 43 40 63 79 90 91 92 86 87 37 31 34 [698.4]SFFLK[440.3] 4165 QLLGTLEEMR 8.7 87 595.3159 2 49.487 0 53 56 95 98 97 97 97 94 96 83 [241.1]LGTLEEMR 4168 WYKSNNWVR 5.8 64 418.214 3 49.517 4.2 62 65 56 58 61 77 72 91 31 [978.4]V[156.1]

PAGE 368

368 4169 FMQYNLVAAFK 7.9 72 666.3455 2 49.527 1.6 31 93 82 83 75 90 91 91 88 31 31 [147.1]MQY[114.0]LVAA[275.2] 4171 SLSTELFK 6 75 462.7556 2 49.562 0.3 31 93 91 87 85 83 93 31 [87.0]LSTELF[128.1] 4172 LVDSMQATLDSEVR 12.6 90 782.3873 2 49.571 0.5 68 76 90 92 92 86 97 97 98 98 94 89 89 88 [212.2]DSMQATLDSEVR 4174 MELDDLSSNMEAVSK 12.9 86 834.8767 2 49.59 0.4 77 77 89 97 98 97 97 93 86 92 93 87 82 85 31 [260.1]LDDLSSNMEAVS[128.1] 4175 MKRRNCNGYNCTLDGNK 9.5 56 662.9719 3 49.601 2.2 80 32 32 50 51 81 65 52 58 83 76 44 40 41 53 69 31 M[554.3]C[334.1]N[731.3] 4177 LLTENGEFGR 7.1 71 568.2906 2 49.636 0.1 91 94 94 86 57 60 75 84 31 31 LLTE[300.1]F[213.1] 4178 RKFKMRHPYLVPVAYYK 9.9 58 732.7474 3 49.646 0.6 31 31 31 32 32 56 75 96 93 89 79 68 55 52 63 70 31 [983.6]PYL[820.4] 4180 LLSLNSADMLK 8.8 80 602.8337 2 49.669 0.3 94 95 95 95 78 65 64 83 79 79 52 LLSL[272.1]D[372.2] 4181 ASYDDYVEGLR 9.1 83 644.2965 2 49.679 0.5 51 51 81 96 97 97 96 94 89 92 62 [158.1]YDDYVEGL[156.1] 4184 RETRM(+15.99)SGQAKWR 7.1 59 507.9267 3 49.724 3 65 61 59 61 31 66 56 51 87 58 66 40 [961.4]A[470.3] 4185 RRTWAMSDRNTKK 7.7 60 550.6249 3 49.734 3 31 72 52 49 66 71 90 90 57 43 46 69 31 [801.4]SD[627.4] 4186 MVVTLQEK 5.9 73 474.2652 2 49.745 0.1 97 97 97 86 76 42 49 38 MVVT[498.3] 4187 MMGYKELAVSKLTR 10 72 813.9383 2 49.755 0.7 40 43 52 58 86 76 86 84 93 94 87 76 73 49 [482.2]K[129.0]LAVSK[370.2] 4189 MCVKGPPVKLLK 7.7 64 438.2661 3 49.789 0.6 95 90 62 55 51 54 37 84 69 70 65 31 MC[478.3]V[482.4] 4190 LVNAWLQPLGQAHPWK 9 56 620.0072 3 49.799 2.8 47 45 39 39 47 54 41 51 57 77 57 71 73 68 69 55 [1839.0] 4193 MFAPYANK 5.3 67 471.231 2 49.829 0.2 91 91 91 31 31 90 31 72 MFA[260.1]A[242.1] 4195 LLPVLYPCCVKKLYK 9.4 62 890.5162 2 49.862 0.7 31 41 41 84 91 95 98 94 83 76 64 34 34 31 31 [323.2]VLYPCC[759.5] 4197 TWHREHTVMGAELR 8.8 63 574.9539 3 49.884 1.2 32 32 32 33 42 45 76 86 95 94 90 79 77 59 [947.4]VMGA[398.2] 4198 KWWAVAELEELR 8.2 68 510.6081 3 49.895 0.7 32 32 41 65 69 87 95 97 31 91 94 77 [670.4]AEL[129.0]EL[156.1] 4202 DFETLSQLSK 6.6 66 584.2985 2 49.948 0.5 31 31 97 95 48 46 45 89 94 79 [262.1]ET[328.2]LS[128.1] 4203 AKFSEEVAGASKPR 9.4 67 492.9323 3 49.96 1.2 72 77 89 55 51 61 74 90 86 83 68 46 47 34 [199.1]F[444.2]AGA[468.3] 4205 FLCPRDAGVLR 6.1 56 416.23 3 49.981 2.3 31 31 31 45 57 70 82 83 72 75 31 [731.3]AG[368.3] 4208 TFKKKMDADGWLVASR 10.5 66 618.33 3 50.024 0.9 34 35 37 35 48 48 67 80 82 91 91 72 75 88 90 69 [878.5]ADGW[212.2]AS[156.1] 4210 LLGLNSADMLK 8.7 79 587.8291 2 50.047 0.7 93 90 86 86 88 82 75 72 70 72 48 LLGLNS[558.3] 4211 YYASVLPATKFLDNK 11.1 74 865.4591 2 50.058 2.9 63 63 85 94 97 96 82 57 47 61 88 86 77 71 31 [326.1]ASVLP[300.2]FL[357.2] 4216 QVGMVALEEELR 9.1 76 687.3583 2 50.121 0.2 42 45 71 95 97 96 90 91 31 87 89 69 [284.1]MVALE[129.0]EL[156.1] 4219 WNFRLWASR 6 67 412.5521 3 50.165 1.2 52 50 50 51 95 83 91 93 31 [603.3]LWAS[156.1] 4220 HSRRPTNTSLGTKR 7.9 57 537.6334 3 50.175 1.6 31 70 70 36 38 45 62 86 91 76 47 46 49 38 [848.4]TS[555.3] 4221 LVLSTLGEK 5.3 59 480.2924 2 50.186 0.5 31 31 95 93 88 72 42 42 31 [212.2]LST[427.2] 4223 QLDLVDKLQLK 8.5 77 656.8955 2 50.204 0.3 67 75 89 93 92 91 62 74 55 83 65 [241.1]DLVD[369.2]L[128.1] 4225 VQLELNQLK 6.4 71 542.8216 2 50.238 0 54 51 86 88 86 69 62 83 57 [227.1]LEL[242.1]L[128.1]

PAGE 369

369 4227 WRYLPHEMVRSLPETR 9 56 518.2717 4 50.256 2.4 32 32 37 37 44 67 68 54 50 70 83 88 75 51 51 47 [1367.7]SL[483.2] 4231 QLLGTLEEMR 8.7 87 595.316 2 50.312 0.3 54 57 95 97 96 95 96 94 96 82 [241.1]LGTLEEMR 4232 SVKYSNNDAVR 7.2 65 418.2139 3 50.322 0.7 31 42 47 53 80 71 76 89 82 86 57 [477.3]S[228.1]DAV[156.1] 4235 LDQYHHDNLNVLVAAFK 11.5 68 666.3456 3 50.352 0.7 48 47 59 41 43 45 78 86 89 66 72 93 92 92 87 70 31 [908.4]NL[213.1]LVAA[275.2] 4237 SLSTLEFK 5.9 74 462.7554 2 50.387 0.1 31 96 95 91 76 73 92 31 [87.0]LST[242.1]F[128.1] 4238 LVDSMQATLDSEVR 12 86 782.3871 2 50.396 0.8 69 74 87 67 67 79 97 97 97 97 94 90 90 90 [212.2]D[346.1]ATLDSEVR 4241 MELDDLSSNMEAVSK 12.1 80 834.8763 2 50.428 0.1 62 62 77 93 90 89 94 95 82 80 82 90 85 88 31 [373.2]DDLSSNMEAVS[128.1] 4243 LLTENGEFGR 6.8 68 568.291 2 50.462 0.4 94 95 95 92 51 51 58 81 31 31 LLTE[300.1]F[213.1] 4244 KKRKYTFELYVPVAYYK 10.7 63 732.7472 3 50.471 2.6 31 35 31 38 37 47 63 92 94 69 86 86 77 75 73 74 53 [951.6]EL[163.1]VP[624.3] 4245 LLSLNSADMLK 7.9 72 602.8338 2 50.483 0.2 94 93 93 94 87 66 63 56 51 51 41 LLSLN[645.3] 4247 ASYDDYVEGLR 9.1 82 644.2961 2 50.504 0.1 52 52 87 97 97 97 97 94 85 90 54 [158.1]YDDYVEGL[156.1] 4249 RHS(+79.97)KMKNAKWR 6.6 60 507.9268 3 50.538 2.7 37 37 34 41 52 70 78 85 81 80 58 [961.4]AKW[156.1] 4251 FNRKNEMECGGHSHVNK 11.1 65 662.972 3 50.56 0.3 58 42 43 47 45 48 77 90 90 89 83 76 77 65 60 61 54 [919.4]ECGG[702.4] 4252 MVSLPSSVK 5.1 57 474.2649 2 50.571 0.5 98 98 98 31 31 40 40 40 31 MVS[611.4] 4255 GRKKVSGVWAPK 7.4 62 438.2657 3 50.615 1.7 31 46 46 42 78 86 86 86 92 81 31 31 [568.4]SGVWA[225.1] 4256 LVKGSVLKEHEYDNVK 9.9 62 620.007 3 50.625 0.2 72 73 56 48 55 59 69 62 57 59 88 76 55 51 67 40 [1090.6]E[619.3] 4257 MKLLLVSSHT(+79.97)YK 8.1 68 500.596 3 50.637 2.9 70 55 55 59 80 82 85 85 84 69 31 51 [485.3]LVSSH[472.2] 4259 QALTWAMHGHELKK 8.5 61 550.6245 3 50.656 0.6 47 44 43 42 38 50 74 91 91 85 73 66 68 31 [801.4]HGH[498.3] 4261 QYT(+79.97)RKALVSKLTR 8.9 69 548.6371 3 50.69 1.4 56 40 43 41 47 66 76 92 94 92 88 87 63 [940.5]VSKLT[156.1] 4262 M(+15.99)QLNLGSSTVMGAELR 10.2 64 574.9542 3 50.701 1.8 51 51 41 41 48 51 52 31 91 91 96 93 84 70 69 53 [846.4]TVMGA[398.2] 4264 RQTWVAELEELR 8.2 68 510.6085 3 50.723 2.5 38 37 40 47 90 90 95 97 31 86 91 69 [571.3]VAEL[129.0]EL[156.1] 4267 QLDLVDKLQMK 6.4 58 444.2514 3 50.765 0.3 43 41 41 41 88 87 70 71 45 58 45 [469.3]VD[628.4] 4269 RM(+15.99)M(+15.99)PRVPKHHR 6.4 58 492.9318 3 50.787 1.5 32 48 42 62 31 31 93 88 74 56 74 [802.4]PK[430.2] 4270 DFETTNLLSK 6.7 67 584.298 2 50.797 0.3 31 31 95 89 46 46 63 94 95 78 [262.1]ET[328.2]LS[128.1] 4276 YYEHAKAAEPVAFGR 10.2 68 570.2851 3 50.871 2 57 44 39 56 77 63 87 95 92 79 74 70 74 76 31 [791.4]AAE[627.3] 4277 S(+79.97)S(+79.97)S(+79.97)CDECDWTAPASR 8.5 57 618.82 3 50.882 37.4 31 31 31 31 31 31 79 72 70 71 91 88 69 77 40 [1353.2]AP[314.2] 4281 TTKKTFGFALCK 7.4 62 448.9168 3 50.934 1.2 76 76 76 42 37 46 62 92 76 60 60 31 [763.4]F[415.2] 4282 TLEDQLSELK 7.2 72 588.3115 2 50.944 0.3 82 85 93 67 57 58 70 79 90 31 TLE[572.2]L[128.1] 4285 RLLHNTNTSGSVRR 8 57 537.6339 3 50.988 2.5 32 33 61 58 47 48 55 89 93 81 74 65 31 31 [848.5]TSG[498.3] 4286 LVLSTLADK 5.3 59 480.2921 2 50.999 0.3 31 31 96 88 77 64 51 50 36 [212.2]LS[528.3] 4287 M(+15.99)NSRVLADVSK 7.7 70 412.5521 3 51.008 0.4 55 44 45 48 84 87 90 94 95 95 31 [504.2]VLADVS[128.1]

PAGE 370

370 4288 QLEAEEQLEAVNSK 11.8 84 794.3969 2 51.019 0.3 63 65 83 93 97 95 86 95 96 96 94 75 87 50 [241.1]EAEEQLEAV[114.0]S[128.1] 4292 LNLELNQLK 6.5 72 542.8218 2 51.072 0.4 60 57 84 86 85 83 61 81 49 [227.1]LELN[128.1]L[128.1] 4294 T(+79.97)M(+15.99)MSCY(+79.97)K 4 57 520.14 2 51.094 0.8 31 73 73 73 82 31 31 [546.1]C[371.1] 4297 EARAHYHNVR 6.7 67 418.2143 3 51.14 0.9 35 35 36 60 71 92 91 82 88 77 [564.3]YHNV[156.1] 4301 S(+79.97)KLYT(+79.97)RGFKVLAETPK 9.7 61 666.6655 3 51.177 2 31 31 32 36 41 41 62 67 82 85 88 91 89 80 76 31 [1112.5]KVLAET[225.1] 4304 ALT(+79.97)ES(+79.97)VRVDRRK 7.2 60 530.5912 3 51.221 1.8 72 72 72 42 42 72 78 72 72 51 35 31 [1570.7] 4306 TTHTFPR 4.1 58 430.2238 2 51.24 2.1 53 52 52 89 96 31 31 [339.2]TF[253.2] 4309 LLTENGEFGR 7 70 568.2911 2 51.283 0.8 93 94 94 92 53 55 67 85 31 31 LLTE[300.1]F[213.1] 4310 SNMQTVSSQFR 8.5 78 642.8037 2 51.292 0.1 60 60 63 80 85 95 99 93 70 86 56 [332.1]QTVSS[128.1]F[156.1] 4311 VLRRYLMVVFAS(+79.97)K 7.7 59 554.6375 3 51.303 1.1 32 32 32 31 32 47 53 90 94 92 86 87 60 [931.5]VVFAS(+79.97)[128.1] 4312 KNRRENLDASER 7 59 496.5947 3 51.314 1.5 32 32 32 42 42 52 91 96 91 74 71 42 [797.4]LDA[372.2] 4315 WLFTLYSVFK 6.5 65 435.2419 3 51.357 2.1 78 34 43 59 91 86 75 75 76 31 [547.3]LY[461.3] 4317 EALVSQLTR 6.9 77 508.7906 2 51.38 0.4 47 52 68 88 85 81 91 92 81 [313.2]VSQLTR 4319 S(+79.97)GDNGQDHR 5.2 58 533.1919 2 51.402 1.9 53 47 53 77 80 58 56 66 31 [453.1]G[536.2] 4329 M(+15.99)RVHLLAALNR 6.3 57 437.2556 3 51.524 0.1 31 31 31 42 70 83 84 79 63 64 47 [652.3]LA[454.3] 4336 Y(+79.97)PAM(+15.99)VS(+79.97)KK 5.1 63 550.217 2 51.609 2.4 31 63 77 77 77 68 78 31 [1080.4] 4337 LLWSKKS(+79.97)HMPNAPK 7.9 56 572.96 3 51.62 0 31 31 31 88 88 77 31 31 92 89 52 52 58 31 [412.2]SK[432.2]MP[410.2] 4339 KHHERDAVVR 5.6 56 416.2298 3 51.654 1.1 34 34 31 63 74 56 72 75 84 31 [972.5]V[156.1] 4340 RRM(+15.99)T(+79.97)RHELEKTR 7 58 570.2855 3 51.666 0.2 31 34 33 47 52 70 82 86 76 65 68 47 [933.4]EL[514.3] 4343 NRQWFRLRR 5.4 60 444.59 3 51.697 0.1 71 65 60 56 58 90 75 31 31 [731.4]R[425.3] 4353 LVLATSVEK 5.4 60 480.2925 2 51.816 0.7 31 97 91 77 69 31 54 31 54 [113.1]VL[615.3] 4354 M(+15.99)DELRK 3.4 57 404.2061 2 51.828 2.6 31 31 81 81 81 31 [262.1]ELR[128.1] 4361 VDSCGGK 4.7 67 333.15 2 51.909 0.6 77 77 77 65 65 75 31 [646.3] 4376 LLTEEGNFGR 8.1 81 568.2913 2 52.097 1.1 95 96 96 96 84 67 59 89 90 31 LLTEE[171.1]FG[156.1] 4381 RRPM(+15.99)QLLDGTER 7.1 59 496.5955 3 52.16 1.8 31 35 42 36 40 84 93 90 72 63 66 49 [684.3]LLD[443.2] 4401 QNANS(+79.97)R 3.5 58 385.1527 2 52.418 0.9 54 55 58 55 62 63 [750.3] 4402 MMT(+79.97)GEST(+79.97)M(+15.99)R 5 56 610.1843 2 52.429 1.7 31 72 50 58 60 88 77 31 31 [629.2]S[484.1] 4410 NY(+79.97)LTCGPLR 5.8 65 558.75 2 52.526 1.9 57 55 67 61 86 87 72 62 31 [571.2]CG[366.2] 4411 RT(+79.97)DLGYS(+79.97)K 4.4 55 550.2156 2 52.538 1.8 43 42 47 64 90 90 31 31 [565.2]GY[295.1] 4439 CMEESPQK 5.1 64 476.1988 2 52.91 0.6 31 31 94 91 91 71 31 64 [234.0]EES[353.2] 4451 M(+15.99)M(+15.99)VGR 3 61 313.1427 2 53.071 2.4 69 70 56 75 31 [606.3]

PAGE 371

371 4463 LLTEKGDM(+15.99)GR 6.3 63 568.2914 2 53.215 1.7 95 95 94 91 47 40 40 46 47 34 LLTE[660.3] 4499 Y(+79.97)NCM(+15.99)MK 3.5 58 443.14 2 53.7 2.5 55 72 72 80 31 31 [460.1]M(+15.99)[259.1] 4504 S(+79.97)TVDCCR 4.6 66 432.1427 2 53.767 0.6 76 76 78 82 82 31 31 [367.1]DC[259.1] 4519 VPS(+79.97)KKKVR 4.6 58 511.3 2 54.009 1 31 31 31 31 94 86 86 66 [491.2]KKV[156.1] 4541 WECGM(+15.99)K 3.6 60 385.1532 2 54.297 2.1 65 65 65 75 31 55 [750.3] 4548 WFEDPSSVLKLS(+79.97)NR 8.6 61 586.6119 3 54.382 2.7 31 31 31 31 83 80 80 78 72 75 92 52 73 39 [577.2]PSS[340.2]L[437.1] 4554 WT(+79.97)DAGS(+79.97)M(+15.99)K 4.9 61 536.1652 2 54.468 2 31 89 86 85 69 63 31 31 [186.1]T(+79.97)DA[499.1] 4577 CT(+79.97)CGGNTK 4.5 57 432.1433 2 54.791 0.8 31 36 35 50 86 77 78 56 [444.1]G[343.2] 4582 TCQADK 4.5 75 333.15 2 54.853 0.6 75 75 75 81 91 53 [332.1]AD[128.1]

PAGE 372

372 APPENDIX N DE NOVO SEQUENCING R ESULTS FOR ELASTASE De novo s ummary r eport (generated by Peaks DB software)

PAGE 373

373 Peptide r esults for e lastase digested m yosin derived by De novo sequencing with PEAKS DB s oftware Scan Sequence TLC ALC (%) m/z z RT ppm local confidence (%) tag (>=80%) 1746 KCSSLRSFASW 9.6 87 636.3137 2 22.483 0 89 89 89 79 79 91 85 85 90 91 86 KCS[200.1]RSFASW 1354 EHLKGLKVCPHCY 11.2 86 763.8854 2 18.089 1.8 97 95 95 98 97 92 73 59 78 88 81 81 81 EHLKGL[330.2]PHCY 1910 MVKEASGPLNFTVF 12 86 770.3969 2 24.293 0.6 72 80 89 94 95 97 94 82 82 70 78 79 91 90 [131.0]VKEASGPL[362.2]VF 1815 SSLKVAELENHF 10.2 85 687.3579 2 23.227 1.9 26 91 92 96 97 97 97 97 94 77 90 64 [87.0]SLKVAELE[114.0]H[147.1] 2658 AFKGKGYAELLTY 11 85 730.8914 2 33.664 1.9 82 87 96 93 91 91 95 96 96 96 81 63 26 AFKGKGYAELL[264.1] 2790 FAKGKGYAELLTY 11 85 730.8913 2 35.3 2 83 88 96 95 95 95 96 96 96 97 82 48 26 FAKGKGYAELL[264.1] 2724 FAKGKGYAELLTY 11 84 730.8911 2 34.47 2.3 82 87 96 95 95 95 98 97 97 96 77 51 26 FAKGKGYAEL[377.2] 2526 AFKGKGYAELLTY 10.9 84 730.8918 2 32.022 1.3 84 89 97 95 95 95 97 97 97 96 79 39 26 AFKGKGYAEL[377.2] 2134 MRTGMKSMLW 8.4 84 620.8049 2 27.014 2 92 86 64 57 79 96 95 92 94 78 MR[289.1]KSML[186.1] 3252 AFKGKGPHELVMF 10.9 84 730.8903 2 41.112 0.9 81 87 96 95 95 94 88 90 98 90 75 67 26 AFKGKGPHEL[377.2] 2328 FAKGKGYAELLTY 10.8 83 730.8914 2 29.487 1.9 81 86 95 95 96 96 97 97 97 96 74 43 26 FAKGKGYAEL[377.2] 1555 MKPRLVLGW 7.5 83 550.3265 2 20.336 1.1 94 93 85 86 95 96 85 85 26 MKPRLVLG[186.1] 1917 QDPEDVLVAAKF 10 83 666.3453 2 24.37 0.5 59 70 91 91 91 91 98 96 96 95 88 26 [243.1]PEDVLVAAK[147.1] 3582 FAKGKGYAELLTY 10.8 83 730.891 2 45.144 2.4 82 86 95 95 96 95 97 97 96 94 70 44 26 FAKGKGYAEL[377.2] 2046 NFESFLKPPF 8.3 83 613.3177 2 25.924 2.5 78 84 96 98 97 95 88 82 80 26 [114.0]FESFLKPP[147.1] 1450 AFKGKRPDW 7.5 83 552.8016 2 19.153 0.9 73 79 91 94 99 97 92 90 26 [218.1]KGKRPD[186.1] 1992 SGGVPAFTVF 8.3 83 981.5058 1 25.281 1.9 30 82 93 88 85 85 89 89 89 90 [87.0]GGVPAFTVF 1920 DHAVKSDGVGVDFLW 12.3 82 822.9041 2 24.413 0.5 80 84 95 96 96 96 95 96 94 70 69 78 75 75 26 DHAVKSDGV[717.3] 1470 FAKLEYAEKKY 9 82 695.3725 2 19.381 2.5 83 89 90 77 77 78 95 94 94 94 26 FAK[405.2]AEKK[163.1] 1327 FLGFESAGLM(+15.99)GY 9.8 82 654.304 2 17.787 2.4 87 88 95 97 95 90 91 91 90 65 63 28 FLGFESAGL[367.1] 3516 AFKGKGYAELLTY 10.6 82 730.8909 2 44.347 2.6 81 87 96 95 95 95 97 97 95 93 61 34 26 AFKGKGYAEL[377.2] 1554 MESLKSHKPF 8.1 81 602.3138 2 20.329 1 98 98 97 96 96 96 68 64 71 26 MESLKS[509.3] 3642 LELLEQVLW 7.3 81 571.8276 2 45.88 2.1 73 93 99 98 95 78 82 83 26 [113.1]ELLE[128.1]VL[186.1] 1761 DSNAFQMF 6.5 81 959.3922 1 22.635 0.6 77 78 74 94 96 79 80 69 [316.1]AF[128.1]M[147.1] 2856 AFKGKGYAELLTY 10.5 81 730.8912 2 36.137 2.1 86 89 96 93 90 90 97 98 97 95 60 27 26 AFKGKGYAEL[377.2] 3384 FAKGKGYAELLTY 10.5 81 730.8909 2 42.745 2.6 82 88 96 94 93 93 96 96 94 92 58 33 26 FAKGKGYAEL[377.2] 1622 MMGLM(+15.99)W 4.8 81 784.321 1 21.106 2.4 91 91 77 66 80 76 MM[170.1]M(+15.99)[186.1] 2196 AFKGKGYAELLTY 10.5 80 730.8918 2 27.812 1.3 81 86 95 92 91 91 95 96 96 94 59 37 26 AFKGKGYAEL[377.2]

PAGE 374

374 1846 QLLGTLEMVW 8 80 595.3162 2 23.566 2.9 46 49 96 99 98 98 96 96 95 26 [241.1]LGTLEMV[186.1] 2121 HLEVTFNLGPSAKPPF 12.8 80 877.4645 2 26.849 3.1 77 77 78 95 98 97 89 90 89 90 95 86 75 67 49 26 [379.2]VTFNLGPSA[469.3] 1762 EYGYALPHALPRF 10.4 80 767.3971 2 22.643 1.4 60 60 82 91 95 97 99 86 87 94 84 76 26 [292.1]GYALPHALP[303.2] 1834 YSHNFFKKLKENTY(+79.97) 11.2 80 949.9477 2 23.433 2.3 71 71 71 92 98 94 97 85 94 79 77 63 72 52 [387.2]NFFKKL[715.3] 2050 CLKLLDLTPF 8 80 581.8304 2 25.968 0.4 75 77 92 93 82 90 95 86 81 26 [216.1]KLLDLTP[147.1] 1880 MPLLGM(+15.99)TSPKVF 9.6 80 668.8531 2 23.953 1 95 94 95 99 98 95 93 87 72 73 26 26 MPLLGM(+15.99)TS[471.3] 1851 LDLLGM(+15.99)TRSRW 8.8 80 682.3593 2 23.621 2.8 48 79 97 99 98 98 97 69 77 83 26 [228.1]LLGM(+15.99)T[243.1]R[186.1] 3120 FAKANGYVTLLTY 10.4 80 730.8907 2 39.453 2.8 79 80 94 94 94 97 96 73 62 93 84 58 26 [147.1]AKANGY[200.1]LL[264.1] 1838 NMSFAVKCVGVRDLW 12 80 862.9358 2 23.483 1.9 69 75 94 98 98 97 88 74 74 92 92 72 60 62 42 [245.1]SFAVK[202.1]GV[570.3] 1941 AESTFKGAMW 8 80 564.2634 2 24.66 0.4 87 78 80 94 96 92 76 66 95 26 A[129.0]STFK[128.1]M[186.1] 2592 FAKANGYVTLLTY 10.3 79 730.8916 2 32.853 1.6 84 84 95 95 92 94 93 81 74 90 71 47 26 FAKANGYV[101.0]L[377.2] 930 FAQEEEFFTF 7.9 79 647.787 2 13.088 3.1 89 91 85 98 99 26 91 91 91 26 FAQEE[129.0]FFT[147.1] 3054 FAKANGYVTLLTY 10.3 79 730.8907 2 38.61 2.8 83 83 94 93 93 96 96 80 71 91 74 43 26 FAKANGYV[101.0]L[377.2] 1088 KGKLKMGVVLY(+79.97) 8.7 79 658.3637 2 14.974 0.4 26 95 95 96 94 80 63 70 69 89 89 [128.1]GKLKM[255.2]LY(+79.97) 1566 FAKANGGPPQLVMF 11.1 79 738.8877 2 20.459 0.9 82 82 92 91 90 94 80 69 77 77 90 77 73 26 FAKANGG[322.2]L[377.2] 1629 SM(+15.99)QLSLDTFSLKAF 11.1 79 802.403 2 21.18 3 80 80 74 94 94 91 64 60 70 92 93 91 92 26 SM(+15.99)[128.1]LSL[363.1]SLKA[147.1] 1276 MQSQELF 5.5 79 882.402 1 17.18 0.6 95 85 95 76 85 88 26 MQS[128.1]EL[147.1] 2329 KRGVLVAMFSVGALS(+79.97)W 12.7 79 900.9639 2 29.497 1.4 70 53 66 87 96 97 97 97 84 77 78 80 81 80 88 26 [341.2]VLVAMF[186.1]GALS(+79.97)[186.1] 2587 LELLEQVLW 7.1 79 571.8276 2 32.786 2.2 77 93 99 98 96 68 74 76 26 [113.1]ELLE[526.3] 1232 AEGAELVDASVVW 10.3 79 673.3348 2 16.671 0.6 49 52 62 72 85 97 97 97 97 95 96 94 26 [328.1]ELVDASVV[186.1] 1974 TTRCADLVKPF 8.7 79 625.8314 2 25.057 0.6 92 96 95 97 96 87 83 82 83 26 26 TTRCADLVK[244.1] 1720 SMPVLVAGNVDGAVQY 12.6 79 810.408 2 22.201 0.6 87 93 93 97 94 92 92 90 72 83 86 69 49 46 53 53 SMPVLVAG[114.0]VD[518.2] 2262 AFKKGGYAELLTY 10.2 79 730.8909 2 28.649 2.6 74 74 91 63 92 91 95 96 97 97 76 41 26 [218.1]K[128.1]GGYAEL[377.2] 2011 SVYPLGGLPPW 8.6 78 1185.635 1 25.504 3.7 89 89 93 97 96 91 85 81 83 26 26 SVYPLGGLP[283.1] 957 DCQVSVMTFF 7.8 78 588.7553 2 13.413 2.5 86 86 80 96 90 88 86 70 71 26 DCQVSVM[395.2] 3504 APLPVNAW 6.3 78 434.2397 2 44.201 0.1 94 93 93 78 73 61 73 57 APL[567.3] 1371 WAKHRW 4.7 78 442.2376 2 18.279 0.6 79 67 66 83 77 95 [385.2]H[156.1]W 2037 MTLVQGVLLEYSKPDW 12.5 78 939.988 2 25.811 1 65 73 88 91 69 84 90 95 98 98 85 90 77 58 56 26 [232.1]LV[128.1]GVLLEYS[526.3] 2221 MTVKLVELAYEGW 10.2 78 769.9 2 28.121 0.4 70 69 88 94 88 75 78 85 73 68 72 88 62 [232.1]VKL[228.1]L[363.1]G[186.1] 2058 LFVKLM(+15.99)SEGW 7.8 78 613.3184 2 26.069 0.8 26 26 82 80 96 89 98 97 99 83 [260.2]VKLM(+15.99)SEGW 3181 LELLEKPGPF 7.8 78 571.8277 2 40.223 2.3 74 93 99 99 96 94 88 70 35 26 [113.1]ELLEKP[301.1]

PAGE 375

375 1446 MTELCLKNKPRW 9.3 78 759.9005 2 19.119 1.1 73 77 89 94 94 88 87 88 83 70 61 26 [232.1]ELCLKNK[439.2] 1827 VHVQSDGVVGDLW 10.1 78 705.8545 2 23.355 0.4 26 99 96 79 91 93 92 90 65 57 66 81 69 [99.1]HV[128.1]SDGV[271.1]L[186.1] 2922 FAKANGYVTLLTY 10.1 78 730.8927 2 36.972 0.1 82 81 94 94 94 97 97 84 73 88 60 32 26 FAKANGYV[101.0]L[377.2] 1936 MLLKLAAW 6.2 78 945.5618 1 24.598 3 93 93 97 80 74 75 79 26 MLLK[441.2] 1800 FNTNEKLQQFF 8.5 77 708.3521 2 23.075 1.1 84 78 96 81 88 71 93 72 82 75 26 F[114.0]TNE[128.1]L[128.1]Q[294.1] 2144 YLSM(+15.99)LLVLGW 7.7 77 605.8316 2 27.146 1.6 26 95 92 87 86 98 86 84 88 26 [163.1]LSM(+15.99)LLVLG[186.1] 1137 CPAKSSVFLAAAW 10 77 675.8481 2 15.552 1.2 26 81 72 75 96 96 96 95 93 84 78 78 26 [103.0]P[199.1]SSVFLA[328.2] 1122 MNKENYDKMKTLW 10 77 850.9083 2 15.369 2.4 57 54 91 95 89 88 94 82 95 87 76 65 26 [245.1]KENYDKMK[400.2] 1753 LSVLLGM(+15.99)TNWW 8.5 77 668.3436 2 22.556 2.6 26 26 90 98 99 98 98 97 81 88 41 [200.1]VLLGM(+15.99)TNW[186.1] 3578 WPLTFLDGNNW 8.5 77 681.8281 2 45.089 0.9 26 74 83 92 96 93 88 83 66 77 61 [283.1]LTFLDG[414.2] 1627 KNLLTRPMW 6.9 77 579.8265 2 21.163 0.4 85 84 94 94 78 75 74 77 26 KNLL[671.3] 2718 LELLEQLVW 6.9 77 571.8281 2 34.394 3 49 87 98 98 94 72 81 81 26 [113.1]ELLE[128.1]LV[186.1] 2155 LELLTPPKTMALY 10 77 745.4205 2 27.285 0.2 26 71 96 97 89 88 93 92 86 83 72 71 26 [242.1]LLTPPKTM[347.2] 2004 STGSFAVKSDGVRDFLW 13 77 936.4686 2 25.42 0.7 27 39 61 94 99 98 98 97 97 97 96 94 91 81 44 59 26 [245.1]SFAVKSDGVRD[446.2] 2036 LADLLGTF 6.1 77 849.4714 1 25.802 0.2 57 59 73 87 97 84 92 62 [299.1]LLGT[147.1] 2988 AFKANGYAKKLCF 10 77 730.8905 2 37.78 1.3 82 88 93 92 92 97 97 96 95 53 39 40 26 AFKANGYAK[491.3] 3977 FAKANGYVTLLTY 10 77 730.891 2 50.053 2.4 86 86 95 95 94 96 96 81 72 84 52 27 26 FAKANGYV[101.0]L[377.2] 3577 LELLEKPGPF 7.7 77 571.8275 2 45.079 1.9 72 92 98 98 94 91 83 67 40 26 [113.1]ELLEKP[301.1] 3511 LELLEKPGPF 7.7 77 571.8272 2 44.283 1.5 65 91 99 99 95 94 89 73 30 26 [113.1]ELLEKP[301.1] 3247 LELLEQVLW 6.9 77 571.8277 2 41.05 2.3 45 86 98 98 92 77 80 81 26 [113.1]ELLE[128.1]VL[186.1] 1117 SVVKFACLW 6.9 77 526.7848 2 15.308 2.4 96 96 96 97 95 77 51 51 26 SVVKF[473.2] 3313 LELLEQLVW 6.9 77 571.8279 2 41.862 2.7 44 88 98 98 96 72 81 81 26 [113.1]ELLE[128.1]LV[186.1] 1850 SHYFQM(+15.99)MLTDRENKW 11.5 76 1001.453 2 23.611 2.4 62 46 46 56 89 89 88 98 98 97 89 62 73 85 62 [534.2]QM(+15.99)MLTDR[243.1]K[186.1] 1723 NFTNEAGLKQFNF 9.9 76 765.372 2 22.239 1 76 82 95 83 87 82 74 80 69 56 47 73 83 [114.0]FTNEA[57.0]L[517.3]F 1878 GNKLLGFTNERW 9.2 76 717.8771 2 23.937 1.2 28 45 50 92 99 98 98 97 89 94 95 26 [299.2]LLGFTNER[186.1] 2893 FAKYSRAELTLY 9.2 76 731.3922 2 36.605 2.4 79 85 95 94 84 83 85 85 87 78 29 26 [147.1]AKYSRAEL[377.2] 1310 NPLLEAYGPAVF 9.2 76 645.8384 2 17.586 2.5 63 68 73 98 92 83 80 91 79 69 63 50 [324.2]LEAYG[414.2] 2259 MWDYLPMCRTLVNSPLW 13 76 1063.008 2 28.603 0.8 39 35 56 85 98 88 84 80 85 95 97 97 91 90 74 67 26 [432.1]YLPMCRTLVNS[396.2] 2460 AFKKGGYAGGKMVF 10.7 76 730.8901 2 31.174 0.7 84 84 95 77 95 96 97 90 76 58 58 62 62 26 AFK[128.1]GGYA[619.3] 3648 AFKGKGHPELMVF 9.9 76 730.8899 2 45.956 0.4 76 83 93 91 90 88 80 69 97 78 63 51 26 [71.0]FKGKGH[97.1]E[490.3] 1993 FRVLM(+15.99)SVSGTAAM(+15.99)QF 11.4 76 838.9096 2 25.29 0.9 30 45 52 83 89 90 89 82 64 65 88 91 91 77 96 [402.2]LM(+15.99)SVS[158.1]AAM(+15.99)[128.1]F

PAGE 376

376 3838 LELLEQVLW 6.8 76 571.8276 2 48.285 2.2 75 93 99 98 95 60 66 67 26 [113.1]ELLE[526.3] 1617 YGKLSLDKNELYF 9.8 76 795.4141 2 21.052 0.1 72 84 94 98 98 95 77 64 65 87 92 26 26 [163.1]GKLSL[357.2]EL[310.1] 1394 CALKVGGTLEHEESKPVW 13.6 76 992.0058 2 18.531 2 40 43 54 47 47 66 94 95 98 98 99 99 97 95 94 84 78 26 [571.3]GTLEHEESKP[285.1] 3445 LELLEQLVW 6.8 76 571.8276 2 43.481 2.1 43 87 98 98 95 72 78 80 26 [113.1]ELLE[241.1]V[186.1] 1578 FAKANGYSLKAKY 9.8 76 730.9 2 20.599 2.2 81 81 95 95 95 98 98 79 68 75 59 26 26 FAKANGY[690.4] 1104 LSLEEPKW 6.1 76 501.2674 2 15.171 2.6 26 99 99 99 93 80 80 26 [113.1]SLEEPK[186.1] 1359 YPAGYSLLLTY 8.3 76 630.8323 2 18.148 5 70 77 83 95 97 90 89 97 51 51 26 [260.1]AGYSLL[377.2] 1712 MVKGLVLEYSKELSY(+79.97) 11.3 76 919.9548 2 22.119 0.9 58 60 75 82 65 88 99 99 89 95 91 80 53 55 36 [358.2]G[113.1]VLEYSKE[443.1] 1200 LFEASDVW 6 76 966.4563 1 16.302 0.4 99 99 95 91 68 65 58 26 LFEA[487.2] 1831 YPLWSAM(+15.99)GAVDPNPVDKSRF 15.1 75 1133.555 2 23.405 2.9 36 39 40 94 95 96 98 98 95 95 95 94 76 88 90 93 62 52 32 31 [373.2]WSAM(+15.99)GAVDP[114.0]PVD[518.3] 2172 AFKANPGLAANPLLEAYLFFY 15.8 75 1165.616 2 27.507 0.8 27 44 53 91 67 61 74 97 99 99 90 82 83 97 98 98 98 94 37 35 48 [346.2]A[268.1]LAANPLLEAYL[457.2] 1142 RNDNKMAFGKLF 9 75 720.8762 2 15.614 2.5 93 90 95 90 87 73 59 61 67 70 86 26 RNDNK[534.3]L[147.1] 1692 MGVLPM(+15.99)ASVSHAF 9.8 75 681.8307 2 21.918 0.2 47 43 42 84 99 99 95 95 97 85 79 79 26 [287.1]LPM(+15.99)ASVS[355.2] 2127 LELLEKPGPF 7.5 75 571.8278 2 26.928 2.5 43 86 98 98 96 94 90 79 36 26 [113.1]ELLEKP[301.1] 1106 ALYKTF 4.5 75 371.7108 2 15.187 1.2 90 90 93 67 82 26 ALY[128.1]T[147.1] 2202 SGTLMPLFSKPF 9 75 662.8521 2 27.885 0.1 27 46 50 94 93 95 99 97 94 87 88 26 [245.1]LMPLFSKP[147.1] 1260 VSLPDGKFLDVRW 9.8 75 766.4169 2 16.998 0.1 26 26 98 95 91 85 85 93 94 93 78 78 26 [186.1]LPDGKFLD[441.2] 1996 LQGEVEDLMVDVAVW 11.3 75 851.9213 2 25.319 0.1 45 42 63 66 90 96 97 97 97 98 96 89 64 53 27 [427.2]VEDLMVDV[356.2] 3241 MESLSKHKPF 7.5 75 602.313 2 40.979 0.3 95 93 93 89 79 83 63 58 65 26 MESL[87.0]K[509.3] 1351 YSLKGLNLGDFHF 9.7 75 755.8883 2 18.065 0.4 49 57 77 95 97 92 89 87 71 66 75 88 26 [363.2]KGLNL[319.1]H[147.1] 1480 MCLLEM(+15.99)M(+15.99)W 6 75 544.7172 2 19.488 1.1 58 59 78 93 93 84 65 65 [347.1]LEM(+15.99)[333.1] 1424 LM(+15.99)SLKDKHW 6.7 75 1173.612 1 18.866 2.6 94 83 81 81 92 84 64 64 26 LM(+15.99)SLKD[451.2] 1560 QNGAKELDLVLQW 9.7 75 757.4044 2 20.39 0.4 43 44 59 83 88 95 95 97 93 83 63 64 61 [299.1]AKELDLV[427.2] 2438 MESLAGAKHLF 8.2 75 602.3139 2 30.887 1.2 96 96 95 94 89 73 65 66 59 58 26 MESLA[653.4] 1514 FAKKGGYAELLTY 9.7 75 730.8914 2 19.871 1.9 68 69 88 91 93 94 96 93 86 81 52 31 26 [218.1]KKGGYAEL[377.2] 2274 DVQLLGGSALKHW 9.7 75 712.3868 2 28.798 2.1 93 92 86 84 69 67 81 79 69 68 72 78 26 DVQL[170.1]G[722.4] 3675 MESLKPNAKW 7.5 75 602.3143 2 46.277 1.9 95 95 94 89 76 57 56 75 79 26 MESL[724.4] 1368 APPNALVW 6 75 867.4739 1 18.255 1.9 26 97 95 86 85 86 92 26 [71.0]PPNALV[186.1] 1057 TSGKTFAKKGRTYF 10.4 75 796.434 2 14.606 1 28 42 58 88 93 98 98 98 99 92 88 68 42 44 [245.1]KTFAKKGR[411.2] 895 FDLTGEVSSVFDF 9.7 74 731.8383 2 12.651 2.9 26 95 93 93 95 94 95 96 84 60 54 49 26 [147.1]DLTGEVSS[508.2] 3370 MPSDGKLF 6 74 447.7235 2 42.566 1 87 87 69 64 81 88 89 26 MP[202.1]GKL[147.1]

PAGE 377

377 2110 NNQNLEKVLW 7.4 74 629.3322 2 26.706 1.2 60 60 59 72 93 97 96 90 86 26 [470.2]LEKVL[186.1] 3997 MESLTPLARW 7.4 74 602.3143 2 50.295 1.9 95 95 92 91 75 64 58 64 77 26 MESL[724.4] 1341 VRDALAKKKELEKPNF 11.9 74 943.5441 2 17.947 2.5 59 43 43 74 89 97 98 99 97 95 96 94 84 39 40 33 [441.2]LAKKKELEK[358.2] 1887 RRSDFVTGVLSDKNPKRY(+79.97) 13.4 74 1109.562 2 24.029 2 29 74 82 97 99 97 94 89 80 76 88 96 92 56 44 44 64 26 [312.2]SDFVTGV[113.1]SDK[738.3] 1105 ECSAKPLY 5.9 74 455.721 2 15.178 0.9 81 82 80 69 73 83 95 26 ECS[199.1]PL[163.1] 3846 FAKANGYALKKCF 9.6 74 730.8904 2 48.379 1.2 72 73 91 90 88 93 97 96 89 74 35 35 26 [218.1]KANGYAL[506.3] 1628 YGKLALSSGLAAEFF 11.1 74 787.4177 2 21.17 1.4 73 84 94 98 96 90 90 68 68 79 66 60 51 42 42 [163.1]GKLALS[822.4] 1999 LLNPESKTPGLMENVLF 12.6 74 951.507 2 25.361 1.3 73 67 57 64 73 93 96 97 90 85 91 92 78 54 56 56 26 [566.3]SKTPGLM[602.3] 2323 LELLEKPGPF 7.4 74 571.8278 2 29.419 2.5 47 87 98 99 96 94 87 69 28 26 [113.1]ELLEKP[301.1] 2161 MLKLWPTPF 6.6 74 1132.625 1 27.363 2.5 89 87 89 90 72 90 90 26 26 MLKL[186.1]PT[244.1] 1280 CPLWKLDARHF 8.1 74 693.3589 2 17.23 2.8 26 26 96 96 93 92 95 83 78 92 26 [200.1]LWKLDA[156.1]H[147.1] 3779 FAKANGYAKLKCF 9.6 74 730.8904 2 47.562 1.2 84 83 95 95 94 95 96 96 88 46 26 26 26 FAKANGYAK[491.3] 2562 FAKKGGYAGCAKLF 10.3 74 487.596 3 32.472 1.2 57 57 79 76 87 82 89 94 91 86 77 64 59 26 [474.3]GGYAGC[459.3] 2040 MTLVKGDPLEYSKEEKW 12.5 74 1027.021 2 25.853 1.4 55 62 81 94 82 81 73 88 98 98 89 93 85 68 32 32 31 [232.1]LVKG[115.0]PLEYSK[572.3] 2652 LELLEKPGPF 7.3 73 571.8277 2 33.591 2.3 47 88 98 98 95 92 87 66 32 26 [113.1]ELLEKP[301.1] 1382 HPVVGYAELLTY 8.8 73 681.3569 2 18.393 2.5 26 26 90 93 93 97 97 97 97 84 48 26 [234.1]VVGYAELL[264.1] 2394 FAKANGYVTLLTY 9.5 73 730.8911 2 30.331 2.3 76 76 94 95 94 95 94 70 56 85 60 27 26 [218.1]KANGY[200.1]L[377.2] 1279 KFLPRW 4.4 73 423.7527 2 17.222 0.3 84 85 92 78 72 26 KFL[439.2] 3914 FAKANGYVTLTLY 9.5 73 730.8907 2 49.239 2.8 77 78 92 91 91 95 94 76 66 80 40 40 26 [218.1]KANGY[200.1]L[377.2] 1438 STKSDGVRDLW 8.1 73 632.3195 2 19.024 0.8 75 83 93 96 96 93 86 47 45 46 41 [87.0]TKSDGV[570.3] 3186 AFKANGYAKCKLF 9.5 73 730.8904 2 40.288 1.2 79 86 94 93 92 95 98 94 85 45 29 29 26 [71.0]FKANGYAK[491.3] 3923 LELLEAGVLW 7.3 73 571.8276 2 49.358 2.2 49 86 98 97 93 81 76 61 60 26 [113.1]ELLEA[455.3] 3106 YGKLPKVAALALCY(+79.97) 10.3 73 795.4128 2 39.267 1.5 65 74 88 90 63 48 62 84 85 81 83 74 75 47 [220.1]KL[324.2]AALA[459.1] 888 CSSAGGANPKVTW 9.5 73 639.3018 2 12.568 1.6 26 94 95 93 94 95 95 89 91 58 42 46 26 [103.0]SSAGGANP[514.3] 4043 FAKANGYVTLLTY 9.5 73 730.8914 2 50.882 1.9 80 80 94 94 90 91 92 78 70 81 37 30 26 FAKANGY[200.1]L[377.2] 3451 AFKGKGYAKMRGF 9.5 73 730.8956 2 43.549 0.5 78 84 95 94 94 94 96 92 78 46 30 37 26 [71.0]FKGKGYA[619.3] 2017 MNTMLKVSVLTYF 9.5 73 773.9056 2 25.572 2.1 79 76 81 96 97 98 88 82 63 55 45 48 35 [245.1]TMLKVS[623.3] 1620 NGVLGVLLW 6.6 73 485.7904 2 21.089 1.5 82 93 93 97 84 75 74 26 26 NGVLG[511.3] 3151 AFKALGARGGHMVF 10.2 73 731.3919 2 39.844 1.2 77 85 95 95 91 85 64 54 51 86 87 90 26 26 [71.0]FKALG[284.2]GHM[246.1] 3020 YGKLALTDVGNFLY 10.2 73 787.415 2 38.172 2.1 68 79 91 97 96 81 64 63 86 65 55 69 73 26 [220.1]KLAL[216.1]V[594.3] 1728 DALLVGQPY 6.6 73 975.5158 1 22.298 1.3 52 52 89 89 83 80 57 88 60 [186.1]LLVG[128.1]P[163.1]

