<%BANNER%>

Evolution of Cyclooxygenase in the Chordates

Permanent Link: http://ufdc.ufl.edu/UFE0022189/00001

Material Information

Title: Evolution of Cyclooxygenase in the Chordates
Physical Description: 1 online resource (131 p.)
Language: english
Publisher: University of Florida
Place of Publication: Gainesville, Fla.
Publication Date: 2008

Subjects

Subjects / Keywords: cephalochordate, cyclooxygenase, gill, hagfish, lamprey, osmoregulation, phylogenetics, physiology, teleost, urochordate
Zoology -- Dissertations, Academic -- UF
Genre: Zoology thesis, M.S.
bibliography   ( marcgt )
theses   ( marcgt )
government publication (state, provincial, terriorial, dependent)   ( marcgt )
born-digital   ( sobekcm )
Electronic Thesis or Dissertation

Notes

Abstract: Cyclooxygenase (COX) is the enzyme found in animals responsible for converting arachidonic acid into prostaglandins. These prostaglandins can then perform multiple functions including regulation of inflammation responses, changes in vascular tone, and ion transport/osmoregulation. Before this thesis, only two main forms of cyclooxygenase (COX-1 and COX-2) and one ancestral form (Ciona COX) were known from the chordates. I sequenced COX genes from several hitherto uninvestigated chordates in order to determine a more comprehensive scenario for the evolutionary history of cyclooxygenase in the chordates. After designing primers, partial COX sequences were obtained from the Sea Lamprey (Petromyzon marinus) and amphioxus (Branchiostoma lancelolatum). Complete COX sequences were obtained from the Atlantic Hagfish (Myxine glutinosa), euryhaline killifish (Fundulus heteroclitus), and longhorn sculpin (Myoxocephalus octodecemspinosus). These novel sequences along with other known COX sequences were then subjected to a variety of phylogenetic analyses using standard techniques. The results of these analyses suggest a complex history for the evolution of cyclooxygenase in the chordates. There appears to have been at least 3 evolutionary independent origins of COX in the chordates. The forms from the sea squirt (Ciona intestinalis) (COXa and COXb) represent the most ancestral forms, the forms from amphioxus represent another independent origin (COXc and COXd), and the vertebrate forms (COX-1 and COX-2) represent yet another origin, with the hagfish and lamprey as likely basal members. Furthermore, the teleosts appear to have duplicate COX-1 (COX-1a and COX-1b) or COX-2 (COX-2a and COX-2b) forms. These results agree with previous studies and reveal novel information about COX forms in the chordates. More intense sampling of other chordates could reveal other novel origins of COX or contribute to a more robust understanding of COX evolution. Finally, the function of most non-mammalian COX forms remains to be investigated.
General Note: In the series University of Florida Digital Collections.
General Note: Includes vita.
Bibliography: Includes bibliographical references.
Source of Description: Description based on online resource; title from PDF title page.
Source of Description: This bibliographic record is available under the Creative Commons CC0 public domain dedication. The University of Florida Libraries, as creator of this bibliographic record, has waived all rights to it worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.
Thesis: Thesis (M.S.)--University of Florida, 2008.
Local: Adviser: Evans, David H.

Record Information

Source Institution: UFRGP
Rights Management: Applicable rights reserved.
Classification: lcc - LD1780 2008
System ID: UFE0022189:00001

Permanent Link: http://ufdc.ufl.edu/UFE0022189/00001

Material Information

Title: Evolution of Cyclooxygenase in the Chordates
Physical Description: 1 online resource (131 p.)
Language: english
Publisher: University of Florida
Place of Publication: Gainesville, Fla.
Publication Date: 2008

Subjects

Subjects / Keywords: cephalochordate, cyclooxygenase, gill, hagfish, lamprey, osmoregulation, phylogenetics, physiology, teleost, urochordate
Zoology -- Dissertations, Academic -- UF
Genre: Zoology thesis, M.S.
bibliography   ( marcgt )
theses   ( marcgt )
government publication (state, provincial, terriorial, dependent)   ( marcgt )
born-digital   ( sobekcm )
Electronic Thesis or Dissertation

Notes

Abstract: Cyclooxygenase (COX) is the enzyme found in animals responsible for converting arachidonic acid into prostaglandins. These prostaglandins can then perform multiple functions including regulation of inflammation responses, changes in vascular tone, and ion transport/osmoregulation. Before this thesis, only two main forms of cyclooxygenase (COX-1 and COX-2) and one ancestral form (Ciona COX) were known from the chordates. I sequenced COX genes from several hitherto uninvestigated chordates in order to determine a more comprehensive scenario for the evolutionary history of cyclooxygenase in the chordates. After designing primers, partial COX sequences were obtained from the Sea Lamprey (Petromyzon marinus) and amphioxus (Branchiostoma lancelolatum). Complete COX sequences were obtained from the Atlantic Hagfish (Myxine glutinosa), euryhaline killifish (Fundulus heteroclitus), and longhorn sculpin (Myoxocephalus octodecemspinosus). These novel sequences along with other known COX sequences were then subjected to a variety of phylogenetic analyses using standard techniques. The results of these analyses suggest a complex history for the evolution of cyclooxygenase in the chordates. There appears to have been at least 3 evolutionary independent origins of COX in the chordates. The forms from the sea squirt (Ciona intestinalis) (COXa and COXb) represent the most ancestral forms, the forms from amphioxus represent another independent origin (COXc and COXd), and the vertebrate forms (COX-1 and COX-2) represent yet another origin, with the hagfish and lamprey as likely basal members. Furthermore, the teleosts appear to have duplicate COX-1 (COX-1a and COX-1b) or COX-2 (COX-2a and COX-2b) forms. These results agree with previous studies and reveal novel information about COX forms in the chordates. More intense sampling of other chordates could reveal other novel origins of COX or contribute to a more robust understanding of COX evolution. Finally, the function of most non-mammalian COX forms remains to be investigated.
General Note: In the series University of Florida Digital Collections.
General Note: Includes vita.
Bibliography: Includes bibliographical references.
Source of Description: Description based on online resource; title from PDF title page.
Source of Description: This bibliographic record is available under the Creative Commons CC0 public domain dedication. The University of Florida Libraries, as creator of this bibliographic record, has waived all rights to it worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.
Thesis: Thesis (M.S.)--University of Florida, 2008.
Local: Adviser: Evans, David H.

Record Information

Source Institution: UFRGP
Rights Management: Applicable rights reserved.
Classification: lcc - LD1780 2008
System ID: UFE0022189:00001


This item has the following downloads:


