<%BANNER%>

Ms. Pilgrim's Precedents

Permanent Link: http://ufdc.ufl.edu/UFE0022621/00001

Material Information

Title: Ms. Pilgrim's Precedents Leta Hollingworth's Conceptions of Race, Class, and the Importance of Educating Gifted Children
Physical Description: 1 online resource (78 p.)
Language: english
Creator: Butcher, Colleen
Publisher: University of Florida
Place of Publication: Gainesville, Fla.
Publication Date: 2008

Subjects

Subjects / Keywords: class, education, gifted, giftedness, history, hollingworth, iq, leta, race, socioeconomic, teaching
Teaching and Learning -- Dissertations, Academic -- UF
Genre: Foundations of Education thesis, M.A.E.
bibliography   ( marcgt )
theses   ( marcgt )
government publication (state, provincial, terriorial, dependent)   ( marcgt )
born-digital   ( sobekcm )
Electronic Thesis or Dissertation

Notes

Abstract: This thesis examines Leta Hollingworth's views of race and class in relation to giftedness, and her opinion about the importance of gifted education. Hollingworth was an eminent educational psychologist in the early twentieth century and one of the founders of gifted education. Her views on race and class were complicated, but they were generally more progressive than the opinions of her eminent peers like E. L. Thorndike and Lewis Terman. She observed racial and class differences in intelligence test scores, but did not necessarily attribute these discrepancies to inherent biological differences. Also, she advocated the need for gifted education because she strongly believed that highly intelligent children were destined to become the leaders and innovators of society in the future. This study helps to establish her views to expand the scholarship about Hollingworth specifically, but also to determine how she influenced and set precedents for future educational psychologists.
General Note: In the series University of Florida Digital Collections.
General Note: Includes vita.
Bibliography: Includes bibliographical references.
Source of Description: Description based on online resource; title from PDF title page.
Source of Description: This bibliographic record is available under the Creative Commons CC0 public domain dedication. The University of Florida Libraries, as creator of this bibliographic record, has waived all rights to it worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.
Statement of Responsibility: by Colleen Butcher.
Thesis: Thesis (M.A.E.)--University of Florida, 2008.
Local: Adviser: Terzian, Sevan G.

Record Information

Source Institution: UFRGP
Rights Management: Applicable rights reserved.
Classification: lcc - LD1780 2008
System ID: UFE0022621:00001

Permanent Link: http://ufdc.ufl.edu/UFE0022621/00001

Material Information

Title: Ms. Pilgrim's Precedents Leta Hollingworth's Conceptions of Race, Class, and the Importance of Educating Gifted Children
Physical Description: 1 online resource (78 p.)
Language: english
Creator: Butcher, Colleen
Publisher: University of Florida
Place of Publication: Gainesville, Fla.
Publication Date: 2008

Subjects

Subjects / Keywords: class, education, gifted, giftedness, history, hollingworth, iq, leta, race, socioeconomic, teaching
Teaching and Learning -- Dissertations, Academic -- UF
Genre: Foundations of Education thesis, M.A.E.
bibliography   ( marcgt )
theses   ( marcgt )
government publication (state, provincial, terriorial, dependent)   ( marcgt )
born-digital   ( sobekcm )
Electronic Thesis or Dissertation

Notes

Abstract: This thesis examines Leta Hollingworth's views of race and class in relation to giftedness, and her opinion about the importance of gifted education. Hollingworth was an eminent educational psychologist in the early twentieth century and one of the founders of gifted education. Her views on race and class were complicated, but they were generally more progressive than the opinions of her eminent peers like E. L. Thorndike and Lewis Terman. She observed racial and class differences in intelligence test scores, but did not necessarily attribute these discrepancies to inherent biological differences. Also, she advocated the need for gifted education because she strongly believed that highly intelligent children were destined to become the leaders and innovators of society in the future. This study helps to establish her views to expand the scholarship about Hollingworth specifically, but also to determine how she influenced and set precedents for future educational psychologists.
General Note: In the series University of Florida Digital Collections.
General Note: Includes vita.
Bibliography: Includes bibliographical references.
Source of Description: Description based on online resource; title from PDF title page.
Source of Description: This bibliographic record is available under the Creative Commons CC0 public domain dedication. The University of Florida Libraries, as creator of this bibliographic record, has waived all rights to it worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.
Statement of Responsibility: by Colleen Butcher.
Thesis: Thesis (M.A.E.)--University of Florida, 2008.
Local: Adviser: Terzian, Sevan G.

Record Information

Source Institution: UFRGP
Rights Management: Applicable rights reserved.
Classification: lcc - LD1780 2008
System ID: UFE0022621:00001


This item has the following downloads:


Full Text

PAGE 1

063,/*5,0635(&('(176/(7$+2//,1*:257+6&21&(37,2162)5$&( &/$66$1'7+(,03257$1&(2)('8&$7,1**,)7('&+,/'5(1 %\ &2//((10$5*$5(7%87&+(5 $ 7+(6,6 35(6(17('727+(*5$'8$7(6&+22/ 2)7+(81,9(56,7<2))/25,'$ ,13$57,$/)8/),//0(17 2)7+(5(48,5(0(176)257+('(*5((2) 0$67(52)$576,1('8&$7,21 81,9(56,7<2))/25,'$

PAGE 2

‹ &ROOHHQ0DUJDUHW%XWFKHU

PAGE 3

7RP\SDUHQWV

PAGE 4

$&.12:/('*0(176 ,WKDQNP\IDPLO\IR UDOORIWKHLUFRQWLQXHGVXSSRUWDQGHQFRXUDJHPHQW,DOVRWKDQNP\ DGYLVHU6HYDQ7HU]LDQIRUKLVXQHQGLQJSDWLHQFHDQGJXLGDQFH

PAGE 5

7$%/(2)&217(176 SDJH $&.12:/('*0(176 $%675$&7 &+$37(5 ,1752'8&7,21 5$&(&/$66$1':+<:(('8&$7(*,)7('&+,/'5(1 5DFH 6RFLRHFRQRPLF&ODVV 7KH,PSRUWDQFHRI(GXFDWLQJ*LIWHG&KLOGUHQ &21&/86,21 /,672)5()(5(1&(6 %,2*5$3+,&$/6.(7&+

PAGE 6

$EVWUDFWRI7KHVLV3UHVHQWHGWRWKH*UDGXDWH6FKRRO RIWKH8QLYHUVLW\RI)ORULGDLQ3DUWLDO)XOILOOPHQWRIWKH 5HTXLUHPHQWVIRUWKH'HJUHHRI0DVWHURI$UWVLQ(GXFDWLRQ 063,/*5,0635(&('(176/(7$+2//,1*:257+6&21&(37,2162) 5$&( &/$66$1'7+(,03257$1&(2)('8&$7,1**,)7('&+,/'5(1 %\ &ROOHHQ0 DUJDUHW %XWFKHU $XJXVW &KDLU6HYDQ7HU]LDQ &RFKDLU(OL]DEHWK%RQG\ 0DMRU)RXQGDWLRQVRI(GXFDWLRQ ,H[DPLQHG/HWD+ROOLQJZRUWKVYLHZVRIUDFHDQGVRFLRHFRQRPLFFODVVLQ UHODWLRQWR LQWHOOLJHQFHDQGKHURSLQLRQDVWRZK\LWZDVLPSRUWDQWWRHGXFDWHJLIWHGFKLOGUHQ+ROOLQJZRUWK ZDVRQHRIWKHPRVWHPLQHQWHGXFDWLRQDOSV\FKRORJLVWVLQWKHHDUO\WZHQWLHWKFHQWXU\DQGRQHRI WKHIRXQGHUVRIJLIWHGHGXFDWLRQLQ$PHULFD6KH KDVRIWHQEHHQRPLWWHGLQVFKRODUVKLSLQJLIWHG HGXFDWLRQRUHGXFDWLRQDOSV\FKRORJ\EXWZKHQVKHKDVEHHQDFNQRZOHGJHGLWKDVEHHQIRUKHU ZRUNRQWKHSV\FKRORJ\RIZRPHQRUKHUUHVHDUFKDQGSURJUDPVLQJLIWHGHGXFDWLRQ7KLVVWXG\ VRXJKWWRH[SDQGWKHH [LVWLQJERG\RINQRZOHGJHDERXW+ROOLQJZRUWKDQGWRGHWHUPLQHKRZKHU ZRUNVHWSUHFHGHQWVIRUIXWXUHHGXFDWRUVDQGHGXFDWLRQDOSV\FKRORJLVWV /LNHRWKHUVRFLDOVFLHQWLVWVLQWKHHDUO\WZHQWLHWKFHQWXU\+ROOLQJZRUWKREVHUYHG GLIIHUHQFHVLQWHVWVFRUHVE HWZHHQGLIIHUHQWUDFLDOJURXSV6KHGLGQRWDVVXPHWKDWELRORJLFDO GLIIHUHQFHVZHUHUHVSRQVLEOHIRUWKHVHGLVFUHSDQFLHVEXWLQVWHDGRIIHUHGSRWHQWLDODOWHUQDWLYH H[SODQDWLRQVIRUWKHVHILQGLQJV6KHDOVREHOLHYHGWKDWVRPHUDFHVZHUHPRUHDGYDQFHGWKDQ RW KHUV$OWKRXJKVKHIRXQGWKDWPRVWJLIWHGFKLOGUHQFDPHIURPZKLWHUDFHVVXFKDV(QJOLVK 6FRWWLVKDQG-HZLVKVKHEHOLHYHGWKDWWKHUHZHUHJLIWHGFKLOGUHQLQHYHU\UDFLDOJURXSDQGWKXV VRXJKWRXWDYHU\GLYHUVHSRRORISDUWLFLSDQWVIRUKHUUHVHDUFK DQGKHUJLIWHGSURJUDPVWKDWVKH

PAGE 7

LPSOHPHQWHGDWWZRSXEOLFVFKRROVLQ1HZ
PAGE 8

&+$37(5 ,1752'8&7,21 :KHQVWXG\LQJWKHKLVWRU\RIJLIWHGHGXFDWLRQLWLVFOHDUWKDWJLIWHGQHVVKDVDOZD\VEHHQ FRQWURYHUVLD O)URPLWVEHJLQQLQJDVDILHOGVFKRODUVKDYHDVNHGKRZGRZHGHILQHZKDWLV JLIWHG"+RZGRZHLGHQWLI\JLIWHGFKLOGUHQ"$QGZKDWGRZHGRZLWKWKHPRQFHZHKDYH LGHQWLILHGWKHP"$GGLWLRQDOO\JLIWHGHGXFDWLRQWRGD\LVFRQIURQWHGE\PDQ\RIWKHVDPH LPS OHPHQWDWLRQSUREOHPVWKDWLWIDFHGDWLWVLQFHSWLRQLQWKHHDUO\WZHQWLHWKFHQWXU\$OPRVWD KXQGUHG\HDUVODWHUHGXFDWRUVVWLOOGHEDWHZKDWW\SHRIFXUULFXOXPDQGPHWKRGVDUHPRVW DSSURSULDWHIRUWKHVHFKLOGUHQKRZWRGHDOZLWKWKHLUXQLTXHVRFLDOSUREO HPVDQGZK\ZHVKRXOG HYHQEHLQYHVWLQJLQSURYLGLQJWKHPVSHFLDOHGXFDWLRQ7KHLVVXHVRIUHSUHVHQWDWLRQFRQWLQXHWR EHSUREOHPDWLF6WXGHQWVIURPPLQRULW\HWKQLFJURXSVDQGIURPWKHORZHUVRFLRHFRQRPLFFODVV DUHVWLOOXQGHUUHSUHVHQWHGLQJLIWHGSURJUDPV $OWKRXJKWKHVROXWLRQVWRWKHVHSUREOHPVPD\QRW EHHYLGHQWWRGD\ZHFDQJDLQLQVLJKWE\ORRNLQJWRKRZWKHIRXQGHUVRIJLIWHGHGXFDWLRQ DGGUHVVHGWKHVHLVVXHVLQWKHSDVWLQFOXGLQJVRPHRIWKHSUHFHGHQWVVHWE\/HWD6WHWWHU +ROOLQJZRUWKZKLFKKDYHF RQWLQXHGWRLQIOXHQFHHGXFDWRUVDQGHGXFDWLRQDOSV\FKRORJLVWVWRGD\ ,QWKHHDUO\WZHQWLHWKFHQWXU\+ROOLQJZRUWKZDVRQHRIWKHPRVWVLJQLILFDQWFRQWULEXWRUV WRWKHILHOGVRIHGXFDWLRQDQGSV\FKRORJ\6KHVWXGLHGDZLGHUDQJHRIWRSLFVEXWPRVW VLJQLILFD QWO\IRFXVHGRQWKHSV\FKRORJ\RIZRPHQWKHHGXFDWLRQRIVXEQRUPDOFKLOGUHQRU FKLOGUHQZLWKVSHFLDOGLVDELOLWLHVDQGWKHHGXFDWLRQRIJLIWHGFKLOGUHQ$OWKRXJKVKHZDVDFUXFLDO FRQWULEXWRUGXULQJKHUFDUHHUIURPXQWLOVFKRODUVKLSWRGD\R IWHQRPLWVKHUZKLOH UHFRJQL]LQJVRPHRIKHUFRQWHPSRUDULHVOLNH/HZLV7HUPDQRU)UDQFLV*DOWRQ 6FKRODUVKLS &KULVWLQH/:RERU&HOHEUDWLQJ2XU)XWXUH%\5HYLVLWLQJ2XU3DVW*LIWHG&KLOG7RGD\0DJD]LQHQR f'RQQD<)RUG'HVHJUHJDWLQJ*LIWHG(GXFDWLRQ$1HHG8QPHW7KH-RXUQDORI1HJUR(GXFDWLRQ QRf -DPHV+%RUODQG/HWD+ROOLQJZRUWKV&RQWULEXWLRQVWRWKH3V\FKRORJ\DQG(GXFDWLRQRIWKH*LIWHG 5RHSHU 5HYLHZ QR f

PAGE 9

DERXW+ROOLQJZRUWKKDVJHQHUDOO\IRFXVHGRQKHUFRQWULEXWLRQVWRIHPLQLVWSV\FKRORJ\RUJLIWHG HGXFDWLRQ+RZHYHUIHZVFKRODUVKDYHVWXGLHGKHUY LHZVRQUDFHRUVRFLRHFRQRPLFFODVVLQ UHODWLRQWRLQWHOOLJHQFHRUJLIWHGQHVV1RUKDYHWKH\GLVFXVVHGZK\VKHIHOWWKDWLWZDVLPSRUWDQW WRHGXFDWHJLIWHGFKLOGUHQ7KLVWKHVLVZLOOH[DPLQHWKHVHLVVXHVWRILOOLQWKHJDSLQVFKRODUVKLS DERXWWKLVHPLQHQW HGXFDWLRQDOSV\FKRORJLVW7KLVWRSLFLVLPSRUWDQWQRWRQO\WRXQGHUVWDQGWKH KLVWRU\RIJLIWHGHGXFDWLRQEXWDOVREHFDXVHWKHVHLVVXHVDUHKLJKO\UHOHYDQWWRGD\,QWKHSUHVHQW GD\WKHUHDUHVWLOOUDFLDODQGFODVVGLVSDULWLHVLQWKHGHPRJUDSKLFVRIJLI WHGHGXFDWLRQDQGWKH GHEDWHDERXWZK\RULIZHVKRXOGLQYHVWPRUHLQHGXFDWLQJWKHVHJLIWHGVWXGHQWVFRQWLQXHV$OVR LQH[DPLQLQJKHUYLHZVZHFDQGLVFRYHUSUHFHGHQWVWKDWVKHVHWWKDWKDYHLQIOXHQFHGHGXFDWLRQDO SV\FKRORJLVWVZKRKDYHVXFFHHGHGKHU, QRUGHUWRXQGHUVWDQGWKHSUHVHQWVWDWXVRIWKHVHLVVXHV ZHVKRXOGFRQVLGHUWKHLURULJLQVLQWKHHDUO\GD\VRIJLIWHGHGXFDWLRQ +ROOLQJZRUWKKDVEHHQRQHRIWKHPRVWLQIOXHQWLDOLQGLYLGXDOVLQHGXFDWLRQDOSV\FKRORJ\ DQGVKHPDQDJHGWRDFFRPSOLVKWKLVGH VSLWHPDQ\SHUVRQDODQGSURIHVVLRQDOFKDOOHQJHV%RUQLQ LQ&KDGURQ1HEUDVNDVKHH[SHULHQFHGDWXUEXOHQWFKLOGKRRGLQFOXGLQJWKHGHDWKRIKHU PRWKHUDQDEVHQWHHIDWKHUDQGODWHUDKRUULILFVWHSPRWKHU7KURXJKRXWWKLVWLPHVKHYLHZHG HGXFDWLRQ DVDQRSSRUWXQLW\WRHVFDSHKHUFLUFXPVWDQFHV 6KHJUDGXDWHGKLJKVFKRRODWWKHDJH RIVL[WHHQDQGZHQWRQWRREWDLQKHUEDFKHORUVGHJUHHIURPWKH8QLYHUVLW\RI1HEUDVNDZKHUH VKHDOVRPHWKHUIXWXUHKXVEDQG+DUU\+ROOLQJZRUWK$IWHUWHDFKLQJKLJKVFK RROIRUWZR\HDUVLQ 1HEUDVND/HWD6WHWWHUPDUULHG+DUU\+ROOLQJZRUWKZKLOHKHZDVLQJUDGXDWHVFKRRODW&ROXPELD 8QLYHUVLW\+RZHYHULQ1HZ
PAGE 10

H[LVWHQFHDVDKRXVHZLIH,QVSLWHRIKHULQWHOOLJHQFHDQGDELOLW\VKHZDVIRUFHGLQWRDZRPDQV WUDGLWLRQDOUR OHIRUZKLFKVKHKDGQRGHVLUH $IWHUDIHZ\HDUV+DUU\+ROOLQJZRUWKZDVKLUHGWR UXQDVWXG\IRUWKH&RFD &ROD&RPSDQ\DQGZDVDEOHWRSD\KLVZLIHWRUXQWKHODERUDWRU\ ZKLFKHQDEOHGKHUWRHQWHUDJUDGXDWHSURJUDPLQSV\FKRORJ\DW&ROXPELD8QLYHUVL W\ ,QUHDFWLRQWRKHUH[SHULHQFHZLWKJHQGHUELDV+ROOLQJZRUWKFKRVHWRVWXG\WKH SV\FKRORJ\RIZRPHQDVDJUDGXDWHVWXGHQW6KHGHGLFDWHGERWKKHUPDVWHUVWKHVLVDQGGRFWRUDO GLVVHUWDWLRQWRGHEXQNLQJSRSXODUP\WKVDERXWWKHSHUFHLYHGLQWHOOHFWXDOD QGELRORJLFDO LQIHULRULW\RIZRPHQ+RZHYHUVKHVKLIWHGKHUDWWHQWLRQWRHGXFDWLRQDOSV\FKRORJ\ZKHQ1DRPL 1RUVZRUWK\DSURIHVVRUDW&ROXPELDSDVVHGDZD\DQG+ROOLQJZRUWKZDVDVNHGWREHJLQ WHDFKLQJ1RUVZRUWK\VFODVVHV $WWKHWLPHHGXFDWLRQDOSV\FKR ORJ\ZDVJHQHUDOO\OLPLWHGWRWKH VWXG\RIVXEQRUPDOFKLOGUHQRUFKLOGUHQZLWKSK\VLFDOGLVDELOLWLHV,QIDFW+ROOLQJZRUWK DVVXPHGDFODVVWKDWZDVVSHFLILFDOO\RQVXEQRUPDOFKLOGUHQ'XULQJWKLVFRXUVHVKHUHTXHVWHG WKDWKHUVWXGHQWVUHFRPPHQGWRKHU DFKLOGZKRZDVDERYHDYHUDJHLQLQWHOOLJHQFHVRWKDWVKH PLJKWGHPRQVWUDWHWKHFRQWUDVWEHWZHHQDVXEQRUPDOFKLOGDQGDKLJKO\LQWHOOLJHQWFKLOG&KLOG (ZKRWHVWHGDWDSSUR[LPDWHO\,4ZDVWKHUHVXOWRIKHUVHDUFK6KHIRXQGWKLVFKLOGVPLQG WR EHVRLQVSLULQJWKDWVKHGHFLGHGVKHZDVPRVWLQWHUHVWHGLQVWXG\LQJWKHJLIWHGSRSXODWLRQ WKURXJKRXWKHUFDUHHU +ROOLQJZRUWKZHQWRQWRSXEOLVKQXPHURXVDUWLFOHVDQGERRNVRQWKHWRSLFRIJLIWHG FKLOGUHQLQFOXGLQJVRPHRIWKHPRVWLQIOXHQWLDOZRUNV RQKLJKO\LQWHOOLJHQWFKLOGUHQDQGWKH &DUROH&3HWHUV/HWD6WHWWHU+ROOLQJZRUWK:RPHQDQG*LIWHGQHVV *LIWHG(GXFDWLRQ,QWHUQDWLRQDO QR f $QQ.OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK 6FRWWVGDOH*UHDW3RWHQWLDO3UHVV f +ROOLQJZRUWK /HWD6WHWWHU+ROOLQJZRUWK$%LRJUDSK\ .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUW K

PAGE 11

VRFLDODQGHPRWLRQDOQHHGVRIJLIWHGFKLOGUHQ6KHDOVRIRFXVHGRQKRZEHVWWRHGXFDWHWKHVH JLIWHGFKLOGUHQZKLFKLVVWLOOKLJKO\GHEDWHGWRGD\+RZHYHU+ROOLQJZRUWKLVVRPHZKDWREVFXUH DWWKHSUHVHQWWLPH ,QIDF WWKHUHKDVEHHQDORWRIXQFHUWDLQW\DERXWZKR VKH DFWXDOO\ZDVIRU H[DPSOHRQHDXWKRUUHIHUUHGWR KHUDV 7HUPDQVUHVHDUFKDVVLVWDQW DOWKRXJK 7HUPDQDQG +ROOLQJZRUWKZRUNHGIRULQVWLWXWLRQVDWRSSRVLWHH QGVRIWKHFRXQWU\ :KHQDVNHGWRQDPH PDMRUI RXQGHUVRIJLIWHGHGXFDWLRQDQGWKHLQWHOOLJHQFHPRYHPHQWQDPHVOLNH/HZLV7HUPDQDQG (/7KRUQGLNHFRPHWRPLQGEXW+ROOLQJZRUWKVZRUNLVVLPLODUO\H[WHQVLYH$OWKRXJKKHU FDUHHUZDVFXWVKRUWZKHQVKHSDVVHGDZD\LQDWWKHDJHRIILIW\ WKUHHV KHSURGXFHGDJUHDW ERG\RIOLWHUDWXUHWKDWVWLOOLQIRUPVVHYHUDOILHOGVZLWKLQHGXFDWLRQDQGSV\FKRORJ\:KHQVKHLV UHFRJQL]HGLWLVSULPDULO\LQWKHSV\FKRORJ\RIZRPHQRFFDVLRQDOO\LQRWKHUILHOGVRI HGXFDWLRQDOSV\FKRORJ\EXWPRVWSURPLQHQWO\LQJL IWHGHGXFDWLRQ 7KHWLPHLQZKLFK+ROOLQJZRUWKEHJDQKHUDFDGHPLFFDUHHUWKHVZDVDQLPSRUWDQW SHULRGIRUWKHIHPLQLVWPRYHPHQWLQ$PHULFD7KHODWHQLQHWHHQWKDQGHDUO\WZHQWLHWKFHQWXU\ VDZDJURZLQJGHPDQGIRUWKHULJKWVRIZRPHQWRKDYHPRUHRS SRUWXQLWLHVIRUHPSOR\PHQW WR KDYHFRQWURORYHUWKHLUUHSURGXFWLYHKHDOWKDQG WR KDYHWKHULJKWWRYRWH$OVRDWWKLVWLPH DUPFKDLUSV\FKRORJ\VWDWHPHQWVDERXWWKHGLIIHUHQFHVEHWZHHQPHQDQGZRPHQZHUHYHU\ SUHYDOHQWDQGZHUHFRPPRQO\KHOGWREHVFL HQWLILFDOO\VXSSRUWHG+RZHYHU+ROOLQJZRUWK GLVSXWHGPDQ\RIWKHVHFODLPVDQGFKRVHWRXVHKHUVWXGLHVDVDJUDGXDWHVWXGHQWWRGLVSURYH WKHP6KHQRWRQO\PDQDJHGWRVXFFHHGLQGLVSHOOLQJVRPHRIWKHVHP\WKVEXWVKHGLGVR ZKLOH IDFLQJVLJQLILFDQWGLII LFXOWLHVILQGLQJIXQGVIRU KHUUHVHDUFKLQJUDGXDWHVFKRRO VKHZDV JHQHUDOO\XQDEOHWRREWDLQIXQGLQJDQGKDGWRXVHKHURZQSHUVRQDOPRQH\LQRUGHUWRFRQGXFW 7KRPDV)DJDQ&RQWULEXWLRQVRI/HWD+ROOLQJZRUWKWR6FKRRO3V\FKRORJ\ 5RHSHU5HYLHZ QRf .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK [Y )DJDQ

PAGE 12

KHUUHVHDUFK 6KHIDFHGPDQ\FKDOOHQJHVWKURXJKRXWKHUFDUHHUSDUWLDOO\GXHWRKHUJHQGHUD QG DFFRUGLQJWRWKHELRJUDSK\ZULWWHQE\KHUKXVEDQGWKLVOHGKHUWRKDYHLQWROHUDQFHRIELJRWU\ SRPSDQGEOXII >DQG@ DQ\RQHRUDQ\JURXSWKDWVRXJKWSHUVRQDODGYDQWDJHVE\HYDGLQJ ZKDW VKHFDOOHGWKHUXOHVRIOLIH DSHUVSHFWLYHWKDWZ RXOGLQIOXHQFHKHUGHFLVLRQVDERXWZKDW P\WKVGHPDQGHGFORVHUH[DPLQDWLRQ 7KHYDULDELOLW\K\SRWKHVLV ZDVDSUHYDLOLQJEHOLHI ZKLFKKHOGWKDWPHQZHUHPRUH SK\VLFDOO\DQGPHQWDOO\YDULDEOHWKDQZRPHQZKLFKDFFRUGLQJWR&KDUOHV'DUZLQ PHDQWWKDW PDOHV >ZHUH@SK\VLFDOO\PRUHKLJKO\HYROYHGWKDQIHPDOHVDQGLQWHOOHFWXDOO\VXSHULRUWR IHPDOHV 7KDW WKHUHZHUHPRUHPHQLQLQVWLWXWLRQVIRUWKHIHHEOH PLQGHGDQG WKDW WKHUHKDG EHHQPDQ\PRUHHPLQHQWPHQWKURXJKRXWKLVWRU\WKDQWKHUHKDGEHHQZRPHQ Z HUHXVHGDV HYLGHQFHWRVXSSRUWWKLVDUJXPHQW +ROOLQJZRUWK IRXQGDOWHUQDWHH[SODQDWLRQVIRUWKHVHFODLPV )RUH[DPSOHVKHDUJXHGWKDWPRUHPHQWKDQZRPHQDFKLH YHGHPLQHQFHEHFDXVHHQYLURQPHQWDO IDFWRUVSUHYHQWHG ZRPHQIURPDFKLHYLQJVXFF HVVLQVRFLHW\ 6KHKHOGWKDWEHFDXVHZRPHQZHUH RIWHQIRUFHGWRUHPDLQDWKRPHEHDULQJDQGUDLVLQJFKLOGUHQDQGUXQQLQJDKRXVHKROGWKH\ZHUH GHQLHGWKHRSSRUWXQLW\WRH[FHOLQDQ\VRFLDOO\UHFRJQL]HGGRPDLQRIZRUN ,QWHUHVWLQJO\ HQRXJKVKHIDFHGWKLVSUREOHPRIREW DLQLQJHPLQHQFHSHUVRQDOO\ IRUGLIIHUHQWUHDVRQV KRZHYHU ODWHULQKHUFDUHHUZKHQVKHZDVSUHYHQWHGIURPHQWHULQJJURXSVRUEHLQJLJQRUHGRQ OLVWVRIHPLQHQWSHRSOHVXFKDV-DPHV0F.HHQ&DWWHOOVGLVWLQFWLRQOLVWVGHVSLWHKHUFRPSDUDEOH /LQGD.6LOYHUPDQ/HWD6WHWWHU+ROOLQJZRUWK &KDPSLRQRIWKH3V\FKRORJ\RI:RPHQDQG*LIWHG&KLOGUHQ -RXUQDORI(GXFDWLRQDO3V\FKRORJ\ QRf 0LFKDHO03LHFKRZVNL7KH+HDUWRI/HWD6+ROOLQJZRUWK 5RHSHU5HYLHZ QRf 6WHSKDQLH06KLHOGV7KH9DULDELOLW\+\ SRWKHVLV7KH+LVWRU\RID%LRORJLFDO0RGHORI6H['LIIHUHQFHVLQ ,QWHOOLJHQFH 6LJQV QRf 6LOYHUPDQ/HWD6WHWWHU+ROOLQJZRUWK&KDPSLRQRIWKH3V\FKRORJ\RI:RPHQDQG*LIWHG&KLOGUHQ