PAGE 378

378 2209 CLKLEVLM(+15.99)VVF 8 73 655.3662 2 27.972 0.5 74 73 93 92 86 86 78 60 62 64 26 [216.1]KLEV[605.3] 3625 FAKKGGYAELTLY 9.4 72 487.5965 3 45.674 2.2 51 52 74 86 82 82 87 93 91 86 78 47 26 [346.2]KGGYAEL[377.2] 2126 MDPTKLLAANPLLEAYVWW 13.8 72 1116.081 2 26.917 0.7 28 43 40 40 54 89 98 99 98 84 78 78 96 97 97 97 86 26 39 [572.3]LLAAN[210.1]LEAYV[372.2] 3769 MESLATLPRW 7.2 72 602.3134 2 47.432 0.3 95 94 93 91 87 61 54 55 63 26 MESLA[653.4] 1227 RLLTENGEGF 7.2 72 568.2902 2 16.611 0.9 28 54 94 95 89 71 83 84 95 26 [269.2]LTE[114.0]GEG[147.1] 1309 RSSVLVALPM(+15.99)HF 8.7 72 458.2527 3 17.576 2.4 26 82 82 82 84 63 70 84 87 73 64 64 [156.1]SSVL[170.1]LP[431.2] 1790 NNTVLVAALKPAVEY 10.8 72 801.45 2 22.958 2 68 67 85 92 74 49 59 61 72 68 57 63 86 90 85 [228.1]TV[763.5]VEY 2338 AFQANGPGLPLLTY 10.1 72 731.393 2 29.604 3.5 87 89 82 93 83 88 67 64 77 89 84 49 29 26 AFQANG[267.2]PL[377.2] 1526 SDNAFQF 5.1 72 828.3517 1 20.007 0.6 69 69 68 92 95 82 26 [316.1]AFQ[147.1] 1297 MFEKSKLKEYT(+79.97)F 8.7 72 815.8851 2 17.436 2.8 26 26 95 94 96 97 98 96 96 84 26 26 [278.1]EKSKLKEY[328.1] 2133 ARYSM(+15.99)LARNKVVDTAHVF 13 72 1047.55 2 27.003 0.5 28 28 29 86 96 96 59 50 49 88 90 95 95 93 91 94 94 26 [390.2]SM(+15.99)L[341.2]KVVDTAHV[147.1] 2028 FVVVKGDPLEYSPRW 10.8 72 896.4739 2 25.703 1.3 26 80 80 84 65 65 76 93 98 98 88 84 55 57 26 [147.1]VVV[300.1]PLEYS[439.2] 1821 MPNAALGPGLPVKGF 10.8 72 734.9043 2 23.29 2.2 92 92 89 97 97 92 87 69 64 76 54 40 42 55 26 MPNAALG[795.5] 2851 LELLEQVLW 6.5 72 571.8281 2 36.071 3 39 80 97 98 91 59 75 77 26 [113.1]ELLE[526.3] 1604 VPPVEEVLY 6.5 72 1044.562 1 20.908 0.2 26 26 96 94 94 94 93 94 26 [196.1]PVEEVL[163.1] 1975 FLELVSAVW 6.5 72 532.2962 2 25.067 2.8 76 65 71 91 85 76 63 68 46 [389.2]LV[443.2] 913 VRHKELEKKLHW 8.6 72 801.9665 2 12.876 2 26 56 89 71 94 93 91 93 86 63 66 26 [255.2]H[128.1]ELEKK[436.2] 1633 NKLHVGAPKF 7.2 72 555.8245 2 21.232 0.1 81 79 89 92 81 78 67 60 59 26 N[128.1]LHV[500.3] 1842 KEASGLPNFTVF 8.6 72 655.3433 2 23.532 0.5 41 41 63 90 89 50 51 56 89 92 96 96 [328.2]SG[324.2]FTVF 1933 FLLWSAFGAVDPNPVDM(+15.99)GKW 14.3 72 1133.553 2 24.565 0.9 27 27 75 64 85 89 97 98 95 95 95 92 84 91 92 90 37 32 32 26 [559.3]SAFGAVDPNPVD[518.2] 1719 FAKANGYSLLLLATY 10.7 72 822.9525 2 22.193 1.2 61 60 91 97 96 98 97 88 88 98 60 39 33 34 26 [218.1]KANGYSLL[561.3] 1387 Y(+79.97)KKDTRAELKAKSFPGKVHF 14.3 72 810.759 3 18.452 2.8 63 45 37 56 73 75 79 85 95 97 98 97 93 87 80 65 61 55 54 26 [942.4]ELKAKSFP[568.3] 1274 VEAAALAQKQELEKKF 11.4 71 601.6728 3 17.159 1.6 78 82 97 99 96 84 73 33 31 33 64 86 83 83 88 26 [99.1]EAAAL[584.3]LEKK[147.1] 3144 MTELDTKPGPLLGF 10 71 759.8977 2 39.757 0.6 61 74 88 93 93 90 89 83 69 68 72 44 44 26 [232.1]ELDTKP[584.3] 3538 FLSLGPCLPAW 7.9 71 602.3154 2 44.603 0.5 91 91 91 92 77 70 84 61 50 48 26 FLSL[154.1]C[467.3] 1048 KKLNPTNKEVPGW 9.3 71 755.9247 2 14.496 3 26 68 66 82 89 85 76 92 92 98 95 26 26 [369.3]NPT[114.0]KEVP[243.1] 1400 KNLKGCVHF 6.4 71 523.2844 2 18.6 0.2 82 81 94 88 80 81 80 26 26 KNLKGCV[284.1] 2805 FAQAGGGVLRDVRW 10 71 766.4092 2 35.478 1 87 88 78 83 70 59 70 75 68 66 70 72 79 26 FA[128.1]A[1095.6] 1676 KKNFFQQLKENTY(+79.97) 9.3 71 884.4256 2 21.728 1.5 89 91 87 97 89 79 49 72 42 48 46 76 53 KKNFF[1084.5] 1689 SWLETYLPGRF 7.8 71 684.8499 2 21.881 1.4 26 88 97 89 97 95 92 76 56 35 26 [87.0]WLETYL[457.2] 4145 HGPAGY 4.3 71 301.14 2 52.173 0.1 26 79 76 79 77 88 [419.2]Y

PAGE 379

379 1885 FNTVTLF 5 71 841.4457 1 24.01 0.3 92 85 89 87 88 26 26 FNTVT[260.2] 1243 AMLKAPGAAPF 7.8 71 1073.586 1 16.796 4.7 90 90 83 84 85 79 71 70 58 39 26 AMLKA[540.3] 3460 MESLPGRVVW 7.1 71 587.3094 2 43.644 2.8 94 93 93 92 72 69 66 74 26 26 MESL[694.4] 2047 MTLVKGDPLEYSQELSKW 12.8 71 1062.539 2 25.934 0.8 75 62 64 81 69 71 88 96 99 99 86 87 69 74 47 39 36 26 [345.2]V[185.1]DPLEYS[771.4] 3416 MPAMVKLW 5.7 71 975.515 1 43.123 0.4 85 78 82 92 74 60 65 26 M[97.1]AM[526.3] 3710 LELLEKPPGF 7.1 71 571.8279 2 46.704 2.7 46 88 99 98 96 94 89 36 31 26 [113.1]ELLEKP[301.1] 910 NVLKKKELEKTAW 9.2 71 793.9686 2 12.834 2.2 36 34 35 78 97 85 84 90 92 94 77 70 42 [454.3]KKELEK[358.2] 4230 VT(+79.97)HDFTCY 5.7 71 533.19 2 53.296 1.8 26 26 96 96 94 81 93 50 [280.1]HDFTC[163.1] 3049 KNLLGFKHW 6.4 71 571.8287 2 38.544 2.8 84 82 94 98 77 73 72 26 26 KNLL[655.3] 1027 MVPGVRF 5 71 403.2244 2 14.256 3.4 94 94 94 76 54 54 26 MVP[459.3] 1818 MSKMLSGNLGLRFHF 10.6 71 869.4524 2 23.267 2.7 79 58 59 93 96 74 71 65 78 96 95 92 44 26 26 [346.2]ML[371.2]GLR[431.2] 3379 LELLEKGPPF 7.1 71 571.8279 2 42.68 2.8 40 86 98 98 95 91 72 64 32 26 [113.1]ELLEK[398.2] 1755 RAVLMTTLSVFY 8.5 71 700.8842 2 22.572 0.3 74 72 66 64 78 83 76 45 61 97 97 26 [570.3]T[301.2]VF[163.1] 3702 APNPAVLW 5.6 71 434.2396 2 46.613 0.4 98 97 77 77 63 58 65 26 AP[680.4] 1402 ALFKVNY 4.9 71 427.7429 2 18.618 1.6 26 98 97 97 54 64 54 [71.0]LFK[376.2] 1708 DHAVKSGDVVGDLW 9.9 71 749.3697 2 22.075 0.7 80 83 94 92 88 84 75 75 72 52 45 51 53 38 DHAVKS[841.4] 2533 FAKAHATGAPLCVVF 10.6 71 766.4086 2 32.109 0.6 78 75 89 91 77 65 70 76 84 90 85 49 49 46 26 [218.1]KA[366.2]APL[448.2] 1162 CPLGALW 4.9 70 759.387 1 15.846 1.6 26 95 94 93 83 71 26 [103.0]PLGA[299.2] 4126 MRCGPALF 5.6 70 447.72 2 51.928 0.3 68 74 85 82 65 66 92 26 [287.1]CG[168.1]L[147.1] 2108 CLKLFPLFSWW 7.7 70 720.3828 2 26.687 2.7 78 79 94 87 88 26 94 77 77 40 26 [216.1]KLF[97.1]L[606.3] 2239 LNYLSM(+15.99)LLLGW 7.7 70 669.8592 2 28.352 1.1 63 58 68 70 85 85 96 98 59 59 26 [503.3]SM(+15.99)LL[356.2] 2166 MVLFNELLATTKSEKKY 11.9 70 1008.05 2 27.429 2.1 50 45 58 89 82 90 93 78 76 91 96 83 76 49 49 54 26 [343.2]FNEL[184.1]TTK[635.3] 1305 FEGMESVPSEELW 9.1 70 770.3394 2 17.528 2.8 26 71 69 72 74 83 95 95 89 89 89 26 26 [593.2]SVPSEE[299.2] 1202 DSVVQLYPVF 7 70 583.8084 2 16.321 0.4 52 66 71 95 83 94 86 97 26 26 [301.1]VQLYP[246.1] 2599 FAKGKGEGKGPGRGW 10.5 70 766.4096 2 32.939 0.5 79 81 91 86 79 77 81 77 77 72 55 52 52 59 26 [147.1]AKG[185.1]E[795.4] 3368 FAKMKRGEYLF 7.7 70 695.3717 2 42.544 1 72 80 91 92 83 69 80 73 74 26 26 [147.1]AKMK[156.1]G[552.3] 1855 MGKDRSTALAKAAW 9.8 70 753.3974 2 23.668 1.1 76 78 89 89 86 89 95 95 79 51 46 37 37 26 [188.1]KDRSTA[640.4] 2232 KCVM(+15.99)FLPPFVVGW 9.1 70 769.9 2 28.266 2 65 69 69 63 41 78 89 89 89 82 72 72 26 [737.4]PPFV[342.2] 1623 MPLGFTATARW 7.7 70 625.8208 2 21.114 0.5 93 93 92 86 83 90 69 36 39 56 26 MPLGFT[585.3] 3270 HHTFKVLY 5.6 70 1044.56 1 41.341 2.2 80 85 85 92 80 53 55 26 HHTFK[375.2] 3471 FAKLEPATGAVELW 9.8 70 766.4091 2 43.784 2.9 76 79 91 94 91 79 69 51 48 65 60 65 77 26 [218.1]KLE[924.5]

PAGE 380

380 1432 HVQLSLASAKGKT(+79.97)W 9.8 70 803.4122 2 18.955 1.4 85 85 81 94 94 92 76 65 69 85 34 34 37 38 HVQLSL[229.1]K[552.2] 3714 FAKANGYACLKKF 9.1 70 730.8904 2 46.759 1.1 84 84 95 94 94 97 95 87 49 42 28 26 26 FAKANGYA[619.4] 2080 STGLFPLFSQPF 8.4 70 670.849 2 26.334 1.7 30 47 53 94 96 26 99 96 93 65 79 53 [245.1]LF[97.1]LFS[372.2] 1971 GACGAVRGPFASSVAHF 11.8 70 817.3963 2 25.013 3 50 42 55 86 95 92 61 51 57 93 92 91 74 69 69 71 26 [231.1]GAV[310.2]FAS[541.3] 4042 APVLPGQW 5.6 70 434.2397 2 50.873 0.1 95 95 95 45 55 52 63 52 APV[581.3] 1911 YSLLGLNTGDPKAF 9.7 70 748.3937 2 24.302 0.7 26 90 90 95 94 94 86 62 67 86 57 53 40 26 [163.1]SLLGLN[158.1]D[443.3] 3350 FAKANGYLSLSKY 9 70 731.3923 2 42.322 2.5 62 62 86 87 87 93 93 74 64 64 50 51 26 [218.1]KANGY[691.4] 3099 MESHVGGVKLF 7.6 70 602.3132 2 39.177 0.1 98 97 97 99 64 59 52 50 55 62 26 MESH[700.4] 3601 HHTYLVKF 5.6 69 1044.562 1 45.372 0.5 62 62 72 90 88 75 76 26 [375.2]YL[374.2] 2785 KNLLGKHFW 6.3 69 571.8287 2 35.233 2.8 86 84 94 97 79 71 58 26 26 KNLL[655.3] 1632 FAHKNKLVW 6.3 69 1142.65 1 21.222 2.4 26 77 78 76 82 87 88 81 26 [483.3]NKLV[186.1] 1641 YGKLALDNKELFY 9 69 787.4178 2 21.316 1.5 45 65 82 97 96 69 58 55 61 76 85 81 26 [220.1]KLA[599.3]LF[163.1] 2480 FAQANGGPPLLLTY 9.7 69 731.392 2 31.419 2.1 87 89 82 88 82 94 73 50 53 60 84 47 47 26 FAQANG[364.2]L[377.2] 3000 FAKAKMAFGLWVY 9 69 766.4097 2 37.923 0.6 84 82 92 71 58 57 71 79 80 81 86 26 26 FAK[548.3]GLW[262.1] 1308 RACESLKPLGLW 8.3 69 686.8757 2 17.569 2.7 54 68 76 96 96 97 97 82 59 38 34 26 [330.1]ESLKP[469.3] 2176 MVKEASGPLNFTVLF 10.4 69 826.939 2 27.55 0.5 45 50 52 88 93 94 92 44 45 49 91 82 83 95 26 [358.2]EASG[324.2]FTVL[147.1] 1107 CPDSLATELDATW 9 69 711.3181 2 15.195 2.7 26 26 62 51 47 45 67 90 97 97 96 97 89 [687.3]ELDATW 1825 LEMWSAFPPVW 7.6 69 681.8299 2 23.338 1.8 46 46 65 76 78 95 98 99 99 26 26 [646.3]AFPP[285.1] 1634 KNLLKGHFW 6.2 69 571.8287 2 21.241 2.9 78 72 87 96 91 80 61 26 26 [242.1]LLKG[470.2] 1230 KGKLKGSLLMMFF 9 69 750.4268 2 16.654 0.8 26 71 70 90 93 86 72 73 80 83 95 26 26 [313.2]LKG[200.1]LMM[294.1] 2131 AFKAGGGYACKLKF 9.6 69 730.8904 2 26.982 1.3 74 84 90 87 64 72 91 94 93 70 52 34 26 26 [71.0]FKA[114.0]GYA[619.4] 3074 AFQANGPGPLLLTY 9.6 69 731.3922 2 38.859 2.3 55 54 66 89 77 89 82 68 79 89 87 48 48 26 [346.2]A[114.0]GP[154.1]LL[377.2] 3171 MESLSKHKPF 6.9 69 602.3141 2 40.094 1.6 93 93 93 91 81 80 41 40 44 26 MESLSK[509.3] 2336 FAKLGPGALPLMMW 9.6 69 766.4096 2 29.582 2.9 80 83 92 87 74 62 63 56 62 91 66 52 50 38 FAKL[395.2]P[561.2] 1642 AFKGKGYAELLSTF 9.6 69 766.4096 2 21.324 2.2 67 73 89 78 75 73 85 90 82 65 52 39 39 48 [218.1]K[242.1]YAE[561.3] 1249 SSAKTFAKKGRSGY 9.6 69 744.4023 2 16.865 0.7 29 43 52 95 96 96 95 96 98 85 52 50 42 26 [245.1]KTFAKKG[463.2] 2119 SKWATLTVVLSVALM(+15.99)SEGW 13.1 69 698.7034 3 26.827 0.8 27 39 35 65 76 84 81 87 26 26 93 90 89 79 79 81 89 90 61 [573.3]LTV[212.2]SVA[260.1]SEG[186.1] 1759 YVHFAKDVPFVTY 8.9 69 793.408 2 22.618 2.5 49 49 49 87 78 52 56 60 96 91 82 90 47 [399.2]F[413.2]PFVT[163.1] 1696 LELLFTLFF 6.2 69 571.8293 2 21.948 1.6 45 78 91 94 85 77 60 58 26 [242.1]LLF[508.3] 1924 APVPLGQW 5.5 69 434.2393 2 24.455 1.1 93 93 93 46 56 48 71 44 APV[581.3] 2380 MAPMVKLW 5.5 69 975.516 1 30.149 0.6 80 74 83 90 71 58 63 26 M[71.0]PM[526.3]

PAGE 381

381 1988 EVLNGQEYLVRF 8.2 68 733.8862 2 25.228 0.9 28 64 86 83 75 56 79 60 94 82 83 26 [228.1]LN[477.2]LVR[147.1] 2060 LWELF 3.4 68 707.3768 1 26.089 0.8 26 96 96 96 26 [113.1]WEL[147.1] 1616 AM(+15.99)EAYKAFLKAKF 8.9 68 767.4125 2 21.043 2.8 79 84 81 84 84 90 91 79 57 46 48 33 26 [71.0]M(+15.99)EAYKA[734.4] 1261 TSSLKRKKEY 6.8 68 620.3568 2 17.006 0.6 26 26 96 92 89 77 57 58 87 71 [188.1]SLK[412.3]E[163.1] 1238 YGKLADTQFAF 7.5 68 630.8196 2 16.739 4.7 79 87 96 97 91 84 55 34 33 47 44 [163.1]GKLAD[594.3] 2703 FAKAPPGGPPHKW 8.9 68 695.3742 2 34.197 1.1 76 74 77 65 69 84 82 56 49 76 72 76 26 [514.3]PG[702.4] 3216 AFKADGYKALLTY 8.9 68 730.8911 2 40.667 2.3 81 87 95 82 63 61 62 66 63 87 74 35 26 AFKA[534.2]L[377.2] 2100 MPELLEKPPGF 7.5 68 629.3316 2 26.594 1 26 26 94 98 98 96 95 92 50 43 26 [228.1]ELLEKP[301.1] 3284 FAKANGYLSLSKY 8.9 68 731.3921 2 41.51 2.3 80 80 92 91 81 85 94 82 62 39 34 34 26 FAKANGYL[578.3] 1994 RVVTDSPLLGKNPTNKELYY 13.6 68 769.7479 3 25.299 2.1 26 26 46 47 63 63 64 82 86 84 90 90 93 92 84 90 90 85 26 26 [754.4]LLGKNPTNKEL[326.1] 2580 APATKPPW 5.4 68 434.2398 2 32.698 0.1 26 94 82 62 78 82 91 26 [71.0]PA[229.1]PP[186.1] 1090 WETEAGLWPLY 7.5 68 682.8298 2 14.991 0.3 42 80 83 96 88 85 91 98 28 26 26 [186.1]ETEAGLW[373.2] 1711 M(+15.99)LPTYLLTGW 6.8 68 605.8143 2 22.113 3 26 53 74 90 93 96 94 61 61 26 [357.2]TYLL[344.1] 2392 SSNPVMLF 5.4 68 447.7231 2 30.297 0.1 75 77 67 85 93 92 26 26 [288.1]PVM[260.2] 1717 QPTEEAKY(+79.97) 5.4 68 1045.423 1 22.176 0.6 62 72 92 97 62 62 67 26 [225.1]TE[571.2] 1242 TTLKHGNRF 6.1 68 537.2972 2 16.788 2 93 93 76 69 80 64 44 50 38 TT[241.2]H[474.2] 2377 VHPVGYAELLTY 8.2 68 681.3575 2 30.115 1.5 26 26 26 97 97 96 93 93 96 79 55 26 [333.2]VGYAEL[377.2] 3066 FAKAKMFGAYVLW 8.8 68 766.4095 2 38.76 0.8 75 74 85 77 77 80 48 61 67 90 92 26 26 [218.1]K[199.1]M[275.1]YV[299.2] 3268 HY(+79.97)S(+79.97)GS(+79.97)VCACDF 7.5 68 476.7603 3 41.307 54.2 67 67 67 90 88 88 88 67 47 47 26 [547.1]GS(+79.97)VC[436.1] 3417 MALLVKHDF 6.1 68 537.2953 2 43.132 1.9 78 77 88 59 55 69 74 82 26 [202.1]L[477.3]D[147.1] 3805 KNLEGLAVW 6.1 68 515.29 2 47.879 0 77 65 90 86 59 53 47 67 64 [242.1]LE[526.3] 967 HMAPVLELETVEAVW 10.2 68 575.2952 3 13.544 0.7 34 37 44 61 78 95 95 97 88 84 80 80 56 56 26 [535.3]LELETVE[356.2] 2160 TLSNDLLPPEWVPF 9.5 68 814.4218 2 27.352 0.2 37 40 51 60 78 94 91 82 89 84 71 71 70 26 [530.2]LLPPE[529.3] 961 AFYVYSVT(+79.97)F 6.1 68 1176.502 1 13.467 0.8 26 26 26 90 88 89 88 90 83 [381.2]VYSVT(+79.97)F 3342 TLFLDDLDKPRW 8.1 68 759.8992 2 42.223 2.7 40 39 68 92 94 94 86 81 75 62 50 26 [361.2]LDDLD[567.3] 1940 LLPNESKTGPLMELNF 10.9 68 901.9723 2 24.649 0.9 26 77 51 47 78 90 92 96 77 67 77 92 75 42 42 48 [566.3]SKT[267.2]M[503.2] 1384 LVGAYAF 4.7 68 740.3981 1 18.412 0.5 65 64 73 74 77 91 26 [503.3]A[147.1] 2066 FAKKGGYAGKGMVF 9.5 68 730.8903 2 26.165 0.9 74 75 91 65 82 84 95 94 75 57 42 41 40 26 [218.1]K[128.1]GGYA[619.3] 4058 LELLFFTLF 6.1 68 571.8278 2 51.064 1.1 46 87 96 99 83 60 57 51 26 [113.1]ELLF[508.3] 4320 DDDDGADY 5.4 68 443.14 2 54.494 1.9 26 26 85 86 84 85 86 59 [230.1]DDGAD[163.1] 1756 NMKQLVAGVNDKCTW 10.1 67 853.9233 2 22.58 2.5 60 59 59 37 42 87 94 86 59 56 78 81 78 79 51 [614.3]VAG[328.1]K[390.1]

PAGE 382

382 997 AQSSPVAAAATF 8.1 67 560.7848 2 13.904 0.8 86 71 95 99 97 87 66 51 39 35 35 43 A[128.1]SSPV[532.3] 1303 FAQYEQTNLQEEF 8.8 67 823.8729 2 17.507 3.2 48 63 66 98 92 65 63 42 44 72 93 97 26 [346.2]YE[584.3]EE[147.1] 1362 SDDTFAATLPRW 8.1 67 690.3342 2 18.188 1.6 26 96 95 94 95 91 81 78 49 40 34 26 [87.0]DDTFAA[653.4] 2226 LSVAALAYSKLLGVEKTAW 12.8 67 674.0546 3 28.189 0.7 26 88 85 84 81 77 75 64 62 72 71 72 76 84 79 58 45 38 34 [113.1]SVAA[845.5]V[615.3] 1982 Y(+79.97)ATM(+15.99)AGPLEKEKW 8.8 67 810.3629 2 25.15 0.7 50 87 68 84 80 66 63 68 58 59 68 68 50 [243.0]A[101.0]M(+15.99)A[967.5] 1324 WTNGKTVNEVGAKLKYAF 12.1 67 1013.543 2 17.743 1.3 73 36 34 79 90 95 96 88 83 53 43 45 47 78 83 56 77 50 [458.2]KTVNE[468.3]K[381.2] 2948 MTELLSTVLVHEF 8.8 67 759.8987 2 37.281 1.9 75 81 92 84 59 57 52 52 82 70 70 70 26 [131.0]TEL[400.2]L[512.2] 3600 T(+79.97)TGYTLTTAAENY(+79.97) 8.8 67 522.532 3 45.361 0.5 55 55 61 64 70 77 77 76 76 76 61 63 59 [1546.6] 3242 KNVRGPGLGYF 7.4 67 403.2235 3 40.991 1.7 67 57 56 60 82 73 74 84 70 69 43 [497.3]G[154.1]L[367.2] 3146 YEYGSRLVF 6.1 67 567.2852 2 39.779 0.5 26 96 91 91 73 63 59 76 26 [163.1]EYG[602.4] 1699 YGVVRLPAF 6.1 67 511.2947 2 21.985 0.7 26 97 97 97 81 64 51 61 26 [163.1]GVVR[428.2] 2013 MTLVRLAGSNW 7.4 67 624.33 2 25.522 2.9 80 80 87 90 74 44 53 61 72 48 47 MTLV[784.4] 1698 EPFWSAFPVPW 7.4 67 681.8288 2 21.977 0.9 34 34 34 97 94 94 98 99 99 26 26 [373.2]WSAFPV[283.1] 1635 NKLLMGAGKGW 7.4 67 587.8234 2 21.249 0.5 83 83 94 96 78 69 59 58 44 44 26 NKLL[687.3] 2290 MM(+15.99)TPGCM(+15.99)AVPW 7.4 67 419.1705 3 28.993 0.5 79 75 62 54 64 73 75 73 73 80 26 [953.3]P[186.1] 1404 RVPHYAELLTY 7.4 67 454.5798 3 18.648 2.7 26 26 95 95 95 97 96 94 56 28 26 [255.2]PHYAEL[377.2] 2530 MGKSATVGVDFLW 8.7 67 705.86 2 32.063 2.9 62 66 78 78 68 67 75 81 76 78 88 26 26 [674.3]G[214.1]F[299.2] 2079 KSVATVGGCGSGAVTW 10.7 67 740.3647 2 26.324 2.6 26 97 96 91 84 84 88 84 50 40 83 70 55 44 48 26 [128.1]SVATVGG[160.0]S[514.3] 3718 HKMYSAFRHW 6.7 67 681.8286 2 46.797 1.8 47 46 50 66 86 86 94 76 58 58 [559.3]SAF[479.2] 954 SVAAGSY 4.7 67 654.3102 1 13.383 1.4 88 90 90 92 55 26 26 SVAA[307.1] 3013 VDFLDTKNHLGLF 8.7 67 759.8992 2 38.085 2.6 73 76 76 87 81 79 82 68 67 61 46 44 26 [361.2]LD[101.0]K[681.4] 2257 LELLFTFLF 6 67 571.8282 2 28.581 0.4 30 86 96 93 81 67 63 58 26 [113.1]ELLF[508.3] 1028 EAERLVVVW 6 67 367.5404 3 14.263 2.8 26 90 58 58 75 93 86 86 26 [129.0]A[398.2]VVV[186.1] 1618 VATTVTGW 5.4 67 834.4356 1 21.06 0 26 57 80 86 85 84 87 26 [170.1]TTVTG[186.1] 1867 VKFTLTGNGGLQM(+15.99)NF 10 67 821.9147 2 23.806 2.2 26 88 87 92 83 62 62 66 39 40 46 69 80 75 80 [99.1]KFTL[627.3]M(+15.99)[114.0]F 3318 AFQYKAYPRGLF 8 67 730.8907 2 41.926 3.9 88 87 77 77 79 94 96 85 31 29 27 26 AF[419.2]AYP[473.3] 1376 NMVLGKKAAVEVLKGPF 11.4 67 901.0239 2 18.332 0 66 71 88 95 92 94 92 81 61 60 81 72 40 33 32 44 26 [245.1]VLGKKA[170.1]E[641.4] 1561 DCKKGGAPVPLTLY 9.3 67 731.3929 2 20.398 1.1 71 71 84 84 85 81 58 55 50 88 81 67 26 26 [218.0]KKGG[267.2]PL[377.2] 3105 YGKLAKGSVVEEFF 9.3 67 787.4165 2 39.256 0.1 53 66 81 95 92 73 66 68 77 68 69 56 32 32 [220.1]KLA[1022.5] 2852 HKMTM(+15.99)LATLDW 7.3 67 681.8295 2 36.081 2.1 41 49 58 82 87 87 73 62 58 72 60 [396.2]TM(+15.99)L[586.3] 1212 KNPCRSELKAKSDETLPAW 12.7 67 725.0421 3 16.441 2.2 49 48 66 68 70 72 59 59 59 77 87 89 90 92 79 67 53 48 26 [1126.6]KSDE[568.3]

PAGE 383

383 3115 NKLLKGFHW 6 67 571.8281 2 39.388 1.8 84 84 94 97 71 67 46 26 26 NKLL[655.3] 2072 KY(+79.97)KLEESRKKLLAANPLLEAYLFFY 16.7 67 1043.227 3 26.239 0.7 50 41 36 39 58 51 46 47 59 49 78 97 98 98 90 80 79 85 89 91 92 86 35 35 46 [1482.8]LAANP[113.1]LEAYL[457.2] 2737 FAKKGGHPELGMLF 9.3 67 766.4088 2 34.626 0.8 80 79 90 79 66 68 70 78 88 58 47 43 46 33 F[71.0]K[476.2]E[561.3] 3303 FAQAPLPGEALLY 8.7 67 695.3734 2 41.74 1.2 90 91 81 78 74 62 58 59 50 52 61 76 26 FAQ[1024.6] 3566 EWVGLVKKNLQW 8 67 500.6197 3 44.946 5.1 42 42 58 77 72 74 80 81 79 65 67 58 [683.4]KK[541.3] 1525 AGLGMTSLGVRSTGW 10 66 746.8822 2 19.998 0.4 73 77 65 70 88 86 65 61 48 47 55 74 75 80 26 [298.2]MT[700.4]G[186.1] 969 KNLETEAF 5.3 66 476.2426 2 13.566 0.3 46 43 56 88 88 88 92 26 [355.2]ETEA[147.1] 3938 VMLGPFEVGNNW 8 66 681.8293 2 49.544 0.2 53 49 43 49 92 99 89 77 76 52 63 48 [400.2]PFE[570.3] 2076 TMFVTFPGVKHLF 8.6 66 762.4086 2 26.295 1.4 78 78 93 98 98 98 26 42 43 58 58 59 26 [232.1]FVTF[778.4] 1876 MWEPLPLDGKVW 8 66 735.8739 2 23.906 3.1 51 77 66 96 35 89 96 90 69 55 40 26 [446.2]P[113.1]PLD[470.3] 1436 CNLESLKKLHAF 7.9 66 468.2558 3 19.007 1.2 64 59 81 76 83 94 98 52 46 47 63 26 [217.1]L[129.0]SLK[596.3] 4064 KCLLVSGLDDPPVY 9.3 66 759.8984 2 51.142 1.5 57 63 78 82 75 76 75 78 85 86 86 26 26 26 [344.2]L[356.2]DDP[359.2] 1774 KGMAFQM(+15.99)MLTDRKS(+79.97)Y 9.9 66 951.9189 2 22.775 0.4 38 30 35 41 95 90 86 80 83 96 96 92 67 28 28 [387.2]FQM(+15.99)MLTDR[458.2] 2414 FAKADGYAKLSKY 8.6 66 731.3921 2 30.575 2.3 80 80 94 92 87 90 69 56 42 48 45 42 26 FAKADG[853.5] 2220 WVSPGGGLLKRF 7.9 66 658.8766 2 28.111 1 73 73 89 87 75 73 76 74 50 44 46 26 [285.1]SP[828.5] 1764 EYGHPLPHALGPVF 9.3 66 511.9342 3 22.674 2.1 52 55 69 59 49 64 91 87 85 82 62 58 77 26 [696.3]PHAL[400.2] 3615 Y(+79.97)T(+79.97)EAAGNW 5.3 66 536.1647 2 45.548 0.1 28 71 59 90 85 72 72 46 [553.1]AA[357.1] 1015 NKRSHF 4 66 788.4161 1 14.122 0.1 48 62 78 77 64 64 [769.4] 1314 KGKLAGSTLAELVHF 9.9 66 785.9508 2 17.636 0.5 26 68 68 78 71 67 61 63 76 84 85 92 93 26 26 [855.5]AELV[284.1] 1686 STEFDRVGVSKW 7.9 66 705.856 2 21.857 2.6 81 81 81 26 95 94 94 68 68 46 26 26 STE[147.1]DRV[557.3] 3082 EVADFGPAVVSVDKW 9.9 66 809.9128 2 38.958 4.6 52 51 80 90 95 75 63 71 72 76 63 52 48 50 42 [228.1]ADF[1038.5] 3737 RVGKVEGNW 5.9 66 522.7841 2 47.04 2.3 45 52 73 85 92 91 60 60 30 [312.2]KVE[357.1] 1890 LEMWSAFPPVW 7.2 66 681.8296 2 24.071 2.2 36 36 47 74 79 97 99 99 99 26 26 [646.3]AFPP[285.1] 3196 FKKDGAPSDFLW 7.9 66 705.8541 2 40.407 3 35 72 54 85 88 85 86 76 75 75 26 26 [403.3]DGAP[648.3] 2509 ANPLLEAYGAPVF 8.5 66 681.3569 2 31.803 2.5 62 57 56 59 96 93 92 86 75 49 41 54 26 [395.2]LEAY[471.2] 1938 VQFTNEQLKQFF 7.9 66 764.8939 2 24.629 0.7 52 43 43 96 83 92 72 93 67 67 48 26 [374.2]TNE[128.1]L[550.3] 2762 FAKAGYAPFLLTY 8.5 66 731.3926 2 34.938 0.3 80 79 84 65 52 59 89 92 77 64 42 38 26 F[71.0]K[291.1]AP[637.3] 1429 TTFVNAHSSAGAPF 9.2 66 703.8394 2 18.925 1.2 90 95 93 63 46 59 88 87 47 45 52 59 61 26 TTF[284.1]HS[530.2] 970 KPMVAANSY 5.9 66 490.7488 2 13.575 3.4 64 55 56 60 62 80 69 79 61 [526.3]A[364.1] 2266 VSPANFTVLF 6.6 66 547.7981 2 28.688 0.8 26 52 61 64 75 91 80 81 94 26 [468.2]FTVL[147.1] 956 WAKAALCRRKCFW 8.5 66 546.9539 3 13.402 2.1 73 74 90 91 47 40 40 52 48 53 74 80 84 [257.1]KA[830.4]FW

PAGE 384

384 3363 TSSVKLLSSKAF 7.9 66 634.3666 2 42.481 0.4 26 94 94 84 64 65 71 74 68 55 58 26 [101.0]SSV[874.5] 1593 FMPYLVKF 5.2 65 522.7842 2 20.772 2.6 26 26 82 80 91 94 95 26 [278.1]PYLVK[147.1] 4013 RPLPAAGLSVCTYY 9.2 65 504.2613 3 50.502 1.8 59 58 62 70 76 73 62 62 67 95 71 62 66 26 [862.5]V[530.2] 1388 TLLSGPRRW 5.9 65 543.3141 2 18.464 0.2 27 90 96 97 87 66 70 26 26 [101.0]LLSG[595.3] 1348 GCLKLPARTW 6.5 65 1144.626 1 18.025 2.9 60 65 75 82 85 86 72 52 45 26 [273.1]KLP[514.3] 2055 APVGALGPW 5.9 65 434.2403 2 26.027 1.3 97 97 97 72 65 47 45 38 26 APV[581.3] 3331 DALLVGQPY 5.9 65 975.5138 1 42.08 0.8 79 79 90 82 42 42 36 82 51 [186.1]LL[284.1]P[163.1] 3211 MTKPKNAGGGKLMW 9.1 65 759.8983 2 40.603 1.8 67 63 70 66 71 65 55 54 69 59 63 74 77 52 [1499.8] 2246 NDAVPRAELLTY 7.8 65 681.3575 2 28.44 1.3 46 48 56 63 74 94 95 96 90 50 38 26 [496.2]RAEL[377.2] 3448 HQMTMPCRLVF 7.2 65 681.8286 2 43.508 1.5 68 46 50 78 97 95 90 61 49 52 26 [497.2]MPC[515.3] 1893 YLLGLEACALVPF 8.5 65 704.88 2 24.094 1.1 37 90 94 94 95 83 62 57 59 58 59 26 26 [163.1]LLGLE[701.4] 1210 VTNSASGPGLF 7.2 65 525.2677 2 16.409 2 66 66 57 77 75 82 84 58 58 63 26 [472.2]SG[414.2] 2520 LELLSPPNLF 6.5 65 571.8288 2 31.946 4.3 42 88 98 96 96 50 41 40 44 52 [113.1]ELLS[568.3] 2575 WTLPM(+15.99)LATNNW 7.2 65 681.83 2 32.634 1.2 50 55 65 91 95 94 77 44 43 48 47 [400.2]PM(+15.99)L[586.2] 2175 LLRRKVGPPAADDAALPDVLY(+79.97) 13.7 65 777.4128 3 27.539 1.3 27 26 26 36 44 65 78 86 76 80 86 88 96 97 91 85 69 55 49 51 41 [822.6]P[97.1]AADDAAL[667.3] 2654 GSCGKGVKFPVPW 8.5 65 681.356 2 33.611 1.1 26 26 93 77 76 81 84 84 80 80 80 26 26 [144.1]C[185.1]GVKFPV[283.1] 3172 YGKLASGTPKEFLY 9.1 65 787.416 2 40.105 0.9 68 79 90 96 88 56 51 56 74 50 50 39 78 26 [220.1]KLA[1022.5] 996 YGMMAASPPF 6.5 65 536.2346 2 13.892 1.8 43 43 66 78 80 91 94 96 26 26 [482.2]AASP[244.1] 2546 MTELDTLAGLLVGW 9.1 65 759.8991 2 32.267 2.4 78 84 94 93 77 56 63 71 73 60 44 38 43 26 [131.0]TEL[1025.6] 2900 VMGGTALLW 5.8 65 474.2541 2 36.686 1 49 49 67 79 77 75 78 79 26 [928.5] 3614 KNLEQVLW 5.2 65 515.29 2 45.536 0 79 67 93 87 53 54 56 26 [242.1]LE[526.3] 1837 YPAPTKLVPLVF 7.8 65 672.9002 2 23.475 0.5 75 75 65 79 90 91 94 97 26 26 26 26 [428.2]TKLV[456.3] 3514 WDVPFLATNNW 7.1 65 681.8287 2 44.314 1.8 26 26 98 98 98 88 85 63 40 47 36 [301.1]VPFLA[515.2] 3670 FAKGKGYSNLLTY 8.4 65 731.3917 2 46.215 1.7 69 71 80 78 81 80 74 59 51 72 67 28 26 [218.1]K[57.0]KG[854.4] 1886 AMPKSDNHEPAQY 8.4 65 496.558 3 24.018 0.6 45 60 56 56 66 71 67 78 80 75 60 60 60 [880.4]E[459.2] 1444 MELFFLF 4.5 65 946.4745 1 19.089 0.3 94 90 91 96 26 26 26 MELF[407.2] 2642 RVMAPPTAPQW 7.1 65 627.3262 2 33.464 0.6 57 67 74 87 87 86 80 61 36 36 34 [386.2]APPT[482.2] 998 QSSAAAAVPTF 7.1 65 525.2663 2 13.914 0.7 81 82 94 90 76 66 46 48 70 26 26 QSSA[657.3] 3985 FAKMKFAELTLY 7.8 65 731.3928 2 50.147 1.8 36 50 61 74 81 67 92 90 89 75 29 26 [477.2]K[147.1]AEL[377.2] 1076 TTAAPAY 4.5 65 694.3418 1 14.833 1.8 89 93 93 96 26 26 26 TTAA[331.2] 2984 WTLPM(+15.99)LATNNW 7.1 65 681.8295 2 37.725 0.4 49 44 65 88 91 88 81 58 43 55 45 [400.2]PM(+15.99)LA[515.2]

PAGE 385

385 1693 YLEVHFTLPF 6.5 65 633.3312 2 21.926 1 34 34 90 98 95 90 71 56 46 26 [276.1]EVHF[458.3] 3356 KPQGSCAALLW 7.1 65 587.3093 2 42.392 2.6 53 57 52 83 82 72 71 64 72 72 26 [353.2]GS[657.3] 2606 GYKLALANGDLYLY 9 65 787.4164 2 33.022 0.3 47 48 84 83 96 79 62 54 61 70 67 60 60 26 [220.1]KLA[1022.5] 1294 KNGLKRNAPALF 7.7 65 664.8925 2 17.396 1.6 48 60 72 83 95 94 63 74 65 43 45 26 [299.2]LKR[613.3] 1986 LLPVLYPSPTLLYKY 9.7 65 890.5174 2 25.206 1.1 26 85 85 99 98 96 95 39 38 37 49 84 78 26 26 [113.1]LPVLYP[398.2]L[454.2] 3669 FAKKNYAYKGVGW 8.4 65 766.4085 2 46.205 2.7 81 79 87 78 69 53 72 82 80 56 40 29 26 F[71.0]K[476.2]YK[399.2] 2194 FALRAVGSLAKRY(+79.97) 8.4 64 766.4099 2 27.778 1.2 67 69 47 41 33 38 56 81 85 88 83 84 60 [714.4]SLAKR[243.0] 2289 NFDVLPCAAVHEY 8.4 64 493.2321 3 28.983 2.5 71 78 86 84 89 26 64 64 57 62 51 52 47 [261.1]DVL[870.4] 1329 CKLVSGGACGGLLRW 9.7 64 760.3973 2 17.805 0.2 60 72 88 86 80 74 73 62 63 79 69 56 44 27 26 [231.1]LVS[970.5] 3314 WLTPFLDGNNW 7.1 64 681.8291 2 41.871 2.4 55 52 43 67 26 95 93 89 66 65 52 [644.3]LDG[414.2] 3699 CDVFNGY 4.5 64 409.1622 2 46.569 1.6 50 50 50 92 83 95 26 [317.1]FNG[163.1] 2385 WNGQACANNMF 7.1 64 419.1703 3 30.211 1.6 63 58 61 47 61 71 74 82 62 77 47 [730.3]N[392.2] 2823 TSFAGAFVSLLY 7.7 64 425.8933 3 35.708 2.8 72 68 53 53 49 66 73 91 70 63 80 26 [681.3]V[200.1]L[163.1] 2878 WAVSGCLVGVPRQF 9 64 506.9347 3 36.404 0.7 42 42 42 56 80 67 63 63 70 90 94 65 65 53 [443.2]G[372.2]VP[431.2] 1608 SSLQRYNLGKMLTVHF 10.3 64 632.0051 3 20.958 0.1 26 74 69 45 47 39 45 78 97 98 90 87 85 85 26 26 [961.5]GKMLTV[284.1] 2740 GELLVGQPY 5.8 64 975.5142 1 34.66 0.3 73 73 93 45 45 61 46 82 54 [186.1]L[397.2]P[163.1] 1626 LELLFLTFF 5.8 64 571.8292 2 21.156 1.3 65 91 97 99 81 44 40 30 26 [113.1]ELLF[508.3] 1441 HNVPPKRVVNKGCPEPRW 11.5 64 705.0458 3 19.061 0.3 48 50 51 78 59 54 52 81 94 80 66 61 70 83 79 57 56 26 [828.5]VVN[288.1]P[568.3] 1251 YNKFLEKVLW 6.4 64 447.2518 3 16.883 0.1 48 79 79 96 98 83 51 43 32 26 [405.2]FLE[526.3] 1718 LKVDTSVGFHF 7 64 625.3333 2 22.185 1.6 44 62 75 93 94 87 83 83 26 26 26 [340.2]DTSVG[431.2] 1407 FLVLKAPGTKS(+79.97)F 7.7 64 694.3743 2 18.674 2.1 26 66 59 70 82 89 84 60 50 54 55 66 [472.3]KAP[600.2] 3032 GYKLSEVAGSVGLFY 9.6 64 795.4134 2 38.32 0.9 56 56 88 80 93 64 45 42 49 53 73 73 77 78 26 [220.1]KLS[1022.5] 2413 MTELDVGNPLLVAF 9 64 759.8992 2 30.564 2.5 75 80 87 88 91 74 69 44 47 47 66 45 45 33 [131.0]TELD[910.5] 1832 VKGTLAKGVDAHPSM(+15.99)GGW 11.5 64 609.6463 3 23.416 1.4 36 40 48 41 43 54 57 69 68 70 72 71 90 90 87 88 93 26 [1176.7]PSM(+15.99)GG[186.1] 3663 T(+79.97)PQCRCAVS(+79.97)Y(+79.97) 6.4 64 684.2026 2 46.126 1.2 26 83 51 89 75 64 54 53 73 69 [181.0]P[128.1]C[839.3] 879 KHVLGETDALHTF 8.3 64 489.9255 3 12.456 2.1 26 26 33 44 54 66 94 91 89 87 72 70 74 [663.4]TDAL[385.2] 3051 EAVYKAAPLNAPAVLVLF 11.5 64 629.3647 3 38.564 0.6 80 78 55 47 44 69 85 80 80 84 87 66 61 77 70 26 26 26 E[532.3]APLNA[739.5] 2601 MADGLGALF 5.8 64 447.723 2 32.959 0.3 72 64 50 50 64 77 70 82 42 [615.3]L[147.1] 2130 MFVTFGKVPHLF 7.7 64 711.8846 2 26.972 1.2 26 94 95 95 97 93 82 73 26 26 26 26 [131.0]FVTFGK[593.3] 3980 CNQLPYSVSSALRVY 9.6 64 567.2858 3 50.083 2.6 55 54 56 76 82 86 83 63 63 52 56 68 66 63 26 [458.2]PYS[875.5] 3267 TVSTRAFAARLF 7.7 64 447.2545 3 41.296 0.6 26 26 54 54 65 76 77 89 89 87 90 26 [762.4]AARL[147.1]