Full Text
xml version 1.0 encoding UTF-8
REPORT xmlns http:www.fcla.edudlsmddaitss xmlns:xsi http:www.w3.org2001XMLSchema-instance xsi:schemaLocation http:www.fcla.edudlsmddaitssdaitssReport.xsd
INGEST IEID E20101106_AAAAFI INGEST_TIME 2010-11-06T22:04:08Z PACKAGE UFE0022189_00001
AGREEMENT_INFO ACCOUNT UF PROJECT UFDC
FILES
FILE SIZE 35461 DFID F20101106_AABLNB ORIGIN DEPOSITOR PATH havird_j_Page_126.QC.jpg GLOBAL false PRESERVATION BIT MESSAGE_DIGEST ALGORITHM MD5
1ed1a1a22a12a4691dc37f6063aec20b
SHA-1
2771d1a75af1b2f26ea306466cd8b656a808d5fc
29542 F20101106_AABLMM havird_j_Page_114.QC.jpg
31a2cac95108c341bcfd62e6564872f9
7c7419f99012d50cffa7bdcc1959fdcdb5a289fb
4917 F20101106_AABLLY havird_j_Page_103thm.jpg
de5703f74c7f17c2c88cca4bc262d74b
1235908da52dd20c928d77da29efbfe549c45393
25271604 F20101106_AABKJK havird_j_Page_127.tif
754d864bfed8991f49345b3d5b366e13
1b03968608d9a81d3447584ae6ddf5578899cff5
F20101106_AABKIW havird_j_Page_049.tif
832875e7169d6d8d3ee7b7a9a5e5c72c
19784e6b548b335c9f95bdf50f724b203b4736d2
36529 F20101106_AABLNC havird_j_Page_127.QC.jpg
cce904d2dababd44e5c8b9165cb679d5
0648cdd79b4972dc310067b67bc4b483430d63c2
8437 F20101106_AABLMN havird_j_Page_114thm.jpg
ee051a431e23231f771f24d815cfe881
9b8dc380814865c6c088e699dabe69ce0d2dbb16
4882 F20101106_AABLLZ havird_j_Page_104thm.jpg
eba263a96113e1c56512f913545cdb8a
43c3290b8fb8364934bc7d0dfe2447a2cf5a4e71
36863 F20101106_AABKJL havird_j_Page_107.QC.jpg
b6e1b72bef56e9db3aae623bcbd1ee65
ed74a39090b4f6cfce6922e2c809ebb36437ac6c
37885 F20101106_AABKIX havird_j_Page_021.QC.jpg
6856c46bc0a3cd0da726ba964c7a606a
5fa3514c3680ac3c514cbca9a33c68229ff1c98b
408234 F20101106_AABKKA havird_j_Page_094.jp2
ae5ec67d4f617f2e99f6cf4537affd22
c7a88250867e841096e2a05d0ba9346060fc480c
9287 F20101106_AABLND havird_j_Page_127thm.jpg
e23560f0dc0f4f3283e86915448f77b6
9e90f812b5bdbc74d2cf35b6e15c84f00fd64765
27976 F20101106_AABLMO havird_j_Page_115.QC.jpg
115c29f529ac2b594c3e61c2c0dc57d5
9d07c1b8bf095811d4b24ac9a97d8b92d257a8bc
104037 F20101106_AABKJM havird_j_Page_027.jpg
d480d786a4053bc72f1d0b9260b87c2f
66f9c61f295403becd4dc23ffd7b106f9f01eac4
7711 F20101106_AABKIY havird_j_Page_115thm.jpg
02c34f4b5d4d255a0f86bbb58447fcf8
0557ea0a361d2fd3046534c14021db475009a48b
50806 F20101106_AABKKB havird_j_Page_077.jpg
237cb0b0408ee45225e403c7011f3514
28749f7560aa23f227b54e90b4315628c1fd4991
36157 F20101106_AABLNE havird_j_Page_128.QC.jpg
a485683b7eedb2bbe4ae29d94824fd14
5634ae22b10e2d9feace279a2d07ae8086272ebf
36584 F20101106_AABLMP havird_j_Page_117.QC.jpg
656187a447d142634189662e0c6cb871
9d5fc52fe0a48f3ef0352fb877cebf37c1dc1257
375600 F20101106_AABKJN havird_j_Page_067.jp2
68a8370a0af0b37694d3ddfa24362b54
8a7ef3a14f2dadab8c92c898bc3112d48545a9d9
44642 F20101106_AABKIZ havird_j_Page_091.jpg
121c17d5a103d3e4780d19206820e254
6e25171108aa9ff0dc1dcfffe5747abab9047ce9
1051960 F20101106_AABKKC havird_j_Page_045.jp2
42070d92b0d522183044bf659c800e35
a019f90f5573042b0222e60be711c82f60b82b98
9357 F20101106_AABLNF havird_j_Page_128thm.jpg
60e9219e6383fe520be04145ab1a30d5
d23dab5cc49d891399a5dd7163923fea8332fd86
9296 F20101106_AABLMQ havird_j_Page_117thm.jpg
a835aa019391ac755255a791a8b4da6c
114e4c4e054f4de7102b93aa3bd285aec3b903aa
111380 F20101106_AABKJO havird_j_Page_046.jpg
cc93fe687c3ca897650ff8080aab505a
235553c41a2e8747267153510077a29af67bbdd8
1051976 F20101106_AABKKD havird_j_Page_013.jp2
099a1c6ff7410c963b7d8e5646365722
5b69040f60c1d31e9235206461a7c278b89578a7
22400 F20101106_AABLNG havird_j_Page_129.QC.jpg
5e3dde1c5b48fd98633b629e81e615ce
6371078a8bbefc603d62c95b99b7d8d0e9f8b0de
37347 F20101106_AABLMR havird_j_Page_118.QC.jpg
2e2be30e1f91e856da40284c6119dbd7
b8590255b8d537a67911421351d7b10499fbb2c1
53042 F20101106_AABKJP havird_j_Page_049.pro
9e96f899548b21da6499e399c2e24a76
6b417c67b22ad4a69adedbb5cb346dec82a3ffad
17838 F20101106_AABKKE havird_j_Page_012.pro
92312be37c4ed8a88c9b050c40fbf4b7
bc2f71608ed577981f4ca3d2b734e424669abacd
33555 F20101106_AABLNH havird_j_Page_130.QC.jpg
41e44304f71f4a4b6a98419fbb42df8c
41a68da555d5e91e1039079b18e55fd3f2eb3a4b
34261 F20101106_AABLMS havird_j_Page_119.QC.jpg
b6d230742ca336eed4b2d32777ce60c0
12333fc7d49760963454a161a4264313fa255b21
106630 F20101106_AABKJQ havird_j_Page_069.jpg
31ae814e298cb19b04b9765bddfe8ffb
fc9b5ef6854f31e1da13c8696c0405837324e11c
F20101106_AABKKF havird_j_Page_091.tif
990937156efbfef3330265761b718f0e
37b4ee523640c9635755592e3599fefdde670790
8457 F20101106_AABLNI havird_j_Page_130thm.jpg
2d4cf0337f2701742bdaa613874c39c5
209955db233b6c44fff89a9d3505208b6cd77ffb
8746 F20101106_AABLMT havird_j_Page_119thm.jpg
2705aa42e76f69d3d897be4fb6fd3ed3
6b8ed52c205df4dd1c3e5023487645e8e855373b
27579 F20101106_AABKJR havird_j_Page_008.pro
8d6ae6b0e26a28a8102070890feba04e
b53b13cdc424653b4a665991686c6478685c166e
8880 F20101106_AABKKG havird_j_Page_024thm.jpg
c54e69b6c17aac30df616f02a81ea802
67a12b4abddb335e9d7bfec553aa45f94c94057f
3331 F20101106_AABLNJ havird_j_Page_131.QC.jpg
b457aa33b6e2c8ed9c0acdde9176becc
69acaee9bde0783179f8af408fdb3cf4a70de4bb
36269 F20101106_AABLMU havird_j_Page_121.QC.jpg
f33a6fe4c45d785b70be6dd849b4144a
cfb28111e24e879555e95b123431ffc7f21c965b
39254 F20101106_AABKJS havird_j_Page_086.jpg
2a6f9880586df474900f996224640115
bc1f11d40b11cc88da711528d500b12a98207cf7
1051977 F20101106_AABKKH havird_j_Page_058.jp2
e5b8462b0485e99c32abcc9b9cd3930c
9317d57b3a30ef9d864114e54c73ef7f22880a95
968 F20101106_AABLNK havird_j_Page_131thm.jpg
208e75aaca12b1249e30e1b6d7f64116
c74726cf27bcc0741fec8740a847ef74fcb7b7bb
36724 F20101106_AABLMV havird_j_Page_122.QC.jpg
3083593ed222c5ec05c58f8c574ee6a8
52a1d35c67cd46b4a0f4175052c090d0536774a7
F20101106_AABKJT havird_j_Page_063.tif
63abdb789538b5145d591c84ac1e519f
89a1788931e96cf386fa74909cc568e697fae363
52648 F20101106_AABKKI havird_j_Page_053.pro
4d24ece0481d9c16709348d9320adac3
6db4855bf99c2372efbb7a843b8d416eaa716174
151734 F20101106_AABLNL UFE0022189_00001.mets FULL
ddc31afa301954e7e7b9bd163f547d7d
f60c68d540bc711aaa6a96f2754ae2d6911279cb
9278 F20101106_AABLMW havird_j_Page_122thm.jpg
5f80c6d47b2a9e5a7490bc519483cf4a
ecad98d232bf88b526abcf45f2901859365748dc
112210 F20101106_AABKJU havird_j_Page_108.jpg
0aedf6daeef283564444a62e79a0027f
4b999f9e551e2f696e42e699287977c445155e67
73924 F20101106_AABKKJ havird_j_Page_082.pro
cb83002be74b0a5ef63668e29842f4d4
7a00f6b10bf127382de3fb90ab6d5c484a05cfe7
41196 F20101106_AABLMX havird_j_Page_123.QC.jpg
ebf164fb54faf608d4f388a822a72ea4
f522b58a6568b21925c5ea05b63ac8a1eba91b3d
F20101106_AABKJV havird_j_Page_116.tif
a18326d8caa24e8747b90eb3e5852db3
d2ac83aa10c574b2f41f81a63b1f91cc072cae02
2495 F20101106_AABKKK havird_j_Page_127.txt
5a930d4c4b75897fecb27a6e5bec1870
6a48d77601f989d58b80da50e75750ae0fa9db38
10098 F20101106_AABLMY havird_j_Page_123thm.jpg
840469ced37c8e7b8e7c84b7a2872c55
27aa5766d175fd5d97add0add4529eb3e2d271fc
127924 F20101106_AABKJW havird_j_Page_009.jp2
3ff79212242fddfe7fdf72b0bd35a6d7
51a11d0bf8a0d104bde42e95fa1bface3d5f7f6f
9098 F20101106_AABLMZ havird_j_Page_124thm.jpg
cd2a49be347f67bc3a6933b3aaa1536a
8031b8db6f0dc166ed6de650dfc9fe299a0324cc
54650 F20101106_AABKJX havird_j_Page_040.pro
6aabdd47ae15a15582849b5af14f676a
329b8b0dce014b0f4bdf57cb1544fa11b2aa370b
444491 F20101106_AABKLA havird_j_Page_096.jp2
4dd5d35b45f51105088013cdc5413fee
ccdb7f61ac5e7fb4e2d79c2d6782a6c5f8e8fa47
1051916 F20101106_AABKKL havird_j_Page_005.jp2
0148fa13cb2dedfb04ccb5e17af8b18b
7c75579e1064efe8b5057184ab95700577d92108
2111 F20101106_AABKJY havird_j_Page_046.txt
b49075e0fe129b9f561eca6367c38e8a
2eea5fb52834c4edeb2c91aa89b0b86c5fbc620e
2133 F20101106_AABKLB havird_j_Page_054.txt
45452f834e14d31ca3a92a6f1d7a761b
013addbb56cbb39b6320b71a052e6b891d02e357
1051969 F20101106_AABKKM havird_j_Page_054.jp2
22d6114c1e068ce8a4234ccd537f6a97
f4fcb9974d9f4bae69ae04247840cc9815628982
F20101106_AABKJZ havird_j_Page_024.tif
afa6bb2d1239a41fae59893a3a5963d8
29218d61294928a376d6d57102aec29670eb8d47
12766 F20101106_AABKLC havird_j_Page_038.pro
99564e5c298324e387fcc7eedae1720c
d0f88bfb933ecfd5fd9352a517d51a2339bfeabb
2442 F20101106_AABKKN havird_j_Page_096thm.jpg
a758ca72f9f4e689399859b7f5b2acbe
26e0d30fa2694c28c2d56a8e5dd0af05a514c49a
108355 F20101106_AABKLD havird_j_Page_030.jpg
dd7bff50cfd9802b024c46b5fdca7605
1809a5dc84af0f4c7fd74bc9a0f548ccbc34407d
F20101106_AABKKO havird_j_Page_104.tif
e96d0bda1e5b32f68e3e6b7eaaa40413
a2ad8c9b350aa50e1d9e66be44c36997ada517d1
72277 F20101106_AABKLE havird_j_Page_066.jpg
9b60a9cca36dfa6920a89478ef71ca82
c1a45121f563268800e74c8961f3b951581c1bca
105432 F20101106_AABKKP havird_j_Page_064.jpg
84b4b4d8342aa50f78ebe0bac786a6a7
f97d5bed696a36e5a7298090496df42401159004
39592 F20101106_AABKLF havird_j_Page_073.pro
a5aa29a175df2eaa7bff9ba7a8dfc61a
7b41097d560d977bb0417fd049ab21e503227535
36765 F20101106_AABKKQ havird_j_Page_053.QC.jpg
421dcc94d281087a674352862b9a23f2
6dfef8a587b343c0810121142698b5c5bef22ad4
9865 F20101106_AABKLG havird_j_Page_038.QC.jpg
ef8f1b1779dfa413f6129d517c8b17c1
363207746275fea79d766964562c6ac6cd4c2393
103643 F20101106_AABKKR havird_j_Page_026.jpg
b108b2993f8f155721464bb7c344bc06
440f43e0ad97b9c4da5a1c267d8288e3fac42881
285 F20101106_AABKLH havird_j_Page_101.txt
ff3330e879695387e5ab889a45df5a50
40ac01f69be09e533fade1ebd70cac97b7593fc7
34157 F20101106_AABKKS havird_j_Page_089.pro
ba7e957766aebd441898065263edf54b
67e65a23ae0d125e61e01a5baac77d4e43c9a123
95720 F20101106_AABKLI havird_j_Page_114.jpg
dadfbf6c72495573a876ee4571377e78
46d7d7ba45e5526b9f80a8f57de01d570a99ae3e
795 F20101106_AABKKT havird_j_Page_094.txt
3a92cb3b0515789429eb8a05b8f1d7c6
5e2dfde7d5a904e2978f71fc14ca0de68f844599
9049 F20101106_AABKLJ havird_j_Page_059thm.jpg
3e40641a15247ee37c14f5238fc4549a
e17ed4158c0bf6058d0443b119e0991a9e7737f1
103157 F20101106_AABKKU havird_j_Page_023.jpg
45390762022c68db2500434581a05f8f
9e4485830ffea324cdbbdb718732054440bbc0c4
1800 F20101106_AABKLK havird_j_Page_037.txt
e32df5e0be7960aab951a044fdee2231
1a5f712728c0a7df4876a0b9e942f98cc449a3b1
36489 F20101106_AABKKV havird_j_Page_032.QC.jpg
8ffaa2506d459ea7d9b4bc03a65d229a
16e26f2cbcc0e95c4bf7e432eafb1cead408f910
2383 F20101106_AABKLL havird_j_Page_119.txt
30eca0ed8b2b3449e27413364454d9ad
6e53c69d1533e6972d44191add148036bea1e7d0
5737 F20101106_AABKKW havird_j_Page_075.pro
9e1e21cf6715b1d66a03bf43eb4bf2ee
fb96a698bcc12fc73c62c577701d7a5aba98159f
49983 F20101106_AABKKX havird_j_Page_020.pro
5f3787797587c1798d59511cdf964993
249685aeeb2fd562393d3478f9d2738c22c69272
F20101106_AABKMA havird_j_Page_093.QC.jpg
f4d59040b9a0c185cb3c3edb8276f439
8db3faf5e8830cfc1190787f2e7c15bae5471480
283163 F20101106_AABKLM havird_j_Page_081.jp2
80987eceee8052f71b65889e20bda624
51ab69e42c9af5dd713f4e3dd715905b69b0a103
2000 F20101106_AABKKY havird_j_Page_130.txt
08f439c4ab3b69fc18b8c8449f3725e7
b29fd3a601c7567464650088dce3f3de73949685
4151 F20101106_AABKMB havird_j_Page_066thm.jpg
2a80b2ae90cb489d4cbd17613c3f6524
3f7b7d91e7e57e087be615e71d0c17facee6d8e5
23167 F20101106_AABKLN havird_j_Page_006.QC.jpg
495ceca209440d3053845512c3cddb1a
23694df053b5d60592807bb87d59621840825de4
362977 F20101106_AABKKZ havird_j_Page_116.jp2
d7d9d7d2ab2d743b4fb6d7534ece1487
5e0b9d7b18b5823d4cb2100e51261aafc349f237
48715 F20101106_AABKMC havird_j_Page_099.jpg
7de1a852239f895179f39dc47fdb04be
7bb733b5ba7d4e49b20e472bddaba65cea9b9c7b
986 F20101106_AABKLO havird_j_Page_112.txt
e58321e20069237c7a5f923a051e5ebd
46bf86e90ad0ea6f008f771462ea3527dd292d48
F20101106_AABKMD havird_j_Page_059.tif
cf321bbccd71dcaa2abaa43832e69815
1393ca663539edb785548bf8fae93b56700cefd1