PAGE 13

VXFFHVVWRWKHP DOHPHPEHUVRIWKHVHRUJ DQL]DWLRQVRUOLVWV $OVR VKH K\ SRWKHVL]HGWKDWWKH UHDVRQ WKHUHZHUHPRUHPHQLQLQVWLWXWLRQVZDVEHFDXVHZRPHQGLGQRWKDYHWRFRPSHWH HFRQRPLFDOO\ WRWKHVDPHH[WHQWWKDWPHQGLG0 DQ\ZRPHQEHFDPHZLYHVDQGPRWKHUVZKLFK G LG QRWUHTXLUHWKHVDPHOHYHORIPHQWDOFRPSHWHQFHDVPDQ\RIWKHPRUHPDVFXOLQHSURIHVVLRQV RU WKH\ ZHUHDEOHWRXVHWKHLUERGLHVDVSURVWLWXWHVWRVXVWDLQDOLYLQJ6KHODWHUIRXQGDVLPLODU SDWWHUQLQFKLOGUHQEHLQJUHIHUUHGIRUVSHFLDOHGXFDWLRQ%R\V ZHUHIDUPRUHOLNHO\WREHUHIHUUHG IRUVSHFLDOHGXFDWLRQWKDQJLUOVODUJHO\EHFDXVHWKH\DWWUDFWHGPRUHDWWHQWLRQZKHQWKH\ZHUH XQDEOHWRFRPSHWHDFDGHPLFDOO\ ZLWKWKHLUSHHUV 7RH[DPLQHWKLVK\SRWKHVLV+ROOLQJZRUWKFRQGXFWHGVHYHUDOVWXGLHVLQKHU HDUO\\HDUVDV DJUDGXDWHVWXGHQWE\JDWKHULQJLQIRUPDWLRQIURPSHRSOHZKRSDVVHGWKURXJKWKH&OHDULQJ+RXVH IRU0HQWDO'HIHFWLYHVZK HUHVKHZDVHPSOR\HG 7KHGDWDWKDWVKHFROOHFWHGVXSSRUWHGKHU K\SRWKHVLVWKDWIHPDOHVHQWHUHGLQVWLWXWLRQVDWGLIIHUHQW WLPHVDQGIRUGLIIHUHQWUHDVRQVWKDQPDOHV GLG $GGLWLRQDOO\ VKH XV HGWKHUHVHDUFKIRUKHUPDVWHUV WKHVLVWRZRUNWRZDUGGLVSURYLQJWKH YDULDELOLW\K\SRWKHVLVE\REWDLQLQJVHYHUDOW\SHVRISK\VLFDOPHDVXUHPHQWVRIWZRWKRXVDQG LQIDQWVLPPHGLDWHO\DIWHU ELUWK 6KHIHOWWKDWWKLVZDVDEHWWHUZD\WRGHWHUPLQHZKLFKJHQGHULI DQ\ZDVPRUHYDULDEOHEHFDXVHWKLVZRXOGSUHYHQWDQ\HIIHFWRIHQYLURQPHQWIURPLQWHUIHULQJ ZLWKWKHUHVXOWV+HUUHVXOWVVKRZ HG WKDWPDOHVZHUHQRWPRUHYDULDEOHWKDQIHPDOHVDFWX DOO\WKH IHPDOHVKDGVOLJKWO\PRUHYDULDELOLW\WKDQPDOHVWKRXJKWKHGLIIHUHQFHVZHUHQR WYHU\ &LQGHO\Q*UH\ +LVWRULFDOWUHDWPHQWRIIH PDOHSV\FKRORJLVWVRIGLVWLQFWLRQ 3DSHUSUHVHQWHGDWWKH$QQXDO &RQYHQWLRQRIWKH$PHULFDQ3V\FKRORJLFDO$VVRFLDWLRQ0RQWUHDO4XHEHF&DQDGD6HSWHPEHU &DPLOOD%HQERZ/HWD6WHWWHU+ROOLQJZRUWK$3LOJULPLQ5HVHDUFKLQ+HU7LPHDQG2XUV 5RHSHU5HYLHZ QRf /XG\%HQMDPLQ-U/HWD6WHWWHU+ROOLQJZRUWK3V\FKRORJLVW(GXFDWRU)HPLQLVW 5RHSHU5HYLHZ QR f 5KRGD0LOOHU/HWD6WHWWHU+ROOLQJZRUWK3LRQHHU:RPDQRI3V\FKRORJ\ 5RHSHU5HYLHZ QR f

PAGE 14

VLJQLILFDQW +ROOLQJZRUWKFRQGXFWHGWKLVUHVHDUFK DOWKRXJK KHUJUDGXDWHDGYLVRU(/ 7KRUQGLNH ZDV DYRFDOSURSRQHQWRI LQFUHDVHG PDOHYDULDELOLW\DQGZDV QRWNQRZQWREH SDUWLFXODUO\V\PSDWKHWLFWRZDUGZRPHQVLVVXHV 1H[WVKHGHFLGHGWRDGGUHVVWKHDUPFKDLUSV\FKRORJ\P\WKRIIXQFWLRQDOSHULRGLFLW\ ZKLFKZD VWKHDVVXPSWLRQWKD WGXULQJPHQVWUXDWLRQZRPHQZHUH SK\VLFDOO\DQGPHQWDOO\ LPSDLUHGWRWKHSR LQWZKHUHLW DIIHFWHG WKHLUDELOLW\DQGSURGXFWLYLW\7KHFODLPRIIXQFWLRQDO SHULRGLFLW\ZDVRIWHQXVHGWRDUJXHWKDWZRPHQVKRXOGQRWEHDOORZHGWRHQWHULQVWLW XWLRQVRI KLJKHUHGXFDWLRQ +ROOLQJZRUWKVRXJKWWRGLVSURYHWKLVE\FROOHFWLQJDVDPSOHRIZR PHQDQGD IHZPHQWRIXQFWLRQDVDFRQWUROJURXSfDQGKDYLQJWKHPFRPSOHWHWHVWVRIPHQWDODQGSK\VLFDO DELOLWLHVHDFKGD\IRUVHYHUDOPRQWKV6KHDOVRKDGWKHSDUWLFLSDQWVNHHSDMRXUQDO WRUHSRUWWKH RQVHW DQGHQGRIHDFKPHQVWUXDOSHULRGDQGWKHLUJHQH UDORYHUDOOKHDOWK 6KH GHPRQVWUDWHGWKDW ZRPHQVSHUIRUPDQFHLQIDFWZDVQRWGHWULPHQWDOO\DIIHFWHGE\PHQVWUXDWLRQ DQGWKDWERWKPHQ DQGZRPHQYDULHGLQWKHLUSHUIRUPDQFHRYHUWLPH $OWKRXJKWKLVZDVDYHU\GLIILFXOW XQGHUWDNLQJ+ROOLQJZRUWKUHFRJQL]H GWKHQHHGIRUH[WHQVLYHDQGGHWDLOHG UHFRUGVWRFKDOOHQJH WKHFRQFHSWRIIXQFWLRQDOSHULRGLFLW\ ZKLFKZDVZLGHO\VXSSRUWHGE\HPLQHQWPHQLQFOXGLQJ PHGLFDOGRFWRUV7KLVSURMHFWGHPRQVWUDWH G KHUFRPPLWPHQWWRULJRURXVO\XSKROGLQJWKH VFLHQWLILFPHWKRGL QRUGHUWRFRQWULEXWHQHZDQGDFFXUDWHLQIRUPDWLRQWRWKHILHOG +HUGHGLFDWLRQ WRWKHSV\FKRORJ\RIZRPHQOHGVFKRODUVWRSRVWKXPRXVO\QLFNQDPHKHU0V3LOJULPGXHWR .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK 6LOYHUPDQ/HWD6WHWWHU+ROOLQJZRUWK&KDPSLRQRIWKH3V\FKRORJ\RI:RPHQDQG*LIWHG&KLOGUHQ .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZ RUWK 6WHSKDQLH6KLHOGV0V3LOJULPV3URJUHVVDQG&RPPHQWDU\ 5RHSHU5HYLHZ QRf%HQMDPLQ

PAGE 15

KHUZRUNRQDERRNWKDWVKHZDVXQDEOHWRILQLVKEHIRUHVKHGLHGWLWOHG 0UV3LOJULP V3URJUHVV LQZKLFKVKHHPSKDVL]HGWKHLPSRUWDQFHRISHUVRQDOFKRLFHIRUZRPHQ +ROOLQJZRUWKDOVRUHVHDUFKHGRWKHUWRSLFVLQHGXFDWLRQDQGSV\FKRORJ\2QHRIWKHVH WRSLFV ZDV WKHSV\FKRORJ\RIWKHDGROHVFHQW ,QWKHHDUO\WZHQWLHWKFHQWXU\ WKHLGHDRI DGROHVFHQFHZDVDUHODWLYHO\QHZFRQFHSW DVSHRSOHZHUHHQWHULQJWKHZRUNIRUFHDQGDGXOWKRRG ODWHULQOLIHWKDQWKH\KDGEHIRUH3V\FKRORJLVWVDQGVRFLHW\EHJDQWRUHFRJQL]HWKDWWKHUHZDVD SHULRGRIWLPHLQZKLFKLQGLYLGXDOVZHUHQRORQJHUFKLOGUHQE XWWKH\ZHUHQRWDVPDWXUHDV DGXOWVHLWKHU+ROOLQJZRUWKVW XGLHGWKLVXQLTXHSKDVHRIOLIH DQGZURWHDQLQIOXHQWLDOERRNFDOOHG 7KH3V\FKRORJ\RIWKH $GROHVFHQW SXEOLVKHGLQ ZKLFK VHUYHGWRLQIRUPQRWRQO\ SURIHVVLRQDOVDQGDFDGHPLFVEXWDOVRSDU HQWVRIDGROHVFHQWFKLOGUHQ 6SHFLDOGLVDELOLWLHVZKLFK ZHUHGLDJQRVHGZKHQDFKLOGKDGDOHDUQLQJSUREOHPWKDWZDVQRWDFFRXQWHGIRUE\DQ,4VFRUH DOVR LQWHUHVWHG KHU 6KH ZDVSDUWLFXODUO\LQIOXHQWLDOLQWKHHDUO\UHVHDUFKRQGLVDELOLWLHVLQ VSHOOLQJ $OWKRXJK+ROOLQJZRUWKUHVHDUFKHGVHYHUDOILHOGV WKHILHOGLQZKLFK >VKH@ ZRUNHGZLWK WKHJUHDWHVWHQWKXVLDVPDQGYLJRULVWKHSV\FKRORJ\DQGHGXFDWLRQRIWKHJLIWHGFKLOG $WWKH WLPH VKH ZDVRQHRIWKHIRUHPRVWLQYHVWLJDWRUVLQJLIWHGHGXFDWLRQDQ GDVWDXQFKDGYRFDWHRI LQWHOOLJHQFHWHVWLQJ6KHIHOWWKDWWKHVHWHVWVZHUHREMHFWLYH DQ GZHUHPXFKPRUHDSSURSULDWHLQ LGHQWLI\ LQJJLIWHGFKLOGUHQ EHFDXVHVKHWKRXJKWWHDFKHUVZHUHRIWHQLQDFFXUDWHLQUHFRPPHQGLQJ ,ELG $PDOLH1HOVRQ5HYLHZRI 7KH3V\FKRORJ\RIWKH$GROHVFHQW (GXFDWLRQDO5HVHDUFK%XOOHWLQ QRf 5 XWK&DYDQ.QRZOHGJH$ERXW3DUHQW &KLOG5HODWLRQVKLSV 0DUULDJHDQG)DPLO\/LYLQJ QRf 'RURWK\6SHHU$Q$QDO\VLVRIWKH6RXUFHVRI(UURUVLQ:RUGV0LVVSHOOHGE\3ULPDU\ 6FKRRO&KLOGUHQLQ WKH&LW\RI%DOWLPRUH 7KH(OHPHQWDU\6FK RRO-RXUQDO QRf $UWKXU*DWHV/HWD6+ROOLQJZRUWK 6FLHQFH1HZ6HULHV QRf

PAGE 16

LQWHOOLJHQWVWXGHQWV 6KHWDXJKWWKHI LUVWFODVVLQWKHFRXQWU\RQWKHWRSLFRIJLIWHGFKLOGUHQLQ DQGKHUERRN *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH SXEOLVKHGLQ ZDVZLGHO\ XVHGDVWKHWH[WERRNRQWKHVXEMHFWIRU\HDUVDIWHULWVSXEOLFDWLRQ ,QVWXG\LQJJLIWHGFKLOGUHQ +RO OLQJZRUWKIRFXVHGRQPDQ\LVVXHVLQWKHILHOGRQHRIZKLFK ZDV WKHQHHGWRDVFHUWDLQWKHEHVW ZD\WRHGXFDWHJLIWHGFKLOGUHQ)URPLWVLQFHSWLRQ DQGLQWKHSUHVHQWGD\ DPDMRUGHEDWHLQWKH ILHOGRIJLIWHGHGXFDWLRQ KDVEHHQ ZKHWKHULWLVPRUHDSSURSULDW HWRJLYHJLIWHGFKLOGUHQ DFFHOHUDWHGHGXFDWLRQLQZKLFKWKH\PRYHWKURXJKWKH WUDGLWLRQDO FXUULFXOXPDWDPXFKIDVWHU SDFHWKDQWKHDYHUDJHVWXGHQWRUWRJLYHWKHPHQULFKPHQWLQZKLFKWKH\UHFHLYHWKHVWDQGDUG FXUULFXOXPDWDPRUHUHJXODUSDFHEXWJR LQWR JUHDWHU GHSWKDQGVWXG\PRUHWRSLFVW KDQFKLOGUHQ LQUHJXODUFODVVHV +ROOLQJZRUWK VRXJKWWRGLVFRYHU ZKLFKRIWKHWZRRUZKDWFRPELQDWLRQRI WKHPfZRXOGEHVWVHUYHJLIWHGFKLOGUHQ VRWKDWWKHVHFKLOGUHQZRXOGJURZXSWREHEHVWSUHSDUHG WRLPSURYH VRFLHW\ $GGLWLRQDOO\ VKH ZURWHDERXWWKHVRFLHWDOLPSRUWDQFHRISURYLGLQJJLIWHG FKLOGUHQVSHFLDOHGXFDWLRQEHFDXVHRIWKHLUSRWHQWLDOWRVHUYHDVOHDGHUV 7KH SK\VLFDOFRPSDULVRQEHWZHHQJLIWHGFKLOGUHQDQGWKHLUQRQ JLIWHGSHHUV DOVR IDVFLQDWHGKHU ,QWKHEHJLQQLQJRIWKHWZHQWLHWKFHQWXU\ PDQ\SHRSOHEHOLHYHG WKDWKLJKO\ LQWHOOLJHQWFKLOGUHQZHUHVPDOOHUZHDNHUDQGPRUHVLFNO\WKDQDYHUDJHEXW+ROOLQJZRUWKDQGKHU FROOHDJXHVFRQGXFWHGPXOWLSOHVWXGLHVWRGHWHUPLQHWKDWJLIWHGFKLOGUHQZHUHDFWXD OO\RQ DYHUDJHODUJHUKHDYLHUDQG MXGJHGWREHPRUH DWWUDFWLYHWKDQWKHLUQRQ JLIWHGSHHUV ,Q DGGLWLRQ VKH ZDVFRQFHUQHGDERXWVRPHRIWKHHPRWLRQDODQGVRFLDOSUREOHPVWKDWJLIWHG %HQERZ %RUODQG/HWD+ROOLQJZRUWKV&RQWULEXWLRQVWRWKH3V\FKRORJ\DQG(GXFDWLRQRIWKH*LIWHG :RERU 'DYLG *XVWDIVRQ1DWXUHDQG1XUWXUHRI,QWHOOHFWXDOO\*LIWHG&KLOGUHQ5HYLHZRI *LIWHG&KLOGUHQ7KHLU1DWXUH DQG1XUWXUH 7KH6FKRRO5HYLHZ QRf .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK

PAGE 17

FKLOGUHQIDFH G UHJDUGLQJSOD\EHFDXVHWKH\ ZHUH PXFKPRUHLQWHOOLJHQ WWKDQWKHLUSHHUVDQG WKHLUPHQWDOLQWHOOLJHQFHIDUVXUSDVVH G WKHLUHPRWLRQDORUVRFLDOLQWHOOLJHQFH,QKHUUHVHDUFKVKH GLVFXVVHGWKHGLIILFXOW\WKDWJLIWHGFKLOGUHQKD G LQILQGLQJSOD\PDWHVDQGWKHW\SHVRISOD\LQ ZKLFKWKHVHFKLOGUHQSUHIHU UHG WR HQJDJH6KHDOVRIRFXVHGRQWKHUROHRISDUHQWVLQWKH GHYHORSPHQWRIJLIWHG FKLOGUHQ $GGLWLRQDOO\VKH FRQVLGHUHGWKHGLIILFXOWLHVWKDWJLIWHGJLUOV IDFH G DVVRFLDWHGZLWKWKHIDFWWKDWJLIWHGJLUOVZHUHOHVVLQWHUHVWHGLQWUDGLWLRQDOJLUODFWLYLWLHV DQGZHUHOLNHO\WREHPRUHDJJUHVVLYHDQGFRPSHWLWL YHWKDQZDVJHQHUDOO\GHVLUDEOHIRUJLUOV 7KURXJKWKLVUHVHDUFKVKHDJDLQ VRXJKWWRVXSSRUWWKHHTXDOLW\RIZRPHQDQG VRPHKDYH K\SRWKHVL]H G WKDW WKLV LVVXHZDVRISDUWLFXODULPSRUWDQFHWR+ROOLQJZRUWK EHFDXVHVKHKHUVHOI ZDVDJLIWHGIHPDOHLQDVRFLHW\WKDWKLJKO\GLVFRXUDJHGZRPHQIURPH[FHOOLQJDFDGHPLFDOO\RU SURIHVVLRQDOO\ 6KH DOVRH[DPLQHGZKHWKHUWKHUHZDVDUHODWLRQVKLSEHWZHHQJLIWHGQHVVDQG DUWLVWLFDELOLW\DQGGHWHUPLQHGWKDWWKHUHZDVQR VLJQLILFDQWFRUUHODWLRQEHWZHHQWKHWZREXWWKDW HPLQHQWDUWLVWVOLNHO\KDGDKLJKOHYHORIJHQHUDOLQWHOOLJHQFHDVZHOODVDVSHFLDODELOLW\LQDUW 7KURXJKRXWKHUFDUHHU+ROOLQJZRUWKZDVDFUXFLDOILJXUHLQHVWDEOLVKLQJWKHSUDFWLFHDQGWKHRU\ RIJL IWHGHGXFDWLRQE\XVLQJVFLHQFHWRJDLQDGHHSHUXQGHUVWDQGLQJRIWKHVRFLDOHPRWLRQDODQG DFDGHPLFSUREOHPVIDFHGE\WKLVVSHFLDOSRSXODWLRQRIVWXGHQWV +HUPHWKRGVKDYHVHW (OL]DEHWK0HFNVWUR WK3DUHQWV5ROHLQ(QFRXUDJLQJ+LJKO\*LIWHG&KLOGUHQ 5RHSHU5HYLHZ QRf 6WHSKDQLH7RODQ)URP3URGXFWLRQWR1XUWXULQJ+ROOLQJZRUWKDQG3DUHQWDO3HUVSHFWLYHV7RGD\ 5RHSHU 5HYLHZ QRf /LQGD.6LOYHUPDQ6RF LDODQG(PRWLRQDO(GXFDWLRQRIWKH*LIWHG7KH'LVFRYHULHVRI/HWD+ROOLQJZRUWK 5RHSHU5HYLHZ QRf .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK (QLG=LPPHUPDQ/HWD6WHWWHU+ROOLQJZRUWKV&RQWULEXWLRQVW RWKH6WXG\RI$UW7DOHQW 5RHSHU5HYLHZ QR f %DUEDUD.HUU/HWD+ROOLQJZRUWKV/HJDF\WR&RXQVHOLQJDQG*XLGDQFH 5RHSHU5HYLHZ QRf

PAGE 18

SUHFHGHQWVWKDWSDYHGWKHZD\IRUIXWXUHHGXFDWLRQDOSV\FKRORJLVWVE\H[DPLQL QJWKHVHLVVXHV V\VWHPDWLFDOO\DQGDVREMHFWLYHO\DVSRVVLEOHDWWKHWLPH 6KH DOVR IRFXVHG RQ HGXFDWLRQIRUH[WUHPHO\LQWHOOLJHQWFKLOGUHQVXFKDVWKRVHDERYH ,4 6WDQIRUG %LQHW f7KHVHFKLOGUHQVKHIHOWIDFHGHYHQPRUHSUREOHPVWKDQWKHW\SLFDOJL IWHG FKLOGDQGDVVXFKQHHGHGVSHFLDODWWHQWLRQDQGRSSRUWXQLWLHV 6KHDOVREHOLHYHGWKDWWKHVH FKLOGUHQZHUH PRVWOLNHO\WRJURZXSWREHWKHLQGLYLGXDOVWKDWZRXOGFRPHXSZLWKLGHDVDQG LQYHQWLRQVWKDWZRXOGLPSURYHVRFLHW\ $GGLWLRQDOO\VKHZDV FRQF HUQHGZLWKWKHGLIILFXOWLHV SRVHGZKHQWU\LQJWRDGPLQLVWHULQWHOOLJHQFHWHVWVRQWKHVHFKLOGUHQEHFDXVHWKH\RIWHQWHVWHG DERYHWKHFHLOLQJRIWKHVHDVVHVVPHQWV )RUGHFDGHV+ROOLQJZRUWKZRUNHGRQDO RQJLWXGLQDO VWXG\RIDGR]HQFKLOGUHQWKDWVKHGHWHUP LQHGWRILWLQWRWKLVKLJKO\LQWHOOLJHQWFDWHJRU\6KH VSHQWRYHUWZHQW\\HDUVDFFXPXODWLQJLQIRUPDWLRQDERXWWKHVHLQGLYLGXDOVEXWXQIRUWXQDWHO\ SDVVHGDZD\EHIRUHVKHZDVDEOHWRSXEOLVKKHUILQDOERRNRQWKHVXEMH FWDQGDVDUHVXOWKHU KXVEDQG SXEOLV KHGL WLQKLVZLIH VQDPHDIWHUKHUGHDWK7KLVWH[WLVVWLOOLQIOXHQWLDOWRGD\IRU VWXGHQWVOHDUQLQJDERXWKLJKO\LQWHOOLJHQWFKLOGUHQ 7KURXJKRXWKHUDFDGHPLFFDUHHU +ROOLQJZRUWKXWLOL]HGSXEOLFVFKRROSURJUDPVIXQGHG E\ORFDOJRYHUQPHQWVLQFRQMXQFWL RQZLWKWKH7HDFKHUV&ROOHJHDW&ROXPELD8QLYHUVLW\LQRUGHU WRVWXG\JLIWHGHGXFDWLRQ 7KHILUVWVFKRROLQZKLFKVKHHVWDEOLVKHGDQH[SHULPHQWDOSURJUDPZDV WKH3XEOLF6FKRROLQWKHHDUO\V 6KHFROOHFWHGGDWDDERXWWKHVHVWXGHQWVWKDWVKHXVHG I RUPDQ\RIKHUVWXGLHV LQFOXGLQJWKRVHWKDWIRFXVHGRQSK\VLFDODWWULEXWHVDQGPXVLFDODELOLW\ 7KH6SH\HU6FKRRODOVRNQRZQDV3XEOLF6FKRROSURYLGHGDQRWKHURSSRUWXQLW\WRFRQGXFW -XOLDQ6WDQOH\/HWD+ROOLQJZRUWKV&RQWULEXWLRQVWR$ERYH /HYHO7HVWLQJRIWK H*LIWHG 5RHSHU5HYLHZ QR f .DWKHU\Q.HDUQH\/HWD+ROOLQJZRUWKV8QILQLVKHG/HJDF\&KLOGUHQ$ERYH,4 5RHSHU5HYLHZ QR f:LOOLDP5RZHWRQ/HWD6WHWWHU+ROOLQJZRUWK$3HUVRQDO3URILOHRI1HEUDVNDV3LRQHHUL QJ 3V\FKRORJLVW 5RHSHU5HYLHZ QRf

PAGE 19

UHVHDUFKRQJLIWHGFKLOGUHQ 7KLVVFKRROZDVFUHDWHGVSHFLILFDOO\DV DQH[SHULPHQWDOVFKRROIRU FKLOGUHQZLWKVSHFLDOQHHGVDQGVHUYHGDPXFKJUHDWHUSRSXODWLRQRIVWXGHQWVRIVXEQRUPDO LQWHOOLJHQFH WKDQJLIWHGVWXGHQWV $WWKH6SH\HU6FKRRO+ROOLQJZRUWKKDG FRPSOHWHFRQWURORYHU WKHFXUULFXOXPDQGSHGDJRJ\RIWKHFODVVH VRIJLIWHGFKLOGUHQ 6KH KDGSODQQHGRQRYHUVHHLQJ WKLV SURJUDPIRUILYH\HDUVEXW GLHGDIWHUDSSUR[LPDWHO\WKUHHDQGDKDOI\HDUV $OWKRXJK WKH SURJUDPGLGQRWUXQ IRU LWVHQWLUHW\DV LQLWLDOO\DQWLFLSDWHG WKHVWXGHQWVZKRZHQWWKURXJKLW UHSRUWHGJUH DWJDLQVIURPKDYLQJKDGWKDWH[SHULHQFHPDQ\\HDUVODWHUDQGUHFDOO+ROOLQJZRUWK DVEHLQJDYHU\SRVLWLYHLQIOXHQFHLQWKHLUOLYHV $GGLWLRQDOO\KHUZRUNLQWKHVHSURJUDPVVHWV KHUDSDUWIURPKHUFRQWHPSRUDULHVLQKHUZLOOLQJQHVVWRDFWLYHO\ZRUNZLWK WKHFKLOGUHQVKHZDV VWXG\LQJ 6FKRODUVQRWHWKDWVKHZDV YHU\FDULQJDQGFRPSDVVLRQDWHWRWKHVWXGHQWV ZLWKZKRP VKHZRUNHG +ROOLQJZRUWKVZRUNKDVRIWHQEHHQRPLWWHGIURPDUWLFOHVZULWWHQLQHGXFDWLRQDO SV\FKRORJ\EXWWKHUHDUHDIHZDXWKRUVZKRKDY HGHGLFDWHGVLJQLILFDQWVFKRODUVKLSWRKHUZRUN 7KHPRVWIUHTXHQWFRQWULEXWRUVKDYHEHHQ6WHSKDQLH6KLHOGV/XG\%HQMDPLQ-U:LOODUG:KLWH DQG/LQGD6LOYHUPDQWKHODVWRIZKRP-DPHV%RUODQGKDVODEHOHG+ROOLQJZRUWKVLQGHIDWLJDEOH FKDPSLRQ 6KLHOGV DQG6LOYHUPDQKDYHIRFXVHGSULPDULO\RQ+ROOLQJZRUWKVZRUNLQWKH SV\FKRORJ\RIZRPHQDQGJLIWHGHGXFDWLRQ:KLWHKDVUHVHDUFKHGKHUFRQWULEXWLRQVWRWKHILHOG RIJLIWHGHGXFDWLRQDQG%HQMDPLQH[DPLQHGKHUZRUNLQIHPLQLVWSV\FKRORJ\$GGLWLRQDOO\DW .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK :LOODUG:KLWHDQG-RVHSK5HQ]XOOL$)RUW\ \HDU)ROORZ XSRI6WXGHQWVZKR$WWHQGHG/HWD+ROOLQJZRUWKV 6FKRROIRU*LIWHG6 WXGHQWV 5RHSHU5HYLHZ QRf:LOODUG:KLWH,QWHUYLHZVZLWK&KLOG,&KLOGDQG&KLOG/ 5RHSHU5HYLHZ QRf&DUROH+DUULV7KH+ROOLQJZRUWK/RQJLWXGLQDO6WXG\)ROORZ XS)LQGLQJVDQG,PSOLFDWLRQV 5RHSHU5HYLHZ QRf 1RUPD*ULIILQ6L[:DOOVRIWKH+RJDQ/HWD+ROOLQJZRUWKDVD0RGHOIRUD7HDFKHURI/HDUQLQJ 5RHSHU 5HYLHZ QRf5KRGD0LOOHU %RUODQG/HWD+ROOLQJZRUWKV&RQWULEXWLRQVWRWKH3V\FKRORJ\DQG(GXFDWLRQ RIWKH*LIWHG

PAGE 20

W KHILIWLHWKDQQLYHUVDU\RIKHUGHDWKLQ2FWREHUDFRPPHPRUDWLYHFRQIHUHQFHZDVKHOGLQ +ROOLQJZRUWKVKRQRUDWWKH8QLYHUVLW\RI1HEUDVND,QWKH 5RHSHU5HYLHZ GHGLFDWHGDQ HQWLUHLVVXHWRDUWLFOHVZULWWHQDERXWKHUFRQWULEXWLRQVWRHGXFDWLRQ DOSV\FKRORJ\ $OWKRXJKKHU QDPHPD\EHUHODWLYHO\REVFXUH WRWKRVHRXWVLGHRIWKHILHOGRIHGXFDWLRQDOSV\FKRORJ\RU IHPLQLVWSV\FKRORJ\ +ROOLQJZRUWKLV PRVWRIWHQ FLWHGLQUHVHDUFKWKDWIRFXVHVVSHFLILFDOO\ RQ KRZKHUZRUNSURSHOOHGWKHZRPHQVPRYHPHQ WLQWKHVDQGVDQG RQ KHU FRQWULEXWLRQVWR WKHHGXFDWLRQRIJLIWHGFKLOGUHQ 0DQ\RIWKHWKHPHVWKDWFRPPRQO\DULVHLQDUWLFOHVZULWWHQDERXW+ROOLQJZRUWKSHUWDLQWR WKHLVVXHVWKDWVKHZDVFRQFHUQHGZLWKWKDWDUHVWLOOUHOHYDQW2QHRIWKHPRV WKRWO\FRQWHVWHG LVVXHVLVWKHSURSHUHGXFDWLRQDODFFRPPRGDWLRQVWRSURYLGHIRUJLIWHGFKLOGUHQ(YHQWRGD\ UHVHDUFKHUVGHEDWHZKHWKHULWLVEHWWHUWRDFFHOHUDWHJLIWHGFKLOGUHQWKURXJKDFDGHPLFJUDGHV PRUHTXLFNO\RUWRRIIHUWKHPDQHQULFKHGFXUULFXOXP WKDWZLOOPRYHWKHPWKURXJKWKHJUDGHVDW DVORZHUSDFHWKDWPRUHFORVHO\PDWFKHVWKHLUFKURQRORJLFDODJHV $OVRWKHXQLTXHLVVXHVWKDW JLIWHGJLUOVIDFHDUH UHOHYDQWVXFKDVGLIILFXOW\LQILQGLQJWR\VDQGJDPHVWKDWDUHFRQVLGHUHGWR EHJHQGHUDSSURSU LDWH $XWKRUVKDYHREVHUYHGWKDW+ROOLQJZRUWKVZRUNH[DPLQHGWKHVRFLDO DQGHPRWLRQDOQHHGVRIDOOJLIWHGFKLOGUHQEXWVKHGLGQRWLFHWKDWJLUOVIDFHGHYHQPRUH FKDOOHQJHVWKDQWKHLUPDOHFRXQWHUSDUWV 5HVHDUFKHUVLQWKHILHOGRIJLIWHGHGXFDWLRQDOVRF RQWLQXH WR H[DPLQH JRDOVRIVRFLDOFRQGXFWDQGUHVSRQVLELOLW\ZKLFKVKRXOGGRPLQDWHWKHHGXFDWLRQDO SURJUDPVRIVXSHULRUFKLOGUHQWRDJUHDWHUGHJUHHWKDQIRUDQ\RWKHUJURXS DWRSLFZLWKZK LFK )DJDQ .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK :RERU 7(UQHVW1HZODQG7KH0HQWDOO\*LIWHG 5HYLHZRI(GXFDWLRQDO5HVHDUFK QR f