PAGE 386

386 991 KGSYGY(+79.97) 3.8 64 377.643 2 13.826 2.5 65 63 77 66 65 45 [735.3] 2197 QLLNFTVDVF 6.4 64 598.3226 2 27.823 1.8 40 40 56 53 89 93 94 68 68 31 [468.3]FTV[361.2] 1957 MSLTHVKKALLAF 8.3 64 729.9301 2 24.853 1.9 58 57 91 96 97 90 86 66 44 43 41 27 26 [218.1]LTHVK[643.4] 1401 DALGGGSGAASLPLF 9.6 64 666.8444 2 18.608 1.6 37 46 61 83 77 75 73 66 70 69 65 74 63 63 26 [299.1]G[957.5] 4000 FAKKGGYAGCAKLF 8.9 64 487.5963 3 50.341 1.8 55 55 77 70 75 75 82 75 74 77 52 46 44 26 [588.3]Y[690.4] 3973 LELPAGPSVF 6.4 64 515.2854 2 50.002 2 75 75 87 64 59 66 71 45 45 45 [242.1]L[655.3] 1141 MFKKECSRLLW 7 64 480.92 3 15.605 2.4 26 65 81 54 78 88 72 65 74 65 26 [278.1]K[257.1]C[655.4] 985 KVDSVLFKFVNFVF 8.9 64 422.9916 4 13.753 2.2 54 53 61 63 60 56 54 65 59 84 80 84 84 26 [1063.6]VNFV[147.1] 1856 SS(+79.97)Y(+79.97)S(+79.97)YGMPQACEQPDW 10.2 64 696.8512 3 23.678 38.4 26 26 26 59 60 84 65 65 70 88 88 91 80 69 85 26 [827.1]G[356.2]ACEQ[97.1]D[186.1] 2307 WVM(+15.99)AAVLGSTRAQGFF 10.2 63 586.2994 3 29.209 0.2 26 65 62 62 76 70 70 79 76 72 76 83 39 43 80 26 [1187.6]A[185.1]F[147.1] 2097 KFFTGATAAPSVTTW 9.5 63 792.9055 2 26.549 1.2 41 84 64 82 80 62 57 63 57 56 70 56 54 69 50 [128.1]F[147.1]TG[985.5] 3332 MALAAQAVLW 6.3 63 537.2952 2 42.09 1.7 74 74 86 69 61 40 48 62 87 26 [202.1]L[440.2]L[186.1] 1414 NNDLLGTKLSF 7 63 611.3275 2 18.75 0.2 76 79 94 95 44 43 45 60 60 70 28 [228.1]DL[746.4] 2408 MHKLLAPPAGNLPAW 9.5 63 539.2971 3 30.498 0.6 64 59 57 62 74 69 74 82 82 84 81 48 46 34 26 [790.5]PAGN[467.3] 1110 KWGVSGAYETLW 7.6 63 698.8493 2 15.235 1.2 41 39 51 73 67 67 67 75 81 83 85 26 [848.4]ETL[186.1] 4008 AFKLCLPAVGNGGVW 9.5 63 766.4088 2 50.437 0.9 56 74 88 93 87 74 71 59 61 79 67 40 36 33 26 [218.1]KLC[950.5] 2455 NKLLKHGFW 5.7 63 571.8282 2 31.107 1.9 81 81 93 97 62 56 43 26 26 NKLL[655.3] 1018 RDLEDTGKDAHTQLNNF 10.8 63 658.6483 3 14.151 0.5 73 54 52 59 58 59 69 39 39 74 73 86 80 84 59 65 46 [1237.6]TQL[375.2] 2053 VFLKATAMLAPVF 8.2 63 469.9412 3 26.009 1.6 26 78 52 48 49 45 61 86 90 85 84 86 26 [730.4]MLAPV[147.1] 1194 RTLPSDDDMVLALW 8.9 63 816.4079 2 16.227 0.7 30 44 47 96 91 91 99 97 87 51 49 42 30 26 [370.2]PSDDDM[582.4] 1912 LCDTVAAAVSLPVYKW 10.1 63 868.4559 2 24.31 2.3 61 64 81 35 32 41 62 72 74 81 26 26 96 91 91 72 [216.1]D[512.3]S[210.1]VYK[186.1] 3334 HRPMAAF 4.4 63 415.2115 2 42.112 2.5 26 85 82 74 73 74 26 [137.1]RP[420.2] 2054 NMMTLLDF 5.1 63 984.4504 1 26.018 2.5 48 48 72 77 76 80 77 26 [590.3]L[262.1] 2827 SMQAVVHSLLLTY 8.2 63 731.3922 2 35.765 0.1 57 56 54 89 90 87 26 88 88 91 32 32 26 [346.1]AVV[137.1]SLL[377.2] 1339 MPAAALSKLEAKRRNVF 10.8 63 634.6966 3 17.927 0.6 93 93 85 80 70 45 44 55 56 48 51 69 93 36 35 53 60 MPAA[840.5]R[516.3] 1922 CNDYVPLWGRKPVLF 9.5 63 903.9741 2 24.432 2.8 53 55 88 97 26 99 98 95 71 53 58 51 42 26 26 [217.1]DY[99.1]PLW[797.5] 3536 FAKLYGGSQLLSTF 8.8 63 766.4104 2 44.581 1.2 72 74 85 78 41 42 45 61 60 85 74 57 55 47 [218.1]K[605.3]L[448.2] 1326 TMLVSMDPALVVPF 8.8 63 760.3973 2 17.777 1.6 70 78 92 96 91 70 64 73 55 53 58 26 26 26 [232.1]LVS[969.5] 1234 SLLLLFALNAVYY 8.2 63 750.4268 2 16.688 2.9 86 86 92 88 44 42 46 60 49 59 69 68 26 SLLL[1054.5] 2038 MSELRLKSPANNAF 8.8 63 789.4094 2 25.821 0.7 87 88 87 90 82 81 58 55 52 49 35 34 34 45 MSELRL[829.4] 1411 RSLTTDLF 5.1 63 476.7587 2 18.724 0.3 35 40 44 81 88 90 98 26 [356.2]TTDL[147.1]

PAGE 387

387 3639 SVLPDGKPY 5.7 63 975.5151 1 45.837 0.6 26 26 96 85 80 60 60 72 59 [186.1]LPD[445.2] 1350 HLLLQGNWGRMW 7.6 63 504.2613 3 18.056 2.9 70 70 65 48 41 44 70 86 88 76 67 26 [775.4]WG[473.2] 1654 RLTPLNGAELVDY 8.2 63 730.8909 2 21.464 0.1 39 41 53 77 77 61 68 83 87 87 88 26 26 [751.4]AELV[278.1] 1921 NEKLQKT(+79.97)LNHTMVF 8.8 63 891.9349 2 24.422 1 29 29 30 93 53 78 54 74 69 89 85 83 85 26 [371.2]L[664.3]HTMV[147.1] 2548 AFKWGYKALVMF 7.6 63 730.8914 2 32.289 0.2 73 73 73 54 70 60 72 67 75 56 53 26 [1441.8] 3183 WPLTM(+15.99)LATNNW 6.9 63 681.8284 2 40.244 1.2 26 59 75 83 86 89 87 40 39 49 55 [396.2]TM(+15.99)LA[515.2] 1778 YAFVRF 3.8 63 401.7154 2 22.825 1.3 26 99 99 99 26 26 [163.1]AFV[303.2] 1860 Y(+79.97)LRVLDGGGMGLRNVKLY 11.3 63 702.0286 3 23.727 2.7 75 47 38 53 54 56 55 49 54 65 76 77 88 74 80 79 79 26 [1311.6]R[114.0]V[404.2] 3343 EYLVCF 3.8 63 387.1802 2 42.234 0.9 26 26 91 79 79 75 [292.1]L[349.1] 2301 FAKAPLKFPKY(+79.97) 6.9 63 695.3731 2 29.133 4.4 73 72 86 74 55 58 82 88 47 26 26 [218.1]K[281.2]KF[468.2] 1752 FKTKLKDVLNPPW 8.2 63 529.3083 3 22.549 0.2 28 27 38 64 76 89 95 97 90 49 56 75 26 [617.4]KDVL[494.2] 2490 FDNGATALSTY 6.9 63 387.1801 3 31.554 0.6 68 65 59 60 59 56 60 71 83 81 26 [789.4]ST[163.1] 2230 RHKGFLLLFSNMF 8.2 63 537.2949 3 28.231 1.9 54 38 34 54 68 92 93 76 52 52 56 78 65 [625.3]LL[739.3] 1177 ALYLFPF 4.4 63 870.4746 1 16.029 1.5 87 86 93 93 26 26 26 ALYL[391.2] 2041 TFPVKGDPLEYSKFVYY 10.7 63 1027.021 2 25.862 1.1 28 31 34 68 61 58 54 85 98 99 90 94 91 92 26 26 26 [744.4]PLEYSKF[425.2] 1092 LVAMGELAETKVNLHF 10.1 63 591.3168 3 15.024 3 40 39 38 39 43 48 57 89 94 97 97 96 77 58 59 26 [713.4]AETKV[511.3] 2000 NFTVLF 3.8 63 740.3988 1 25.371 1.5 62 72 91 96 26 26 [261.1]TV[260.2] 1797 TELLPAPAEPVMARCF 10 63 872.9404 2 23.033 1.4 30 31 35 80 88 89 91 94 93 94 64 36 35 39 71 26 [343.2]LPAPAEP[707.3] 1008 QASTPLKGADF 6.9 63 567.7925 2 14.041 0.9 71 86 95 97 89 59 46 41 35 38 26 [128.1]ASTP[631.3] 2786 WDVPM(+15.99)LGGGKTW 7.5 63 681.8294 2 35.243 0.4 26 26 99 99 96 84 78 66 46 49 52 26 [301.1]VPM(+15.99)L[586.3] 1573 FAKLCGAGATGVPPGW 10 63 766.3903 2 20.535 0.5 68 70 80 66 65 67 66 72 80 69 67 77 47 38 38 26 [218.1]K[401.2]A[694.3] 3147 NNSEKGAVVASFPLW 9.4 63 809.9141 2 39.791 0.8 63 59 50 47 54 67 74 84 68 62 66 95 94 26 26 [700.3]V[257.1]FP[299.2] 2064 MVRFLVPAYNVF 7.5 63 728.3959 2 26.143 1.9 78 77 92 74 26 93 92 55 34 34 41 51 [230.1]R[260.2]VP[594.3] 3411 KPYSTSF 4.4 63 415.2107 2 43.056 6.2 65 63 63 26 73 73 73 [810.4] 2947 Y(+79.97)KSRTKVCAKLCLLRNYKY 11.9 63 608.3206 4 37.27 2.3 82 60 45 56 62 63 58 56 57 62 65 55 65 92 93 81 47 53 27 Y(+79.97)[1330.8]LRN[454.2] 2151 SCSAGGASAHVALF 8.8 63 639.3013 2 27.233 1 26 89 89 88 88 83 53 46 64 61 46 49 61 26 [87.0]CSAGG[796.4] 1290 MEGSLAF 4.4 63 754.3431 1 17.36 1.1 85 84 89 64 60 26 26 MEG[418.2] 2899 AFKKGGYAELTLY 8.1 63 487.5964 3 36.675 2.4 40 41 53 38 84 80 89 92 89 76 59 39 26 [474.3]GGYAE[490.3] 3944 WAWVVTVSQTRW 7.5 63 506.9347 3 49.621 3 39 77 48 73 75 26 91 89 73 62 64 26 [742.4]VS[571.3] 3691 AFKKGGYAELTLY 8.1 63 487.5963 3 46.471 2.7 47 47 68 44 65 72 88 90 84 70 55 49 26 [588.3]YAE[490.3] 2094 RFVLVKKSTPDRW 8.1 63 816.4714 2 26.515 1.4 26 26 26 96 94 94 90 82 82 72 48 39 29 [402.2]LVKKST[554.3]

PAGE 388

388 1093 GKMVKGFDKKPF 7.5 62 691.3852 2 15.035 2.1 27 46 61 95 92 67 52 61 77 84 57 26 [316.2]VK[447.2]K[244.1] 2268 QPAVTYGVLF 6.2 62 1094.588 1 28.72 0.3 42 55 63 94 78 49 51 78 84 26 [296.1]V[420.2]L[147.1] 1098 TVLQFHW 4.4 62 465.7482 2 15.096 6.4 26 98 96 66 73 48 26 [101.0]VL[598.3] 2776 LSPGVVNPGQDQW 8.1 62 466.2326 3 35.112 1.5 26 80 75 74 69 67 61 83 63 55 51 52 50 [113.1]S[466.3]P[614.2] 4088 KGWCAQLALEVMNF 8.7 62 805.3947 2 51.444 2.7 36 38 49 59 60 46 74 78 80 71 70 67 69 69 [857.4]L[620.3] 1738 MVQCPLVPF 5.6 62 1033.521 1 22.393 0.1 98 95 82 87 91 26 26 26 26 MVQCP[456.3] 3711 WVLESPHLKESW 7.5 62 504.2605 3 46.714 1.1 26 86 87 78 79 87 91 68 35 35 38 33 [186.1]VL[216.1]PH[643.3] 1548 KFVTLYACGGVRF 8.1 62 487.5964 3 20.256 1.8 26 56 50 53 77 87 81 68 68 80 66 66 26 [588.4]YA[160.0]G[402.2] 1602 YPLFGMPRVLKPALDGYPTPW 13.1 62 605.3211 4 20.887 2.1 78 78 64 52 53 61 65 57 43 31 28 37 57 93 95 95 94 91 76 27 26 [1469.8]LDGYP[384.2] 2292 LVCCGGCF 5 62 401.1592 2 29.027 2.4 76 73 73 33 68 79 67 26 [782.3] 3092 WMVPKPLAAPWKW 8.1 62 537.2957 3 39.089 0.9 59 61 44 63 78 84 82 79 74 68 48 26 37 [641.3]PL[739.4] 1873 VFPTTLDDLGNLLVW 9.3 62 851.9583 2 23.876 2.6 32 32 37 59 72 96 97 92 69 68 39 42 84 81 26 [545.3]LDD[397.2]LV[186.1] 1731 EGLVLGQPY 5.6 62 975.5158 1 22.322 1.3 79 64 67 80 61 44 42 64 55 [299.1]V[558.3] 2475 WLMPKGPF 5 62 975.5146 1 31.355 2.6 26 95 91 83 62 53 58 26 [186.1]LMP[429.2] 1342 VFRAYGPLLKRF 7.5 62 489.6249 3 17.956 1.9 26 56 55 59 63 75 76 85 85 67 68 26 [790.4]LL[431.3] 2814 TELLGGGSVDDLRW 8.7 62 759.3844 2 35.597 1.4 58 61 84 77 62 54 66 57 56 59 63 62 80 26 [230.1]L[813.4]R[186.1] 3261 VHHYDAAVLLKGPKTGMWY(+79.97) 11.8 62 756.0362 3 41.219 2.7 26 26 73 64 44 60 62 60 68 90 92 93 95 93 65 54 36 36 33 [1005.5]LKGPK[718.2] 1824 WTQKGGLGKLMTHVF 9.3 62 568.3075 3 23.33 1 28 35 30 33 49 59 77 94 98 93 91 93 92 26 26 [770.4]GKLMTH[246.1] 3984 MATASGPLF 5.6 62 447.7229 2 50.138 0.4 71 52 44 45 60 72 90 93 26 [518.2]PL[147.1] 2710 RRCLAPGGMLSVVPPMY 10.6 62 923.9774 2 34.284 0.8 26 56 53 81 64 66 82 66 66 76 90 89 89 53 31 31 26 [415.2]L[168.1]G[301.1]SVV[488.2] 1060 AWPCVDDTTLVLW 8.1 62 759.8671 2 14.633 1.8 26 26 82 65 65 95 97 96 85 60 49 27 26 [257.1]P[202.1]DDTT[511.3] 3470 LYVVVSTTY 5.6 62 1044.56 1 43.774 0.9 26 97 97 91 91 61 33 33 26 [113.1]YVVV[452.2] 1009 VLGKNGGAM(+15.99)GLSYF 8.7 62 715.3613 2 14.051 0.7 38 42 55 70 67 62 44 41 36 42 95 95 88 88 [900.4]LSYF 2364 EANPLLAYGGVPLF 8.7 62 487.5973 3 29.95 0.6 48 41 40 65 68 79 85 86 90 89 91 26 26 26 [637.3]AYGGV[357.2] 3543 CKLLADGDLDLPVF 8.7 62 759.8984 2 44.668 1.4 53 52 77 71 41 39 65 81 79 82 83 85 26 26 [700.4]D[113.1]DLP[246.1] 3306 APPQAVVW 5 62 434.2397 2 41.786 0.3 26 98 79 48 63 73 79 26 [71.0]P[680.4] 3496 YVAPAAVCPGKAKW 8.7 62 487.5962 3 44.088 1.4 76 78 78 65 40 41 41 58 78 93 83 69 35 26 [871.4]GK[385.2] 3326 SPSVTCSNSVVKRF 8.7 62 504.2609 3 42.018 0 57 57 57 85 85 79 77 53 57 59 64 52 52 26 [271.1]VT[1020.5] 2347 LYVVSSTLY 5.6 62 1044.561 1 29.727 0.6 26 98 98 91 91 41 36 45 26 [113.1]YVVS[464.2] 2683 AGCLLKVTPGSRMW 8.7 62 759.8981 2 33.961 1.9 28 37 39 74 76 68 69 72 87 76 65 65 78 26 [785.4]P[617.3] 2002 AAGVGLMTVY 6.2 62 981.5059 1 25.389 1.4 58 74 75 86 56 56 72 84 26 26 [199.1]V[301.1]T[262.1]

PAGE 389

389 2918 WLTPFLDGNHY 6.8 62 681.8289 2 36.916 2.1 68 70 55 90 26 94 82 56 43 41 49 [400.2]P[147.1]LD[471.2] 1275 MSLVQCGLVNGAPW 8.7 62 737.8636 2 17.17 1.2 66 65 93 41 40 42 55 65 89 71 74 67 63 26 [218.1]L[500.2]V[525.2] 2358 MPDGNPVTGAY(+79.97) 6.8 62 401.1588 3 29.873 2 41 46 48 70 70 80 59 60 81 92 26 [514.2]P[200.1]GA[243.0] 2935 FAKKGGNSGAPGVRW 9.3 62 766.4087 2 37.126 1.7 71 71 88 62 51 69 62 70 69 45 41 49 71 75 26 [218.1]K[1166.6] 3223 WYSVRVCKGAMLTW 8.6 62 567.285 3 40.753 2.5 43 53 43 84 91 56 52 63 79 78 68 61 60 26 [436.2]VR[989.5] 3330 FAQNRLKKENHF 7.4 62 766.4092 2 42.069 1 65 69 61 68 65 64 74 56 42 42 66 64 [1512.8] 3381 LTVFVKALFGY 6.8 62 629.364 2 42.7 2.7 72 75 91 96 81 63 59 38 33 33 33 [214.1]VFV[679.4] 2869 WLS(+79.97)LAPVKPAALW 8 62 766.408 2 36.298 1 79 92 72 91 69 66 61 49 47 47 56 41 26 [186.1]L[167.0]L[933.5] 2720 HQMTFLATLDW 6.8 62 681.8288 2 34.414 0.5 54 41 43 77 96 91 74 53 44 52 48 [497.2]FL[586.3] 2361 GYGKGANPGPSSW 8 62 639.3013 2 29.906 3.6 26 72 82 89 89 88 69 83 72 33 33 33 26 [220.1]GKGA[114.0]P[514.2] 4027 MNKWAYVHNCGPGVGVKDKY 12.3 62 756.0379 3 50.68 4.3 82 72 59 42 39 35 49 69 66 75 88 92 89 85 65 45 45 45 47 37 M[1115.5]GPGV[690.4] 1476 DCKKLYAFVRF 6.8 62 695.3722 2 19.449 1.7 64 64 71 28 63 52 89 95 95 26 26 [750.4]AFV[303.2] 2077 VFSAAGVVGVTMLAVPF 10.5 62 555.6406 3 26.304 0.3 75 74 36 37 39 52 53 46 48 51 67 90 92 86 85 83 26 [987.5]MLAVP[147.1] 1010 KPRMLVGW 4.9 62 493.7848 2 14.063 2 59 47 38 34 88 98 99 26 [512.3]LVG[186.1] 1004 TSTRPF 3.7 62 708.3677 1 13.99 0.3 26 81 90 75 68 26 [101.0]ST[400.2] 3840 VKAKKSLSTNAFSLTKY 10.5 62 629.3641 3 48.305 1.8 34 34 43 61 49 47 55 80 92 89 95 94 85 57 52 48 26 [754.5]STNAFS[505.3] 2626 VSLTLSMSCAMHW 8 62 489.2264 3 33.26 0.6 26 84 71 73 77 49 49 59 83 69 65 64 26 [99.1]S[632.3]C[525.2] 3502 MSNGDFF 4.3 62 409.1619 2 44.167 2.4 83 74 64 76 77 26 26 M[667.3] 1749 GTPLHKHW 4.9 62 488.2606 2 22.508 2.1 64 65 63 76 84 85 26 26 [368.2]HK[323.1] 1206 TTGHRSF 4.3 62 805.3946 1 16.373 0.6 26 91 93 91 70 28 28 [101.0]TGH[390.2] 3961 MFKGPPLW 4.9 62 975.5148 1 49.846 2.8 26 96 87 81 78 68 26 26 [131.0]FKG[493.3] 2089 MMM(+15.99)QVRNF 4.9 62 1072.476 1 26.453 2 26 26 88 78 71 63 65 71 [262.1]M(+15.99)[644.3] 1198 SSAAVNAKNAKAF 8 62 426.8987 3 16.269 1.1 93 90 52 40 37 48 50 56 68 73 80 80 26 SS[739.4]KA[147.1] 1435 WRRGVTWKKKLSGAASCY 11.1 62 525.0361 4 18.997 2.4 66 66 41 56 58 52 40 32 33 88 87 88 83 76 65 64 76 26 [1197.7]KLSG[495.2] 2973 MSKFRCKALTLY 7.4 61 730.8906 2 37.588 0.8 49 54 76 92 60 58 70 67 80 69 29 26 [346.2]F[458.2]L[377.2] 4105 DMRCLRAMLFF 6.8 61 468.23 3 51.666 2.6 60 68 47 62 65 71 78 73 61 57 26 [1383.7] 1587 VNLPAEGQGTF 6.8 61 566.7856 2 20.698 0.8 86 70 67 64 84 74 65 41 42 44 33 V[324.2]A[619.3] 1558 YPSLKGAAGPGW 7.4 61 602.3138 2 20.362 3.9 26 26 93 87 85 81 75 68 58 56 48 26 [260.1]SLKG[539.2] 3277 FTLLDDLDHLAVF 8 61 759.8975 2 41.427 2.6 31 35 48 90 92 83 73 71 71 75 49 42 31 [361.2]LDD[795.4] 2288 GCEVAEF 4.3 61 377.6578 2 28.972 1.1 26 26 87 84 88 89 26 [160.0]EVAE[147.1] 4299 WS(+79.97)CVY 3.1 61 369.1216 2 54.219 0.7 26 79 69 79 52 [718.2]

PAGE 390

390 3339 CLMHTFESLKPGKKW 9.2 61 602.314 3 42.177 2.1 39 46 60 75 79 90 93 92 86 62 45 43 51 26 26 [585.2]FESL[724.4] 1946 KVFTNAWLKKFFHCY(+79.97) 9.2 61 671.328 3 24.718 2.1 26 96 78 74 77 66 64 67 42 60 26 53 79 79 26 [128.1]V[1765.8] 1820 FAQMLKGTGRQAFPW 9.2 61 869.4524 2 23.282 4.7 28 29 29 71 93 95 96 93 92 54 47 52 79 26 26 [477.2]LKGTG[785.4] 4235 Y(+79.97)FWGCCASDVVS(+79.97)HW 8.6 61 607.2062 3 53.376 0.2 26 58 59 68 78 71 56 55 74 86 86 82 26 26 [1112.3]VVS(+79.97)[323.1] 3087 VFRLKGAPPNM(+15.99)LVLY(+79.97) 9.2 61 605.3195 3 39.025 0.4 26 49 56 38 44 45 59 83 90 77 86 73 59 57 70 [771.5]PP[114.0]M(+15.99)[568.3] 1969 WLTTAGDFTVW 6.7 61 648.8181 2 24.994 2.3 82 42 46 72 68 68 81 65 59 59 26 W[443.2]D[533.3] 2566 LLLMTATAVPQRW 8 61 500.6194 3 32.514 2.4 26 94 66 64 68 63 52 50 63 77 55 62 50 [113.1]L[1254.7] 2953 GYKLSLSGVGGEYLF 9.2 61 795.4129 2 37.348 1.5 52 56 82 64 81 66 43 43 57 87 72 71 86 26 26 [220.1]K[113.1]S[356.2]G[186.1]Y[260.2] 3757 ECLLKGGDLDLPVF 8.6 61 759.8986 2 47.283 1.7 26 74 75 66 65 61 67 59 58 79 82 86 26 26 [1043.5]LP[246.1] 1485 GELPDGKF 4.9 61 862.4296 1 19.545 0.9 48 48 89 83 81 84 26 26 [186.1]LPDG[275.2] 3312 WLAKCAAGGGAPLAVF 9.8 61 511.2751 3 41.851 1.2 79 72 59 59 66 65 50 42 64 85 81 80 47 40 40 43 [857.4]GAP[430.3] 1680 LFVVHAPAEGAMKKKW 9.8 61 604.6729 3 21.782 2.9 26 26 26 72 72 60 63 73 83 86 86 82 82 80 26 26 [834.5]EGAMKK[314.2] 3406 AFKLRVTVAAGRY(+79.97) 7.9 61 766.4092 2 42.991 2.1 64 70 82 81 66 52 39 48 67 68 58 67 26 [218.1]KL[1053.5] 4093 TLVGKFGSKDDACKY 9.2 61 544.6073 3 51.512 1.5 49 50 55 66 72 64 58 49 52 66 76 78 75 72 26 [1612.8] 2895 TDDGEAF 4.3 61 377.6496 2 36.624 3.9 26 44 81 80 80 87 26 [216.1]DGEA[147.1] 1262 KNALKGSLEPKPF 7.9 61 714.9133 2 17.014 1 40 45 49 89 91 73 58 62 75 66 63 50 26 [313.2]LK[855.4] 3015 Y(+79.97)TVCTEADS(+79.97)CTGYAPY(+79.97) 9.8 61 661.8685 3 38.104 2.2 27 48 41 70 68 69 50 50 60 93 91 92 75 61 46 26 [1129.3]CTG[574.2] 2444 GFLDGSLYLTLY 7.3 61 681.3556 2 30.965 3.9 45 41 41 67 83 80 80 82 78 71 33 26 [432.2]GSLY[490.3] 1758 STKGWTGM(+15.99)PPVW 7.3 61 681.8289 2 22.61 0.4 42 43 50 56 81 89 93 96 98 26 26 26 [373.2]WTGM(+15.99)P[382.2] 1192 LLGSS(+79.97)TKLGTTRGNY 9.2 61 549.941 3 16.196 1 67 68 58 60 58 56 69 78 88 81 58 50 45 45 26 [879.5]GT[591.3] 4050 FKLMHPVPRNLTY 7.9 61 404.7242 4 50.97 1.7 53 60 75 83 93 26 26 67 66 78 67 67 26 [388.2]MH[940.5] 3809 KTPGNFLLMVY(+79.97) 6.7 61 681.8298 2 47.936 0.3 50 37 37 41 70 95 94 81 67 66 26 [497.3]FLL[473.1] 2491 MTVYLPNLHQRF 7.3 61 506.9352 3 31.565 1.6 51 51 57 61 70 69 62 79 70 53 52 51 [1499.8] 1768 NKNLERLAW 5.5 61 572.3184 2 22.711 2.3 75 78 75 90 77 46 43 34 26 [356.2]L[655.3] 2208 NM(+15.99)YVVDVVM(+15.99)EF 6.7 61 459.8747 3 27.962 2.3 46 46 50 72 74 77 86 70 52 52 39 [737.3]V[522.2] 1328 CELVSPGVVTGNTLF 9.1 61 768.3943 2 17.795 2.7 26 97 97 97 71 70 65 60 64 38 37 44 55 57 26 [103.0]ELV[1072.6] 1705 STGTMLKVGKERAW 8.5 61 782.4192 2 22.048 0.1 28 38 51 93 97 97 94 69 39 39 43 52 77 26 [245.1]TMLK[826.4] 3433 ALVVVRRSKGDNW 7.9 61 500.6191 3 43.333 0.9 38 38 46 61 61 62 61 82 75 77 58 74 51 [793.5]S[600.3] 3276 Y(+79.97)KKSGLVDTLKWSKSGVKYY 12.2 61 608.3197 4 41.416 4.2 81 79 57 74 67 53 55 51 51 71 58 41 40 76 63 63 74 59 65 32 Y(+79.97)[2168.2] 3537 M(+15.99)AKADGPGLLKTPF 8.5 61 731.3931 2 44.593 1.3 43 46 65 92 85 83 73 43 45 68 57 56 62 26 [346.2]ADG[853.5] 3781 HLVAAGFFTAADKY 8.5 61 504.2613 3 47.581 0.5 26 60 55 63 74 73 78 76 63 63 72 51 51 37 [1491.8]

PAGE 391

391 2229 RYSHLLPGFW 6.1 61 425.8931 3 28.221 1.2 29 79 65 92 84 67 65 70 26 26 [406.2]HL[600.3] 2439 TTALPLAALAAPAGWW 9.7 61 537.2954 3 30.898 1.2 53 59 52 48 58 79 84 80 66 48 57 69 71 61 52 26 [596.4]AA[852.4] 2833 NRPGRNGAPVFLY 7.9 61 487.5962 3 35.839 1.1 41 41 53 61 67 72 76 79 82 81 78 26 26 [822.4]PV[423.2] 1195 LWAPSDDDPVKKNY 8.5 61 824.4053 2 16.238 1.3 33 37 44 91 82 41 98 96 78 49 55 56 56 26 [370.2]PS[115.0]DD[729.4] 4314 S(+79.97)PT(+79.97)GCNAVY 5.5 61 536.1653 2 54.421 1.9 26 58 70 84 56 48 66 73 60 [445.1]G[550.2] 955 VQRDHLGHVF 6.1 61 604.3212 2 13.392 1.7 68 48 54 88 72 72 64 82 26 26 [383.2]D[307.2]H[246.1] 4092 YCYGPDGDSY(+79.97) 6.1 61 610.1846 2 51.501 2.4 27 44 47 77 82 85 75 66 70 26 [486.2]PD[502.1] 2091 NTTAMGSFPF 6.1 61 536.7415 2 26.472 1 43 43 58 82 76 76 76 95 26 26 [316.1]A[275.1]F[244.1] 1688 NVFNQATKNLSFLGLW 9.7 61 617.9971 3 21.873 0.9 60 66 34 41 33 53 78 68 53 71 93 95 89 54 47 26 [1129.6]SFL[356.2] 1225 RDLESEVDNEKRNVPTW 10.3 61 1044.01 2 16.591 1.2 56 53 55 66 73 74 88 90 76 80 80 48 52 37 35 33 26 [729.3]VD[114.0]EK[753.4] 1695 SKTSDGVRDFLW 7.3 61 705.856 2 21.941 2.5 38 48 54 84 82 84 82 81 88 26 26 26 [316.2]SDGVRD[446.2] 2282 YGGAGGAATPHRY 7.9 61 639.3037 2 28.894 1.4 34 56 67 85 75 72 82 74 63 54 41 43 35 [277.1]A[114.0]A[725.4] 1532 KGLT(+79.97)PGASGLTGALW 9.1 61 754.8807 2 20.073 2.1 80 76 79 73 71 69 66 63 65 42 36 37 54 64 26 K[1361.6] 1012 RVM(+15.99)DQNGGLKEF 7.3 61 705.345 2 14.08 0.9 26 87 85 84 51 65 74 64 42 39 39 65 [156.1]VM(+15.99)D[873.4] 1808 LVKYAPTY 4.8 61 954.5297 1 23.156 0.3 73 72 85 78 60 42 44 26 [212.2]K[595.3] 1934 QCGAVTSAFGERFLF 9.1 60 816.8958 2 24.576 0.2 36 36 46 83 70 75 92 93 96 65 49 65 41 26 26 [288.1]A[200.1]SAF[749.4] 3295 FAKKGGYALLTEY 7.9 60 487.5962 3 41.642 2.9 37 39 51 67 80 84 93 93 88 45 40 38 26 [474.3]GGYAL[506.2] 2625 WVVTGGSKFGSTVW 8.5 60 504.2617 3 33.248 1.2 56 56 59 47 40 46 69 73 86 88 84 84 26 26 [814.4]FGST[285.1] 1669 SWVKKSNRDGKNYHRLYY 10.9 60 772.0684 3 21.645 2.9 64 62 58 66 57 57 64 75 79 83 83 87 61 52 43 35 26 26 [1100.6]GKN[895.4] 1724 KPFTLKSLSMAGTAKSRW 10.9 60 670.3732 3 22.248 2.5 78 77 57 55 62 68 67 69 49 41 46 82 74 71 65 51 40 26 [1203.7]G[729.4] 1352 SSHRARPGLDFHF 7.9 60 509.5927 3 18.073 1.6 26 26 39 38 55 76 76 82 90 79 79 86 26 [791.4]GL[262.1]H[147.1] 2907 LFSHVCAGKVNSFPLW 9.7 60 602.3133 3 36.773 2.7 74 74 74 80 65 56 53 61 66 68 47 65 67 56 26 26 [347.2]H[1301.7] 2983 LELLFLFTF 5.4 60 571.8283 2 37.715 0.2 71 91 96 99 26 51 39 39 26 [113.1]ELL[655.3] 2280 FVDLDTVAGKHAVF 8.4 60 759.8999 2 28.874 1.7 80 69 68 85 90 66 59 40 38 41 62 52 52 36 F[214.1]LD[910.5] 1732 KPVFLKEDLPNGSVVKLYTY(+79.97) 12.1 60 797.4175 3 22.328 1.1 33 40 40 56 49 36 38 68 71 72 72 88 76 77 82 91 88 41 48 31 [1280.7]G[186.1]VKL[507.1] 3325 DDS(+79.97)GPGDDMAT(+79.97)F 7.2 60 463.1303 3 42.007 2.4 26 51 41 40 66 61 67 86 85 84 84 26 [723.2]DMAT(+79.97)[147.1] 2672 FAKAKAMFGYVLW 7.8 60 766.4095 2 33.835 0.7 60 59 74 31 71 78 78 77 70 64 62 26 26 [1512.8] 4100 S(+79.97)PNRQESTY 5.4 60 387.8234 3 51.604 1.4 69 65 53 58 43 49 87 88 26 [791.3]ST[163.1] 3198 WLS(+79.97)LPAVPKAALW 7.8 60 766.4093 2 40.44 2.6 47 82 52 71 88 76 71 63 62 55 46 36 26 [186.1]L[280.1]P[836.5] 2668 VYAFLVPARLKSDTMY 9.6 60 625.3345 3 33.783 0.6 45 45 50 63 80 45 43 44 65 76 84 80 77 68 65 26 [480.2]L[536.3]KS[510.2] 2674 YLFRPAAAKGFMF 7.8 60 506.9355 3 33.855 0.4 26 26 26 82 54 74 80 82 75 74 73 77 26 [423.2]R[168.1]AA[610.3]

PAGE 392

392 2880 KNSLAQANGVSSVPF 9 60 759.8985 2 36.438 0.8 68 58 46 46 60 51 65 54 76 74 74 80 93 26 26 [1069.6]SV[244.1] 4319 CSPMGPY 4.2 60 377.6495 2 54.483 2.5 26 72 72 68 75 79 26 [735.3] 1132 KASVPSHLY 5.4 60 334.519 3 15.487 1.1 62 49 50 55 26 26 90 90 90 [569.3]HLY 3180 WLAKACANGAPVLAF 9 60 511.2749 3 40.213 0.8 79 62 49 45 50 51 56 47 80 79 86 72 56 57 26 [857.4]G[71.0]P[430.3] 2350 VLCKKLFLKNMY 7.2 60 750.4258 2 29.759 2.2 56 59 58 74 46 37 44 72 84 69 70 46 [944.6]K[408.1] 2281 YLVVSSTLY 5.4 60 1044.562 1 28.885 0.5 26 26 96 85 85 68 61 63 26 [276.1]VVS[464.2] 3542 WAKYVLSTHDKY 7.2 60 504.2604 3 44.658 1.4 39 41 51 84 90 59 61 90 63 50 50 39 [385.2]YV[200.1]T[543.2] 1051 VRFDMGPGSAAPLY 8.4 60 740.8677 2 14.537 1.9 27 27 27 61 78 77 89 78 69 70 63 64 76 26 [705.3]P[659.3] 2917 KNLLGKHFW 5.4 60 571.8281 2 36.906 1.8 77 74 88 96 62 54 33 26 26 [242.1]LL[655.3] 2870 VSLPDGQLF 5.4 60 975.5141 1 36.309 0.4 26 26 94 71 66 78 58 67 48 [186.1]L[657.3] 1075 WRAGTGRYKKALYKSW 9.6 60 493.5219 4 14.822 2.5 47 40 36 45 44 52 82 81 47 62 88 92 85 53 73 26 [628.3]RY[256.2]ALY[401.2] 3012 Y(+79.97)KSKRTPLLYSM(+15.99)SVTKLRY 11.4 60 608.3208 4 38.074 0 76 66 44 46 50 52 58 69 70 66 70 67 67 66 77 52 42 50 43 [2411.2] 1964 GKKLKEGPAFGALLAANPLLEAYGMPW 16.2 60 948.1814 3 24.932 0.9 26 27 34 55 50 34 34 49 51 65 46 41 51 95 98 97 89 80 81 93 93 91 77 48 40 32 26 [1296.8]LAANPLLEA[634.3] 3236 NNFALPLQLKRW 7.2 60 500.6205 3 40.917 0.9 55 55 50 57 75 81 54 39 79 61 82 26 [559.3]P[482.3]R[186.1] 2722 TDKTSAKAW 5.4 60 504.2603 2 34.436 2.2 62 59 72 82 76 63 59 34 26 [344.2]T[543.3] 3114 WHLFSALLAPMVF 7.8 60 511.2752 3 39.377 1.2 26 26 83 69 62 66 70 79 82 60 57 64 26 [323.1]L[531.3]A[474.2] 2402 FAQAKAMGVAPAALW 9 60 766.4087 2 30.426 0.7 90 90 60 71 41 71 71 66 53 43 50 75 48 33 26 FA[1294.7] 2866 VKCVKSKAHGPY(+79.97) 7.2 60 466.2331 3 36.253 2.9 57 57 46 50 63 80 86 87 61 53 47 26 [557.3]SKA[534.2] 1550 LYVVLTSSY 5.4 60 1044.56 1 20.277 1.1 26 98 98 88 69 55 48 26 26 [113.1]YVV[551.3] 2784 WLAKSSLEAPVAPY 8.4 60 511.2761 3 35.223 1.1 82 70 53 49 66 77 61 61 69 87 47 43 39 26 W[799.4]P[430.2] 3337 LYVVSSTLY 5.4 60 1044.56 1 42.158 1.1 26 97 96 89 89 39 33 40 26 [113.1]YVVS[464.2] 2467 M(+15.99)AKLEPAGTAKRGW 8.4 60 766.4083 2 31.257 2.9 44 50 55 83 82 84 67 43 44 73 77 76 26 26 [346.2]LEP[827.4] 3800 FAKNS(+79.97)KRLKAF 6.6 60 695.3743 2 47.812 0.8 67 77 91 89 67 75 51 40 35 34 26 [218.1]KN[910.5] 1196 KAPLAGNGGKWW 7.2 60 642.8464 2 16.249 0.7 26 50 72 92 70 65 63 83 64 41 50 34 [296.2]L[242.1]G[557.3] 2287 Y(+79.97)HSCGSVFGSLSW 7.8 60 503.8677 3 28.961 1.2 83 83 83 26 44 57 57 88 76 60 58 26 26 Y(+79.97)HS[346.1]F[530.2] 2734 Y(+79.97)NM(+15.99)DPAYTGT(+79.97)AW 7.2 60 522.5079 3 34.585 2.3 44 51 51 62 63 68 78 85 53 52 75 26 [950.3]T[495.2] 2191 MFM(+15.99)PTLELKLPVGLGSLHAW 11.9 60 752.7363 3 27.745 1.1 27 36 34 44 52 54 71 62 59 69 69 78 90 93 68 65 70 58 59 26 [1415.8]GL[651.3] 1615 Y(+79.97)LRHKALGKM(+15.99)LTVHF 9 60 637.3356 3 21.034 2.8 49 32 33 55 48 67 84 88 77 69 87 74 71 26 26 [848.4]LG[275.1]L[484.2] 2427 RSLTTDLF 4.8 60 476.7582 2 30.744 0.6 41 44 45 81 80 78 78 26 [356.2]TT[375.2] 3128 HKCVHGNSVGARVF 8.4 60 504.2604 3 39.548 1.9 63 60 54 56 69 71 55 58 78 88 59 48 43 26 [961.5]G[473.3] 1398 APPQAVVW 4.8 60 434.2405 2 18.585 1.8 26 97 66 49 55 75 78 26 [71.0]P[680.4]

PAGE 393

393 4057 MERPAFKHLF 6 60 425.8931 3 51.053 1.4 64 46 41 52 75 83 85 52 67 26 [584.3]FK[397.2] 3109 KSTSAFNVGGSGLW 8.4 60 705.8533 2 39.31 1.3 45 51 52 65 75 51 49 54 84 80 58 62 75 26 [834.4]GG[443.2] 1345 HLNLQGLPAWGQQY 8.3 60 812.9129 2 17.995 2.7 34 33 38 94 87 97 96 88 66 32 29 29 52 52 [364.2]LQGLP[733.3] 3304 WTNYGLAVGGKFPKAVW 10.1 60 632.0038 3 41.751 2 37 62 40 51 54 65 48 53 57 89 90 86 84 64 46 44 37 [961.5]GKFP[484.3] 1454 KCELNGAVKKWGW 7.7 60 759.899 2 19.201 1.4 54 54 71 72 69 79 64 61 75 56 40 47 26 [1499.8] 3911 APAKPPTW 4.8 60 434.2396 2 49.21 0.5 26 95 77 71 66 86 26 26 [71.0]P[296.2]P[287.1] 2847 STEGSGGVRLVYW 7.7 60 705.8542 2 36.016 0.1 41 48 44 58 58 85 86 74 70 73 77 26 26 [461.2]GG[816.5] 1281 RLLTENGECTRDTKLLAW 10.7 60 1060.05 2 17.239 2 35 46 75 82 85 87 84 83 76 74 72 38 37 54 53 31 28 26 [382.3]TENGE[1187.6] 1369 LAFKTF 3.6 60 363.7135 2 18.264 1.7 26 26 93 91 92 26 [184.1]FKT[147.1] 1861 M(+15.99)VDLAEGKEYKLVRF 8.9 60 605.3211 3 23.736 1.5 74 76 71 76 83 85 49 48 54 50 59 43 49 43 26 [474.2]AE[1120.6] 3643 WNTMLRLDALLW 7.1 60 511.2751 3 45.89 1.1 96 35 34 34 50 48 76 87 77 79 66 26 W[728.4]D[483.3] 3136 AEERNLVPAPNAPVPW 9.5 60 587.3095 3 39.646 0.8 26 26 59 57 56 66 79 82 70 61 59 81 85 83 26 26 [811.4]P[282.1]APV[283.1] 2149 NKCLKPGSGPASTLF 8.9 60 760.4 2 27.21 0.6 38 39 48 82 74 52 50 74 85 68 59 59 62 67 26 [345.1]L[369.2]G[616.3] 2272 FAKANPGALVCAALW 8.9 60 766.4092 2 28.763 1.4 77 75 65 44 41 67 70 61 53 44 46 65 81 71 26 [1142.6]A[299.2] 2767 AFKKGGYAELTLY 7.7 60 487.5964 3 35.004 2.4 38 39 50 39 77 73 79 87 85 75 58 41 26 [751.4]AE[490.3] 3576 WLTKKAMHSSPVF 7.7 59 511.275 3 45.068 1 75 86 57 68 54 56 60 85 58 58 58 26 26 [186.1]L[559.3]H[517.3] 2102 VTLEGTLPLW 5.9 59 564.8176 2 26.615 1.6 36 38 66 79 89 86 78 61 30 26 [442.2]GT[509.3] 2511 YGQLATGAAALLVYY 8.9 59 787.4161 2 31.825 0.7 60 59 78 87 66 41 41 55 64 64 75 72 70 26 26 [348.1]L[1093.6] 2938 MFKGPPLW 4.8 59 975.5139 1 37.157 1.9 26 95 89 78 75 56 26 26 [131.0]FK[550.3] 2871 GYKLAPGSAATVLYY 8.9 59 787.4162 2 36.318 0.6 68 68 93 86 88 70 59 41 41 44 51 54 69 26 26 [220.1]KLA[1022.5] 2617 Y(+79.97)KKSEKVELNFKLKRNYY 10.7 59 608.3199 4 33.156 0 85 82 56 70 51 50 60 62 67 38 38 42 87 88 74 42 37 31 Y(+79.97)K[1202.7]LK[596.3] 950 VQLASGNSSVVF 7.1 59 403.2154 3 13.331 0 31 30 40 55 60 89 63 63 71 87 92 26 [498.3]G[288.1]VV[147.1] 1479 WWDVFDGFRPNLDVLLYY(+79.97) 10.7 59 800.0358 3 19.477 0.6 26 46 56 57 81 79 63 48 67 68 84 86 87 66 60 29 30 27 [586.3]F[572.3]NLD[731.3] 1594 LRLTENSVFGGGGLLEEVRVW 12.5 59 1166.123 2 20.784 2.9 27 34 41 59 72 54 71 72 76 71 52 72 63 64 69 86 82 65 55 26 26 [1513.8]EE[540.3] 3839 SVLTGKSANGAPVPAY 9.5 59 511.2756 3 48.294 0.5 26 82 66 41 40 51 73 59 53 90 84 84 65 44 57 26 [87.0]V[671.4]GAP[430.2] 2815 WALTSVTTKEKLFHRTWYY 11.3 59 608.3196 4 35.607 1.5 44 43 44 65 70 58 59 65 65 61 63 73 73 77 84 69 34 37 36 [1641.9]R[613.3] 1113 TTHYNYDQSVRAVF 8.3 59 567.6074 3 15.261 2.9 84 83 69 47 56 48 75 52 80 48 44 48 51 40 TT[820.3]S[572.3] 3316 KKPVGGKFTVPRTVWW 9.5 59 629.3635 3 41.892 2 26 47 48 56 56 61 72 82 87 84 81 74 66 46 26 30 [694.4]FTVP[728.4] 2760 SSLFVAVSVTQPW 7.7 59 474.2549 3 34.915 2.3 26 79 79 65 64 64 83 85 55 54 36 42 33 [604.3]VS[611.3] 2424 RTVSGCKSNPKRW 7.7 59 506.9352 3 30.712 3.1 63 63 69 64 52 53 54 58 66 75 60 59 26 [1499.8] 2247 LVHSLFGSFRAVT(+79.97)W 8.3 59 567.285 3 28.45 2.9 26 26 26 71 71 68 72 75 78 81 75 62 65 26 [987.5]R[537.2]