2141 F20101106_AABKLP havird_j_Page_022.txt
7900a26947042691a5f3a2ef8f58a701
0d07ae60e8c80b98fbd12712eebc0960c5386db5
4697 F20101106_AABKME havird_j_Page_035thm.jpg
f7f6e2eb5525cf7fa9aa44f27af5909b
cf6537deaa196d30357973a7047e9b2af63221dd
F20101106_AABKLQ havird_j_Page_072.tif
0793ee6a297c1d60980966669a962aa8
eb648bd7963bb3ede8268870ea4b6358f0f89518
9354 F20101106_AABKMF havird_j_Page_118thm.jpg
c496dbd1e7773bff0a5a78acbb56817f
df10c768bcd5f4869a9ac1c14472369b2b4e0b59
2135 F20101106_AABKLR havird_j_Page_108.txt
8ab4350a0294572abc59dbf46233c50c
80d2950081213153daa227f2ac38b0b7e5b86132
63507 F20101106_AABKMG havird_j_Page_124.pro
0cb2c737dac266965f1b9e1751607540
411a4256b694a0ddcc87c5ec359194e64a302b01
6778 F20101106_AABKLS havird_j_Page_100thm.jpg
f1e49997bdaf79e44d4afab81ae8d0ce
ee066ceae09e3593fa476bfc1709f48007dea54a
F20101106_AABKMH havird_j_Page_066.tif
d6a3ee8f3b48012159e4c9b1cd56ee23
77c0815238c4d8aed34f84c4d4e751b557898941
F20101106_AABKLT havird_j_Page_095.tif
f287297af7494ec4e84d7b3ada7a41bb
32730563d582868c08be3e9a80ba9e942ba147d0
4035 F20101106_AABKMI havird_j_Page_116thm.jpg
a6670b84d3bb50d1bab59ce70867a3c0
847d246a144276ed40fbaa92b01567dbe9b57f48
12137 F20101106_AABKLU havird_j_Page_116.QC.jpg
0a795773b497a3b3019c62ba5af31895
8199444e2f5c2751e76ec30bb13a762cd40823c7
95691 F20101106_AABKMJ havird_j_Page_010.jp2
e7186ed413147d53f0016f8c84760e19
d2ff162dff03b72ae3ab4a0abe6fe14137c28168
14014 F20101106_AABKLV havird_j_Page_077.QC.jpg
22e4f5c5e1d81e75f5fec08c6fc0a355
430d0ed6ed220ae34eeb23548f8799659e248ddc
22084 F20101106_AABKMK havird_j_Page_001.jpg
7be6d8017b3cb05efe571d00f71e583d
2b337e0488c3fecf1d65bdb3f81ff603f9d7ce54
8416 F20101106_AABKLW havird_j_Page_016thm.jpg
223d9062b31682a8d675a5207893783d
c153122bfbd41e8b2b72e12502fe6a2c79f80621
67199 F20101106_AABKML havird_j_Page_063.jpg
7462b6e32d91f1292d6219582280815c
10ce2a5ea22bdf793dd69daf396a599957a28278
111571 F20101106_AABKLX havird_j_Page_021.jpg
cb2d66a061b6defdb9c8c166c6122236
6919c9d183fc4d5db2e2167e9ae25c1827e9740e
F20101106_AABKNA havird_j_Page_046.tif
c7791c5aa4887b18d868e3818ff984a5
aa2607ce4cf318884e71bdc887646de360bd20e3
36887 F20101106_AABKMM havird_j_Page_018.QC.jpg
0cde75705f3a8f306b586711fa4a2041
a47498f00171bcc5009f8fc8128f195e32e8f851
56600 F20101106_AABKLY havird_j_Page_092.jp2
3b931f473a3e0fabc7989abdba6ab2fb
f733830fce82011b556bb69fa05b77b2109f27ef
1051981 F20101106_AABKNB havird_j_Page_026.jp2
70f583a425e498c05ca95392f784a443
adf40ee6f790a397ec879ed2defdf66a27629fae
19793 F20101106_AABKLZ havird_j_Page_096.pro
e3b5da2f0ea26ad3a648c34512f07350
886c7f4da405867b2bf5b81a2569eb08793e8444
405844 F20101106_AABKNC havird_j_Page_008.jp2
05e9e7f8a84f150a15c810e660a5c253
cf5e5940959e3c26e9b652197d71af91f6d53549
1810 F20101106_AABKMN havird_j_Page_048.txt
6d8ba28b70674b675729e7f5da9bf6f3
8e33c9d407ec0d2458249c59dfb838ede24756a6
123857 F20101106_AABKND havird_j_Page_127.jpg
d6131a92f325d84cec1385118c379d84
fb2a05eda4c6352f9e36215d1ce6463ff1d3a701
2523 F20101106_AABKMO havird_j_Page_121.txt
8419fb0b83627f42ca141abf43fabef7
f77975e42bd51b884e19b94d9531efc99601a509
2002 F20101106_AABKNE havird_j_Page_005.txt
c7d6291ec6e2fd6327456f61ec231afe
159ddd42cd2d5222cd52b4e4fe4eb7cce5c342d6
F20101106_AABKMP havird_j_Page_026.tif
564e3941ad3d68b109edb243c50059f6
7353f7ceeb0d4d6ef9039076918219fd2cd3c3e6
38093 F20101106_AABKNF havird_j_Page_057.QC.jpg
83454dffbb2415331e74b903f7ea0621
f6016f3ab81c70eaa939dd9d9381c6009612c564
78558 F20101106_AABKMQ havird_j_Page_036.jpg
e29c390778596c7fe7ce3fdb34808259
b258973f765316a051c9cadca91d7868f4e54713
111985 F20101106_AABKNG havird_j_Page_024.jpg
fdb71623c8dc7e394eda05fe71d3136a
af057b6b3f7e3604dbe821a1830a6604b10d315f
F20101106_AABKMR havird_j_Page_055.tif
5a8b3d47dc8bbd57e79d019bfa9a3799
5f7564fdf30ecadcf99188021508554939ad4739
1053954 F20101106_AABKNH havird_j_Page_036.tif
b06cde66deb5645c036fc36b8a0d4ca2
75f3da73a6c03fce3eab240816b541f9364f78e4
1051978 F20101106_AABKMS havird_j_Page_069.jp2
359eff3027460f30b6f7e9ecc0cc8ce4
5c2ce35b7b5cace00124ccff19cb9814e0dbe3a5
6889 F20101106_AABKNI havird_j_Page_071.QC.jpg
f68989ffa88521ca09a1549c561325b1
b7490ab09131dc9b0600314185b394518fb311b2
109944 F20101106_AABKMT havird_j_Page_044.jpg
0ebf557c13297f5cb076bb46d1ef8a7e
1c78731aec8c6bf6e406fbb6cd45e583f5c6f683
2559 F20101106_AABKNJ havird_j_Page_117.txt
e4f67aa3684da2d1973dc4266d0c3b79
2f1eaa5189ee8704efc56e7cc42e2a5cb1d85fd2
8253 F20101106_AABKMU havird_j_Page_031thm.jpg
54f307c0aae786b31f8dd8b6526dc878
ea262dda2f439da6f9223054a26b65962970b617
F20101106_AABKNK havird_j_Page_011.tif
68842f382e760655ce8de7b74bc20846
b4cef0118b92d53042a8e3cdd0487391015b0fca
12251 F20101106_AABKMV havird_j_Page_099.QC.jpg
29da11af551e75a27d7f540aea647f32
394326962c21d84a681d65e35c27666fab0afd94
28302 F20101106_AABKNL havird_j_Page_066.pro
a8f1a3904054287ec532f267ccf3cf5d
ec6f5473cdf552011d0c8ce437ca24e635e6894c
103031 F20101106_AABKMW havird_j_Page_047.jpg
1e58d37ad7375d6d38889698b6ff9ce4
233383d45dc965ccf9b506c23d7fbf6881747f46
4484 F20101106_AABKOA havird_j_Page_079thm.jpg
ff4db7ec74d57d630112afcfbbcf4c60
76ce02eaaaab200af51a0d6849ad9711846a946f
F20101106_AABKNM havird_j_Page_047.tif
35cddc54e8bd619c977b039f4dd37ebd
d14ce5ad81fdfac9e99d14be9dd393a2f1d4da18
4179 F20101106_AABKMX havird_j_Page_091thm.jpg
d8deee3626eee459451d0f586eb3c860
87f2cfbcff883d7b9b879887f3d59716cc13ec15
7564 F20101106_AABKOB havird_j_Page_011thm.jpg
cc13a08de3b16441ed772f4820551945
3e843e012f3ea55508d7eec8e96fb08cb1033aae
2630 F20101106_AABKNN havird_j_Page_003thm.jpg
0e299f8afad139b2c27430537fd513e6
901cd1526c9a6746848213cc31143699469a15de
709 F20101106_AABKMY havird_j_Page_012.txt
8c992757922a99ec343acdb2fb181985
f104a9098ff3316d691542b2c7166ec38aefbd04
33887 F20101106_AABKOC havird_j_Page_038.jpg
615a187bf5bdcf587837b8255112d2cc
2a134ff47133dfc8e2d5031e6628c07d2249fbd8
122560 F20101106_AABKMZ havird_j_Page_009.jpg
3e894ccc575b7d955bcec108b82b7dd0
10dc3a19bdb1ce6fd04f3b14939f0571e76a6fd8
37112 F20101106_AABKOD havird_j_Page_004.QC.jpg
675d22abb3a71807c943dbbb5b6cfd72
0ea679e2b2e00db7ab4c03d4c9ec96434ff4bdb5
51631 F20101106_AABKNO havird_j_Page_107.pro
98d76dd1364bb09ae8927596ba8291a0
eefe015c59d600d4edf1a0ebc1ad113ed87ccc4a
8114 F20101106_AABKOE havird_j_Page_048thm.jpg
3430960d710779a93cb8eb86156a344e
c1cab04d5dd45ce3d04cd1a8040f82c5d23fe886
2989 F20101106_AABKNP havird_j_Page_072thm.jpg
e714743c159fd3cc1ddaf400c0b7ae7d
ecfac97642bf25ea1b46d7b4ab7c0914f5ad18b5
96579 F20101106_AABKOF havird_j_Page_085.jpg
9fb135cb1afde9cb728f2da23e6a7979
1afbca9cbebe74423dc9a20494ebd6d46d61e0d0
4189 F20101106_AABKNQ havird_j_Page_095thm.jpg
d7e3d814dbc2eb2a91ec1f5ed5f44f18
cfb50ccebf1d3d979946b6680a6b82aa47e093be
1051973 F20101106_AABKOG havird_j_Page_121.jp2
0dc2484b45159e383ffd69dce24aa7ae
6085876e2d6b2eb33c8d422e65f71d737d95653d
9144 F20101106_AABKNR havird_j_Page_126thm.jpg
e96ed952ee181d8cf77a32388d96d896
67a0c4a4a4669266733cb130b99731099c42593e
9260 F20101106_AABKOH havird_j_Page_071.pro
56e4b313433b042d59fc0adca8712b6b
da4e85fa8245a0342095ea8acfa1cd89f68db903
3041 F20101106_AABKNS havird_j_Page_068thm.jpg
c2b5f54c2ff5835ea0f9260ec4b4eebb
5fc594f0f1600a88bda44dcfb7e862a9d8481a3d
20648 F20101106_AABKOI havird_j_Page_113.QC.jpg
08cdf719f7b5a9fcd71c551895f6597a
9bdc40c60e671b9e0552fbfd5016bf5888fab017
27428 F20101106_AABKNT havird_j_Page_064.QC.jpg
075cc11f29a70b87fd7ec3c2829dbe94
47e6469bc03a46115596b0ffe21c79deb4a6777a
56190 F20101106_AABKOJ havird_j_Page_035.jpg
a8557ab727a731a7ce906c4e69865503
794dd3bf9eb7ee880e8fa45beab11b310f815e3a
44553 F20101106_AABKNU havird_j_Page_080.QC.jpg
3d392254ec812b666f1798ffbca79127
23a68642143d3f5a1ca8a28c3b1a15b810755a10
F20101106_AABKOK havird_j_Page_060.tif
ec7fbb84358a6074f414cd4ab60b6a0d
e6804670887f45ec2b2d45e72c0c24ab01a1a840
F20101106_AABKNV havird_j_Page_065.tif
c3063ca3feabc3aaecb5cc38a0d3efaf
23f5401c0868c9d1c3c46e6c955a00f3d93905e5
13205 F20101106_AABKOL havird_j_Page_008.QC.jpg
f4645e5d1616d7dab13658eae91970f5
69e6b8fcf7231c5782195a0b095f0edb6f2d15e9
F20101106_AABKNW havird_j_Page_012.tif
7a3e8b3a4a69fa1f6e05cdb693ac764f
74b1849fa355e8d4bb4ba35800ec772e305507c5
9933 F20101106_AABKOM havird_j_Page_081.pro
1be8ec9d4a967b428354c55fc4333f0f
9edb76f4fd142b011dd2c4170ed5d7cd1a305db5
84267 F20101106_AABKNX havird_j_Page_080.pro
dd0e1fd85c47e8d0f2b20939df2ea762
7b7aa1ead87943e76fbf9ff796ebe67eb3a43cb0
102965 F20101106_AABKPA havird_j_Page_006.jpg
2d8243e5780b6e66307427fdef3fdfb1
442a396cd83d7e9471b79a8573d1aa132bd0fbc6
2062 F20101106_AABKON havird_j_Page_018.txt
10b755b8bd0ff3a8831286698ad81a12
715a8900ba9e64fee2ac63e68586895d23ef2323
5322 F20101106_AABKNY havird_j_Page_102thm.jpg
0dd8141eb5ab7c85259b04e74b0fb376
730f943745aeec940b9c40e7d845e0d120f9d370
85285 F20101106_AABKPB havird_j_Page_007.jpg
e66da5ba2c536f9ea2214b8fd4c7c6ff
996c8ce3592cf5bb96f61af6f4a9899ac64e92c3
63035 F20101106_AABKOO havird_j_Page_128.pro
6bf5485e8ce6d30f8d5277559dae7b85
ac8a75ddd59a4da18c5b8346e188969fec7b33a6
34755 F20101106_AABKNZ havird_j_Page_087.pro
0789812015f3be482896edb00c8d3cde
112a2cb4022bb335110942ad5c102f24db070ff5
40816 F20101106_AABKPC havird_j_Page_008.jpg
b29e51c6d1d123a3e16622cc4de04846
96736e65833d220eca7b08e145f9aa9592d8d22d
94335 F20101106_AABKPD havird_j_Page_010.jpg
bb0ebc03ef459927160b56753fe38291
84eb603e2ccce0241e011ad80383e3fdd465fa69
54807 F20101106_AABKOP havird_j_Page_051.pro
d53828c6d85f96ccb82e83c38ec6ec5d
cdae5d2f3dc4d2ac3c3cd9f9c0a691c9a0288f58
95183 F20101106_AABKPE havird_j_Page_011.jpg
092dd9af7e83d397381dc7d44798a7db
192480f647c71fa889b1206be940a3ba15c6ffc4
33474 F20101106_AABKOQ havird_j_Page_009.QC.jpg
c8681b23eb4d114031263896d34418e1
337a4dd4d59da98822ce6bca3d0a33b0864b9550
102008 F20101106_AABKPF havird_j_Page_013.jpg
ea9eb2f26c32688b319d4536032cf811
02e05519af1a75309c53f0b2cd0c2efef0092733
81232 F20101106_AABKOR havird_j_Page_097.jpg
9645ccfdb98d126035ce54b50bcc68c4
3b758d5151012732a7dc1531726eb918107cc70f
113617 F20101106_AABKPG havird_j_Page_014.jpg
bcbd21e797baf99f500c90b97e8d83a7
6dc125c7a0e19fce641526d2d4adccf6c1764c69
48535 F20101106_AABKOS havird_j_Page_098.jpg
4770f915292bfa485f13e3995ff2e242
650fa24fefc0fb332a6df2ca9fd4506208ac3293
113938 F20101106_AABKPH havird_j_Page_015.jpg
107d86e355b71b24ef5e0c1bf679fac6
e970f8dca10e0b37c970ce3344f470d5f1d59e40
8738 F20101106_AABKOT havird_j_Page_107thm.jpg
dff166f0c1a9b6f3ee353be0ff7bb6bf
b74e7e9a6fcad1aa6256cbaeae79e9e30c1c62c9
108867 F20101106_AABKPI havird_j_Page_017.jpg
78f8569b64f617cd25a368073681a6b7
863f318695cb7992e5ad3292d5f8b29646e74cb7
196410 F20101106_AABKOU UFE0022189_00001.xml
abdc1ea3627e9e53d459b5b9e32b2f0a
8077709f97df861c80e773b14e0ee1d533d4fc50
109218 F20101106_AABKPJ havird_j_Page_018.jpg
1534527d4713c5e31a1b99456404deea
4d06a6f4b064b38affe07a4805d949b3cddd9b44
104520 F20101106_AABKPK havird_j_Page_019.jpg
6ecd12b4ad267d946656eac1c2338ea1
ccecc5a3c642984c909ac8721e12c51d3bb2192d
105332 F20101106_AABKPL havird_j_Page_020.jpg
706c4f0be2b6ad642120fd8ca464f5c7
0a6d2bcdce68173cd2b57e4a0e6cb869bf21136d
42260 F20101106_AABKOX havird_j_Page_003.jpg
a804d91f055ad2d594360055afc9ff6e
23a5bbb317b44ffc84e5688775e55b8ee9448d3f
111432 F20101106_AABKQA havird_j_Page_049.jpg
3ceba72ab8780e4609a242fccd386b60
5beaa6c02d0355bbe42c3be38d04f516dc72a6b4
113521 F20101106_AABKPM havird_j_Page_022.jpg
61383a58fb089e6f36fedd05b12b1aa4
69a9752d43c683a0ae283c659d03dbd972b020ec
111693 F20101106_AABKQB havird_j_Page_050.jpg
d4e09c066623a660550c63e37f0a4c66
4518b085038df01ee882e6b50b4ffafbb8c9ed1c