PAGE 21

+ROOLQJZRUWKZDVFRQFHUQHGGXHWRKHUEHOLHIVWKDWJLIWHG FKLOGUHQZRXOGSOD\DVSHFLDOUROHLQ VRFLHW\DVDGXOWV 0RVWRIWKHVFKRODUVKLSZULWWHQDERXW+ROOLQJZRUWKDJUHHVXSRQWKHLPSRUWDQFHRIKHU FRQWULEXWLRQVDQGWKHXQLTXHPHWKRGVWKDWVKHXVHGWRVWXG\JLIWHGFKLOGUHQ+RZHYHURQHWRSLF WKDWKDVEHHQGH EDWHGFRQFHUQV+ROOLQJZRUWKVYLHZVRIWKHLQIOXHQFHRIQDWXUHRUQXUWXUHLQ GHWHUPLQLQJDSHUVRQVLQWHOOLJHQFHDQGVXFFHVVLQOLIH+ROOLQJZRUWKZDVDVXSSRUWHURI HXJHQLFV EXWVFKRODUVGHEDWHZKHWKHURUQRWVKHEHOLHYHGLQWHOOLJHQFHFRXOGEHOLPLWHGE \ PHPEHUVKLSLQDGLIIHUHQWUDFHRUVRFLDOFODVV6LOYHUPDQ DUJXH V WKDW+ROOLQJZRUWKEHOLHYHGWKDW LQWHOOLJHQFHZDVODUJHO\DIIHFWHGE\HQYLU RQPHQWDOIDFWRUVZKLFKH[SODLQHG WKHODFNRIHPLQHQW SHUVRQDOLWLHVZKRFDPHIURPORZHUVRFLR HFRQRPLFFODVVHV %R UODQGPDNHVDVLPLODUFODLP +DUULVPDNHVQRWHRI+ROOLQJZRUWKVGHOLEHUDWHHIIRUWVWRHQVXUHWKDWWKHUDFLDOPDNHXSRIWKH 6SH\HU6FKRROPLUURUHGWKHUDFLDOPDNHXSRI1HZ
PAGE 22

LQGLFDWHZKHWKHU+ROOLQJZRUWKDWWULEXWHGWKLVWRHQYLURQPHQWDORUELRORJLFDOGLIIHUHQFHV 7KLV GHEDWHLVFHUWDLQO\QRWWKHSULPDU\IRFXVRIWKHERG\RIVFKRODUVKLSRQ+ROOLQJZRUWKEXWLWKDV EHHQQRWHGE\DIHZUHVHDUFKHUV 7KHSULPDU\JRDO RIWKLVWKHVLVZDVWRDQVZHUWKUHHTXHVWLRQV ZKDW ZHUH +ROOLQJZRUWKV Y LHZVRQUDFHDQGJLIWHGQHVV" : KDW ZHUH KHUYL HZVRQFODVVDQGJLIWHGQHVV" $ QGZK\ GLGVKH EHOLHYHLW ZDV LPSRU WDQWWRHGXFDWHJLIWHGFKLOGUHQ" :KLOHIRFXVLQJRQWKHVHTXHVWLRQV, DOV R ORRNHG WRGHWHU PLQHZKHWKHUKHULGHDV FKDQJHGRYHUWKHFRXUVHRIKHUFDUHHUDQGLI VRKRZWKH\ FKDQJHG ,KRSH G WRXQGHUVWDQG WKHH[WHQWWRZKLFK +ROOLQJZRUWKV LGHDVFRQIRUPHGZLWKRU GHYLDWHGIURP WKHFRQWH[WRIHGXFDWLRQDOSV\FKRORJ\DQGLQWHOOLJHQF HUHVHDUFK RIKHUWLPH 7 KURXJKRXWWKLVSURMHFW, FRQVLGHUHG ZK\LWLVLPSRUWDQWWRGD\IRUXVWRXQGHUVWDQGWKHVHDVSHFWV RI+ROOLQJZRUWKVZRUN QDPHO\EHFDXVHWKHVHVSHFLILFLVVXHVDUHVWLOOXQUHVROYHGLQJLIWHG HGXFDWLRQDQGXQGHUVWDQGLQJWKHLUKLVWR ULFDORULJLQVFDQVKHGOLJKWRQZK\JLIWHGHGXFDWLRQLVLQ LWVSUHVHQWVWDWHDQGZKDWSUHFHGHQWV+ROOLQJZRUWKVHWIRUIXWXUHHGXFDWLRQDOSV\FKRORJLVWV7R FRQGXFWP\UHVHDUFK,ILUVWUHDGDOORIWKHDUWLFOHVWKDWVFKRODUVKDYHZULWWHQDERXW+ROOLQJZRUWK WRDVFHUWDLQZKHWKHUWKHVHLVVXHVKDYH\HWEHHQH[DPLQHGDQGWRGHWHUPLQHZKHWKHURWKHU DXWKRUVFRXOGKHOSLQIRUPP\UHVHDUFKTXHVWLRQV6HFRQG,UHDGDOORI+ROOLQJZRUWKVSXEOLVKHG ZRUNVWRILQGHYLGHQFHWKDWGLUHFWO\DQVZHUVP\TXHVWLRQV,QUHDGLQJK HUZRUNV,VRXJKWDQ\ LQGLFDWLRQRIKHURSLQLRQVRQUDFHFODVVRUWKHLPSRUWDQFHRIHGXFDWLQJJLIWHGFKLOGUHQLQKHU ZRUGVWKHSRSXODWLRQVWKDWVKHFKRVHWRZRUNZLWKRUWKHVFKRODUVKLSWKDWVKHFKRVHWRVXSSRUW KHUFODLPV,H[DPLQHGWKHDUJXPHQWVW KDWVKHPDGHDERXWWKHRULJLQVRILQWHOOLJHQFHDQGWKH LQIOXHQFHRIHQYLURQPHQW,QWKHFRQWH[WRIKHUFRQWHPSRUDULHV,VRXJKWWRGLVFRYHUZKHWKHU +ROOLQJZRUWKZDVPRUHRUOHVVLQFOXVLYHRIGLYHUVHVWXGHQWSRSXODWLRQV,DOVRDVVHVVHGZKDW /HVOLH0DUJROLQ*RRGQHVV3HUVRQLILHG7KH(PHUJHQFHRI*LIWHG&KLOGUHQ 6RFLDO3UREOHPV QRf

PAGE 23

DSSHDOVVKHPD GHWRHPSKDVL]HWKHLPSRUWDQFHRIUHVHDUFKLQJDQGSURYLGLQJJLIWHGSURJUDPVIRU KLJKO\LQWHOOLJHQWVWXGHQWV %DVHGXSRQP\UHVHDUFK,KDYH GHYHORSHGK\SRWKHVHVWRDQVZHUP\UHVHDUFK TXHVWLRQV ,Q WHUPVRIUDFH +ROOLQJZRUWK REVHUYHG WKDWVRPHUDFLDOJURXS VWHQG HG WRVFRUHORZHU RQDYHUDJH LQ LQWHO OLJHQFHWHVWVWKDQRWKHUJURXSV+RZHYHU VKHDOVREHOLHYHG WKDWDOOUDFHVSURGXFH G JLIWHG LQGLYLGXDOVLQYDU\LQJQXPEHUVDQGWKXVLW ZDV LPSRUWDQWWKDWJLIWHGSURJUDPVLQFOXGHFKLOGUHQ RIDOOUDFHV:LWKUHJDU GVWRFODVV ,KDYHGHWHUPLQHGWKDWVKH REVHUYHGWKDWWKHPDMRULW\RI FKLOGUHQLGHQWLILHGDVJLIWHGFDPHIURPIDPLOLHVLQWKHPLGGOHDQGXSSHUVRFLRHFRQRPLFFODVVHV $OWKRXJKVKH GLGUHFRJQL]H WKDWWKHUH ZHUH QXPHURXVJLIWHGFKLOGUHQZKRZ HUHERUQLQWR ID PLOLHV LQWKHORZHUVRFLRHFRQRPLFFODVVDQGVKHLQFOXGHGFKLOGUHQIURPWKHVHKRPHVLQKHU UHVHDUFKDVZHOO)LQDOO\ ,DUJXHWKDWVKH DGYRFDWHGVSHFLDOHGXFDWLRQIRU JLIWHGFKLOGUHQIRUWKH JRRGRIWKHFKLOGUHQEXWPRUHVRIRUWKHEHQHILWWKHVHLQGLYLGXD OVZRXOGSURYLGH WR VRFLHW\DV WKH\JUHZXSWREHFRPHOHDGHUVLQYHQWRUVDQGLQQRYDWRUV 7KLVUHVHDUFKZLOODGGWRWKHH[LVWLQJ ERG\RIOLWHUDWXUHDERXW+ROOLQJZRUWKDVZHOODVFRPSOLFDWHZKDWOLWWOHKDVEHHQVDLGDERXWKHU YLHZVRQUDFHFODVVDQGJLIWH GQHVV,ZLOOGHPRQVWUDWHWKDWKHUYLHZVZHUHPRUHFRPSOH[WKDQ RWKHUDXWKRUVKDYHLQGLFDWHGDQGWKDWLWLVLPSRUWDQWWRH[DPLQHWKHVHYLHZVEHFDXVHVKHKDV EHHQVRLQIOXHQWLDORQWKHILHOGRIJLIWHGHGXFDWLRQ$OVRWKLVUHVHDUFKZLOOKHOSWRXQFRYHUZK\ +ROOLQJZRUWKIHOWWKDWJLIWHGHGXFDWLRQZDVVRLPSRUWDQWZKLFKKDVQRWEHHQGLVFXVVHGLQWKH H[LVWLQJERG\RIOLWHUDWXUH

PAGE 24

&+$37(5 5$&(&/$66$1':+< :(('8&$7(*,)7('&+ ,/'5(1 *LYHQWKDW+ROOLQJZRUWKZDVRQHRIWKHILUVWHGXFDWLRQDOSV\FKRORJLVWVL Q$PHULFDWR UHVHDUFKJLIWHGQHVVLWLVLPSRUWDQWWRXQGHUVWDQGKRZVRPHRIKHUDWWLWXGHVLQIOXHQFHGKHUZRUN 0DQ\RIWKHLVVXHVDWWKHIRUHIURQWRIJLIWHGHGXFDWLRQWRGD\ZHUHDOVRSUREOHPVGXULQJKHU FDUHHU7KUHHRIWKHVHLVVXHVDUHUDFHVRFLRHFRQRPLF FODVVDQGKRZDQGZK\ZHHGXFDWHJLIWHG FKLOGUHQ,QDQDWWHPSWWREHWWHUXQGHUVWDQGWKHRULJLQDQGGHYHORSPHQWRIJLIWHGHGXFDWLRQZH VKRXOGDVFHUWDLQ+ROOLQJZRUWKVYLHZVRQWKHVHPDWWHUV 5DFH +ROOLQJZRUWKVYLHZVRQUDFHZHUHVKDSHGE\KHUHDUO\OLI HH[SHULHQFHV%RUQLQ&KDGURQ 1HEUDVNDLQVKHZDVVDLGWRKDYHEHHQWKHILUVWZKLWHFKLOGERUQLQ'DZHV&RXQW\ ,QKLV RELWXDU\RI+ROOLQJZRUWK$73RIIHQEHUJHUUHIHUUHGWRKHUHDUO\\HDUVDVDWUDGLWLRQDOSUDLULH OLIHFRPSOHWHZLWKURDPLQJF DWWOHDQG,QGLDQV 6KHUHSRUWHGFKLOGKRRGPHPRULHVRIJURZLQJXS QHDUPDQ\6LRX[,QGLDQVEXWLWLVXQNQRZQZKHWKHURUQRWVKHDFWXDOO\PHWDQ\RIWKHP +HU IDWKHU-RKQQ\6WHWWHUZDVUHSRUWHGO\DQWL 6HPLWLFZKLFKDOVRKDGDQLPSDFWRQKLVGDXJKWHU 7K HWZRKDGDYHU\WXPXOWXRXVUHODWLRQVKLSGXHWRWKHIDWKHUVLQWHUPLWWHQWSUHVHQFHLQKLV GDXJKWHUVOLYHVDQGKLVFKRLFHRIDVHFRQGZLIHZKRZDVHPRWLRQDOO\FUXHOWR/HWD +ROOLQJZRUWKDQGKHUWZRVLVWHUV$OWKRXJK+ROOLQJZRUWKDQGKHUIDWKHUVKDUHGDO RYLQJUDSSRUW KHZRXOGRIWHQWHDVHKHUDERXWKHUORRNVVD\LQJWKDWVKHORRNHGOLNHVKHPLJKWFRPHIURP *HUPDQ-HZLVKVWRFNZKLFKXSVHWKHUJUHDWO\ +HUIDWKHUVEHOLHIVOLNHO\SOD\HGDUROHLQKHU +ROOLQJZRUWK /HWD6WHWWHU+ROOLQJZRUWK$%LRJUDSK\ $73RIIHQEHUJHU/HWD6WHWWHU+ROOLQJZRUWK 7KH$PHULFDQ-RXUQDORI3V\FKRORJ\ QR f .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK ,ELG

PAGE 25

ODWHUDWWLWXGHVWRZDUGGLIIHUHQWUDFLDOJURXSV7KHUHL VDOVRHYLGHQFHWKDWKHUKXVEDQG+DUU\/ +ROOLQJZRUWKKHOGVRPHDQWL 6HPLWLFEHOLHIVDIWHUKDYLQJVRPHIUXVWUDWLQJH[SHULHQFHVZKLOH ZRUNLQJLQDVWRUHUXQE\-HZLVKSHRSOHDVDWHHQDJHU $OWKRXJKWKHUHLVQRHYLGHQFHWKDWKHU LPPHGLDWHIDPLO\ZDVSDUW LFXODUO\UDFLVWLQJHQHUDODQWL 6HPLWLVPZDVFRPPRQDPRQJVRPHRI WKHPRVWLQIOXHQWLDOLQGLYLGXDOVLQ+ROOLQJZRUWKVOLIH )URPWKHRQVHWRIKHUSURIHVVLRQDOFDUHHU+ROOLQJZRUWKZDVLQFOXVLYHRIPXOWLSOHUDFHVLQ KHUUHVHDUFK$VDJUDGXDWHVWXGHQWVK HHQJDJHGLQWZRPDMRUVWXGLHVWKDWLQFOXGHGUDFLDOO\ GLYHUVHSDUWLFLSDQWJURXSV,QKHUVWXG\RQWKHYDULDELOLW\K\SRWKHVLVVKHH[DPLQHGQHZERUQ LQIDQWVDWWKH1HZ
PAGE 26

HQWLUHO\WRH[DPLQLQJWKHGHPRJUDSKLFVRIWKHJLIWHGSRSXODW LRQ6KHGHFODUHGWKDWVRPHUDFLDO JURXSVVFRUHGKLJKHURQDYHUDJHWKDQRWKHUV6KHQHYHUGHILQHGH[DFWO\ZKDWVKHZDVUHIHUULQJ WRZKHQVKHXVHGWKHWHUPUDFHEXWVKHRIWHQLQGLFDWHGWKDWGLIIHUHQW(XURSHDQQDWLRQDOLWLHV UHSUHVHQWHGGLIIHUHQWUDFHV +RZHYHUVKHGLGQRWGLIIHUHQWLDWHDPRQJQDWLRQDOLWLHVZKHQ UHIHUULQJWREODFNSHRSOHRU$PHULFDQ,QGLDQV6KHOXPSHGWRJHWKHUDOOEODFNVXQGHUDVHSDUDWH FDWHJRU\RIUDFHDVVKHGLGZLWK$PHULFDQ,QGLDQV6KHEHOLHYHGWKDWWKHGLIIHUHQFHLQVFRUHVRI HD FKUDFHFRXOGQRWEHH[SODLQHGE\ODQJXDJHGLVFUHSDQFLHVEHFDXVHVRPHUDFLDOJURXSVWKDW IDFHGHTXDOODQJXDJHEDUULHUVVFRUHGKLJKHUWKDQRWKHUUDFHV3DUWLFXODUO\VKHQRWHGWKDWQHJUR FKLOGUHQ DQG,WDOLDQVWHQGHGWRVFRUHORZHUWKDQ6ZHGLVKRU-HZLVK SHRSOH +RZHYHUVKHVWDWHG WKDWWKHUHZHUHJLIWHGLQGLYLGXDOVLQHYHU\UDFLDOJURXS6KHDGGLWLRQDOO\SRLQWHGRXWWKDWWKH SRSXODWLRQVWHVWHGPLJKWQRWSURYLGHDUHSUHVHQWDWLYHVDPSOHRIWKHUDFHDVDZKROH7KHJURXSV RILQGLYLGXDOVWHVWHGZHUHQHFHVVD ULO\LPPLJUDQWVIURPWKHLUQDWLYHFRXQWULHVDQGWKXVPLJKWEH DVNHZHGVDPSOHWKHPLJUDWLRQRISHRSOHVLVDOZD\VRQWKHEDVLVRIVRPHPRWLYHZKLFKVHOHFWV XQHTXDOO\DPRQJWKHWRWDOSRSXODWLRQIURPZKLFKWKHHPLJUDQWVJR $OVRLQ 7KH 3V\FKRORJ\ RI6XEQRUPDO&KLOGUHQ +ROOLQJZRUWKDGGUHVVHGWKHLVVXHRIUDFHDQGLQWHOOLJHQFH QRWLQJWKDWWKHEODFNDQG$PHULFDQ,QGLDQFKLOGUHQDSSHDUHGWREHOHVVLQWHOOLJHQWWKDQZKLWH FKLOGUHQ%XWVKHDJDLQUHFRJQL]HGWKDWWKHUHPLJKWEHDVHOHFWLRQELDVEHFDXVH WKHVHFKLOGUHQ ZHUHGHVFHQGHQWVRISHRSOHZKRZHUHFDXJKWDQGHQVODYHGE\ZKLWHSHRSOH2WKHUPHPEHUVRI WKHVHUDFHVZHUHQRWDQGWKXVPLJKWKDYHEHHQPRUHLQWHOOLJHQW ,QDGGLWLRQWREHOLHYLQJWKDW VRPHLQGLYLGXDOVRIKLJKLQWHOOLJHQFHZHUH IRXQGLQHYH U\UDFLDOJURXS VKH REYLRXVO\EHOLHYHG /HWD+ROOLQJZRUWK *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH 1HZ
PAGE 27

WKDWFHUWDLQSHUVRQDOLW\WUDLWVZHUHGLVWULEXWHGDFURVVPXOWLSOHUDFHV6KHIRXQGWKDWFKDUDFWHU WUDLWVOLNHQHXURWLFLVPDQGVXEPLVVLYHQHVVZHUHPRUHVWURQJO\FRUUHODWHGWRLQWHOOLJHQFHOHYHO WKDQWKH\ZHUHZLWKUDFH +HUTXLFNQHVVWRSRLQWRXWSRWHQWLDODOWHUQDWHH[SODQDWLRQVIRU GLVFUHSDQFLHVLQLQWHOOLJHQFHWHVWSHUIRUPDQFHGHPRQVWUDWHGKHUEHOLHIWKDWJURXSGLIIHUHQFHVLQ WHVWVFRUHVZHUHQRWQHFHVVDULO\LQGLFDWLYHRILQKHUHQWELRORJLFDOGLIIHUHQFHV +ROOLQJZRUW KGLGKRZHYHUEHOLHYHWKDWVRPHUDFHVZHUHPRUHDGYDQFHGWKDQRWKHUV6KH UHIHUUHGWRVRPHUDFLDOJURXSVDVSULPLWLYHDQGHQGRUVHGVHYHUDOUDFLDOVWHUHRW\SHVLQFOXGLQJ DQ$IULFDQZLWKDFKLOGRQKHUEDFN>DQG@DQ,QGLDQ>ZKR@PD\VFUDSHDQ GVPRNH KLGHV 6KHDOVRUHIHUUHGWRWKHWUDGLWLRQVDQGWDOHVRIVDYDJHV 'LVFXVVLQJULWHVRILQLWLDWLRQ LQGLIIHUHQWFXOWXUHVLQ 7KH3V\FKRORJ\RIWKH$GROHVFHQW +ROOLQJZRUWKDUJXHGWKDWVRPHUDFHV ZHUHOHVVFLYLOL]HGSDUWLFXODUO\WKHEODFNDQGUHG RQHV
PAGE 28

+ROOLQ JZRUWKVYLHZVRQWKHSURJUHVVLRQRIUDFHVVHHPWREHSDUWLFXODUO\UDFLVWIURPWKHSUHVHQW OHQVEXWWKH\ZHUHOHVVH[WUHPHZKHQH[DPLQHGLQFRQWH[W ,QKHUVWXGLHVRQJLIWHGQHVV+ROOLQJZRUWKGLGQRWPDNHVLJQLILFDQWPHQWLRQRIUDFLDO JURXSVH[FHSWWRQ RWHWKHFRPSRVLWLRQRIKHUSDUWLFLSDQWSRROV6KHZRUNHGZLWKDODUJH SURSRUWLRQRIFKLOGUHQZKRZHUHRI(QJOLVK6FRWWLVKDQG-HZLVKKHULWDJH6KHQRWHGLQ UHIHUHQFHWRDFHQVXVFRQGXFWHGLQ&DOLIRUQLDWKDWFKLOGUHQRI6FRWWLVK(QJOLVKDQG-HZLVK GHU LYDWLRQPRVWIUHTXHQWO\WHVW>HG@DERYH,4ZKLOHQHJURHV3RUWXJXHVHDQG,WDOLDQV IXUQLVK>HG@IDUIHZHUWKDQWKHLUVWDWLVWLFDOSURSRUWLRQ 6KHGLGQRWK\SRWKHVL]HDERXWWKH SUHSRQGHUDQFHRI(QJOLVKRU6FRWWLVKFKLOGUHQEXWVKHGLGSURSRVHDUHDVR QZK\VKHIRXQGVR PDQ\KLJKO\LQWHOOLJHQW-HZLVKFKLOGUHQ)RUPDQ\RIKHUVWXGLHVVKHREWDLQHGKHUSDUWLFLSDQWV E\DGPLQLVWHULQJLQWHOOLJHQFHWHVWVWRODUJHJURXSVRIFKLOGUHQLQ1HZ
PAGE 29

QRWWKHH[LVWHQFHRIWKHP7KLVLVLQFRQWUDVWWRYLHZVRIWZRRIKHUPRVWIDPRXVFRQWHPSRUDULHV 7KRUQGLNHDQG7HUPDQ +ROOLQJZRUWKVODWHUFDUHHUDOVRSURYLGHGHYLGHQFHWKDWVKHEHOLHYHGWKHUHZHUHJLIWHG LQGLYLGXDOVLQPLQRULW\UDFHV ,QKHUVWXG\RIKLJKO\LQWHOOLJHQWEODFNFKLOGUHQ0DUWKD-HQNLQV QRWHGWKDW+ROOLQJZRUWKVXJJHVWHGWZRSRWHQWLDOSDUWLFLSDQWVIRUWKHVWXG\EXWXQIRUWXQDWHO\ SDVVHGDZD\EHIRUH-HQNLQVGLVFRYHUHGWKHFKLOGUHQVQDPHV -HQNLQVKDGDGLIILFXOWWLPH VHFX ULQJSDUWLFLSDQWVIRUKHUVWXG\ZKLFKLQGLFDWHVWKDWQRWPDQ\RWKHUUHVHDUFKHUVZHUH H[DPLQLQJWKLVSRSXODWLRQRIJLIWHGFKLOGUHQ$OVR+ROOLQJZRUWKKHUVHOIZDVLQYROYHGLQDVWXG\ RIKLJKO\LQWHOOLJHQWEODFNFKLOGUHQZLWK3DXO:LWW\DWWKHWLPHRIKHU GHDWKWLWOHG,QWHOOLJHQFH DV5HODWHGWR5DFH 7KHFRQFOXVLRQRIWKLVLQYHVWLJDWLRQZDVWKDWWZHQW\WRWZHQW\ ILYHSHUFHQW RIEODFNFKLOGUHQVFRUHGDWRUDERYHWKHPHGLDQLQWHOOLJHQFHWHVWVFRUHRIWKHZKLWHSRSXODWLRQ %RWKRIWKHVHH[DPSOHVGHPRQVWUD WHGKHULQFOXVLRQRIEODFNFKLOGUHQLQKHUUHVHDUFKRQ JLIWHGQHVVDQGKHUDWWHPSWWRXQGHUVWDQGWKHQHHGVRIDOOJLIWHGVWXGHQWVUHJDUGOHVVRIUDFH $QRWKHULQGLFDWLRQRI+ROOLQJZRUWKVEHOLHIWKDWWKHUHZDVJLIWHGQHVVLQHYHU\UDFLDO JURXSLVUHIOHFWH GLQKHUZRUNDWWKH36DOVRNQRZQDVWKH6SH\HU6FKRRO7KLVVFKRROZDV DFROODERUDWLYHHIIRUWEHWZHHQWKHFLW\JRYHUQPHQWDQGWKH7HDFKHUV&ROOHJHDW&ROXPELDWKDW ZDVODUJHO\VSHDUKHDGHGE\+ROOLQJZRUWK$WWKH6SH\HU6FKRROVKHZDVDEOHWRSUDF WLFHWKH FXUULFXOXPDQGSHGDJRJ\WKDWVKHKDGSURSRVHGIRUJLIWHGFKLOGUHQIRUPDQ\\HDUV,WLQFOXGHG QLQHVHSDUDWHFODVVHVRIFKLOGUHQVHYHQRIZKLFKZHUHIRUFKLOGUHQZLWKORZ,4VFRUHVFDOOHGWKH 6WHSKHQ7RPOLQVRQ(GZDUG/HH7KRUQGLNHDQG-RKQ'HZH\RQWKH6FLHQFHRI(GXFDWLRQ 2[IRUG5HYLHZRI (GXFDWLRQ QRf :LOPD9LDOOH7HU PDQDO6FLHQFH"7KH:RUNRI/HZLV7HUPDQ5HYLVLWHG 5RHSHU5HYLHZ QRf 0DUWKD-HQNLQV&DVH6WXGLHVRI1HJUR&KLOGUHQRI%LQHW,4DQG$ERYH 7KH-RXUQDORI1HJUR(GXFDWLRQ QRf -%6WURXG$SSOLFDWLRQRI,Q WHOOLJHQFH7HVWV 5HYLHZRI(GXFDWLRQDO5HVHDUFK QRf ,ELG

PAGE 30

%LQHWFODVVHVDQGWZRIRUFKLOGUHQZLWKYHU\KLJK,4 VFRUHVFDOOHGWKH7HUPDQFODVVHV +ROOLQJZRUWKPDGHDFRQVFLRXVHIIRUWWRVHHNRXWJLIWHGFKLOGUHQRIGLIIHUHQWUDFHVLQRUGHUWR HVWDEOLVKDJURXSRIVWXGHQWVWKDWUHIOHFWHGWKHUDFLDOPDNH XSRI1HZ
PAGE 31

UHFRJQL]DEOHHYHQZKHQWKHLUQDPHVZHUHRPLWWHGEHLQJ WKDWLWZDVVXFKDVPDOOJURXS 0DQ\ RIWKHFKLOGUHQZHUHORFDWHGWKURXJKVFDQWUHFRUGVWKDWUHPDLQHGIURPKHUVSHFLDOHGXFDWLRQDO SURJUDPVIRUJLIWHGFKLOGUHQDW36DQGWKH6SH\HU6FKRRO +RZHYHUZHGRNQRZWKDWDW WKH6SH\HU6FKRROWKHUHZHUH WZHQW\ WKUHHQDWLRQDOLWLHVUHSUHVHQWHGLQFOXGLQJFKLOGUHQRI $IULFDQ $PHULFDQ&KLQHVH-DSDQHVH0H[LFDQDQG,QGLDQGHVFHQW :HGRQRWNQRZZKDW SURSRUWLRQVRIVWXGHQWVZHUHIURPPLQRULW\UDFHV+ROOLQJZRUWKUHFRUGHGWKHIDPLO\KLVWRU\RI PRVWRIKHUVW XGHQWVZKLFKRIWHQLQFOXGHGQDWLRQDOLWLHVFRQVLGHUHGZKLWHVXFKDV(QJOLVK +RZHYHUZHNQRZWKDWVKHIRXQGJLIWHGQHVVH[LVWHGLQHYHU\UDFLDOJURXSWKDWZDVUHSUHVHQWHG LQ1HZ
PAGE 32

DQGELUWK UDWH,IDSHUVRQDFFHSWHGWKDWSURIHVVLRQDORFFXSDWLRQVZHUHDVVXPHGE\KLJKO\ LQWHOOLJHQWSHRSOHWKLVPHDQWWKDWWKHPRVWLQWHOOLJHQWSRUWLRQRIWKHSRSXODWLRQKDGIHZHU FKLOGUHQ 6KHEHOLHYHGSDUHQWVRIKLJKO\LQWHOOLJHQW FKLOGUHQVKRXOGDFWXDOO\EHHQFRXUDJHGWR KDYHPRUHRIIVSULQJ 6KHQRWHGWKDWSHRSOHLQWKHXSSHUVRFLRHFRQRPLFFODVVKDGDORQJHU SHULRGRIUHSURGXFWLYHIXQFWLRQWKDQRWKHUV 6KHDOVROLNHPDQ\SK\VLFLDQVDWWKHWLPH EHOLHYHGWKDWWKHPHQWDOO\GHILFLH QWVKRXOGEHVWHULOL]HG EHFDXVHWKDWZDVWKHPRVWHIILFLHQW ZD\WRUHGXFHWKHQXPEHURIVXEQRUPDOLQGLYLGXDOV 7KLVDSSHDUVWREHWKHRQO\LQVWDQFHLQ ZKLFKVKHVXSSRUWHGWKHLGHDRIUHVWULFWLQJSURFUHDWLRQDPRQJDJURXSRISHRSOH6KHZDVKLJKO\ LQIOXH QFHGE\VRPHRIWKHHGXFDWLRQDOWUHQGVLQ*HUPDQ\DQGGXULQJWKDWWLPH*HUPDQ HGXFDWLRQDOSV\FKRORJLVWVZHUHYHU\FRQFHUQHGZLWKUHEXLOGLQJDQGLPSURYLQJWKHFRXQWU\DIWHU WKH)LUVW:RUOG:DU 1RWDEO\VKHGLHGEHIRUHWKH6HFRQG:RUOG:DUDQGWKXVGLG QRWVHHWKH FRQVHTXHQFHVRIHXJHQLFVLQ*HUPDQ\+HUFRQWHPSRUDULHVZHUHDEOHWRUHYLVHWKHLUSRVLWLRQRQ WKHPDWWHUDIWHUZLWQHVVLQJWKDWZDUEXW+ROOLQJZRUWKQHYHUKDGWKLVRSSRUWXQLW\ 7RGD\ZH DVVRFLDWHHXJHQLFVZLWKUDFLVPEXWWKHDVSHFWVRIHXJHQL FVWKDWVKHHVSRXVHGZHUHSULPDULO\ LVVXHVRIKRZWRHQVXUHLQWHOOLJHQFHZDVSDVVHGRQWRIXWXUHJHQHUDWLRQV)RU+ROOLQJZRUWKUDFH ZDVPXFKOHVVLPSRUWDQWWKDQPHQWDOFDSDFLW\ 6WURXG 7RODQ +ROOLQJZRUWK *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH .OHLQ $)RUJRWWHQ9R LFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK /HWD+ROOLQJZRUWK 7KH3V\FKRORJ\RI6XEQRUPDO&KLOGUHQ 1HZ
PAGE 33