PAGE 394

394 3483 DALLNGLPY 5.3 59 975.5139 1 43.932 0.6 50 50 91 76 50 49 54 83 26 [186.1]L[397.2]P[163.1] 2090 VFLTMF 3.6 59 757.3941 1 26.462 1.5 26 26 92 90 93 26 [246.1]LTM[147.1] 2344 HSLKAPTAAVM(+15.99)F 7.1 59 430.23 3 29.683 2.8 26 67 62 48 50 56 60 68 81 81 80 26 [805.4]AVM(+15.99)[147.1] 958 TFLAALHKPFFKATRW 9.5 59 484.2774 4 13.423 4.2 42 45 56 61 78 79 74 60 36 34 75 76 77 62 59 26 [1915.1] 2498 VDDLLLSCLAKGGLPRMPW 11.3 59 695.3734 3 31.654 1.3 52 53 62 60 73 59 56 55 45 50 76 80 81 87 75 54 39 35 26 [1170.6]GGL[667.3] 1138 VEKLLYGKF 5.3 59 366.2183 3 15.563 0.2 41 40 62 79 83 80 62 56 26 [469.3]LY[332.2] 2056 VRFRVRGGRKWVEDLMVDVLY(+79.97) 12.4 59 891.801 3 26.036 1.4 28 28 27 31 37 41 64 57 47 57 57 72 78 94 93 92 91 86 59 55 39 [1625.9]DLMVD[455.2] 1218 RDLEETTVKDLGTGGFWY 10.7 59 696.3419 3 16.512 1.5 39 38 47 67 70 68 62 57 53 54 73 75 85 81 58 38 38 55 [1356.7]TG[553.2] 2286 Y(+79.97)KKPFLLFKLESLRNYQY 10.6 59 608.3209 4 28.949 0.1 82 79 58 62 62 63 57 53 60 63 45 46 71 83 69 32 38 32 Y(+79.97)[1443.9]R[568.2] 2924 WNT(+79.97)GGGLLQHF 6.5 59 437.1944 3 36.992 2.9 68 39 37 44 55 69 82 68 67 88 26 [652.2]L[241.1]H[147.1] 4137 KRRPASVENW 5.9 59 621.84 2 52.068 2.2 27 27 50 64 84 88 62 59 63 63 [537.3]AS[528.2] 1165 NPMTRGDGRRNF 7.1 59 474.2329 3 15.887 1.4 76 83 50 43 43 51 63 73 91 51 26 51 [114.0]P[617.3]R[417.2] 2931 FLLLSPHGDSMGYLVVKY(+79.97)F 11.2 59 756.0373 3 37.072 1.9 27 27 68 46 45 50 77 82 71 64 66 83 89 91 90 37 34 33 32 [807.5]G[333.1]GYLV[617.3] 2648 FLKGRPLVCDF 6.5 59 432.2384 3 33.537 2.3 46 45 54 68 76 64 61 63 63 77 26 [1275.7] 1581 DKKAGKSKEHENTGGHLVF 11.2 59 1041.538 2 20.625 1.6 30 30 31 56 71 67 82 91 94 96 94 67 67 68 51 33 31 26 26 [627.4]SKEHE[825.4] 1908 CELVSMNMLTDRENRQLPF 11.2 59 1148.547 2 24.274 1.1 62 66 85 94 89 65 39 40 58 87 87 77 52 59 32 30 30 31 26 [232.1]LVS[489.2]TD[1040.6] 3507 GYNMSAATGFPSATMY(+79.97) 9.4 59 583.562 3 44.227 0.9 39 43 58 45 62 66 66 41 39 48 75 86 84 72 68 43 [1096.5]SA[475.1] 3380 TLWPM(+15.99)LNGQTW 6.5 59 681.8291 2 42.69 0.1 35 35 26 99 87 82 69 58 46 50 54 [400.2]PM(+15.99)L[586.2] 1058 KSRKKSEELTF 6.5 59 451.5903 3 14.615 2.5 52 46 44 44 65 86 92 73 55 60 26 [627.4]SE[490.2] 2484 SRKSHAAMMSVYPKLRNKYY 11.8 59 608.3199 4 31.475 1.9 37 40 53 56 60 48 47 47 66 61 61 64 58 59 92 91 83 62 53 30 [1573.8]LRN[454.2] 1500 GKESTPFKGGPVGRRF 9.4 59 573.9816 3 19.715 0.7 34 33 34 35 46 39 72 96 95 68 66 77 76 69 69 26 [746.4]KG[769.4] 4074 KECKMGAGNVGAAPW 8.8 59 506.9125 3 51.269 2.5 54 53 59 58 69 61 50 60 73 82 81 72 42 36 26 [918.4]VG[425.2] 3237 LEKNLLTVGPVFSPAKKY(+79.97) 10.6 59 695.3773 3 40.927 0.9 46 45 51 47 48 53 59 76 72 69 80 80 79 76 58 39 41 34 [1064.6]VF[754.3] 2559 NDDAS(+79.97)M(+15.99)DCTSMCESY(+79.97) 8.8 59 616.4637 3 32.427 42.6 43 47 60 59 60 72 66 53 54 69 72 58 52 57 53 [1828.4] 2412 YLVPFMKF 4.7 59 1044.561 1 30.555 2 26 26 97 97 97 72 26 26 [276.1]VPF[406.2] 1335 RPWFTVVM(+15.99)PTGPLKYRY 10 59 1064.065 2 17.874 0.3 26 27 26 73 96 82 65 64 71 79 59 57 62 75 41 45 44 [586.3]TV[1321.7] 3646 RAAPTMPFGPAVF 7.6 59 681.3567 2 45.922 2.1 28 37 57 64 75 91 94 26 86 54 50 50 46 [496.3]MP[147.1]G[414.2] 892 NYAGGAMTYAKY 7.1 59 655.2963 2 12.608 2 53 56 69 64 68 79 60 56 57 58 53 26 [1290.6] 1892 TLLSVLCVPKW 6.5 59 629.8635 2 24.086 2.5 27 89 94 94 57 52 51 57 67 26 26 [101.0]LLS[825.5] 1927 WKFWWLTALGKNAGLAKELYY 12.3 59 853.4557 3 24.493 2.6 35 33 31 26 42 42 44 69 79 86 88 83 61 50 59 84 89 88 82 26 26 [1231.7]GKN[241.1]AKEL[326.1] 1255 SWKLSPKSNKGLALEYY 10 59 662.0233 3 16.934 0.9 26 78 41 34 40 61 53 53 89 93 89 74 60 69 77 26 26 [913.5]NKG[752.4]

PAGE 395

395 2419 Y(+79.97)KKDNDVELKNFLRPPVKF 11.2 59 608.3207 4 30.643 1.2 70 52 41 63 64 75 72 67 63 54 40 43 83 71 88 46 42 46 26 [1573.7]L[156.1]P[471.3] 1375 APKTLLAKLDGMKTKW 9.4 59 451.0155 4 18.324 0.1 74 67 48 48 59 73 68 49 50 76 73 65 62 56 36 26 [1782.0] 3068 SVLPDGAGLF 5.9 59 975.5142 1 38.783 0.3 26 26 92 64 60 71 70 65 72 36 [186.1]L[657.3] 903 WLPGSVKATLYY 7 59 466.5874 3 12.751 0.9 26 39 44 54 57 64 82 83 82 71 71 26 [639.3]KAT[439.2] 3724 Y(+79.97)QCDCAAMDSMS(+79.97)PY(+79.97) 8.2 59 608.8217 3 46.866 2.4 85 61 61 61 66 70 67 41 42 48 75 86 26 26 Y(+79.97)[1055.3]S(+79.97)[340.1] 3133 FAKLVNGNVGNGRW 8.2 59 766.4086 2 39.612 1.8 79 80 91 67 37 36 50 61 71 76 45 46 49 26 [147.1]AK[1166.6] 891 WWVSPPCNTLRF 7 59 502.5841 3 12.597 1.4 26 70 70 89 26 95 88 67 57 43 40 26 [471.2]S[97.1]PC[631.3] 3610 M(+15.99)VVAVQPSESLPVF 8.2 59 759.8956 2 45.48 2.2 82 82 78 39 38 38 61 61 83 85 89 26 26 26 M(+15.99)V[581.3]ESL[343.2] 1844 HPFVFPSNKNDTPAKGLGHRSFVF 14.1 59 675.6018 4 23.548 0.5 26 78 79 67 67 65 45 32 34 35 36 41 46 67 76 88 75 59 57 67 75 75 79 26 [1679.8]G[943.5] 1452 KVVLCRSKGGVYT(+79.97)VDLSGLPRW 12.9 59 838.4396 3 19.181 2.1 26 26 52 67 61 54 55 51 43 46 58 58 66 70 92 68 62 69 87 72 67 26 [1569.8]D[257.1]L[439.2] 1737 KNPLLLPKNRGY 7 59 471.6173 3 22.383 0.2 29 48 59 62 68 62 59 63 68 76 79 26 [1393.8] 3184 SLNVVGVVGGPLF 7.6 59 629.3634 2 40.254 0.5 55 54 52 65 66 65 71 85 79 54 40 42 26 [668.4]V[471.2] 4181 VPGLVVW 4.1 59 385.2346 2 52.645 1.8 26 71 78 86 93 26 26 [253.1]LV[285.1] 4094 YGMYDMYGEPFEF 7.6 59 550.2169 3 51.524 1.7 36 39 38 42 41 58 59 73 72 86 74 77 59 [1109.4]P[423.2] 2283 KVPLAHAPFRLTCY 8.2 59 404.7247 4 28.904 0.4 43 46 54 60 62 72 66 26 39 62 51 74 90 67 [1330.8]C[163.1] 3016 NNWFVWAKASPLW 7.6 59 809.9133 2 38.116 1.8 49 71 66 78 90 89 89 66 35 36 31 26 26 [561.2]VWA[682.4] 1264 RPRGALKLAHYF 7 58 476.9446 3 17.034 2.1 26 49 42 55 60 63 66 80 81 60 61 53 [778.5]LA[447.2] 2048 LRYRVMPALWWKNPKPYVLY(+79.97) 11.7 58 669.1019 4 25.945 2.6 27 27 30 67 78 96 85 43 42 52 41 38 33 41 73 76 80 83 85 63 [687.4]MP[1120.6]YVL[243.0] 3596 S(+79.97)S(+79.97)GYDCEDVW 5.8 58 660.6798 2 45.304 0.3 26 35 39 44 86 90 78 78 78 26 [554.1]DC[529.2] 2919 DLALVGTTATVRLLKEW 9.9 58 629.3641 3 36.927 1.8 45 45 56 54 53 57 58 72 80 82 80 82 70 39 36 39 36 [770.4]ATVR[669.4] 1785 KSAHLPKLMNTTYF 8.2 58 550.9595 3 22.901 2 71 71 55 51 44 55 68 89 66 65 73 48 27 27 [761.5]L[757.3] 2242 QNARVT(+79.97)YEDCVHY(+79.97) 7.6 58 586.5518 3 28.382 1 52 51 62 84 74 46 46 48 56 67 67 74 26 [313.1]R[1269.4] 2418 WVTAFGNSVGKTPF 8.2 58 504.2615 3 30.632 0.8 26 74 74 86 74 67 56 68 71 74 37 36 40 26 [386.2]A[1034.5] 3224 KKPKGVPAAGVGRKF 8.8 58 770.4764 2 40.764 1.7 26 53 47 55 68 64 62 65 90 90 83 60 52 26 26 [805.5]AGV[488.3] 2059 RLRT(+79.97)NSLKTLTKRLSLTPVM(+15.99)Y 12.3 58 863.1423 3 26.078 1.1 27 27 36 41 33 35 36 62 72 87 96 85 82 93 92 81 56 49 44 45 36 [1149.6]LTKRLSL[607.3] 1437 RMVPVKKLTFLY 7 58 498.9676 3 19.016 1.3 66 63 79 51 39 41 44 54 58 85 89 26 [1052.7]FL[163.1] 2382 APPQAVVW 4.7 58 434.2404 2 30.181 1.5 26 97 74 41 59 70 70 26 [71.0]P[680.4] 4232 VGCTPTAAHY(+79.97) 5.8 58 550.2162 2 53.33 2.4 51 52 51 57 62 72 88 92 26 26 [558.2]AA[380.1] 1209 SNGGRAPF 4.7 58 805.3946 1 16.4 0.6 26 75 81 85 61 53 55 26 [201.1]GG[471.3] 3949 TDVVAHGGKPGVSTW 8.7 58 504.26 3 49.686 0.4 37 39 49 62 65 68 70 63 62 66 76 72 54 42 42 [1491.7] 2258 WRGGVGAGVLNETF 8.2 58 731.8736 2 28.591 2.5 76 75 85 62 47 41 42 62 60 61 58 55 58 26 [342.2]G[1044.5]

PAGE 396

396 1292 LHWKLDKLLY 5.8 58 443.5969 3 17.378 2.8 26 26 77 65 48 66 72 85 85 26 [920.5]LL[163.1] 2967 MNKKYLATKT(+79.97)KW 7 58 531.2739 3 37.511 0.5 52 50 81 73 54 45 58 71 66 45 50 47 [245.1]K[1199.6] 2476 ALVLPLLPAAGAMDTY 9.3 58 539.2975 3 31.364 1 45 45 52 35 55 72 71 60 68 91 87 64 57 49 45 26 [887.6]AG[581.2] 2360 SKGPKKLDAGFEAVY 8.7 58 537.29 3 29.894 1.8 43 43 39 38 33 57 61 85 85 85 84 54 54 54 52 [738.5]DAGF[462.2] 1897 Y(+79.97)MHLAALLHKKRAQLMVDVVW 12.2 58 651.3425 4 24.146 2.5 28 40 34 49 57 64 68 66 47 48 29 29 32 39 78 95 96 95 95 95 26 [1854.0]MVDVV[186.1] 3988 LELLFLFTF 5.2 58 571.8282 2 50.192 0.4 42 88 96 99 26 59 42 40 26 [113.1]ELL[655.3] 1882 KTPLGWSTVPY 6.4 58 624.8364 2 23.972 2.5 70 70 56 47 53 86 87 87 26 26 26 [496.3]WST[359.2] 3048 WLNKMANGAPVLAF 8.1 58 511.2756 3 38.533 2.2 74 69 44 58 63 65 62 56 57 77 65 45 45 26 [1512.8] 1377 APAVEAGVGF 5.8 58 459.2395 2 18.341 1.1 26 85 70 68 80 56 56 49 59 26 [71.0]P[170.1]E[431.2] 1954 VKRVDSDLDKHPKVMTAY 10.5 58 701.3729 3 24.812 0.9 34 36 40 35 36 70 76 62 62 64 72 70 73 85 79 57 57 26 [1517.8]V[466.2] 2271 QLNLEGVPYFVRF 7.5 58 791.4238 2 28.752 1.2 53 43 45 89 90 85 87 90 62 26 26 26 26 [355.2]LEGVP[712.4] 2214 DQTLTPATVVNRGF 8.1 58 759.8987 2 28.036 0.6 34 34 39 70 62 57 66 84 84 81 56 58 56 26 [726.4]TVV[474.2] 4312 EPETDVDF 4.6 58 476.2 2 54.388 1.5 26 26 68 68 76 65 65 65 [932.4] 1903 QPFGTTVGSGSKSLLMKAVW 11.6 58 698.7095 3 24.216 4.2 38 50 35 42 43 45 45 45 52 91 81 84 86 87 95 89 51 35 29 27 [874.4]GSKSLLM[484.3] 1148 MLKCAVGVVLF 6.4 58 393.8935 3 15.689 2.7 59 60 70 60 45 45 63 86 93 26 26 [702.4]VV[260.2] 1915 KDWRACKGPKGCGMVF 9.3 58 594.9595 3 24.352 2.3 36 36 31 46 46 76 82 68 64 76 76 54 55 68 81 26 [759.3]K[630.3]V[147.1] 3796 WY(+79.97)GAT(+79.97)Y(+79.97) 3.5 58 500.6191 2 47.77 1.8 26 62 68 78 84 26 [557.2]T(+79.97)[243.0] 1258 YVRSPEM(+15.99)MPLFKSGYY 9.3 58 992.4731 2 16.964 2.3 26 26 68 64 69 73 26 90 81 80 79 49 45 48 70 26 [878.4]MPL[745.3] 3441 MTTKGPPY 4.6 58 447.7227 2 43.427 0.8 78 78 71 54 54 72 26 26 [875.4] 1030 LDKNAGVVVW 5.8 58 550.807 2 14.281 2.8 47 46 61 72 61 56 70 69 66 26 [1081.6] 3412 FPLTRTAMKAKLCLLRSHTY(+79.97) 11.6 58 608.3188 4 43.068 0.6 34 33 34 35 41 67 68 68 58 58 63 63 55 79 91 91 83 45 45 36 [1573.9]LRS[481.1] 2410 AMRAPPGVYGCKF 7.5 58 466.2335 3 30.521 0.5 42 49 67 70 74 79 64 67 73 55 41 37 26 [1377.7] 1081 ETKYRKKPF 5.2 58 598.8447 2 14.891 2.9 64 63 69 73 47 64 59 51 26 [1177.7] 4076 MMKRRTKVF 5.2 58 399.564 3 51.288 1.8 97 96 91 43 26 39 48 48 26 MMK[787.5] 1574 AM(+15.99)LTSLLTVPSYF 7.5 58 729.88 2 20.545 1.4 44 39 55 57 62 63 81 78 79 26 54 54 54 [632.3]L[694.3] 1188 SLLKEKYSY 5.2 58 565.8098 2 16.159 2.9 56 56 93 75 48 50 40 72 26 [200.1]L[798.4] 2682 VRLLPCPSETHTPPLY 9.2 58 608.3205 3 33.949 2.7 32 31 37 55 55 78 67 49 51 69 89 86 80 56 55 26 [1095.6]HTP[373.2] 2295 MKKDHDVLKVLHF 7.5 58 537.3 3 29.057 1.7 27 45 51 55 75 69 70 71 81 76 73 26 26 [966.5]K[496.3] 3574 ESRARGHKFVNAF 7.5 58 506.9346 3 45.035 2.1 59 55 54 56 64 60 63 71 58 52 50 51 53 [1499.8] 1807 ARFPKCDAAKQFKKY(+79.97) 8.7 58 627.648 3 23.148 2.9 81 81 74 46 55 60 56 61 70 61 60 50 38 33 33 AR[1634.8] 4036 LKEGPTTHTKVHVY 8.1 58 537.2951 3 50.795 0.8 64 63 81 55 45 57 63 65 41 42 40 62 62 62 [241.2]E[1220.6]

PAGE 397

397 1171 RFNVVMKLYDTLFRF 8.7 58 650.3541 3 15.957 0.6 26 59 46 74 65 56 62 84 74 93 70 58 38 26 26 [874.5]L[163.1]D[664.4] 3199 DALLVQGPY 5.2 58 975.514 1 40.451 0.6 55 54 88 59 47 38 58 91 26 [186.1]L[397.2]P[163.1] 3756 TTKSGGGYATKVKY 8.1 58 487.5963 3 47.272 0.1 52 62 65 66 57 44 65 81 86 73 54 41 26 26 [588.3]YA[619.4] 3847 SSAS(+79.97)HW 3.5 58 377.6324 2 48.389 2.5 39 51 50 86 90 26 [245.1]S(+79.97)H[186.1] 3836 WAES(+79.97)AAGGY(+79.97) 5.2 58 536.1654 2 48.25 1.5 56 56 56 89 91 67 39 34 26 [386.2]S(+79.97)A[428.1] 1888 KVVKASGKY 5.2 58 490.3009 2 24.04 1.1 26 26 67 68 74 75 74 79 26 [960.6] 2883 NMWLRSAVVM(+15.99)PLW 7.5 58 809.9147 2 36.471 0.7 36 38 33 42 45 69 66 58 69 79 88 95 26 [1203.6]PL[186.1] 2748 FVDLDTGGKLKYY 7.5 58 759.8982 2 34.763 3.5 71 61 61 89 79 56 48 52 76 66 31 26 26 [361.2]L[1025.5] 1393 NKEVTGTKVRVSCENRY 9.8 58 496.5063 4 18.521 2.2 41 43 52 48 50 64 59 46 37 34 89 89 88 76 55 61 39 [1112.6]VSC[562.2] 1408 WAHQGGAGRGPLW 7.5 58 696.8484 2 18.684 1.6 26 63 60 41 50 75 87 90 66 52 43 63 26 [636.3]AG[609.3] 2853 VEAAKTFPVNAPAVVLLF 10.4 58 629.3638 3 36.091 0.9 58 55 69 56 49 48 51 54 82 67 75 65 71 85 61 28 28 26 [843.4]V[353.2]V[472.3] 1231 KKGRHGMLMKKW 6.9 58 500.6204 3 16.662 1.2 26 26 59 55 44 54 68 91 82 83 70 26 [794.4]LMK[314.2] 3088 KHPAVAVHTTF 6.3 58 403.2231 3 39.036 2.9 39 55 73 62 63 70 74 55 55 55 26 [1188.6] 3240 APAKPTPW 4.6 58 434.2392 2 40.973 1.3 26 95 68 60 73 82 26 26 [71.0]P[296.2]T[283.1] 2620 FTSPDVALKVTGF 7.5 58 461.2513 3 33.188 2.3 63 64 64 77 75 65 52 53 62 45 45 45 31 [1362.7] 3169 WVKGPVKPFTPPF 7.5 58 500.6194 3 40.072 2 26 57 59 64 66 57 63 86 89 47 47 55 26 [794.5]PF[442.2] 2278 Y(+79.97)TMACCCELGGGSWWY(+79.97) 9.2 57 663.8751 3 28.839 0.6 38 45 39 75 79 81 62 56 47 49 65 50 47 50 64 64 [649.2]C[1218.4] 3238 M(+15.99)TT(+79.97)GDYVCCTYGDMT(+79.97)F 9.2 57 661.8699 3 40.939 0.3 29 54 37 44 47 83 62 62 68 77 79 86 73 52 30 30 [601.1]Y[569.2]G[574.2] 2732 TPPVVGVVGCNMTTYY 9.2 57 567.6042 3 34.562 2.4 26 26 26 81 74 72 71 79 82 74 57 59 61 58 39 26 [295.2]V[354.2]G[876.3] 2362 RQGSMPSAWSKW 6.9 57 474.2302 3 29.916 2.1 54 43 53 52 55 71 63 64 89 87 26 26 [814.4]WS[314.2] 2888 M(+15.99)EDDMEEACYTGPMCY(+79.97) 9.2 57 661.8676 3 36.537 0.9 26 52 56 63 62 69 73 65 64 68 76 88 44 41 39 26 [1333.4]G[574.1] 1046 ELEAPPKF 4.6 57 930.4958 1 14.475 3 26 94 93 95 55 33 33 26 [129.0]LEA[469.3] 1681 LYVVVTTSY 5.2 57 1044.56 1 21.793 1.1 26 97 97 97 61 40 39 29 26 [113.1]YVV[551.3] 1087 HKLVRAAVLYDKHLANHY 10.3 57 716.7314 3 14.962 1.3 31 32 34 42 46 53 44 47 83 88 93 81 92 81 58 40 44 36 [874.6]LYDKHL[485.2] 3409 FVDLDMLVKLYY 6.9 57 759.8982 2 43.035 1.4 57 70 69 90 85 51 45 52 55 56 26 26 [361.2]LD[910.5] 3668 KAVDVGSGGAAPGKTVLVLF 11.5 57 629.364 3 46.193 1.6 33 35 38 44 46 50 72 50 48 51 75 83 92 91 88 88 72 26 30 26 [912.5]PGKTV[472.3] 3468 S(+79.97)CY(+79.97)NCCEVEGNW 6.9 57 522.7836 3 43.751 49.5 26 26 71 71 71 83 78 78 61 41 41 33 [730.1]C[714.3] 1383 MWLKEEAHLLSW 6.9 57 771.892 2 18.403 0.4 37 38 67 83 95 98 79 61 37 30 30 26 [430.2]KEE[707.4] 2240 AFKKGGYLSMPPLW 8 57 797.926 2 28.362 0.2 62 62 83 61 88 88 52 44 43 61 56 39 28 26 [218.1]K[128.1]GG[987.5] 3932 ELLTTAGPTGCLVPF 8.6 57 759.8983 2 49.468 1.4 27 51 59 56 43 42 48 80 88 81 69 70 87 26 26 [685.4]PTG[216.1]V[244.1] 3405 CLMLKSGESLKALPEW 9.2 57 602.3146 3 42.979 2.4 45 43 42 43 53 57 67 87 89 91 77 66 40 37 46 26 [732.4]ESL[724.4]

PAGE 398

398 1899 RFVMTGLHLNAYKW 8 57 868.4561 2 24.166 3 32 32 55 80 78 82 84 55 44 43 48 59 60 44 [402.2]M[101.0]GL[912.5] 3165 WKAPNPVAPRGNRF 8 57 537.2957 3 40.014 0.9 77 38 33 35 48 58 73 78 80 75 66 43 47 44 [863.5]P[630.3] 3942 LYVVLTSSY 5.2 57 1044.56 1 49.6 0.9 26 96 96 87 64 48 42 26 26 [113.1]YVV[551.3] 2998 LTATAPLM(+15.99)M(+15.99)GTPKF 8 57 504.2609 3 37.889 2.5 44 44 45 57 65 60 54 64 59 85 75 57 59 26 [961.5]G[473.3] 1320 SWGAEDLHPLPKKKKEY 9.7 57 676.0309 3 17.704 1.3 37 37 50 64 61 54 62 71 57 58 82 83 67 52 45 45 38 [1105.5]PK[676.4] 1849 LLPVLYKFANGLRRTF 9.2 57 636.7126 3 23.603 0.9 26 93 93 49 46 56 49 45 59 71 80 79 82 27 26 26 [113.1]LP[835.5]G[113.1]R[404.2] 1750 M(+15.99)TNGMKALPSVNLKW 8.6 57 569.2985 3 22.517 2.6 40 39 46 57 74 83 73 70 81 67 61 47 44 45 26 [550.2]K[184.1]P[727.4] 2184 APPKATPW 4.6 57 434.2404 2 27.663 1.5 26 95 58 51 56 69 73 26 [71.0]P[680.4] 3964 YLLLPALSGGNMVVY 8.6 57 537.2945 3 49.89 2 28 28 61 62 64 66 58 58 69 67 45 46 59 71 68 [1590.8] 1896 EMLWLACDPDVAGGRDKVKY 11.4 57 756.0367 3 24.137 1.7 31 30 31 34 41 59 64 64 69 62 72 85 90 79 67 75 64 56 33 26 [1272.6]AG[846.5] 1956 RELEMLPLMEYVSTKAAMELVW 12.6 57 880.4463 3 24.843 1.4 34 33 39 65 54 50 52 67 65 72 55 54 50 48 44 58 91 91 80 63 55 26 [1891.0]AME[398.2] 3664 KVSMKGSGM(+15.99)VPWPGRDYHAF 11.4 57 756.0363 3 46.137 2.2 44 46 37 37 40 56 70 73 78 75 76 77 88 74 66 61 32 32 44 26 [1303.6]P[846.4] 3193 NMKWASEDPDVAGQASLRKY 11.4 57 756.0356 3 40.373 0.1 51 51 51 38 44 63 68 76 82 60 57 58 91 63 69 66 43 40 36 26 [961.4]P[285.1]G[846.5] 2397 S(+79.97)CCS(+79.97)QCGS(+79.97)EDNDW 7.4 57 558.421 3 30.361 54.3 26 26 60 55 43 46 81 86 85 73 58 57 40 [771.1]GS(+79.97)E[530.2] 3022 SLLNPAASSVDHW 7.4 57 466.2332 3 38.194 0.2 35 38 47 47 58 75 79 78 75 75 77 26 26 [1377.7] 4002 DSKRKAPDLRKW 6.9 57 500.6191 3 50.362 0.7 51 50 54 61 42 57 64 67 77 66 62 26 [1480.8] 3606 Y(+79.97)FSCNCQGS(+79.97)GDF 6.8 57 496.472 3 45.438 1.9 26 64 65 78 64 78 73 86 53 32 35 26 [925.3]G[486.1] 1840 QKSMPLLGTFGLLSKDDHARRF 12.6 57 839.7831 3 23.5 1.7 28 28 28 45 64 58 66 59 49 57 84 89 95 84 73 80 78 42 39 35 38 26 [1102.6]GLLS[128.1]D[782.4] 2319 LLTTGCTTKCGALGPTY 9.7 57 567.2858 3 29.363 2.2 37 39 50 41 42 49 78 57 56 56 77 81 80 61 56 75 26 [1078.5]AL[418.2] 1722 Y(+79.97)LDKAATNPREGWVKLKSKY 11.4 57 816.4231 3 22.231 2.7 51 48 37 56 39 39 38 52 57 54 56 75 90 91 86 82 69 56 28 26 [1395.6]WVKL[506.3] 1099 LSFLAPPGRLGFKGVLCY(+79.97) 10.3 57 673.3483 3 15.102 1.5 67 50 48 43 40 44 68 62 52 41 49 84 61 47 49 58 88 67 [1108.6]F[397.3]C[243.0] 3738 KTFDATF 4 57 415.2108 2 47.051 6.5 53 53 65 61 59 78 26 [810.4] 1442 YRKGCARRKNAARLAM(+15.99)VF 10.3 57 532.5446 4 19.07 1.3 26 40 39 69 75 66 66 32 37 48 82 91 85 75 62 45 47 33 [1232.7]AAR[577.3] 2142 M(+15.99)KHLGCLAVHVSLHGVNRLW 11.4 57 762.7399 3 27.123 2.5 45 38 37 66 59 63 80 90 93 95 26 54 54 87 76 50 31 30 31 26 [685.3]LAVH[299.2]H[725.4] 1545 GPTAPTLAGY 5.7 57 947.483 1 20.215 0.3 45 55 58 82 65 48 45 62 80 26 [255.1]A[382.2]G[163.1] 1216 VVCLLAGPDGLGYLF 8.5 57 768.9113 2 16.479 1.5 39 35 32 45 96 74 61 60 76 69 74 65 52 43 26 [414.2]L[990.5] 979 WWVKGMHSLS(+79.97)Y(+79.97) 6.3 57 518.54 3 13.681 0.5 26 26 51 50 66 71 78 76 76 76 26 [1534.6] 1624 GRKPLHVAKNPRKLYY 9.1 57 970.5721 2 21.123 1.5 27 31 38 67 69 50 48 51 73 87 85 74 68 82 26 26 [986.6]NP[284.2]L[326.1] 1214 QLHGNRW 4 57 910.4641 1 16.461 0.1 39 51 60 68 75 76 26 [891.4] 3474 CPGHRGF 4 57 387.18 2 43.828 2 26 26 89 80 73 75 26 [200.1]GH[360.2] 1556 MLFSHPKPGDAKKW 8 57 547.9573 3 20.343 0.3 34 35 43 47 69 88 79 75 85 59 51 53 45 26 [615.3]P[225.1]G[628.3]

PAGE 399

399 962 M(+15.99)GTLMKW 4 57 441.7139 2 13.477 0.7 39 38 66 72 71 82 26 [549.2]K[186.1] 2521 WLCVSAKATAVHVF 8 57 511.2757 3 31.956 2.4 74 75 47 62 49 47 58 73 63 57 58 75 26 26 [1512.8] 3764 WLS(+79.97)LPAPAAKVLW 7.4 57 766.4088 2 47.369 1.9 28 70 52 80 62 55 58 81 54 48 48 70 26 [466.2]L[265.1]A[597.4] 1962 MNKWLACDPDVAGGVGDKVKY 11.9 57 756.0369 3 24.914 1.4 38 37 55 35 33 40 43 59 68 71 81 88 93 83 57 53 61 67 61 35 26 [1173.5]VAGG[789.4] 1191 LLGSPYALNAMGVYY 8.5 57 544.6099 3 16.185 1 91 67 54 54 72 66 57 42 42 71 64 57 42 41 26 L[1499.7] 4221 VKCCAPQLRW 5.7 57 602.31 2 53.174 0.2 42 42 42 44 78 78 66 69 76 26 [1184.6] 1256 TTAALGLAKSNKGANKEYY 10.8 57 667.3532 3 16.944 0.3 29 30 33 36 39 34 35 38 60 66 84 80 74 81 84 89 81 73 26 [913.5]NK[57.0]ANKE[326.1] 1405 FVWGYAKVKTY 6.3 57 681.3671 2 18.657 1.3 26 26 60 91 78 93 92 50 36 40 26 [432.2]G[163.1]AK[491.3] 2365 FAKRCGVGGPVLW 7.4 57 695.3766 2 29.961 0 72 72 77 74 70 73 62 56 55 42 26 26 26 [1370.7] 2143 MVRM(+15.99)LSGAVKTVW 7.4 57 747.4041 2 27.135 2.9 72 73 88 78 67 64 60 51 34 33 35 51 26 [230.1]R[1088.6] 942 Y(+79.97)S(+79.97)DS(+79.97)GGMPCY 5.7 57 660.112 2 13.234 47.7 26 26 40 43 65 90 79 80 87 26 [749.1]G[131.0]PC[163.1] 4169 YMPTGYGY 4.5 57 476.1987 2 52.488 1.7 26 64 67 74 67 56 69 26 [932.4] 1239 HVT(+79.97)FLHLQAF 5.7 57 646.8148 2 16.748 2.8 26 26 26 26 93 94 92 59 71 49 [564.2]LHL[346.2] 3477 MVNKQVQCLKAAW 7.4 57 759.8977 2 43.856 2.5 72 71 68 36 34 39 55 65 74 74 68 48 26 [1499.8] 2586 WVRGCADVVPLAVF 7.9 57 511.2751 3 32.775 1.2 26 57 56 66 65 67 44 47 35 79 56 54 69 67 [1512.8] 2972 LLMGGKDVAVPRPF 7.9 57 500.6194 3 37.578 2.4 91 87 56 52 56 60 51 44 51 72 68 31 42 26 LL[1254.7] 3640 VVWMVTTRTKRCLLRSKS(+79.97)W 10.8 57 608.3209 4 45.846 1.8 43 41 43 51 45 77 83 38 31 34 37 51 73 88 87 81 71 68 26 [715.4]T[757.4]LRS[481.2] 1417 SLRSTELF 4.5 57 952.5106 1 18.789 0.9 31 33 42 65 81 82 89 26 [443.2]TEL[147.1] 1166 GKFVVSDRMAYDKKAKKFNRW 11.9 57 644.3477 4 15.897 2.7 31 35 42 52 48 48 53 62 52 82 68 56 46 80 73 70 80 63 54 48 36 [1019.5]A[406.2]K[199.1]K[603.3] 2425 ESRLGGGSAGGSGW 7.9 57 639.3019 2 30.723 7.5 41 43 52 60 72 57 60 72 69 65 65 55 49 26 [1258.6] 3560 GKLRALLAEPDDY 7.4 57 487.5958 3 44.87 0.9 40 40 40 42 43 46 69 78 85 74 74 74 26 [822.5]E[490.2] 1252 WNPLVFHYVGLPRF 7.9 57 436.9881 4 16.892 0.8 79 56 60 85 26 26 76 51 50 54 73 63 61 26 [397.2]L[1215.7] 3484 CVLLALQQW 5.1 57 537.2956 2 43.942 2.5 56 56 78 36 62 53 47 49 68 [1054.6] 3093 NKVDPGTSFVFW 6.8 57 466.2336 3 39.101 2.4 51 40 44 42 58 66 64 71 82 61 59 36 [798.4]F[432.2] 963 HLHLRPKPPAAVLANHY 9.6 57 645.3672 3 13.487 0.1 26 37 37 41 34 47 60 77 55 63 74 77 73 62 57 69 64 [1915.1] 3508 GKLTLEAQT(+79.97)GALRDF 8.5 57 567.2853 3 44.238 0.1 36 42 54 64 57 54 55 41 56 69 84 74 63 65 26 [1078.5]A[531.3] 1543 WMESGPMTAF 5.7 57 578.7453 2 20.197 2.7 26 86 64 64 73 60 57 50 46 34 [186.1]M[820.3] 2553 WQQACASGGPFKW 7.4 57 489.2268 3 32.351 1.5 71 37 36 59 60 37 38 44 83 75 63 63 63 [831.3]G[558.3] 2635 LLFPEGHLVRRY 6.8 57 500.62 3 33.379 1.8 31 30 48 74 71 66 68 77 76 79 26 26 [1480.8] 2437 EPY(+79.97)Y(+79.97)CPYYYHY(+79.97) 6.2 56 600.8174 3 30.875 41.8 26 85 85 26 26 69 73 57 48 55 66 [129.0]PY(+79.97)[1312.4] 3226 FVLRGVMGTFLLF 7.3 56 750.4253 2 40.788 0.6 26 79 64 55 52 43 45 53 76 73 70 65 26 [1480.8]

PAGE 400

400 2346 CELLKGPSLDVTPF 7.9 56 759.8981 2 29.717 1 26 77 88 80 77 70 63 65 60 49 37 39 26 26 [232.1]LL[1041.5] 1668 FPVFSSASLEGKGKAY(+79.97) 9 56 589.9526 3 21.636 4.7 47 40 40 43 54 85 53 48 59 87 91 92 52 39 40 26 [577.3]S[271.2]EGK[499.2] 3983 WLAKKTMGKAPDW 7.3 56 511.2755 3 50.127 2 81 70 51 45 48 48 62 74 68 60 48 46 26 W[1326.7] 3526 RTALVFRVNAFLPPVW 9 56 629.3638 3 44.453 1.5 51 37 35 37 55 65 82 66 87 93 92 70 37 37 26 26 [687.4]R[99.1]NAF[592.3] 1287 QNDKLSVRW 5.1 56 573.3079 2 17.317 2 55 54 69 69 88 91 26 26 26 [485.2]LS[441.2] 1830 YPLVYVLNPDVAGGRDKFY(+79.97) 10.7 56 756.0386 3 23.397 3.1 37 35 35 42 49 52 55 52 64 67 85 89 93 85 62 59 35 35 32 [1173.6]VAGG[789.3] 2422 LFQATTGM(+15.99)LVNNTKLF 9 56 605.321 3 30.677 1.6 46 46 37 50 68 70 54 60 86 82 56 52 54 56 54 26 [865.4]LV[717.4] 1332 LYWPFTTKVLWKF 7.3 56 576.9881 3 17.844 0.7 26 54 44 53 69 76 69 66 68 61 52 38 50 [1709.9] 2817 MNKFAKAGAREAYY 7.9 56 810.4043 2 35.629 1 42 41 67 69 67 65 44 44 50 59 67 65 76 26 [1600.8] 3248 WTLPFASLKGY(+79.97) 6.2 56 681.8289 2 41.06 0.8 47 46 45 74 96 69 51 43 51 66 26 [497.3]F[699.3] 1053 LPKARGGPSPKKFLLLGPSTDRY(+79.97) 13 56 645.3518 4 14.56 1.9 41 46 39 40 47 60 70 69 61 61 63 55 39 54 48 46 48 53 66 59 68 86 65 [2160.2]R[243.0] 2882 KSRRPGGMTLALHW 7.9 56 537.2955 3 36.46 1.6 33 33 38 80 52 58 69 89 89 87 58 36 33 26 [371.2]R[211.1]MTL[507.3] 4108 S(+79.97)EM(+15.99)GGSPY 4.5 56 462.1465 2 51.708 0.5 31 31 65 87 92 89 26 26 [443.1]GGS[260.1] 2337 KTLFLPASGEVASW 7.9 56 753.4042 2 29.593 1 76 60 56 55 64 58 55 43 43 48 66 58 56 43 [1486.8] 3210 Y(+79.97)KKSEAMKAKLESLKAAKYY 11.3 56 608.3195 4 40.591 2.5 75 69 40 51 53 50 51 58 62 57 56 43 41 57 89 87 57 46 46 29 [1686.8]KA[525.3] 1942 KSPKQLKENTLY(+79.97) 6.8 56 764.8939 2 24.669 2.3 32 32 34 44 46 93 53 60 54 78 84 58 [568.3]L[472.2]L[243.0] 981 EAKVAVEYLTW 6.2 56 436.8989 3 13.7 0.8 46 44 44 51 58 54 56 84 74 77 26 [726.4]Y[400.2] 2752 GYKLAPGSGTTVFLY 8.4 56 787.4189 2 34.807 2.8 63 63 92 86 92 61 51 42 44 39 41 42 69 26 26 [220.1]KLA[1022.5] 3833 APPQAVVW 4.5 56 434.2397 2 48.222 0.2 26 94 62 49 53 65 71 26 [71.0]P[680.4] 1606 RKKGLSGCGAALLF 7.9 56 710.9064 2 20.928 2.7 30 30 36 52 50 73 72 81 82 80 59 59 50 26 [726.5]CGA[444.3] 1690 FNKNGAANLVAY 6.7 56 641.3336 2 21.889 1 59 37 39 52 82 73 58 49 61 60 53 46 [503.2]G[702.4] 4212 DDDDSGDF 4.5 56 443.14 2 53.056 1.9 26 26 26 94 87 82 78 26 [345.1]DSG[262.1] 2389 LELLFFTLF 5.1 56 571.8289 2 30.264 0.9 39 87 96 99 44 37 36 37 26 [113.1]ELL[655.3] 1263 KVELEENLLPGDKRRF 9 56 648.3629 3 17.024 1.7 58 56 67 43 54 39 39 40 85 66 67 77 72 76 26 26 [954.5]L[856.5] 2496 ADALPLGAYGGVPLF 8.4 56 487.5964 3 31.633 2.4 31 36 52 52 46 61 67 85 86 82 78 81 26 26 26 [637.3]AYG[57.0]V[357.2] 2032 HKFLTGSLKSMADLKGWKW 10.7 56 1117.103 2 25.746 1.6 68 36 34 45 51 78 82 79 61 59 63 67 59 61 53 50 39 40 34 [683.4]S[1443.8] 1621 Y(+79.97)WNKVTFKLEGLKKF 8.4 56 661.0174 3 21.096 1.6 39 62 38 36 45 49 70 95 93 80 72 49 47 34 26 [1018.4]KLE[573.4] 2671 WLMLNLW 3.9 56 975.5145 1 33.825 2.4 26 97 60 41 41 64 58 [186.1]L[657.3] 3038 LLKKCAPPASAKSW 7.9 56 500.6191 3 38.4 1.8 69 69 69 75 62 65 26 67 46 46 54 52 54 26 [1480.8] 3708 WLTSGKKGGAPLMW 7.9 56 511.2748 3 46.683 0.6 69 39 35 41 48 45 73 78 80 83 83 39 39 26 [857.5]GAP[430.2] 2174 KLVSKKPTCSGGGGFLLHW 10.7 56 1008.048 2 27.527 0.6 48 47 69 62 64 53 53 62 67 68 70 47 48 51 50 59 60 53 26 [1996.1]

PAGE 401

401 3604 ATPLAVNPGQDQW 7.3 56 466.2335 3 45.405 0.4 27 41 55 71 69 59 57 81 56 50 52 53 52 [666.4]P[614.2] 2539 WLMPGKPF 4.5 56 975.5147 1 32.184 2.8 26 85 80 77 57 44 50 26 [186.1]LM[526.3] 3500 LLFVALHPFKEW 6.7 56 500.6188 3 44.145 0.7 69 69 56 39 38 48 54 94 92 32 44 30 [793.5]PF[443.2] 3905 Y(+79.97)S(+79.97)NDNDTSWEMYY 7.3 56 616.4969 3 49.132 42.2 26 68 62 69 52 66 59 59 63 82 65 26 26 [1242.3]E[457.2] 3512 VKSKLF 3.4 56 361.2341 2 44.293 0.3 26 40 72 82 87 26 [314.2]KL[147.1] 2222 WGKKDTTTAKKLESLGNVAYGY 12.3 56 608.3204 4 28.132 2.6 35 35 39 65 48 56 82 64 44 43 60 65 60 59 82 82 59 61 61 48 46 26 [715.4]T[757.4]LG[667.3] 2881 KETLKGCGTKAKLCLLKDKS(+79.97)W 11.8 56 608.3209 4 36.448 1.2 32 30 30 45 71 62 55 42 41 48 51 60 60 56 74 93 80 77 73 60 26 [1573.9]LK[596.2] 898 DFRLPSGSEDLHPALTF 9.5 56 476.2409 4 12.681 1.5 26 39 60 47 69 54 39 35 36 59 58 67 81 84 82 82 26 [1353.6]PALT[147.1] 2875 TKRLGDGFMW 5.6 56 404.2066 3 36.373 1.3 26 26 75 59 57 63 76 73 73 26 [1191.6] 3602 FAELAGAAGKAEVLW 8.4 56 766.911 2 45.382 2.6 26 29 41 39 49 51 71 45 50 61 89 83 84 87 26 [915.5]AEVL[186.1] 1814 HPM(+15.99)PRVDLGKRY(+79.97)AQKLTLSFF 11.8 56 650.834 4 23.219 2.3 26 26 64 55 42 67 61 59 60 67 52 30 39 35 43 77 70 67 76 78 72 [2581.3] 3362 YPEALAVANMDNAKKAW 9.5 56 473.7408 4 42.47 2.4 70 69 59 54 53 52 42 42 55 58 61 72 51 50 58 70 26 [1872.9] 3403 QT(+79.97)MACDGCGDENY(+79.97) 7.3 56 522.7845 3 42.958 37.8 46 61 54 54 51 50 48 41 56 62 66 67 65 [1547.4] 3174 APPQAVVW 4.5 56 434.2408 2 40.14 2.3 26 98 73 39 47 61 73 26 [71.0]P[680.4] 4147 QPTMPVSVAACGF 7.3 56 654.3089 2 52.192 1.3 56 55 57 50 52 54 58 57 82 73 53 46 26 [839.4]A[378.1] 1614 LYVVLTSSY 5 56 1044.562 1 21.027 0.4 26 97 97 84 58 46 38 26 26 [113.1]YVV[551.3] 2008 KVS(+79.97)VSPTGLLVGLELW 8.9 56 593.321 3 25.463 0.7 62 58 52 52 56 42 39 41 62 86 83 72 71 45 34 31 [948.5]LV[598.3] 1812 WKAKGRVSTAKGNAGALQELYY 12.3 56 804.4324 3 23.202 0.2 40 39 47 50 53 53 52 59 64 69 65 73 85 78 44 36 37 52 88 80 26 26 [1269.7]N[440.2]EL[326.1] 1306 GYWLLCLHTLVVW 7.3 56 534.9547 3 17.54 0.3 29 66 47 53 43 72 63 66 76 76 77 26 26 [1583.8] 3118 DLRGGTFPVTRRVLLW 8.9 56 629.3637 3 39.419 0.4 74 74 77 76 48 42 47 52 77 81 87 32 30 33 29 26 [942.5]TR[667.4] 2534 KHAKAKRPKGVFGY 7.8 56 397.4877 4 32.12 0.8 46 39 40 50 64 63 47 51 81 89 92 38 43 32 [916.6]KGV[367.2] 3265 DALQVLGPY 5 56 975.5163 1 41.275 1.8 65 68 90 47 38 36 44 83 26 [186.1]L[397.2]P[163.1] 2168 TLGPLPKSGASVLPY 8.4 56 500.6195 3 27.452 1.7 40 40 46 50 61 74 66 63 69 74 74 83 36 26 26 [1008.6]V[373.2] 2631 DDNCPCCAGT(+79.97)MACNNS(+79.97)Y(+79.97) 9.5 56 674.4626 3 33.322 47 50 48 39 53 58 76 68 58 43 45 52 50 53 53 63 70 60 [2002.5] 1038 LEEAEGVDEFTSF 7.3 56 736.8243 2 14.378 1 26 26 26 98 96 71 61 63 95 49 39 39 28 [371.2]AE[271.1]E[482.2] 1542 HALPAKSACY(+79.97) 5.6 56 1140.49 1 20.187 1.1 80 74 73 64 40 34 33 52 75 26 H[984.4] 1003 KHLGKPLYDRHGKW 7.8 56 578.99 3 13.979 0.2 29 34 44 71 63 72 88 94 95 55 33 36 33 26 [660.4]LYD[664.4] 3274 Y(+79.97)PDMPCGDEHCST(+79.97)W 7.8 56 600.8171 3 41.382 43 26 61 47 66 49 49 64 76 91 26 26 64 64 64 [958.3]E[694.2] 1546 HAEENNAWW 5 56 1156.482 1 20.225 1.4 26 26 95 63 47 60 74 79 26 [208.1]E[800.3] 3361 AFKKGGYALLTEY 7.2 56 487.5963 3 42.459 2.8 32 35 42 38 72 76 89 92 91 51 37 35 26 [588.3]YAL[506.2] 2101 T(+79.97)YERKAVFSKERRRVRGMKVKSGDDFF 15 56 843.9316 4 26.604 3 30 30 31 42 54 75 66 65 74 56 50 40 26 26 54 62 91 92 91 87 55 51 70 70 44 32 26 [2142.1]GMKV[796.3]