103061 F20101106_AABKPN havird_j_Page_025.jpg
e938bf5b3813fd8f6ef0e5ae0a584e4e
cd60785e2b2d07f3fbe617acaa1d0765e21533bf
114251 F20101106_AABKOY havird_j_Page_004.jpg
1366d013a030f235f2f88298b0c7e96e
20e308432bf3556b6dda032466b1cc623fd5480b
114853 F20101106_AABKQC havird_j_Page_051.jpg
e072e3cbded0b38a8f29a5524a9399aa
6a0d12a1a65ffd1ef8736452f4c1315be75227f8
117491 F20101106_AABKPO havird_j_Page_028.jpg
e50284256327e1c327650cfea687b4b4
1391859ce2776459eea2d583096e30663c1f761b
104771 F20101106_AABKOZ havird_j_Page_005.jpg
1d472f54276b532f72fcbe1cb2a31c27
5a24a9c17337b2fbfd33fbcd6dc4686eab38c5e6
113972 F20101106_AABKQD havird_j_Page_052.jpg
907508da3070474b5eda456dbac4254f
c90388481e12340edb5c21ca7191dd347bb4c120
110974 F20101106_AABKPP havird_j_Page_029.jpg
e6f4f23c70a26ae3b585cbb3a087c16e
8111deeae1467eb381cf7b7f3de21344c438147c
112903 F20101106_AABKQE havird_j_Page_053.jpg
f675ede30a7709bf0054d44375135ba1
b8f451543b3e04804ff8d89e50e8ce2aa9afe0ba
115978 F20101106_AABKQF havird_j_Page_054.jpg
4550e08ddf5f35a295c6c65551c67701
cf1a75ee34c026425ff4798a1d489bf3d7159619
104094 F20101106_AABKPQ havird_j_Page_031.jpg
2ae74070ccb98152076e95d6db9e6a93
fca2accb9a6a193545d925ada412a4ad3c795f00
115585 F20101106_AABKQG havird_j_Page_055.jpg
994f9a0fe83330fbeb410f9857a7d2ea
11be0fa6f3871cb1a1ab1ea8b54155c05538b5f7
108765 F20101106_AABKPR havird_j_Page_032.jpg
d46a767e79d1848cf47b8ef822b72a1d
afa1132202d3cf3790a2d383524a221948dd08f9
106245 F20101106_AABKQH havird_j_Page_056.jpg
933440f33717845f06a556e1092dd9d7
220a91a70cdb86145fdd4253a28575b117eafed5
112882 F20101106_AABKPS havird_j_Page_033.jpg
bc3c4a2aa9d183e355e8a7bfb9254e28
cea4456ecd2321a7d7ecfcf0cfc841b31f846668
110323 F20101106_AABKQI havird_j_Page_058.jpg
d98ecc436c5a377ef597d19d03ac5a23
ade39eda9f56d59a01157ac5a23e2146979954ec
80631 F20101106_AABKPT havird_j_Page_034.jpg
95533dcf970d578f39c3623566c945a5
bf7abddbe5a6fb47ddc34c0e4affb98cc18be078
113073 F20101106_AABKQJ havird_j_Page_059.jpg
c285846e90530dc099918dc0a43a0e7b
541749c0f991ebecf1a4cf92a962f01b05bd4dc7
63306 F20101106_AABKPU havird_j_Page_037.jpg
f225bf0ee95e190290b4d78c37840a34
003c6bf61ccfc10562e2b4c1f4841b85fb7251e6
108716 F20101106_AABKQK havird_j_Page_060.jpg
a739d33fca96ecefcb277f4abc0ff0fd
9cb54768e144384721a9680d3d9da307027446d7
110822 F20101106_AABKPV havird_j_Page_039.jpg
779e59e7d0bacd45a1e727c0b3320249
49c40f772fceca55c32d71c7d9debb243a14c668
115332 F20101106_AABKQL havird_j_Page_061.jpg
db9c837b6c8587345b9d3e1b957f32bc
44db5299c443c9f551124e42eb981d3b88eb0a92
114365 F20101106_AABKPW havird_j_Page_040.jpg
b72c53db47461a7cdb42224001dbde21
b050c547227b954d9a602a9aa16a0f314fdb9d65
115640 F20101106_AABKQM havird_j_Page_062.jpg
b6a77e07f534a14248babb9b6b821222
20164a2b1f5a2e7d1e4904ae96744548a4acdbaa
108717 F20101106_AABKPX havird_j_Page_041.jpg
4adb4030615b5d27f08c3284cf9fcc15
6fa47b22663051cd5b846f09ee0ce7be120b6db4
51332 F20101106_AABKRA havird_j_Page_084.jpg
f69aeec395bd8b3a715cf8c6a0aff451
4aa7d9f4f0604f0fd0b25a48379791b4fd7fae29
96765 F20101106_AABKQN havird_j_Page_065.jpg
9de3edba7883180e76458e80fa080e02
4e8abddf838465583ecf10425806ec272a1073dd
101900 F20101106_AABKPY havird_j_Page_042.jpg
815ed5a5a6627f1eceab606629ca5a9c
b0bc21d0ab36761c127d42cba40efa0d37183686
68912 F20101106_AABKRB havird_j_Page_087.jpg
4a75d1b0968652af5e6b848e82d2062a
6343aa291596bd08337727afb99fc445d038bf52
38424 F20101106_AABKQO havird_j_Page_067.jpg
6c6df98cde3aafea8cc5a9d7873705c4
d57e48c057682baa5962cd250103382884ee303d
119897 F20101106_AABKPZ havird_j_Page_043.jpg
d7fd94123af0d9cf7bc47a5781c56536
02640cf3a4959046b8e4b561c46565037ee50a6e
39891 F20101106_AABKRC havird_j_Page_088.jpg
e7c717071fbfe7f93dd80bf3ca4aab9e
130b22ad9fa34c132a002c16582a1652107fba82
53284 F20101106_AABKQP havird_j_Page_068.jpg
dcad15e160d101714ab27bf2b70194d3
71ac355e3720a950313712b7cafcbcf097f79c8d
68241 F20101106_AABKRD havird_j_Page_089.jpg
f2014e09561eba6b496b87e437270c60
3d6a42be92e405ecd5a1ebfe71748c8520901ef3
142651 F20101106_AABKQQ havird_j_Page_070.jpg
5959d8aee3ca0770aad78c2c5c4d246d
273a532785b73cf05888b0a947ac30c157a23b27
80506 F20101106_AABKRE havird_j_Page_090.jpg
6320ba0d4c87cc79feec4026e9ed0a39
b2df9ca386c0c00036bd5b79036c60587ef93c2a
55081 F20101106_AABKRF havird_j_Page_092.jpg
e30673c3771e851e6d6019c946c804d8
27e229ef6419f958c8122c5c64be7cc51ef6a768
23351 F20101106_AABKQR havird_j_Page_071.jpg
05434cde3b3074cc92e973911dc5d361
79133bc48d6fe1b7eb7b4bdc8f51058ceb395d33
39631 F20101106_AABKRG havird_j_Page_094.jpg
1795f732692862a205ad50ba5e3c8a07
7afd8e6632fac806b44b512bdefc5fcb4b1acdbc
40471 F20101106_AABKQS havird_j_Page_072.jpg
0b1728d1c23d65f9e7e5cf0d285230a2
3a72b593a1b440e9823263206e48d1a7b7729a2d
47425 F20101106_AABKRH havird_j_Page_095.jpg
af3159714ef9a998e9f7accf3718e160
056b4703d406a72df03464c30aec9fb49154d1fa
189602 F20101106_AABKQT havird_j_Page_074.jpg
067378a083cb8c806aacc42b5a859c63
07b60218d8f532cf25c83f973f3b94c9b3273b02
41970 F20101106_AABKRI havird_j_Page_096.jpg
74219fd24b96060c93fd3c328c306402
10d6ca0a9264d6a1a9e1ab81bfb21ccb3388ffa9
15218 F20101106_AABKQU havird_j_Page_075.jpg
010edaebb04f3020a33858aac2bd31ab
42cf268f6b5246486f0c0fc4e6986a12aa1ffe5d
85127 F20101106_AABKRJ havird_j_Page_100.jpg
02612f5f75eccecb4492fe02505e667f
cbe638435586fd7cf48a830e28a99edc9abafc1a
171455 F20101106_AABKQV havird_j_Page_076.jpg
b802c31c71ed6c77761d022135435560
6759a3c8da72c5dbe1b6931e4458f9a01e01592e
48115 F20101106_AABKRK havird_j_Page_102.jpg
04a80204719bacbe9ef0ab3ca746b289
39e55eb844699ad617c08a4b5e7179519c88b62b
167652 F20101106_AABKQW havird_j_Page_078.jpg
11a7335f9fc2a8f7d98f93912ee9d44d
2104d1ac5adc7809e1c5d3e7e39281d17677cffd
44186 F20101106_AABKRL havird_j_Page_103.jpg
78743109ce51b173d9128f985bbe1504
b9e7c3458041d1e9cf94350a3f4771cb75d3e73a
54788 F20101106_AABKQX havird_j_Page_079.jpg
414736d01abf4044ce928bb4e60e67b2
c3b569fc1735d9098cfbc057b9fdcb726455a64c
122610 F20101106_AABKSA havird_j_Page_121.jpg
1be8212da06f0c001357657c3de414a8
e5f7ca8ca10ec643a6c5a73d8ace6211dfd0f6fa
51768 F20101106_AABKRM havird_j_Page_104.jpg
5387d5f377556552c0d429c7ce4f8934
fb934d8b123a7c9f05b2fbc463c221d0466c8100
179100 F20101106_AABKQY havird_j_Page_080.jpg
ab1c76653c0dd2871df796100437bc86
7c4699d8e6a72abffb176dc263edbddda75fda0f
127510 F20101106_AABKSB havird_j_Page_122.jpg
b6e3de607d1eb41f50ee1ac764c33719
31e1195fa11952449509f38a610a9ae1acec5b20
101221 F20101106_AABKRN havird_j_Page_105.jpg
9a0b06a967f97b444f436b41405fd2fb
785b760f98e91d40535d84b83666f7e6e19464c3
182719 F20101106_AABKQZ havird_j_Page_083.jpg
df159085bfbe1b1b8f68b9bfeea0702f
02d9317c06cedf992944d6f35c12ad710a64271b
140371 F20101106_AABKSC havird_j_Page_123.jpg
29f50b5fcc838ea6fc99658230fd0822
1932bb6a1e0751fb38fdee9da793af9c402ee889
105611 F20101106_AABKRO havird_j_Page_106.jpg
07769ca44272a2ae24a6c95f9d828911
5f842361818215b1a0ea3863152279e317dcb808
128111 F20101106_AABKSD havird_j_Page_124.jpg
5cf2ffee19defe827bb9fd66cdd19cfe
558fbec73365afb0d7512a80d1a18697ec199f95
107696 F20101106_AABKRP havird_j_Page_107.jpg
67a219aa986798b25eac1f61b1c42f74
3964660431b07a0f4392059047ed764b6e4b3fe3
124253 F20101106_AABKSE havird_j_Page_125.jpg
48acd4fa32b50a93319eb60dab599ab3
fdda9d1ea80b0b75e2d66f540dde912408f8b606
112907 F20101106_AABKRQ havird_j_Page_109.jpg
f260cda8e5fcb075ea6027ee4bf230ce
020a78e9bba3a425c724201b26b7bfd728938a33
120722 F20101106_AABKSF havird_j_Page_126.jpg
c73c9a54535adbeb03ac3b1732f08d98
b1a20dfedb075041646de81888b21c9ba78b7e94
107912 F20101106_AABKRR havird_j_Page_110.jpg
4960b5b916761b3efb0c12fd6f6de794
f3db49cb01b62e68a0a5944ec5634d8e111224d3
123419 F20101106_AABKSG havird_j_Page_128.jpg
2e752ad77ecfa5dcfddec88c3c3c5de9
5afad877a138d07cdfbfd8ecb91e3482aec60ed4
75745 F20101106_AABKSH havird_j_Page_129.jpg
fdc3a487dd50209ec0e6183463f7b743
0a22517ee8cd8f242f3a145b34ff80dcfdf0ab5a
117639 F20101106_AABKRS havird_j_Page_111.jpg
3f82521d17c55d5b1e0c7ddd39a23487
5f5d98af5628d77c1081d0c80be49e40e7737ce3
103247 F20101106_AABKSI havird_j_Page_130.jpg
8bb577c42fd86e99ab8fb2e17909c4b9
c80ed135c9926724fb4e82f262eea583025cca2d
53858 F20101106_AABKRT havird_j_Page_112.jpg
241666f848f382c3fdda3b02ba49e565
23ea9848458c5b2998d022a006a89a775a7d9515
214993 F20101106_AABKSJ havird_j_Page_001.jp2
3ac44064b431ac1bab7e0419c7939a41
058a76a114addcbf883e45a8219744e01548bc24
72620 F20101106_AABKRU havird_j_Page_113.jpg
b22175336500800a51a8843a7a6f2f60
d06bc0a0a845474a118a7b389ab6230eb0b7a13b
27857 F20101106_AABKSK havird_j_Page_002.jp2
37ceb2c600b7659e3be7c974861ba647
f55cec79eaf7d838eab021c79b079d4fb1417d29
89951 F20101106_AABKRV havird_j_Page_115.jpg
0890d50e24d857e5f9071ad4b977defe
91598db2c2064e06cb5af41a62f4a6ebf9678d8b
438910 F20101106_AABKSL havird_j_Page_003.jp2
0c0861daddf4021387aae4a173181e52
9bb2c0944d76b0ec98511e7e39887f5f9f2e7aae
36933 F20101106_AABKRW havird_j_Page_116.jpg
803a122cfd15bcbc28e29c563b7c0a11
7411b13575413a6d57e20fa8de08153077ef5139
1051972 F20101106_AABKTA havird_j_Page_030.jp2
1064602956057f375f42af98588b9c41
60ee3033a3d1fe243b334e56926cfc0071dcc214
1051982 F20101106_AABKSM havird_j_Page_004.jp2
7e3afca1840f2af11e34513a8a7b18c7
a138176dde5fa113c974e5705903127c37dcbd2b
124558 F20101106_AABKRX havird_j_Page_117.jpg
44b50ed11106eb125f2d6f27af73d25c
226b7bf06f663d58285beac0240f2686fd590d44
F20101106_AABKTB havird_j_Page_031.jp2
e041be60baf6aafd512a4bb9659f3ff2
273810ef55010b305c98dcb97d9795aad468d36d
1030627 F20101106_AABKSN havird_j_Page_006.jp2
be79cf0473b3c6f6513a34e04e43ec6f
a2c80e9d1777d49ef6ccca9c7dc454bed5558188
132888 F20101106_AABKRY havird_j_Page_118.jpg
9bd34678cf1625f7b75131bb3b53df75
9f8e706015f790a505bcc4e4387fc1c4dfe1cd3b
F20101106_AABKTC havird_j_Page_032.jp2
42be87933cc37ca56854e738e874370a
aaa0556d3d5a85521448e7dcfa1fe8281156dd51
829419 F20101106_AABKSO havird_j_Page_007.jp2
d3fdef15ec3416abf1eabe6b4e30d250
cc61e2395f283fffa235d74a686f908a87a116af
116914 F20101106_AABKRZ havird_j_Page_119.jpg
959b0e2946067671c75c6f7ddd044252
dbfdbc1b8d2ce2c0fed1a500cc5f71c8803ed392
1051952 F20101106_AABKTD havird_j_Page_033.jp2
dd5dc7baec704822b2a3099a73f14cc9
ca36fa7f62dbd4445cde481a0379bb66c9836def
1047201 F20101106_AABKSP havird_j_Page_011.jp2
e192e9b72b05feb060e82d2862066690
72e6545af90ca575ea0e471079c37f0824aa44ba
875520 F20101106_AABKTE havird_j_Page_034.jp2
fd8f8bd2fbec375667bdd5ecdf5fd897
22ed9ffa3e949bf2d1db8fedbd9e3620743eb77a
1051932 F20101106_AABKSQ havird_j_Page_014.jp2
3cbc614c14760077e502fef11c11caec
9adf319ce400485ab98bae25cc6d648bf6289748
80112 F20101106_AABKTF havird_j_Page_036.jp2
2db2f5b22a67b71981ade76fbacb7c04
db9bf3e6613bf1388b9cc3790487b28f08df0147
F20101106_AABKSR havird_j_Page_016.jp2
ee866a7eae19d14a575902813d0e3544
b0ed7000f036c1d8417dc46749a9956af23950a7
1051965 F20101106_AABKTG havird_j_Page_040.jp2
6bc8af169a997590a82014fba07eb91f
1ddd6575613808fac83a721240dffa20262acb09
F20101106_AABKSS havird_j_Page_017.jp2
122c344418003a7979ae681e6b2b54db
f4294d6038f72a40741ccd14273a76e49472c5aa
1051946 F20101106_AABKTH havird_j_Page_041.jp2
d766de5531f59f731bb1f87b04a7bdf3
906b4bf1cf7a875cf93b2c44be07f3a810cfc121
1051970 F20101106_AABKTI havird_j_Page_043.jp2
efb9dacdf2dd3cb8975f9655d68160c6
ad0ee00994411b0f27b793a1e09d087b325e947e
1051940 F20101106_AABKST havird_j_Page_019.jp2
73e5efc2d7c3961e10bc82c37d780c34
619de1306f898131d12720b9301976347c547afa
1051967 F20101106_AABKTJ havird_j_Page_044.jp2
285e9b161f3a0b06ee8e3ce56b7d2e46
040ba53debe10b4639205351a9609e08198d9b49
1051979 F20101106_AABKSU havird_j_Page_020.jp2
b7078895685408554f0d03bff6e1b0b9
c0a87b5cfebb2a0233b1e6aaa64975f2f39d2428