7KHUHLVQRHYLGHQFHWKDWVKHXVHGHXJHQLFDUJXPHQWVWRFODLPWKDWDQ\UDFHZ DV LQKHUHQWO\VXSHULRUWRDQ\RWKHU7KHRQO\DXWKRUZKRKDVDUJXHGWKDW+ROOLQJZRUWKXVHG HXJHQLFVWRVXSSRUWFODLPVRIUDFLDOLQIHULRULW\LV6WHSKHQ6HOGHQ 7R PDNHWKLVDUJXPHQW6HOGHQ FLWHV *LIWHG&KLOGUHQ VSHFLILFDOO\+ROOLQJZRUWKVDVVHVVPHQWRILQ WHOOLJHQFHWHVWVFRUH GLIIHUHQFHVEHWZHHQUDFHV 7KLVTXRWDWLRQUHSUHVHQWVRQHRIWKHIHZWLPHVWKDW+ROOLQJZRUWK GLUHFWO\DGGUHVVHVWKHLVVXHRIUDFHDQGLQWHOOLJHQFHDQGFDQRQO\EHXVHGDVHYLGHQFHRIKHU VXSSRUWRIUDFLDOO\EDVHGHXJHQLFVZKHQWDNHQ RXWRIWKHFRQWH[WRIKHUODUJHUERG\RIZRUN6KH GLGQRWDUJXHWKDWRQHUDFHZDVSK\VLFDOO\RUPHQWDOO\VXSHULRUWKDQDQ\RWKHU*HQHUDOO\ZKHQ VKHGLGILQGGLIIHUHQFHVLQLQWHOOLJHQFHWHVWVFRUHVVKHZDVTXLFNWRSRLQWRXWWKDWWKHUHPLJKW KDYHEHHQR WKHUIDFWRUVWKDWH[SODLQHGZK\WKHVHGLIIHUHQFHVZHUHIRXQGVXFKDVDVHOHFWLRQELDV $OVRLQKHURZQUHVHDUFKDQGSURJUDPVVKHZDVLQFOXVLYHRILQGLYLGXDOVIURPHYHU\UDFLDOJURXS LQWKHORFDODUHDHYHQWKRXJKWKLVUHTXLUHGSDUWLFXODUHIIRUWRQKHUEH KDOI7DNHQDVDZKROH +ROOLQJZRUWKVZRUNGHPRQVWUDWHGDZLOOLQJQHVVWRORRNEH\RQGUDFHWRGHWHUPLQHZKHUH LQWHOOLJHQFHFDPHIURPDQGKRZWRSHUSHWXDWHLW$OWKRXJKKHULQLWLDOVXUURXQGLQJVHQJHQGHUHG UDFLVWEHOLHIVVKHGLGQRWDSSHDUWROHWWKHVHEHOL HIVLQIOXHQFHKHULQKHUFDUHHU7KURXJKRXWKHU ZRUNKHUYLHZVRIUDFHDSSHDUHGWRUHPDLQFRQVLVWHQW6KHDOZD\VVHHPHGWREHRSHQWRWKHLGHD WKDWUDFLDOGLIIHUHQFHVLQLQWHOOLJHQFHZHUHTXLWHSRVVLEO\GXHWRHQYLURQPHQWDOIDFWRUVUDWKHU WKDQLQKHUHQWE LRORJLFDOGLIIHUHQFHV +ROOLQJZRUWKVEHOLHIVPD\DSSHDUWREHUDFLDOO\ELDVHGLQWKHSUHVHQWGD\EXWLQWKH HDUO\WZHQWLHWKFHQWXU\VKHZDVRQHRIWKHPRVWVRFLDOO\SURJUHVVLYHDFDGHPLFVLQWKHILHOGRI HGXFDWLRQDOSV\FKRORJ\2WKHUUHVHDUFKHUVRILQW HOOLJHQFHDQGJLIWHGQHVVLQFOXGLQJ7HUPDQ 6HOGHQ

PAGE 34

ZHUHOHVVUDFLDOO\LQFOXVLYHLQWKHLUZRUN ,Q-%6WURXGDUJXHGWKDWEODFNFKLOGUHQZHUH QRWRQO\LQIHULRULQWKHLULQWHOOLJHQFHWHVWVFRUHVEXWDOVRLQWKHLUDELOLW\WROHDUQ $GGLWLRQDOO\ WKHLVVXH RIUHSUHVHQWDWLRQRIPLQRULWLHVLQJLIWHGHGXFDWLRQSURJUDPVFRQWLQXHVWREHSUREOHPDWLF WRGD\%ODFN$VLDQ0H[LFDQDQG-HZLVKVWXGHQWVDUHDPRQJWKRVHZKRVWLOOIDFHEDUULHUVLQ EHLQJUHFRJQL]HGDVJLIWHG &RQVLGHULQJWKHFRQWLQXLQJSUREOHPVRIUHSUHV HQWDWLRQKHUHIIRUWV ZHUHYHU\SURJUHVVLYH6RPHRIWKHFKDOOHQJHVWKDWHGXFDWLRQDOSV\FKRORJLVWV OLNH +ROOLQJZRUWK H[SHULHQFHGZKLOHH[DPLQLQJWKHUHODWLRQVKLSEHWZHHQUDFHDQGLQWHOOLJHQFHLQ WKHHDUO\WZHQWLHWKFHQWXU\UHPDLQDUHOHYDQWFRQFHUQHYHQLQ WKHWZHQW\ ILUVWFHQWXU\7KDWWKH GHPRJUDSKLFVVHFWLRQLQ *LIWHG&KLOGUHQ LVTXRWHGE\RWKHUVFKRODUVWRGHPRQVWUDWHKHUUDFLDO EHOLHIVH[HPSOLILHVWKHFRQFHUQDERXWWKHSRWHQWLDOELDVHVLQWKHZRUNRIHDUO\HGXFDWLRQDO SV\FKRORJLVWVEXWXQWLOQRZWKHU HKDVEHHQQRV\VWHPDWLFH[DPLQDWLRQRI+ROOLQJZRUWKVZULWLQJ WRGHWHUPLQHKHULGHDVRQUDFHDQGJLIWHGQHVV$OWKRXJKVLPSO\ORRNLQJDWWKLVVPDOOVHFWLRQRI *LIWHG &KLOGUHQ PLJKWVXJJHVWWKDWVKHZDVUDFLVWE\WRGD\VVWDQGDUGVDPRUHFRPSUHKHQVLYH ORRN DWKHUZRUNVKRZVKHUDWWLWXGHVZHUHPXFKPRUHFRPSOH[DQGRSHQWRWKHSRVVLELOLW\RI LQWHOOLJHQFHEHLQJLQGHSHQGHQWRIUDFH:HFDQQRWVLPSO\ODEHOKHUDVDUDFLVWRUQRWDUDFLVW EHFDXVHKHUYLHZVZHUHPRUHFRPSOLFDWHGWKDQWKDW 2EYLRXVO\ WKLVLVDQ LPSRUWDQWLVVXHEXWLW FDQQRWEHIXOO\XQGHUVWRRGE\ORRNLQJDWVXFKDVPDOOVDPSOHDVWKHGHPRJUDSKLFVFKDSWHULQRQH ERRN 6RFLRHFRQRPLF&ODVV $QRWKHULVVXHWRGD\LQJLIWHGHGXFDWLRQLVWKDWWKHJUHDWHUSURSRUWLRQRIJLIWHGFKLOGUHQ FRPHIURPIDPLOLHVL QWKHPLGGOHDQGXSSHUVRFLRHFRQRPLFFODVVHV+ROOLQJZRUWKDOVRQRWHGWKLV .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK [YLL 6WURXG 0DUJROLQ

PAGE 35

WUHQGDQGH[DPLQHGZKDWWKHUHODWLRQVKLSZDVEHWZHHQJLIWHGQHVVDQGFODVV6KHODUJHO\UHOLHG RQUHVHDUFKFRQGXFWHGE\RWKHUVRFLDOVFLHQWLVWVDQGKHURZQH[SHULHQFHVWRDVFHUWDLQ ZK\WKHUH ZHUHVRIHZKLJKO\LQWHOOLJHQWFKLOGUHQIRXQGLQIDPLOLHVWKDWVWUXJJOHGILQDQFLDOO\6KHSURSRVHG VHYHUDOH[SODQDWLRQVIRUWKLVSKHQRPHQRQEXWFRXOGQRWGHWHUPLQHWKDWWKHUHZDVDVLQJOHFDXVDO UHODWLRQVKLSEHWZHHQDQ\IDFWRUV $JDLQ+ROOLQJ ZRUWKVXSEULQJLQJOLNHO\LQIOXHQFHGKHUODWHUEHOLHIVDERXWWKH UHODWLRQVKLSEHWZHHQVRFLRHFRQRPLFFODVVDQGJLIWHGQHVV+HUKXVEDQGQRWHGWKDWVKH H[SHULHQFHGSRYHUW\GXULQJKHUFKLOGKRRGDQGHDUO\DGXOWKRRG\HDUV $VDFKLOG+ROOLQJZRUWK JUHZXSLQWK HORZHUVRFLRHFRQRPLFFODVV6KHDQGKHUVLVWHUVZHUHUDLVHGE\JUDQGSDUHQWVLQ UXUDO1HEUDVNDXQWLOVKHZDVDQDGROHVFHQWZKHQKHUIDWKHUUHPDUULHGDQGWRRNKLVGDXJKWHUV EDFNLQWRKLVFXVWRG\6KHJUHZXSLQDYHU\LVRODWHGDQGLPSRYHULVKHGKRPHLQFRQ WUDVWWRWKH XSSHUDQGPLGGOHFODVVXSEULQJLQJVRIPDQ\RIKHUSHHUVLQWKHILHOGRIHGXFDWLRQDO SV\FKRORJ\ $OWKRXJKVKHKDGKRSHGWREHFRPHDZULWHUVKHHQWHUHGDWHDFKLQJFDUHHUDIWHU JUDGXDWLQJFROOHJHVRWKDWVKHFRXOGILQDQFLDOO\VXSSRUWKHU\RXQJH UVLVWHUV +HUSHUVRQDOOLIH H[HPSOLILHGWKHFKDOOHQJHVWKDWDJLIWHGFKLOGPLJKWIDFHJURZLQJXSLQDIDPLO\WKDWZDVLQWKH ORZHUVRFLRHFRQRPLFFODVV7KLVZDVDQHFGRWDOHYLGHQFHWKDWJLIWHGFKLOGUHQFRXOGFRPHIURP SDUHQWVZKRZHUHQRWHFRQRPLFDOO\VXF FHVVIXO +ROOLQJZRUWKDOVROLYHGLQDQLPSRYHULVKHGVWDWHDVDQHZO\ZHG+HUGHOD\LQHQWHULQJ JUDGXDWHVFKRRODIWHUPDUU\LQJZDVGXHWRILQDQFLDOFRQVWUDLQWV7KDWVKHZDVEDUUHGIURP WHDFKLQJPDGHWKHLUHFRQRPLFVLWXDWLRQHYHQPRUHVWUHVVIXO:KHQWKH\ ZHUHILUVWPDUULHGWKH\ +ROOLQJZRUWK /HWD6WHWWHU+ROOLQJZRUWK$%LRJUDSK\ 0LOOHU ,ELG

PAGE 36

ZHUHVRPHWLPHVXQDEOHWRSD\WKHLUEDVLFELOOVOLYLQJLQWKHLURQHURRPDSDUWPHQW 'HVSLWH WKHLULPSRYHULVKHGVWDWHERWK+ROOLQJZRUWKVZHUHYHU\PXFKRSSRVHGWRJRYHUQPHQWIXQGHG VRFLDOZHOIDUHSURJUDPV $FFRUGLQJWRKHUKXVEDQ GVKHGLVOLNHGWKHSKLODQWKURSLFHFRQRPLF HIIRUWVWKDWDVVLVWHGWKRVHZKREXUGHQHGVRFLHW\DQGLJQRUHGWKHLQGLYLGXDOVXSRQZKRPVRFLHW\ GHSHQGHGIRULPSURYHPHQW $OWKRXJKSUHVHQWGD\VFKRODUVKDYHDUJXHGWKDWVKHZDV LQWHOOHFWXDOO\JLIWHG +ROOLQJZRUWK VFLUFXPVWDQFHVSUHYHQWHGKHUIURPOLYLQJXSWRKHUDELOLWLHV 7KLVPLJKWKDYHEHHQKHUPRWLYDWLRQWRSURYLGHILQDQFLQJIRUVRPHRIWKHKLJKO\JLIWHGFKLOGUHQ VKHHQFRXQWHUHGZKRFDPHIURPKRPHVLQWKHORZHUVRFLRHFRQRPLFFODVV+HUHFRQRPLF FRQWULEXWLRQV WRVWXGHQWVH[HPSOLILHGKHUUHFRJQLWLRQRIWKHSURPLVHWKDWWKHVHVWXGHQWVKHOG DOWKRXJKWKHLUSDUHQWVKDGQRWWKULYHGILQDQFLDOO\ )URPWKHEHJLQQLQJVRIKHUFDUHHU+ROOLQJZRUWKRIWHQZRUNHGZLWKJURXSVRISHRSOHLQ WKHORZHUVRFLRHFRQRPLFFODVV:KL OHVHHNLQJKHUJUDGXDWHGHJUHHVVKHZDVHPSOR\HGDWWKH &OHDULQJ+RXVHIRU0HQWDO'HIHFWLYHVLQ1HZ
PAGE 37

WLPHVKHZDVH[SRVHGWRWKHGLVDGYDQWDJHGVLWXDWLRQVRIF KLOGUHQVFKRROVLPPLJUDQWVDQGWKRVH ZKRH[SHULHQFHGFULPHSROOXWLRQDQGKHDOWKSUREOHPV 7KHVHSURIHVVLRQDOH[SHULHQFHV H[SRVHGKHUWRVRPHRIWKHFKDOOHQJHVWKHJLIWHGFKLOGUHQIURPWKHORZHUVRFLRHFRQRPLFFODVV PLJKWIDFHLQDELJFLW\ ,Q *LIWH G&KLOGUHQ +ROOLQJZRUWKGLVFXVVHGVRFLRHFRQRPLFFODVVLQWKHVDPHFKDSWHUWKDW VKHGLVFXVVHGUDFHZKLFKZDVWKHFKDSWHURQWKHGHPRJUDSKLFVRIJLIWHGFKLOGUHQ&LWLQJGDWD WKDWKDGEHHQFROOHFWHGE\7HUPDQVKHVWDWHGWKDWWKHPDMRULW\RIJLIWHGFKLOGUHQ KDGSDUHQWV ZKRZHUHHPSOR\HGLQSURIHVVLRQDOVHPL VNLOOHGRUFOHULFDORFFXSDWLRQV $ODUJHPDMRULW\RI WKRVHWHVWLQJLQWKHWRSFHQWLOHKDYHIDWKHUVZKRDUHHLWKHUSURIHVVLRQDOPHQRUSURSULHWRUVDQG H[HFXWLYHVVKHREVHUYHG>EXW@YHU\IHZDUHVRQ VRUGDXJKWHUVRIXQVNLOOHGPDQXDOODERUHUV 6KHVWDWHGWKLVIDFWLQRWKHUDUWLFOHVDOVR 7KLVHYLGHQFHVKHFODLPHGGLVSURYHGWKHFRPPRQ $PHULFDQP\WKWKDWJLIWHGFKLOGUHQZHUHRIWHQERUQLQWRORZHULQFRPHIDPLOLHVDQGIRXQGWKHLU ZD\WRSURPLQHQFHE \ULVLQJDERYHWKHLUFLUFXPVWDQFHV 7KLVFODLPZDVVXSSRUWHGE\RWKHU UHVHDUFKHUVZKRKDGVLPLODUILQGLQJVUHJDUGLQJSDUHQWDORFFXSDWLRQVDQGFKLOGUHQV LQWHOOLJHQFH 6KHREVHUYHGKRZJLIWHGFKLOGUHQZHUHGLVWULEXWHGDFURVVVRFLRHFRQRPLFFODVVHV EXWVKH UHFRJQL]HGWKDWWKHUHZHUHQRDEVROXWHUXOHVDERXWZKHUHKLJKO\LQWHOOLJHQWLQGLYLGXDOV ZHUHIRXQG )DJDQ +ROOLQJZRUWK *LIWHG&KLOGUHQ7KHLU1DWXUHDQG 1XUWXUH +ROOLQJZRUWK:KR,VWKH*LIWHG3XSLO" +ROOLQJZRUWK3URYLVLRQVIRU,QWHOOHFWXDOO\6XSHULRU&KLOGUHQ ,ELG /HWD+ROOLQJZRUWK6HOHFWHG5HIHUHQFHVIURPWKH/LWHUDWXUHRQ([FHSWLRQDO&KLOGUHQ 7KH(OHPHQWDU\6FKRR O -RXUQDO QRf(OL]DEHWK/:RRGV7KH0HQWDOO\*LIWHG 5HYLHZRI(GXFDWLRQDO5HVHDUFK QR f

PAGE 38

+ROOLQJZRUWKDOVRSUHVHQWHGHYLGHQFHWKDWLQGLFDWHGPRVWJLIWHGFKLOGUHQWHQGHGWROLYHLQ FLWLHV7KLVDGGUHVVHGDFRQFHUQKHOGE\HGXFDWLRQDOSV\FKRORJL VWVWKDWWKHUHZHUHPDQ\KLJKO\ LQWHOOLJHQWFKLOGUHQZKRZHUHQRWUHFHLYLQJWKHSURSHUHGXFDWLRQDODWWHQWLRQEHFDXVHWKH\ZHUH OLYLQJLQUXUDODUHDVZKHUHWKHVFKRROVFRXOGQRWSURYLGHVSHFLDOHGXFDWLRQIRUWKHP6KHGLG QRWHKRZHYHUWKDWWKHDFWRIOLYL QJLQWKHFLW\FRXOGQRWEHWKHFDXVHRIFKLOGUHQVJLIWHGQHVV EHFDXVHRQFHRXWVLGHRIWKHFLW\WKHLQWHOOLJHQFHOHYHOVLQUXUDODUHDVLQFUHDVHGZLWKGLVWDQFH IURPDFLW\ 6KHEHOLHYHGWKDWWKHUHDVRQWKDWSHRSOHWKRXJKWJLIWHGFKLOGUHQFDPHIURPUXUDO D UHDVZDVEHFDXVHWKHSHRSOHZKRDFKLHYHGHPLQHQFHLQWKHILUVWIHZFHQWXULHVLQ$PHULFDKDG FRPHIURPUXUDODUHDVEHFDXVHPDMRUPHWURSROLWDQFLWLHVGLGQRW\HWH[LVW :KHUHUXUDO FKLOGUHQKDYHEHHQWHVWHGDWUDQGRPLQWKLVFRXQWU\VKHQRWHGWKH\\L HOGDVRPHZKDWORZHU DYHUDJHLQWHOOLJHQFHWKDQFLW\FKLOGUHQ\LHOG +RZHYHUVKHIHOWWKDWPRUHUHVHDUFKQHHGHGWR EHGRQHLQWKLVDUHDDVWKHUHZDVQRUHOLDEOHFHQVXVRIWKHJLIWHGWDNHQRQIDUPVUDQFKHVDQGLQ KDPOHWVLQ$PHULFD +ROOLQJZRUWKGH VLUHGPRUHUHVHDUFKRQWKHORFDWLRQRIJLIWHGFKLOGUHQ EHFDXVHVKHIHOWLWZDVVRLPSRUWDQWWRHGXFDWHWKHVHFKLOGUHQXSWRWKHLUIXOOFDSDFLWLHV,IWKHUH ZHUHGURYHVRIJLIWHGFKLOGUHQIRXQGLQUXUDODUHDVVFKRROVQHHGHGWRDGMXVWWRDFFRPPRGDWHWKLV SR SXODWLRQ 8QWLOWKHODWHQLQHWHHQWKDQGHDUO\WZHQWLHWKFHQWXULHVZKHQLQWHOOLJHQFHWHVWVZHUHILUVW FUHDWHGJLIWHGQHVVZDVGHWHUPLQHGE\ORRNLQJDWKRZPXFKHPLQHQFHDQLQGLYLGXDODFKLHYHG +ROOLQJZRUWKUHFRJQL]HGWKDWWKLVPHWKRGZDVSUREOHPDWLFEH FDXVHRIWKHSRWHQWLDODOWHUQDWH /HWD+ROOLQJZRUWK:KR$UH*LIWHG&KLOGUHQ" &KLOG6WXG\ QRf +ROOLQJZRUWK3URYLVLRQVIRU,QWHOOHFWXDO O\6XSHULRU&KLOGUHQ /HWD+ROOLQJZRUWK,QWHOOHFWXDOO\6XSHULRU&KLOGUHQ 0F&OXUHV0DJD]LQH QRf +ROOLQJZRUWK:KR,VWKH*LIWHG3XSLO" +ROOLQJZRUWK3URYLVLRQVIRU,QWHOOHFWXDOO\6XSHULRU&KLOGUHQ

PAGE 39

H[SODQDWLRQVIRUDSHUVRQVVXFFHVVRUIDLOXUHLQOLIH6KHSRLQWHGWRWKHODFNRIZRPHQRQOLVWVRI HPLQHQWLQGLYLGXDOVDVHYLGHQFHWKDWHQYLURQPHQWDOIDFWRUVSUHYHQWHGPDQ\LQWHOOLJHQWIHPDOHV IURPDFKLHYLQJSXEOLFVXFFHV V%XWVKHGLGGUDZXSRQWKLVUHVHDUFKWRDVFHUWDLQWKDWHPLQHQW DGXOWVFRQVWLWXWHDGHILQLWHVPDOOSHUFHQWDJHRIWKHSRSXODWLRQWKH\DUHPRVWRIWHQERUQLQFLWLHV RURQWKHHVWDWHVRIQREOHVLQORQJVHWWOHGFRXQWULHVWKDWWKH\KDYHPDQ\PRUHGLVWLQJX LVKHG UHODWLYHVWKDQSHRSOHRUGLQDULO\KDYHDQGWKDWWKH\RULJLQDWHXVXDOO\LQIDPLOLHVRIVXSHULRU VRFLR HFRQRPLFVWDWXV 7KLVTXRWDWLRQLQGLFDWHVKHUUHFRJQLWLRQWKDWPRVWSHRSOHZKR DFKLHYHGHPLQHQFHFDPHIURPWKHXSSHUVRFLRHFRQRPLFFODVV+RZHYHU KHUFULWLFLVPRIWKH PHWKRGRORJ\XVHGLQWKHVHVWXGLHVUHIOHFWHGKHUEHOLHILQWKHLQIOXHQFHRIHQYLURQPHQWRQWKH RXWFRPHRIDSHUVRQVOLIHDQGKHUUHFRJQLWLRQWKDWPDQ\KLJKO\LQWHOOLJHQWSHRSOHPLJKWQHYHU DFKLHYHHPLQHQFHEHFDXVHWKH\ZHUHOLPLWHGE\ DIDFWRUWRWDOO\XQUHODWHGWRDELOLW\ +ROOLQJZRUWKEHOLHYHGWKDWSDUWRIWKHUHDVRQWKDWJLIWHGFKLOGUHQRIWHQFDPHIURPSDUHQWV ZLWKZKLWH FROODUDQGPRUHLQWHOOHFWXDOFDUHHUVZDVEHFDXVHKHUHGLW\SOD\HGDVLJQLILFDQWUROHLQ LQWHOOLJHQFH $OWKRXJKQR WDOORIDSHUVRQVLQWHOOLJHQFHFRXOGEHH[SODLQHGE\WKHLQWHOOLJHQFH RIIDPLO\VKHUHFRJQL]HGWKDWWKHUHZDVPRVWRIWHQDSRVLWLYHFRUUHODWLRQEHWZHHQ,4VFRUHVRI IDPLO\PHPEHUV6KHQRWHGWKDWPRVWJLIWHGFKLOGUHQKDGDWOHDVWRQHKLJKO\LQWHOOLJHQW SDUHQW (YLGHQFHRIWKHLQIOXHQFHRIKHUHGLW\DOVRLQFOXGHGWKHJUHDWHULQVWDQFHRIKLJKO\LQWHOOLJHQW VLEOLQJVRIJLIWHGFKLOGUHQWKDQZRXOGEHIRXQGLQWKHJHQHUDOSRSXODWLRQ DQGWKDWJLIWHG +ROOLQJ ZRUWK,QWHOOHFWXDOO\6XSHULRU&KLOGUHQ +ROOLQJZRUWK3URYLVLRQVIRU,QWHOOHFWXDOO\6XSHULRU&KLOGUHQ /HWD+ROOLQJZRUWK7KH&KLOGRI9HU\6XSHULRU,QWHOOLJHQFHDVD6SHFLDO3UREOHPLQ6RFLDO$GMXVWPHQW $QQDOV RIWKH$PHULFDQ$FDGHP\ RI3ROLWLFDODQG6RFLDO6FLHQFH QRf /HWD+ROOLQJZRUWK7KH5HJUHVVLRQRI6LEOLQJVRI&KLOGUHQ:KR7HVWDWRU$ERYH,46WDQIRUG %LQHWf 7KH -RXUQDORI(GXFDWLRQDO3V\FKRORJ\ QRf

PAGE 40

FKLOGUHQRIWHQKDGDODUJHQXPEHURIHPLQHQWDGXOWUHODWLYH V 7KXVPRUHJLIWHGFKLOGUHQVKRXOG FRPHIURPKLJKO\LQWHOOLJHQWSDUHQWV$GGLWLRQDOO\RWKHUUHVHDUFKHUVIRXQGWKDWWKHUHZDVDKLJK FRUUHODWLRQEHWZHHQLQWHOOLJHQFHWHVWVFRUHVEHWZHHQSDUHQWVDQGFKLOGUHQ 3DUHQWVLQWKHXSSHU VRFLRHFRQRPLFFODVVHVZ HUHDOVRDEOHWRSURYLGHDVXSSRUWLYHHQYLURQPHQWIRUJLIWHGFKLOGUHQ ZKLFK+ROOLQJZRUWKEHOLHYHGFRXOGEHDGHWHUPLQLQJIDFWRULQLQWHOOLJHQFH ,QIDFWLQ 7KH 3V\FKRORJ\RIWKH$GROHVFHQW VKHDUJXHGWKDWDSSUR[LPDWHO\VHYHQW\ ILYHSHUFHQWRIFKLOGUHQ ZRXOGEHZHOOVHUYHGWRVLPSO\EHHGXFDWHGIRUWKHLUSDUHQWVSURIHVVLRQVEXWWKDWWKHUHZDVD WHQSHUFHQWRYHUODSLQLQWHOOLJHQFHEHWZHHQWKHFODVVHV7HQSHUFHQWRIWKHFKLOGUHQERUQLQWRWKH ORZHUFODVVZHUHLQWHOOLJHQWHQRXJKWREHHGXFDWHGIRUDSURI HVVLRQDOFDUHHUDQGYLFHYHUVD 6KHEHOLHYHGWKDWPRVWFKLOGUHQZHUHFORVHWRWKHLQWHOOLJHQFHOHYHORIWKHLUSDUHQWVEXWVKH UHFRJQL]HGWKDWWKHUHZHUHH[FHSWLRQVWRWKLVUXOH7KHUHIRUHVKHIHOWWKDWKHUHGLW\FRXOGQRW SURYLGHWKHFRPSOHWHH[SODQDWLR QIRUKRZVRPHLQGLYLGXDOVFDPHWREHKLJKO\LQWHOOLJHQW ,QGHWHUPLQLQJWKHGHPDUFDWLRQVRIFODVV+ROOLQJZRUWKRIWHQUHIHUUHGWRWKHRFFXSDWLRQDO FODVVLILFDWLRQRI7DXVVLJZKLFKZDVDOVRXVHGE\7HUPDQ(DFKIDPLO\VFODVVGHSHQGHGRQWKH IDWKHUVRF FXSDWLRQ7KLVFODVVLILFDWLRQLQFOXGHGILYHJURXSVZLWKWKHKLJKHVWHDUQLQJFODVV ODEHOHG&ODVVDQGWKHORZHVWHDUQLQJFODVVODEHOHG&ODVV7KHFODVVHVLQFOXGHGSURIHVVLRQDO PHQDQGSURSULHWRUVFOHULFDOZRUNHUVVNLOOHGWUDGHVPHQVHPL VNLOOHGWUDGH VPHQDQGXQVNLOOHG ODERUHUV +ROOLQJZRUWKQRWHGWKDWPRVWJLIWHGFKLOGUHQFDPHIURPKRPHVLQ&ODVVHVDQG SUREDEO\EHFDXVHLQPDQ\FDVHVLQWHOOLJHQFHZDVLQKHULWHGIURPSDUHQWV+RZHYHUVKHZDVQRW +ROOLQJZRUWK3URYLVLRQVIRU, QWHOOHFWXDOO\6XSHULRU&KLOGUHQ 6WURXG .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK +ROOLQJZRUWK 7KH3V\FKRORJ\RIWKH$GROHVFHQW +ROOLQJZRUWK *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH

PAGE 41

FRQYLQFHGWKDWJHQHWLFVZHUHWKHRQO\GHWHUPL QDQWRILQWHOOLJHQFHVKHDOVRIHOWWKDWWKH HQYLURQPHQWSOD\HGDVLJQLILFDQWUROH 6KHVXJJHVWHGZKLOHH[DPLQLQJWKHPXOWLSOHIDFWRUVWKDW LQIOXHQFHGLQWHOOLJHQFHWKDWWKHLQKHULWDQFHRILQWHOOHFWGRHVQRWIROORZWKHVLPSOHIRUPXOD >LW@LV DFRPSOH[UHVXOWLQJIURPWKHLQFLGHQFHRIDJUHDWQXPEHURIIXQFWLRQVDFWLQJWRJHWKHULQ DJUHDWQXPEHURIZD\V 6KHZDVDYHU\HDUO\YRLFHLQWKHQDWXUHYHUVXVQXUWXUHGHEDWHLQ SV\FKRORJ\DQGLQWHOOLJHQFHUHVHDUFKVKHIHOWWKDWQDWXUHSOD\HGDVWURQ JUROHLQWKHGHYHORSPHQW RILQWHOOLJHQFHEXWUHFRJQL]HGWKDWQXUWXUHZDVDOVRLQIOXHQWLDO+HUYLHZVRQWKHUHODWLRQVKLS EHWZHHQVRFLRHFRQRPLFFODVVDQGJLIWHGQHVVDUHSDUWLFXODUO\LPSRUWDQWZKHQH[DPLQLQJWKH GHYHORSPHQWRIJLIWHGSURJUDPVEHFDXVHVKH ZDVRQHRIWKHILUVWSHRSOHWRRIIHUH[SODQDWLRQVDV WRZK\WKHUHZDVDKLJKHUSURSRUWLRQRIKLJKO\LQWHOOLJHQWFKLOGUHQIRXQGLQPLGGOHDQGXSSHU FODVVKRPHV 2QHRIWKHUHDVRQVWKDW+ROOLQJZRUWKEHOLHYHGWKDWWKHPDMRULW\RIFKLOGUHQFDPHIURP SDUHQWVZ KRKHOGSURIHVVLRQDORUVNLOOHGRFFXSDWLRQVZDVEHFDXVHLQDFDSLWDOLVWVRFLHW\ FRPSHWLWLRQZRXOGQDWXUDOO\OHDGWKHPRVWWDOHQWHGLQGLYLGXDOVWRULVHWRWKHWRS6KHZDVMXVWRQH RIPDQ\SHRSOHLQFOXGLQJHGXFDWLRQDOSV\FKRORJLVWVZKREHOLHYHGLQWKLVL GHDRIDPHULWRFUDF\ ZKHUHLQWHOOLJHQFHDQGHIIRUWZRXOGOHDGDQ\RQHWRVXFFHVV 6KHWKXVFRQFOXGHGWKDWWKHPRVW LQWHOOLJHQWSHRSOHZRXOGDOVREHWKHPRVWHFRQRPLFDOO\VXFFHVVIXO 6KHUHOLHGXSRQWKHLGHD WKDWWKHYHU\LQWHOOLJHQWDUHWKRVHZKRULVHL QWKHZRUOGE\FRPSHWLWLRQDQGZKRDUHDOVRDEOHWR SURGXFHFKLOGUHQOLNHWKHPVHOYHV 6KHIHOWWKDWWKLVH[SODLQHGZK\WKHUHZHUHKLJKHUPHGLDQ %RUODQ G/HWD+ROOLQJZRUWKV&RQWULEXWLRQVWRWKH3V\FKRORJ\DQG(GXFDWLRQRIWKH*LIWHG+ROOLQJZRUWK *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH /HWD+ROOLQJZRUWK 6SHFLDO7DOHQWVDQG'HIHFWV 1HZ
PAGE 42