PAGE 402

402 2115 RRFVKYTATPRYLM(+15.99)Y 8.4 56 991.0264 2 26.772 1 26 78 26 51 70 75 74 78 77 72 64 36 34 34 34 [1962.0] 1123 YQRDGVSDNAAKVMY 8.4 56 572.939 3 15.379 1 63 40 40 39 50 74 81 75 39 46 55 75 63 61 26 [718.3]S[892.4] 4301 HTPTMANT(+79.97)F 5 56 550.2178 2 54.238 0.3 26 51 52 59 89 67 49 51 52 [436.2]M[513.2] 2646 APPQAVVW 4.5 56 434.2403 2 33.519 1.2 26 96 66 41 45 59 83 26 [71.0]P[395.2]V[186.1] 1296 FAAVRMW 3.9 56 880.4521 1 17.429 2.6 26 96 91 91 29 26 26 [147.1]AAV[473.2] 1605 KSRCAVGSAAVKAHF 8.3 56 511.2758 3 20.917 2.1 29 30 50 81 77 70 63 47 48 71 72 63 56 44 26 [371.2]C[1038.6] 2034 KTAARELTLAANPLLAFAAACHY 12.8 56 806.0959 3 25.779 3 32 32 35 33 37 40 50 56 72 80 74 62 65 66 84 74 70 78 52 43 38 52 45 [983.6]A[395.2]L[834.3] 3438 APPQAVVW 4.4 56 434.2398 2 43.401 0 26 97 58 37 41 75 80 26 [71.0]P[395.2]V[186.1] 2479 FTLLMVLGGELYY 7.2 56 759.8978 2 31.409 1.8 45 45 74 87 67 68 70 69 42 42 56 26 26 [361.2]L[1025.5] 2186 LSKLKKSGTNAFSLTKY 9.5 56 629.3644 3 27.684 2.3 34 32 37 37 56 58 64 77 92 84 89 77 55 43 39 38 26 [841.5]TNA[739.4] 3442 WYSLAGAGAQGASKSVF 9.5 56 567.2858 3 43.436 0.4 38 43 36 64 69 68 58 59 65 50 51 47 50 54 61 61 61 [1680.8] 1729 FAKNKYAGPHKVVW 7.8 56 548.9706 3 22.304 2.1 42 53 65 64 73 76 93 81 56 44 45 26 26 26 [751.4]AG[746.4] 2596 TNTSPSSVRYLW 6.7 56 705.8551 2 32.895 1.3 47 44 63 72 51 53 55 84 56 45 49 42 [674.3]V[618.3] 2920 CAPPAQAPLLGSTVW 8.3 56 504.2609 3 36.938 2.7 26 26 26 78 53 47 52 68 75 86 89 76 70 26 26 [848.4]LG[473.2] 3085 NNRLVPGPGLGFMF 7.8 56 506.9343 3 39.003 0.1 53 52 55 74 75 39 39 68 56 60 71 57 45 26 [1499.8] 1333 EFMARPYVLKAKLY 7.8 56 432.9927 4 17.854 0.7 26 59 57 62 73 86 29 30 38 53 87 72 72 26 [634.3]P[503.3]A[404.2] 3111 HPKKKLLFLCVNF 7.2 56 397.4875 4 39.332 2.9 33 39 39 77 70 50 28 28 80 70 63 69 69 [991.6]L[463.2] 2451 RHLMGSALPFF 6.1 56 425.894 3 31.051 0.5 37 52 43 66 65 59 69 80 83 26 26 [752.4]LP[294.1] 1714 WRSTTGCVGLVTHKW 8.3 56 577.63 3 22.136 2.3 44 54 41 71 50 45 49 70 90 91 64 48 43 40 26 [890.4]GL[651.3] 2604 WLMVQLW 3.9 56 975.5143 1 33.002 2.3 26 26 88 66 50 77 52 [299.2]M[526.3] 1016 RAAPKASSPLDY 6.7 56 425.8942 3 14.131 0.9 33 34 39 42 51 53 65 94 88 66 68 26 [681.4]SP[391.2] 2404 WVALPKHMGRYTPGPAAEKAF 11.7 56 582.5591 4 30.447 1.4 36 36 38 59 63 68 74 68 44 37 38 49 82 85 88 88 66 38 37 37 26 [1439.7]PGPA[546.3] 730 NGCT(+79.97)CMTVY 5 55 536.17 2 10.322 1.6 39 42 50 55 54 58 79 91 26 [790.2]V[163.1] 2433 HPDSLAAGGCLRPKMF 8.9 55 567.2845 3 30.819 0.9 26 26 70 53 52 70 75 65 64 68 66 79 46 45 46 26 [1680.8] 4086 LLNAALRKKHYRCPAAHW 10 55 430.4417 5 51.421 1.7 52 48 47 52 71 69 68 58 27 40 36 38 40 62 79 89 86 26 [1735.0]AH[186.1] 1035 TKLVVAPSKLTY 6.7 55 660.3995 2 14.338 1.1 37 41 55 74 89 78 76 69 44 39 30 26 [441.3]V[760.4] 951 HPANERW 3.9 55 455.2189 2 13.34 2.1 26 78 78 68 83 26 26 [419.2]E[342.2] 1489 ESRVRSMPVSEVEAGLTLYY 11.1 55 572.291 4 19.591 0.5 33 32 47 66 74 90 81 76 80 45 41 40 46 43 49 72 62 45 48 26 [627.3]SM[97.1]V[1225.6] 2997 WHRRGDGPPDVAFSGGRVHY 11.1 55 756.0374 3 37.877 1.6 26 55 45 36 45 60 71 79 80 49 47 60 74 73 69 56 41 37 39 55 [961.5]P[1188.6] 2968 FELFKY 3.3 55 846.4415 1 37.523 2.2 93 86 48 41 36 26 FE[551.3] 2655 LERKGPYVTGPRPRLF 8.9 55 629.3641 3 33.621 1 36 35 37 38 52 67 70 82 84 58 49 42 84 51 67 26 [843.5]VT[310.2]P[416.3]

PAGE 403

403 1044 KAVANKAWALVGPW 7.8 55 504.2897 3 14.453 1.1 30 31 34 60 46 56 52 64 87 91 90 74 26 26 [868.5]ALV[340.2] 3835 FTLSKSSGMLLATY 7.7 55 759.8978 2 48.239 0.6 44 56 59 59 59 26 68 43 41 53 71 80 82 26 [1164.6]AT[163.1] 2865 M(+15.99)LLYVVLGGDPVAGGRLYNY(+79.97) 11.1 55 756.0366 3 36.242 1 47 47 52 45 46 46 49 49 65 55 54 76 84 86 82 75 40 31 35 33 [1272.7]AGG[789.3] 3246 WLMGNAAGKGPALVF 8.3 55 511.2751 3 41.04 1.3 72 59 35 41 45 69 59 53 65 84 81 48 43 43 26 [928.5]GP[430.3] 4045 MNNKHAGATPEPRMF 8.3 55 567.6048 3 50.905 0.2 51 47 55 53 46 36 39 45 51 75 88 81 70 61 26 [1021.5]EP[434.2] 2042 AKFLLTSSSVGAGSFRFY 10 55 646.6754 3 25.871 0.2 28 32 35 63 77 77 83 38 49 49 60 68 86 82 64 41 29 28 [673.4]S[401.2]GS[613.3] 1863 MLEKVVTF 4.4 55 483.7702 2 23.755 0.3 75 64 56 56 69 39 39 39 [947.5] 1518 HPKRSTAYLDHKGLDHSRTSF 11.6 55 614.0665 4 19.92 0.5 63 63 34 34 38 52 38 41 64 70 72 83 80 72 74 84 41 36 32 44 37 [1305.7]KG[228.1]H[578.3] 2218 WKNHSLGPVRKVF 7.2 55 784.4442 2 28.077 2.8 33 57 42 81 76 78 85 81 47 33 34 40 26 [428.2]H[200.1]GP[629.4] 1983 SLKPLKAPMPFET(+79.97)LPRRY 10 55 556.7981 4 25.161 0.2 37 37 55 58 68 56 53 61 54 53 63 65 77 53 75 70 26 26 [2205.2] 1806 FKWADRFPALGKNKSPKEYY 11.1 55 815.7608 3 23.139 1.3 55 38 33 49 52 79 34 37 72 83 80 82 86 64 51 48 45 46 38 26 [1118.6]LGKN[895.4] 3950 NKLTPLPNAVSY(+79.97) 6.6 55 466.2325 3 49.698 3 56 43 42 44 51 76 86 48 51 51 53 58 [666.4]P[614.2] 1813 KSVKTREVVNWLTHGFAYLY 11.1 55 603.5763 4 23.21 1.4 46 52 64 43 42 48 50 48 59 48 46 32 49 80 94 87 78 54 50 26 [1540.9]HGF[510.2] 3348 MNKRNGNGPTHPPRGDARQY 11.1 55 756.0374 3 42.299 1.2 37 36 46 47 46 52 56 46 47 62 76 85 90 68 66 62 44 41 49 39 [1206.6]PP[846.4] 4040 ELLELQVW 4.4 55 515.2853 2 50.84 1.8 35 71 87 68 49 37 42 48 [242.1]L[655.3] 3264 FALGTVPSALDLAAW 8.3 55 766.4131 2 41.264 2.4 68 64 43 40 48 56 33 33 32 38 84 88 89 80 26 [956.5]DLAA[186.1] 2179 LLRDCKLGT(+79.97)PSHSGLPFF 9.9 55 690.0063 3 27.596 2 42 51 50 33 31 31 54 53 56 64 83 82 82 82 70 69 26 26 [1176.6]SHSG[504.3] 1701 LKEDEKSLKKMAALSRKMKY 11 55 600.0884 4 22.001 1.4 44 43 56 58 58 64 71 81 78 35 36 39 48 56 77 78 68 33 38 33 [829.4]L[1435.8] 3842 MDGGGFAY 4.4 55 409.1617 2 48.328 2.9 75 72 59 37 63 78 26 26 [798.3] 2120 LEGLT(+79.97)LPTGKGEEKLELF 9.9 55 685.3547 3 26.838 1.9 93 91 50 49 88 62 68 47 49 37 37 40 58 44 44 45 58 26 LE[170.1]T(+79.97)[1441.8] 3940 LWWQAVAPLVWY 6.6 55 766.4094 2 49.578 1.3 52 52 53 61 65 64 77 77 77 26 26 26 [1512.8] 1272 LDAAALAQQLSAKKVPY 9.4 55 596.3415 3 17.138 2.1 80 81 88 87 69 51 51 44 44 42 41 60 74 30 29 32 26 LDAA[1397.8] 907 VRAAVHLVAKGRYF 7.7 55 529.6483 3 12.803 1.6 73 60 48 35 35 64 73 52 55 86 81 38 38 27 [916.6]KG[466.2] 3712 WRKDAHTLVKVF 6.6 55 500.6195 3 46.726 2.7 55 45 37 64 62 68 86 77 63 48 26 26 [793.4]T[586.4] 1434 RRKKAATGSNPTGGKELYY 10.5 55 699.7123 3 18.987 1.2 26 49 36 39 36 33 33 43 63 68 88 88 89 84 66 66 78 26 26 [1069.6]PTGG[696.3] 3864 WFVAKGSMNKKRVHVVVY 9.9 55 537.8018 4 48.599 2 26 79 63 61 61 56 54 56 43 46 47 51 71 26 67 61 61 57 [2129.2] 1684 MGKVMVW 3.9 55 850.4299 1 21.826 1.8 26 85 76 59 50 60 26 [131.0]G[643.4] 1390 WVALLLRLALT(+79.97)GDSS(+79.97)RFKF 10.5 55 785.0664 3 18.481 0.9 40 40 50 56 31 57 64 66 68 66 65 68 77 94 81 34 29 26 26 [1501.8]SS(+79.97)[578.3] 3829 LSVGPVCAPKALLF 7.7 55 472.2745 3 48.171 2.6 26 62 62 62 68 66 66 73 53 50 53 55 42 26 [1395.8] 3367 SVEVGGGPVLKLPTF 8.3 55 500.6192 3 42.534 2.4 63 63 59 64 61 51 42 50 80 65 61 49 45 40 26 [682.3]V[699.4] 2114 KDVEPAGGSAVSALAW 8.8 55 779.3998 2 26.761 1.1 67 54 56 83 68 46 48 67 58 49 44 43 45 62 57 26 [342.2]E[1067.5]

PAGE 404

404 2787 SLVAKVVGAFAGKSLLYY 9.9 55 629.3646 3 35.253 0.4 26 83 78 64 58 53 45 44 54 60 76 73 45 42 54 57 44 26 [87.0]L[1666.9] 2454 WLAKVPDSADALVF 7.7 55 511.2755 3 31.096 2.2 84 77 61 57 57 66 43 45 50 79 41 41 37 26 W[1326.7] 4117 WLMSKVNAVANLW 7.2 55 511.2752 3 51.814 1.3 41 83 38 45 47 57 52 91 76 52 41 47 38 [186.1]L[559.3]A[583.3] 1363 ERKFLGQAAGFAAAQEESGDKHF 12.7 55 624.3065 4 18.196 2.7 27 27 44 45 54 45 35 47 57 57 58 52 58 57 69 93 91 90 83 51 43 45 26 [1545.8]EESG[527.2]

PAGE 405

405 APPENDIX O DE NOVO SEQUENCING R ESULTS FOR CEM LOW De novo s ummary r eport (generated by Peaks DB software)

PAGE 406

406 Peptide r esults for CEM low digested m yosin derived by De novo sequencing with PEAKS DB s oftware Scan Sequence TLC A LC (%) m/z z RT ppm local confidence (%) tag (>=0%) 1575 LLGSLDVHEPEY 11.3 95 686.3441 2 20.079 1.4 96 96 95 96 97 99 94 94 94 89 89 89 LLGSLDVHEPEY 3213 LLGSLDVHEPEY 11.3 94 686.3431 2 39.666 0.1 96 96 94 95 97 99 95 95 95 89 89 89 LLGSLDVHEPEY 3279 LLGSLDVHEPEY 11.3 94 686.3429 2 40.486 0.3 96 96 94 95 97 99 94 94 94 87 87 87 LLGSLDVHEPEY 789 VGNEYVTK 7.5 94 455.2374 2 11.618 0.1 97 97 86 94 88 97 99 89 VGNEYVTK 3544 LLGSLDVHEPEY 11.2 94 686.3431 2 43.695 0 94 93 91 93 96 99 93 93 93 90 90 90 LLGSLDVHEPEY 1678 KAGLLGTLEEMR 11.1 93 659.3636 2 21.203 0.5 85 88 88 93 98 96 96 96 97 95 95 82 KAGLLGTLEEMR 936 LTENADFGR 8.3 92 511.7491 2 13.285 0.8 95 95 93 86 88 90 96 97 84 LTENADFGR 1919 FSPEELKNMW 9.1 91 640.8024 2 23.788 0.2 87 89 97 98 98 97 90 86 90 76 FSPEELKNMW 858 ESGDNLNDAEER 11 91 674.7836 2 12.419 0.7 66 72 95 96 90 95 92 97 97 96 97 97 ESGDNLNDAEER 1613 EM(+15.99)LDDLSSNM(+15.99)EAVSK 13.7 91 850.8715 2 20.499 0.2 93 94 94 98 98 98 99 97 77 82 87 86 82 85 92 EM(+15.99)LDDLSSNM(+15.99)EAVSK 1890 FSAEELKNMW 9.1 91 627.7951 2 23.47 0.6 88 88 97 98 98 97 90 86 91 72 FSAEELKNMW 1893 NFDKVLAEW 8.2 91 561.2845 2 23.509 0.7 71 80 93 92 92 94 97 98 99 NFDKVLAEW 1039 RAAEKELVDASER 11.8 90 737.3855 2 14.411 1.2 33 90 96 97 97 97 99 99 99 96 91 91 82 RAAEKELVDASER 2949 LLGSLDVPEHEY 10.8 90 686.3428 2 36.411 0.4 96 96 95 96 98 99 97 97 76 68 68 86 LLGSLDVPEHEY 886 YETDALQR 7.2 90 498.2435 2 12.745 0.5 94 95 97 93 93 92 81 69 YETDALQR 1918 DLAGFEL 6.2 89 764.3822 1 23.78 0.3 73 72 89 95 97 97 97 DLAGFEL 855 SKYEDTALQR 8.9 89 605.8065 2 12.394 0.3 93 93 97 84 85 86 94 95 85 74 SKYEDTALQR 1639 NSYEETLDHLETMK 12.4 89 855.3896 2 20.783 1.9 66 79 83 97 91 97 97 97 94 94 96 87 87 68 NSYEETLDHLETMK 1241 MGVKPFSTW 8 88 526.7676 2 16.533 4.4 94 94 95 97 26 94 94 98 99 MGVKPFSTW 1042 HLM(+15.99)SI 4.4 88 616.3129 1 14.447 1 96 92 84 85 82 HLM(+15.99)SI 1581 DVLASMGQLNVK 10.6 88 637.8422 2 20.144 0 26 99 98 97 97 97 96 81 95 87 93 86 DVLASMGQLNVK 1473 KMELDDLSSNMEAVSK 14.1 88 898.924 2 18.968 0.1 90 89 94 96 98 99 98 98 89 60 72 83 88 78 81 89 KMELDDLSSNMEAVSK 1179 LSDVHEPEY 7.9 88 544.7496 2 15.887 2.2 26 99 99 94 93 93 94 94 94 LSDVHEPEY 1319 KKDLDDLELTLAK 11.4 88 751.4292 2 17.361 2.7 97 96 95 96 96 97 95 94 93 88 71 74 45 KKDLDDLELTLAK 3346 LLGSLDVPEHEY 10.5 88 686.3433 2 41.3 0.4 95 95 93 94 96 99 98 98 75 61 61 79 LLGSLDVPEHEY 863 M(+15.99)GAGETAPR 7.9 88 453.2101 2 12.478 1.8 67 67 96 93 90 91 95 97 86 M(+15.99)GAGETAPR 738 HELEAEEER 7.9 87 571.2607 2 10.995 2 99 99 97 94 95 26 91 91 91 HELEAEEER 1875 QLGEVEDLMVDVER 12.2 87 816.4013 2 23.314 0.6 40 44 88 91 96 97 97 97 97 98 99 91 92 91 QLGEVEDLMVDVER

PAGE 407

407 1486 LVDSMQATLDSEVR 12.2 87 782.3882 2 19.104 0.6 50 58 86 93 94 84 97 97 98 98 96 88 90 88 LVDSMQATLDSEVR 1691 FSVTTAERELV 9.6 87 626.333 2 21.331 0.7 86 86 88 96 96 94 91 84 62 85 88 FSVTTAERELV 877 TSEDKVGLYK 8.7 87 570.3012 2 12.64 0.9 91 90 93 95 95 95 88 78 84 56 TSEDKVGLYK 1222 YEEGQAELEGSLK 11.3 87 726.8459 2 16.338 0.5 26 99 98 94 80 98 98 98 97 92 84 76 83 YEEGQAELEGSLK 1169 LTM(+15.99)FGEK 6.1 87 421.2092 2 15.769 1.5 90 91 91 97 84 86 66 LTM(+15.99)FGEK 882 TM(+15.99)FGEK 5.2 87 364.6678 2 12.693 0.1 96 93 93 81 91 63 TM(+15.99)FGEK 1560 NFDQVLADFSK 9.5 87 642.3174 2 19.911 0.8 68 79 95 85 94 97 95 94 82 82 75 NFDQVLADFSK 1155 TDLAAALAK 7.8 86 437.2558 2 15.636 0.4 88 90 97 98 99 97 87 89 26 TDLAAALAK 1558 SSSDAGVLSVVSK 11.2 86 618.3277 2 19.895 0.4 26 95 97 95 95 96 96 97 97 97 97 97 26 SSSDAGVLSVVSK 1601 MKNSYEETLDHLETMK 13.8 86 984.9567 2 20.358 1.1 79 76 80 95 97 98 81 80 83 96 97 96 95 80 80 58 MKNSYEETLDHLETMK 1485 LVDSM(+15.99)QATLDSEVR 12 86 790.3854 2 19.094 0.3 48 55 79 94 93 79 97 97 98 97 94 89 90 89 LVDSM(+15.99)QATLDSEVR 3682 EPGSLDVTFFFL 10.3 86 686.3431 2 45.363 3 94 94 92 92 93 96 95 93 93 73 55 55 EPGSLDVTFFFL 1347 ALEDQLSELK 8.6 86 573.3063 2 17.651 0.5 82 86 95 93 78 96 97 83 85 59 ALEDQLSELK 1881 CLCGKVLEGSV 9.4 86 554.2791 2 23.38 2.4 40 66 68 94 93 94 97 97 96 96 96 CLCGKVLEGSV 1361 M(+15.99)VAELEELR 7.7 86 553.2807 2 17.794 1.5 98 97 97 98 99 26 92 92 67 M(+15.99)VAELEELR 1931 TVFLTMFGEK 8.6 86 586.8045 2 23.922 0.2 97 97 97 98 98 96 95 65 63 47 TVFLTMFGEK 1200 LEDEQSLGAQLQK 11.1 86 729.8755 2 16.098 0.3 66 66 94 97 81 94 95 97 97 81 93 77 69 LEDEQSLGAQLQK 1369 MVAELELVW 7.7 85 1089.564 1 17.88 0.6 92 90 89 93 95 91 93 94 26 MVAELELVW 2237 MVATGGGVELGV 10.2 85 545.2842 2 27.64 0.3 95 95 93 88 82 71 73 75 84 81 82 92 MVATGGGVELGV 2075 LLTEGNEFGR 8.5 85 568.2902 2 25.65 0.9 92 94 94 92 81 67 84 87 88 64 LLTEGNEFGR 1337 FGTSEDKVGLY 9.3 84 608.2969 2 17.545 2.1 72 76 90 92 91 90 89 90 85 88 60 FGTSEDKVGLY 1254 WQLHLDDAVNI 9.3 84 662.3364 2 16.671 2.7 58 70 69 97 97 98 97 92 88 68 90 WQLHLDDAVNI 1671 LLSLNSADMLK 9.3 84 602.8341 2 21.134 0.3 96 96 96 96 88 91 91 91 66 67 44 LLSLNSADMLK 2592 KMELDDLSSNMEAVSK 13.5 84 898.9236 2 32.053 0.3 79 79 88 92 94 98 97 97 77 62 76 75 79 79 81 89 KMELDDLSSNMEAVSK 2363 FNDAGVLWVSK 9.3 84 618.3239 2 29.212 1.1 77 67 91 92 96 96 97 93 93 94 26 FNDAGVLWVSK 2172 MFSPANK 5.9 84 397.6967 2 26.83 0.5 81 70 72 96 95 88 84 MFSPANK 1701 LELLEKPMGL 8.4 84 571.8282 2 21.446 0.2 64 78 98 98 94 90 79 67 79 90 LELLEKPMGL 1266 KVAEQELVDASERGV 12.6 84 815.4241 2 16.802 1.9 89 87 92 97 89 97 98 98 98 96 91 87 57 52 28 KVAEQELVDASERGV 1719 LTMFGEKL 6.7 84 469.7543 2 21.636 0.3 93 92 96 96 82 74 83 53 LTMFGEKL 1099 VTNSADMLK 7.6 84 489.7497 2 15.026 0.3 81 81 80 96 95 94 85 86 56 VTNSADMLK 1999 QDPEDVLVAAFK 10.1 84 666.3456 2 24.726 0 58 71 91 91 91 91 98 95 95 82 78 59 QDPEDVLVAAFK

PAGE 408

408 979 ELNKLQGEVDR 9.2 84 650.8459 2 13.735 0.7 82 82 71 81 95 70 94 94 87 92 70 ELNKLQGEVDR 900 QFAGDDAPR 7.6 84 488.728 2 12.892 0.6 46 61 92 97 97 96 94 93 75 QFAGDDAPR 1359 MVAELEELR 7.5 84 545.2834 2 17.777 1.1 97 96 94 96 98 26 91 91 62 MVAELEELR 1786 DLDDLELTLAK 9.2 84 623.333 2 22.329 1.3 27 83 97 97 96 98 98 97 84 85 55 DLDDLELTLAK 1755 LLGLNSADMLK 9.2 84 587.8286 2 22.003 0.2 98 98 97 96 89 90 87 88 65 66 43 LLGLNSADMLK 999 WSGLDVGL 6.7 84 423.7217 2 13.969 0.6 26 95 84 82 89 95 97 99 WSGLDVGL 978 ASM(+15.99)GQLNVK 7.5 84 482.2498 2 13.727 0.5 59 59 91 92 75 94 90 97 91 ASM(+15.99)GQLNVK 2107 LGFVPTVGL 7.5 84 902.5342 1 26.042 0.3 63 62 85 93 93 89 83 87 94 LGFVPTVGL 2627 NFDAGVLWVSK 9.2 84 618.325 2 32.483 0.8 69 76 88 89 93 95 95 94 94 95 26 NFDAGVLWVSK 1929 QLLGTLEEMR 8.3 83 595.3158 2 23.907 0.1 33 34 95 99 98 98 99 95 97 83 QLLGTLEEMR 3231 LKDALAAEL 7.5 83 472.2761 2 39.892 1 89 89 89 80 70 51 91 92 95 LKDALAAEL 3365 FNDAGVLWVSK 9.2 83 618.325 2 41.528 0.8 76 63 86 87 93 93 94 97 97 98 26 FNDAGVLWVSK 1164 LLTEGNEFGR 8.3 83 568.2906 2 15.715 0.1 97 97 97 94 59 49 71 93 94 76 LLTEGNEFGR 880 QGEVDDSVQEAR 10 83 666.8048 2 12.678 0.1 53 68 77 95 99 98 93 93 80 84 88 64 QGEVDDSVQEAR 934 GEVDDSVAGEA 9.2 83 1048.445 1 13.27 1.6 77 77 77 94 96 96 91 81 63 65 94 GEVDDSVAGEA 2695 KMELDDLSSNMEAVSK 13.3 83 898.924 2 33.313 0.1 75 73 73 78 93 97 94 94 88 63 71 87 88 79 82 88 KMELDDLSSNMEAVSK 1227 NLTEEMASQDESVAK 12.5 83 826.3767 2 16.395 1.1 41 40 79 95 98 98 98 96 85 97 95 90 73 72 84 NLTEEMASQDESVAK 1185 NEELEAMVK 7.5 83 531.7612 2 15.951 1.4 61 67 97 97 96 94 85 88 58 NEELEAMVK 1131 VAEQELVDASER 10 83 673.3334 2 15.373 0.1 46 46 73 64 94 97 97 99 97 94 95 90 VAEQELVDASER 1233 NLTEEM(+15.99)ASQDESVAK 12.5 83 834.3743 2 16.455 1 41 40 79 96 98 98 95 84 74 94 93 89 82 82 91 NLTEEM(+15.99)ASQDESVAK 3217 KMELDDLSSNMEAVSK 13.3 83 898.924 2 39.709 0.1 89 88 91 94 97 98 94 93 82 58 61 63 77 73 77 85 KMELDDLSSNMEAVSK 1368 LEDDLSNSMEAVSK 11.6 83 769.3582 2 17.87 2.7 50 50 84 94 95 96 72 76 83 88 87 86 96 98 LEDDLSNSMEAVSK 1987 LLAPASSSSMI 9.1 83 1076.565 1 24.583 0.9 85 81 81 87 77 77 84 79 81 81 92 LLAPASSSSMI 807 AAEDLKEAGAA 9.1 83 523.2618 2 11.84 0.3 78 76 82 97 97 81 76 73 76 75 95 AAEDLKEAGAA 1092 VFDKEGNGTMV 9.1 83 598.7847 2 14.954 0.5 95 92 90 89 85 86 73 67 65 79 79 VFDKEGNGTMV 2436 MVAEELELR 7.4 82 545.2847 2 30.123 1.2 97 97 97 99 26 88 88 89 58 MVAEELELR 3330 FVDKDDEVVMGANK 11.5 82 783.8762 2 41.099 1.1 86 85 85 77 78 78 90 93 98 95 82 55 71 74 FVDKDDEVVMGANK 1404 TTAAPTL 5.8 82 674.3724 1 18.246 0.8 89 91 91 85 60 64 93 TTAAPTL 897 AGGGLAANLDKK 9.9 82 557.8145 2 12.867 0.2 63 57 82 92 94 98 92 67 67 81 95 94 AGGGLAANLDKK 1343 KMEM(+15.99)ENLDGEEK 9.9 82 734.8184 2 17.607 0.1 72 71 89 84 92 85 90 84 79 83 85 66 KMEM(+15.99)ENLDGEEK 1620 MELDDLSSNMEAVSK 12.3 82 834.8768 2 20.573 0.5 62 61 86 90 95 96 97 68 52 80 92 87 84 86 88 MELDDLSSNMEAVSK

PAGE 409

409 3100 FNDAGVLWVSK 9 82 618.325 2 38.254 0.8 74 62 85 87 92 93 95 93 93 94 26 FNDAGVLWVSK 923 KLAEKDEEMWALK 10.6 82 795.9116 2 13.149 2.3 84 84 91 93 96 97 98 94 88 50 61 73 48 KLAEKDEEMWALK 964 MQGQEDENGSVHY 10.6 82 747.3016 2 13.589 0.2 59 52 93 79 97 98 93 86 92 93 74 71 71 MQGQEDENGSVHY 1803 WLQELVDASEGVVGI 12.3 82 807.9199 2 22.517 2.9 27 51 35 85 96 98 97 97 95 93 90 89 87 89 89 WLQELVDASEGVVGI 1320 NNGDAAFF 6.5 81 855.3611 1 17.371 2.3 63 76 77 76 76 91 94 94 NNGDAAFF 1335 TGFPPDVAGNVDYK 11.4 81 740.3577 2 17.531 2.1 32 32 65 99 99 98 96 95 93 82 90 88 90 74 TGFPPDVAGNVDYK 3516 EFLGAEL 5.7 81 778.398 1 43.353 0.1 94 90 84 71 63 71 93 EFLGAEL 767 LEEAGGATSA 8.1 81 453.2139 2 11.348 0.5 26 26 92 90 92 97 96 95 96 98 LEEAGGATSA 4010 EPGSLDVTTVPAW 10.6 81 686.3433 2 49.396 0.2 90 90 89 92 94 98 95 93 86 69 64 64 26 EPGSLDVTTVPAW 3334 LLTEEGNFGR 8.1 81 568.2905 2 41.155 0.4 95 95 93 93 82 73 65 81 77 54 LLTEEGNFGR 2884 EPGSLDVTTVAPW 10.6 81 686.3433 2 35.594 0.1 95 95 95 96 97 98 97 92 62 57 62 77 26 EPGSLDVTTVAPW 851 KNLEVTVK 6.5 81 465.7845 2 12.344 0.1 91 84 90 89 89 65 88 51 KNLEVTVK 1399 SLSTELFK 6.5 81 462.7553 2 18.193 0.3 26 97 95 93 92 89 91 63 SLSTELFK 963 NLEVTVK 5.7 81 401.737 2 13.583 0.2 26 99 96 96 88 92 68 NLEVTVK 1903 ARNAALMAGKAANPL 12.2 81 734.904 2 23.609 3 64 69 80 92 95 86 68 55 64 74 95 97 83 93 95 ARNAALMAGKAANPL 2753 EPGSLDVTTVAPW 10.5 81 686.3442 2 34.017 1.5 94 94 94 95 97 98 96 86 63 57 66 80 26 EPGSLDVTTVAPW 3155 MVAEELELR 7.3 81 545.2842 2 38.939 0.4 95 94 94 95 26 92 86 87 57 MVAEELELR 1383 LLDPEATGSLKKEF 11.3 81 774.4203 2 18.037 1.3 87 89 89 96 95 94 92 85 64 65 94 58 58 58 LLDPEATGSLKKEF 4041 GTFPPDVAGNVDYK 11.3 81 740.3593 2 49.78 0 62 61 87 98 98 97 93 87 66 53 81 83 87 71 GTFPPDVAGNVDYK 3450 FELQEI 4.8 81 778.397 1 42.562 1.3 94 93 90 62 87 57 FELQEI 1566 NFAMALVGVDSK 9.7 81 626.3223 2 19.972 2.1 60 67 91 93 95 95 83 75 76 83 85 60 NFAMALVGVDSK 3523 MVAELEELR 7.3 81 545.284 2 43.436 0 97 96 94 93 93 26 83 85 55 MVAELEELR 1503 LSFSADQVEDFQEA 11.3 81 793.3547 2 19.288 0.4 81 83 83 90 92 77 65 92 97 98 96 57 63 47 LSFSADQVEDFQEA 742 ASM(+15.99)GQLNVK 7.3 81 482.2497 2 11.049 0.6 51 51 87 93 83 94 85 93 85 ASM(+15.99)GQLNVK 856 KVETEENDLSK 8.9 81 646.3218 2 12.401 0.9 92 91 91 97 95 64 55 69 85 88 53 KVETEENDLSK 1303 TLLTSNPY 6.4 81 908.4722 1 17.193 0.1 47 47 91 90 91 88 98 89 TLLTSNPY 1519 LKDLVDKLNVR 8.9 81 656.9004 2 19.456 0.8 89 88 96 98 98 96 94 84 47 49 41 LKDLVDKLNVR 898 SAEELKCAA 7.2 80 461.2208 2 12.876 0.2 70 70 94 98 98 92 69 55 74 SAEELKCAA 3298 NFDAALVTAWK 8.8 80 618.3245 2 40.717 0.1 65 72 94 95 88 87 83 75 69 84 68 NFDAALVTAWK 1777 Y(+79.97)AWAELGEKLDNLKR 12.1 80 943.4656 2 22.228 1.6 27 27 77 97 97 98 95 94 95 97 97 86 78 81 52 Y(+79.97)AWAELGEKLDNLKR 1528 TLEDLGASELK 8.8 80 588.3118 2 19.564 0.7 85 88 95 93 70 58 69 93 84 86 57 TLEDLGASELK

PAGE 410

410 2289 EPGSLDVTTVAPW 10.4 80 686.3438 2 28.296 0.9 95 94 94 96 97 98 96 91 68 54 56 72 26 EPGSLDVTTVAPW 1798 FELQEI 4.8 80 778.398 1 22.458 0.1 93 92 85 62 89 58 FELQEI 1769 FCELHDLTEEYSNQL 12 80 920.9081 2 22.146 1.7 26 90 90 94 97 97 94 94 97 97 89 83 48 52 49 FCELHDLTEEYSNQL 3006 MVAEELELR 7.2 80 545.284 2 37.108 0 95 94 94 97 26 88 84 85 54 MVAEELELR 2649 HAPPPDVAGNVDYK 11.2 80 740.3629 2 32.762 2.8 26 26 98 98 98 98 95 94 92 79 91 78 81 62 HAPPPDVAGNVDYK 2206 LLTEGNEFGR 8 80 568.2911 2 27.255 0.6 89 91 91 91 65 51 68 89 91 69 LLTEGNEFGR 2525 FELQEL 4.8 80 778.3975 1 31.228 0.7 91 91 86 63 88 58 FELQEL 1116 AVNSADMLK 7.2 80 474.7447 2 15.21 0.3 59 58 85 96 94 91 85 88 59 AVNSADMLK 708 HVTS(+79.97)DLDCSF 8 80 602.2236 2 10.618 1 26 78 78 78 88 93 93 89 86 86 HVTS(+79.97)DLDCSF 1026 GVVDLESEVDNEKGV 12 80 794.8874 2 14.27 1.5 55 69 73 94 96 96 95 95 97 98 60 73 68 81 43 GVVDLESEVDNEKGV 1437 VKLELNPGSKGEVDR 12 80 820.9528 2 18.592 1.2 49 57 85 94 97 84 65 60 82 96 93 92 83 89 64 VKLELNPGSKGEVDR 3299 YNSEETLDHLEVNF 11.2 80 855.3893 2 40.727 3.5 65 59 64 93 93 92 93 93 93 95 92 61 61 57 YNSEETLDHLEVNF 2620 EPGSLDVTAPCGLL 11.2 80 686.3428 2 32.405 2.9 95 95 95 95 95 98 97 75 71 41 51 58 66 80 EPGSLDVTAPCGLL 2373 LQDVLDKL 6.4 80 472.2769 2 29.344 0.8 83 75 96 97 95 70 72 47 LQDVLDKL 3430 MDLTPF 4.8 80 723.3378 1 42.325 0.4 91 91 95 89 84 26 MDLTPF 2787 EFLQEL 4.8 80 778.3972 1 34.431 1.1 94 91 85 62 86 57 EFLQEL 3147 EPGSLDVTTVAPW 10.4 80 686.3431 2 38.846 0.2 95 95 94 96 97 98 96 96 80 50 51 55 26 EPGSLDVTTVAPW 1614 EALEELRAAL 8 80 557.8092 2 20.508 0.8 62 64 90 93 92 92 87 79 81 52 EALEELRAAL 3232 FGGDAGVLWVSK 9.6 80 618.3239 2 39.902 1 35 62 79 90 91 93 93 95 94 94 96 26 FGGDAGVLWVSK 845 KVAEQEI 5.6 80 408.7266 2 12.275 0.3 70 70 79 92 78 92 74 KVAEQEI 1493 FLAGMSLNGGEKDDL 11.9 80 783.8774 2 19.174 0.5 79 81 93 96 97 93 85 54 66 87 88 78 78 85 26 FLAGMSLNGGEKDDL 1357 SPEDKLSELK 8 80 573.3057 2 17.747 0.4 77 77 75 76 82 95 95 79 81 53 SPEDKLSELK 1213 LQDAEEQLEAVNSK 11.1 80 787.3899 2 16.237 1.3 38 37 88 95 97 91 63 90 97 97 96 79 92 47 LQDAEEQLEAVNSK 2622 MDLTPF 4.8 79 723.3375 1 32.423 0.9 90 90 93 88 86 26 MDLTPF 2962 MDLTPF 4.8 79 723.3378 1 36.571 0.5 90 91 94 89 84 26 MDLTPF 1731 EFLQEL 4.8 79 778.3977 1 21.751 0.5 93 90 86 61 88 55 EFLQEL 1331 LTFM(+15.99)GEKLK 7.1 79 541.7979 2 17.483 2.8 73 78 95 96 79 76 92 95 26 LTFM(+15.99)GEKLK 1883 CTGGALTLAGML 9.5 79 554.2791 2 23.395 2.4 57 64 88 90 90 93 94 95 91 61 52 72 CTGGALTLAGML 3009 NFAWLVGDVSK 8.7 79 412.552 3 37.152 0.1 84 92 85 75 88 87 85 80 80 85 26 NFAWLVGDVSK 1050 SQVADLTSV 7.1 79 919.4745 1 14.52 1.6 79 69 85 91 96 95 86 81 26 SQVADLTSV 2934 LLTEGNEFGR 7.9 79 568.2909 2 36.215 0.3 94 94 94 84 63 53 57 87 91 69 LLTEGNEFGR

PAGE 411

411 2463 FLAGMVTGNADKDDL 11.9 79 783.8761 2 30.468 1.2 73 75 90 94 97 95 94 83 68 88 90 65 65 78 26 FLAGMVTGNADKDDL 4142 EPGSLDVTFPPNV 10.3 79 686.3432 2 51.043 0.2 93 93 91 91 92 97 93 94 72 59 50 52 48 EPGSLDVTFPPNV 2095 EPGSLDVPFGPEK 10.3 79 686.3442 2 25.894 1.6 91 91 93 96 97 98 96 96 96 59 38 38 33 EPGSLDVPFGPEK 1429 TLEDQLSELK 7.9 79 588.3121 2 18.507 1.2 86 89 97 89 49 55 95 83 84 59 TLEDQLSELK 1845 YSLEHDLTEEDCK 10.3 79 791.3403 2 22.971 0.2 56 60 88 94 91 89 80 78 79 92 79 80 57 YSLEHDLTEEDCK 2603 LLTSSGTPM(+15.99)GR 8.7 79 568.2909 2 32.19 2.7 90 91 90 94 75 70 61 66 83 90 55 LLTSSGTPM(+15.99)GR 1689 YPELEGVSPAL 8.7 79 587.8019 2 21.317 2.1 97 97 97 93 88 71 69 66 80 80 26 YPELEGVSPAL 1491 MVAELEELRAA 8.7 79 616.3214 2 19.16 0.5 93 92 92 93 94 26 90 88 78 76 40 MVAELEELRAA 2497 FNFVDTLDTYDVNF 11.1 79 855.3883 2 30.879 0.1 84 82 82 92 92 93 94 89 79 73 81 54 54 52 FNFVDTLDTYDVNF 2824 FNDAGVLWVSK 8.7 79 618.3255 2 34.875 1.6 68 58 81 80 82 87 93 96 96 97 26 FNDAGVLWVSK 2338 LLTSSGTPM(+15.99)GR 8.7 79 568.291 2 28.905 2.5 91 93 93 97 67 63 57 67 85 93 57 LLTSSGTPM(+15.99)GR 953 KLLDPAETGSLKK 10.3 79 700.4106 2 13.472 1 90 90 98 97 91 75 71 86 71 67 73 86 26 KLLDPAETGSLKK 3198 LLTSSGTPM(+15.99)GR 8.7 79 568.2909 2 39.474 2.7 94 94 93 96 92 83 66 61 63 81 39 LLTSSGTPM(+15.99)GR 2284 FNGWVLADVSK 8.7 79 412.5521 3 28.231 0.1 44 68 86 86 96 92 86 87 95 95 26 FNGWVLADVSK 2515 MELDDLSCQTEAVSK 11.8 79 834.8767 2 31.103 0.4 54 53 84 94 95 94 94 81 61 72 72 76 71 83 89 MELDDLSCQTEAVSK 1668 LLAEEELVDASERRL 11.8 79 871.9685 2 21.096 0.9 72 75 74 81 98 97 97 98 97 95 93 89 51 27 27 LLAEEELVDASERRL 1569 KMNDLQEGLEAVSDLPVK 14.2 79 993.5114 2 20.01 2.9 80 77 83 96 94 82 91 92 98 96 94 94 93 76 64 34 34 28 KMNDLQEGLEAVSDLPVK 2819 LLGSLDVTM(+15.99)T(+79.97)LL 9.4 79 686.3445 2 34.813 1.6 96 96 95 96 98 98 95 86 85 38 26 30 LLGSLDVTM(+15.99)T(+79.97)LL 2715 GTFPPDVAGNVDYK 11 79 740.3596 2 33.562 0.3 30 29 53 98 98 97 95 94 93 78 89 82 87 71 GTFPPDVAGNVDYK 2212 M(+15.99)AESADKVEDFTNL 11 79 793.3551 2 27.326 1.3 94 91 87 86 88 88 88 93 97 93 89 34 35 30 M(+15.99)AESADKVEDFTNL 3736 NFWGVLDAVSK 8.6 79 412.5522 3 46.014 0.3 74 87 74 69 65 82 83 79 80 82 84 NFWGVLDAVSK 3408 LLTEGNEFGR 7.9 79 568.2908 2 42.051 0.2 94 94 94 88 56 50 60 90 88 66 LLTEGNEFGR 1096 NLELTVK 5.5 79 408.7446 2 14.997 0.8 26 97 97 94 84 86 62 NLELTVK 952 LYDQHAV 5.5 79 423.2108 2 13.463 0.9 93 93 96 79 66 66 54 LYDQHAV 2689 MDLTPF 4.7 78 723.338 1 33.244 0.3 91 90 94 87 80 26 MDLTPF 1807 DVDDVLKTGVDNPGHPF 13.3 78 912.941 2 22.55 0.7 33 39 49 78 87 97 98 97 95 93 94 89 87 83 86 92 26 DVDDVLKTGVDNPGHPF 2583 SAFPPDVAGGGVDYK 11.8 78 740.3602 2 31.947 1.2 32 32 61 98 98 97 94 90 86 73 81 92 83 85 68 SAFPPDVAGGGVDYK 941 MGESAGLHETA 8.6 78 551.7462 2 13.342 1.7 73 77 91 93 94 96 95 95 91 26 26 MGESAGLHETA 4007 FELQEL 4.7 78 778.3975 1 49.353 0.8 93 92 89 59 79 55 FELQEL 2505 LQTLVGAEL 7 78 472.2766 2 30.987 0 85 66 71 59 66 78 86 94 97 LQTLVGAEL 3605 LLTENGEFGR 7.8 78 568.2909 2 44.427 0.3 96 95 94 88 55 62 78 78 77 55 LLTENGEFGR