1051901 F20101106_AABKTK havird_j_Page_046.jp2
3bc698272ad320c37d7a075a9c363ccd
44a582f9459e88eb97b2e02b044e3f36f6376b77
1051918 F20101106_AABKSV havird_j_Page_021.jp2
2c3ee0370ee7e84fb0af6649ed150d27
3f4b802f5518d0f5f539ff2f904dac2fd18c5e68
1051980 F20101106_AABKTL havird_j_Page_047.jp2
13e714a0e8d4276686df929215655878
71eb5335a572ebb516b460f770bc267fcfa44fdb
1051963 F20101106_AABKSW havird_j_Page_023.jp2
a2659be0e66877ae2841a597b8712c37
fb5c043c2f8f7bf5c6699fbb59558661273069a3
1047786 F20101106_AABKTM havird_j_Page_048.jp2
1b23335095f708f116c78c3202091e1f
1a0f83477a22f40468381f210be1dfa9041375de
F20101106_AABKSX havird_j_Page_027.jp2
7d549188cabd3b32468dac325d315e33
14df77b883a6baa33ef47345eef0f928c6e1d198
1022854 F20101106_AABKUA havird_j_Page_065.jp2
4bf51b0caf76ac26d674adb775c04ca9
d722b4347b3a53379236fb9314ed98b7f1209a73
1051971 F20101106_AABKTN havird_j_Page_049.jp2
1474930fe913653c0098656f80d1ef69
5ee173558695d7b96462d22d9ad54603a9ba287e
F20101106_AABKSY havird_j_Page_028.jp2
ec9d882d33490455df11e4cb44f06674
2e166c1c063659b1534d776a422568a839343b1c
749840 F20101106_AABKUB havird_j_Page_066.jp2
a85841e2d294f8b486b571ef43835c95
0e167597638a202766ac850fe1631796f25f2200
1051975 F20101106_AABKTO havird_j_Page_050.jp2
34e7ea392640a74024c39bb79a592942
ef9dd0e0ba827c7ed7fb48e28b13a7b043da3a39
1051924 F20101106_AABKSZ havird_j_Page_029.jp2
9e1a04eff8a8d0d060d275157026a8e1
c2cecf5df852858ac3646e21d5e86bf4a98d6786
529472 F20101106_AABKUC havird_j_Page_068.jp2
10ee250dcb5c029ac2ab94deb520ea7d
869218f02a6f697694a7240b3f401bb6afe4dcdb
F20101106_AABKTP havird_j_Page_051.jp2
a483ab83b0f055d448a8a4a2c00acd89
4cab7434f7bb5d901b5b68e98349c364e398623d
1051863 F20101106_AABKUD havird_j_Page_070.jp2
64f438ab1c1afb847121dbfad8fd021c
b8503f8e468cefa27e1c1cee52727699ca71f50e
F20101106_AABKTQ havird_j_Page_052.jp2
fffeff0bb677f2990e8cfb40ddbbec34
c59b9c858b48c95ad3feb20e595e2a2388b8745c
235690 F20101106_AABKUE havird_j_Page_071.jp2
09d17e7d77261403ab889ca4daa7703e
7a8218bdf1f0a0f6284e7229facab16c3db9c981
1051968 F20101106_AABKTR havird_j_Page_053.jp2
f0e71e59a980b29cfad75193783d90fb
1e363e855ab20c5e1ba5cc693c361d7a87e3782f
738701 F20101106_AABKUF havird_j_Page_073.jp2
359017838fcfbddc351b17d6f65a6994
31544024cee3dd45551309133ce7f509c578ab59
1051956 F20101106_AABKTS havird_j_Page_055.jp2
4ad840cc0ced2b1b8b7237065e806bc2
011b12ddc07c4eab5db27d5bade6ebc67b6ea98d
53343 F20101106_AABLAA havird_j_Page_032.pro
3b1b940faecb103bdbc1e1d50dd28bbf
96cdcb10a79b39b6b2d319fef7e64621a10ecda7
1051953 F20101106_AABKUG havird_j_Page_074.jp2
1887adc997357542dca867f9ad935033
aa5553643a7b6324ccdd6eaf7aaa08dd074bcbc7
1051936 F20101106_AABKTT havird_j_Page_056.jp2
7cd78bbc4323918ccf8963ec9ff67ff3
2e21ecadb64ab08464ee25c6710fc0469f296baf
54814 F20101106_AABLAB havird_j_Page_033.pro
d460385a9fcd195f06f3b18d99adb35b
f359bf062f7453669fc0d552a6e8abf6451e89dc
1051985 F20101106_AABKUH havird_j_Page_076.jp2
8815db4ef0ec8362ef7dab07617d6a3f
2f8c1ff9c7a810ee5dde015c7d151d9f61d0b0d2
27247 F20101106_AABLAC havird_j_Page_037.pro
7bf653a1a9885de4d260f65c56f913e4
b057276a47d5f68046b91af420a5857ca5a7d03e
862316 F20101106_AABKUI havird_j_Page_077.jp2
cbf792dfefab1fd076dd90b1bd2a29a5
01a7e2cdc76874a57ae856b5b6820b32d580d970
F20101106_AABKTU havird_j_Page_057.jp2
001b1c085708b38142e92f9122ce2ea1
70d5c547f75a18d7bb4ecdcda54ddbf3e0bdbc72
52977 F20101106_AABLAD havird_j_Page_039.pro
1c48e8f5f5de5126c3f5cb83874cccae
5ced49991e8cdfeb29169613ad9705e4c25047dd
F20101106_AABKUJ havird_j_Page_078.jp2
73c9f0126d74dd61b7dc90363214e2cb
6901c5d23e022b92904094cc542a39bc5402f736
51626 F20101106_AABLAE havird_j_Page_041.pro
d48c2a1493aa7a5f0043d7ca661a3a01
6b86a9b5d3f193b586e226683efcc5bdfdd4a30a
984274 F20101106_AABKUK havird_j_Page_079.jp2
2a17e62a0ae24a348e7e42abbcde7942
5670c28d29e31852aae04e584b83e0309ee68674
F20101106_AABKTV havird_j_Page_059.jp2
a89a1367b19a8b9c3b0b155066f259b0
2a6387d92ac9df89ab74dad033ef674e7dc61d54
49401 F20101106_AABLAF havird_j_Page_042.pro
e810f9c4b8e3aeeb57f6413e79730352
34100dc64e75a2cee4d1a0fc69b193472390b773
F20101106_AABKUL havird_j_Page_082.jp2
459e038f7ee889ba1cea864d3be2b3fb
2dc62a0ea468e84045a094245d37c262f6dc8350
1051983 F20101106_AABKTW havird_j_Page_061.jp2
2a367be925f562a262742a4bd6dfba11
9a211652cd73eda3249315cea45f7cbec7248bbd
56616 F20101106_AABLAG havird_j_Page_043.pro
7326ed84bf596f3f2749ddb97fb02ee5
7cbb12619c6b2ec5470edd1010d77f853f360fba
477844 F20101106_AABKVA havird_j_Page_102.jp2
1a6fa6b60173fa87eca1af4eda4784c2
9c48b30e9af00db6c6443b29987c85e9b352d9eb
1051959 F20101106_AABKUM havird_j_Page_083.jp2
b6dd00a4f38463383d8ff86ca8a24d86
c834259a9a021782c334b1d16a7eb471e5321dd4
F20101106_AABKTX havird_j_Page_062.jp2
614ee9638a856cd04e0f095bc87ac083
09b99986ab35ef1dd127c7242be044572015bd63
51394 F20101106_AABLAH havird_j_Page_044.pro
3dd2371d4c1f2e441ca2ccc748dc56f0
77426af2e990b126cecc487846582c04890d08dd
504028 F20101106_AABKVB havird_j_Page_104.jp2
10f0a98997e1840d886e35a40089f885
89dbd800e2402c9edeffdb27a52d4ed195cb9d2c
925142 F20101106_AABKUN havird_j_Page_084.jp2
cb8c2a12e1f217ce098da1fc32cc7030
aba3c3eaf6c09a3ad42393929753fed04db878c3
720010 F20101106_AABKTY havird_j_Page_063.jp2
e2aade2b00cdcb812c96262b54279371
1ab0af1d551e8ac937e349145c459d0d56a7f6f8
52035 F20101106_AABLAI havird_j_Page_045.pro
9f726e550f88ccbc320c78d5715bea5b
28f98ba8053fde59e296401ef2087de22d176165
F20101106_AABKVC havird_j_Page_105.jp2
f0016564e1c408c4d652fbfc5fb6dfe7
ebb249cd7b4d5cf70c6a4c9e3dfac52986b25c25
F20101106_AABKUO havird_j_Page_085.jp2
8d3c334522881ee3678f426d0ef27e78
91313a757239265dc791eeb7b97c495aeb1d3bc2
1029841 F20101106_AABKTZ havird_j_Page_064.jp2
7d7a5cfb29ac6d299df2f563cf2ba06b
b2cdc46dd4558d8de6a197db207785c72e2542ec
53613 F20101106_AABLAJ havird_j_Page_046.pro
69698c15f8ed3b151564e73e045dfda2
72ae2bd4680a2d80d690fb47fec4ca9f852b91ba
1051927 F20101106_AABKVD havird_j_Page_106.jp2
ffe1d45f0f42bd144881121af7f08f8a
5eb727773f4253b29c71fd585ff91ed77abffaa8
358782 F20101106_AABKUP havird_j_Page_086.jp2
65622faec7c759ec8746eda77660a681
ad398ca67c751a8bade0b7df66393285ef3f7c84
48637 F20101106_AABLAK havird_j_Page_047.pro
07ac8afeb2c792746296bf9436648954
280bfeeed81d6b9c18a04cfc0530f4a6ea8aff5b
F20101106_AABKVE havird_j_Page_107.jp2
e6fe92adff6916d1a954c2d76bcfc143
8f1b31dd01563cba3f0d8115a8bf5526bf1ed1fb
746742 F20101106_AABKUQ havird_j_Page_087.jp2
f017ca8aa38036677d8cb8fb5ded8fbb
4d987a9e545ae10d826e90d2a19cdd7fbf284fad
44528 F20101106_AABLAL havird_j_Page_048.pro
16570c4e9c501949217027b375e79184
d34e921943999799e2d741098e757c39b8ca03db
F20101106_AABKVF havird_j_Page_108.jp2
9700e2ecab9690146a7025de077008d6
4043f2f055b362a191069f0046a22441f143f18a
42670 F20101106_AABKUR havird_j_Page_088.jp2
cae9e8591aceb6374fd3fd720b63a676
1d24485f1a094005dfab4b681cf934910e6ac5e8
42630 F20101106_AABLBA havird_j_Page_069.pro
cbc4cc21a0bd13db3f36aa66bbd070ce
8b2c234ac019e260de4a9fc39ffd287618694989
52250 F20101106_AABLAM havird_j_Page_050.pro
433ae3cf47c84ec7515c62b15f44e433
99c8bc9194cbf214e4d79f5c28e0188748c6580b
1051974 F20101106_AABKVG havird_j_Page_109.jp2
5a5e297a073fda5ecb42b49fc9730108
4464cf027c2e16a8bd4ee7ceba848fe7bba9db63
740630 F20101106_AABKUS havird_j_Page_089.jp2
fba05c7209ecfa3f3588ceefa31e6813
996e017af70d7b64a034616115d7cb9f90b32f04
53833 F20101106_AABLAN havird_j_Page_052.pro
a8bf6a397920180d23d18e68095d7562
c792595ef124a898d2f9d206f90ec95b414fdec8
F20101106_AABKVH havird_j_Page_110.jp2
6475ee3723440878b7d4b0f8663458f1
652297c608f06dbe51cb3554d9eac858e50e4781
402542 F20101106_AABKUT havird_j_Page_091.jp2
f055ac3e7f93b1391fe31a12dccd7817
22b3d5e32811b56c4660d742233e9c1dc1ca7f69
65565 F20101106_AABLBB havird_j_Page_070.pro
acb407578fd64d75dda27750e0c002ca
60a6554e18a018b50556217bc8a6b45b4d7f85e1
54426 F20101106_AABLAO havird_j_Page_054.pro
f6a42ac870040dcee0b4299cc2f08897
76040ec766613d83f42eecce1affdd5a38dee8d5
1051955 F20101106_AABKVI havird_j_Page_111.jp2
1003fee3e243ec871d4a2fd4772d23ab
4b2937d2523be618b2d2b1498f53574de8237b32
598943 F20101106_AABKUU havird_j_Page_093.jp2
97dfbdeddae7f38a5f87e861956e0f53
c99964356a548fed83048e91134b3532be5c4ba9
19160 F20101106_AABLBC havird_j_Page_072.pro
7552e03c5f12df1ba70b40160cca27e7
59cc495c5bf98ccc9a29c50d35e52b3731055f40
55541 F20101106_AABLAP havird_j_Page_055.pro
312728479a7486b00bad6daf3e2547bd
b4627b0f812117afac4637c8800055328d691a50
567142 F20101106_AABKVJ havird_j_Page_112.jp2
807163805215f4dc773e6a9190a28cba
fe43ea88557ae5113daa84f2644c16413af512ae
89568 F20101106_AABLBD havird_j_Page_074.pro
cc5528db4a4e5e6ee3018088cf50a9ae
3d6c7d4fb35683750e42bf779b1c65dd481759f4
50826 F20101106_AABLAQ havird_j_Page_056.pro
96b1a1a04f27d446aa79504b9f92bf67
df4f28fbb0d6c292f69fa4dc4a032435bbdc9dae
1051930 F20101106_AABKVK havird_j_Page_114.jp2
8a9112b0c343b97e2fc2560f73682685
fca7e0bd0a0f74bbc32370bfecffd20641106d1e
465814 F20101106_AABKUV havird_j_Page_095.jp2
86c192a889bac4b7ecd4dd688c1aba18
0724ac528c1f65a388f29df87061391938aa5169
21052 F20101106_AABLBE havird_j_Page_077.pro
757cd5423b425da71c53ceb21354196d
dd0ceae963effb0f684cd37e4acecc24595b518a
55822 F20101106_AABLAR havird_j_Page_057.pro
fedbcf62c7c2e19caac6a6cbe9f1ce56
0f4de5b363b5f0401bbff1066939fb889cdba938
1051966 F20101106_AABKVL havird_j_Page_115.jp2
63ba9e572b4e8c04141a316af6cd5999
693666921cfc915429091b0ea1078f0db82c4ff8
845839 F20101106_AABKUW havird_j_Page_097.jp2
8860b21e41a7a2bc527fd959a8c319f4
a9f3acc386374fcf44461ad7170b0eb52ea7789c
80729 F20101106_AABLBF havird_j_Page_078.pro
9ec7756f3882a312ca0f447573e2f1ed
6184e1420a1ae0fe1dbeb5f603938b3d0d8c7206
53996 F20101106_AABLAS havird_j_Page_059.pro
1399af9846ea3fd5c4eb2630aee3bd88
928a9c1e6255767ac9826c5dc8c9795665fc9b54
F20101106_AABKVM havird_j_Page_117.jp2
a3dc391e43e0760cfc07a51e2ba7edb6
74792c640a3a96b33b0cc0cbf70483c2485f4e6f
515080 F20101106_AABKUX havird_j_Page_099.jp2
b1363412909f60c0bc7e6062f83e03e7
38bf42d661eb8decfb3ca08b01ff97cf2e6bac74
23406 F20101106_AABLBG havird_j_Page_079.pro
0a5d25924d5c3af2fd85be00cfae8f5c
8cdaae7d61269e8ca86efec8b3975ee1de960648
F20101106_AABKWA havird_j_Page_009.tif
bc783befa91eeb1e659d4f8e70093944
a3926c9a27bde15ee14291291bc04afaf4a78709
F20101106_AABKVN havird_j_Page_120.jp2
770841bc1028b95ac810ffa8b39ad5df
98874566455bf6db0c9e66cf05050f9aaa4d39ac
896234 F20101106_AABKUY havird_j_Page_100.jp2
26633fb88a60be827b2bac5ad88018e2
efac315e27bb5a5193c8b957ca68f739aa9aefa9
88083 F20101106_AABLBH havird_j_Page_083.pro
3b56aaf621b4d601dd63628c91457d9f
6c7a936c8a7f6ac4599fc6a4db38a3bee94bf670
F20101106_AABKWB havird_j_Page_013.tif
4d7b48b9abb595739ef1db85c2fe18f7
178bcb199bf9a159bb0e12cc3cfd26abf239c01d
52277 F20101106_AABLAT havird_j_Page_060.pro
7dff6c18440014dcdc2f87ee5d27d769
e2522f4018ed3aed198f4ca9a9ca466c5def9982
1051941 F20101106_AABKVO havird_j_Page_122.jp2
4ddcdc464499b8b8a84ec62273658884
61a0939c86b322a68401204d542dec6c0e4b40fd
458452 F20101106_AABKUZ havird_j_Page_101.jp2
f8dccd299ce1c590a4268bbb8841501f
28d0ac66cb9a0bdf57174303ff14be2f93ac177f
22550 F20101106_AABLBI havird_j_Page_084.pro
5ca499a22d50e5718c8ae198dbfff0b3
ee87357a66f956c4846295f1209c3826e000a6b6
F20101106_AABKWC havird_j_Page_014.tif
f716794e697060d2a94dcea4a5a149d0
189c0de23c76af34c0d7abfb38ea5b8a57760cc9
54439 F20101106_AABLAU havird_j_Page_061.pro
0ee9cd71a8b901a650f8c089cc130774
fb67f2efa52a5c2cf93025aa20b12c0918067840
F20101106_AABKVP havird_j_Page_124.jp2
6ec86d138ebbd357d985f30bc8b6271a
ac550784bd0c58d90f2d32c671169f2e70f59237
45480 F20101106_AABLBJ havird_j_Page_085.pro