,4VFRUHVLQSULYDWHVFKRROVWKDQLQSXEOLFVFKRROV +LJKO\LQWHOOLJHQWSDUHQWVZHUHPRUHOLNHO\ WRKDYHPRU HLQWHOOLJHQWFKLOGUHQDQGWREHHFRQRPLFDOO\VXFFHVVIXOZKLFKPHDQWWKDWWKH\FRXOG DIIRUGWRSD\WXLWLRQIRUWKHLUFKLOGUHQWRDWWHQGSULYDWHVFKRROV6KHQRWHGWKDWDWSULYDWHVFKRROV WKHPHGLDQ,4VFRUHZDVZKLOHWKHPHGLDQ,4VFRUHDWSXEOLFVFK RROVZDVQHDU $V PHQWLRQHGHDUOLHULQWKLVFKDSWHUVKHXVHGWKLVIDFWWRDUJXHWKDWWKHSUHSRQGHUDQFHRI-HZLVK FKLOGUHQLQKHUVWXGLHVUHIOHFWHGWKHIDFWWKDWWKHPDQ\RIWKHPRVWLQWHOOLJHQW&DWKROLFDQG 3URWHVWDQWFKLOGUHQZHUHVHQWWRSULYDWHV FKRROV +RZHYHUVKHGLGQRWEHOLHYHWKDWDOOJLIWHG LQGLYLGXDOVFRXOGVXUPRXQWREVWDFOHVWRDFKLHYHHPLQHQFH 7KLVH[SODLQHGKRZVRPHJLIWHG FKLOGUHQZHUHIRXQGLQKRXVHKROGVIURPWKHORZHUVRFLRHFRQRPLFFODVVRQHRUERWKSDUHQWV PLJKWKDYHEHHQKLJKO\ LQWHOOLJHQWEXWXQDEOHWRVXFFHHGHFRQRPLFDOO\$FFRUGLQJWRKHUYLHZ PRVWJLIWHGFKLOGUHQZRXOGEHIRXQGLQKRPHVWKDWZHUHILQDQFLDOO\VXFFHVVIXOEXWDFHUWDLQ PLQRULW\RIWKHPZRXOGFRPHIURPKRPHVLQWKHORZHUVRFLRHFRQRPLFFODVV 6LJQLILFDQWO\ +ROOLQJZRUWKVFRQFHUQDERXWWKHXQGHUUHSUHVHQWDWLRQRIFKLOGUHQIURPWKH ORZHUVRFLRHFRQRPLFFODVVZKRZHUHLGHQWLILHGDVJLIWHGIRUHVKDGRZHGDSUREOHPWKDWUHPDLQV DQLVVXHLQJLIWHGHGXFDWLRQWRGD\+HULQWHUHVWLQWKHUHODWLRQVKLSEHWZHHQHGXFDWLRQDQG RSSRUWXQLW\IRUJLIWHGFKLOGUHQLVRQHZD\LQZKLFKVKHVXEVWDQWLDOO\GLIIHUHGIURP7HUPDQ 6KH RIWHQLQYROYHGFKLOGUHQIURPWKHORZHUVRFLRHFRQRPLFFODVVLQKHUZRUNRQJLIWHGQHVV$OWKRXJK WKHPDMRULW\RIKHUSDUWLFLSDQWVFDPHIURPSDUHQWVLQVNLOOHGS URIHVVLRQVDVPDOOHUQXPEHUZHUH IURPSDUHQWVHQJDJHGLQXQVNLOOHGRFFXSDWLRQV&KLOGUHQIURPORZHUVRFLR HFRQRPLFFODVVHV +ROOLQJZRUWK7DSSLQJ 5DWHRI&KLOGUHQ:KR7HVW$ERYH,46WDQIRUG %LQHWf +ROOLQJZRUWK,QWHOOHFWXDO O\6XSHULRU&KLOGUHQ +ROOLQJZRUWK7DSSLQJ 5DWHRI&KLOGUHQ:KR7HVW$ERYH,46WDQIRUG %LQHWf /LQGD.6LOYHUPDQ7KH/HJDF\RI/HWD+ROOLQJZRUWK *LIWHG&KLOG4XDUWHUO\ QRf 6LOYHUPDQ,W$OO%HJDQ:LWK/HWD+ ROOLQJZRUWK7KH6WRU\RI*LIWHGQHVVLQ:RPHQ

PAGE 43

ZHUHUHSUHVHQWHGLQKHUZRUNDWWKH6SH\HU6FKRRODQGLQKHUFDVHVWXGLHVRIKLJKO\JLIWHG FKLOGUHQ6KHDOVRKHOSHGVXSSRUWVRPHRI WKHVHFKLOGUHQILQDQFLDOO\LQWKHLUHIIRUWVWRREWDLQ KLJKHUHGXFDWLRQ +HUSHUVRQDOSKLODQWKURSLFFRQWULEXWLRQVWRKHUVWXGHQWVH[HPSOLILHGKHU EHOLHIWKDWVRFLHW\VKRXOGHQGHDYRUWRHGXFDWHWKHEHVWDQGEULJKWHVWUDWKHUWKDQWKHOHDVWDEOH VWXGHQWV7 KHLVVXHVRIFODVVDQGJLIWHGQHVVZHUHSDUWLFXODUO\LPSRUWDQWWRKHUEHFDXVHVKHKDG VHHQKRZILQDQFLDOUHVWULFWLRQVFRXOGOLPLWDJLIWHGLQGLYLGXDOVDELOLW\WREHHGXFDWHGWRKLVRUKHU IXOOFDSDFLW\6KHEHJDQKHUOLIHLQPHDJHUVXUURXQGLQJVDQGHDUO\ RQGHWHUPLQHGWKDWJLIWHG FKLOGUHQFRXOGFRPHIURPDQ\VRFLRHFRQRPLFFODVVDOWKRXJKWKHPDMRULW\RIWKHPFDPHIURPWKH PLGGOHDQGXSSHUFODVVHV%DVHGXSRQKHUSURIHVVLRQDOZULWLQJVKHUYLHZVRQWKLVLVVXHDSSHDUHG WRUHPDLQFRQVWDQWWKURXJKRXWKHUFDUHH U3URYLGLQJDVPXFKHGXFDWLRQDORSSRUWXQLW\DVSRVVLEOH ZDVFUXFLDOLQ+ROOLQJZRUWKVRSLQLRQEHFDXVHJLIWHGFKLOGUHQZRXOGJURZXSWRILOODYHU\ VSHFLDOUROHLQVRFLHW\ 7KH,PSRUWDQFHRI(GXFDWLQJ*LIWHG&KLOGUHQ $QRWKHUSULPDU\FRQFHUQIRU+ROOLQJZRUW KZDVWKDWRIKRZDQGZK\JLIWHGFKLOGUHQ QHHGHGVSHFLDOHGXFDWLRQDORSSRUWXQLWLHV0DQ\HOHPHQWDU\VFKRROVGXULQJWKHHDUO\WZHQWLHWK FHQWXU\LPSOHPHQWHGWKHVDPHFXUULFXOXPDQGSHGDJRJ\IRUDOOVWXGHQWVLQHYHU\JUDGHEXW +ROOLQJZRUWKZDVFRQFHUQHGWKDW WKLVPHWKRGZDVQRWDSSURSULDWHIRUJLIWHGFKLOGUHQ+RZHYHU WRFRQYLQFHRWKHUHGXFDWLRQDOSV\FKRORJLVWVWKDWSURYLGLQJVSHFLDOHGXFDWLRQIRUJLIWHGFKLOGUHQ ZDVQHFHVVDU\VKHILUVWKDGWRH[SODLQWKHLPSRUWDQWUROHWKDWKLJKO\LQWHOOLJHQWLQGLYLGXDOVK DGLQ VRFLHW\+HUSULPDU\DUJXPHQWIRUWKHHGXFDWLRQRIJLIWHGFKLOGUHQZDVWKDWWKHVHZHUHWKHSHRSOH ZKRDVDGXOWVZRXOGFRQWULEXWHWRWKHPDWHULDODQGLGHRORJLFDOSURJUHVVRIVRFLHW\+HU FRQILGHQFHLQWKHUROHRIKLJKO\LQWHOOLJHQWLQGLYLGXDOVPRWLY DWHGKHUWRGLVFRYHUDVPXFKDVVKH .HDUQH\

PAGE 44

FRXOGDERXWWKLVSRSXODWLRQDQGKRZEHVWWRVHUYHWKHPVRLWLVLPSRUWDQWWRXQGHUVWDQGZK\VKH PDGHWKHVHFODLPVDERXWWKHIXWXUHRIJLIWHGFKLOGUHQ +ROOLQJZRUWKRIWHQFRPSODLQHGWKDWHGXFDWLRQDOSV\FKRORJ\DVDILHOG WHQGHGWRIRFXV PRUHRQSURYLGLQJVSHFLDOHGXFDWLRQIRUFKLOGUHQZLWKOHDUQLQJGLVDELOLWLHVRUORZ,4VFRUHVWKDQ LWGLGRQHGXFDWLQJFKLOGUHQDWWKHRWKHUHQGRIWKH,4VSHFWUXP6KHEHJDQKHUFDUHHUVWXG\LQJ WKHSV\FKRORJ\RIZRPHQDQGWKHQVKHIRFXVHG RQVXEQRUPDOFKLOGUHQ+RZHYHULQZKHQ GHPRQVWUDWLQJWKHGLIIHUHQFHEHWZHHQWKHPLQGRIDVXEQRUPDOFKLOGUHQDQGDJLIWHGFKLOGVKH GLVFRYHUHG&KLOG()URPWKDWSRLQWRQVKHEHFDPHIDVFLQDWHGE\JLIWHGFKLOGUHQ$OWKRXJK VKHEHJDQSXEOLVKLQJD UWLFOHVDERXWJLIWHGFKLOGUHQLQ VKHSULPDULO\SXEOLVKHGZRUNRQ VXEQRUPDOFKLOGUHQDQGOHDUQLQJGLVDELOLWLHVLQWKHHDUO\V%HJLQQLQJLQWKHPLG V WKRXJKVKHVZLWFKHGKHUIRFXVLQZULWLQJWRJLIWHGFKLOGUHQSXEOLVKLQJWKHILUVWWH[WERRN RQ JLIWHGHGXFDWLRQ *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH LQ +ROOLQJZRUWKFODLPHGWKDWJLIWHGFKLOGUHQUHFHLYHGVRPXFKOHVVDWWHQWLRQEHFDXVHWKH\ FDXVHGIHZHUSUREOHPVIRUDGXOWVDQGWHDFKHUV ,QKHURSLQLRQWKHVHFKLOGUHQ>ZHUH@WRDJU HDW H[WHQWORVWLQWKHYDVWHQWHUSULVHVRIPDVVHGXFDWLRQDQG>ZHUH@OHIWWRKDQGOHWKHLUVSHFLDO SUREOHPVDVWKH\PD\E\WKHPVHOYHV 7KLVDSSHDUHGEDFNZDUGWRKHUEHFDXVHVKHIHOWWKDW HGXFDWLRQVKRXOGVHUYHWKHVWXGHQWVZKRKHOGWKHPRVWSURPLVHIRU VRFLHW\6KHZDVGLVDSSRLQWHG LQWKHEOLQGZDVWHDWSUHVHQWRIWKHVHYDOXDEOHKXPDQUHVRXUFHV +RZHYHUVKHZRUULHGWKDW VSHFLDOHGXFDWLRQKDGEHFRPHVRFLDOO\WDERREHFDXVHLWZDVRIWHQDVVRFLDWHGZLWKFKLOGUHQRIORZ 6WDQOH\ +ROOLQJZRUWK7KH&KLOGRI9HU\6XSHULRU,QWHOOLJHQFHDVD6SHFLDO3UREOHPLQ6RFLDO$GMXVWPHQW +ROOLQJZRUWK3UREOHPVRI5HODWLRQVKLSEHWZHHQ(OHPHQWDU\DQG 6HFRQGDU\6FKRROVLQWKH&DVHRI+LJKO\ ,QWHOOLJHQW3XSLOV /HWD+ROOLQJZRUWK%ULJKW6WXGHQWV7DNH&DUHRI7KHPVHOYHV 7KH1RUWK$PHULFDQ5HYLHZ QRf

PAGE 45

LQWHOOLJHQFH6XSHULRUFKLOGUHQ VKHODPHQWHGKDYHUHFHLYHGVROLWWOHDWWHQWLRQDVFRPSDUHG ZLWKGHIHFWLYHFKLOGUHQWKDWSDUHQWVQRZIHHOLWLVDVDQLQVXOWZKHQLWLVVXJJHVWHGWKDWWKHLUFKLOG VKRXOGEHWHVWHG %XW+ROOLQJZRUWKDUJXHGWKDWJLIWHGFKLOGUHQQHHGHGWRUHFHLYHVSHFL DO HGXFDWLRQDODWWHQWLRQEHFDXVHWKH\KHOGDXQLTXHSURPLVHIRUWKHIXWXUH6KHIHOWWKDWLWZDVWKH UHVSRQVLELOLW\RIHGXFDWRUVWRGHWHUPLQHDQGLPSOHPHQWHGXFDWLRQWKDWZRXOGKHOSWKHVHVWXGHQWV GHYHORSWKHLUPD[LPXPPHQWDOFDSDFLWLHV +ROOLQJZRUWKVEHO LHIWKDWJLIWHGFKLOGUHQZHUHWKHLQGLYLGXDOVPRVWOLNHO\WROHDGVRFLHW\ DVDGXOWVPRWLYDWHGKHUWRVWXG\WKHHGXFDWLRQRIJLIWHGFKLOGUHQ4XRWLQJ3ODWRV 5HSXEOLF VKH ZDVLQVSLUHGE\WKHLGHDWKDWWKHPRVWDEOHVKRXOGJXLGHVRFLHW\DQGIHOWWKDWWKHF KLOGUHQZKR ZRXOGOHDGDQGLQYHQWZHUHKLJKO\JLIWHGVWXGHQWV 2QHRIWKHSULQFLSDOUHDVRQVVKH DVVHUWHGIRUREWDLQLQJNQRZOHGJHFRQFHUQLQJDEOHSHUVRQVLVWKDWWKH\DQGRWKHUVOLNHWKHPPD\ EHSURSHUO\HGXFDWHGIRUVRFLDOIXQFWLRQVZKLFKWKH\DORQH FDQSHUIRUP 6KH EHOLHYHGJLIWHG FKLOGUHQZRXOGFRQWULEXWHWRWKHFRQVHUYDWLRQDQGDGYDQFHPHQWRIWKHOHDUQHGSURIHVVLRQV SURYLGHOLWHUDU\LQWHUSUHWDWLRQDQGDQDO\]HDEVWUDFWLGHDVRIJRYHUQPHQWDQGHFRQRPLFV 6KH WUXVWHGWKDWPRVWSHRSOHRIDYHUDJH RUHYHQDERYHDYHUDJHLQWHOOLJHQFHVHUYHGVLPSO\WRPDLQWDLQ WKHVWDWXVTXRLQVRFLHW\EXWJLIWHGLQGLYLGXDOVFRXOGFRQWULEXWHLQZD\VWRLPSURYHLW,Q *LIWHG &KLOGUHQ VKHDUJXHGRWKHUVFDQFRQVHUYHEXWRQO\WKHJLIWHGFDQRULJLQDWH 6KHIRXQGWKH SRSXODUDVVXPSWLRQWKDWRQHPDQLVHTXDOO\OLNHO\DVDQRWKHUWRGLVFRYHUVRPHWKLQJ>WREH@ &KDUORWWH**DUULVRQ$JQHV%XUNHDQG/HWD+ROOLQJZRUWK7KH3V\FKRORJ\ RIWKH3URGLJLRXV&KLOG 7KH -RXUQDORI$SSOLHG3V\FKRORJ\ QRf /HWD+ROOLQJZRUWK$Q(QULFKPHQW&XUULFXOXPIRU5DSLG/HDUQHUVDW3XEOLF6FKRRO6SH\HU6FKRRO 7HDFKHUV&ROOHJH5HFRUG f +ROOLQJZRUWK &KLOGUHQ$ERYH ,4 +ROOLQJZRUWK$Q(QULFKPHQW&XUULFXOXPIRU5DSLG/HDUQHUVDW3XEOLF6FKRRO6SH\HU6FKRRO +ROOLQJZRUWK *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH

PAGE 46

JURWHVTXHFRQVLGHULQJZKDWVRFLDOVFLHQWLVWVKDGOHDUQHGDERXWJLIWHGFKLOGUHQ :LWKDOORI WKHDGYDQFHPHQWVLQLQWHOOLJHQFHWHVWLQJLWZDVULGLFXOR XVWRKHUWKDWDQ\RQHZRXOGTXHVWLRQWKDW JLIWHGFKLOGUHQZHUHGHVWLQHGIRUJUHDWQHVV6KHDUJXHGWKDWXSRQJLIWHGFKLOGUHQVRFLHW\PXVW GHSHQGIRUWKHFRQVHUYDWLRQDQGDGYDQFHPHQWRIWKDWDEVWUDFWNQRZOHGJHZKLFKXQGHUOLHVOHDUQHG SURIHVVLRQVPRGHUQILQ DQFHDQGDOORWKHUKXPDQFRQFHUQVWKDWFDOOIRUFRPSHWHQWDEVWUDFW WKLQNLQJDERXWFRPSOH[PDWWHUV>WKRVHZKR@IDOOEHORZWKHUHTXLVLWHKLJKPLQLPXPFDQQRW SHUIRUPWKLVSDUWLFXODUVHUYLFH *LIWHGHGXFDWLRQWKHQZDVQRWMXVWDQLVVXHRISURYLGLQJW KH EHVWVHUYLFHVIRUWKHFKLOGEXWDQHFHVVDU\FRPPLWPHQWIRUWKHLPSURYHPHQWRIWKHQDWLRQDQG KXPDQLW\DVDZKROH+ROOLQJZRUWKKDGFRPSOHWHIDLWKWKDWKLJKO\LQWHOOLJHQWLQGLYLGXDOVKDG EHHQWKHOHDGHUVLQWKHSDVWDQGZRXOGFRQWLQXHWREHLQWKHIXWX UH 1RWDOORIWKHFKLOGUHQZKRZHUHFODVVLILHGDVJLIWHG WKRVHLQWKHWRSRQHSHUFHQWRIWKH SRSXODWLRQLQLQWHOOLJHQFHVFRULQJDERYHRQWKH6WDQIRUG %LQHW,4WHVW ZRXOGLPSURYH VRFLHW\DQGWKRVHZKRZRXOGGRVRZRXOGXVHGLIIHUHQWPHDQVWRDFFRPSO LVKWKLV +ROOLQJZRUWKEHOLHYHGWKDWPRGHUDWHO\JLIWHGFKLOGUHQWKRVHZLWKDQ,4VFRUHEHWZHHQDQG PDGHWKHEHVWFDQGLGDWHVIRUOHDGHUVRIVRFLHW\EHFDXVHWKH\ZHUHPRUHLQWHOOLJHQWWKDQPRVW RIWKHLUSHHUVEXWQRWVRLQWHOOLJHQWDVWREHDZNZD UGDURXQGRWKHUSHRSOH 7KLVZDVUHIOHFWHG LQWKHLULQFUHDVHGDELOLW\WRSOD\ZLWKWKHLUSHHUVFRPSDUHGWRFKLOGUHQZKRVFRUHGDERYH ,4 +LJKO\JLIWHGFKLOGUHQWKRVHZLWKDQ,4RIDSSUR[LPDWHO\RUKLJKHUZHUHWKHRQHVZKR /HWD+ROOLQJZRUWK7KH,PSRUWDQFHRI6WXG\LQJ0HQWDO'HYLDWHV -RXUQD ORI&RQVXOWLQJ3V\FKRORJ\ QR f +ROOLQJZRUWK%ULJKW6WXGHQWV7DNH&DUHRI7KHPVHOYHV +ROOLQJZRUWK$Q(QULFKPHQW&XUULFXOXPIRU5DSLG/HDUQHUVDW3XEOLF6FKRRO6SH\HU6FKRRO /HWD+ROOLQJZRUWK,QWHOOLJHQFH DVDQ(OHPHQWLQ3HUVRQDOLW\
PAGE 47

ZRXOGLPSURYHVRFLHW\ ZLWKQHZLQYHQWLRQVDQGLQQRYDWLYHLGHDV 6KHEHOLHYHGWKDWJLIWHG FKLOGUHQZKRVFRUHGDERYHRQWKH6WDQIRUG %LQHW,4WHVW>ZRXOG@EHFDSDEOHRIWKDW H[WUDRUGLQDU\VHUYLFHRILQWHOOHFWZKLFKPD\UHVXOWLIRWKHUWUDLWVDUHIDYRUDEOHLQSURIHVVLRQDO VFLHQWLILFDQGDUWLVWLFHPLQHQFHDQGLQPRUDOOHDGHUVKLS $OWKRXJKVKHGLGQRWEHOLHYHHYHU\ JLIWHGFKLOGZRXOGLPSURYHVRFLHW\VKHGLGEHOLHYHWKDWIURPWKHVHFKLOGUHQZRXOGEHIRXQGWKH FRQVHUYDWRUVDQGRULJLQDWRUVRIWKRVHLGHDVDQGWHFKQLTXHVXS RQZKLFKFLYLOL]DWLRQGHSHQGV +RZHYHUVLPSO\KDYLQJNQRZOHGJHRIKRZWRDFWLQZD\VWKDWEHQHILWVRFLHW\GLGQRWQHFHVVDULO\ PHDQWKDWLQGLYLGXDOVZRXOGDFWXDOO\XVHWKLVNQRZOHGJHWRHQJDJHLQYLUWXRXVEHKDYLRU %XW +ROOLQJZRUWKKDGVWXGLHGWKHFKDUD FWHURIJLIWHGFKLOGUHQDQGIHOWWKDWPRVWRIWKHPZRXOGXVH WKHLUHGXFDWLRQDQGNQRZOHGJHWRVRFLHW\VEHQHILW +LJKO\LQWHOOLJHQWLQGLYLGXDOVZHUHWKH RQO\RQHVZKRZRXOGEHDEOHWRPDNHDQ\VLJQLILFDQWFRQWULEXWLRQVWRWKHSURJUHVVRIVRFLHW\ WKURXJKQ HZPDWHULDODQGLQWHOOHFWXDODGYDQFHPHQWV7KHUHIRUHHGXFDWLQJWKHPWRWKHEHVWRI WKHLUDELOLWLHVZDVRIXWPRVWLPSRUWDQFHWRKHU +ROOLQJZRUWKVEHOLHIWKDWLQWHOOLJHQFHUHPDLQHGUHODWLYHO\VWDEOHRYHUWLPHLQIOXHQFHGKHU YLHZVRQWKHIXWXUHFRQWULEXW LRQVRIJLIWHGFKLOGUHQ6KHKDGDVFHUWDLQHGWKLVLQIRUPDWLRQE\ FRQGXFWLQJLQWHOOLJHQFHWHVWVRQLQGLYLGXDOVDVFKLOGUHQDQGDJDLQDVDGXOWV,QWKHHDUO\WZHQWLHWK FHQWXU\SHRSOHFRPPRQO\EHOLHYHGWKDWJLIWHGFKLOGUHQJUHZLQWRLQWHOOHFWXDOO\DYHUDJHDG XOWV 6KHGLVSURYHGWKLVLGHDLQKHUUHVHDUFKRQWKHVWDELOLW\RILQWHOOLJHQFHDQGK\SRWKHVL]HGWKDWWKLV ,UYLQJ/RUJHDQG/HWD+ROOLQJZRUWK $GXOW6WDWXVRI+LJKO\,QWHOOLJHQW&KLOGUHQ -RXUQDORI*HQHWLF3V\FKRORJ\ f /HWD+ROOLQJZRUWK$Q,QWURGXFWLRQWR%LRJUDSK\IRU
PAGE 48

DSSHDUHGWRKDSSHQEHFDXVHDVJLIWHGFKLOGUHQJUHZXSWKHSRSXODWLRQVWRZKLFKWKH\ZHUHEHLQJ FRPSDUHGZHUHPRUHDQGPRUHVHOHFWLYH )RUH[DPSOH DJLIWHGFKLOGZRXOGVHHPSDUWLFXODUO\ EULJKWLQDNLQGHUJDUWHQFODVVURRPZKHUHKHZRXOGEHVXUURXQGHGE\DJHQHUDOO\UDQGRPVDPSOH RISHHUVLQFROOHJHKRZHYHUPRVWRUDOOVWXGHQWVZRXOGEHLQWKHJLIWHG,4VFRUHUDQJHRIDERYH DQGWKXVWKHILUVW FKLOGZRXOGQRWVWDQGRXWDQ\PRUH%HOLHYLQJWKDWVFLHQFHKDGDOUHDG\ PDQDJHGWRLGHQWLI\DVWDEOHPHDVXUHRIDSHUVRQVLQWHOOLJHQFH+ROOLQJZRUWKDUJXHGWKDWLQWKH QHDUIXWXUHVFLHQWLVWVZRXOGEHDEOHWRJDXJHDSHUVRQVIXWXUHDFKLHYHPHQWDWZKLFKS RLQWWKH\ ZRXOGEHDEOHWRVHOHFWDQGFKHULVKKXPDQJHQLXVZLWKRXWUHJDUGWRUDFHVH[RUFRQGLWLRQRI HFRQRPLFVHUYLWXGH 6KHVDZLQWHOOLJHQFHWHVWLQJDVDQXQELDVHGDQGVFLHQWLILFZD\WR GHWHUPLQHLQWHOOLJHQFHZKLFKOHGKHUWREHOLHYHWKDWLWZDVRQ O\DPDWWHURIWLPHEHIRUHWKH LGHQWLILFDWLRQRIJLIWHGLQGLYLGXDOVZRXOGEHDSHUIHFWHGSURFHVV$QGRQFHWKLVZDVDFKLHYHG HGXFDWRUVZRXOGEHDEOHWRWUXVWWKDWSURYLGLQJHIILFLHQWJLIWHGHGXFDWLRQZRXOGUHDSGHILQLWH EHQHILWVIRUVRFLHW\LQWKHIXWXUH ,QDGGLWLRQWRWKHDSSDUHQWVWDELOLW\RI,4VFRUHVRYHUWLPH+ROOLQJZRUWKVEHOLHIVDERXW WKHLPSRUWDQFHRIHGXFDWLQJJLIWHGFKLOGUHQZHUHLQIOXHQFHGE\KHUIDLWKLQWKHDFFXUDF\RI LQWHOOLJHQFHWHVWV6KHWUXVWHGLQWKHVHWRROVRIHGXFDWLRQDOSV\FKROR J\DOPRVWWRDIDXOWIURPD SUHVHQWSHUVSHFWLYH2QHRIWKHUHDVRQVWKDWVKHIRXQGLQWHOOLJHQFHWHVWVVRUHOLDEOHZDVWKDWWKH\ KDGEHHQVWDQGDUGL]HG6WDQGDUGL]DWLRQVKHDUJXHGHQDEOHVXVWRNQRZKRZPXFKWKHW\SLFDO RUDYHUDJHfPHPEHUVRIDVSHFL HVDQDJHJURXSDQRFFXSDWLRQDOJURXSRUWKHOLNHFDQGRLQD JLYHQVLWXDWLRQDQGWRILQGWKHFDSDFLW\RIDQ\PHPEHURIWKHVSHFLHVJURXSRUFODVVUHODWLYHWR W\SLFDOPHPEHUV 6KHGLGQRWKRZHYHUDGGUHVVZKLFKSRSXODWLRQVKDGEHHQXVHGWR +ROOLQJZRUWK &KLOGUHQ$ERYH,4 *DUULVRQ%XUNHDQG+ROOLQJZRUWK +ROOLQJZRUWK *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH

PAGE 49

VWDQG DUGL]HLQWHOOLJHQFHWHVWV,IWKHWHVWVZHUHEHLQJVWDQGDUGL]HGE\UDFLDOO\DQGHFRQRPLFDOO\ KRPRJHQHRXVJURXSVWKHUHPLJKWKDYHEHHQFXOWXUHELDVLQWKHWHVWVZKLFKZRXOGGHFUHDVHWKHLU YDOLGLW\LQPHDVXULQJDQLQKHUHQWDELOLW\DVRSSRVHGWRDFKLHYHPHQW RUFXOWXUDONQRZOHGJH +ROOLQJZRUWKGLGQRWGLVFXVVWKLVSRWHQWLDOSUREOHPLQWKHGHVLJQRILQWHOOLJHQFHWHVWV,QPDQ\ DUWLFOHVVKHZURWHDERXWWKHLPSRUWDQFHDQGDFFXUDF\RIWKHVHWHVWVSDUWLFXODUO\RIWKH6WDQIRUG %LQHW,4WHVW 6KHFODLPHGWKDWVRFL DOVFLHQWLVWVFRXOGQRZLGHQWLI\DWDQ\SRLQWEH\RQGWKH VHYHQWK\HDUWKRVHZKRDWWZHQW\ RQHDQGWKHUHDIWHUZLOOVWDQGDWWKHWRSRIWKHDGXOWSRSXODWLRQ LQ FDSDFLW\IRUNQRZLQJ ,ILQWHOOLJHQFHWHVWVZHUHJHQXLQHO\PHDVXULQJDQLQKHUHQWDELOLW\ LQFKLOGUHQWKDWZRXOGUHPDLQVWDEOHLQWRDGXOWKRRG+ROOLQJZRUWKIHOWWKDWWKH\FRXOGDQGPXVW EHXVHGDVDWRROWRGHWHUPLQHZKRKHOGWKHPRVWSRWHQWLDOWRDGYDQFHVRFLHW\ +ROOLQJZRUWKDOVRDUJXHGWKDWJLIWHGFKLOGUHQQHHGHGVSHFLDOHGXFDWLRQDOFRQVLGH UDWLRQV EHFDXVHWKDWZDVZKDWDGHPRFUDWLFVRFLHW\GHPDQGHG,QSDUWLFXODUVKHH[SUHVVHGZDVKHU LUULWDWLRQWKDWSHRSOHKDGPDOLFHWRZDUGWKHPRVWFDSDEOHPHPEHUVRIVRFLHW\QDPHO\JLIWHG FKLOGUHQ 6KHZDVGLVPD\HGWKDWLQHGXFDWLRQLW>KDG@EHHQDVVXP HGWKDWMXVWLFHZRXOGEH ZHOOVHUYHGE\SUHVFULELQJWKHVDPHFXUULFXOXPDWWKHVDPHUDWHDWWKHVDPHWLPHIRUHYHU\ FKLOG 6KHEHOLHYHGWKDWLQDGHPRFUDWLFVRFLHW\FKLOGUHQVKRXOGQRWDOOUHFHLYHWKHVDPH HGXFDWLRQEXWUDWKHUWKH\VKRXOGDOOUHFHL YHWKHHGXFDWLRQWKDWEHVWVXLWHGWKHLUQHHGV 1RWDOO FKLOGUHQZRXOGEHDEOHWRWKULYHLQWKHWUDGLWLRQDOFODVVURRPDQGWKXVGLIIHUHQWPHWKRGVZHUH /RUJHDQG+ROOLQJZRUWK/HWD+ROOLQJZRUWKDQG5XWK.DXQLW]7KH&HQWLOH6WDWXVR I*LIWHG&KLOGUHQDW 0DWXULW\ -RXUQDORI*HQHWLF3V\FKRORJ\ f /HWD+ROOLQJZRUWK:KDW:H.QRZ$ERXWWKH(DUO\6HOHFWLRQDQG7UDLQLQJRI/HDGHUV 7HDFKHUV&ROOHJH 5HFRUG QRf .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI /HWD6WHWWHU+ROOLQJZRUWK +ROOLQJZRUWK 6SHFLDO7DOHQWVDQG'HIHFWV +ROOLQJZRUWK,QWHOOHFWXDOO\6XSHULRU&KLOGUHQ