PAGE 412

412 1497 SALEEAEGTLEHEESK 12.5 78 879.9047 2 19.221 0.3 28 28 38 82 98 99 98 92 91 94 97 98 94 75 77 56 SALEEAEGTLEHEESK 876 ETEM(+15.99)ATNDESVAK 10.2 78 720.8118 2 12.629 0.3 70 75 91 91 90 56 52 77 87 85 74 74 88 ETEM(+15.99)ATNDESVAK 1539 LQEQVDDLEGSLEQEK 12.5 78 930.4474 2 19.689 0.3 46 44 45 71 96 98 98 98 98 97 96 96 96 58 64 42 LQEQVDDLEGSLEQEK 2068 MFELTGLLGAEK 9.4 78 654.8467 2 25.567 0.4 26 99 96 94 92 92 95 64 65 71 69 69 MFELTGLLGAEK 1403 TTAAPLTA 6.2 78 745.4099 1 18.238 1.1 87 90 90 81 63 58 69 82 TTAAPLTA 1612 MEEVDLSSACSEAVSK 12.5 78 842.8745 2 20.49 0.8 26 93 83 79 91 96 97 73 57 55 56 73 88 87 91 96 MEEVDLSSACSEAVSK 2985 FELQEI 4.7 78 778.3976 1 36.86 0.5 91 90 87 59 85 54 FELQEI 1443 LKDVLDQL 6.2 78 472.2768 2 18.658 0.5 90 87 92 94 96 52 58 52 LKDVLDQL 2979 SAFPPDVAGNVDYK 10.9 78 740.3597 2 36.786 0.5 28 28 50 98 98 95 95 94 91 79 92 84 85 69 SAFPPDVAGNVDYK 893 NTYETDALK 7 78 527.7556 2 12.816 1 47 46 91 95 95 91 84 87 60 NTYETDALK 2160 EPGSLDVTTVAPW 10.1 78 686.3436 2 26.677 0.6 90 89 89 94 97 97 93 89 65 54 58 66 26 EPGSLDVTTVAPW 1587 GTFPPDVAGNVDYK 10.9 78 740.3602 2 20.207 1.2 29 29 55 98 98 98 96 95 86 70 88 84 86 70 GTFPPDVAGNVDYK 2945 LLGSLVDTT(+79.97)PL 8.6 78 604.8123 2 36.355 0 95 95 93 93 95 26 94 72 67 79 42 LLGSLVDTT(+79.97)PL 2166 EGVDDDAKEAR 8.6 78 602.7753 2 26.751 0.5 72 73 73 94 91 72 72 82 79 81 62 EGVDDDAKEAR 1045 KQLEDSLVQVK 8.6 78 643.8699 2 14.465 0.9 54 41 79 87 89 90 97 94 76 76 68 KQLEDSLVQVK 2397 MEAGMVETLDKSQK 10.9 78 783.8765 2 29.643 2.9 76 77 90 94 98 97 89 86 90 90 54 49 44 49 MEAGMVETLDKSQK 3375 GTFPDPVAGNVDYK 10.9 78 740.3592 2 41.657 0.2 30 30 56 98 98 97 92 91 90 82 93 81 81 64 GTFPDPVAGNVDYK 1887 CTNGKVDSVGK 8.6 78 1107.547 1 23.444 0.8 80 79 75 94 87 85 79 73 54 69 75 CTNGKVDSVGK 1781 QVAEKELLDASERVGL 12.4 78 878.9752 2 22.274 0.3 62 80 89 91 94 96 98 99 98 98 95 46 46 46 61 36 QVAEKELLDASERVGL 1816 ESFLPMLK 6.2 78 482.7626 2 22.652 0.8 26 91 91 92 86 83 89 61 ESFLPMLK 910 ARETECVRLQSA 9.3 78 681.8434 2 13.013 0.1 72 78 92 96 94 71 58 65 88 50 69 95 ARETECVRLQSA 2017 NLEVTVK 5.4 78 401.7368 2 24.943 0.6 26 99 95 95 82 83 59 NLEVTVK 2487 EPGSLDVTTVAPW 10.1 78 686.343 2 30.767 0.3 94 94 94 96 96 98 96 89 46 42 57 76 26 EPGSLDVTTVAPW 826 SDYVGDEAQSK 8.5 78 599.7649 2 12.064 0.3 26 26 99 99 97 96 96 97 76 75 63 SDYVGDEAQSK 2285 EPGSLTLTFPF 8.5 78 604.8119 2 28.241 2.7 93 93 92 94 95 88 77 82 82 26 26 EPGSLTLTFPF 3666 MVAEELELR 7 78 545.285 2 45.164 1.8 95 94 94 98 26 82 77 78 49 MVAEELELR 3429 LQDLVDKL 6.2 78 472.2765 2 42.316 0.2 85 76 94 96 88 65 67 45 LQDLVDKL 3649 MDLTPF 4.6 77 723.3389 1 44.959 1 89 89 94 86 78 26 MDLTPF 2061 LLDGGSLGPSPL 9.3 77 563.3109 2 25.483 0.3 97 97 95 96 92 91 91 92 94 26 26 26 LLDGGSLGPSPL 1789 FSGDEEFPDLSHI 10.1 77 746.8342 2 22.355 1.6 62 61 80 84 96 98 98 92 90 92 95 26 26 FSGDEEFPDLSHI 1159 KKDLTELEDV 7.7 77 595.3195 2 15.665 0.6 87 72 70 70 63 67 83 88 89 81 KKDLTELEDV

PAGE 413

413 3868 LLTENGEFGR 7.7 77 568.2911 2 47.625 0.8 94 95 94 74 52 58 70 83 87 62 LLTENGEFGR 1693 LYVVPEPEV 7 77 1044.562 1 21.347 0.9 26 97 97 81 71 71 83 83 83 LYVVPEPEV 2920 FELQEI 4.6 77 778.3975 1 36.044 0.8 90 87 83 59 87 55 FELQEI 1203 QLESDLVQVK 7.7 77 579.8234 2 16.138 2.6 46 52 81 89 89 98 97 78 72 67 QLESDLVQVK 972 CPDLPGCKAAF 8.5 77 561.2607 2 13.664 2.3 26 97 96 96 73 62 78 94 97 99 26 CPDLPGCKAAF 3616 LLGSLDVTTSS(+79.97)AK 10.1 77 686.3433 2 44.555 2 94 95 94 94 95 95 93 94 89 48 38 38 32 LLGSLDVTTSS(+79.97)AK 991 NSWVAQVTCA 7.7 77 539.7527 2 13.863 0.2 52 55 71 96 96 70 85 80 80 83 NSWVAQVTCA 817 EERADLAETGA 8.5 77 581.2729 2 11.95 0.2 26 66 65 68 65 80 95 97 93 93 96 EERADLAETGA 3758 LQDLVDKL 6.2 77 472.2758 2 46.29 1.6 78 67 92 96 90 71 73 48 LQDLVDKL 3118 YGVGAGVLEGW 8.5 77 554.2772 2 38.48 0.3 26 35 86 88 81 81 89 95 94 95 76 YGVGAGVLEGW 3018 EPGSLDVTCPAGLL 10.8 77 686.343 2 37.251 2.6 92 92 94 96 98 98 97 78 67 55 57 34 56 61 EPGSLDVTCPAGLL 1353 ALEDQLSELK 7.7 77 1145.604 1 17.712 1.1 57 65 82 93 77 90 86 81 85 52 ALEDQLSELK 2686 LLGSLDVTGYGNY 10 77 686.3431 2 33.217 0.2 94 95 95 96 98 98 97 87 74 45 45 48 26 LLGSLDVTGYGNY 3540 LLTENGEFGR 7.7 77 568.2908 2 43.644 0.2 94 95 94 88 53 58 66 81 82 58 LLTENGEFGR 1341 YNQNENGNGGELK 10 77 718.8237 2 17.591 0 81 82 53 84 93 85 92 44 71 85 81 86 61 YNQNENGNGGELK 2766 KMELDDLSSNMEAVSK 12.4 77 898.9236 2 34.167 0.3 73 72 81 88 96 96 94 95 80 50 43 44 86 72 73 84 KMELDDLSSNMEAVSK 2421 EPGSLDVTSLAPW 10 77 686.3425 2 29.94 1.1 92 92 94 96 97 98 96 87 48 46 54 71 26 EPGSLDVTSLAPW 2703 LQDVLDLK 6.2 77 472.2765 2 33.419 0.1 83 71 94 96 91 65 68 47 LQDVLDLK 1770 ALEEAEGTLEHEESKLL 13.1 77 949.4729 2 22.154 0.2 30 30 50 89 94 95 87 88 94 96 96 94 85 83 77 80 34 ALEEAEGTLEHEESKLL 927 HANGPASSMKLMV 10 77 671.8331 2 13.198 1.3 95 94 87 94 93 92 92 79 48 48 54 77 42 HANGPASSMKLMV 3417 STEDRVGDRTK 8.5 77 632.3193 2 42.164 2.1 95 95 92 84 80 80 87 83 64 56 26 STEDRVGDRTK 1350 LDDLRKDL 6.2 77 494.2771 2 17.674 0.1 84 84 91 84 73 71 80 46 LDDLRKDL 2125 ASFPPDVAGNVDYK 10.8 77 740.3589 2 26.251 0.6 34 44 59 95 98 98 96 94 89 65 75 76 82 65 ASFPPDVAGNVDYK 1188 VEEVKLTSS(+79.97)ETA 9.2 77 686.8157 2 15.972 0.1 42 49 83 90 93 93 90 91 88 80 91 26 VEEVKLTSS(+79.97)ETA 2655 FELQEL 4.6 77 778.3987 1 32.838 0.9 94 91 87 56 78 53 FELQEL 2319 GTFPPDVAGGGVDYK 11.5 77 740.3592 2 28.667 0.2 29 29 54 98 98 97 94 93 84 63 77 90 84 87 70 GTFPPDVAGGGVDYK 828 STHPHFV 5.4 77 412.7062 2 12.081 0.3 95 95 96 99 99 26 26 STHPHFV 1207 DEKVDVVQVK 7.7 77 579.8234 2 16.169 2.6 59 57 78 90 90 95 96 72 65 61 DEKVDVVQVK 3316 EFLQEL 4.6 77 778.3973 1 40.934 0.9 91 89 86 58 81 53 EFLQEL 787 VGNEYVTK 6.1 77 909.4677 1 11.586 0.1 88 84 77 87 83 67 79 46 VGNEYVTK 3243 ASFPPDVAGGGVDYK 11.5 77 740.36 2 40.04 0.9 29 38 50 94 97 98 95 92 88 73 76 86 79 83 66 ASFPPDVAGGGVDYK

PAGE 414

414 1819 QLLGTLEEMRDEK 10 77 781.3983 2 22.679 0.2 46 58 81 93 93 95 96 95 87 61 61 62 63 QLLGTLEEMRDEK 1445 LQDLVDKL 6.1 77 943.5458 1 18.672 0.1 80 69 90 98 92 67 70 43 LQDLVDKL 1456 RSEVHGMVAA 7.7 77 528.7665 2 18.784 0.2 81 80 80 26 70 73 82 89 90 93 RSEVHGMVAA 2141 LLTEGNEFGR 7.7 77 568.291 2 26.453 0.4 90 90 91 91 57 46 49 89 89 70 LLTEGNEFGR 2316 EFLQEL 4.6 77 778.3979 1 28.624 0.2 95 91 86 56 77 51 EFLQEL 2470 LLTSSGTPM(+15.99)GR 8.4 77 568.2907 2 30.553 3 83 82 82 94 81 73 71 72 69 83 47 LLTSSGTPM(+15.99)GR 1978 KWFGLVGAEDSVK 10 77 718.3831 2 24.481 0.7 42 42 84 97 96 85 66 68 93 96 97 96 26 KWFGLVGAEDSVK 1228 LMTNL 3.8 77 591.3164 1 16.403 1.1 79 79 84 85 53 LMTNL 3297 LQDVLDKL 6.1 77 472.2765 2 40.709 0.1 86 80 96 97 92 56 59 42 LQDVLDKL 2187 GTFPPDVAGNVDYK 10.7 77 740.3595 2 27.018 0.2 39 37 62 98 98 97 93 89 83 67 85 77 79 62 GTFPPDVAGNVDYK 4088 LKDVLDQL 6.1 77 472.2764 2 50.37 0.4 86 83 91 93 92 53 58 54 LKDVLDQL 4076 LLGSLDVTTGST(+79.97)K 10 77 686.3428 2 50.221 1.2 95 95 94 96 97 98 96 89 61 51 43 44 31 LLGSLDVTTGST(+79.97)K 1666 KVAEQELVDASEGVRL 12.2 77 871.9685 2 21.08 0.9 88 86 91 96 86 97 98 98 98 96 87 68 37 32 30 29 KVAEQELVDASEGVRL 3749 LLGSLDVTTSGT(+79.97)K 9.9 77 686.3416 2 46.169 0.6 93 92 91 93 95 96 92 88 78 43 41 43 44 LLGSLDVTTSGT(+79.97)K 1750 LCM(+15.99)LLDLK 6.1 77 482.7637 2 21.946 0.4 81 85 85 94 52 74 84 53 LCM(+15.99)LLDLK 3421 RAHM(+15.99)LPVF 6.1 76 493.767 2 42.205 2.8 56 54 78 86 86 83 83 83 RAHM(+15.99)LPVF 3112 TGFPPDVAGNVDYK 10.7 76 740.3593 2 38.405 0 32 32 59 98 98 98 96 91 84 65 85 78 82 64 TGFPPDVAGNVDYK 1421 CLPTAPKGTYDDYVEVKV 13.8 76 999.4951 2 18.425 2.9 27 63 81 92 94 95 94 93 93 92 94 96 72 63 66 62 63 26 CLPTAPKGTYDDYVEVKV 1455 TRLSDLTEQLGETGGA 12.2 76 824.4112 2 18.776 1.9 53 61 88 94 95 97 96 96 82 95 95 93 54 46 43 26 TRLSDLTEQLGETGGA 1943 DFDKVLADWK 7.6 76 618.817 2 24.062 0.6 26 92 77 78 92 91 84 72 74 71 DFDKVLADWK 844 TQQVEELK 6.1 76 487.7612 2 12.267 0.1 54 42 60 96 97 93 94 71 TQQVEELK 1841 LHENETLDHQCGW 9.9 76 791.3408 2 22.921 0.5 98 98 96 85 91 93 93 84 59 46 53 64 26 LHENETLDHQCGW 1479 EFPPVVEEVGKK 9.1 76 679.372 2 19.03 0.5 96 96 96 99 26 93 89 71 65 71 80 26 EFPPVVEEVGKK 829 RSKYETDALQR 8.4 76 683.8574 2 12.088 0.2 90 89 91 92 74 76 75 71 68 55 51 RSKYETDALQR 1078 GTDKVEDFQEA 8.4 76 619.7814 2 14.822 1.7 49 64 79 92 96 98 98 90 59 50 56 GTDKVEDFQEA 2355 LLGSLDVTTGTS(+79.97)K 9.9 76 686.3425 2 29.12 0.8 95 96 94 95 97 98 97 93 77 44 35 35 28 LLGSLDVTTGTS(+79.97)K 1822 S(+79.97)VLLMVHEL 6.8 76 1120.552 1 22.719 3.9 26 26 97 92 92 85 85 85 92 S(+79.97)VLLMVHEL 1141 RDDLGAEKAAM(+15.99)VER 10.6 76 788.8925 2 15.474 2 42 42 57 86 72 72 92 92 97 93 92 72 75 72 RDDLGAEKAAM(+15.99)VER 1263 GELPDGKFLDNKK 9.9 76 730.8893 2 16.778 2 35 35 80 96 89 86 86 94 96 94 72 72 48 GELPDGKFLDNKK 3001 FLAGMVGNGDDKETL 11.4 76 783.877 2 37.044 0.1 75 77 92 95 97 96 95 76 73 88 90 49 46 51 31 FLAGMVGNGDDKETL 750 AEGAAM(+15.99)VER 6.8 76 475.2239 2 11.143 0.3 35 43 46 91 95 96 89 94 89 AEGAAM(+15.99)VER

PAGE 415

415 2370 MVAEELELR 6.8 76 545.2841 2 29.302 0.2 95 95 95 98 26 78 71 73 48 MVAEELELR 804 KLGASGGHGNV 8.3 76 498.7646 2 11.797 0.2 79 73 76 89 96 98 94 82 44 55 43 KLGASGGHGNV 1029 RASSYKPV 6.1 76 454.2535 2 14.31 0.3 26 94 94 91 87 90 92 26 RASSYKPV 2064 TPMVAENFI 6.8 76 1021.501 1 25.514 1.7 91 90 72 67 66 79 65 83 65 TPMVAENFI 2781 TGFPPDVAGGGVDYK 11.4 76 740.3597 2 34.356 0.5 29 29 53 98 98 96 92 91 83 63 75 89 82 85 67 TGFPPDVAGGGVDYK 1036 NLPDLSAHF 6.8 76 1013.507 1 14.386 1.8 47 61 71 89 99 94 94 95 26 NLPDLSAHF 3495 LQDVLDKL 6.1 76 472.2762 2 43.111 0.8 89 79 95 96 89 56 59 38 LQDVLDKL 2853 FELQEL 4.5 76 778.3971 1 35.22 1.3 93 87 86 56 76 53 FELQEL 960 M(+15.99)LTDVSVNQW 7.6 76 604.7834 2 13.544 1.8 78 79 90 89 83 82 81 53 56 61 M(+15.99)LTDVSVNQW 3807 NM(+15.99)SRVLADVSK 8.3 76 412.5518 3 46.88 0.2 57 65 79 91 92 92 74 73 87 90 26 NM(+15.99)SRVLADVSK 3587 MVAEADGKLGV 8.3 76 545.2841 2 44.213 0.2 97 96 95 96 73 45 48 49 71 72 84 MVAEADGKLGV 976 ASMGQLNVK 6.8 76 474.2523 2 13.714 0.5 72 77 94 92 37 41 78 95 90 ASMGQLNVK 3203 AM(+15.99)ESADQVEDFVTK 10.6 76 793.3572 2 39.536 1.3 67 73 71 76 76 82 65 89 95 98 96 58 70 35 AM(+15.99)ESADQVEDFVTK 864 ETELEESGAKKLAK 10.6 76 766.9132 2 12.485 1.7 39 46 57 90 98 94 92 86 86 91 88 70 72 44 ETELEESGAKKLAK 2272 LLTEAQTM(+15.99)GR 7.6 76 568.2908 2 28.08 2.9 94 94 94 92 63 42 57 69 87 60 LLTEAQTM(+15.99)GR 3166 FNDAGVLWVSK 8.3 76 618.3242 2 39.078 0.6 62 52 65 67 84 92 93 95 95 95 26 FNDAGVLWVSK 2071 WHVLYPPVVM(+15.99)LPKTK 11.3 76 912.517 2 25.598 1.5 26 26 98 98 98 98 99 86 86 85 88 83 64 65 26 WHVLYPPVVM(+15.99)LPKTK 1289 ARLLTENGEGF 8.3 76 603.8086 2 17.048 1.1 41 41 73 92 94 86 74 74 74 87 91 ARLLTENGEGF 1948 LGLTNWDDMEKL 9.1 75 717.8505 2 24.121 0.3 32 38 83 96 90 84 87 82 93 79 80 55 LGLTNWDDMEKL 1764 DTLDYKLPPF 7.5 75 604.8134 2 22.088 0.3 59 66 87 93 85 55 50 74 91 91 DTLDYKLPPF 2692 GFGDAGVLWVSK 9.1 75 618.3245 2 33.285 0 28 71 84 87 84 79 81 78 93 93 95 26 GFGDAGVLWVSK 1415 TGFMDYVEGLR 8.3 75 644.3052 2 18.365 0.4 46 47 64 71 92 94 98 97 81 84 49 TGFMDYVEGLR 1872 SELKKDLDDLELTLAK 12.1 75 916.0067 2 23.274 0.1 28 33 46 79 97 95 96 98 97 95 94 92 88 60 62 38 SELKKDLDDLELTLAK 1186 NEELEAM(+15.99)VK 6.8 75 539.7585 2 15.958 1.2 55 57 97 97 92 90 66 59 59 NEELEAM(+15.99)VK 2919 TAFGAGVLEGW 8.3 75 554.2771 2 36.034 0.1 26 79 82 80 73 62 71 91 93 93 73 TAFGAGVLEGW 2914 TGFPDPVAGNVDYK 10.6 75 740.3593 2 35.969 0.1 33 32 56 98 98 96 94 89 82 57 82 80 84 67 TGFPDPVAGNVDYK 1969 VLAGWFQTAGPA 9 75 609.3194 2 24.37 0.2 95 95 91 91 90 73 52 56 77 74 77 26 VLAGWFQTAGPA 2783 MTLLSAGGEV 7.5 75 977.4973 1 34.378 0.1 94 93 95 97 79 68 67 49 49 56 MTLLSAGGEV 3183 EFLQEL 4.5 75 778.3977 1 39.296 0.5 95 90 82 50 87 45 EFLQEL 1129 KSLEDETNLGAQLQK 11.3 75 837.4397 2 15.342 1.1 57 61 82 95 97 87 48 46 95 91 91 64 83 66 57 KSLEDETNLGAQLQK 3454 GDFGKVLEGW 7.5 75 554.2771 2 42.611 0.1 46 57 63 81 75 75 84 93 94 77 GDFGKVLEGW

PAGE 416

416 2653 RATEEMASQDESVAK 11.3 75 826.3818 2 32.804 1.7 38 46 63 78 89 93 93 94 75 91 81 78 64 63 76 RATEEMASQDESVAK 1103 EWLQEQAAFVER 9 75 753.3721 2 15.071 0.9 41 41 71 55 96 77 97 97 95 75 77 75 EWLQEQAAFVER 3117 FELQEI 4.5 75 778.3972 1 38.471 1.1 90 88 82 56 78 53 FELQEI 1463 FDTPDQMEDYGLW 9.8 75 808.8301 2 18.858 2.7 67 73 89 89 84 62 85 90 94 83 62 59 33 FDTPDQMEDYGLW 2127 FSLPML 4.5 75 707.3797 1 26.284 0.1 55 55 94 89 91 64 FSLPML 1926 MLKPVMPLK 6.7 75 528.819 2 23.865 0.1 90 90 93 96 98 90 41 46 27 MLKPVMPLK 1134 NSMQTVSSQFR 8.2 75 642.8038 2 15.401 0.3 50 51 61 66 95 96 99 96 63 82 61 NSMQTVSSQFR 1258 VFDKEGNGTMVGAELR 12 75 861.9272 2 16.718 0.4 57 62 56 64 95 98 91 92 84 61 61 72 85 79 82 56 VFDKEGNGTMVGAELR 1498 FLKTEGGNTVCADDL 11.2 75 791.8742 2 19.23 0.3 82 84 94 96 93 93 74 59 78 89 50 48 60 92 26 FLKTEGGNTVCADDL 1692 SFLPMLK 5.2 75 835.4752 1 21.339 0.7 54 54 91 91 84 87 60 SFLPMLK 2553 EPGSLDVTPCAGLL 10.5 75 686.3428 2 31.578 2.8 94 94 94 96 96 98 96 68 55 56 59 37 48 51 EPGSLDVTPCAGLL 1663 VVDTAPKGTYDDYVEGLRV 14.2 75 1049.03 2 21.041 1.3 68 69 60 69 90 96 95 92 91 87 85 94 93 91 92 58 29 29 27 VVDTAPKGTYDDYVEGLRV 2517 SAFPPDVAGNVDYK 10.5 75 740.3603 2 31.136 1.3 30 30 57 98 98 97 95 93 81 54 71 81 86 70 SAFPPDVAGNVDYK 3412 LLGSLDVTTT(+79.97)SGK 9.7 75 686.343 2 42.1 1.4 95 95 93 93 94 97 96 96 85 34 33 29 26 LLGSLDVTTT(+79.97)SGK 1348 LEGADVDQLEAV 9 75 629.8118 2 17.659 0.1 48 43 42 66 93 97 93 73 93 82 82 81 LEGADVDQLEAV 888 TLAAVSGGGDKPADAGAGK 14.2 75 821.9237 2 12.76 0.5 27 27 48 95 97 98 95 91 89 87 87 81 75 84 92 75 47 52 65 TLAAVSGGGDKPADAGAGK 2404 LLTEGNEFGR 7.5 75 568.2915 2 29.728 1.4 91 93 93 89 56 50 64 82 74 51 LLTEGNEFGR 949 EAEEQLEAVNSK 9 75 673.8257 2 13.424 0.7 26 26 94 91 74 94 97 94 93 73 88 42 EAEEQLEAVNSK 954 TLAAVSGNDKPADA 10.5 75 665.3357 2 13.481 0.3 31 30 56 96 97 98 97 82 90 90 86 80 81 26 TLAAVSGNDKPADA 2417 EPGSLDVAPNPL 9 75 604.8116 2 29.885 0.2 91 91 92 94 96 85 83 51 48 43 67 49 EPGSLDVAPNPL 3037 FNADGVLGSSLR 9 75 618.3239 2 37.483 2.2 86 75 90 93 93 92 82 71 67 49 55 36 FNADGVLGSSLR 2173 MVAEGSAGVLGV 9 75 545.2842 2 26.839 0.3 92 92 91 73 52 48 59 73 82 75 75 78 MVAEGSAGVLGV 3178 TGFPPDVAGNVDYK 10.4 75 740.3601 2 39.231 1.1 29 29 53 98 98 95 93 92 86 60 77 78 83 66 TGFPPDVAGNVDYK 2772 LKDVLDQI 6 75 472.2761 2 34.237 1 87 85 89 92 89 49 53 49 LKDVLDQI 1294 NAQGEQLDNLKR 8.9 75 693.3615 2 17.103 1.9 35 31 31 93 94 86 97 97 94 83 86 61 NAQGEQLDNLKR 2223 EPGSLDVPCTQLL 9.7 75 686.3433 2 27.469 2.2 94 94 93 95 97 99 95 73 59 58 33 46 28 EPGSLDVPCTQLL 2561 NFDKVLADWK 7.4 74 618.3241 2 31.669 0.7 62 66 87 88 92 88 68 59 64 65 NFDKVLADWK 2233 NLTEEMASGADESVAK 11.9 74 826.3777 2 27.584 0.1 42 42 75 95 89 85 86 93 85 80 84 77 70 54 54 72 NLTEEMASGADESVAK 3387 ATFQGVLEGW 7.4 74 554.2769 2 41.804 0.2 26 92 91 60 77 79 96 96 97 26 ATFQGVLEGW 1127 LTLDGANRDGLLSK 10.4 74 736.9078 2 15.326 1.2 27 48 88 90 60 52 63 86 93 84 86 94 94 68 LTLDGANRDGLLSK 1104 MALTEQLWTNA 8.2 74 639.3115 2 15.079 2.9 48 56 85 96 95 83 97 84 73 26 70 MALTEQLWTNA

PAGE 417

417 1677 MCTVVT(+79.97)VEAV 7.4 74 1131.484 1 21.195 1.2 89 86 87 94 26 26 79 78 86 88 MCTVVT(+79.97)VEAV 1985 MDSPLAALDPTEFER 11.2 74 846.4009 2 24.562 0.1 47 36 37 85 85 96 97 95 93 79 72 76 70 70 70 MDSPLAALDPTEFER 3046 GTFPPDVANGVDYK 10.4 74 740.3594 2 37.598 0.2 31 30 57 99 99 97 94 89 54 65 81 83 86 69 GTFPPDVANGVDYK 2549 LLGSLVDTT(+79.97)PL 8.2 74 604.8113 2 31.523 1.7 93 94 89 89 92 26 80 64 63 80 42 LLGSLVDTT(+79.97)PL 1409 LGLNSAPSFR 7.4 74 531.29 2 18.304 0.9 75 86 94 90 93 86 84 46 44 39 LGLNSAPSFR 2944 LATTTDLADASR 8.9 74 412.2143 3 36.345 0.8 79 77 80 67 67 65 73 84 86 77 79 51 LATTTDLADASR 1438 TLEDQLSELK 7.4 74 1175.617 1 18.601 0.9 81 81 86 89 75 92 64 55 70 44 TLEDQLSELK 4257 GEVDDSVQEAR 8.2 74 602.7754 2 52.518 0.3 74 74 74 92 86 70 69 68 73 78 52 GEVDDSVQEAR 1138 KKLESDLVRA 7.4 74 579.8453 2 15.448 0.5 26 82 78 76 81 83 91 75 80 64 KKLESDLVRA 1167 LTMFGEK 5.2 74 413.2117 2 15.753 1.6 93 93 98 26 72 80 54 LTMFGEK 1582 EPGSLDMGTLSSPI 10.4 74 702.3377 2 20.152 3 89 90 80 79 88 93 89 56 55 51 52 68 68 73 EPGSLDMGTLSSPI 3221 MVAEGSAGALLA 8.9 74 545.2843 2 39.762 0.6 96 96 89 80 61 56 59 69 81 80 59 59 MVAEGSAGALLA 3561 LQDLVDKL 5.9 74 472.2765 2 43.91 0.1 84 77 96 97 94 51 53 38 LQDLVDKL 2590 EFLQEL 4.4 74 778.3969 1 32.032 1.6 95 90 74 54 77 52 EFLQEL 2137 YPAGTETLVDLMAW 10.4 74 783.8776 2 26.398 1.9 90 92 83 84 90 90 80 69 75 92 74 41 37 33 YPAGTETLVDLMAW 3364 LKVLDDQI 5.9 74 472.2768 2 41.518 0.5 87 87 85 77 88 52 61 52 LKVLDDQI 2158 MLDLTPF 5.2 74 836.4225 1 26.659 0.4 77 75 78 90 85 84 26 MLDLTPF 4106 GTFPPDVAGNVDYK 10.4 74 740.3588 2 50.589 0.7 33 33 58 97 97 97 95 85 68 54 86 79 83 66 GTFPPDVAGNVDYK 1198 VDLLKNGV 5.9 74 857.5092 1 16.083 0.2 26 93 93 92 84 64 64 72 VDLLKNGV 1911 QAGLLGTLEM(+15.99)I 8.1 74 581.3127 2 23.706 0.2 48 48 57 70 94 88 88 92 87 90 46 QAGLLGTLEM(+15.99)I 1452 WSTMLPKL 5.9 74 488.271 2 18.738 1.6 78 78 76 81 83 73 76 43 WSTMLPKL 3273 KMGLSSLADASR 8.9 74 412.5515 3 40.412 1 26 69 65 70 80 92 86 86 89 80 81 55 KMGLSSLADASR 2892 QFTAGVLWADK 8.1 74 618.3242 2 35.689 0.6 47 49 62 76 85 87 93 92 78 78 61 QFTAGVLWADK 3737 LLTEEGNFGR 7.4 74 568.2909 2 46.025 0.3 93 93 93 95 65 54 51 76 67 46 LLTEEGNFGR 747 KQVETETEQLK 8.1 74 666.854 2 11.115 0.3 78 70 94 96 98 95 57 55 47 73 46 KQVETETEQLK 3379 STELQEAEGVPV 8.9 74 629.8118 2 41.7 0.2 79 85 83 77 67 92 70 46 57 68 77 77 STELQEAEGVPV 1219 KEASGPLNF 6.6 74 481.7504 2 16.302 0.6 40 40 85 90 84 72 71 87 90 KEASGPLNF 2863 MLKVCDPF 5.9 74 952.4637 1 35.329 0.7 93 91 68 51 47 69 83 83 MLKVCDPF 2537 LLTEGNEFGR 7.4 74 568.2904 2 31.374 0.5 89 90 90 90 58 49 63 72 80 51 LLTEGNEFGR 3714 EFLQEI 4.4 74 778.3984 1 45.747 0.5 85 79 77 58 85 56 EFLQEI 2617 ATFGAGVLEGW 8.1 74 554.2771 2 32.366 0.1 26 89 87 86 63 46 56 90 93 94 75 ATFGAGVLEGW

PAGE 418

4 18 741 NLGPAGGHDTAGAR 10.3 74 647.3182 2 11.039 0.1 51 50 83 74 60 67 95 93 82 81 88 66 62 73 NLGPAGGHDTAGAR 1698 LREPSLEL 5.9 74 478.7741 2 21.408 0.1 63 61 74 94 94 74 95 30 LREPSLEL 2070 QLGEVEDLMVDVERA 11 74 851.919 2 25.587 0.4 32 33 64 71 87 91 95 91 82 84 97 89 65 69 47 QLGEVEDLMVDVERA 957 TCGANERDTLL 8.1 74 596.7857 2 13.519 1.2 54 59 88 89 82 88 81 58 77 90 38 TCGANERDTLL 966 NLEVTVK 5.2 74 802.4663 1 13.609 0.7 26 99 98 98 74 70 47 NLEVTVK 4072 FELQEI 4.4 74 778.3967 1 50.169 1.8 94 92 88 50 69 46 FELQEI 3846 EFLQEI 4.4 74 778.3987 1 47.349 0.9 93 88 88 53 68 49 EFLQEI 3054 EFLQEL 4.4 74 778.3978 1 37.693 0.4 90 85 82 53 80 48 EFLQEL 1683 SFLPMLK 5.2 74 418.2411 2 21.259 0.3 85 85 96 67 63 64 52 SFLPMLK 1417 MTLVTAGGEV 7.4 74 977.4969 1 18.379 0.3 94 87 88 26 79 73 77 67 67 73 MTLVTAGGEV 2908 MELDPMSSSSAEAVSK 11.8 74 834.8757 2 35.895 0.8 46 45 73 81 83 89 97 98 58 57 55 80 70 64 82 89 MELDPMSSSSAEAVSK 3491 LLGSLTLPS(+79.97)DL 8.1 74 604.8127 2 43.055 0.6 92 92 92 93 93 87 84 91 26 26 26 LLGSLTLPS(+79.97)DL 771 TEAPLNPK 5.9 73 435.2397 2 11.4 0.7 91 92 96 84 85 84 26 26 TEAPLNPK 3132 FLAGMNGGTVEKDDL 11 73 783.8766 2 38.65 0.5 77 78 89 93 92 72 59 64 80 81 68 66 72 78 26 FLAGMNGGTVEKDDL 2645 AMLAGGASEAVL 8.8 73 545.2839 2 32.709 0.2 63 65 77 78 77 51 55 62 80 86 92 88 AMLAGGASEAVL 3401 CDESADKVEDFTVK 10.3 73 793.354 2 41.965 2.7 26 90 89 81 82 79 77 83 96 97 94 44 52 30 CDESADKVEDFTVK 2496 FGGDAGVLWVSK 8.8 73 618.3257 2 30.869 1.9 26 54 71 81 79 83 86 86 93 93 96 26 FGGDAGVLWVSK 3081 EPGSLDVTTNPNK 9.5 73 686.343 2 38.025 2.8 95 95 94 96 97 98 96 93 63 31 31 32 26 EPGSLDVTTNPNK 2694 SPNLMDF 5.1 73 823.3674 1 33.303 2.4 82 82 75 77 77 89 26 SPNLMDF 2737 LLTEEGNFGR 7.3 73 568.2922 2 33.825 2.7 91 90 91 94 66 62 50 68 69 47 LLTEEGNFGR 1163 DAQLHLDDAVR 8.1 73 626.8174 2 15.707 0.3 46 46 43 94 95 95 96 95 70 74 47 DAQLHLDDAVR 2514 KMELDDLSSNMEAVSK 11.7 73 898.9233 2 31.092 0.7 71 71 82 94 97 97 97 98 91 68 71 59 34 31 45 60 KMELDDLSSNMEAVSK 3774 GTFPPDVAGNVDYK 10.3 73 740.3593 2 46.471 0 30 30 55 97 97 95 93 78 75 60 84 77 83 65 GTFPPDVAGNVDYK 2682 TAFAGPPGFGSV 8.8 73 554.2774 2 33.167 0.7 26 26 94 85 81 76 62 50 90 94 95 95 TAFAGPPGFGSV 2848 GTFPPDVAGNVDYK 10.2 73 740.3593 2 35.157 0.1 34 33 61 98 98 97 93 91 76 45 55 80 87 71 GTFPPDVAGNVDYK 3249 EFLQEL 4.4 73 778.3964 1 40.113 2.1 95 91 87 48 73 43 EFLQEL 4187 WVDDADQEVK 7.3 73 602.7768 2 51.601 1.4 26 26 92 77 71 80 80 90 93 90 WVDDADQEVK 825 QEAECATSKQEAK 9.5 73 711.8286 2 12.056 2.1 48 56 59 90 89 85 85 78 68 52 83 85 68 QEAECATSKQEAK 1242 NQLADLM(+15.99)R 5.8 73 488.749 2 16.539 2.7 36 36 89 93 92 87 89 58 NQLADLM(+15.99)R 2595 MEAGMVTELDQSKK 10.2 73 783.8774 2 32.096 1.6 72 74 89 94 97 95 91 82 73 78 44 50 51 26 MEAGMVTELDQSKK 2393 FELQEI 4.4 73 778.3967 1 29.589 1.7 93 89 80 51 78 44 FELQEI

PAGE 419

419 1246 QANDKSLELKAK 8.8 73 672.8777 2 16.584 0.1 51 44 43 93 94 68 64 92 95 89 90 47 QANDKSLELKAK 2458 EFLQEL 4.4 73 778.3976 1 30.404 0.5 91 82 78 53 82 49 EFLQEL 2128 EFLEQLL 5.1 73 891.4829 1 26.293 0.8 95 95 91 84 52 63 26 EFLEQLL 2347 ECAKEATLL 6.6 73 977.497 1 29.011 0.2 70 75 75 69 64 63 64 80 94 ECAKEATLL 1111 QQNLESEVDNEK 8.8 73 716.8315 2 15.156 0.5 42 41 43 61 90 91 92 97 96 72 84 61 QQNLESEVDNEK 1269 LQGEVEDI 5.8 73 902.4459 1 16.842 0.7 81 68 73 71 76 89 95 26 LQGEVEDI 1405 YFSTVDDLEGSLEKEKK 12.4 73 994.496 2 18.255 0.5 46 35 35 71 96 99 98 97 93 88 84 83 78 61 57 65 47 YFSTVDDLEGSLEKEKK 1800 HLELVDNPANTLGNER 11.7 73 896.4512 2 22.476 1.8 90 87 87 96 71 70 66 45 45 51 84 92 89 62 76 48 HLELVDNPANTLGNER 3432 NFAWLVGATEK 8 73 618.3238 2 42.346 1.2 75 83 96 97 94 91 85 71 37 35 32 NFAWLVGATEK 3033 LKDVLDQI 5.8 73 472.276 2 37.439 1.1 85 79 83 87 90 49 56 49 LKDVLDQI 4090 GFGDAGVLWVSK 8.7 73 618.3247 2 50.39 0.3 35 71 83 72 69 76 79 78 92 92 93 26 GFGDAGVLWVSK 682 ETNSVCTR 5.8 73 909.4067 1 10.296 3 26 96 87 91 83 68 87 40 ETNSVCTR 2451 ASFPPDVANGVDYK 10.2 73 740.3591 2 30.315 0.2 38 48 76 97 98 98 95 79 45 52 65 77 82 63 ASFPPDVANGVDYK 3366 AELGEQLDNLQR 8.7 73 693.3555 2 41.538 1.3 45 51 77 70 71 74 93 96 78 87 66 58 AELGEQLDNLQR 3276 EPGSLVDPAPNL 8.7 73 604.8112 2 40.442 0.5 92 92 91 92 94 26 90 81 71 40 38 60 EPGSLVDPAPNL 2637 LKDVVGAEL 6.5 73 472.2768 2 32.614 0.5 87 82 82 72 46 49 60 83 88 LKDVVGAEL 2151 ESFLPML 5.1 73 836.4218 1 26.579 0.6 26 80 80 96 84 85 54 ESFLPML 859 KS(+79.97)VETDALKGV 8 73 613.8036 2 12.427 2.3 45 45 45 96 96 95 94 92 61 61 66 KS(+79.97)VETDALKGV 2320 NLFESFLPMLK 8 73 669.8599 2 28.678 0.1 63 73 91 69 67 84 97 79 64 65 40 NLFESFLPMLK 1936 AGLLGTLENKCA 8.7 73 1189.625 1 23.98 0.2 72 72 88 86 81 82 86 83 57 54 65 38 AGLLGTLENKCA 3629 LKDVLDQL 5.8 73 472.2764 2 44.714 0.4 75 73 93 95 90 48 54 48 LKDVLDQL 2322 QVTEEMASQDESVAK 10.9 73 826.3771 2 28.698 0.7 31 32 60 91 97 96 96 93 71 86 77 70 61 55 63 QVTEEMASQDESVAK 2681 EPGSLTLTFPF 8 73 604.8117 2 33.155 3 93 92 90 90 92 90 69 64 61 26 26 EPGSLTLTFPF 1548 TLDDLQAEEDKVNTLTK 12.3 72 966.9911 2 19.784 0.5 36 36 49 85 87 73 96 97 94 67 65 81 72 83 78 79 45 TLDDLQAEEDKVNTLTK 969 KLEEQEAL 5.8 72 480.2559 2 13.643 0.1 76 75 91 91 58 67 74 44 KLEEQEAL 3099 LQVDLDKL 5.8 72 472.2767 2 38.245 0.4 85 74 83 70 86 66 69 43 LQVDLDKL 2933 MFQLVASNADTGAEL 10.9 72 783.8763 2 36.204 0.9 26 80 68 88 92 62 56 49 59 83 91 83 76 82 83 MFQLVASNADTGAEL 737 HHPAGGATSAGA 8.7 72 517.2436 2 10.983 0.9 38 38 58 89 94 88 91 93 85 80 85 26 HHPAGGATSAGA 1023 MPVSPTSEVDNEKR 10.1 72 530.2606 3 14.246 2.3 62 62 62 85 78 78 82 88 97 97 69 51 51 42 MPVSPTSEVDNEKR 4131 EPTSSGVVFGR 8 72 568.2902 2 50.9 0.9 26 96 96 96 67 57 57 58 86 85 65 EPTSSGVVFGR 3854 EPGSLDVPAPQV 8.7 72 604.8106 2 47.458 1.4 92 92 91 92 93 26 81 81 70 58 42 44 EPGSLDVPAPQV

PAGE 420

420 1521 FGTPPDVANGVDYK 10.1 72 740.3599 2 19.485 0.8 31 40 45 93 98 96 92 81 49 59 76 84 89 73 FGTPPDVANGVDYK 2999 LLTEEGNFGR 7.2 72 568.2911 2 37.023 0.6 91 91 90 92 74 64 52 62 61 40 LLTEEGNFGR 3209 LLGSLPLTS(+79.97)DL 8 72 604.8113 2 39.614 1.6 95 95 93 94 96 70 64 61 70 26 26 LLGSLPLTS(+79.97)DL 2759 SPNLMDF 5.1 72 823.3686 1 34.086 3.9 79 78 71 80 80 89 26 SPNLMDF 3478 EPGSLDVPM(+15.99)GQLL 9.4 72 686.3429 2 42.901 2.8 91 91 91 94 96 98 97 72 34 34 39 64 29 EPGSLDVPM(+15.99)GQLL 1276 MAVFGGVTVW 7.2 72 533.7745 2 16.913 2.5 97 95 95 84 70 83 70 71 26 26 MAVFGGVTVW 1135 QYGQTVSSQM(+15.99)R 7.9 72 650.8011 2 15.41 0.1 32 32 34 42 92 95 99 96 92 95 79 QYGQTVSSQM(+15.99)R 3510 SPNLMDF 5.1 72 823.3675 1 43.282 2.5 77 77 77 86 77 82 26 SPNLMDF 2511 FEPVPVELDGKK 8.7 72 679.3719 2 31.06 0.4 96 96 96 97 82 78 71 62 50 50 55 26 FEPVPVELDGKK 4042 EPGSLVDPGQPL 8.7 72 604.8116 2 49.791 0.2 93 93 93 95 96 26 81 53 53 40 59 78 EPGSLVDPGQPL 1060 CPERSRKY 5.8 72 519.762 2 14.636 1.8 26 26 88 79 79 91 96 88 CPERSRKY 1085 EVGLSKDDLR 7.2 72 566.3043 2 14.887 0.9 31 33 55 72 91 90 90 89 93 72 EVGLSKDDLR 1005 AAEDLKEAGACV 8.7 72 588.7828 2 14.037 1.7 66 71 73 93 95 71 56 51 62 83 69 70 AAEDLKEAGACV 1120 WAGEALEEGSLK 8.6 72 645.3225 2 15.256 0.5 34 39 53 62 89 84 88 95 89 83 68 75 WAGEALEEGSLK 3309 FASPPDVAGNVDYK 10.1 72 740.3597 2 40.852 0.5 36 41 41 93 26 95 93 92 90 70 86 84 86 69 FASPPDVAGNVDYK 1792 SYELPDGGAVLTLGNER 12.2 72 895.9497 2 22.393 0.2 51 50 71 80 95 93 85 43 39 57 96 98 97 91 56 70 43 SYELPDGGAVLTLGNER 967 M(+15.99)AEVVAGTA 6.5 72 864.4125 1 13.616 0.8 71 71 61 74 91 83 80 86 26 M(+15.99)AEVVAGTA 1642 YNSKVMNDHLECTR 10.1 72 855.3888 2 20.822 1.8 79 65 75 73 52 52 70 80 87 87 90 75 76 41 YNSKVMNDHLECTR 2872 FAESADKVEDFEQA 10.1 72 793.3536 2 35.443 1 26 84 83 83 91 92 91 93 97 99 26 42 50 42 FAESADKVEDFEQA 2615 LLGSLLTPS(+79.97)DI 7.9 72 604.8118 2 32.344 0.8 95 94 92 93 96 87 76 75 26 26 26 LLGSLLTPS(+79.97)DI 814 LAGGANPTNKEVR 9.3 72 663.86 2 11.923 0.4 37 36 47 49 64 86 89 79 73 88 88 96 96 LAGGANPTNKEVR 1367 EYEGQAELEGSLKEA 10.8 72 826.8868 2 17.859 1 26 90 69 91 79 95 95 93 91 82 77 76 36 36 33 EYEGQAELEGSLKEA 1054 WVDDSVQEAGVNAEEK 11.5 72 888.4102 2 14.566 2.7 26 26 95 93 87 87 76 93 92 70 66 48 60 79 81 61 WVDDSVQEAGVNAEEK 3441 ASFPPDVAGVNDYK 10.1 72 740.3611 2 42.459 2.4 30 41 59 96 99 98 95 91 76 58 55 68 73 59 ASFPPDVAGVNDYK 1366 GM(+15.99)PVPAPMVA 7.2 72 985.486 1 17.851 1.5 70 70 70 69 69 63 65 73 81 83 GM(+15.99)PVPAPMVA 3630 LLGSLTLPS(+79.97)DI 7.9 72 604.8114 2 44.723 1.5 94 95 93 94 95 80 71 82 26 26 26 LLGSLTLPS(+79.97)DI 937 LAEKDEEMEQLKR 9.3 72 809.9099 2 13.293 1.2 67 59 63 81 96 99 26 97 96 61 70 63 49 LAEKDEEMEQLKR 1630 LTRQVDDLEGSLEQEQKL 12.9 72 1051.041 2 20.689 1.5 54 39 39 50 93 98 98 97 96 93 91 91 88 61 83 35 44 31 LTRQVDDLEGSLEQEQKL 3333 AM(+15.99)ESADKVEDFEAK 10 72 793.3539 2 41.144 2.8 71 76 76 85 89 92 91 93 97 99 26 35 38 31 AM(+15.99)ESADKVEDFEAK 2791 MVAEGAGGTLLA 8.6 72 545.2841 2 34.472 0.1 94 93 93 92 80 77 49 51 56 79 45 46 MVAEGAGGTLLA 1623 QQADSVAELEGQLQTLQR 12.9 72 1007.514 2 20.613 0.2 52 52 83 94 99 98 97 98 97 73 73 73 91 36 37 46 49 34 QQADSVAELEGQLQTLQR