27ac45ab83a1cb2592de08f19dcdcc4c
b3cd36e62e413a97d04a7bbb468b467b80dcadd4
F20101106_AABKWD havird_j_Page_015.tif
c738ce44e970d05b2f05177829668bb9
b4420400817c5d1b0c7846e0ffdab32e8719a520
55968 F20101106_AABLAV havird_j_Page_062.pro
ec688c5953ad3cabcf96a43216134b83
f59be03a1a0a7b1e4b23cc704bceafdeba1e615e
F20101106_AABKVQ havird_j_Page_127.jp2
8a3da38bed7aa66c2716e3af67e20f55
c9b1f5ddf3b69c45f86a5a720428fc586fcf8021
28699 F20101106_AABLBK havird_j_Page_088.pro
cea4b94a4e8e1871dda867dadfd35789
40e3d2a67b7eb7d71a70c2a2f4936880bf41c44a
F20101106_AABKWE havird_j_Page_016.tif
595c33b642ca0584c182608ad04e3c20
e280442fd062ae542f6dcd317f11cc0ed858447b
31460 F20101106_AABLAW havird_j_Page_063.pro
066d4567295e381b23f2805d256f54ed
88aa906e52dafb5da62967020cf60873c403dfdd
F20101106_AABKVR havird_j_Page_128.jp2
b96c09e81ddfa5e1b0f001e8a9e33add
dcc2332e99e663156d23d9ed654da422e5b84958
24670 F20101106_AABLCA havird_j_Page_112.pro
ddb9a2ddea99ca7907969fbeb6dd85ff
12cd8a216d7c163aa37b64002ba9b83ab8142cbe
39267 F20101106_AABLBL havird_j_Page_090.pro
15f9d4a59c5f1b5b136976a691035882
8777a50a33da95bda0e55d088eb1f45883619669
F20101106_AABKWF havird_j_Page_017.tif
2bff48773b28880ec383b9f84e066ed6
5ee45ac60c62995b15e31a51a4ef2b60e5ca043b
37690 F20101106_AABLAX havird_j_Page_065.pro
bd36d6db3ac76a81b14df4833be58483
c812c7276667f304f4077325f27552af822b1512
F20101106_AABKVS havird_j_Page_130.jp2
598c255c04fc69dd45fdd5d2979534ab
eddf723ca8c3932f616b2e6f2fb5ed38c59f8efd
20677 F20101106_AABLCB havird_j_Page_113.pro
be01a2ee57eab1f5134fcd7e02de5944
950111f0dfcf4e144ab5a110e9e131edf868760e
26624 F20101106_AABLBM havird_j_Page_092.pro
309281381a665b72df9594127f3cffc1
8c2412f5207df8ef2ff2c4e708704154aa571f35
F20101106_AABKWG havird_j_Page_018.tif
797e13344b8682cac3901c36a8822ee3
925db910a77defc60d8eab01c5bf78064a73cacb
14241 F20101106_AABLAY havird_j_Page_067.pro
f8062a6e057fc4217c86234423840a88
1daf818a309da8830646c5341c08cf2dd3f17a07
73699 F20101106_AABKVT havird_j_Page_131.jp2
2eedff3cdd82f598f1c442592e918db4
731537b0ac9695fed104fc78650b56b0153ac8a7
15055 F20101106_AABLBN havird_j_Page_093.pro
afd7fac41d36a1fa0c5159b941b99651
8e6fe4c17b49e77270f0a86f95237f407419f99e
F20101106_AABKWH havird_j_Page_019.tif
325ad529d5a0b9bf24eebc7ef506f342
fa0cb62d8487fda1485ed0bc8ed800a26ce5a4c9
20460 F20101106_AABLAZ havird_j_Page_068.pro
dee62630a3a32d5fc31378f898a68ab3
d98f84316a16ba16509d9b8f6d92fa3a62b8284c
F20101106_AABKVU havird_j_Page_002.tif
af7c530b53b26a6368cdfadc29ad469d
6c7451d8e1bf3fd798f7a9003187c3e73394d195
29416 F20101106_AABLCC havird_j_Page_114.pro
6ae01c5feda9c3e368297b22a2165de9
2a47edf328a5a20274cdaa3176e9658e9a4c73fc
18347 F20101106_AABLBO havird_j_Page_094.pro
cb51202b6f686bac14ba864bc443901f
681fa855a39abb2d90355191bd0ba8a9c27af8d5
F20101106_AABKWI havird_j_Page_020.tif
df2e87fa999d6526f769140c3e3c26a6
d52b2f6e3e80d7673ace7f2e571b1901ad7735dd
F20101106_AABKVV havird_j_Page_003.tif
c2121175385209d670495fddf917b391
45720486d9d67c0eedd045b46884d9ad69853167
22494 F20101106_AABLCD havird_j_Page_115.pro
c482fe7fae14506b3a53af2c2decd116
3cf571dc64422a83c10db5396c0ed58f040eef3a
5556 F20101106_AABLBP havird_j_Page_095.pro
8c888613928fb038a42d669776bb4aef
3d83e1b0c1c0e859f003bd3b12e08f41775695c6
F20101106_AABKWJ havird_j_Page_021.tif
77fe188ca3e4f6cd7c4bcdbf4b2d5f04
3e436f911e82853a9b57c2acafc2ae7c7a3e1415
11078 F20101106_AABLCE havird_j_Page_116.pro
7bf15086c2d39e3f66aa2ae867369d6b
4b93d628fdfebc5719632706318335d80dcebc7a
26471 F20101106_AABLBQ havird_j_Page_098.pro
36b00de31e678b4ce2cfa2376a122719
b8f94e4f7306730eb7157739b742f6e1e2e22375
F20101106_AABKWK havird_j_Page_022.tif
7ab1ba50b33508a403d9695422f90da6
b70198ed930792652b932ff08a50128128c45d62
F20101106_AABKVW havird_j_Page_004.tif
b7621c0f5cdd62c8881dbc58755ec9c5
fb8f53758a8c7c1a93a8b28b5ec1a0d6595dab45
62407 F20101106_AABLCF havird_j_Page_117.pro
a5a3049741bd674df6ff9837ad2c314a
434a63d52f858d6c99f0434a8d7e00ac846fe81a
23318 F20101106_AABLBR havird_j_Page_099.pro
11e5158513935604c7263829e4ef2935
eae587c79ccb340e3897a5c4f1856c6b1cb013a1
F20101106_AABKWL havird_j_Page_023.tif
1c3a70ee6eca6be9bdcb173c5530fa4b
8a1b45b325833f44979aa25e458e2b60727596b0
F20101106_AABKVX havird_j_Page_005.tif
9d2aeb623b311275f2f1c40d0fffd7e8
14003b4ebcd2030bb17a46e393206a799c5bc539
65279 F20101106_AABLCG havird_j_Page_118.pro
8ccb369f1f92585894ba049eb5034d4c
aa79252494f7d4ea801beac0f8b3f0fdb6173f20
F20101106_AABKXA havird_j_Page_043.tif
df4ce5003b0433c62b88c341783c7b51
4b46962a6105ff95a79508f9dfa346157f01bebd
27498 F20101106_AABLBS havird_j_Page_100.pro
b174afddca2c4222a36110c1e598e3b3
a4af2a57f24fb68cf1f360138ba4533529693e82
F20101106_AABKWM havird_j_Page_025.tif
35f092c7c1417def95db51cbde6411f1
19cce5daae29116a25d6d2d44d690663bef78b4d
F20101106_AABKVY havird_j_Page_006.tif
7bd7bd732091a6708259cf73ed114f53
5875a6fb62e129e6211496d6f29ab7dad1552e62
57651 F20101106_AABLCH havird_j_Page_119.pro
9ca345bf392b4f3d0d2182309275ed5a
0f0ffece0f57f7b40494e8cd7e45d0ab8e411592
F20101106_AABKXB havird_j_Page_044.tif
53c4fa2b3ca9378aa32be93f8e0c8159
c5b053a9d7e29c584746a34269a5b47f72015d44
3802 F20101106_AABLBT havird_j_Page_101.pro
0a3b79908f5f96610c672af97f957dc7
ccdec8f506ca869f5430226c382185e3031af2f9
F20101106_AABKWN havird_j_Page_027.tif
d3a12e7cf76883576b1b2fd524146d0b
8386abdeff16d464eb8fc5fdd21063c065468106
F20101106_AABKVZ havird_j_Page_008.tif
1f1ba9e45cb82251e2331e3a6e0e1800
fe9a1da7526ba6f0818dadc2e5350a32fa01769b
61650 F20101106_AABLCI havird_j_Page_121.pro
b75e9521d4274667bbfdc2d697f35a92
4578cb4ceba4416752ad5848c26d89644cf12e37
F20101106_AABKXC havird_j_Page_045.tif
35ee41b101dc53e1e2daebc5c9eb7834
5f59eeb2ef598fefbc81d44c64da8494f5adef67
22213 F20101106_AABLBU havird_j_Page_103.pro
807508d0c104829358647063736189c1
19bcb32c0d5cb7d2af633bf90a0382e6f79ed8c2
F20101106_AABKWO havird_j_Page_028.tif
0ce62c8b7adc0a5d80450edee3d5f356
114f9b5a64aaab99ef0d464062f6bf20d710d6fa
63021 F20101106_AABLCJ havird_j_Page_122.pro
a86570f5fc0b108dd330ed3486172a2d
b0d9db73f36c88fd0703987e67290f5b0178dc09
F20101106_AABKXD havird_j_Page_048.tif
fd6e173a0ff68e768c4c3e627abb5d60
2c4acead6f36b981cf99e8282e5aa04042e40cc3
25063 F20101106_AABLBV havird_j_Page_104.pro
e99e34d6f7af8c76182910bc001a4a87
ee06ebfbff386a2612db459d5f39a10c052d9482
F20101106_AABKWP havird_j_Page_029.tif
04db0d9c6958d171686b220b2b4ccca9
fc4dff2fd3b6699ede84176668ea17ce1515f35b
68792 F20101106_AABLCK havird_j_Page_123.pro
92274ff1b5d977e3ae7c3e4c1a4891ea
a54fe483ca3a5f10b3a2d7a493eeae98a23547d0
F20101106_AABKXE havird_j_Page_050.tif
894f2def868d22de048af248848024cd
017f465563443895c42ab1f0f79ca8ef0305eb13
47890 F20101106_AABLBW havird_j_Page_105.pro
22c2bd931bac49f766c78157480788a9
583c5219f3a774d3bce9efc049432be3dcf921d2
F20101106_AABKWQ havird_j_Page_030.tif
70d7bf992a02984ca546c3ffd9d5818f
4bbbe0e15038ea90abc5cba6d09a73e9c4b92894
60882 F20101106_AABLCL havird_j_Page_125.pro
f4bdfe2d7ff89744ac973f9d71354851
8fa231991baef91b64324ad2d113ed4ec7a3be40
F20101106_AABKXF havird_j_Page_051.tif
981d72fef37e7a0bb09b05efe3649375
fd33cac1e7bbc650bf8a944ed7cc0a034de1bbf1
54603 F20101106_AABLBX havird_j_Page_108.pro
6cc2ea91ad33f7ae2caa7b188c45f38b
78297c7040cd4b7e668e3f170c118287498ef14c
F20101106_AABKWR havird_j_Page_031.tif
fe693f7f9af84d2d3c7ae4aecde70686
17cef2d6397c1926aaf319a0f16d6209ec9f7d2a
1941 F20101106_AABLDA havird_j_Page_011.txt
6548e16860dd382bfb2e5d6f8010a76d
42994c449d740ecf53b898f96e7f9e6b0b3c62a2
59531 F20101106_AABLCM havird_j_Page_126.pro
ad05404ae35ffbfcd830cb44f53ab447
22c5023d44f5422fc794d71ea1b0c61d38034ef9
F20101106_AABKXG havird_j_Page_052.tif
af01cfb19a6698f658fee2bdb3e42a82
8c5ce2d7fb08acf1ef7afa21f0e8932252932957
54105 F20101106_AABLBY havird_j_Page_109.pro
4c7b768300db9033a037b6a3f166e53d
f892819fffcc58ed0d9cbb6395b22e944f2a7f6f
F20101106_AABKWS havird_j_Page_032.tif
bd412ceab6782a9d1181cefc60174db8
c7d640e42a3ba6db6ebd8351f94e45da6d1789aa
2039 F20101106_AABLDB havird_j_Page_013.txt
f06ea694ad3db48742edd91330525fa4
e7efc35a2d9658d5ec45c22e5ec8f368cbb88eeb
60877 F20101106_AABLCN havird_j_Page_127.pro
4eb1a1774328e01b2a7f665b176c2bad
d68ca75ebc1b63a18d26ea0ef41f6467c17486f3
F20101106_AABKXH havird_j_Page_054.tif
9bfac054a5ca285fb918e828408e0977
607b1209c13a2783e2d5dc35f31c48584d3d220e
57387 F20101106_AABLBZ havird_j_Page_111.pro
ec106be35b066761a9d5ec1925691470
64d9280b58d0b09fa6496d2e49e68614823fbf23
F20101106_AABKWT havird_j_Page_033.tif
58cb9d70b2e2a979c205672cb833b45f
01b174107f97f05c857f33cc102f8310871a6522
F20101106_AABLDC havird_j_Page_014.txt
1647c241980e827a0f1241044563d5b2
def47e62244cf11dabc0e173eafa861ae9e783a4
35840 F20101106_AABLCO havird_j_Page_129.pro
3df5859c2f9f109493a46947ba9108a9
1c1314c0575463b8bb1d991e3001057d02885183
F20101106_AABKXI havird_j_Page_056.tif
2b148ed6a07a7e055a527d48bb5609fe
f235ed4281499ff3d936e4b91747e824efa79f52
F20101106_AABKWU havird_j_Page_034.tif
6163cced57aed298f3d9306e3fe84c62
aab42a431e80c088191b3377a258690aef10e2d5
50042 F20101106_AABLCP havird_j_Page_130.pro
78f5d0349a9ac6b71d5a0b13b523460b
960060329b79beb779b14549ac880590b67c1d6f
F20101106_AABKXJ havird_j_Page_057.tif
81d283754ddb155f797c5896ce0afdcd
d4936a418334cdb97506a77d3a0a8d0574161c7c
F20101106_AABKWV havird_j_Page_035.tif
18f0aa47b05aed1816ced21b157bc930
3d12c2232e77535da53acd35658888543d56f5f5
2160 F20101106_AABLDD havird_j_Page_015.txt
52fe072b7ebca9be7aaf37c0b4aabfb4
be1b4bd9ea9aacab0f01d7d48ae50fb84b7c06a5
3084 F20101106_AABLCQ havird_j_Page_131.pro
67faa222b826e8940d399da41627a1fb
408798f7a37945d16bbfa20038afd658060f220d
F20101106_AABKXK havird_j_Page_058.tif
615b797bc54794d8f74eb2bfa8f09a9a
02146e2898916ded8fe293973c4d4334d85804fa
F20101106_AABKWW havird_j_Page_038.tif
7e144afdf0cbc24c94130ee26fc5861e
cea80b5ca3042869f4cf8d2b0937121b2b9d76ac
1965 F20101106_AABLDE havird_j_Page_016.txt
374833fb1c8eac47a748ce59bfaf809a
647b495391f3cd3519fcad787de9838f4b384356
408 F20101106_AABLCR havird_j_Page_001.txt
dc53397bbdefdace81d619cb9fed582b
1e15054f3184f2c8fd9d2f8c12d74f65674c2844
F20101106_AABKXL havird_j_Page_061.tif
3be3b5f17e366e54b726ec1f64f4a81e
3aa235c990813ca73ebfd5037daa91b1272e4065
2006 F20101106_AABLDF havird_j_Page_020.txt
90ff7a837d1ab40f7bca5248c20f8670
44b6c54b632f2047c2a251531d483ab73a42cc45
F20101106_AABKYA havird_j_Page_082.tif
1892b46a0c2e316c2ec0322e7f8acc40
23e5a5c832b345c65e68f05e5e23520e03e4e371
95 F20101106_AABLCS havird_j_Page_002.txt
847a9149979ea2740678a56d88b7a962
710a8084be424dd9152862e3df768f08404dc9d7
F20101106_AABKXM havird_j_Page_062.tif
e2093610b35ddb1f7e8e24b24fdffbc3
c51cfe572f59cd315ac364b32646e606e84eddb9
F20101106_AABKWX havird_j_Page_039.tif
5a5b3f1973c2c8c995f28cbd1b5784bc
99d60660df9879fe36e38132865870f470705242
2130 F20101106_AABLDG havird_j_Page_021.txt
8cabd7d2c216b4fdfecfaa9a09d268ae
a9cf60a4fbc7602a02ea3d068bb60b89840d3298
F20101106_AABKYB havird_j_Page_085.tif
8484cf87ee9497247a138ed11fa70f90
42fc1f4dca831095870df5e7ef49359bb611120a
875 F20101106_AABLCT havird_j_Page_003.txt
368354c8f60be40d2c19135f1bd7c2c9
c79ac7c1f031b0d5853f5b3b2f75dfc94591db77
F20101106_AABKXN havird_j_Page_064.tif
11e9061de8c04a40b882803af01ef62b
23c9d00742b2006890d25390fe8c342bda70ab82
F20101106_AABKWY havird_j_Page_040.tif
077075eb975bd04e2306f41231584d6c
9e81e37d910d3f64d3a9ea53850e870abd54da1f
1958 F20101106_AABLDH havird_j_Page_023.txt
685927da6dbddefbf4e92b844bf8c311
1dd79304c0c04909539b35a6979f8d070e43b53e
F20101106_AABKYC havird_j_Page_086.tif
677aaf441b3d8e5456c1d53025c69942
0f9de9954e1ed3c866cdff88dd5114c398fb4247
2219 F20101106_AABLCU havird_j_Page_004.txt