PAGE 50

PRUHHIIHFWLYHIRUFKLOGUHQZKRIHOORXWVLGHRIPLGGOHUDQJHRILQWHOOLJHQFH6KHIHOWWKDWSHRSOH LJQRUH GWKHIDFWVRIELRORJ\ZKHQWKH\DUJXHGWKDWLWZDVGHPRFUDWLFWRJLYHDOOFKLOGUHQWKH VDPHHGXFDWLRQEHFDXVHWKH\IDLOHGWRUHFRJQL]HWKDWVRPHFKLOGUHQKDGPRUHLQWHOOHFWXDO FDSDFLW\WKDQRWKHUV ,QKHURSLQLRQDOOWKDWDGHPRFUDWLFVFKRROFDQGRLV WRHTXDOL]H RSSRUWXQLW\LWFDQQRWHTXDOL]HWKHFKLOGUHQ (TXDOL]LQJRSSRUWXQLW\PHDQWHGXFDWLQJFKLOGUHQ WRWKHLUKLJKHVWLQGLYLGXDOSRWHQWLDOUDWKHUWKDQHGXFDWLQJWKHPWRWKHVDPHOHYHODVRWKHU FKLOGUHQ6KHEHOLHYHGWKDWHYHQWXDOO\DOOFKLOGUHQZ RXOGKDYHDVSHFLDOLQGLYLGXDOL]HGHGXFDWLRQ SODQEXWFKLOGUHQZKRVFRUHGVRKLJKO\RQWKH,4FRQWLQXXPQHHGHGVSHFLDOHGXFDWLRQ LPPHGLDWHO\ ,QWKLVUHVSHFWVKHVKDUHGEHOLHIVVLPLODUWRWKHSHGDJRJLFDOSURJUHVVLYHVRIWKH HDUO\WZHQWLHWKFHQWXU\ZKR DOVRGHVLUHGWRHVWDEOLVKLQGLYLGXDOL]HGFXUULFXOXPIRUVWXGHQWV 3URYLGLQJVSHFLDOHGXFDWLRQIRUJLIWHGFKLOGUHQZDVSV\FKRORJLFDOO\SRVVLEOHDQGSURSHU VRFLDOO\VRXQGDQGHWKLFDOO\KXPDQLWDULDQ 6KHEHOLHYHGWKDWZLWKWKHNQRZOHGJHJDLQHGLQ WKHO DWHQLQHWHHQWKDQGHDUO\WZHQWLHWKFHQWXULHVUHJDUGLQJLQWHOOLJHQFHWHVWVVRFLHW\KDGWKH DELOLW\DQGWKHUHVSRQVLELOLW\WRSURYLGHWKHEHVWHGXFDWLRQDOVHUYLFHVDYDLODEOHWRJLIWHGFKLOGUHQ $FFRUGLQJWR+ROOLQJZRUWKJLIWHGFKLOGUHQQHHGHGVSHFLDOHGX FDWLRQDORSSRUWXQLWLHVWR SUHYHQWWKHPIURPGHYHORSLQJEDGKDELWV%HFDXVHWKH\FRXOGPRYHWKURXJKDVWDQGDUG FXUULFXOXPDWDPXFKIDVWHUUDWHWKDQWKHLUSHHUVJLIWHGFKLOGUHQZHUHOLNHO\WREHFRPHERUHGLI WKH\ZHUHIRUFHGWRVLWLQDUHJXODUFODVVURRP 6KHFODLPHGWKDWLQDWUDGLWLRQDOFODVVURRPDFKLOG +ROOLQJZRUWK3URYLVLRQVIRU,QWHOOHFWXDOO\6XSHULRU&KLOGUHQ/HWD+ROOLQJZRUWK+RZ6KRXOG*LIWHG &KLOG UHQ%H(GXFDWHG" %DOWLPRUH%XOOHWLQRI(GXFDWLRQ f +ROOLQJZRUWK 7KH3V\FKRORJ\RI6XEQRUPDO&KLOGUHQ /HWD+ROOLQJZRUWK3V\FKRORJLFDO6HUYLFHIRU3XEOLF6FKRROV 7HDFKHUV&ROOHJH5HFRUG QRf 'DYLG7\DFN 7K H2QH%HVW6\VWHP$+LVWRU\RI$PHULFDQ8UEDQ(GXFDWLRQ &DPEULGJH+DUYDUG8QLYHUVLW\ 3UHVVf +ROOLQJZRUWK7KH)RXQGLQJRI3XEOLF6FKRRO6SH\HU6FKRRO

PAGE 51

ZLWKDQ,4VFRUHRIZDVWHGDERXWKDOIRIKLVRUKHUWLPHZKHUHDVDFKLOGZLWKDQ,4VFRUH DERYHZDVWHGSUDFWLFDOO\DOORIKLVRUKHUWLPH ,QWKHVHVLWXDWLRQVVKHEHOLHYHGWKDWWKHVH FKLOGUHQ ZRXOGGHYHORSEDGKDELWVVXFKDVOD]LQHVVWKDWZRXOGIROORZWKHPLQWRDGXOWKRRG6KH DOVRDUJXHGWKDWWKH\PLJKWGHYHORSDSURWHFWLYHGHDIQHVVDVDQHVFDSHIURPWKHLQWROHUDEOH ERUHGRPRIGULOORUJHWLQWRPLVFKLHIRUHYHQGURSRXWRIVFKRRODOW RJHWKHU 6KHEHOLHYHG WKDWJLIWHGFKLOGUHQZRXOGHLWKHUOHDUQWRHQMR\VFKRRODQGWKHQWKHLUIXWXUHFDUHHUVDQGWKXVWKHLU WDOHQWVZRXOGEHVRFLDOO\FDSLWDOL]HGRUWKH\ZRXOGGHYHORSDGLVWDVWHRIDQGDQHJDWLYLVP WRZDUGDFWLYLWLHVDQGVRFLDOSURMHFWV %HFDXVHVKHIHOWWKDWVRFLHW\ZDVGHSHQGHQWXSRQWKHVH FKLOGUHQDVIXWXUHOHDGHUVDQGLQQRYDWRUVVKHDUJXHGWKDWHGXFDWRUVQHHGHGWRHQVXUHWKDWJLIWHG LQGLYLGXDOVGLGQRWGHYHORSEDGKDELWVE\EHLQJLQDSSURSULDWHO\SODFHGLQDFODVVURRPWKDW KLQGHUHGWK HLULQWHOOHFWXDOGHYHORSPHQW +RZHYHUVSHFLDOHGXFDWLRQFRXOGEHXVHGWRFRPEDWWKHVHEDGKDELWVDQGSUHVHUYHWKH FKDUDFWHURIWKHJLIWHGFKLOGZKLFK+ROOLQJZRUWKEHOLHYHGWREHVXSHULRUDVDJURXS 6KH RIWHQDVNHGWHDFKHUVDQGSDUHQWVWRUDWH JLIWHGFKLOGUHQLQFKDUDFWHUWUDLWVDQGIRXQGWKDWWKH LQWHOOHFWXDOO\DEOHDUHMXGJHGWREHDERYHDYHUDJHLQFKDUDFWHU 6RPHRIWKHFKDUDFWHULVWLFV LQZKLFKVKHHYDOXDWHGJLIWHGFKLOGUHQLQFOXGHGQHXURWLFLVPVHOI VXIILFLHQF\DQG VXEPLVVLYHQHVV ,QDOOFDWHJRULHVJLIWHGFKLOGUHQZHUHUDWHGIDYRUDEO\ $GGLWLRQDOO\VKH FLWHGHYLGHQFHIURPRWKHUUHVHDUFKHUVWKDWVXSSRUWHGWKHFODLPWKDWJLIWHGFKLOGUHQZHUHKLJKO\ +ROOLQJZRUWK:KDW:H.QRZ$ERXWWKH(DUO\6HOHFWLRQDQG7UDLQLQJRI/HDGH UV +ROOLQJZRUWK7KH)RXQGLQJRI3XEOLF6FKRRO6SH\HU6FKRRO +ROOLQJZRUWK &KLOGUHQ$ERYH,4 +ROOLQJZRUWK:KR,VWKH*LIWHG3XSLO" +ROOLQJZRUWK,QWHOOHFWXDOO\6XSHULRU&KLOGUHQ +ROOLQJZRUWKDQG5XVW +ROOLQJZRUWK &KLOGUHQ$ERYH,4

PAGE 52

UDWHGLQSHUVRQDOLW\WUDLWV %HFDXVHJLIWHGFKLOGUHQZHUHVXSHULRULQLQWHOOHFW DQGLQFKDUDFWHU VKHKDGFRPSOHWHFRQILGHQFHWKDWWKH\ZRXOGILOOVSHFLDOUROHVLQVRFLHW\VIXWXUHSURJUHVV 7KHHPRWLRQDODQGVRFLDOQHHGVRIJLIWHGFKLOGUHQDOVROHG+ROOLQJZRUWKWREHOLHYHWKDW WKHVHFKLOGUHQUHTXLUHGVSHFLDOHGXFDWLRQDOFRQVLGHUDWL RQV7KHVHSDUWLFXODUQHHGVPLJKWPDNH WKHPELWWHUWRZDUGVWKHLUSHHUVZKHQSODFHGLQDUHJXODUFODVVURRP6KHIHOWWKDWJLIWHGFKLOGUHQ VKRXOGOHDUQKRZWRVXIIHUIRROVJODGO\WRUHIUDLQIURPEHLQJQHJDWLYLVWLFWRZDUGDXWKRULW\ DQGWRKROGWKHPVHOYH VWREHQLJQFKLFDQHU\DVRSSRVHGWRH[WUHPHFKLFDQHU\ 2QHZD\ IRUWHDFKHUVWRKHOSVWXGHQWVDYRLGEHFRPLQJVRFLDOO\LVRODWHGZDVWRJXLGHWKHPLQILQGLQJDQ RUGLQDU\FRXUVHRIOLIHUHFUHDWLRQVFRQJHQLDOERWKWRWKHPVHOYHVDQGWRFRQWHPSRUDULHV EH FDXVHVRFLDOSOD\ZDVRIWHQGLIILFXOWIRUKLJKO\LQWHOOLJHQWFKLOGUHQGXHWRWKHH[WUHPH GLIIHUHQFHEHWZHHQWKHLUFKURQRORJLFDODJHDQGWKHLUPHQWDODJH $KLJKO\LQWHOOLJHQWFKLOG PLJKWKDYHDPHQWDODJHWKDWZDVVHYHUDO\HDUVROGHUWKDQKLVRUKHUFKUR QRORJLFDODJH*LIWHG FKLOGUHQRIWHQIDFHGWKHSUREOHPRIEHLQJVLJQLILFDQWO\PRUHPDWXUHWKDQWKHLUVDPH DJHGSHHUV EXWSK\VLFDOO\WRRVPDOOWRLQWHUDFWZLWKFKLOGUHQZKRPDWFKHGWKHLULQWHOOHFWXDODJH6KHDOVRIHOW LWZDVLPSRUWDQWWKDWJLIWHGFKLOGUHQ EHH[SRVHGWRFKLOGUHQZLWKVLPLODUO\KLJKLQWHOOLJHQFHOHYHOV WRKHOSWKHPGHYHORSVRFLDOVNLOOV 7KHHPRWLRQDODQGVRFLDOSUREOHPVRIJLIWHGFKLOGUHQZHUH PRUHSUREOHPDWLFIRUWKHPRVWKLJKO\LQWHOOLJHQWZKLFKFRQFHUQHGKHUEHFDXVHRIKHUEHOLHIWKDW VRFLHW\QHHGHGWKHVHFKLOGUHQIRUPDWHULDODQGLGHRORJLFDODGYDQFHPHQWLQWKHIXWXUH $OWKRXJKVKHZDVFRQFHUQHGZLWKWKLVSURJUHVVIRUDOORIPDQNLQGVKHZDVDOVRDZDUHRIWKH /HWD+ROOLQJZRUWK6HOHFWHG5HIHUHQFHVIURPWKH/LWHUDWXUHRQ([FHSWLRQDO&KLOGUHQ 7KH(OHPHQWDU\6FKRRO -RXUQDO QRf +ROOLQJZRUWK:KDW:H.QRZ$ERXWWKH(DUO\6HOHFWLRQDQG7UDL QLQJRI/HDGHUV +ROOLQJZRUWK$Q(QULFKPHQW&XUULFXOXPIRU5DSLG/HDUQHUVDW3XEOLF6FKRRO6SH\HU6FKRRO +ROOLQJZRUWK:KDW:H.QRZ$ERXWWKH(DUO\6HOHFWLRQDQG7UDLQLQJRI/HDGHUV 6LOYHUPDQ

PAGE 53

LQWHUQDWLRQDOLPSOLFDWLRQVIRU$PHULFDDIWHUREVHUYLQJWKHHGXFDWLRQDOSURJU HVVWDNLQJSODFHLQ *HUPDQ\$IWHU:RUOG:DU,*HUPDQ\GHSHQGHGRQWKHHGXFDWLRQRIJLIWHGFKLOGUHQWRKHOS UHEXLOGWKHFRXQWU\DQG+ROOLQJZRUWKREVHUYHGWKDWDVDUHVXOWRIWKHVHHIIRUWV*HUPDQ\KDG YHU\DGYDQFHGHGXFDWLRQDOSV\FKRORJ\SURJUDPVLQSODF HZHOOEHIRUHRWKHUFRXQWULHVGLG 2QHRIWKHFRPPRQGHEDWHVDERXWJLIWHGHGXFDWLRQLQWKHHDUO\WZHQWLHWKFHQWXU\WKDW FRQFHUQHG+ROOLQJZRUWKLQYROYHGWKHTXHVWLRQRIKRZEHVWWRHGXFDWHJLIWHGFKLOGUHQ7KH SULPDU\DUJXPHQWVZHUHIRUHQULFKPHQWDFFHOH UDWLRQRUDFRPELQDWLRQRIWKHWZR0DQ\ WHDFKHUVDQGVFKRROVSUHIHUUHGWKHDFFHOHUDWLRQPHWKRGLWZDVHDVLHUWRDFFRPPRGDWH +ROOLQJZRUWKGLVFXVVHGERWKDVSRWHQWLDORSWLRQVEXWVKHKDGDFDYHDWDERXWWKHXVHRI DFFHOHUDWLRQ:KHQKLJKO\JLIWHGFKLOGU HQZHUHDFFHOHUDWHGUDSLGO\WKURXJKWKHJUDGHVWKH\ZHUH YHU\RIWHQSXWLQWRWKHDZNZDUGSRVLWLRQRIEHLQJVLJQLILFDQWO\\RXQJHUWKDQWKHLUFODVVPDWHV ZKLFKVRPHWLPHVOHGWRJLIWHGFKLOGUHQEHFRPLQJYLFWLPVRIEXOO\LQJ $OVRZKHQDFFHOHUDWHG E\PRUHWK DQRQHRUWZR\HDUVWKHFKLOGUHQZHUHSK\VLFDOO\OHVVFDSDEOHWKDQWKHLUSHHUVZKLFK FDXVHGSUREOHPVRISOD\EXWDOVRLQFHUWDLQVFKRROVXEMHFWVVXFKDVSHQPDQVKLS7KLV FRQWULEXWHGWRWKHVWXGHQWVIHHOLQJVRILVRODWLRQDQGGLIILFXOW\ILWWLQJLQVRFLDO O\ZKLFKVKH IHDUHGZRXOGLPSDFWWKHLUDELOLW\WRVHUYHVRFLHW\LQWKHIXWXUH(VVHQWLDOO\VKHDUJXHGWKDWVRPH DFFHOHUDWLRQZDVDSSURSULDWHEXWJHQHUDOO\QRWE\PRUHWKDQRQHRUWZR\HDUV 7KHPDMRULW\RI HGXFDWRUVGXULQJWKHHDUO\WZHQWLHWKFHQWXU\S UHIHUUHGDFFHOHUDWLRQIRUSUDFWLFDOSXUSRVHV%XW +ROOLQJZRUWKIHOWWKDWLWZDVDOVRLPSRUWDQWIRUJLIWHGVWXGHQWVWRUHFHLYHDQHQULFKHGFXUULFXOXP ZLWKLQVHJUHJDWHGFODVVHVZKHUHWKH\ZHUHDEOHWRH[SORUHPRUHIXOO\WKHVXEMHFWVLQZKLFKWKH\ /HWD+ROOLQJZRUWK3V \FKRORJLFDO&OLQLFVLQWKH8QLWHG6WDWHV 7HDFKHUV&ROOHJH5HFRUG QRf +DUULV 6LOYHUPDQ 6RFLDODQG(PRWLRQDO(GXFDWLRQRIWKH*LIWHG7KH'LVFRYHULHVRI/HWD+ROOLQJZRUWK %HQERZ

PAGE 54

ZHUHLQWH UHVWHGDPRQJSHHUVWKDWZHUHPHQWDOO\HTXDOWRWKHP 3URYLGLQJDFXUULFXOXPWKDW DOORZHGWKHJLIWHGFKLOGUHQWRUHPDLQZLWKSHHUVWKDWZHUHFORVHLQFKURQRORJLFDODQGPHQWDODJH ZRXOGKHOSSUHYHQWJLIWHGFKLOGUHQIURPEHFRPLQJIUXVWUDWHGZLWKHGXFDWLRQDQ GWKHLUFRKRUWV 7KLVZRXOGHQFRXUDJHWKHPWRVHHNRXWZD\VWRKHOSVRFLHW\LQWKHIXWXUHUDWKHUWKDQEHLQJELWWHU EHFDXVHWKH\KDGQHJDWLYHH[SHULHQFHVDVFKLOGUHQ $VJLIWHGHGXFDWLRQHYROYHGPRUHSURJUDPV EHJDQWRHPSKDVL]HWKHHQULFKPHQWPHWKRGDVRS SRVHGWRWKHDFFHOHUDWLRQPHWKRG+HURSLQLRQV SURYLGHLQVLJKWDVWRZK\VKHHVWDEOLVKHGDFXUULFXOXPDW36DQGWKH6SH\HU6FKRROWKDW ZRXOGWKHQVHWDSUHFHGHQWIRUIXWXUHJLIWHGHGXFDWLRQ $QRWKHUGHEDWHUHOHYDQWWRJLIWHGHGXFDWLRQLQWKHHDUO\ WZHQWLHWKFHQWXU\ZDVWKH TXHVWLRQRIZKHWKHUJLIWHGFKLOGUHQVKRXOGEHHGXFDWHGWROHDUQNQRZOHGJHWKDWDOUHDG\H[LVWHG RUEHHGXFDWHGLQZD\VWKDWHQFRXUDJHGWKHPWRFUHDWHQHZNQRZOHGJH$OWKRXJK+ROOLQJZRUWK EHOLHYHGWKDWJLIWHGFKLOGUHQZHUHGHVWLQHG WRFUHDWHQHZLQYHQWLRQVDQGLGHDVVKHIHOWWKDWLQ RUGHUWRGRVRWKH\QHHGHGWRKDYHDFRQWH[WRIH[LVWLQJNQRZOHGJH7KLVZDVKHULQVSLUDWLRQIRU KHUFRXUVHVRQELRJUDSKLHVDQGWKHHYROXWLRQRIFRPPRQWKLQJV 6KHEHOLHYHGWKDWFKLOGUHQ VKRXOGXQGHUV WDQGWKHKLVWRULFDOFRQWH[WRIWKHLUFDUHHUVDQGWKXVWKH\VKRXOGEHWDXJKWSUDFWLFDO KLVWRULHV ,QRUGHUIRUVWXGHQWVWRHQJDJHLQHIIHFWLYHRULJLQDOLW\WKH\ILUVWKDGWRKDYHD VRXQGDQGH[KDXVWLYHNQRZOHGJHRIZKDWWKHFRXUVHRISUHFHGLQJHYHQWVK DVEHHQ )RU H[DPSOHVKHEHOLHYHGWKDWE\VWXG\LQJELRJUDSKLHVJLIWHGFKLOGUHQZRXOGOHDUQWKDWDOORIWKH LGHDVDQGLQYHQWLRQVWKH\OHDUQHGDERXWLQWKHLUVWXG\RIWKHHYROXWLRQRIFRPPRQWKLQJV +ROOLQJZRUWK+RZ6KRXOG*LI WHG&KLOGUHQ%H(GXFDWHG" %RUODQG/HWD+ROOLQJZRUWKV&RQWULEXWLRQVWRWKH3V\FKRORJ\DQG(GXFDWLRQRIWKH*LIWHG +ROOLQJZRUWK 7KH3V\FKRORJ\RIWKH$GROHVFHQW +ROOLQJZRUWK$Q(QULFKPHQW&XUULFXOXPIRU5DSLG/HDUQHUVDW3XEOLF 6FKRRO6SH\HU6FKRRO

PAGE 55

RULJLQDWHGZLWKLQWKHPLQGVRISHRSOH 6KHZRXOGKDYHH DFKLQGLYLGXDOFKLOGVHOHFWD ELRJUDSK\DQGRQFHDZHHNDQKRXUZRXOGEHGHYRWHGWRKDYLQJWZRFKLOGUHQSUHVHQWWKHLU ILQGLQJVDERXWDQHPLQHQWSHUVRQ:LWKWKLVPHWKRGDOOFKLOGUHQZRXOGOHDUQDERXWPDQ\ GLIIHUHQWLQIOXHQWLDOSHRSOHLQKLVWRU\ DQGFK LOGUHQZRXOGSUDFWLFHWKHVNLOOVRIRUJDQL]LQJDQG GHOLYHULQJDSUHVHQWDWLRQWRWKHLUSHHUV,QOHDUQLQJDERXWKRZVRFLHW\KDGDOUHDG\HYROYHG +ROOLQJZRUWKWUXVWHGWKDWJLIWHGFKLOGUHQZRXOGVHHZD\VLQZKLFKRWKHUVKDGFRQWULEXWHGDQG WKXVILQGRSSRUWXQ LWLHVWRDGGWRWKLVSURJUHVVDVZHOO +ROOLQJZRUWKVFRQFHUQZLWKKRZEHVWWRHGXFDWHJLIWHGFKLOGUHQZDVDOVRUHIOHFWHGLQKHU ZRUNDW36DQGWKH6SH\HU6FKRRO6KHLQVWLWXWHGVHYHUDOFXUULFXODUSURJUDPVWKDWVKH EHOLHYHGZRXOGEHKHOSIXOWRKHU VWXGHQWVDVDGXOWVVXFKDVWKHHYROXWLRQRIFRPPRQWKLQJVDQG WKHOLYHVRIIDPRXVSHRSOHWRRULHQWWKHPLQWLPHDQGVSDFH 6KHDOVRLQFOXGHG)UHQFK ODQJXDJHDQGOLWHUDWXUHEHFDXVHWKHVHSXSLOVZRXOGKDYHPRUHRFFDVLRQWRPHHWIRUHLJQ SHRSOHVDQGWR UHSUHVHQWWKHLUFRXQWU\DEURDGLQWKHUHDOPRILGHDV 6KHSURYLGHGHPRWLRQDO HGXFDWLRQWRFRXQWHUDFWVRPHRIWKHSUREOHPVWKDWWKHFKLOGUHQPLJKWKDYHDQGWRKHOSWKHP OHDUQKRZWRGHDOZLWKSHRSOHRIORZHULQWHOOLJHQFHZLWKSDWLHQFHDQGORYHUDWKHUWK DQDQJHURU GHVSDLU 7KHLQGLYLGXDOFKLOGVKHDUJXHGVKRXOGKDYHEURXJKWWRKLVDWWHQWLRQZKDWHYHU NQRZOHGJHZLOOPRVWKHOSKLPWRDGMXVWKLPVHOIVXFFHVVIXOO\WRDFLYLOL]HGZRUOGDQGDWWKHVDPH WLPHWRUHQGHUWRRWKHUVWKHPD[LPXPVHUYLFHRIZKLFK KHLVFDSDEOH +RZHYHUVKH ,ELG +ROOLQJZRUWK$Q,QWURGXFWLRQWR%LRJUDSK\IRU
PAGE 56

FRQWHPSODWHGWKHLGHDRIZKHWKHURUQRWJLIWHGFKLOGUHQVKRXOGEHJXLGHGLQWRSDUWLFXODU RFFXSDWLRQVRUZKHWKHUWKH\VKRXOGEHHGXFDWHGWRJRLQWRDQ\LQGXVWU\LQFOXGLQJWKRVHRI PDQXDOODERU 6KHZDVSDUWLFXODUO\FRQFHUQH GDERXWKRZWRHGXFDWHJLIWHGJLUOVIRUDQ RFFXSDWLRQEHFDXVHLQWKHHDUO\WZHQWLHWKFHQWXU\PDQ\FDUHHUVZHUHLQDFFHVVLEOHWRWKHP 6KHFRQFOXGHGWKDWWKHSHUVRQDOULJKWRIWKHYHU\JLIWHGLQGLYLGXDOPXVWEHUHVSHFWHGXVLQJWKH UDWLRQDOHWKDWDNLQ JRUTXHHQKDVWKHULJKWWRDEGLFDWHDWZLOOZLWKRXWUHSURDFK &RPSDULQJ JLIWHGFKLOGUHQWRUR\DOW\GHPRQVWUDWHGKHUIDLWKLQDVRFLHW\LQZKLFKWKHPRVWLQWHOOLJHQWKDGWKH ULJKWWRDVVXPHSRVLWLRQVRIOHDGHUVKLS$OWKRXJKJLIWHGFKLOGUHQGLGQRWLQKHU LWDSRVLWLRQRI OHDGHUVKLSOLNHDPRQDUFKGRHVVKHIHOWWKH\ZHUHERUQZLWKSRWHQWLDOVXFKWKDWPDQ\RIWKHP ZRXOGQDWXUDOO\DVVXPHWKHVHUROHVDVDGXOWV +ROOLQJZRUWKEHOLHYHGWKDWRQFHSHRSOHUHFRJQL]HGWKHLPSRUWDQWUROHWKDWJLIWHGFKLOGUHQ ZRXOGS OD\LQWKHIXWXUHRIVRFLHW\WKH\ZRXOGVXSSRUWVSHFLDOHGXFDWLRQIRUWKHVHFKLOGUHQLI QRWIRUWKHEHQHILWRIJLIWHGFKLOGUHQWKHPVHOYHVWKHQDWOHDVWIRUWKHEHQHILWRIVRFLHW\0DQKDV ZHDOWKLQVRIDUDVKHGHYHORSVDQGXWLOL]HVWKHFKDUDFWHUDQGL QWHOOHFWZKLFKH[LVWDVLQERUQ DVVHWVLQYDU\LQJGHJUHHVDPRQJWKHMXYHQLOHPHPEHUVRIVRFLHW\VKHDUJXHG>DQG@ZHVKDOO WKHUHIRUHH[SHFWWRZLWQHVVDJUHDWUHQDLVVDQFHRIFKLOGVWXG\ 6KHHPSKDVL]HGWKHLPSRUWDQW UROHWKDWHGXFDWLRQSOD\HGLQWKH DGYDQFHPHQWRIVRFLHW\ZKHQVKHFODLPHGWKDWHGXFDWRUVDUH WKHRQO\RIILFLDOJXDUGLDQVDSSRLQWHGE\VRFLHW\IRUJLIWHGFKLOGUHQ 6KHEHOLHYHGWKDW +ROOLQJZRUWK([SHULPHQWVLQWKH(GXFDWLRQRI*LIWHG&KLOGUHQ+ROOLQJZRUWK *LIWHG&KLOGUHQ7KHLU 1DWXUHDQG1XUWXUH +ROOLQJZRUWK 7KH3V\FKRORJ\RIWKH$GROHVFHQW +ROOLQJZRUWK:KDW:H.QRZ$ERXWWKH(DUO\6HO HFWLRQDQG7UDLQLQJRI/HDGHUV +ROOLQJZRUWK3V\FKRORJLFDO&OLQLFVLQWKH8QLWHG6WDWHV +ROOLQJZRUWK7KH7HUPDQ&ODVVHVDW3XEOLF6FKRRO

PAGE 57

HGXFDWRUVKDGWKHDELOLW\RSSRUWXQLW\DQGGXW\WRFRQWULEXWHWRWKHSURJUHVVRIVRFLHW\E\ SUHSDULQJJL IWHGFKLOGUHQIRUWKHLUVSHFLDOUROHVLQWKHIXWXUH +ROOLQJZRUWKVLGHDVDERXWUDFHVRFLRHFRQRPLFFODVVDQGWKHQHHGWRHGXFDWHJLIWHG FKLOGUHQLQIOXHQFHGKHUZRUNDQGUHVHDUFK6KHVRXJKWRXWSDUWLFXODUJURXSVRIFKLOGUHQWR LQFOXGHLQKHUSURJUDPVD QGUHVHDUFKVWXGLHVDQGZDVSDUWLFXODUO\PRWLYDWHGWRVWXG\JLIWHG HGXFDWLRQEHFDXVHVKHIHOWWKHVHFKLOGUHQKDGDXQLTXHUROHWRILOO6KHWKRXJKWWKDWWKHPDMRULW\ RIJLIWHGFKLOGUHQFDPHIURPZKLWHPLGGOHDQGXSSHUFODVVIDPLOLHVEXWWKDWDVPDOOHU S URSRUWLRQZRXOGEHIRXQGLQDOOUDFLDOJURXSVDQGLQWKHORZHUVRFLRHFRQRPLFFODVV6KHIHOWWKDW JLIWHGHGXFDWLRQZDVQHFHVVDU\IRUWKHJRRGRIWKHFKLOGUHQEXWPRUHVRIRUWKHJRRGRIVRFLHW\ 7KHIRXQGHUVRIHGXFDWLRQDOSV\FKRORJ\DQGJLIWHGHGXFDWLRQ VHWSUHFHGHQWVWKDWDUHVWLOOUHOHYDQW LQWKHWZHQW\ ILUVWFHQWXU\DQGIRU+ROOLQJZRUWKRQHRIWKHVHSUHFHGHQWVZDVWRH[DPLQHKRZ UDFHFODVVDQGWKHLPSRUWDQFHRIJLIWHGHGXFDWLRQZRXOGDIIHFWUHVHDUFKDQGLPSOHPHQWDWLRQRI SURJUDPVWKDWVHUYHGWKHVH KLJKO\LQWHOOLJHQWLQGLYLGXDOV