PAGE 421

421 2482 FNWGVLDAVSK 7.9 72 412.552 3 30.702 0.2 42 57 57 76 76 86 85 77 73 73 79 FNWGVLDAVSK 2677 MELDVESSCAAEAVSK 11.5 72 834.8765 2 33.101 0.1 51 50 72 68 68 79 92 80 63 63 66 70 70 69 86 89 MELDVESSCAAEAVSK 2439 LQDVLDKL 5.7 72 472.2761 2 30.164 1 71 59 90 94 90 60 62 43 LQDVLDKL 607 MQGQEDENGSHV 8.6 72 665.7697 2 9.31 0.6 39 34 69 56 88 96 89 67 76 75 82 82 MQGQEDENGSHV 1216 NQTALAQSTPF 7.9 72 589.2955 2 16.276 0.7 46 44 62 64 85 96 75 90 96 98 26 NQTALAQSTPF 2028 NKLLEKWVNF 7.2 72 645.8656 2 25.076 2.7 72 71 95 98 96 93 43 36 46 60 NKLLEKWVNF 3798 FNELVKGDW 6.4 72 554.2767 2 46.764 0.6 70 60 85 93 77 67 70 92 26 FNELVKGDW 1590 EPGSLECALPDVGV 10 72 693.3334 2 20.232 1.4 93 94 94 95 96 97 87 86 69 61 38 28 28 28 EPGSLECALPDVGV 1714 SATNDLQEGLEAVSPAQK 12.9 71 929.4631 2 21.581 0.1 27 30 33 62 88 91 84 94 95 98 96 92 92 88 66 50 51 40 SATNDLQEGLEAVSPAQK 1157 TDLAAALAK 6.4 71 873.5042 1 15.652 0.2 61 63 83 88 96 95 75 50 26 TDLAAALAK 3355 SPNLMDF 5 71 823.3678 1 41.403 2.9 81 81 75 72 72 89 26 SPNLMDF 1924 CTGTKAGPVFDV 8.6 71 1194.58 1 23.846 2 52 58 87 91 69 45 53 82 85 78 77 71 CTGTKAGPVFDV 4188 LTEADGGFGR 7.1 71 511.7481 2 51.612 1.1 66 68 87 56 46 74 73 83 88 68 LTEADGGFGR 1852 LKMPVCGVPKL 7.8 71 592.848 2 23.046 0.5 67 71 93 97 92 71 66 55 64 63 42 LKMPVCGVPKL 4077 WNGFVLADVSK 7.8 71 412.5519 3 50.232 0.5 45 44 57 79 91 84 79 88 93 93 26 WNGFVLADVSK 1247 EWTEKLGETGKSHL 10 71 807.908 2 16.593 2.1 37 37 65 63 87 88 92 94 88 80 77 77 80 26 EWTEKLGETGKSHL 862 KVQHELEEAEER 8.6 71 748.872 2 12.467 2 65 77 61 97 99 99 26 26 26 95 95 82 KVQHELEEAEER 2793 MEAGTEVELSLMTR 10 71 783.8776 2 34.505 1.5 78 78 82 86 95 92 82 68 64 61 61 60 57 26 MEAGTEVELSLMTR 2146 LLGSLVDTT(+79.97)PL 7.8 71 604.8116 2 26.515 1.1 91 87 79 80 92 26 86 71 65 65 36 LLGSLVDTT(+79.97)PL 1000 LVDSMAGA 5.7 71 763.3674 1 13.976 2.6 26 93 93 93 87 74 75 26 LVDSMAGA 2868 LLTEEGGGFGR 7.8 71 568.2914 2 35.392 1.2 93 93 93 95 78 69 48 32 51 75 51 LLTEEGGGFGR 1704 LVNASVLPDGQFLDNK 11.4 71 865.4595 2 21.468 0.1 34 34 34 87 95 99 98 89 73 46 42 87 88 86 72 67 LVNASVLPDGQFLDNK 3976 LLGSLSGGDFGSV 9.3 71 604.8106 2 48.973 1.4 91 93 88 90 94 91 69 48 54 64 46 46 46 LLGSLSGGDFGSV 1899 NSAMKGVGDSKVAF 10 71 705.8542 2 23.577 2.4 44 45 51 55 54 65 82 83 82 83 83 85 89 87 NSAMKGVGDSKVAF 816 TQQVEELKR 6.4 71 565.812 2 11.94 0.3 44 36 51 97 98 95 93 94 26 TQQVEELKR 1458 MADLEKEEA 6.4 71 1035.469 1 18.8 2.6 95 86 85 78 74 62 62 68 26 MADLEKEEA 1895 MPNAALAPASLWVK 10 71 734.9036 2 23.525 1.2 96 96 91 98 98 94 84 69 52 46 54 38 39 33 MPNAALAPASLWVK 1091 AYGEAAL 5 71 694.3408 1 14.947 0.3 39 63 68 77 74 85 89 AYGEAAL 1339 TLLTTNPY 5.7 71 922.4863 1 17.562 1.9 41 41 84 95 94 94 26 88 TLLTTNPY 3840 FTGPDPVAGNVDYK 9.9 71 740.3601 2 47.279 1.1 34 45 60 93 95 90 89 80 77 55 61 62 82 63 FTGPDPVAGNVDYK 3397 FVDKDANGTVMGAEL 10.7 71 783.879 2 41.915 2.6 63 62 61 65 68 45 39 47 85 90 94 87 79 85 87 FVDKDANGTVMGAEL

PAGE 422

422 940 LTENWNVF 5.7 71 1022.492 1 13.333 1.9 80 83 92 89 79 54 60 26 LTENWNVF 1633 GKKNSNPKGTLDDYVEGLR 13.5 71 1046.043 2 20.72 2.1 26 46 64 77 89 44 51 90 95 92 90 92 97 85 81 88 45 55 31 GKKNSNPKGTLDDYVEGLR 769 AEDLDAAQAAF 7.8 71 561.2606 2 11.368 2.6 26 94 93 93 53 51 64 79 96 99 26 AEDLDAAQAAF 1980 LKDVLDQI 5.7 71 472.2769 2 24.499 0.6 86 82 86 89 91 42 47 42 LKDVLDQI 724 CRGQEDESMCR 7.8 71 657.2557 2 10.822 0.7 80 83 83 67 94 95 77 77 67 26 26 CRGQEDESMCR 3505 FNDKVLADWK 7.1 71 618.3245 2 43.219 0.1 77 61 74 58 61 87 85 67 68 66 FNDKVLADWK 1291 QEM(+15.99)EEEAGEAKAELK 10.6 71 854.3885 2 17.064 2.6 51 60 51 26 26 89 82 81 88 95 89 87 83 88 60 QEM(+15.99)EEEAGEAKAELK 709 LFS(+79.97)GPM(+15.99)GK 5.7 71 466.7003 2 10.629 1.4 26 91 91 94 82 61 71 45 LFS(+79.97)GPM(+15.99)GK 1011 LLDPEATTRKK 7.8 71 636.3683 2 14.104 1.8 97 97 96 98 88 66 65 69 47 26 26 LLDPEATTRKK 3383 FELQEI 4.3 71 778.3974 1 41.752 0.9 85 82 81 50 79 45 FELQEI 4065 LLTEGNEFGR 7.1 71 568.2906 2 50.083 0.1 91 93 92 92 63 41 45 74 68 45 LLTEGNEFGR 1771 EVVMKPPF 5.7 71 473.7571 2 22.165 0.5 26 77 68 74 84 85 76 71 EVVMKPPF 799 DVDLAESA 5.7 71 819.3729 1 11.734 0.1 26 26 93 86 82 78 81 90 DVDLAESA 993 DASERVGL 5.7 71 846.4334 1 13.895 2.2 93 77 75 90 76 62 54 36 DASERVGL 1122 LGNSAGGFNK 7.1 71 482.7478 2 15.274 3.9 61 61 79 96 97 95 68 48 49 50 LGNSAGGFNK 1121 SLDDKEELDATW 8.5 71 711.3265 2 15.264 2 38 38 70 49 47 49 84 96 96 95 96 85 SLDDKEELDATW 1572 LEELEEELEAERAA 9.9 71 815.8943 2 20.039 0.5 37 37 60 77 79 90 26 97 96 96 94 80 76 35 LEELEEELEAERAA 590 RHSHTAHY(+79.97)SW 7.1 71 681.2818 2 9.069 2.2 26 72 77 76 70 74 90 95 95 26 RHSHTAHY(+79.97)SW 1533 MPAVLSGGTMTYPGLADR 12.7 71 918.9529 2 19.623 0.2 28 31 40 56 95 97 96 92 88 72 77 96 91 69 64 64 65 42 MPAVLSGGTMTYPGLADR 1025 FGMMSAHAA 6.4 71 922.3882 1 14.262 3 67 70 88 94 84 84 91 26 26 FGMMSAHAA 3956 LKVLDDQL 5.7 71 472.2757 2 48.725 1.7 86 86 84 77 85 45 53 45 LKVLDDQL 797 AEETTYEF 5.7 71 495.2083 2 11.712 0.4 26 88 85 85 83 81 87 26 AEETTYEF 1739 LLVGTGAAVDSPTAAK 11.3 71 735.9135 2 21.822 2.5 90 90 82 79 68 68 79 81 78 83 83 90 50 32 31 37 LLVGTGAAVDSPTAAK 2412 MTAGASLVEV 7.1 71 977.4979 1 29.821 0.7 96 96 95 86 81 83 52 43 43 26 MTAGASLVEV 1055 ALLGSPSDDDFLCPR 10.6 71 803.3845 2 14.577 2.4 31 48 72 90 94 98 97 93 99 94 86 59 32 33 26 ALLGSPSDDDFLCPR 2661 LFAGMVETGNGKDEV 10.6 70 783.877 2 32.909 0.1 61 67 93 96 97 96 83 74 74 59 65 65 43 48 30 LFAGMVETGNGKDEV 3574 FEPPFAKHRTK 7.8 70 679.371 2 44.064 2 95 95 91 90 77 77 88 57 33 40 26 FEPPFAKHRTK 1725 GTYDDYVEGLRV 8.5 70 693.8304 2 21.694 0 29 40 43 81 92 97 97 93 86 64 71 48 GTYDDYVEGLRV 2869 FVDAGGSGGTVVMGAEL 12 70 783.8773 2 35.402 0.3 66 72 69 43 41 48 50 63 68 80 87 97 95 81 66 80 81 FVDAGGSGGTVVMGAEL 970 AEDLGAEKAMA 7.7 70 553.2633 2 13.649 0.1 26 97 96 95 57 39 40 69 90 92 70 AEDLGAEKAMA 4006 FNELVGKDW 6.3 70 554.277 2 49.343 0.1 70 62 91 93 57 43 46 90 76 FNELVGKDW

PAGE 423

423 1125 NLAEKELL 5.6 70 465.2694 2 15.312 1.4 34 34 77 91 91 92 96 43 NLAEKELL 1865 EPLGSLDVPAPNLY 9.8 70 742.8859 2 23.201 1 26 96 94 94 95 96 98 98 98 42 40 33 36 31 EPLGSLDVPAPNLY 1336 VQLELNQLK 6.3 70 542.8206 2 17.538 1.9 45 42 96 97 97 87 59 63 42 VQLELNQLK 1553 ELLSEGTLEHEESQLL 11.2 70 913.9543 2 19.84 0.3 27 30 40 59 88 81 82 93 96 97 93 87 84 53 78 30 ELLSEGTLEHEESQLL 1489 ECVAVDDLSSDMKAVSK 11.9 70 898.925 2 19.13 1.2 82 81 80 76 79 95 98 96 95 51 39 40 41 74 51 51 56 ECVAVDDLSSDMKAVSK 1419 ASSEAEDLRHQPI 9.1 70 726.8582 2 18.408 0.9 27 41 57 94 97 96 95 93 90 65 38 69 46 ASSEAEDLRHQPI 3552 CS(+79.97)GLGTSL 5.6 70 409.1621 2 43.789 1 26 92 91 92 77 54 52 73 CS(+79.97)GLGTSL 3165 LKDVLDQL 5.6 70 472.2763 2 39.068 0.6 85 80 86 89 93 39 47 39 LKDVLDQL 1218 QAFTQQVEELQGV 9.1 70 738.8694 2 16.293 0.9 54 68 75 89 74 59 81 84 90 85 44 50 52 QAFTQQVEELQGV 2331 LFAGMVGATNDKDEV 10.5 70 783.8773 2 28.82 0.3 59 65 91 95 97 96 89 74 63 61 66 65 46 50 29 LFAGMVGATNDKDEV 3696 EPGSLASTGYKV 8.4 70 604.8109 2 45.528 0.9 90 90 89 91 90 65 59 87 71 40 35 29 EPGSLASTGYKV 2037 ELLKPPLALPL 7.7 70 602.39 2 25.193 1.5 40 40 73 57 59 74 75 80 85 87 96 ELLKPPLALPL 837 QVETEQTELK 7 70 602.8065 2 12.191 0 63 62 94 92 90 61 61 56 73 45 QVETEQTELK 2081 NLEVTVK 4.9 70 401.7368 2 25.724 0.5 26 99 93 93 66 64 46 NLEVTVK 2425 MELDDLSSNMEAVSK 10.5 70 834.875 2 29.982 1.7 47 47 73 84 95 95 96 56 45 57 63 61 60 79 86 MELDDLSSNMEAVSK 2279 MMQSFLDLLVK 7.7 70 662.8528 2 28.166 1.6 76 75 72 67 70 85 71 71 65 67 46 MMQSFLDLLVK 2100 DPALVELLK 6.3 70 997.5925 1 25.958 0.2 26 78 83 88 98 96 65 57 34 DPALVELLK 1174 QDLGKML 4.9 70 402.7172 2 15.829 1.4 26 93 93 94 71 65 44 QDLGKML 1635 ALEDGALSEL 7 70 1017.511 1 20.752 1.3 42 46 63 81 75 71 81 80 84 72 ALEDGALSEL 3461 MEAGMVGATTKKDEV 10.5 70 783.8769 2 42.695 2.3 73 69 86 90 97 96 88 84 81 56 65 52 36 39 28 MEAGMVGATTKKDEV 2356 SPNLMDF 4.9 70 823.3681 1 29.13 3.3 70 68 69 82 81 90 26 SPNLMDF 1177 WLPDGAGFLDNKKALCK 11.9 70 938.4928 2 15.855 0.1 82 88 72 69 57 48 64 88 94 94 71 79 90 68 42 43 31 WLPDGAGFLDNKKALCK 1863 M(+15.99)S(+79.97)SVAELWQLATGLK 10.5 70 865.4169 2 23.179 2 26 74 76 76 81 90 94 78 54 68 68 56 55 61 83 M(+15.99)S(+79.97)SVAELWQLATGLK 2307 LQDVLDLK 5.6 70 472.2764 2 28.52 0.3 80 67 91 92 80 50 54 41 LQDVLDLK 981 EADVGGYSK 6.3 70 463.2167 2 13.763 0.1 26 98 98 95 89 83 42 56 34 EADVGGYSK 2712 MVANRSGAQR 7 70 545.2838 2 33.519 2.1 97 97 85 74 84 76 45 42 41 51 MVANRSGAQR 1711 FGGTAAAEPTGGF 9.1 70 1182.543 1 21.54 0.5 29 67 82 88 75 67 65 77 75 64 62 70 79 FGGTAAAEPTGGF 3141 CRGSTVLADVSK 8.4 70 412.5522 3 38.769 0.7 37 42 57 63 70 81 89 87 90 95 95 26 CRGSTVLADVSK 1638 TMKAVSVHPTLENEM(+15.99)Y 11.1 70 933.4431 2 20.774 0.9 56 56 77 88 85 86 86 62 75 78 88 65 50 60 68 26 TMKAVSVHPTLENEM(+15.99)Y 2429 GFGAEGLVGAVMK 9.1 70 618.3248 2 30.037 2.4 30 65 85 93 65 61 84 81 82 76 63 73 42 GFGAEGLVGAVMK 1649 NYAGGAEELRSELYYR 11.1 70 945.9506 2 20.896 2.1 48 51 81 89 95 97 99 94 88 75 60 61 75 30 31 30 NYAGGAEELRSELYYR

PAGE 424

424 2931 ESFLPMLK 5.6 70 482.7622 2 36.184 0.1 26 77 77 92 83 76 77 46 ESFLPMLK 3699 YPEDAQPGKGCR 8.4 70 660.8039 2 45.572 0.4 90 90 86 74 74 69 65 69 73 60 55 26 YPEDAQPGKGCR 1752 NMKAAHLVGAT(+79.97)FAAPK 11.1 70 853.9254 2 21.962 0.6 40 41 50 82 81 74 77 76 65 69 83 88 86 60 60 72 NMKAAHLVGAT(+79.97)FAAPK 1836 EFLDF 3.5 70 670.3086 1 22.865 0.5 98 98 98 26 26 EFLDF 1971 VTNFGLVSGLDKW 9 70 479.2573 3 24.401 0.4 47 47 46 60 86 95 97 93 89 81 54 57 46 VTNFGLVSGLDKW 1828 EFLDF 3.5 69 670.3085 1 22.785 0.5 98 98 98 26 26 EFLDF 1416 EFPWMPVPVKK 7.6 69 679.369 2 18.372 2.1 96 96 96 65 72 55 89 26 55 68 39 EFPWMPVPVKK 1942 WGDFVLADVSK 7.6 69 412.8804 3 24.053 0.5 49 45 41 47 84 95 93 93 93 92 26 WGDFVLADVSK 2728 FVDQRNMGVMGANK 9.7 69 783.877 2 33.722 3 70 70 54 41 65 57 56 89 93 94 82 60 65 70 FVDQRNMGVMGANK 2345 TM(+15.99)LHDGNTAEMSK 9 69 725.8205 2 28.99 2.5 62 65 90 88 83 78 54 51 55 86 61 79 42 TM(+15.99)LHDGNTAEMSK 2357 FNESFLPLMKVV 8.3 69 712.3856 2 29.14 0.9 68 62 87 85 88 96 58 37 37 89 93 26 FNESFLPLMKVV 3520 FTAGAGVLEGW 7.6 69 554.2774 2 43.404 0.7 26 82 80 70 51 57 75 83 86 87 62 FTAGAGVLEGW 4100 YLPGEEVVVPGAK 9 69 679.3715 2 50.516 0.3 85 85 85 62 56 66 71 89 89 50 50 51 57 YLPGEEVVVPGAK 2646 MTLVTAGGEV 6.9 69 977.4966 1 32.719 0.6 93 90 92 26 77 62 66 58 58 65 MTLVTAGGEV 913 DVAAGSLGV 6.2 69 394.7117 2 13.039 1.6 79 75 55 45 44 63 76 87 95 DVAAGSLGV 3443 MVGKGEGEVAI 7.6 69 545.2853 2 42.48 2.4 66 69 85 53 39 37 66 88 81 89 83 MVGKGEGEVAI 833 SADVTFGVK 6.2 69 462.246 2 12.14 1.6 54 65 90 97 95 91 61 37 29 SADVTFGVK 3855 LSFEPMLK 5.5 69 482.7618 2 47.469 0.8 77 74 77 92 77 57 60 36 LSFEPMLK 1206 LVLSTLASGV 6.9 69 480.293 2 16.161 1.7 26 26 97 96 93 92 83 53 59 61 LVLSTLASGV 1797 VRSGSAGAEVSKPSRY(+79.97) 11.1 69 865.9172 2 22.448 3 26 82 82 95 96 96 95 95 95 98 49 37 37 38 42 36 VRSGSAGAEVSKPSRY(+79.97) 3342 LLGSLPLDT(+79.97)TV 7.6 69 604.8117 2 41.247 1 88 89 81 84 92 73 70 66 35 41 36 LLGSLPLDT(+79.97)TV 3052 GFGDKVLADW 6.9 69 554.2769 2 37.672 0.3 29 57 74 54 54 66 87 93 95 78 GFGDKVLADW 4084 MVAESAGGVLGV 8.3 69 545.2835 2 50.317 0.9 96 95 95 90 50 50 60 79 77 43 43 45 MVAESAGGVLGV 3890 LKDVLDQL 5.5 69 472.2764 2 47.9 0.3 79 65 66 71 95 56 61 56 LKDVLDQL 1079 RNSTDVDRKY(+79.97)R 7.6 69 745.3486 2 14.829 0.4 63 58 66 90 84 83 93 89 45 45 37 RNSTDVDRKY(+79.97)R 1427 M(+15.99)AM(+15.99)EQSKL 5.5 69 969.4355 1 18.488 2.5 71 76 76 96 46 76 53 54 M(+15.99)AM(+15.99)EQSKL 3233 KFCDETLDPAKPCGW 10.3 69 855.3873 2 39.911 0.7 49 48 63 85 84 95 94 80 63 57 61 70 77 76 26 KFCDETLDPAKPCGW 4000 LLTEGGSVM(+15.99)GR 7.6 69 568.2914 2 49.266 1.8 92 92 92 88 75 46 40 52 55 81 41 LLTEGGSVM(+15.99)GR 1513 MCAPEEGKANKEGSLEKA 12.4 69 946.4506 2 19.389 2.7 31 34 49 62 94 95 92 92 95 62 66 93 86 81 81 41 43 35 MCAPEEGKANKEGSLEKA 2559 STKSDGVSHKFA 8.3 69 632.3201 2 31.647 0.2 64 72 88 93 93 93 94 96 33 33 31 31 STKSDGVSHKFA 1888 NGLMVAELEELR 8.3 69 687.3589 2 23.454 1 32 31 33 94 98 98 97 97 26 80 81 54 NGLMVAELEELR

PAGE 425

425 2194 YSNGGKANGAEGTVK 10.3 69 726.858 2 27.106 0.7 68 65 58 79 79 79 79 78 78 80 84 63 38 38 59 YSNGGKANGAEGTVK 1996 LYGVLDL 4.8 69 792.45 1 24.698 0.2 77 77 91 89 83 26 35 LYGVLDL 2410 EAGLDVDAGLEAV 8.9 69 629.8122 2 29.8 0.8 43 44 60 76 85 96 78 72 71 80 60 61 62 EAGLDVDAGLEAV 2465 FHSLM(+15.99)VPPLVA 7.6 69 613.8347 2 30.49 1.6 71 71 72 83 82 91 89 26 76 45 45 FHSLM(+15.99)VPPLVA 3175 QMEMEDGGLLADK 8.9 69 718.8231 2 39.187 0.4 62 72 94 94 89 76 66 56 59 67 53 55 45 QMEMEDGGLLADK 1511 KEFLQEL 4.8 69 453.7506 2 19.372 0.9 60 67 37 87 69 94 64 KEFLQEL 2879 EPGSLVDHELL 7.6 69 604.8115 2 35.53 0.1 92 92 91 93 95 26 26 72 61 72 30 EPGSLVDHELL 3802 LLTEGNEFGR 6.9 69 568.2907 2 46.813 0 97 96 95 93 56 46 69 63 37 30 LLTEGNEFGR 3024 TMAGAEATLL 6.9 69 977.4973 1 37.322 0.1 70 71 80 78 63 56 61 54 59 91 TMAGAEATLL 2298 NFADALVAGMVK 8.2 69 618.3253 2 28.401 1.5 60 67 92 93 90 89 65 59 68 51 52 32 NFADALVAGMVK 3911 TGFPPDVAGNVDYK 9.6 69 740.3595 2 48.149 0.2 28 27 46 96 96 97 89 82 79 56 66 62 75 55 TGFPPDVAGNVDYK 1583 LMSVI 3.4 69 562.3268 1 20.16 0.2 26 96 96 96 26 LMSVI 2249 GEVDDVSQEAR 7.5 69 602.7756 2 27.787 0.1 50 50 50 95 90 59 58 54 85 90 69 GEVDDVSQEAR 875 LKVVDTAPK 6.2 69 485.8002 2 12.62 0.1 63 63 93 98 91 74 42 44 44 LKVVDTAPK 995 QNAGADEELFGALK 9.6 69 731.861 2 13.915 1.8 46 37 40 78 87 93 98 94 64 60 63 46 71 74 QNAGADEELFGALK 1035 KLEEVWRW 5.5 69 573.3088 2 14.379 0.3 63 61 83 84 84 56 56 56 KLEEVWRW 2196 ASMGAVANVK 6.9 69 474.2521 2 27.127 0.9 54 59 85 78 54 45 61 75 88 80 ASMGAVANVK 3125 MELDDLSSGSPM(+15.99)GVSK 11 69 834.8778 2 38.563 1.7 52 51 79 94 92 80 80 26 66 67 69 40 41 69 88 93 MELDDLSSGSPM(+15.99)GVSK 1156 RELSAQSSPF 6.9 69 561.2833 2 15.644 0.8 51 50 84 79 64 51 79 98 99 26 RELSAQSSPF 2475 M(+15.99)AESADGGLKDFEAK 10.3 68 792.8636 2 30.616 0.6 65 72 72 86 89 92 61 50 59 79 90 95 36 41 32 M(+15.99)AESADGGLKDFEAK 2197 WALDVCPVGEAV 8.2 68 629.8112 2 27.136 1.2 55 49 52 74 77 76 92 79 76 65 59 62 WALDVCPVGEAV 2745 M(+15.99)VRCPLADVSK 7.5 68 412.2134 3 33.931 2 26 62 62 62 84 76 75 86 94 94 26 M(+15.99)VRCPLADVSK 2218 RCGSTVLADVSK 8.2 68 412.5517 3 27.402 0.7 39 38 60 74 66 69 84 83 89 94 93 26 RCGSTVLADVSK 3065 MEQTGNSVTVLMEK 9.6 68 783.877 2 37.821 2.3 76 75 61 90 83 63 73 85 91 89 45 41 42 35 MEQTGNSVTVLMEK 2020 EAPADAELGEQLDQVQRVK 13 68 1048.535 2 24.983 0.6 27 27 51 50 57 94 97 98 95 94 74 89 76 59 60 56 66 70 49 EAPADAELGEQLDQVQRVK 1707 QDLKGLMTNL 6.8 68 566.8057 2 21.507 1.1 37 40 90 86 80 80 92 65 66 44 QDLKGLMTNL 961 HRLDEAENL 6.2 68 548.7728 2 13.553 0.3 35 65 44 63 84 96 71 81 73 HRLDEAENL 2056 AFSPDPVAGGGVDYK 10.2 68 740.3585 2 25.419 1.1 33 41 41 91 26 97 94 90 80 61 66 79 74 81 62 AFSPDPVAGGGVDYK 1441 VDKDLESELK 6.8 68 588.3119 2 18.629 0.9 53 53 48 75 81 88 89 70 74 47 VDKDLESELK 1951 NM(+15.99)ADALVGAGGKK 8.9 68 624.325 2 24.151 1.1 37 38 82 87 86 82 74 68 67 63 57 69 72 NM(+15.99)ADALVGAGGKK 2027 FGLPGGPPCVLVAAF 10.2 68 722.8884 2 25.066 2.7 58 65 89 92 86 58 47 49 52 52 74 71 64 79 81 FGLPGGPPCVLVAAF

PAGE 426

426 1380 QQTLDDLQAEEDQVSK 10.9 68 923.9373 2 17.998 0.5 47 47 55 70 88 93 88 66 86 92 85 81 50 54 55 26 QQTLDDLQAEEDQVSK 3195 FDTLPMLK 5.5 68 482.7623 2 39.443 0.1 26 83 81 87 86 67 68 43 FDTLPMLK 852 FGLAMPPGGK 6.8 68 974.5148 1 12.354 2.1 84 85 92 87 73 62 47 49 71 26 FGLAMPPGGK 1833 FSADPPVAGGGVDY 9.5 68 676.3118 2 22.841 0 34 42 49 76 77 97 92 87 80 63 66 78 81 26 FSADPPVAGGGVDY 3809 LSTEWGQGVL 6.8 68 545.2831 2 46.902 1.3 52 56 89 94 70 75 54 77 54 55 LSTEWGQGVL 3169 MMPWKATL 5.5 68 977.4973 1 39.111 2.6 69 70 70 86 74 64 71 38 MMPWKATL 1885 GLLGTELEMR 6.8 68 559.7983 2 23.413 1.7 36 36 67 77 83 73 68 81 86 70 GLLGTELEMR 3199 M(+15.99)LAGMVVTARCGNDL 10.2 68 783.8767 2 39.484 1.6 52 52 81 92 94 95 81 70 67 64 52 53 49 54 59 M(+15.99)LAGMVVTARCGNDL 1297 MEAGMVTGNGLQL 8.9 68 660.8166 2 17.128 2 76 77 88 92 95 88 57 57 57 73 42 48 29 MEAGMVTGNGLQL 2244 TDLAAALAK 6.1 68 437.2552 2 27.723 0.8 66 74 93 96 93 83 38 39 26 TDLAAALAK 1305 VDDDLKAEEDQVSK 9.5 68 795.8776 2 17.222 0.8 26 26 89 84 83 74 74 74 90 80 54 77 88 26 VDDDLKAEEDQVSK 1567 ESKMKLADSSR 7.5 68 417.8842 3 19.98 1.5 48 44 50 55 72 76 90 90 95 96 26 ESKMKLADSSR 1311 S(+79.97)EASPRL 4.8 68 839.3636 1 17.285 2.7 91 91 87 88 42 44 30 S(+79.97)EASPRL 694 MLTNDGNNK 6.1 68 503.7341 2 10.446 1.3 92 91 85 54 40 34 51 87 74 MLTNDGNNK 2286 NLEVTVK 4.8 68 401.7375 2 28.252 1.1 26 99 94 94 60 56 43 NLEVTVK 3133 LLTEVGGSM(+15.99)GR 7.5 68 568.2911 2 38.661 2.4 88 89 89 92 72 66 47 37 79 26 57 LLTEVGGSM(+15.99)GR 2578 MVGVTAGGDVAL 8.1 68 545.2839 2 31.887 0.1 67 68 70 67 65 71 66 83 82 72 72 26 MVGVTAGGDVAL 3106 WALDVCGPVEAV 8.1 68 629.8111 2 38.332 1 60 46 48 85 92 91 84 73 65 56 54 54 WALDVCGPVEAV 3119 TM(+15.99)LHDGNATEMSK 8.8 68 725.8204 2 38.49 2.4 59 61 86 68 65 65 67 73 91 87 54 65 34 TM(+15.99)LHDGNATEMSK 1107 AAEVTHGLFTETERR 10.2 68 572.9619 3 15.118 2.8 73 76 74 88 73 65 63 57 43 40 76 82 84 91 26 AAEVTHGLFTETERR 3945 EPGSLDVTSGNAPK 9.5 68 686.3427 2 48.579 2.3 89 87 59 63 75 94 90 76 70 78 49 40 46 29 EPGSLDVTSGNAPK 4073 GDFALATVAGW 7.5 68 554.2772 2 50.179 0.2 48 49 68 95 76 58 58 53 62 91 83 GDFALATVAGW 1953 VM(+15.99)LGLLPVLYPPVYRHGQK 12.9 68 1098.619 2 24.182 2.9 29 32 32 63 90 99 97 97 97 96 98 90 86 86 49 44 33 34 29 VM(+15.99)LGLLPVLYPPVYRHGQK 1344 QLDLVDQLK 6.1 68 536.3062 2 17.615 0.6 43 47 86 89 98 90 52 61 41 QLDLVDQLK 1318 KATALDDLELTLAK 9.5 68 501.2885 3 17.354 2.7 30 29 35 44 68 81 97 97 97 97 96 64 65 42 KATALDDLELTLAK 2574 NM(+15.99)CGNSTLPPKGDVNF 10.9 68 855.3885 2 31.832 4.5 54 55 87 83 64 87 86 89 95 73 45 47 66 49 50 46 NM(+15.99)CGNSTLPPKGDVNF 3207 CRVPM(+15.99)LADVSK 7.5 68 412.2137 3 39.592 1.2 64 64 64 69 59 59 61 88 94 94 26 CRVPM(+15.99)LADVSK 3671 LLTEGDQFGR 6.8 68 568.2905 2 45.226 0.3 95 96 94 79 37 35 35 73 82 47 LLTEGDQFGR 3340 CASRSVLADVSK 8.1 68 412.5521 3 41.226 0.3 45 46 46 66 26 96 93 90 91 91 90 26 CASRSVLADVSK 2807 DVESACEVAGMEVDK 10.2 68 791.3423 2 34.669 0.3 77 79 77 80 82 90 83 68 67 67 74 77 30 30 28 DVESACEVAGMEVDK 1329 EGFTYPKLK 6.1 68 361.5347 3 17.468 1.4 26 75 72 71 79 88 82 87 26 EGFTYPKLK

PAGE 427

427 1941 M(+15.99)GTLVELLR 6.1 68 524.2955 2 24.044 2.8 35 39 59 75 78 88 89 91 50 M(+15.99)GTLVELLR 2031 TPGLMENFLVLHQLR 10.2 68 589.9899 3 25.117 1.3 71 73 67 66 67 53 48 79 95 96 96 88 38 40 30 TPGLMENFLVLHQLR 3351 STQSDGVRQGTK 8.1 68 632.319 2 41.361 1.5 79 78 75 92 92 91 90 70 41 32 36 29 STQSDGVRQGTK 4208 S(+79.97)PADYER 4.7 68 459.1724 2 51.871 2.7 85 85 74 73 62 54 37 S(+79.97)PADYER 2181 LYPPAFGARHTK 8.1 68 679.3718 2 26.945 0.9 73 72 95 96 81 75 70 71 59 48 38 26 LYPPAFGARHTK 2050 LLAPASTM(+15.99)NI 6.8 68 1046.554 1 25.348 1.5 74 74 73 88 84 74 66 43 51 44 LLAPASTM(+15.99)NI 1608 QEGSVEDFKEAGF 8.8 68 721.8256 2 20.441 0.4 46 39 41 58 89 95 85 84 60 43 72 90 68 QEGSVEDFKEAGF 2349 NFVWGLADVSK 7.4 68 412.5522 3 29.043 0.3 26 26 26 87 89 93 89 88 94 94 26 NFVWGLADVSK 1577 FTGPDPVAGNVDYK 9.5 68 740.3604 2 20.096 1.5 28 32 38 85 91 97 94 86 77 59 79 59 63 49 FTGPDPVAGNVDYK 2835 LQLVDDKL 5.4 68 472.2767 2 35.01 0.3 26 78 85 85 88 63 65 46 LQLVDDKL 1015 EAPAGYTKLAPNL 8.8 68 672.8633 2 14.144 2.7 26 55 66 72 62 63 77 91 94 87 65 50 64 EAPAGYTKLAPNL 739 TYHPVAHR 5.4 68 327.5064 3 11.007 1.3 33 73 59 85 72 71 83 59 TYHPVAHR 2802 EPTSSGVVFGR 7.4 67 568.2903 2 34.612 0.8 26 97 97 97 74 61 61 56 58 66 42 EPTSSGVVFGR 1105 NNKNKDPLNDSVVK 9.4 67 792.9198 2 15.087 1 30 37 38 85 87 91 71 67 53 79 89 91 94 26 NNKNKDPLNDSVVK 778 DDAKVPPK 5.4 67 869.4728 1 11.48 0.1 91 90 90 93 94 26 26 26 DDAKVPPK 1930 DLNATLDQLLPAAKV 10.1 67 791.4457 2 23.914 0.3 63 63 79 95 78 59 77 54 81 94 72 67 48 38 38 DLNATLDQLLPAAKV 3143 LLGSLDVTGGNY 8.1 67 604.8115 2 38.791 0.1 91 92 89 91 95 26 90 63 54 46 38 26 LLGSLDVTGGNY 1355 RCEFPGNAACGAEK 9.4 67 726.8201 2 17.73 1.9 77 78 94 96 81 75 42 40 43 46 65 62 68 69 RCEFPGNAACGAEK 1375 LLTENGEGF 6.1 67 979.473 1 17.947 0.1 86 86 85 83 55 39 38 65 64 LLTENGEGF 1168 QDLANLF 4.7 67 410.7148 2 15.762 3 26 90 87 67 62 76 59 QDLANLF 2346 MGEPAVCTVAAPL 8.8 67 629.8113 2 29.001 1.2 70 72 86 81 79 77 91 67 59 66 39 39 45 MGEPAVCTVAAPL 831 KALQESHQKDV 7.4 67 641.8424 2 12.121 2 82 80 85 73 92 93 90 38 32 37 34 KALQESHQKDV 1908 YLLQELLGA 6.1 67 510.2923 2 23.667 0.1 88 88 75 63 69 72 65 55 26 YLLQELLGA 2507 MVAEGTGGVLGV 8.1 67 545.2844 2 31.007 0.7 95 95 90 85 46 40 40 50 76 61 61 62 MVAEGTGGVLGV 1030 DLQHRLDEADGA 8.1 67 670.3158 2 14.318 0.5 79 51 46 94 61 58 80 88 86 69 63 26 DLQHRLDEADGA 918 LLAPPVW 4.7 67 398.2424 2 13.093 1.6 98 98 95 97 26 26 26 LLAPPVW 1876 VDVVGGEDLMVDVER 10.1 67 544.6033 3 23.322 0.6 35 35 36 51 62 51 53 76 87 94 97 98 75 76 75 VDVVGGEDLMVDVER 2099 GMKSNAVSKNDL 8.1 67 632.3202 2 25.948 2.4 26 92 91 84 65 83 87 67 58 51 58 37 GMKSNAVSKNDL 2483 LLGSLPLTES(+79.97)V 7.4 67 604.8113 2 30.712 1.6 94 94 91 90 92 59 55 47 44 41 26 LLGSLPLTES(+79.97)V 2385 YAAPPDVAGNVDYK 9.4 67 740.3587 2 29.492 0.8 31 31 40 89 26 98 95 94 77 54 69 79 84 68 YAAPPDVAGNVDYK 3672 MDFPLLADVSK 7.4 67 412.5518 3 45.236 5.5 26 67 67 49 65 79 78 90 93 93 26 MDFPLLADVSK

PAGE 428

428 2980 FEPPAFKTRHK 7.4 67 679.3719 2 36.797 0.6 95 95 95 26 87 83 86 65 36 35 30 FEPPAFKTRHK 701 YPTSALY(+79.97)K 5.4 67 511.732 2 10.531 2.6 96 95 82 74 63 49 39 36 YPTSALY(+79.97)K 4011 M(+15.99)VRGSGLADVSK 8.1 67 412.552 3 49.407 0.1 26 66 57 44 55 84 83 84 89 94 93 26 M(+15.99)VRGSGLADVSK 2045 LAGTVLGAEL 6.7 67 472.2764 2 25.288 0.4 47 44 51 66 62 73 80 77 78 87 LAGTVLGAEL 695 RTELHSEETR 6.7 67 629.313 2 10.457 0.5 51 51 73 88 76 43 49 80 88 67 RTELHSEETR 3508 YAAPPDVAGNVDYK 9.4 67 740.3581 2 43.262 1.6 33 33 43 90 26 93 89 87 81 58 75 77 83 64 YAAPPDVAGNVDYK 3423 CFHLSRTSSNMEAVSK 10.7 67 599.6185 3 42.24 0.5 61 61 61 57 56 62 71 93 95 80 87 85 47 41 48 57 CFHLSRTSSNMEAVSK 839 CPELKQFQPTSSHLER 10.7 67 950.4737 2 12.207 1 26 43 61 74 67 65 50 72 91 96 97 26 90 78 80 48 CPELKQFQPTSSHLER 2541 DVESADCGAEDFVPK 10 67 791.3397 2 31.427 1 68 69 67 63 66 82 77 66 68 78 82 79 47 55 29 DVESADCGAEDFVPK 1542 DSPVLSGGMFAYPGLADR 12.1 67 926.9467 2 19.715 2 26 26 26 26 96 95 89 83 71 61 73 95 84 63 63 81 82 56 DSPVLSGGMFAYPGLADR 242 S(+79.97)NVNGS(+79.97)SV 5.4 67 462.15 2 3.705 2.2 60 52 59 62 84 78 69 69 S(+79.97)NVNGS(+79.97)SV 2080 LLGSLTLPS(+79.97)DL 7.4 67 604.8113 2 25.714 1.7 94 93 89 88 91 74 56 67 26 26 26 LLGSLTLPS(+79.97)DL 1782 MTMVFTKVK 6 67 1084.588 1 22.283 1.1 95 95 96 87 75 53 36 34 26 MTMVFTKVK 1986 M(+15.99)PPGVAELEELR 8 67 678.8449 2 24.573 0.2 26 38 34 81 95 96 97 98 26 76 78 51 M(+15.99)PPGVAELEELR 2605 VDSETVLVFAKPA 8.7 67 459.255 3 32.21 2.7 90 90 59 50 46 46 46 75 77 76 73 73 63 VDSETVLVFAKPA 662 VLNPMMSSGPL 7.4 67 573.2891 2 10.028 1.4 29 29 29 59 64 85 94 94 78 81 89 VLNPMMSSGPL 1209 MLKSGMLGKPF 7.4 67 604.8307 2 16.199 0.9 82 83 88 80 76 73 45 43 56 78 26 MLKSGMLGKPF 1115 MVPALFHTM(+15.99)ELEESKK 10.7 67 635.9849 3 15.201 2.5 66 68 65 66 69 71 78 71 57 66 90 90 59 55 63 26 MVPALFHTM(+15.99)ELEESKK 1564 M(+15.99)NSVGVLADFSK 8 67 428.5474 3 19.957 1.9 45 44 36 37 44 77 94 91 88 82 82 78 M(+15.99)NSVGVLADFSK 4108 LLGSLEGASSQF 8 67 604.8114 2 50.608 0.1 93 93 91 90 86 63 50 38 40 49 52 52 LLGSLEGASSQF 2409 CPHPADGAVEDFKEA 10 67 793.3547 2 29.789 4.5 26 26 26 85 85 90 83 82 89 97 96 96 43 35 35 CPHPADGAVEDFKEA 2124 NFEPLFPFSK 6.7 67 613.3176 2 26.242 2.2 69 75 91 99 26 26 72 67 67 71 NFEPLFPFSK 1275 DVM(+15.99)RQSLLGLLDVLDTPA 12 67 658.0204 3 16.905 2.4 83 83 61 50 36 72 91 82 78 89 77 49 44 48 59 81 83 26 DVM(+15.99)RQSLLGLLDVLDTPA 1477 QM(+15.99)LEDDGYLDVNAVSK 10.7 67 906.9214 2 19.001 2 55 69 59 72 82 95 69 75 83 83 34 32 37 65 70 80 QM(+15.99)LEDDGYLDVNAVSK 1684 MEMENHYAR 6 67 1180.487 1 21.265 0.9 88 56 83 83 60 82 46 61 37 MEMENHYAR 3084 MVGQGTVDVAI 7.3 67 545.2839 2 38.054 0.1 72 73 83 57 63 51 61 91 76 76 26 MVGQGTVDVAI 2551 MTLVTAGGEV 6.7 67 977.4966 1 31.546 0.6 93 81 84 26 75 64 68 54 54 63 MTLVTAGGEV 4053 M(+15.99)DTAADQVEDFKTV 9.3 67 793.3547 2 49.933 1.8 41 48 60 83 85 69 56 86 96 96 91 43 42 33 M(+15.99)DTAADQVEDFKTV 2478 LDAADVDGALEAV 8.7 67 629.8112 2 30.649 0.9 57 54 63 74 77 90 77 64 61 68 58 59 60 LDAADVDGALEAV 3687 TSKSDGVAKWNA 8 67 632.3202 2 45.425 0.3 59 59 86 91 93 93 78 62 44 40 45 45 TSKSDGVAKWNA 1870 CLLKKDLDDLELTRR 10 67 611.0071 3 23.258 1.9 43 43 53 46 46 50 68 96 96 95 95 85 75 74 26 CLLKKDLDDLELTRR

PAGE 429

429 3941 FGGGLLDGAPGF 8 67 554.2768 2 48.525 0.4 32 67 84 44 45 62 69 71 86 74 73 87 FGGGLLDGAPGF 1637 NFDQVLADWKKKY 8.7 67 552.2921 3 20.766 2 62 38 57 39 80 83 87 92 91 61 52 68 49 NFDQVLADWKKKY 1559 WCGKLNVKDQELEAMVK 11.3 67 996.0051 2 19.902 2.9 29 32 46 72 92 87 93 64 53 41 81 89 88 82 67 68 40 WCGKLNVKDQELEAMVK 1449 KLEEQEALVSQI 8 67 693.8771 2 18.715 0.4 63 63 84 77 39 52 73 93 96 48 59 48 KLEEQEALVSQI 2669 LLTETAQM(+15.99)GR 6.7 67 568.2911 2 33.004 2.3 89 90 90 90 49 47 43 51 72 40 LLTETAQM(+15.99)GR 1183 LTMFGEK 4.7 67 825.4178 1 15.921 0.4 83 83 91 26 64 66 49 LTMFGEK 2250 TNVADPF 4.7 66 763.3655 1 27.798 4.5 56 51 73 84 73 62 62 TNVADPF 2956 S(+79.97)LAERPA 4.6 66 823.3687 1 36.495 2.7 96 96 83 59 43 52 33 S(+79.97)LAERPA 2278 CGVLVGVGLPCPAL 9.3 66 649.3542 2 28.155 0.4 72 78 78 89 81 70 68 73 79 81 26 41 42 44 CGVLVGVGLPCPAL 637 VTHDS(+79.97)LDCSF 6.6 66 602.2239 2 9.704 1.6 26 54 50 54 26 93 93 90 87 87 VTHDS(+79.97)LDCSF 2961 MDSVKFHSSNMGNKSK 10.6 66 599.6182 3 36.56 0.9 35 35 44 73 64 84 67 92 97 85 87 70 58 67 70 26 MDSVKFHSSNMGNKSK 1379 MVLKAEEY(+79.97)VNTLTK 9.3 66 859.9265 2 17.991 1.3 30 32 43 83 97 98 26 26 95 83 83 82 88 56 MVLKAEEY(+79.97)VNTLTK 2448 NLTEEMASKDEGEAK 10 66 826.3782 2 30.27 0.7 36 36 42 90 94 94 94 93 74 71 79 42 35 53 56 NLTEEMASKDEGEAK 990 ANGEVAQSVGV 7.3 66 515.7603 2 13.854 2.8 48 56 90 92 96 96 51 47 39 54 56 ANGEVAQSVGV 2025 LELLEKPMGLF 7.3 66 645.3638 2 25.048 2.4 40 61 97 99 96 88 55 43 40 63 42 LELLEKPMGLF 2309 KPKMVHLDFW 6.6 66 434.2335 3 28.539 0.8 26 40 42 42 59 93 91 88 88 88 KPKMVHLDFW 2201 FLAGMVQGSADKDDL 9.9 66 783.8775 2 27.19 0.6 60 63 84 93 95 89 34 35 35 85 87 66 66 68 26 FLAGMVQGSADKDDL 1860 VLLLDKAVPVPGPV 9.3 66 708.9445 2 23.135 0.5 49 49 83 97 93 93 63 57 49 26 87 76 76 26 VLLLDKAVPVPGPV 3300 MTAGALVSDI 6.6 66 977.4968 1 40.738 0.4 67 71 87 86 76 77 56 56 56 26 MTAGALVSDI 2899 MGELKEPCGVPV 8 66 629.8123 2 35.776 0.3 48 50 63 80 71 74 76 60 64 65 69 69 MGELKEPCGVPV 3509 LM(+15.99)GPAVCTSAPPV 8.6 66 629.8114 2 43.272 1.1 48 44 50 88 90 75 78 88 64 65 54 55 55 LM(+15.99)GPAVCTSAPPV 983 FNLAFGGTGNNL 7.9 66 612.8022 2 13.78 3 84 65 78 86 80 78 71 61 53 45 44 44 FNLAFGGTGNNL 2290 S(+79.97)LAERPA 4.6 66 823.3696 1 28.307 1.6 94 94 81 66 49 45 32 S(+79.97)LAERPA 3245 MVSVYDDVDNSMVVLR 10.6 66 921.4442 2 40.061 2.2 66 66 66 97 95 90 84 47 47 60 70 76 89 38 33 28 MVSVYDDVDNSMVVLR 2741 FNAFMAETASSNPK 9.3 66 757.851 2 33.878 0.2 73 62 82 83 80 78 81 81 55 55 62 44 58 26 FNAFMAETASSNPK 1008 QSLAGEQEY 6 66 512.7336 2 14.062 1.7 32 32 47 66 73 86 76 95 83 QSLAGEQEY 1181 WADVDGSADPL 7.3 66 573.2602 2 15.903 1.9 72 78 92 97 71 55 33 35 42 64 82 WADVDGSADPL 1674 QLKLGTLEEMR 7.3 66 439.9115 3 21.157 0.5 33 43 32 53 59 65 93 98 88 88 69 QLKLGTLEEMR 2542 TFMVNGGSYESMK 8.6 66 725.8203 2 31.438 0.5 64 64 59 56 48 67 73 78 86 85 61 72 41 TFMVNGGSYESMK 1995 RQMVAELEELGVAA 9.2 66 758.3953 2 24.688 0.1 33 49 44 96 94 94 95 26 96 93 63 43 44 46 RQMVAELEELGVAA 3912 AWLFELS(+79.97)EKKPK 7.9 66 778.3981 2 48.16 1.9 50 48 66 68 90 92 63 86 85 76 36 26 AWLFELS(+79.97)EKKPK