42eb8f60f3956bb208ca934d788f85b5
0acb6f46186fffe3e77809fa6bd077bc457e1ebb
F20101106_AABKXO havird_j_Page_067.tif
55f756ab027166a7f361e6630a652264
9f680555a9f51d49262df91d1335688b7f9c0df0
F20101106_AABKWZ havird_j_Page_042.tif
1a6781f8372ee3ec929ecc456bb1c411
989174908273943802c516aa95302fc3d1949762
2153 F20101106_AABLDI havird_j_Page_024.txt
900e8be634c875fa74c2ef4f5c3edaf5
f16675c7c69251bf10a4e34720626bda6e2480c8
F20101106_AABKYD havird_j_Page_087.tif
46eb9658073be55e51085a682551dc56
f832a3381a8581cafdbcec2273604db768cd98d7
4102 F20101106_AABLCV havird_j_Page_006.txt
a3a63b7e34e06cae1c92f3326ac0c17e
c6a1166f762d85d949a383f5618ad8582796493f
F20101106_AABKXP havird_j_Page_068.tif
c3dcb5dc74c2209d6cda4428373d63bd
75d39750adfe5a2aa452144f197094f3a5e4ec06
2035 F20101106_AABLDJ havird_j_Page_027.txt
7756044a1d47f9c91a9d085fef96df91
1ff3281da88c203982744b444eb59262fd4b4e94
F20101106_AABKYE havird_j_Page_092.tif
a1b33690ad29525467f359d192a47c69
cf68ac20f72f116dfc35c64aa1e7ed6e73079706
3409 F20101106_AABLCW havird_j_Page_007.txt
88b10d253e4a9e25f063cdef4547931d
3db9f4e3cbd156cb4372ce4208f73d1963790489
F20101106_AABKXQ havird_j_Page_069.tif
0981b2e54c1ff7cefeb186cc49951878
84f69b7f0798f597b1d833773419c21fbcc16280
2256 F20101106_AABLDK havird_j_Page_028.txt
bdd0f6a020a6cdeab221aa8d959e7605
5bccabbfe1fc70b2e26eb760a7d6db1b61828b15
F20101106_AABKYF havird_j_Page_093.tif
275cf6727d7c574bbfdb50634b9caafe
5040045a4b1eab42404dc647f9be764729e75f35
1129 F20101106_AABLCX havird_j_Page_008.txt
231e4025cffefd3c6a9d48b9f1bc73ce
f602ff4a4e392cfd82e302662926070f7b45ed60
F20101106_AABKXR havird_j_Page_070.tif
42329805673317e15460e09e35cd03e0
ca3b8d663ebab93127111f7694a9aaa4df5d5c5d
1929 F20101106_AABLEA havird_j_Page_047.txt
26da4358dbe2eb340da833b6bdd6d1a8
215df6afab4e005e1d86fdb67d07f03273d29165
2110 F20101106_AABLDL havird_j_Page_029.txt
362bfb7c8c602776984298c5a35d5c04
48747fc5052d7b601db0e353f6dc9a97d8e43bda
F20101106_AABKYG havird_j_Page_094.tif
b04734c7c465911110999c36ef8f0efd
cc9518816fc4b6b45691c4d86f2a8edcce402815
3077 F20101106_AABLCY havird_j_Page_009.txt
175ceaad256c6e27eb922234571ff59f
79e9f248ec45e048532365634faca08cf3455863
F20101106_AABKXS havird_j_Page_073.tif
76ca2476c29a414aa321072b55145b91
46983a3343246edc6da13b206fa7358925e87066
2090 F20101106_AABLEB havird_j_Page_049.txt
ad57e56394f64a97159cdebb431b15fd
52efab2b4a4b9a6246e63150ba97f1ebb8b3a04f
2014 F20101106_AABLDM havird_j_Page_030.txt
c6408636f1f512f9f678ebdc7f64bbd3
0fec2cf3e3128a4a59ac72adecc782930f58682b
F20101106_AABKYH havird_j_Page_096.tif
b07caca5420547eb05db8eb0574fbd48
0f3040224ac77cee871f9f91aeb4842432a4bfea
2183 F20101106_AABLCZ havird_j_Page_010.txt
393559f61060af8df93db1ecc55aedd9
6f178072341fa09c48ad5955ea13e286779c32f1
F20101106_AABKXT havird_j_Page_075.tif
6051c9e573c5ede7e683be9a09864f06
c18869192f4848d61a70e67ec6edf57ce676945d
2047 F20101106_AABLEC havird_j_Page_050.txt
beb3aaf6dd040c55f2f7e7a1d5777b4b
4ae78a513bc5e75e40cf34785d1ea0c358b23807
2012 F20101106_AABLDN havird_j_Page_031.txt
c8573c2a93195398f413cf98cd7f3b16
b3635f3ddb527ce48a9f45a88f86e3469a5e33d9
F20101106_AABKYI havird_j_Page_097.tif
6a62b4fd2a137e07c2a3a079bb535efc
b57721ad3f97331e373312ca866eab2f27aec8e8
F20101106_AABKXU havird_j_Page_076.tif
dd6136812731733b1d07f7643dea0075
56eeb0764de160fdce0afabd00909b5530ad613b
2155 F20101106_AABLED havird_j_Page_051.txt
9f123c0886ab84be8c309774ae263787
e044da4e76319978a9b85012f6ac00e583da0b69
2094 F20101106_AABLDO havird_j_Page_032.txt
9943925b089b84fe1ddb743fd6301580
90c0a2f380acf6510668a0f78e624b26f6ff9cc6
F20101106_AABKYJ havird_j_Page_098.tif
d676a2fd3c5e9a1ea952dbda59cbe6b0
af8290f560a3a867e58df2f81b3d636e9bb6a7ea
F20101106_AABKXV havird_j_Page_077.tif
94158e3fe8207b63e6505191d757f637
ef35ef1ba5624af5e80d756f995493b1d94721ea
2193 F20101106_AABLDP havird_j_Page_033.txt
df973bbc4b3119a7b3e36a3569786aba
ce371e16837b9bbc6970d711581e681e51b75876
F20101106_AABKYK havird_j_Page_099.tif
fc81434f938b9f18c16b051db56b13df
e56c12a97e84e55746500b63ea0f139543aad666
F20101106_AABKXW havird_j_Page_078.tif
49433b91e34cb7dc85726657b58afa12
8e3f358f1fc9c89195c0197ee10f0ed2cf12088c
2113 F20101106_AABLEE havird_j_Page_052.txt
409649c0b4a4f53fed79a63e76ff8d83
6df7603a2a86e8073ae9ed55d788340862b43c74
1511 F20101106_AABLDQ havird_j_Page_034.txt
2363e79ecbd645ba234219d8a25bf136
f6518de52457d7a3019a98c563c35312b004e691
F20101106_AABKYL havird_j_Page_101.tif
a74b1ec5e5213859fdf0bd39fbdc8d2c
69763de70f6c155da9b8f502ad490e00e0179eb9
F20101106_AABKXX havird_j_Page_079.tif
491dda3923c4c80b46e5297987125d25
8939e8e8f28e2f74d2a091ffa4692dc562a0e3cd
2046 F20101106_AABLEF havird_j_Page_056.txt
8ada2c19d3cedc0a1b76b4338414267a
d7f826259ad8bdc68c32e8eec8f997fc6bc1bc29
1289 F20101106_AABLDR havird_j_Page_035.txt
8dce5609fdce5da218d0e9c55efad837
d7145b52f56788263d75dbb22b0559e1515fec52
F20101106_AABKYM havird_j_Page_103.tif
59fe04d6cf1b73099696f98fc1f96582
32044960d91b47a9df18ec1acbb660c214721a31
F20101106_AABLEG havird_j_Page_057.txt
991d244d750cc59cbee65a27f7e768bb
22e88cd2b84ffe40a946190b2221fff70d0ed8e2
F20101106_AABKZA havird_j_Page_124.tif
b1bfd26adab9323be02242c9249e5198
b301daae7537231faa2a8e442a28480c74f01b17
2061 F20101106_AABLDS havird_j_Page_036.txt
b35086d2b5cf474e2d862e524fc40a65
8544ab489a32c48eb4bfb5b2b28e7c3c916365a3
F20101106_AABKYN havird_j_Page_105.tif
2bfa5a78222bea47d4169961d4eee3ce
6fb083ab7aef2270c2af3275161f2ad109bc9ddf
F20101106_AABKXY havird_j_Page_080.tif
825704ed2be081ac6d7185d031a0b7ce
64557c68040853b815f832600dbaa9f3a9828a00
2103 F20101106_AABLEH havird_j_Page_058.txt
4e74c68419559825ae762a979e23e974
3db75651b22c03af276f4129612e515d98b0c3aa
F20101106_AABKZB havird_j_Page_125.tif
78353df0439ab904b29a2a1576e13563
6531ad2b90556b3056594c655b0371a4ba260329
585 F20101106_AABLDT havird_j_Page_038.txt
2e53bac8d4b177e35eb8e0a689e5aeae
edb5b3b37f0ca16e3e223dbb338b58b825d2ce99
F20101106_AABKYO havird_j_Page_106.tif
24ac5113cdefc0e27da23fd16024ffbb
b2f4712f97454eb833d07466e08287588e4cc5eb
F20101106_AABKXZ havird_j_Page_081.tif
651354398b0ba626d3e656c764e552bf
4193d7301956b87483de86723e77a832fce15c05
2122 F20101106_AABLEI havird_j_Page_059.txt
98974e90008636a99a285424eb116401
6c9e921cca59db2750c78546f5c52f7dd6f95a16
F20101106_AABKZC havird_j_Page_128.tif
19b2d2f37419f5e1dd5ed02468a8be58
6f1447eb97d6ae749336094b1dfd60697c8a52c9
2188 F20101106_AABLDU havird_j_Page_039.txt
d524d13311f13a38aa8430fe68003090
54efc61ca17db8a758d45468d41787c0dd7e5739
F20101106_AABKYP havird_j_Page_107.tif
853e82adedd9d5eb1610eda6735d6e3d
2f5f7e2d0d34b5395c4e13f83a3dc825749183cb
2058 F20101106_AABLEJ havird_j_Page_060.txt
21235176d1bc462325e27271a06f3574
bb517bda948c7cd8a85fce1fc150365723d1bf78
F20101106_AABKZD havird_j_Page_129.tif
4b3ecf5bf1fc3b0a3218f8f227198ef0
617b8418dd0ff96dc6c4fde0e3c6af3920f0467a
2143 F20101106_AABLDV havird_j_Page_040.txt
5c9068395d84adaab72245fa84727800
81e9f9414a8a54bef176d1d6c05bff06a349a4d2
F20101106_AABKYQ havird_j_Page_108.tif
86774a16916fff40faa5296c52b7b802
1b8ed4d722257c7b532e0f15772de24f730b7d5b
2195 F20101106_AABLEK havird_j_Page_062.txt
783d764606ba026a93df92d899a35499
a02519fced54fdf9e9c2f5dc495beefe497d53da
F20101106_AABKZE havird_j_Page_130.tif
4ea5121091e48ef9a6fd257e2ac811da
3ba257d7b34f19236afcefef7c4e77cd6d40a8a9
1953 F20101106_AABLDW havird_j_Page_042.txt
d2bbd36760617cbdb0a00593495bc4c0
d558b28ae936d42e0ee4645b4e39385f1499c441
F20101106_AABKYR havird_j_Page_109.tif
942705b65f0a9190d0cd744b966d2688
e519ffb50c0947da51239f318a88aa62d54da439
1199 F20101106_AABLFA havird_j_Page_079.txt
b7e981eff0291f113348859183ee10c8
aa2d3a2b7e545251f1dbace4804730e7b46c4da5
1245 F20101106_AABLEL havird_j_Page_063.txt
4711264a70a966ccedc099ebe2a8e996
0b4486c5727a3ef71ab456e95ad232011605c494
F20101106_AABKZF havird_j_Page_131.tif
9656d7200428e7b89a46f69ed40cd94d
36a69d431926c95c4929dba9995c576283eedcb9
2220 F20101106_AABLDX havird_j_Page_043.txt
470cc61852eb524f25c1250b20fe4011
103866c69e9eb42637961d306c1bc0dc4297a9da
F20101106_AABKYS havird_j_Page_110.tif
0c5193de226a283a2968e2f806e9d360
335e81b3c1691748c34173b9946d30228bfc0146
3550 F20101106_AABLFB havird_j_Page_080.txt
631d7f5a6c6f5bf7b92e742f88ad8464
fe1e885cc4d3e78b41149a15e33970335baae13b
1482 F20101106_AABLEM havird_j_Page_064.txt
8e8965c6fee7cf67dd285c00f8d5d5d2
6daa1e7d974614a31ee0d633d408fb84785dbf8c
7034 F20101106_AABKZG havird_j_Page_001.pro
2b9625be698e6794177e887f5db66ecb
66f180f5180f27867c5f4ec80a0ad4736f8a6dd1
2037 F20101106_AABLDY havird_j_Page_044.txt
fbb17ffb594ecec94789ad1a0cd69d53
0755c12478e021e0170d58a547a0dbd2b5d808ef
550 F20101106_AABLFC havird_j_Page_081.txt
f548b4aa8f8b2cbef5d20897173720b0
fff9438a0f4e4642e82caac60e8c3caa440b6368
1499 F20101106_AABLEN havird_j_Page_065.txt
7b705d0404ca64807643243db3451d13
66796620e26d0c99dd8d38fd880f515774cd90dd
965 F20101106_AABKZH havird_j_Page_002.pro
424538cef09f21458f76fea70807ad3f
e9328750245688e4a4c73043bf8c71f343025815
2060 F20101106_AABLDZ havird_j_Page_045.txt
a520b0ab97776ffd95de5d2a15eac50d
88cc729a1594c5596c3f218477a01bbf19184f38
F20101106_AABKYT havird_j_Page_111.tif
60da02203fe2bed3c75880036485d0e6
622f3af191dce42f2a556b48b18c7c11a6a522a5
3197 F20101106_AABLFD havird_j_Page_082.txt
be7db0d6e928f7e3c05eaeb3b769525a
7ddd209eac6d7f3c9e583e82213c5e5f108fea90
1132 F20101106_AABLEO havird_j_Page_066.txt
3a059663c013fde083fb20158b52c11f
4505032560111f5f348f14d2570b606f1c5d32a1
20245 F20101106_AABKZI havird_j_Page_003.pro
01bb65b9781378703e4a98975570de2e
3dc8a38f9ea58468fbe4c2c9372e299d5d21d63e
F20101106_AABKYU havird_j_Page_112.tif
31f82445f8a51a22935635e046bb8ee9
cbe6fe9868dbb91bc5e327a0aa05414b448ac5cb
2660 F20101106_AABLFE havird_j_Page_086.txt
ac588c30fc74f7288d9d229235f3960b
09e9cea44182dcc0c352ede978b89695c8562f23
575 F20101106_AABLEP havird_j_Page_067.txt
cf09466991df19484f24d47a7b46ddb7
9f43e90859627925dfc332d2cd4e5703ce8e96fb
55593 F20101106_AABKZJ havird_j_Page_004.pro
61f68f032b3bea502fd5ccf3d40ad4bc
d322a52ad893f5e4bc9c72f07ab391a3dd184dbf
F20101106_AABKYV havird_j_Page_113.tif
c6e3dc7fceb4bcf0378c1e28d8100a88
cbc891e5a95938672924132e7b40ca0f69261042
818 F20101106_AABLEQ havird_j_Page_068.txt
ef6869370af504fa8250ce83d1b45c48
9aea1fe545a12758e972233662ea36b6be232464
50559 F20101106_AABKZK havird_j_Page_005.pro
e2ce7334cc452edbe19a6b95593632e0
f85a950dc8f2ef29c0685a8357586b6e134fd8df
F20101106_AABKYW havird_j_Page_114.tif
aa677b9986e8d7fe4836129da1ca49e6
1933c9811e590c6542f57f844d6c50bbf567b401
1514 F20101106_AABLFF havird_j_Page_087.txt
f841f899d49077fa2b0811070fb49e0f
3333328150ecf397fc508eb22ec4986b1faf013b
2695 F20101106_AABLER havird_j_Page_070.txt
6f7bc034347a37d1caa88a1cb7e9557a
5e2586b9385e6967f540e54576dcba6c6d18f9b2
98045 F20101106_AABKZL havird_j_Page_006.pro
50fcd8bebb57222a6368fefd71a44b2f
0fc5e6b429e599357e2eae44f90883bd4325591c
F20101106_AABKYX havird_j_Page_119.tif
5099baeb9564e901be385d95a17d7e95
eed41ecc1c358fc66d852c82db8e179ef0703c87
2481 F20101106_AABLFG havird_j_Page_088.txt
afe2c12bcc579db9582472dabc78a599
eaf9027a90a4fc17e20ffc263163af3f7d9cc44a
406 F20101106_AABLES havird_j_Page_071.txt
f027791ad4abbd9fb1a7bc77511f4503
6f2e81077a8666cdf07765b91a59703620de5673
75432 F20101106_AABKZM havird_j_Page_009.pro
b30fcb561f32db4b62ee1f602bc52c27
f97e4c4259891dd614eab9e7cf8f578a10a40c3b
F20101106_AABKYY havird_j_Page_121.tif
f32b3cb39c3421a3b83561bad643f03b
4c39abd96354c2b95b4e5f203632c0ec391e6f21
2338 F20101106_AABLFH havird_j_Page_090.txt
0708379892147e4b2a5bc94d7ce64da2
102b55cf0b5d94250e51bc2baecd4a481122e0cf