PAGE 58

&+$37(5 &21&/86,21 +ROOLQJZRUWKVYLHZVRQUDFHVRFLRHFRQRPLFFODVVDQGWKHLPSRUWDQFHRIHGXFDWLQJ JLIWHGFKLOGUHQZHUHFRPSOH[6KHDFNQRZOHGJHGWKDWWKHUHKDGEHHQGLIIHUHQFHVLQLQWHOOLJHQFH WHVWVFRUHVRIGLIIH UHQWUDFHVDQGWKDWVRPHUDFHVZHUHPRUHDGYDQFHGWKDQRWKHUV+RZHYHUWKLV GLGQRWPDNHKHUXQLTXHDVDVRFLDOVFLHQWLVWLQWKHHDUO\WZHQWLHWKFHQWXU\0DQ\RIKHU FRQWHPSRUDULHVEHOLHYHGWKDWVRPHUDFLDOJURXSVZHUHPRUHLQWHOOLJHQWWKDQRWKHUJURXSV 6LJQLILFDQWO\WKRXJK+ROOLQJZRUWKDUJXHGWKHSRVVLELOLW\RIRWKHUH[SODQDWLRQVIRUWKHUDFLDO GLVFUHSDQFLHVIRXQGLQLQWHOOLJHQFHWHVWLQJ 6KHGLGQRWLQGLFDWHWKDWVKHIRXQGLQKHUHQW ELRORJLFDOGLIIHUHQFHVZHUHQHFHVVDULO\UHVSRQVLEOHIRUWKHGLIIHUHQ FHVLQWHVWVFRUHV$OVRVKH DUJXHGWKDWHYHU\UDFLDOJURXSSURGXFHGFKLOGUHQZKRZHUHKLJKO\LQWHOOLJHQWEXWVRPHUDFHV SURGXFHGPRUHRIWKHVHFKLOGUHQWKDQRWKHUV +ROOLQJZRUWKVFKLOGKRRGDQGHDUO\DGXOWKRRGH[SHULHQFHVLQIOXHQFHGKHUYLHZVRQUDFH $VDJUDGXDWHVWXGHQWVKHZRUNHGZLWKLQGLYLGXDOVRIYDULRXVUDFLDOJURXSV ,QKHUIDPRXV WH[WERRN *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH VKHGHYRWHGRQHVHFWLRQWRWKH GHPRJUDSKLFVRIWKHJLIWHGSRSXODWLRQDQGVWDWHGFOHDUO\WKDWVRPHUDFLDOJURXS VWHVWHGKLJKHU WKDQRWKHUJURXSVGLGEXWSURSRVHGDOWHUQDWLYHH[SODQDWLRQVIRUWKHVHUHVXOWV6KHEHOLHYHGWKDW VRPHUDFHVZHUHPRUHDGYDQFHGWKDQRWKHUV EXWWKDWHYHU\UDFHLQFOXGHGVRPHKLJKO\ LQWHOOLJHQWLQGLYLGXDOV6KHIRXQGWKHODUJHVWSURSRUWLR QRIJLIWHGFKLOGUHQFRPLQJIURP(QJOLVK +ROOLQJZRUWK *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH +ROOLQJZRUWK 7KH3V\ FKRORJ\RI6XEQRUPDO &KLOGUHQ .OHLQ $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU+ROOLQJZRUWK 6FKODSSDQG+ROOLQJZRUWK$Q(FRQRPLFDQG6RFLDO6WXG\RI)HHEOH 0LQGHG:RPHQ +ROOLQJZRUWK 7KH3V\FKRORJ\RIWKH$GROHVFHQW

PAGE 59

6FRWWLVKRU-HZLVKKHULWDJH 6KHGLGKRZHYHUILQGJLIWHGFKLOGUHQIURPWZHQW\ WKUHHGLIIHUHQW QDWLRQDOLWLHVIRUWKH6SH\HU6FKRRO DQGIRXQGDWOHDVWWZRKLJKO\JLIWHGFKLOGUHQRI1HJUR GHVFHQW 6KHHVSRXVHG VRPHFRPSRQHQWVRIWKHHXJHQLFVPRYHPHQWSULPDULO\WKHLGHDRI SRVLWLYHHXJHQLFV 6KHRIWHQFLWHGVRFLDOVFLHQFHDQGHGXFDWLRQUHVHDUFKEHLQJFRQGXFWHGLQ *HUPDQ\DWWKHWLPH EXWSDVVHGDZD\EHIRUH:RUOG:DU,,DQGZDVQRWDEOHWRVHHWKHUHVXOWV RIH XJHQLFVWRUHYLVHKHUSRVLWLRQRQWKHPDWWHUOLNHVRPHRIKHUFRQWHPSRUDULHVZHUHDEOHWR GR 6KHQHYHUXVHGHXJHQLFVDUJXPHQWVWRFODLPVXSHULRULW\RIDQ\RQHUDFHRYHUDQRWKHU +ROOLQJZRUWKDOVRFRQVLGHUHGWKHLQWHUSOD\EHWZHHQELRORJ\DQGHQYLURQPHQW ZKHQ H[DPLQLQJWKHLVVXHRIVRFLRHFRQRPLFFODVVDQGJLIWHGQHVV$OWKRXJKVKHEHOLHYHGWKHPDMRULW\ RIJLIWHGFKLOGUHQZHUHIRXQGLQIDPLOLHVZKHUHWKHIDWKHUKHOGSURIHVVLRQDOVNLOOHGRUFOHULFDO HPSOR\PHQWVKHDJDLQDFNQRZOHGJHGWKDWQRWDOOKLJKO\LQWH OOLJHQWFKLOGUHQFDPHIURPVXFK IDPLOLHV6KHRIIHUHGDSRWHQWLDOH[SODQDWLRQIRUWKHUHDVRQWKDWPRUHJLIWHGFKLOGUHQZHUHIRXQG LQIDPLOLHVLQWKHPLGGOHDQGXSSHUVRFLRHFRQRPLFFODVVHV6KHEHOLHYHGWKDWLQDPHULWRFUDWLF VRFLHW\OLNHWKH8QLWHG6WDWHV WKHPRVWWDOHQWHGDQGLQWHOOLJHQWZRXOGULVHWRWKHXSSHUOHYHOVRI WKHVRFLRHFRQRPLFVFDOH%HFDXVHVKHEHOLHYHGWKDWLQWHOOLJHQFHZDVODUJHO\LQIOXHQFHGE\ KHUHGLW\VKHFRQFOXGHGWKDWVXFFHVVIXOSDUHQWVZRXOGJLYHELUWKWRKLJKO\LQWHOOLJHQWFKLOGUHQ +RZHYHUVKHDOVRUHFRJQL]HGWKDWHQYLURQPHQWSOD\HGDUROHLQDSHUVRQVVXFFHVVDQGWKXV EHOLHYHGWKDWVRPHFKLOGUHQZRXOGEHIRXQGLQWKHORZHUVRFLRHFRQRPLFFODVVEHFDXVHWKHLU +ROOLQJZRUWK:KR,VWKH*LIWHG3XSLO" .OHLQ)LWWLQJWKH6FKRROWRWKH&KLOG7KH0LVVLRQRI/HWD6WHWWHU+ROOLQJZRUWK)RXQGHURI*LIWHG -HQNLQV 7RODQ +ROOLQJZRUWK([SHULPHQWVLQWKH(GXFDWLRQRI*LIWHG&KLOGU HQ 0DUJROLQ

PAGE 60

SDUHQWVWKRXJKKLJKO\LQWHOOLJHQWKDGQRWEHHQDEOHWRRYHUFRPHWKHHQYL URQPHQWDOREVWDFOHVWR VXFFHVV +ROOLQJZRUWKVHDUO\OLIHH[SHULHQFHVDOVRLQIOXHQFHGKHUYLHZVRQFODVV'XULQJ FKLOGKRRGDQGDVD\RXQJDGXOWVKHVWUXJJOHGILQDQFLDOO\ $OWKRXJKVKHZDVYHU\LQWHOOLJHQW KHUHFRQRPLFFLUFXPVWDQFHVSUHYHQWHGKHUIURP UHDFKLQJKHUIXOOSRWHQWLDODVHDUO\DVVKHPLJKW KDYHZKLFKSUREDEO\PRWLYDWHGKHUGHVLUHWRKHOSJLIWHGFKLOGUHQWKDWVKHIRXQGZKRZHUH ILQDQFLDOO\OLPLWHG+HUHPSOR\PHQWGXULQJJUDGXDWHVFKRROH[SRVHGKHUWRWKHSUREOHPVRI SRYHUW\ 6KHH[DPLQHGVR FLRHFRQRPLFFODVVLQKHUFKDSWHURQWKHGHPRJUDSKLFVRIJLIWHG FKLOGUHQLQ *LIWHG&KLOGUHQ DQGGHWHUPLQHGWKDWWKHPDMRULW\RIWKHVHFKLOGUHQFDPHIURP IDPLOLHVLQWKHXSSHUVRFLRHFRQRPLFFODVVHVEXWQRWDOORIWKHPGLG 6KHFULWLFL]HGHPLQHQFH VWXGLHV EHFDXVHWKH\FRXOGQRWHVWDEOLVKZKHWKHUHQYLURQPHQWRUKHUHGLW\LQIOXHQFHGWKHSHUVRQV VXFFHVV6KHWKRXJKWWKDWWKHUHZDVDKHUHGLWDU\FRPSRQHQWWRLQWHOOLJHQFHZKLFKZRXOGH[SODLQ ZK\PRVWJLIWHGFKLOGUHQFDPHIURPILQDQFLDOO\VXFFHVVIXOKRPHV7KHPD MRULW\RIFKLOGUHQVKH EHOLHYHGZRXOGEHZHOOVHUYHGE\EHLQJHGXFDWHGIRUWKHLUSDUHQWVRFFXSDWLRQVEXWWKDWWKHUH ZRXOGEHDVPDOOSHUFHQWDJHRIFKLOGUHQZKRZRXOGEHRYHU RUXQGHUTXDOLILHGIRUWKHVH FDUHHUV 6KHDOVRVRXJKWVRFLRHFRQRPLFFODVVGLY HUVLW\LQKHUSURJUDPDWWKH6SH\HU6FKRRO DQGKHOSHGWRIXQGKLJKHUHGXFDWLRQIRUVRPHRIKHUJLIWHGVWXGHQWV 6LOYHUPDQ7KH/HJDF\RI/HWD+ROOLQJZRUWK +ROOLQJZRUWK /HWD6WHWWHU+ROOLQJZRUWK$%LRJUDSK\ .OHLQ)LWWLQJWKH6FKRROWRWKH&KLOG7KH0LVVLRQ RI/HWD6WHWWHU+ROOLQJZRUWK)RXQGHURI*LIWHG )DJDQ +ROOLQJZRUWK *LIWHG&KLOGUHQ7KHLU1DWXUHDQG1XUWXUH +ROOLQJZRUWK 7KH3V\FKRORJ\RIWKH$GROHVFHQW .HDUQH\

PAGE 61

+ROOLQJZRUWKEHOLHYHGWKDWHGXFDWLQJJLIWHGFKLOGUHQZDVYLWDOO\LPSRUWDQWIRUWZR SULPDU\UHDVRQV)LUVWVKHWKRXJKWWKDWLWZDVHGXFDWLRQ VGXW\IRUWKHJRRGRIJLIWHGFKLOGUHQ 6KHIHOWWKDWPRVWRIWKHVHKLJKO\LQWHOOLJHQWFKLOGUHQZRXOGVXIIHULQDWUDGLWLRQDOFODVVURRP EHFDXVHWKH\ZRXOGH[SHULHQFHVRFLDOHPRWLRQDODQGLQWHOOHFWXDOSUREOHPV,QDJLIWHGHGXFDWLRQ SURJUDPOLNHWKHRQHW KDW+ROOLQJZRUWKGHVLJQHGWKH\ZRXOGKDYHWKHRSSRUWXQLW\WRLQWHUDFW ZLWKVLPLODUO\LQWHOOLJHQWSHHUVEHDEOHWRSXUVXHWKHLURZQDFDGHPLFLQWHUHVWVDQGGHYHORSVNLOOV QHFHVVDU\WRIXQFWLRQLQODUJHUVRFLHW\6HFRQGVKHEHOLHYHGWKHVRFLHW\VKRXOGHGX FDWHJLIWHG FKLOGUHQIRULWVRZQEHQHILW6KHRIWHQDUJXHGWKDWJLIWHGFKLOGUHQZHUHWKHRQHVXSRQZKRP VRFLHW\UHOLHGIRUSURJUHVV+LJKO\LQWHOOLJHQWLQGLYLGXDOVFRQWULEXWHGPDWHULDOO\DQGLGHRORJLFDOO\ WRDGYDQFHPHQW7KLVZDVLPSRUWDQWIRUWKH8QLWHG6 WDWHVDVDFRXQWU\WRUHPDLQSRZHUIXO LQWHUQDWLRQDOO\EXWDOVRIRUKXPDQNLQGRYHUDOO +ROOLQJZRUWKIHOWWKDWHGXFDWLRQDOSV\FKRORJ\DQGVSHFLDOHGXFDWLRQVKRXOGVSHQGPRUH WLPHVWXG\LQJJLIWHGFKLOGUHQDQGWKDWWKURXJKLQWHOOLJHQFHWHVWLQJHGXFDWRU VFRXOGQRZLGHQWLI\ JLIWHGFKLOGUHQDWD\RXQJDJHDQGSURYLGHWKHPZLWKXQLTXHHGXFDWLRQDORSSRUWXQLWLHV (GXFDWLQJJLIWHGFKLOGUHQZDVSDUWLFXODUO\QHFHVVDU\EHFDXVHWKHVHLQGLYLGXDOVZRXOGJURZXSWR FRQWULEXWHWRWKHDGYDQFHPHQWRIVRFLHW\LQWKHSURG XFWVWKH\ZRXOGLQYHQWDQGWKHLGHDVDQG WKHRULHVWKH\ZRXOGGHYHORS ,QGLYLGXDOVZLWK,4VFRUHVEHWZHHQDQGZHUHEHVWVXLWHG WREHOHDGHUVDQGLQGLYLGXDOVZLWK,4VFRUHVKLJKHUWKDQZRXOGSURYLGHQHZLQYHQWLRQVDQG LGHDV 6KHDUJXHGWKDWLQ DGHPRFUDF\HGXFDWRUVGLGQRWKDYHWRSURYLGHWKHVDPHVHUYLFHVWR DOOFKLOGUHQEXWWKDWWKH\QHHGHGWRSURYLGHWKHHGXFDWLRQWKDWZRXOGHQDEOHDOOFKLOGUHQWRUHDFK WKHLUIXOOSRWHQWLDO 3URYLGLQJVSHFLDOHGXFDWLRQIRUJLIWHGFKLOGUHQZRXOGKHOSWRVH UYHWKHLU +ROOLQJZRUWK$Q(QULFKPHQW&XUULFXOXPIRU5DSLG/HDUQHUVDW3XEOLF6FKRRO6SH\HU6FKRRO +RO OLQJZRUWK,QWHOOLJHQFHDVDQ(OHPHQWLQ3HUVRQDOLW\/RUJHDQG+ROOLQJZRUWK +ROOLQJZRUWK,QWHOOHFWXDOO\6XSHULRU&KLOGUHQ

PAGE 62

XQLTXHHPRWLRQDODQGVRFLDOQHHGV 6KHZDVDEOHWRLQFRUSRUDWHKHUEHOLHIVDERXWWKHVSHFLDO QHHGVRIJLIWHGFKLOGUHQLQKHUSURJUDPVLPSOHPHQWHGLQ36DQGWKH6SH\HU6FKRRO 8QGHUVWDQGLQJ+ROOLQJZRUWKVRSLQLRQVSURYLGHVFRQWH[WIRUFRQ VLGHULQJWKHZRUNRIKHU FRQWHPSRUDULHVDQGWKHVWDWHRIVSHFLDOHGXFDWLRQWRGD\6RFLDOVFLHQFHVLQFOXGLQJHGXFDWLRQDO SV\FKRORJ\H[SHULHQFHGWUHPHQGRXVJURZWKLQWKHHDUO\WZHQWLHWKFHQWXU\7KHPHWKRGVDQG WRROVEHLQJXVHGDWWKDWWLPHKDYHEHHQVKDS HGDQGUHILQHGVLQFHEXWPDQ\RIWKHPDUHVWLOOEHLQJ XVHGSUHVHQWO\LQWKHLUPRGLILHGIRUPV7KHILHOGVWKDWHPHUJHGGXULQJWKDWWLPHKDYHEHHQKLJKO\ LQIOXHQFHGE\WKHLUEHJLQQLQJVDQGDVVFKRODUVRIVRFLDOVFLHQFHVWRGD\ZHEHQHILWIURPEHLQJ DZDUHR IWKHVWDUWLQJSRLQWRIWKHILHOG$VRQHRIWKHILUVWSURPLQHQWHGXFDWLRQDOSV\FKRORJLVWV +ROOLQJZRUWKSOD\HGDQLPSRUWDQWUROHLQPXOWLSOHDVSHFWVRISV\FKRORJ\DQGZKDWZHQRZ FRQVLGHUVSHFLDOHGXFDWLRQ ,WLVSDUWLFXODUO\UHOHYDQWWRFRQVLGHUKRZKHU YLHZVPLUURUHGRUGLIIHUHGIURPWKH RSLQLRQVRIKHUSHHUV7ZRRIKHUPRVWQRWDEOHFRQWHPSRUDULHVZHUH(/7KRUQGLNHZKRZDV FRQFHUQHGZLWKOHDUQLQJDQGLQWHOOLJHQFHDQG/HZLV7HUPDQZKRIRFXVHGRQLQWHOOLJHQFHDQG JLIWHGHGXFDWLRQ7KRUQGLNHKDVEHH QKDLOHGDVWKHILUVWPDMRUHGXFDWLRQDOSV\FKRORJLVWDQGIURP KLVSRVLWLRQDW&ROXPELD8QLYHUVLW\VKDSHGWKHFXUULFXOXPSHGDJRJ\DQGRUJDQL]DWLRQDO VWUXFWXUHRIWKH$PHULFDQVFKRRODVZHOODVWKHEDVLFDLPVDQGPHWKRGVRIXQLYHUVLW\ EDVHG LQTXLU\ 7 KRUQGLNHQRWRULRXVO\KHOGLGHDVDERXWWKHLQIHULRULW\RIZRPHQZKLFKZDVLQGLUHFW FRQWUDGLFWLRQWR+ROOLQJZRUWKVILQGLQJVDVRQHRIKLVJUDGXDWHVWXGHQWV +HEHOLHYHGWKDW LQWHOOLJHQFHDQGYLUWXHYDULHGDVDIXQFWLRQRIUDFHDQGVRFLRHFRQRPLFFODVV D QGZDVDQDYLG +ROOLQJZRUWK7KH)RXQGLQJRI3XEOLF6FKRRO6SH\HU6FKRRO 7RPOLQVRQ 6LOYHUPDQ/HWD 6WHWWHU+ROOLQJZRUWK&KDPSLRQRIWKH3V\FKRORJ\RI:RPHQDQG*LIWHG&KLOGUHQ 7RPOLQVRQ

PAGE 63

VXSSRUWHURIERWKWKHSRVLWLYHDQGQHJDWLYHHXJHQLFGRFWULQHVRIKLVSUHGHFHVVRUV ,QWHOOHFWZDV LQ7KRUQGLNHVRSLQLRQLQKHULWHGDQGQRWDSURGXFWRIWKHHQYLURQPHQW $GGLWLRQDOO\KH IRUPHGDJRRGQHVVFKDUWEDVHGRQLQGH[HVRIFODVV DQGUDFH 0XFKOLNH+ROOLQJZRUWK 7KRUQGLNHEHOLHYHGWKDWLQDPHULWRFUDF\SRZHUVKRXOGEHLQYHVWHGLQPHQRIVXSHULRULQWHOOHFW DQGYLUWXHV ,QVRPHZD\V+ROOLQJZRUWKVKDUHGWKHEHOLHIVRIKHUDGYLVRUEXWLQRWKHUVVKH VWURQJO\GLIIHUHG6KHYRFDOO\ RSSRVHGKLVVH[LVWEHOLHIVLQWKHJHQHUDOLQWHOOHFWXDOLQIHULRULW\RI ZRPHQE\SURYLGLQJHYLGHQFHWKDWWKHUHZHUHMXVWDVPDQ\JLIWHGJLUOVDVWKHUHZHUHER\VDQG VKHGLGQRWDVFULEHWRWKHQHJDWLYHHXJHQLFVSUHFHSWVWKDWKHVXSSRUWHG6KHDOVREHOLHYHG WKDWWKH HQYLURQPHQWGLGSOD\DUROHLQLQWHOOLJHQFH+RZHYHUVKHIRXQGFRUUHODWLRQVEHWZHHQUDFHDQG FODVVDQGLQWHOOLJHQFHDQGIHOWWKDWLQDPHULWRFUDF\WKHPRVWLQWHOOLJHQWZRXOGEHWKHPRVW VXFFHVVIXODQGFRQWUROPRVWRIWKHZHDOWK $OWKRXJKOHVV H[SOLFLWLQKLVVH[LVPWKDQ7KRUQGLNH7HUPDQDOVRSURPRWHGPLVRJ\QLVWLF YLHZV+HLQFOXGHGIDUPRUHPDOHVWKDQIHPDOHVLQKLVUHVHDUFKEXWGLVPLVVHGWKHSRVVLELOLW\RI VHOHFWLRQELDVRUWHVWELDV+HIRXQGWKDWWKHDYHUDJHLQWHOOLJHQFHRIIHPDOHVZDVHTX DOWRWKDWRI PDOHVDQGKHFRQFOXGHGWKDWZRPHQIDLOHGWRDFKLHYHHPLQHQFHEXWGLGQRWFRQFOXGHZK\WKLV ZDVVR+HDOVRKHOGUDFLVWYLHZVZKLFKHYROYHGRYHUWKHFRXUVHRIKLVFDUHHU,QWKHWZHQWLHV DQGWKLUWLHVKHDUJXHGWKDWQHJURDQG/DWLQUDFHV ZHUHLQWHOOHFWXDOO\LQIHULRU +HH[SUHVVHG DQWL 6HPLWLFEHOLHIVDQGEHOLHYHGWKDWPL[LQJUDFHVOHGWRLQIHULRUFKLOGUHQ7HUPDQZDVDOVR 6HOGHQ 7RPOLQVRQ ,ELG ,ELG 9LDOOH

PAGE 64

NQRZQWRHVSRXVHHXJHQLFV $GGLWLRQDOO\LQVWDQGDUGL]LQJKLVLQWHOOLJHQFHWHVWVKHXVHGD ZKLWHPLGGOHFODVVSRSX ODWLRQZLWKRXWFRQVLGHULQJWKDWWKLVPLJKWLPSDFWWKHYDOLGLW\RIWKH WHVWVIRUYDULRXVUDFLDOJURXSV+RZHYHULQWKHV7HUPDQVYLHZVRQUDFHKDGPHOORZHG DQGKHSURFODLPHGWKDWQRUDFHRUQDWLRQDOLW\KDVDQ\PRQRSRO\RQEUDLQVDQGWKDWODQJXDJ H DQGHQYLURQPHQWPLJKWLQIOXHQFHWKHODFNRIPLQRULW\UHSUHVHQWDWLRQLQJLIWHGJURXSV +LV YLHZVRQVRFLR HFRQRPLFFODVVDSSHDUHGWRUHPDLQFRQVWDQWRYHUWLPHDQGKHEHOLHYHGWKDWWKH VRFLDOKLHUDUFK\UHIOHFWHGWKHVWUDWLILFDWLRQRILQWHOOLJHQFH +HIH OWWKDWLQWHOOLJHQFHZDVEDVHG RQKHUHGLW\DQGWKDWLQWHOOLJHQFHWHVWLQJZDVDYDOLGPHDVXUHWRLGHQWLI\JLIWHGFKLOGUHQ +H DOVRLQVLVWHGWKDWWKHZHOIDUHRIWKHFRXQWU\GHSHQGHGRQWKHHGXFDWLRQRIJLIWHGFKLOGUHQEXWGLG QRWKDYHWKHVDPHLQWHUHVWWK DW+ROOLQJZRUWKGLGLQSXWWLQJIRUWKFXUULFXOXPDQGPHWKRGVWREH XVHGLQJLIWHGSURJUDPV+HIDYRUHGDFFHOHUDWLRQIRUJLIWHGFKLOGUHQDQGODPHQWHGWKHIDFWWKDW PRVWRIWKHPZHUHXQGHUSURPRWHG 7HUPDQDQG+ROOLQJZRUWKWKXVVKDUHGVRPHYLHZVRQ JLIWHG\ RXWK7KH\ERWKIRXQGPRUHJLIWHGFKLOGUHQLQFHUWDLQUDFLDOJURXSVEXWXQOLNH7HUPDQLQ KLVHDUO\RSLQLRQV+ROOLQJZRUWKDUJXHGDOWHUQDWLYHVWRLQKHUHQWELRORJLFDOGLIIHUHQFHV7KH\ERWK EHOLHYHGWKDWVRFLDOFODVVZDVODUJHO\WKHUHVXOWRIWKHGLVWULEXWL RQRILQWHOOLJHQFH$OVRWKH\ DJUHHGWKDWJLIWHGFKLOGUHQKHOGDQLPSRUWDQWUROHLQWKHIXWXUHRIVRFLHW\EXW+ROOLQJZRUWK H[SDQGHGRQWKLVLGHDPRUHVXEVWDQWLDOO\DQGRIIHUHGLGHDVIRUKRZWRFXOWLYDWHWKHVHIXWXUH OHDGHUVDQGLQQRYDWRUV 6HOGHQ 9LDOOH ,ELG ,ELG ,ELG

PAGE 65

+ROOLQJZRUWK VEHOLHIVLQUDFHFODVVDQGWKHLPSRUWDQFHRIJLIWHGHGXFDWLRQUHVHPEOHG WKRVHRSLQLRQVRIKHUPRVWIDPRXVFRQWHPSRUDULHVEXWWKH\ZHUHQRWLGHQWLFDO6KHZDVPRUH LQWHUHVWHGLQWKHLQIOXHQFHRIHQYLURQPHQWWKDQ7KRUQGLNHDQG7HUPDQDQGGLGQRWEHOLHYH WKDW KHUHGLW\ZDVWKHRQO\IDFWRULQLQWHOOLJHQFH6KHVXSSRUWHGSRVLWLYHHXJHQLFVEXWZDVQRWNQRZQ WRVXSSRUWQHJDWLYHHXJHQLFVRUXVHHXJHQLFFODLPVUHJDUGLQJUDFLDOGLIIHUHQFHV6KHVXJJHVWHG SODXVLEOHH[SODQDWLRQVWKDWGLGQRWUHO\RQELRORJLFDOVXSH ULRULW\WRHOXFLGDWHZK\WKHKLJKHVW SURSRUWLRQRIJLIWHGFKLOGUHQZHUHIRXQGLQZKLWHPLGGOHDQGXSSHUFODVVKRPHV6KHZDVDOVR PXFKPRUHFRQFHUQHGZLWKWKHLQIOXHQFHJLIWHGFKLOGUHQZRXOGKDYHRQVRFLHW\DVDGXOWVDQG WKXVVSHQWPXFKRIKHUFDUHHUH[D PLQLQJWKHEHVWPHWKRGVWRHGXFDWHWKHP$OWKRXJKLWLV WHPSWLQJWRWU\WRODEHOKHUDVEHLQJUDFLVWRUFODVVLVWRUQRWEHLQJUDFLVWRUFODVVLVWGHSHQGLQJRQ RQHVLQWHUSUHWDWLRQFOHDUO\WKHDQVZHULVPRUHFRPSOH[WKDQWKDW6KHGRHVQRWILWLQWRDQ\R I WKHFDWHJRULHVLQZKLFKZHPLJKWSODFHVRPHRIKHUFRQWHPSRUDULHV,QVKRUW+ROOLQJZRUWKZDV PRUHRSHQWRDOWHUQDWLYHH[SODQDWLRQVIRUWKHGLVFUHSDQFLHVIRXQGEHWZHHQGLIIHUHQWUDFLDORU VRFLRHFRQRPLFJURXSVWKDQ7HUPDQRU7KRUQGLNHZHUH%\KROGLQJWKH VHDWWLWXGHVKRZHYHUVKH RSHQHGWKHGRRUIRUIXWXUHHGXFDWLRQDOSV\FKRORJLVWVDQGVHWSUHFHGHQWVWKDWZRXOGEHXVHGLQWKH IXWXUHWRH[DPLQHWKHVHLPSRUWDQWLVVXHV/LNHPDQ\RIKHUVXFFHVVRUVLQHGXFDWLRQDO SV\FKRORJ\VKHZDVPRUHVHQVLWLYHWKDQKHUSH HUVLQUHJDUGVWRHQYLURQPHQWDODQGHPRWLRQDO IDFWRUVWKDWLQIOXHQFHGFKLOGUHQ +ROOLQJZRUWKDOVRLQIOXHQFHGKHUSHHUVLQWHUPVRIWKHFXUULFXOXPDQGSHGDJRJ\XVHGWR HGXFDWHJLIWHGFKLOGUHQ,QWKHHDUO\WZHQWLHWKFHQWXU\WKHSRSXODUDVVXPSWLRQZDVWKDW JLIWHG FKLOGUHQZRXOGH[FHOLQDQ\HGXFDWLRQDOHQYLURQPHQWDVDUHVXOWRIWKHLUWDOHQWDQGWKXVJLIWHG HGXFDWLRQZDVODUJHO\LJQRUHGEHIRUHEHLQJVWXGLHGE\HGXFDWLRQDOSV\FKRORJLVWVOLNH7KRUQGLNH DQG7HUPDQ+RZHYHUUHVHDUFKHUVGLGQRWV\VWHPDWLFDOO\ H[DPLQHJLIWHGHGXFDWLRQSURJUDPV