PAGE 430

430 3659 NFDKVLWEGK 6.6 66 618.3241 2 45.083 0.7 67 70 89 85 85 83 60 35 40 40 NFDKVLWEGK 3468 M(+15.99)LSSADQVEDFKEA 9.2 66 793.3546 2 42.778 1.9 48 48 66 89 87 54 49 86 89 96 95 40 35 33 M(+15.99)LSSADQVEDFKEA 805 ETVYKKGCVAI 7.2 66 404.2226 3 11.807 2.6 79 79 53 51 73 39 51 55 74 81 84 ETVYKKGCVAI 2268 M(+15.99)LAGMVTVGGSGKDEV 10.5 66 783.8764 2 28.026 3 61 61 88 94 97 93 67 58 61 49 52 70 69 44 53 28 M(+15.99)LAGMVTVGGSGKDEV 1858 CPLEEEYMYPKASDSL 10.5 66 937.9141 2 23.113 1.2 62 63 56 63 83 58 58 77 81 89 83 73 69 48 48 33 CPLEEEYMYPKASDSL 4035 MEAGMVTTGAAGETKL 10.5 66 783.877 2 49.708 2.2 69 70 83 89 95 92 90 52 45 49 81 72 45 36 40 36 MEAGMVTTGAAGETKL 2939 MVAEGQGTLAL 7.2 66 545.2839 2 36.281 0.1 92 93 93 93 60 35 38 56 78 39 42 MVAEGQGTLAL 1285 LEAVAGADF 5.9 66 892.4406 1 17.003 0.5 44 45 61 53 55 73 79 86 90 LEAVAGADF 846 QKVETEQTELASK 8.5 66 745.8882 2 12.284 0.3 55 60 82 93 85 72 41 66 67 75 48 48 57 QKVETEQTELASK 2121 FELQELL 4.6 66 446.2446 2 26.215 0.3 44 54 54 66 92 98 49 FELQELL 1915 EAFLKLKHDANK 7.9 66 471.932 3 23.743 2.5 26 82 68 64 58 76 72 72 74 76 64 51 EAFLKLKHDANK 1176 REQFEEEGAEAQAELK 10.5 66 932.4377 2 15.845 1.9 35 49 37 48 55 98 91 80 80 89 96 66 80 49 54 35 REQFEEEGAEAQAELK 1675 ADSNADFKF 5.9 66 1014.453 1 21.164 0.5 86 86 66 47 53 71 76 76 26 ADSNADFKF 2626 S(+79.97)LAAPER 4.6 66 823.3688 1 32.473 2.5 97 93 93 95 26 26 26 S(+79.97)LAAPER 2445 LYPSSGLVAPPEK 8.5 66 679.3717 2 30.239 0.1 65 65 92 92 62 53 54 72 85 84 41 48 34 LYPSSGLVAPPEK 2117 EFPKSAADGLLPL 8.5 66 679.3722 2 26.164 0.8 93 93 83 61 50 50 44 50 82 86 68 57 30 EFPKSAADGLLPL 857 LYDQHLGK 5.3 66 325.1746 3 12.41 0.9 48 48 79 49 83 70 73 71 LYDQHLGK 1152 FGAANGATVSSQF 8.5 66 628.8007 2 15.597 2.8 47 42 44 38 38 45 54 76 91 97 91 91 91 FGAANGATVSSQF 3159 M(+15.99)VDDVGVLSSNMEAVSK 11.2 66 599.6181 3 38.993 0.4 41 47 47 46 39 44 53 74 99 94 85 87 84 71 64 65 68 M(+15.99)VDDVGVLSSNMEAVSK 1327 RGMLQNSELKAK 7.9 66 687.8804 2 17.436 1 46 55 66 67 58 71 79 79 87 72 71 31 RGMLQNSELKAK 1939 S(+79.97)FKMFKMF 5.2 66 1145.494 1 24.012 1.5 90 90 90 71 41 57 40 41 S(+79.97)FKMFKMF 2812 KGMLSSLADASR 7.9 66 412.5522 3 34.732 0.6 26 51 49 64 76 86 81 80 81 67 70 48 KGMLSSLADASR 793 ALGKNPSQAGEVK 8.5 66 649.8557 2 11.657 1.6 68 63 68 93 87 52 34 31 45 52 67 92 92 ALGKNPSQAGEVK 1397 SAGALGAGAAVVLAPA 10.5 66 648.3701 2 18.179 1 49 48 61 67 67 59 42 41 86 83 83 81 67 59 71 78 SAGALGAGAAVVLAPA 4017 MVAEAGGGTLLA 7.9 66 545.2841 2 49.485 0.1 96 95 90 90 80 73 48 42 44 52 35 36 MVAEAGGGTLLA 1395 LLGSLDVPT(+79.97)TL 7.2 65 604.8116 2 18.164 1.2 97 96 91 90 95 26 26 73 42 52 26 LLGSLDVPT(+79.97)TL 3489 METDVGVLSSNMEAVSK 11.1 65 599.6187 3 43.035 0.6 35 36 38 40 42 55 54 58 98 94 68 76 82 84 80 81 83 METDVGVLSSNMEAVSK 1906 EQLFELLK 5.2 65 1019.577 1 23.646 0.1 59 43 56 76 90 79 77 38 EQLFELLK 2415 KMGSTVLADASR 7.9 65 412.5522 3 29.864 0.6 26 45 39 39 75 81 87 85 87 80 81 53 KMGSTVLADASR 4146 KLEDVCPGPMAV 7.8 65 629.8118 2 51.085 0.4 56 51 51 60 68 81 75 59 68 76 66 69 KLEDVCPGPMAV 1627 FGTNEVGSVGLF 7.8 65 613.8064 2 20.651 0.3 45 49 54 68 78 66 66 72 87 76 75 43 FGTNEVGSVGLF

PAGE 431

431 3091 KLDLVDQGMALK 7.8 65 444.2513 3 38.136 0.5 78 78 91 89 86 77 48 53 46 45 51 36 KLDLVDQGMALK 1829 SAFPPDVAGVNDYKNL 10.5 65 853.9231 2 22.792 0.4 31 31 61 96 90 87 93 94 83 46 42 80 93 38 38 34 SAFPPDVAGVNDYKNL 2607 FAESADQVEDFEAK 9.1 65 793.3541 2 32.244 0.5 26 86 79 79 86 82 66 85 96 99 26 32 34 30 FAESADQVEDFEAK 2021 LKLGTRCGADSSPERR 10.5 65 873.459 2 24.994 1.9 30 41 62 83 83 82 70 68 65 65 66 66 66 78 85 26 LKLGTRCGADSSPERR 4144 FNGWVALDVSK 7.2 65 412.5521 3 51.064 0.1 41 51 65 68 85 64 68 81 82 82 26 FNGWVALDVSK 2697 WWAAMAKSSNMEAVSK 10.4 65 599.6184 3 33.346 2.9 26 29 33 33 33 49 78 97 95 87 93 83 76 69 72 86 WWAAMAKSSNMEAVSK 2275 LDGPSTEAGLEAV 8.5 65 629.811 2 28.111 1.2 44 45 54 69 91 90 63 56 54 75 66 66 68 LDGPSTEAGLEAV 3181 LQDLVDGAPFKK 7.8 65 444.2515 3 39.263 2.6 83 72 88 88 79 66 63 67 83 29 31 27 LQDLVDGAPFKK 4020 FPEGLEEI 5.2 65 933.458 1 49.517 1.8 81 81 65 68 85 87 26 26 FPEGLEEI 1763 YPLVT(+79.97)GLLSKWDDMEK 10.4 65 987.9673 2 22.078 0.4 58 47 47 49 54 94 95 97 89 66 43 53 78 61 61 44 YPLVT(+79.97)GLLSKWDDMEK 2629 MGEPAVCAPTALV 8.5 65 629.8119 2 32.503 0.3 57 58 71 79 71 71 93 82 54 50 48 53 55 MGEPAVCAPTALV 732 EADLTGVAGAA 7.2 65 487.7435 2 10.92 0.8 26 91 87 88 48 43 43 66 68 59 92 EADLTGVAGAA 1492 TM(+15.99)LHDQTNEMSK 7.8 65 725.8204 2 19.167 2.4 56 59 89 89 87 62 44 43 90 61 61 35 TM(+15.99)LHDQTNEMSK 674 GFNMFHK 4.6 65 440.71 2 10.185 0.8 44 53 54 68 83 75 75 GFNMFHK 1133 QEELKEGAAAMVER 9.1 65 520.9279 3 15.391 0.5 31 32 32 67 58 53 55 79 97 97 92 69 72 69 QEELKEGAAAMVER 1471 QKKADSVAEAVEQLDNLQR 12.4 65 1071.562 2 18.938 1.1 26 26 71 85 91 98 97 96 93 52 51 80 56 64 93 36 38 40 33 QKKADSVAEAVEQLDNLQR 2015 LLNPESKTGPLMENFI 10.4 65 901.9714 2 24.923 0.1 65 61 50 62 74 64 64 85 65 59 76 86 65 50 56 49 LLNPESKTGPLMENFI 763 LEEANATSA 5.9 65 905.4208 1 11.299 0.2 26 26 80 66 46 67 83 90 97 LEEANATSA 2131 FVLM(+15.99)TDGW 5.2 65 984.4501 1 26.325 0.6 26 95 73 68 66 77 85 26 FVLM(+15.99)TDGW 4252 CS(+79.97)WVY 3.3 65 369.1218 2 52.457 0.2 26 26 90 90 90 CS(+79.97)WVY 2229 KSGMDGNSGLKGI 8.5 65 632.3204 2 27.544 2.1 46 46 50 54 92 94 74 80 83 82 47 47 43 KSGMDGNSGLKGI 2529 FVDQPFDVVMGAEL 9.1 65 783.8773 2 31.279 2.3 55 58 57 36 44 44 68 88 94 93 73 56 63 74 FVDQPFDVVMGAEL 191 FVMSSA 3.9 65 321.1515 2 2.788 1 26 67 67 66 78 83 FVMSSA 723 TENGEGFR 5.2 65 455.2064 2 10.813 0.6 26 97 95 90 85 57 36 30 TENGEGFR 2716 MWVVVMGVLNARGDS(+79.97)K 10.4 65 921.4438 2 33.572 0.1 34 64 54 92 80 63 62 69 85 73 59 59 62 55 72 51 MWVVVMGVLNARGDS(+79.97)K 2915 FLGVYDDEGDGGMVVRL 11 65 921.4432 2 35.98 3 45 52 61 90 91 92 94 80 53 40 43 68 74 87 50 42 32 FLGVYDDEGDGGMVVRL 2389 YPGVVDPVCGSGQPAEPAV 12.3 65 921.444 2 29.536 3.8 42 69 75 95 98 98 80 77 65 64 63 60 45 57 75 50 34 35 39 YPGVVDPVCGSGQPAEPAV 869 LNKTEAGEGSF 7.1 65 576.7808 2 12.548 1 44 43 49 58 82 79 78 85 68 66 56 LNKTEAGEGSF 1354 DSLAATPSLLKA 7.8 65 593.837 2 17.722 0.8 26 96 91 71 60 57 72 70 79 59 56 37 DSLAATPSLLKA 1762 TPFEVMLK 5.2 65 482.7624 2 22.072 0.3 26 69 69 72 90 75 71 43 TPFEVMLK 3343 ELLLSTGAQVGA 7.8 65 579.8219 2 41.259 0.1 55 55 80 58 53 43 56 82 76 71 72 73 ELLLSTGAQVGA

PAGE 432

432 3067 LLTSNVEM(+15.99)GR 6.5 65 568.2911 2 37.843 2.3 92 92 92 80 44 48 52 76 26 42 LLTSNVEM(+15.99)GR 1217 RDVSNGEVAF 6.5 65 547.267 2 16.285 0.6 59 59 47 39 38 64 65 84 94 94 RDVSNGEVAF 3048 LFGVYDDYHDMVVVAV 10.4 65 921.4438 2 37.619 1.4 38 35 57 95 90 86 86 79 47 46 67 81 78 64 39 41 LFGVYDDYHDMVVVAV 3021 MGKSDGNSGVKLA 8.4 65 632.3202 2 37.294 2.4 26 91 86 86 87 91 71 77 77 55 32 30 27 MGKSDGNSGVKLA 3184 GYVGGGLLEGW 7.1 65 554.2772 2 39.306 0.3 26 26 92 83 52 36 40 92 93 93 73 GYVGGGLLEGW 2165 MCNKGRK 4.5 65 418.7142 2 26.742 2.2 87 64 59 92 95 26 26 MCNKGRK 1990 WTTLPAGPLTSGRDDEMQL 12.3 65 696.6752 3 24.622 2.1 47 47 61 39 38 49 70 83 86 90 92 91 92 94 86 41 37 45 31 WTTLPAGPLTSGRDDEMQL 3459 LCFLGTTPL 5.8 65 482.762 2 42.675 0.6 26 26 94 91 93 68 68 68 42 LCFLGTTPL 2577 LYPGVSAEPSPLK 8.4 65 679.3718 2 31.877 0.3 68 69 88 81 65 42 43 77 90 90 44 46 32 LYPGVSAEPSPLK 2531 TTVSDPAGPLVGL 8.4 65 613.8352 2 31.301 0.5 79 78 80 91 62 46 41 49 64 61 42 72 72 TTVSDPAGPLVGL 1806 QEVAELVDASEGVRL 9.7 65 807.9199 2 22.542 0.4 44 45 37 38 56 95 96 95 95 94 90 66 41 37 34 QEVAELVDASEGVRL 1937 SLAGSGGPVAFTVF 9.1 65 655.3427 2 23.991 0.4 32 32 39 58 84 83 72 57 52 54 76 82 88 89 SLAGSGGPVAFTVF 971 NKECPGEVETAMPPV 9.7 65 534.2493 3 13.656 0.8 37 37 56 54 74 78 78 79 81 81 77 64 64 76 26 NKECPGEVETAMPPV 2433 VFDGNGPGTSSNPVSFSK 11.6 65 599.6193 3 30.09 0.9 55 58 49 41 44 60 67 58 62 93 96 86 94 79 59 52 54 49 VFDGNGPGTSSNPVSFSK 2813 EPGSLDVHLEL 7.1 65 604.8119 2 34.743 0.7 92 91 91 91 92 26 26 61 46 61 28 EPGSLDVHLEL 997 KGQGADEEFEGALK 9 65 739.8587 2 13.936 1.3 33 45 36 69 75 96 98 26 26 82 79 66 82 84 KGQGADEEFEGALK 2490 NLEVTKV 4.5 65 401.7367 2 30.796 0.9 26 99 90 86 53 54 42 NLEVTKV 1345 FASPVLVACAPNEY 9 65 740.8609 2 17.622 0.3 27 33 33 88 26 91 89 90 83 51 54 70 85 76 FASPVLVACAPNEY 1686 KSKSGGSSPMPDSSGQNK 11.6 65 889.9186 2 21.279 2.1 39 27 68 74 71 59 84 95 87 80 80 78 79 61 47 36 51 35 KSKSGGSSPMPDSSGQNK 2063 MPKYF 3.2 65 343.1721 2 25.504 1.2 79 79 65 71 26 MPKYF 2073 LLPVLYPPVTTLYYK 9.7 65 890.5162 2 25.631 2.4 26 57 57 98 98 98 99 99 35 36 48 80 48 40 40 LLPVLYPPVTTLYYK 3286 Y(+79.97)PMAMLSSVAGPRW 9 65 823.3688 2 40.569 2.4 26 71 72 81 66 63 70 74 72 76 85 58 51 31 Y(+79.97)PMAMLSSVAGPRW 1557 SSSLATGLADVSK 8.4 64 412.5544 3 19.888 0.8 26 26 64 50 45 56 81 91 90 90 94 94 26 SSSLATGLADVSK 3426 EPGSLVDPANPL 7.7 64 604.8112 2 42.272 0.4 86 85 79 80 86 26 86 57 53 37 46 47 EPGSLVDPANPL 3813 WALLDVAM(+15.99)TAGHA 8.4 64 686.3401 2 46.954 0.4 39 38 59 93 97 94 54 44 53 55 85 95 26 WALLDVAM(+15.99)TAGHA 618 KTDVPFELPA 6.4 64 558.8003 2 9.459 0.1 65 64 84 82 69 69 69 55 49 33 KTDVPFELPA 3738 CPTTRERPEAV 7.1 64 629.8125 2 46.034 2.4 51 60 60 70 87 86 60 83 54 46 46 CPTTRERPEAV 1389 TVDLSAVKV 5.8 64 466.2767 2 18.104 0.3 26 26 26 26 95 93 92 95 95 TVDLSAVKV 756 VMTDDKTA 5.1 64 880.4073 1 11.218 0.8 26 92 91 80 65 62 68 26 VMTDDKTA 1066 FGVLALGMFF 6.4 64 551.2934 2 14.698 0.4 26 97 95 92 63 45 54 62 79 26 FGVLALGMFF 1846 WMKVMPNAGAPL 7.7 64 657.8378 2 22.979 1 38 59 49 89 92 94 80 77 72 38 39 39 WMKVMPNAGAPL

PAGE 433

433 2955 GMKSDGTGAVNVK 8.4 64 632.3202 2 36.485 2.4 26 92 91 94 90 85 49 44 53 54 47 57 48 GMKSDGTGAVNVK 1432 WGLLVPYDKA 6.4 64 581.3188 2 18.543 0.1 39 37 53 91 26 99 98 77 59 59 WGLLVPYDKA 2088 RCGSTVLADVSK 7.7 64 412.5516 3 25.806 0.9 37 35 48 63 68 76 79 73 79 91 91 26 RCGSTVLADVSK 1625 YAAPDPVAGVNDYKNL 10.3 64 853.9227 2 20.63 0.1 46 46 61 72 61 80 92 90 84 70 58 77 79 35 35 32 YAAPDPVAGVNDYKNL 665 FDETSGA 4.5 64 726.2942 1 10.074 0.2 26 26 97 93 89 89 26 FDETSGA 2134 CNLLYPAANLMR 7.7 64 460.2374 3 26.365 0.5 84 75 78 68 68 77 71 58 47 47 55 36 CNLLYPAANLMR 2022 MPGSLSTLAALAQL 9 64 686.8776 2 25.005 1.9 91 91 89 90 66 57 70 71 78 64 36 30 30 29 MPGSLSTLAALAQL 3972 YPAGTDLETVNQMK 9 64 783.8766 2 48.92 0.5 76 78 53 57 71 69 73 69 73 85 53 41 57 37 YPAGTDLETVNQMK 3640 YAAPPDVANGVDYK 9 64 740.3601 2 44.856 1.1 31 31 40 87 26 93 86 83 58 69 83 71 75 57 YAAPPDVANGVDYK 1809 ESFLPMLK 5.1 64 964.5176 1 22.581 0.5 26 92 92 94 71 43 50 41 ESFLPMLK 2638 YNQAGSGPAGCGGQAELK 11.5 64 854.3893 2 32.624 2.3 80 68 37 46 49 86 71 64 62 54 56 75 78 65 77 64 70 46 YNQAGSGPAGCGGQAELK 1729 WLLAPMFGLW 6.4 64 617.3293 2 21.723 2.1 37 37 50 78 74 58 66 81 91 65 WLLAPMFGLW 1146 AEAKSSMLDATVK 8.3 64 675.8499 2 15.532 0.6 47 48 64 82 97 94 50 48 71 88 50 41 46 AEAKSSMLDATVK 1722 TLEDQLSEL 5.8 64 1047.52 1 21.659 0.7 51 53 75 76 53 72 63 71 59 TLEDQLSEL 3693 LAGLVDDKL 5.8 64 472.2763 2 45.497 0.5 54 58 70 73 67 91 58 60 40 LAGLVDDKL 2059 VM(+15.99)FPDVF 4.5 64 870.4049 1 25.452 1.9 26 26 89 89 79 68 68 VM(+15.99)FPDVF 905 M(+15.99)AKAEQSGGGEM(+15.99)RAPA 10.2 64 811.8684 2 12.951 2.2 37 38 57 98 94 75 73 70 70 80 91 85 53 36 30 30 M(+15.99)AKAEQSGGGEM(+15.99)RAPA 2854 TAFALEGGVGW 7 64 554.2781 2 35.23 2 26 26 26 88 85 62 61 56 77 94 98 TAFALEGGVGW 3406 RQTPPHWASR 6.4 64 412.552 3 42.029 2 51 44 54 80 87 26 91 74 76 51 RQTPPHWASR 1578 M(+15.99)AM(+15.99)EGASLQKEY 7.7 64 695.3041 2 20.104 1.1 35 47 47 93 95 94 51 43 35 57 91 76 M(+15.99)AM(+15.99)EGASLQKEY 2003 MVLSGNEALGVALA 9 64 672.8625 2 24.777 1 26 26 92 88 87 54 57 71 92 63 55 60 58 60 MVLSGNEALGVALA 3839 YLPAPKQHFTR 7 64 679.3715 2 47.269 1.3 79 77 88 68 50 41 39 78 55 74 50 YLPAPKQHFTR 3685 S(+79.97)LAAEPR 4.5 64 823.3685 1 45.393 3 95 91 91 89 26 26 26 S(+79.97)LAAEPR 1977 TLLSVACSLPRV 7.7 64 629.8638 2 24.471 1.4 59 68 87 85 78 62 63 64 65 51 54 26 TLLSVACSLPRV 3305 M(+15.99)VAPAVCTPPSAV 8.3 64 629.8118 2 40.797 0.5 45 44 44 66 69 73 91 87 84 61 54 50 58 M(+15.99)VAPAVCTPPSAV 2423 SPNLMDF 4.5 64 823.3672 1 29.961 2.1 64 64 65 68 69 88 26 SPNLMDF 3306 HPVGPPMREPSPQDK 9.6 64 836.4155 2 40.807 2 26 83 77 75 80 83 77 78 64 90 49 48 40 47 34 HPVGPPMREPSPQDK 3267 FAESADQVEDFAEK 8.9 64 793.354 2 40.337 0.5 26 85 81 80 85 83 61 78 96 99 26 30 30 29 FAESADQVEDFAEK 2611 ELACPM(+15.99)APGGQNTKR 9.6 64 530.2574 3 32.288 0.3 36 41 51 81 77 76 74 76 88 79 74 64 50 53 30 ELACPM(+15.99)APGGQNTKR 1224 ANADVAQW 5.1 64 874.4043 1 16.361 1.2 49 47 66 77 77 63 66 63 ANADVAQW 2827 S(+79.97)LAAPER 4.5 64 823.3688 1 34.904 2.6 95 90 90 91 26 26 26 S(+79.97)LAAPER

PAGE 434

434 1317 GCTAEHPAACSELLL 9.6 64 757.8547 2 17.346 2.9 59 68 86 92 94 26 30 75 86 81 74 56 59 38 26 GCTAEHPAACSELLL 4056 QELEAEGALEAV 7.7 64 629.8109 2 49.966 1.3 35 36 59 65 80 92 76 68 73 57 59 59 QELEAEGALEAV 1459 EYPPLPEGVLFL 7.7 64 687.3712 2 18.809 0.1 93 93 93 96 26 85 84 49 46 35 32 29 EYPPLPEGVLFL 1197 LSSTEL 3.8 64 649.3403 1 16.076 0 26 26 95 90 95 48 LSSTEL 3731 GGFGSVVLADW 7 64 554.2768 2 45.954 0.4 30 30 60 58 49 42 67 95 94 95 76 GGFGSVVLADW 843 KAEPAPEPV 5.7 64 469.2532 2 12.258 0.3 63 63 83 26 26 26 94 94 94 KAEPAPEPV 3660 MGPSLMATGTPPV 8.3 64 629.811 2 45.092 1.6 59 48 37 69 69 87 93 74 66 65 68 63 26 MGPSLMATGTPPV 1149 KQYEEGGAAELEGSLK 10.2 64 854.9231 2 15.57 0.1 32 38 34 62 67 84 78 76 79 81 92 92 72 51 37 39 KQYEEGGAAELEGSLK 942 LDKMMPK 4.5 64 431.7301 2 13.35 0.5 70 55 59 77 68 65 48 LDKMMPK 3725 RVPSATSTPA 6.4 64 493.7667 2 45.882 0.4 26 26 87 80 80 26 59 79 85 85 RVPSATSTPA 2281 FTLHDVDEM(+15.99)PCK 7.6 64 725.8217 2 28.187 1.4 51 55 84 88 90 90 90 90 26 30 35 29 FTLHDVDEM(+15.99)PCK 729 DFETSGA 4.5 64 726.2943 1 10.889 0.3 26 26 96 93 87 87 26 DFETSGA 2005 EPTEATKFGR 6.4 64 568.2904 2 24.797 0.5 26 26 96 93 80 67 59 63 70 53 EPTEATKFGR 1839 TGM(+15.99)PPDVAGNVDYKVK 10.2 64 853.9236 2 22.904 1.1 28 34 36 80 29 76 89 92 90 71 80 86 82 48 61 30 TGM(+15.99)PPDVAGNVDYKVK 2890 S(+79.97)LAGPGNK 5.1 64 823.3685 1 35.669 3 96 92 81 73 56 41 40 26 S(+79.97)LAGPGNK 3211 EEPSDKVKVK 6.4 64 579.8215 2 39.634 0.6 26 92 92 69 53 54 69 76 60 41 EEPSDKVKVK 2673 FAQM(+15.99)DEVKDNMNK 8.3 64 793.3553 2 33.057 3.1 74 80 74 97 98 96 75 41 40 34 35 42 36 FAQM(+15.99)DEVKDNMNK 3975 GT(+79.97)ADVVAVVKGPTDA 9.5 64 740.3595 2 48.962 1.9 43 55 71 79 70 60 50 53 74 69 68 77 76 73 26 GT(+79.97)ADVVAVVKGPTDA 1467 TNTSDGVRPFVA 7.6 64 632.3204 2 18.906 0.7 33 31 50 64 92 92 92 83 74 41 50 55 TNTSDGVRPFVA 951 QESQLAGEYKEA 7.6 64 676.8197 2 13.455 0.5 38 39 44 43 83 90 92 94 96 54 43 42 QESQLAGEYKEA 1019 SM(+15.99)LCKK 3.8 64 363.1884 2 14.193 1.5 97 95 64 57 40 26 SM(+15.99)LCKK 743 NKKLHPTGGPGMY 8.3 64 700.3631 2 11.061 2.8 32 32 43 64 74 82 82 73 78 83 75 77 26 NKKLHPTGGPGMY 2554 S(+79.97)LASHTK 4.4 64 823.3685 1 31.587 2.9 96 96 84 48 47 45 26 S(+79.97)LASHTK 3376 EFPGLFHNLRK 7 64 679.3716 2 41.667 1.2 90 90 84 79 67 72 85 39 30 30 28 EFPGLFHNLRK 1882 FGGELVAGGVCV 7.6 64 1107.551 1 23.387 0.4 28 78 77 79 93 83 52 52 73 44 42 55 FGGELVAGGVCV 3996 LLHHAAGMLNLVCR 8.9 64 516.6157 3 49.216 1.9 96 94 94 67 68 58 56 59 69 41 41 46 49 42 LLHHAAGMLNLVCR 2418 WSDMENGELDLK 7.6 64 718.8233 2 29.896 2.2 26 26 97 94 86 71 72 56 48 53 77 50 WSDMENGELDLK 1302 LYPRGCAKTVHLK 8.3 63 743.4194 2 17.184 3 69 68 90 59 53 60 68 78 73 75 44 50 32 LYPRGCAKTVHLK 2499 VFDARGAQSSNMEAWK 10.2 63 599.618 3 30.912 0.6 51 54 50 53 53 46 38 38 85 96 82 90 82 68 72 50 VFDARGAQSSNMEAWK 2253 SCDPVLVAGNVDYK 8.9 63 740.36 2 27.841 1.4 26 26 26 26 26 92 90 92 91 73 81 81 84 66 SCDPVLVAGNVDYK 760 SAETELGSLA 6.3 63 489.243 2 11.271 0.2 65 68 90 86 70 38 37 37 66 71 SAETELGSLA

PAGE 435

435 3534 FAESADGAVEDFEKA 9.5 63 793.3564 2 43.572 2.5 26 78 69 64 68 79 73 75 90 94 99 26 34 37 31 FAESADGAVEDFEKA 2977 M(+15.99)EPCGSTLDVAAGPCLK 10.8 63 854.3895 2 36.752 1.9 26 26 71 63 71 91 90 81 73 60 61 67 70 64 57 59 39 M(+15.99)EPCGSTLDVAAGPCLK 2485 YPCLDL 3.8 63 723.3372 1 30.735 1.3 67 67 67 96 26 54 YPCLDL 2878 KTKKDDPSGDSCYVEKVV 11.4 63 666.6657 3 35.519 1.1 61 64 84 77 75 63 55 64 42 40 40 71 70 81 70 69 81 26 KTKKDDPSGDSCYVEKVV 1949 FGDALAAVTGW 7 63 554.2773 2 24.129 0.4 41 57 76 95 95 81 51 45 50 74 26 FGDALAAVTGW 1113 DDLQAEEDQVSK 7.6 63 688.8125 2 15.186 0.1 29 32 32 45 90 95 95 89 51 78 92 26 DDLQAEEDQVSK 3348 M(+15.99)NLSHQLTSYYAA 8.2 63 757.8524 2 41.318 2.1 54 49 75 81 76 57 75 67 68 65 56 57 37 M(+15.99)NLSHQLTSYYAA 1051 EPAVCGALK 5.7 63 444.2362 2 14.527 0.3 26 63 48 41 50 66 86 89 95 EPAVCGALK 841 NLETEKDDLK 6.3 63 602.8065 2 12.227 0.2 56 65 90 92 65 43 54 54 66 43 NLETEKDDLK 1779 WVPDNAMGEQLDNLRK 10.1 63 629.3129 3 22.257 0.9 36 36 66 70 36 41 48 75 77 69 96 95 82 57 69 49 WVPDNAMGEQLDNLRK 2799 EAYLPMLK 5.1 63 482.762 2 34.581 0.4 26 79 78 90 86 53 55 36 EAYLPMLK 2098 DLVNLNM(+15.99)TVF 6.3 63 591.2955 2 25.938 2.8 26 65 54 46 52 61 71 75 82 94 DLVNLNM(+15.99)TVF 3012 EPGSLDVPGQPL 7.6 63 604.8116 2 37.182 0.3 90 90 85 87 93 26 26 65 52 29 49 60 EPGSLDVPGQPL 2207 LGVLDLAGF 5.7 63 904.5139 1 27.265 0.1 39 35 37 72 81 69 57 80 93 LGVLDLAGF 3004 NVEFGSDVECASEPV 9.5 63 791.3394 2 37.086 1.5 38 38 53 78 64 62 74 77 75 75 70 70 58 60 48 NVEFGSDVECASEPV 1889 NNKNGALVEDLMVDVWV 10.7 63 639.3232 3 23.461 1.5 35 33 30 32 37 48 50 61 90 95 95 95 95 95 69 53 52 NNKNGALVEDLMVDVWV 3251 Y(+79.97)LRASPCGSGLAKLDNLGVK 12.6 63 714.6977 3 40.131 0.4 32 37 30 39 42 51 45 43 51 66 73 84 87 87 87 74 83 80 78 83 Y(+79.97)LRASPCGSGLAKLDNLGVK 4083 M(+15.99)TLVPVNGEEGCW 8.2 63 725.8202 2 50.307 0.8 59 61 85 89 80 73 54 63 65 65 49 44 26 M(+15.99)TLVPVNGEEGCW 3824 LKVLDNEI 5 63 472.2763 2 47.093 0.6 67 65 72 59 71 52 62 52 LKVLDNEI 3467 M(+15.99)DMVY(+79.97) 3.2 63 377.6133 2 42.767 0.9 26 26 87 87 87 M(+15.99)DMVY(+79.97) 1390 LQELL 3.2 63 615.3712 1 18.111 0.1 74 60 76 78 26 LQELL 1097 AEVAETQVNKLR 7.6 63 679.3748 2 15.005 0.7 29 29 29 93 93 87 57 80 55 74 77 47 AEVAETQVNKLR 3142 Y(+79.97)NGALPRLVVVYVEYY 10.1 63 666.6651 3 38.779 1.7 45 44 38 56 44 39 45 69 72 83 85 89 90 85 92 26 Y(+79.97)NGALPRLVVVYVEYY 1210 RCNLSGAAGPVK 7.6 63 586.8123 2 16.209 2.5 45 45 55 65 61 56 56 65 61 75 82 84 RCNLSGAAGPVK 1896 ACMPPDVAGNVDYKDYK 10.7 63 943.4267 2 23.536 0.1 28 39 42 85 75 85 93 92 70 55 60 93 70 51 41 43 42 ACMPPDVAGNVDYKDYK 1325 TLMLGALCMPVLL 8.2 63 458.9236 3 17.421 0.3 77 70 49 46 50 61 85 88 89 92 44 35 27 TLMLGALCMPVLL 3304 MVGVGGTGEVAI 7.6 63 545.2841 2 40.787 0.1 58 59 71 74 63 63 55 56 58 57 74 63 MVGVGGTGEVAI 870 EQFEEEQEAK 6.3 63 633.7776 2 12.558 0.2 35 35 30 47 98 94 78 74 77 57 EQFEEEQEAK 1378 SSSDKVLADEGKKK 8.8 63 497.9371 3 17.983 2.9 26 52 64 53 53 61 94 93 93 79 76 79 26 26 SSSDKVLADEGKKK 1979 LVAKDFNGAPW 6.9 63 609.3198 2 24.491 0.9 81 68 63 48 48 88 69 60 60 75 26 LVAKDFNGAPW 3576 SPNLMDF 4.4 63 823.3674 1 44.085 2.4 65 65 60 63 67 91 26 SPNLMDF

PAGE 436

436 2947 M(+15.99)S(+79.97)LKRAAMLAPHHI 8.8 63 836.416 2 36.377 1.5 26 26 85 80 65 60 72 66 73 78 67 75 75 26 M(+15.99)S(+79.97)LKRAAMLAPHHI 2970 NHLEEGYMDLMV 7.5 63 725.8209 2 36.666 0.4 43 43 47 81 80 75 72 77 49 61 77 43 NHLEEGYMDLMV 3496 MDLPTF 3.8 63 723.3376 1 43.12 0.8 76 76 85 55 55 26 MDLPTF 3027 MEKCGPAKSSNMGNKSK 10.7 63 599.6184 3 37.364 2.4 33 32 32 36 61 69 65 70 93 96 88 84 68 58 71 75 26 MEKCGPAKSSNMGNKSK 761 GTSPNLSAGA 6.3 63 437.7169 2 11.281 0.2 29 33 38 58 57 91 97 97 98 26 GTSPNLSAGA 2927 VRLPEDAMMPGYF 8.2 63 763.3638 2 36.129 1.7 44 37 43 58 64 61 76 91 95 84 63 59 35 VRLPEDAMMPGYF 2261 MMS(+79.97)GRCDCVY(+79.97)Y(+79.97) 6.9 63 523.1135 3 27.94 42.6 26 73 50 70 74 75 68 75 75 73 26 MMS(+79.97)GRCDCVY(+79.97)Y(+79.97) 2923 ELELAPGAAVSGI 8.2 63 613.8351 2 36.076 0.3 26 52 74 81 74 66 53 55 53 58 60 78 80 ELELAPGAAVSGI 2379 M(+15.99)EHGVVAMLVKK 7.5 63 679.3716 2 29.416 2.1 26 93 85 80 76 66 61 45 46 66 67 38 M(+15.99)EHGVVAMLVKK 2719 MTAQLVSEV 5.6 63 977.4969 1 33.607 0.3 93 92 86 59 76 77 26 26 26 MTAQLVSEV 3289 M(+15.99)MCNCGCAAY(+79.97) 6.3 63 581.6481 2 40.602 0.4 26 91 62 52 86 74 54 56 64 57 M(+15.99)MCNCGCAAY(+79.97) 2301 M(+15.99)CLLGTPLSSNPVCMSK 10.7 63 599.6184 3 28.446 0.3 43 42 45 48 38 39 63 69 99 95 84 77 68 62 62 77 48 M(+15.99)CLLGTPLSSNPVCMSK 945 KLDLPEATKEKK 7.5 63 467.2766 3 13.389 0.2 71 46 42 59 78 97 96 82 34 33 64 45 KLDLPEATKEKK 1236 SDLTEQI 4.4 63 805.3928 1 16.48 1.1 26 81 81 83 50 63 52 SDLTEQI 1740 AEPVEALVNSK 6.9 63 578.8141 2 21.83 0.2 26 80 69 68 69 78 72 51 45 69 57 AEPVEALVNSK 3569 DNFKVLADASR 6.9 63 618.3239 2 44.002 2.2 39 44 47 87 66 59 63 67 78 82 51 DNFKVLADASR 3258 VLPLLGW 4.4 63 399.2503 2 40.218 1.8 26 75 63 52 80 88 51 VLPLLGW 3097 YPGGDALNEMELGA 8.8 63 718.8236 2 38.211 2.6 48 43 47 50 47 50 72 57 77 85 87 66 67 72 YPGGDALNEMELGA 2267 WKTRCVADLTW 6.9 63 460.237 3 28.015 2.1 55 55 42 60 64 85 79 73 68 66 37 WKTRCVADLTW 3617 STKSDGVRQNTA 7.5 63 632.3204 2 44.565 3.7 63 72 87 88 86 80 68 45 44 34 48 30 STKSDGVRQNTA 946 ADAKSY 3.8 63 654.3102 1 13.396 1.5 55 58 85 76 73 26 ADAKSY 2014 LKLGTLEEMVGDEAGRV 10.6 63 908.9766 2 24.912 0.7 27 35 49 60 65 90 95 94 68 57 57 77 83 57 47 46 48 LKLGTLEEMVGDEAGRV 1605 KKTLAPYNMEASGDDNLPPK 12.5 63 730.3694 3 20.41 1.4 83 85 59 56 44 36 37 44 39 60 62 60 57 76 90 80 83 86 77 26 KKTLAPYNMEASGDDNLPPK 935 SVAGDNSPSLK 6.9 63 537.7756 2 13.278 1.5 31 31 31 66 72 77 85 87 75 80 48 SVAGDNSPSLK 3527 LFAGMVGATNDKDEV 9.4 63 783.877 2 43.489 0 57 62 91 95 97 94 55 43 50 61 61 56 39 41 28 LFAGMVGATNDKDEV 1189 QMEMNELDGELKK 8.1 62 782.8715 2 15.98 0.7 64 77 90 84 39 40 82 80 66 49 44 52 40 QMEMNELDGELKK 1151 M(+15.99)CPMAELAGPRVNSK 9.4 62 810.3909 2 15.586 2.6 26 65 65 69 87 88 87 78 76 80 46 34 33 49 47 M(+15.99)CPMAELAGPRVNSK 3604 M(+15.99)VFLPLADASR 6.9 62 412.5521 3 44.417 2.9 26 26 26 27 85 94 91 89 80 81 57 M(+15.99)VFLPLADASR 2215 NLEVTVK 4.4 62 401.7371 2 27.359 0 26 99 90 90 44 51 33 NLEVTVK 921 RTLAAGDEEMEKLK 8.7 62 530.9434 3 13.131 0 30 31 37 52 67 73 88 96 26 86 84 81 90 26 RTLAAGDEEMEKLK 948 RNEGFSPRR 5.6 62 559.7938 2 13.414 0.9 72 56 50 64 89 89 84 26 26 RNEGFSPRR

PAGE 437

437 925 TSRSSRTDA 5.6 62 490.7412 2 13.168 0.4 46 52 73 26 78 79 87 90 26 TSRSSRTDA 1381 YAPEELKCAA 6.2 62 547.7633 2 18.01 0.8 26 26 26 26 97 96 95 75 67 84 YAPEELKCAA 1799 DSDLEAEASAGLFGLL 10 62 804.3953 2 22.467 2.3 26 82 85 94 97 97 92 64 43 42 49 50 51 41 47 29 DSDLEAEASAGLFGLL 3474 EPTEKTAFGR 6.2 62 568.2906 2 42.849 0.1 26 26 98 94 76 62 57 70 70 38 EPTEKTAFGR 3483 STQSDGVRQSKA 7.5 62 632.3196 2 42.963 2.5 60 60 55 88 93 92 91 75 31 31 32 36 STQSDGVRQSKA 3096 LLDM(+15.99)APMVYLRPL 8.1 62 516.6154 3 38.201 0.6 87 57 43 42 56 61 66 77 84 84 46 64 35 LLDM(+15.99)APMVYLRPL 2760 FGGADALVAGMVK 8.1 62 618.3245 2 34.096 2.9 27 60 80 91 92 81 81 60 54 53 45 45 34 FGGADALVAGMVK 1001 ELVVTVQELVDASER 9.3 62 562.9667 3 13.985 3 46 46 46 26 52 48 44 91 96 95 89 86 65 64 31 ELVVTVQELVDASER 2643 YLPGGNSKHKTR 7.5 62 679.3715 2 32.69 1.8 85 83 92 86 48 46 55 88 44 40 42 33 YLPGGNSKHKTR 4034 LYPPANPACRKK 7.5 62 679.3722 2 49.698 2.8 71 71 95 76 66 49 65 63 61 51 48 26 LYPPANPACRKK 2398 SDVPAVGAELVGL 8.1 62 613.8345 2 29.654 0.6 81 81 81 49 36 34 52 68 60 56 49 78 78 SDVPAVGAELVGL 3219 GMQSANVGGTTKL 8.1 62 632.3199 2 39.743 2.9 63 63 73 89 79 64 79 78 60 58 36 30 28 GMQSANVGGTTKL 4152 MVAETGNALLA 6.8 62 545.2849 2 51.163 1.6 93 93 92 88 47 45 50 52 46 37 36 MVAETGNALLA 2274 MPMVTTGGAKF 6.8 62 570.2843 2 28.1 2.2 80 84 74 73 74 59 54 54 46 45 36 MPMVTTGGAKF 2937 M(+15.99)TVSADQVEDFGASL 9.3 62 793.354 2 36.259 2.7 38 38 42 71 70 78 53 67 93 98 95 73 38 35 36 M(+15.99)TVSADQVEDFGASL 2085 MDLFGNSSLAR 6.8 62 605.7996 2 25.777 2.7 69 69 93 86 86 49 44 62 43 44 32 MDLFGNSSLAR 730 Y(+79.97)LPM(+15.99)SEVAHKA 6.8 62 671.2989 2 10.898 0.2 26 47 44 79 86 91 86 85 54 51 30 Y(+79.97)LPM(+15.99)SEVAHKA 2821 TM(+15.99)LSCAGGGYEAFK 8.7 62 725.8212 2 34.833 0.8 57 55 82 77 67 63 63 47 54 68 82 61 49 37 TM(+15.99)LSCAGGGYEAFK 1599 KPGSDNVTTVFHA 8.1 62 686.8453 2 20.341 1.5 73 73 78 83 74 68 89 74 45 40 50 26 26 KPGSDNVTTVFHA 1158 NLQQEI 3.7 62 744.3887 1 15.658 0.2 52 70 63 49 91 45 NLQQEI 2067 LLDGGSLGPSPI 7.5 62 1125.614 1 25.557 0.9 78 80 80 91 77 61 62 64 69 26 26 26 LLDGGSLGPSPI 1420 MVDVSSAATL 6.2 62 993.4928 1 18.415 0.7 26 65 60 60 61 53 54 75 80 83 MVDVSSAATL 919 ALGKGGYDKYV 6.8 62 1170.617 1 13.099 1.9 55 52 68 69 77 82 73 63 41 50 47 ALGKGGYDKYV 3779 EQLFEI 3.7 62 778.3978 1 46.529 0.3 43 41 49 52 91 94 EQLFEI 4028 KSGMDGNSGLKVA 8.1 62 632.3201 2 49.625 2.6 43 39 37 40 86 89 72 69 66 56 60 78 64 KSGMDGNSGLKVA 1221 MVSQNGTGANTLL 8.1 62 653.3267 2 16.331 0.5 86 86 86 66 59 61 47 47 41 40 61 84 36 MVSQNGTGANTLL 1767 DVLASMGQL 5.6 62 933.4713 1 22.129 0.3 26 94 94 82 69 51 47 50 39 DVLASMGQL 3850 FAESADQVEDFEKA 8.7 62 793.3533 2 47.4 1.4 26 91 88 78 75 57 41 55 87 98 26 49 51 39 FAESADQVEDFEKA 2039 YVKPPVDF 5 62 482.7618 2 25.215 2.7 26 26 47 47 87 86 86 86 YVKPPVDF 1192 GRNLKNR 4.3 62 429.2567 2 16.015 0.3 47 55 70 73 65 67 54 GRNLKNR 1545 VLNLCHKQPKLVSLS(+79.97)V 9.9 62 620.0068 3 19.757 2.2 91 91 82 78 62 49 36 32 50 49 85 89 54 54 54 26 VLNLCHKQPKLVSLS(+79.97)V

PAGE 438

438 4104 M(+15.99)LQMVTTAGQKDDL 8.7 62 783.877 2 50.555 2.3 62 61 59 96 95 95 61 48 52 35 37 56 76 26 M(+15.99)LQMVTTAGQKDDL 1505 LEELESNGLEAEGV 8.7 62 744.8569 2 19.306 0.2 26 26 26 99 95 52 37 47 87 97 94 56 56 59 LEELESNGLEAEGV 2023 AVFPSLACL 5.6 62 920.4907 1 25.016 0.3 56 61 88 95 26 83 54 56 33 AVFPSLACL 1956 RRYTKKLGHLSDLTEKLNDY(+79.97) 12.4 62 844.0972 3 24.216 1.6 26 32 36 38 48 48 42 49 72 89 94 94 94 94 93 84 76 41 52 28 RRYTKKLGHLSDLTEKLNDY(+79.97) 2875 MLGEGASGVGLV 7.4 62 545.2841 2 35.476 0.1 54 56 63 82 50 42 36 37 50 85 89 93 MLGEGASGVGLV 1392 CMFEKKSGPTPT(+79.97)QTV 9.3 62 867.3876 2 18.126 2.3 26 26 26 89 89 98 94 81 74 70 67 84 31 31 33 CMFEKKSGPTPT(+79.97)QTV 1732 M(+15.99)VDPVF 3.7 62 723.3381 1 21.758 0.1 97 97 97 26 26 26 M(+15.99)VDPVF 1579 GTFPPDVADTFSNK 8.7 62 748.3578 2 20.112 1.4 38 37 54 96 96 83 76 75 62 59 42 42 52 45 GTFPPDVADTFSNK 3707 TFGPYSLAADFYK 8 62 740.3597 2 45.667 2.1 31 31 52 92 82 70 71 64 52 51 72 72 56 TFGPYSLAADFYK 2169 VM(+15.99)DDLAALSSNMEAVSK 10.5 62 599.6184 3 26.796 0.1 44 44 46 55 54 58 76 70 78 96 84 81 71 45 40 47 50 VM(+15.99)DDLAALSSNMEAVSK 3588 GFGELLNGCVV 6.8 62 554.2773 2 44.223 2.5 27 27 96 96 90 53 52 67 52 52 61 GFGELLNGCVV 1735 DFETSQLI 4.9 62 952.4618 1 21.779 0.4 26 26 98 95 84 57 78 26 DFETSQLI 973 LKEEAGEAL 5.6 62 959.5042 1 13.672 0.2 44 43 73 87 65 57 51 60 71 LKEEAGEAL 2569 LRSAGAMMAMNKFPF 9.3 62 836.4143 2 31.768 2.7 37 38 44 51 66 63 76 76 76 77 77 81 67 61 26 LRSAGAMMAMNKFPF 2109 LQTLLDQI 4.9 62 472.2768 2 26.073 0.5 81 60 55 56 81 50 57 50 LQTLLDQI 526 MKGQEGS(+79.97)SGGELA 8 62 665.7698 2 8.06 1.6 78 71 93 68 89 90 88 41 48 40 29 29 31 MKGQEG