PAGE 66

WKURXJKRXWWKHQDWLRQ VRLWLVGLIILFXOWWRDVFHUWDLQZLGHVSUHDGWUHQGVLQWKHLULPSOHPHQWDWLRQ $VHDUO\DVWKHVVRPHHGXFDWRUVZKRZHUHFRQFHUQHGZLWKWKLVVSHFLDOSRSXODWLRQDUJXHG IRUIOH[LEOHSURPRWLRQLQZK LFKPDQ\JLIWHGFKLOGUHQZHUHVLPSO\DFFHOHUDWHGWKURXJKWKH JUDGHVDWDTXLFNHUSDFHWKDQWKHLUSHHUV 7KLVZDVDZD\WKDWKLJKO\LQWHOOLJHQWFKLOGUHQFRXOG UHFHLYHDQHGXFDWLRQPRUHFRPPHQVXUDWHZLWKWKHLULQWHOOHFWXDODELOLWLHVEXWLWFRXOGDOVRFDXVH HPRWLRQDODQGVRFLDOSUREOHPVIRUWKHVHFKLOGUHQ,QDVXUYH\FRQGXFWHGLQWKHPDMRULW\RI FLWLHVWKDWSURYLGHGVSHFLDOVHUYLFHVWRJLIWHGFKLOGUHQGLGVRLQWKHIRUPRIDFFHOHUDWLRQ ,Q VRPHFDVHVHGXFDWRUVZKRZHUHSDUWLFXODUO\LQWHUHVWHGLQVHU YLQJJLIWHGFKLOGUHQVXJJHVWHGDQG LPSOHPHQWHGVHJUHJDWHGFODVVHVIRUKLJKO\LQWHOOLJHQWFKLOGUHQZKLFKPLJKWLQFOXGHHQULFKPHQW DFFHOHUDWLRQRUDFRPELQDWLRQRIWKHWZR $OWKRXJKLWLVFOHDUWKDWLQGLYLGXDOHGXFDWRUVZHUH LQWHUHVWHGLQSURYLGLQJVSHFL DOHGXFDWLRQIRUJLIWHGFKLOGUHQWKHUHZDVQRXQLYHUVDOSURJUDPRU PHWKRGEHLQJLPSOHPHQWHG 7KHSURJUDPVWKDW+ROOLQJZRUWKLPSOHPHQWHGLQ36DQGWKH6SH\HU6FKRROZHUH KLJKO\LQIOXHQWLDORQWKHJLIWHGHGXFDWLRQEHLQJRIIHUHGDWWKDWWLPH+HUZR UNSDUWLFXODUO\WKDW EHLQJGRQHDWWKH6SH\HU6FKRROUHFHLYHGQHZVFRYHUDJHERWKORFDOO\DQGDURXQGWKHZRUOG $OWKRXJKWKHPDMRULW\RIWKHFODVVHVVHUYHGFKLOGUHQZLWKORZLQWHOOLJHQFHRUVSHFLDOGLVDELOLWLHV WKHJLIWHGFODVVHVZHUHPXFKPRUHLQIOXHQWL DO(GXFDWRUVIURPDYDULHW\RIFRXQWULHVWUDYHOHGWR $6FRWW /HH7KH6HOHFWLRQRI%ULJKW&KLOGUHQIRU6SHFLDO&ODVVHV 7KH(OHPHQWDU\6FKRRO-RXUQDO QR f )UDQN1)UHHPDQ3URYLVLRQLQWKH(OHPHQWDU\6FKRROIRU6XSHULRU&KLOGUHQ 7KH(OHPHQWDU\6FKRRO-RXUQDO QRf ELG ,ELG /HH

PAGE 67

1HZ
PAGE 68

RUFRPSDFWLQJ$GGLWLRQDOO\KHUXVHRIDPRGHUDWHDPRXQWRIDFFHOHUDWLRQDORQJZLWKDQ HQULFKHGFXUULFXOXPUHPDLQVHVVHQWLDOWRJLIWHGHGXFDWLRQ %RWKWKHSHGDJRJ\DQGFXUULFXOXP WKDW+ROOLQJZRUWKGHYHORSHGFRQWLQX HVWREHKLJKO\UHOHYDQWWRHGXFDWRUVLQWKHFODVVURRPDQGWR HGXFDWLRQDOSV\FKRORJLVWV$IXOOXQGHUVWDQGLQJRIKHUYLHZVRQUDFHFODVVDQGWKHLPSRUWDQFH RIJLIWHGQHVVFDQKHOSH[SODLQZK\VKHFKRVHWKHVWXGHQWVWKDWVKHGLGZKHQHVWDEOLVKLQJWKH 6SH\H U6FKRROZKDWVKHIHOWZDVLPSRUWDQWLQHGXFDWLQJFKLOGUHQIRUIXWXUHYRFDWLRQDO RSSRUWXQLWLHVDQGZK\JLIWHGFKLOGUHQQHHGHGWROHDUQDERXWVSHFLILFWRSLFV *LIWHGSURJUDPVWRGD\DOVRIDFHPDQ\RIWKHVDPHFKDOOHQJHVWKDW+ROOLQJZRUWK LGHQWLILHG:HV WLOOILQGXQGHUUHSUHVHQWDWLRQRIVWXGHQWVIURPPLQRULW\UDFLDOJURXSV(YHQZLWK DZDUHQHVVRIWKLVSUREOHPHGXFDWLRQDOSV\FKRORJ\KDVQRW\HWIRXQGDZD\WRFRQVLVWHQWO\ FRUUHFWLW2QHSURSRVHGIDFWRULQWKLVSUREOHPLVWKHXVHRILQWHOOLJHQFHWHVWLQJZ KLFKKDVDQ DSSUHFLDEOHFXOWXUDOELDV $OWKRXJKWKLVLVQRWWKHVDPHH[SODQDWLRQWKDW+ROOLQJZRUWK SURSRVHGKHUFRQFHUQZLWKWKLVLVVXHH[HPSOLILHGKHUHDUO\FRQWULEXWLRQWRWKHFRQWLQXHG H[DPLQDWLRQDVWRZK\WKHUHDUHIHZHULGHQWLILHGJLIWHGFKLOGUHQL QVRPHUDFHVWKDQRWKHUV$OVR JLIWHGSURJUDPVWRGD\RIWHQVHUYHWRUHVHJUHJDWHVFKRROVDORQJUDFLDOOLQHV 7KLVLVLQGLUHFW FRQWUDGLFWLRQWRZKDW+ROOLQJZRUWKEHOLHYHGDERXWWKHUDFLDOFRPSRVLWLRQRIJLIWHGFODVVHV6KH DFWLYHO\ZRUNHGWRHQVXUHUDFLDO GLYHUVLW\LQKHUSURJUDPV&OHDUO\HGXFDWLRQDOSV\FKRORJLVWV WRGD\FDQJDLQIURPH[DPLQLQJ+ROOLQJZRUWKVSHUVSHFWLYHVRQUDFHWRLQIRUPSUHVHQWSUDFWLFHV $V-HURPH0RUULVDUJXHG 6FKRROVWRGD\DUHQRWLPPXQHIURPWKHUHDOLWLHVRIKLVWRU\DQGWKH SHUYD VLYHXQVSRNHQEHOLHIVLQWKHVFLHQWLILFFRPPXQLW\WKDWGRXEWWKHLQWHOOHFWXDOFDS DFLW\RI 6LOYHUPDQ6RFLDODQG(PRWLRQDO(GXFDWLRQRIWKH*LIWHG7KH'LVFRYHULHVRI/HWD+ROOLQJZRUWK -DPHV-*DOODJKHU7KH5ROHRI 5DFHLQ*LIWHG(GXFDWLRQ 5RHSHU5HYLHZ QRf ,ELG

PAGE 69

>PLQRULWLHV@ (GXFDWRUVDQGVFKRODUVFDQKDYHDPRUHFRPSUHKHQVLYHXQGHUVWDQGLQJRIWKH SUHVHQWVWDWHRIJLIWHGHGXFDWLRQE\ORRNLQJDWWKHSUHFHGHQWVWKDW+ROOLQJZ RUWKDQGKHUSHHUV KDYHVHW ,VVXHVRIXQGHUUHSUHVHQWDWLRQRIFKLOGUHQIURPWKHORZHUVRFLRHFRQRPLFFODVVDOVR FRQWLQXHWRSODJXHJLIWHGHGXFDWLRQSURJUDPV$OWKRXJKHGXFDWRUVDUHIXOO\DZDUHWKDWJLIWHG FKLOGUHQH[LVWLQWKHORZHUVRFLRHFRQRPLFFODVVWK LVSRSXODWLRQLVVWLOOXQGHULGHQWLILHGDQG XQGHUVHUYHG (QULFKPHQWFXUULFXOXPLVSDUWLFXODUO\HIIHFWLYHIRUJLIWHGVWXGHQWVFRPLQJIURP ORZHUVRFLRHFRQRPLFFODVVKRPHVEHFDXVHWKHLUIDPLOLHVFDQQRWDIIRUGWRSURYLGHDOORIWKH RSSRUWXQLWLHVWKDWIDPLOLHV LQWKHPLGGOHDQGXSSHUVRFLRHFRQRPLFFODVVHVFDQ$OVRHQULFKPHQW FXUULFXOXPWUHDWVWKHVHVWXGHQWVDVLQGLYLGXDOVE\DOORZLQJWKHPWRVWXG\WKHWRSLFVWKDWLQWHUHVW WKHP +ROOLQJZRUWKUHFRJQL]HGVRPHRIWKHXQLTXHSUREOHPVWKLVSRSXODWLRQIDFHGDQG L QWHJUDWHGHQULFKPHQWLQKHUSURJUDPVE\HQJDJLQJWKHVWXGHQWVLQVXEMHFWVWKDWLQWHUHVWHGWKH LQGLYLGXDOVWXGHQWVDQGSURYLGLQJILHOGWULSVDQGSUHVHQWDWLRQV$GGLWLRQDOO\JLIWHGFKLOGUHQIURP WKHORZHUVRFLRHFRQRPLFFODVVEHQHILWIURPKDYLQJHGXFDWRUVZK RDUHPHQWRUVWRWKHP $V HYLGHQFHGLQ &KLOGUHQ$ERYH,4 +ROOLQJZRUWKPHQWRUHGKHUVWXGHQWVDVVKHPDLQWDLQHGD SHUVRQDOUHODWLRQVKLSZLWKPDQ\RIWKHVHKLJKO\JLIWHGFKLOGUHQDQGHYHQFRQWULEXWHGILQDQFLDOO\ WRKHOSVRPHRIWKHPDIIRUGKLJKHUHGXFD WLRQDORSSRUWXQLWLHV(GXFDWRUVWRGD\FDQVWLOOOHDUQ IURPWKHFXUULFXOXPDQGPHWKRGVWKDW+ROOLQJZRUWKXVHGLQWKHVDQGV -HURPH(0RUULV$IULFDQ$PHULFDQ6WXGHQWVDQG*LIWHG(GXFDWLRQ 5RHSHU5HYLHZ QRf 7KRPDV3+pEHUW(GXFDWLQJ*LIWHG&KLOGUHQIURP/RZ6RFLRHFRQRPLF%D FNJURXQGV&UHDWLQJ9LVLRQVRID +RSHIXO)XWXUH ([FHSWLRQDOLW\ QRf ,ELG ,ELG

PAGE 70

7KHPRWLYDWLRQVIRUHGXFDWLQJJLIWHGFKLOGUHQWRGD\DUHDOVRFRQVLVWHQWZLWK +ROOLQJZRUWKVEHOLHIV(GXFDWRUVFRQWLQXH WRYLHZJLIWHGHGXFDWLRQDVQHFHVVDU\WRUHPDLQ HFRQRPLFDOO\FRPSHWLWLYHLQWHUQDWLRQDOO\ +RZHYHUWKHQHHGVRIJLIWHGVWXGHQWVDUHDOVRD IDFWRULQWKHLPSRUWDQFHRIJLIWHGHGXFDWLRQ-DPHV%RUODQGGHVFULEHVWKHVHWZRSKHQRPHQDDV WKHQDWLRQDOUHVRXUFH DQGVSHFLDOHGXFDWLRQDOFRQFHSWLRQVRIJLIWHGQHVV7KHILUVWUHIHUVWR VRFLHW\VLQYHVWPHQWLQJLIWHGHGXFDWLRQIRUWKHSURPRWLRQRIWKHFRPPRQJRRGDQGWKHVHFRQG UHIHUVWRFRPPLWPHQWWRPHHWLQJLQGLYLGXDOQHHGVRIJLIWHGFKLOGUHQ +ROOLQJZRUWKPDGHER WK RIWKHVHDUJXPHQWVLQKHUZULWLQJDOWKRXJKVKHSODFHGJUHDWHUHPSKDVLVRQKRZPHHWLQJWKH QHHGVRIJLIWHGFKLOGUHQZRXOGQHFHVVDULO\OHDGWRVRFLHWDODGYDQFHPHQWDVWKHVHFKLOGUHQJUHZ XSWREHFRPHWKHOHDGHUVDQGLQYHQWRUVRIWKHQH[WJHQHUDWLRQ8QGH UVWDQGLQJKHUYLHZVFDQVKHG OLJKWRQKRZSUHVHQWGD\HGXFDWRUVKDYHFRPHWREHOLHYHLQWKHQHHGIRUJLIWHGHGXFDWLRQIRUWKH FKLOGUHQLQWKLVXQLTXHSRSXODWLRQEXWDOVRIRUWKHFRPPRQJRRG 7KHZRUNRI/HWD+ROOLQJZRUWKUHPDLQVKLJKO\UHOHYDQWWRGD\JL YHQWKHFRQWLQXLQJ LVVXHVRIXQGHUUHSUHVHQWDWLRQRIPLQRULWLHVDQGWKHORZHUVRFLRHFRQRPLFFODVVDQGWKH FRQWURYHUV\RYHULIDQGKRZWRSURYLGHVSHFLDOHGXFDWLRQIRUJLIWHGFKLOGUHQ,QRUGHUWRIXOO\ XQGHUVWDQGWKHQDWXUHRIWKHVHLVVXHVDQGLQVHHNLQJ LQVLJKWLQWRKRZWRUHVROYHWKHPZHFDQ ORRNWRWKHZULWLQJDQGSUDFWLFHRIWKHIRXQGHUVRIWKHILHOGRIJLIWHGHGXFDWLRQ8QGHUVWDQGLQJ +ROOLQJZRUWKVYLHZVVSHFLILFDOO\FDQDYDLOXVLQRXUDWWHPSWWRILQGVROXWLRQVWRWKHVHSUREOHPV 0DQ\VFKRODUVKDYH DOUHDG\HQJDJHGLQWKLVH[DPLQDWLRQUHJDUGLQJVRPHRIWKHPHWKRGVWKDW +ROOLQJZRUWKXVHGLQKHUFODVVURRPVXFKDVVRFLDODQGHPRWLRQDOHGXFDWLRQDQGWKHWUHDWPHQWRI 6S\URV.RQVWDQWRSRXORV0DQLVKD0RGLDQG/DUU\9+HGJHV:KR$UH$PHULFDV*LIWHG" $PHULFDQ-RXUQDO RI(GXFDWLRQ QRf -DPHV+%RUODQG7KH&RQVWUXFWRI*LIWHGQHVV 3HDERG\-RXUQDORI(GXFDWLRQ QRf

PAGE 71

JLIWHGJLUOV$GGLWLRQDOO\VFKRODUO\DWWHQWLRQKDVEHHQSDLGWR0V3LOJULPLQUHJDUG VWRKHU ZRUNZLWKWKHSV\FKRORJ\RIZRPHQ $VHYLGHQFHGLQWKLVWKHVLVKRZHYHUZHDOVRQHHGWRH[DPLQHKHUEHOLHIVRQUDFHFODVV DQGWKHLPSRUWDQFHRIHGXFDWLQJJLIWHGFKLOGUHQSDUWLFXODUO\EHFDXVHWKHVHLVVXHVVWLOOSODJXH JLIWHGHGXFDWLRQ$OWKRX JKWKHVHWRSLFVKDYHQRWEHHQDGGUHVVHGH[WHQVLYHO\E\VFKRODUVXSWR WKLVSRLQWLWLVDSSDUHQWWKDW+ROOLQJZRUWKVLGHDVDERXWWKHVHLVVXHVGLGLQIDFWLQIOXHQFHKHU ZRUNDVRQHRIWKHIRXQGHUVRIJLIWHGHGXFDWLRQDQGWKXVVHWSUHFHGHQWVIRUWKHIXWXUH +HU GHGLFDWLRQWRWKHVFLHQWLILFVWXG\RIHGXFDWLRQDQGLQWHOOLJHQFHDQGKHURSHQQHVVWRDOWHUQDWLYH H[SODQDWLRQVSDYHGWKHZD\IRUIXWXUHHGXFDWLRQDOSV\FKRORJLVWV$VHGXFDWRUVWRGD\IDFHWKHVH SUHYDOHQWDQGHQGXULQJLVVXHVRIXQGHUUHSUHVHQWDWLRQLQJL IWHGHGXFDWLRQDQGFRQFHUQRYHUKRZ DQGZK\WRSURYLGHVSHFLDOHGXFDWLRQDORSSRUWXQLWLHVWRWKLVSRSXODWLRQ/HWD+ROOLQJZRUWKV ZRUNFDQJXLGHERWKFXUULFXOXPDQGSUDFWLFH

PAGE 72

/,672)5()(5(1&(6 $GDPV'DYLV:DOODFH (GXFDWLRQIRU([WLQFWLRQ$PHULFDQ, QGLDQVDQGWKH%RDUGLQJ6FKRRO ([SHULHQFH /DZUHQFH8QLYHUVLW\3UHVVRI.DQVDVf %HQERZ&DPLOOD/HWD6WHWWHU+ROOLQJZRUWK$3LOJULPLQ5HVHDUFKLQ+HU7LPHDQG2XUV 5RHSHU5HYLHZ QRf %HQMDPLQ-U/XG\/HWD 6WHWWHU+ROOLQJZRUWK3V\FKRORJLVW(GXFDWRU)HPLQLVW 5RHSHU 5HYLHZ QRf %RUODQG-DPHV+/HWD+ROOLQJZRUWKV&RQWULEXWLRQVWRWKH3V\FKRORJ\DQGWKH(GXFDWLRQRI WKH*LIWHG 5RHSHU5HYLHZ QRf %RUODQG-DP HV+7KH&RQVWUXFWRI*LIWHGQHVV 3HDERG\-RXUQDORI(GXFDWLRQ QR f %XUQVLGH/HQRLU+$Q([SHULPHQWDO3URJUDPLQ(GXFDWLRQRIWKH,QWHOOHFWXDOO\*LIWHG $GROHVFHQW 7KH6FKRRO5HYLHZ QRf &DYDQ5XWK.QRZO HGJHDERXW3DUHQW &KLOG5HODWLRQVKLSV 0DUULDJHDQG)DPLO\/LYLQJ QR f )DJDQ7KRPDV&RQWULEXWLRQVRI/HWD+ROOLQJZRUWKWR6FKRRO3V\FKRORJ\ 5RHSHU5HYLHZ QRf )RUG'RQQD<'HVHJUHJDWLQJ*LIWHG(GXFDWLRQ$ 1HHG8QPHW 7KH-RXUQDORI1HJUR (GXFDWLRQ QRf )UHHPDQ)UDQN13URYLVLRQLQWKH(OHPHQWDU\6FKRROIRU6XSHULRU&KLOGUHQ 7KH(OHPHQWDU\ 6FKRRO-RXUQDO QRf *DOODJKHU-DPHV-7KH5ROHRI5DFHLQ*LIWHG(GXF DWLRQ 5RHSHU5HYLHZ QRf *DUULVRQ&KDUORWWH$%XUNHDQG/+ROOLQJZRUWK7KH3V\FKRORJ\RID3URGLJLRXV&KLOG 7KH-RXUQDORI$SSOLHG3V\FKRORJ\ QRf *DWHV$UWKXU/HWD6+ROOLQJZRUWK 6FLHQFH1HZ6HULHV QRf *UD\:LOOLDP6(GXFDWLRQRIWKH*LIWHG&KLOG:LWK6SHFLDO5HIHUHQFHWR5HDGLQJ 7KH (OHPHQWDU\6FKRRO-RXUQDO QRf *UH\&LQGHO\Q+LVWRULFDO7UHDWPHQWRI)HPDOH3V\FKRORJLVWVRI'LVWLQFWLRQ3DSHUSU HVHQWHG DWWKH$QQXDO&RQYHQWLRQRIWKH$PHULFDQ3V\FKRORJLFDO$VVRFLDWLRQ0RQWUHDO4XHEHF &DQDGD6HSWHPEHU *ULIILQ1RUPD6L[:DOOVRIWKH+RJDQ/HWD+ROOLQJZRUWKDVD0RGHOIRUD7HDFKHURI /HDUQLQJ 5RHSHU5HYLHZ QRf

PAGE 73

*XVWDIVRQ'DYLG1DWXUHDQG1XUWXUHRI,QWHOOHFWXDOO\*LIWHG&KLOGUHQ5HYLHZRI *LIWHG &KLOGUHQ7KHLU1DWXUHDQG1XUWXUH7KH6FKRRO5HYLHZ QRf +DUULV&DUROH7KH+ROOLQJZRUWK/RQJLWXGLQDO6WXG\)ROORZ XS)LQGLQJVDQG ,PSOLFDWLRQV 5RHSHU5HYLHZ QRf +pEHUW7KRPDV3 (GXFDWLQJ*LIWHG&KLOGUHQIURP/RZ6RFLRHFRQRPLF%DFNJURXQGV&UHDWLQJ 9LVLRQVRID+RSHIXO)XWXUH ([FHSWLRQDOLW\ QRf +ROOLQJZRUWK+DUU\ /HWD6WHWWHU+ROO LQJZRUWK$%LRJUDSK\ /LQFROQ8QLYHUVLW\RI1HEUDVND 3UHVVUHSULQW%ROWRQ$QNHU3XEOLVKLQJ&RPSDQ\ +ROOLQJZRUWK/HWD63V\FKRORJLFDO&OLQLFVLQWKH8QLWHG6WDWHV 7HDFKHUV&ROOHJH5HFRUG QRf +ROOLQJZRUWK/HWD6 6SHFLDO7DOHQWVDQG'HIHFWV 1HZ
PAGE 74

+ROOLQJZRUWK/HWD6+RZ6KRXOG*LIWHG&KLOGUHQ%H(GXFDWHG" %DOWLPRUH%XOOHWLQRI (GXFDWLRQ f +ROOLQJZRUWK/HWD6:KR,VWKH*LIWHG3XSLO" $QQXDO6FKRROPH QV:HHN3URFHHGLQJV f +ROOLQJZRUWK/HWD63V\FKRORJLFDO6HUYLFHIRU3XEOLF6FKRROV 7HDFKHUV&ROOHJH5HFRUG QRf +ROOLQJZRUWK/HWD66HOHFWHG5HIHUHQFHVIURPWKH/LWHUDWXUHRQ([FHSWLRQDO&KLOGUHQ 7KH (OHPH QWDU\6FKRRO-RXUQDO QRf +ROOLQJZRUWK/HWD66HOHFWHG5HIHUHQFHVIURPWKH/LWHUDWXUHRQ([FHSWLRQDO&KLOGUHQ 7KH (OHPHQWDU\6FKRRO-RXUQDO QRf +ROOLQJZRUWK/HWD67KH)RXQGLQJRI3XEOLF6FKRRO6SH\ HU6FKRRO 7HDFKHUV&ROOHJH 5HFRUG QRf +ROOLQJZRUWK/HWD67KH7HUPDQ&ODVVHVDW3XEOLF6FKRRO -RXUQDORI(GXFDWLRQDO 6RFLRORJ\ QRf +ROOLQJZRUWK/HWD6%ULJKW6WXGHQWV7DNH&DUHRI7KHPVHOYHV 7KH1 RUWK$PHULFDQ5HYLHZ QRf +ROOLQJZRUWK/HWD67KH,PSRUWDQFHRI6WXG\LQJ0HQWDO'HYLDWHV -RXUQDORI&RQVXOWLQJ 3V\FKRORJ\ QRf +ROOLQJZRUWK/HWD6$Q(QULFKPHQW&XUULFXOXPIRU5DSLG/HDUQHUVDW3XEOLF6FKRR O 6SH\HU6FKRRO 7HDFKHUV&ROOHJH5HFRUG f +ROOLQJZRUWK/HWD63UREOHPVRI5HODWLRQVKLSEHWZHHQ(OHPHQWDU\DQG6HFRQGDU\6FKRROVLQ WKH&DVHRI+LJKO\,QWHOOLJHQW3XSLOV -RXUQDORI(GXFDWLRQDO6RFLRORJ\ QRf +ROOLQJZRUWK/HWD6:KDW:H.QRZ$ERXWWKH(DUO\6HOHFWLRQDQG7UDLQLQJRI/HDGHUV 7HDFKHUV&ROOHJH5HFRUG QRf +ROOLQJZRUWK/HWD6,QWHOOLJHQFHDVDQ(OHPHQWLQ3HUVRQDOLW\
PAGE 75

.HDUQH\.DWKHU\Q/HWD+ROOLQJZRUWKV8QILQLVKHG/HJDF\&KLOGUHQ$ERYH,4 5RHSHU 5HYLHZ QRf .HUU%DUEDUD/HWD+ROOLQJZRUWKV/HJDF\WR&RXQVHOLQJDQG*XLGDQFH 5 RHSHU5HYLHZ QRf .OHLQ$QQ*)LWWLQJWKH6FKRROWRWKH&KLOG7KH0LVVLRQRI/HWD6WHWWHU+ROOLQJZRUWK )RXQGHURI*LIWHG 5RHSHU5HYLHZ QRf .OHLQ$QQ* $)RUJRWWHQ9RLFH$%LRJUDSK\RI/HWD6WHWWHU +ROOLQJZRUWK 6FRWWVGDOH*UHDW 3RWHQWLDO3UHVV .RQVWDQWRSRXORV600RGLDQG/9+HGJHV:KR$UH$PHULFDV*LIWHG" $PHULFDQ -RXUQDORI(GXFDWLRQ QRf /HH$6FRWW7KH6HOHFWLRQRI%ULJKW&KLOGUHQIRU6SHFLDO&ODVVH V 7KH(OHPHQWDU\6FKRRO -RXUQDO f /RUJH,UYLQJDQG/+ROOLQJZRUWK$GXOW6WDWXVRI+LJKO\,QWHOOLJHQW&KLOGUHQ -RXUQDORI *HQHWLF 3V\FKRORJ\ f /RZLH5REHUWDQG/+ROOLQJZRUWK6FLHQFHDQG)HPLQLVP 7KH6FLHQWLILF 0RQWKO\ QR f 0DUJROLQ/HVOLH*RRGQHVV3HUVRQLILHG7KH(PHUJHQFHRI*LIWHG&KLOGUHQ 6RFLDO3UREOHPV QRf 0HFNVWURWK(OL]DEHWK3DUHQWV5ROHLQ(QFRXUDJLQJ+LJKO\*LIWHG&KLOGUHQ 5RHSHU5HYLHZ QR f 0LOOHU5KRGD/HWD6WHWWHU+ROOLQJZRUWK3LRQHHU:RPDQRI3V\FKRORJ\ 5RHSHU5HYLHZ QRf 0RQWDJXH+HOHQDQG/+ROOLQJZRUWK7KH&RPSDUDWLYH9DULDELOLW\RIWKH6H[HVDW%LUWK 7KH $PHULFDQ-RXUQDORI6RFLRORJ\ QRf 0RUULV-HURPH($IULFDQ$PHULFDQ6WXGHQWVDQG*LIWHG(GXFDWLRQ 5RHSHU5HYLHZ QR f 1HOVRQ$PDOLH5HYLHZRI 7KH3V\FKRORJ\RIWKH$GROHVFHQW(GXFDWLRQDO5HVHDUFK%XOOHWLQ QRf 1HZODQG 7(UQHVW7KH0HQWDOO\*LIWHG 5HYLHZRI(GXFDWLRQDO5HVHDUFK QRf 3HWHUV&DUROH/HWD6WHWWHU+ROOLQJZRUWK:RPHQDQG*LIWHGQHVV *LIWHG(GXFDWLRQ ,QWHUQDWLRQDO QRf 3LHFKRZVNL0LFKDHO7KH+HDWRI/HWD 6+ROOLQJZRUWK 5RHSHU5HYLHZ QRf

PAGE 76

3RIIHQEHUJHU$7/HWD6WHWWHU+ROOLQJZRUWK 7KH$PHULFDQ-RXUQDORI 3V\FKRORJ\ QRf 5RZHWRQ:LOOLDP/HWD6WHWWHU+ROOLQJZRUWK$3HUVRQDO3URILOHRI1HEUDV NDV3LRQHHULQJ 3V\FKRORJLVW 5RHSHU5HYLHZ QRf 5\OH*LOEHUW&DQ9LUWXH%H7DXJKW",Q (GXFDWLRQDQGWKH'HYHORSPHQWRI5HDVRQ HGLWHGE\ 5)'HDUGHQ3++LUVWDQG563HWHUV /RQGRQ5RXWOHGJHDQG.HJDQ3DXO /WG 6FKODSS0D[DQG/+ROOLQJZRUWK$Q(FRQRPLFDQG6RFLDO6WXG\RI)HHEOH 0LQGHG :RPHQ 0HGLFDO5HFRUG f 6HOGHQ6WHYHQ ,QKHULWLQJ6KDPH7KH6WRU\RI(XJHQLFVDQG5DFLVPLQ$PHULFD 1HZ
PAGE 77

7RPOLQVRQ6WHSKHQ(GZDUG/HH7KRUQGLNHDQG-RKQ'HZH\RQWKH6FLHQFHRI(GXFDWLRQ 2[IRUG5HYLHZRI(GXFDWLRQ QRf 7\DFN'DYLG% 7KH2QH%HVW6\VWHP$+LVWRU\RI$PHULFDQ8UEDQ(GXFDWLRQ &DPEULGJH +DUYDUG8QLYHUVLW\3UHVV 9LDOOH:LOPD7HUPDQDO6FLHQFH"7KH:RUNRI/HZLV7HUPDQ5HYLVLWHG 5RHSHU5HYLHZ QRf :KLWH:LOODUG,QWHUYLHZVZLWK&KLOG ,&KLOG-DQG&KLOG/ 5RHSHU5HYLHZ QRf :KLWH:DQG-5HQ]XOOL$)RUW\
PAGE 78

%,2*5$3+,&$/6.(7&+ &ROOHHQ%XWFKHUUHFHLYHGD0DVWHURI$UWVLQ(GXFDWLRQLQVRFLDOIRXQGDWLRQVRIHGXFDWLRQ IURPWKH8QLYHUVLW\RI)ORULGDLQ*DLQHVYLOOH)ORULGD6KHDOVRUHF HLYHGD%DFKHORURI6FLHQFH LQSV\FKRORJ\ZLWKDPLQRULQJHQHUDOHGXFDWLRQIURPWKH8QLYHUVLW\RI)ORULGD*DLQHVYLOOH )ORULGD6KHZRUNHGDVDJUDGXDWHDVVLVWDQWLQERWKWKH$FDGHPLF7HFKQRORJ\GHSDUWPHQWDQG WKH:LOOLDPDQG*UDFH&HQWHUIRU:ULWWHQ DQG2UDO&RPPXQLFDWLRQ6KHVHUYHGDVDQDWKOHWLF WXWRULQWKHIRUPHUDQGDVDQLQVWUXFWRULQWKHODWWHUWHDFKLQJ,QWURGXFWLRQWR3XEOLF6SHDNLQJ