808 F20101106_AABLET havird_j_Page_072.txt
04198793e4c0e413476f2d4cf0d1855e
6bdc1e4a8a694278a8d048b62a34ec07af9b4014
53671 F20101106_AABKZN havird_j_Page_010.pro
8e6b8b1a456e857f68cb0f1c6817b958
8032eb897b5c5b19f071c001c239b47a84fca8e0
2107 F20101106_AABLFI havird_j_Page_091.txt
c5b17377189a0d309cd5724fb0f1c980
43c00ec74fa0662f070e9e22d63e8e25c7bb7782
1889 F20101106_AABLEU havird_j_Page_073.txt
cbb4477aed2a4f512e57ab29e0d30194
611702261889801ffa964870c113a8c8f6b175af
44195 F20101106_AABKZO havird_j_Page_011.pro
a4a460b94e36edbe66f4bb66655e8323
73b0d22ba6a993765ab58216decd306922a83071
F20101106_AABKYZ havird_j_Page_123.tif
46765c2cc28b1c37a3cb05f140e3f7ff
596ba3efe6aa63ddf3c6d11eea1d549113187527
1155 F20101106_AABLFJ havird_j_Page_092.txt
3a0bc9c01868a21b7dca8dfec2a09f13
745e2a04de55b6d0b55ee8c0a3b146b05c3d8142
4085 F20101106_AABLEV havird_j_Page_074.txt
dac089466e3f41e91d47008b8b5bd3fe
88b6c7515bd9d72e56c4e1e8d6d368302184c183
54483 F20101106_AABKZP havird_j_Page_014.pro
2eceb33f1274e842abd0b5a4b4d370ac
02011818e0d5ca90c29fc5eca507d74a73f81e07
1279 F20101106_AABLFK havird_j_Page_093.txt
0fa546546d8f39bb46022286c3acf33a
bf46795605d1ec2fa541aa76a61ba04a5eefb1f7
273 F20101106_AABLEW havird_j_Page_075.txt
5c8aff7d7dc9a328d3fc1110280b99fc
93ed4a19f2026b4cd551f4a61166cdf154405fbd
48950 F20101106_AABKZQ havird_j_Page_016.pro
6fd93887ede4fc1afc71923a38b48dad
ca1edfe2a06f3bde0b277d9a4031f6479bed2719
243 F20101106_AABLFL havird_j_Page_095.txt
4a749cfbe83569608588bc07d169eb29
ddebe53d87e927c7122077eb5803cceb409aa259
3679 F20101106_AABLEX havird_j_Page_076.txt
a2519e32829a6c378011d8543baff9b4
421a798af727f5e6f1e186c9af9c108d4ab66b89
52325 F20101106_AABKZR havird_j_Page_018.pro
a88af7904485e9e01fbae9c06a045589
12063016facf8ae80ca13b253d05348c07f7964c
522 F20101106_AABLGA havird_j_Page_116.txt
bf69012f6a1b70a186aa2fa9a31a85a8
9b2352940cf33cab1d645e681f77e7327d08c954
861 F20101106_AABLFM havird_j_Page_096.txt
099f60f5a6a3254a216b5bda320a642b
92672ec5176921edadcc541419f7e85ef6e1ab69
1004 F20101106_AABLEY havird_j_Page_077.txt
04edfbd39ae5f39d2a3c220c7fcddd93
16d86cd9ae11157e0e2b2cd705b6b4fd278e5c08
54282 F20101106_AABKZS havird_j_Page_021.pro
5940e13c82b101ca3cd912ff4c500391
762877c6481ce286b3b89054021520bbfe1e8c93
2686 F20101106_AABLGB havird_j_Page_118.txt
7edd100879b2be2875cf167dc01ccc57
a36f3ae6a8070263cb182ee8361244ed45fa00a6
3156 F20101106_AABLFN havird_j_Page_097.txt
b72cb335d49efc13a453ccd40d59665d
243056858081c17b179381a6ea4121c5f4637b9c
3653 F20101106_AABLEZ havird_j_Page_078.txt
a2917635e4588de583d49582eb118440
35309c1bef02980b665171e0fe160b0b1ad6eb57
54421 F20101106_AABKZT havird_j_Page_022.pro
73125db6b0d761fabb10b75e22316459
8240e60b372a14992d4bd5b85d483576051ac10f
2566 F20101106_AABLGC havird_j_Page_122.txt
f4b642ca0e1b9cc05c1b679461bb976c
e358fb4470dd45851ba1623029c2b0a670ce7d3e
1951 F20101106_AABLFO havird_j_Page_098.txt
95c692ee6dc5db60ad11ef772b581145
dead2d8d2bc74456607dcf2a6c3aac786c03d1be
50317 F20101106_AABKZU havird_j_Page_025.pro
9ee852c967354762d202b79be1b37cdd
5c3b5c312b2acf5c2407a7e2acb2a7e7ea445bf4
2489 F20101106_AABLGD havird_j_Page_125.txt
01cca1be0a179272b691acade9a69a41
0ee54fb738c1b7c70f75b6e5aaa4568da72be891
1300 F20101106_AABLFP havird_j_Page_100.txt
cac9f84da07cf5dd99fc68695cdda081
facc4274b7de32a8fc11506407e53ea33d249c9e
51004 F20101106_AABKZV havird_j_Page_027.pro
27216520e1af1fe62a0778683b4d5e61
1dcf26c586563f0f3b7cf4dd1e8466df0485bc2b
2452 F20101106_AABLGE havird_j_Page_126.txt
94ffafc7831e66cff24f9682f1ef513d
6d50c97f402d8acee6c0b4eddddf8576664ce375
57668 F20101106_AABKZW havird_j_Page_028.pro
c8d643349ab227dd34e17804b32e186e
ea715e23fc894b065b22c72968a89fe183de521e
2596 F20101106_AABLGF havird_j_Page_128.txt
7456c8dff6c85da9d8a89cceaafa6e93
e85313f822b9a9d39178ea268d22e1947508d74c
372 F20101106_AABLFQ havird_j_Page_102.txt
5b88dfe0738cfcf7f7f44fb80da6d7e4
b89221c1165f4cb0a9cbc40336448aece5b861c9
53804 F20101106_AABKZX havird_j_Page_029.pro
eef6a1448817965264106295ce9586ba
3fce17a116cc1382a2797286c844a9733ab126c4
1153 F20101106_AABLFR havird_j_Page_104.txt
03421c3a00b8619ada4891ac83977e0b
2f6be41ba8d08b539e57b99bd5413c6eef68f94b
51123 F20101106_AABKZY havird_j_Page_030.pro
7677b6f143d0d27ff3bf2f6d1dc77144
ce40131cbeb2e60535aa6e601036a19ffd58ca0c
1480 F20101106_AABLGG havird_j_Page_129.txt
b2b429860af449e00988b9edd155eef7
41c350f24d90f236dc2212ded5e918ba09fe730f
2018 F20101106_AABLFS havird_j_Page_106.txt
8a31132c89076e50e4d9532ec28ac406
83e23ed3cbd90550ff3d15dee8695a20b1fffdc5
51202 F20101106_AABKZZ havird_j_Page_031.pro
104eb45b8b79d96cd3745889ba3b0b96
a9d9a6097c3bffc41a69e14f2fb08f060a93ed75
127 F20101106_AABLGH havird_j_Page_131.txt
0dd795abb252ce40eee587fd258012d7
97d147f7b16d3d311661d554d7fe61dfd46d480c
F20101106_AABLFT havird_j_Page_107.txt
65a9058225b42ceb9e2d504cc5225b6a
7aca4bb7baea65cbcbf6341589684ded5f66a848
1982 F20101106_AABLGI havird_j_Page_001thm.jpg
6edf2a1e417b8a9222e3754e8c767653
5eb4bab6afa413a25ac85e1a128b8cce4bed57bb
2116 F20101106_AABLFU havird_j_Page_109.txt
8e6a75c56249901c2e394fbb224ac5e1
fe692a7ff7c15fbf584c8307aa910ec41d05b6f5
1551509 F20101106_AABLGJ havird_j.pdf
0c451bec7f6a82512187180839ca71f1
17f1aa2f0690313b1cd35d2449a63f36978b43b3
2049 F20101106_AABLFV havird_j_Page_110.txt
b32634bdcd613495534996ac56f40cf7
ebfece7779199b0f234ef8760a9832627ba21122
7091 F20101106_AABLGK havird_j_Page_001.QC.jpg
bb394f692681761cd354f9c117835b51
792d98c79d879dfa552b9d5d4b04acc19341f301
2246 F20101106_AABLFW havird_j_Page_111.txt
41a1cbead5d64d7e353c3e313feb8148
e94ce9ca911d1188d61360354c7efd9874256a4d
36682 F20101106_AABLHA havird_j_Page_014.QC.jpg
d0f2813c163558c10ac712edaf6c1135
ef7a076fe32d1dc2364e40f1ffd9d6c98096d711
1222 F20101106_AABLGL havird_j_Page_002.QC.jpg
8e6c75bc9c143c8b0edf6b83a7081dc6
8942ecaf0e4fccf575e57cd39b518444b68074f5
882 F20101106_AABLFX havird_j_Page_113.txt
b5b524380db330003777cf9ba2668c61
52cd0fc5066154045972fabd306650e7f6575f2f
9037 F20101106_AABLHB havird_j_Page_014thm.jpg
64601fa9e22da2b902d533d8ebc937ae
bc9f60284b5a93411b26139258d01734d05d9639
632 F20101106_AABLGM havird_j_Page_002thm.jpg
430937f076ce8792b8d9aed5e78651b9
8d0067676dad477622c8d1c771b5472cde917cb8
1573 F20101106_AABLFY havird_j_Page_114.txt
596aeecbf5d389c7730c73cd0fab26f7
6dbc615a762601a020b3c55d713893f125c8bbf9
123666 F20101106_AABKEA havird_j_Page_120.jpg
8995d8d3a8b37e5a0b606564b4a1e3c3
413ba0c7fb8c8f46f209468e37ed510afe56580b
37165 F20101106_AABLHC havird_j_Page_015.QC.jpg
65501565c17c039adb28cbbc2f201e4c
53c9608e81f79aca16daf0f2494953b4f87c21ce
10266 F20101106_AABLGN havird_j_Page_003.QC.jpg
0924c72e7e03c2217307edd3b93c9956
e49e87df93f3a7c2d1cc27a0e0c88c79132198b1
985 F20101106_AABLFZ havird_j_Page_115.txt
3a616a0b7541b6b147fd23ac5e302c53
f03ffd8cb56655b58595b3d75fb51c895f15bd50
49516 F20101106_AABKEB havird_j_Page_023.pro
2ae0e754ab50a832f6967e7e8db93517
09b8431a8a2b79614f0e6956da73a652dfc37b7d
9239 F20101106_AABLHD havird_j_Page_015thm.jpg
6fe2800da4bc171eed94806591b352cf
c9c0aa093b1cf0c43322fddeef0d729095038bce
33764 F20101106_AABLGO havird_j_Page_005.QC.jpg
9a719eaccb853ee9747c2a397a983023
0e8ade71d3e7b99965c1e8c9f0145c1791c21a0f
2139 F20101106_AABKEC havird_j_Page_061.txt
1ba920c6e30422292e4c764020aa7e9a
8f87c103c5061513c2e1dffb07cac14bec0ecaac
33369 F20101106_AABLHE havird_j_Page_016.QC.jpg
3756da4c4e6c4902fbb8a74b75f86047
c31025741de8abfb696bf1b4e904daa649477352
8635 F20101106_AABLGP havird_j_Page_005thm.jpg
50d2dff48b263ba6d4b30a2491eac73b
19b10498d9e6f928fb86e9bc6a3c5149e15c89ac
24745 F20101106_AABKED havird_j_Page_085.QC.jpg
07f3326f00568d81a3f29d756c8e3da9
0f706ece2c9a2106e0951d5d2ad9b929ed60e136
35712 F20101106_AABLHF havird_j_Page_019.QC.jpg
317d519a850dafcedc499ca7057084d3
147a142d1819a5bcb1c4b96129adc929694d42b8
5502 F20101106_AABLGQ havird_j_Page_006thm.jpg
eece40813c857d97b8b4a3466af7f01e
357a1469715e5523551b9351d7e055cb6422a6a3
4137 F20101106_AABKEE havird_j_Page_002.jpg
1abbd4c25695cb0c936bb01283dbe38e
992a0da5d45d877354e0ac01f05f17ce4876e554
8456 F20101106_AABLHG havird_j_Page_019thm.jpg
f581ea8d1f37223562dbfd97283d9c88
8fd8d6948ea46692388ad018aa6ee29f38a6a37e
4228 F20101106_AABLGR havird_j_Page_007thm.jpg
f66a3bb52a9a81705e547734b3b73eeb
f8958b058df72539b07efe39d96ec2c260921dfb
3236 F20101106_AABLGS havird_j_Page_008thm.jpg
b35dae45523155bf46d11ddbd809bd69
e21c1fcd973de6d5a7c9606c50aef73fbd0b8010
F20101106_AABKEF havird_j_Page_102.tif
8c87a97eec0803f40cc305c1284ffe89
e0a9d80e64c989203dc8e3b8aedff3097376669f
35305 F20101106_AABLHH havird_j_Page_020.QC.jpg
193dc17959b5d50767652c21fabe0c52
80a029e9aaea8a14f27245cecce0cc1c32ca3f51
26124 F20101106_AABLGT havird_j_Page_010.QC.jpg
a80217a2ebf7484cebbe9a524f813583
3cfc9a30e14ffc71c48819d3295b458937f7353c
69498 F20101106_AABKEG havird_j_Page_073.jpg
922902696e6f280ad5fb4d2d61200f3e
4caee35e01430db9466dd6bf1580f7c57b430d45
8427 F20101106_AABLHI havird_j_Page_020thm.jpg
5df7751451d32effb0638110866b1d9a
efff2fd85f24f5667c2494296cc9374422253792
6254 F20101106_AABLGU havird_j_Page_010thm.jpg
a6f9e5fb9f850aae3ca412c311171585
332ff2d87d3c9e1aa7006d855fdd46e71cef3dcf
F20101106_AABKEH havird_j_Page_010.tif
b75be2ae867a9f78167bff9d14e19f12
c3b7eef3da813d9ba2f39cbb8d6631b325f74423
8978 F20101106_AABLHJ havird_j_Page_021thm.jpg
e0258ab1773f27300f967063dbd20cd6
4148e86c542f27d16b5dc5b41f8e1d8dd64ffd22
30120 F20101106_AABLGV havird_j_Page_011.QC.jpg
e5b1d1c4c4eb479697fd13835addd87a
5918c3f2fd4d3d4178325ce6b635196dc3e3b101
36597 F20101106_AABKEI havird_j_Page_124.QC.jpg
1e84458ada3a89da1c8f526efe7df0cf
ebd64635682482d261d0b8783d2a7533ada0ae5d
36981 F20101106_AABLHK havird_j_Page_022.QC.jpg
ccc3ae3c150b185b3af9ae3d1ff9ad94
dfb354b3bfd53411d2888186cf348f8bbaf890c8
14140 F20101106_AABLGW havird_j_Page_012.QC.jpg
7e81d49087ce32399ab1982ff460e93f
c6bd3dfe6388ce9d8c64c887d30de74a2e4fb4b9
8901 F20101106_AABKEJ havird_j_Page_120thm.jpg
e54d2423d77aa03f07b36fda3d9ddb63
ce238cbce98815df999f4faee7e2f1392ae203e7
9042 F20101106_AABLHL havird_j_Page_022thm.jpg
32a857769dbc4b6900ad6b63ed92a471
31bb6963f780e3304093b9977c260e7e7e0ec262
3354 F20101106_AABLGX havird_j_Page_012thm.jpg
68c0355e5fc5b3192f9b913e9efdea3e
3b0290e12912005da8e79a349a974319ff376779
36977 F20101106_AABLIA havird_j_Page_033.QC.jpg
42c4d431cc18320511c33e0f8b294a39
a380d11b045a4df8cfb8785062d2a02fe7988d63
F20101106_AABKEK havird_j_Page_119.jp2
b2922413f292875d6aa418121dde66e1
696383eb6c1bc4ebae853260ca27a0b087f6a688
34501 F20101106_AABLHM havird_j_Page_023.QC.jpg
ee0dafbcd12de3e410b5ad0c3ace4736
879c8f032ee54cfc26bc9ab26fb76ae39e9bb2a8
32729 F20101106_AABLGY havird_j_Page_013.QC.jpg
4f92e32b7a44094bc2d5be11c03048ce
aa4777630706c63943897e965968a77cc5d9d88f
26922 F20101106_AABLIB havird_j_Page_034.QC.jpg
a30421cc9b81869ac5c57eb796a45eac
f3ff9601eadacdfb650d7dc4a5be8122055b1c93
3785 F20101106_AABKEL havird_j_Page_083.txt
54e5ad12c1c277328d9b724037e252d8
2ffd36df5d90b747f0ab71a08b86d73fbf0a397f
36180 F20101106_AABLHN havird_j_Page_024.QC.jpg
c4c7afef60af7b48ffeea1aad5f5f027
e4ebfacad1e6873f1d69d5d765fe2f1fb118abb0
8076 F20101106_AABLGZ havird_j_Page_013thm.jpg
cf256a29d2ced163dc23c178d2067ce3
58ca5f908c3c59e0c7c47b60832cd4ad8030d15d
1991 F20101106_AABKFA havird_j_Page_026.txt
cbb89d430026c6f016cd9a1814a72bd8
62e1613547570d66893a2a03786ea02de2b0f499
6628 F20101106_AABLIC havird_j_Page_034thm.jpg
e670ade48b34bf8d9fdb668d025a9cd0
843a77952490ecb420bea53fffb9184939071437
2524 F20101106_AABKEM havird_j_Page_120.txt
ca4043162e67165620ef55806f873436
369eda8cef3ad69b77a667882ee4959a2d9e8102
33590 F20101106_AABLHO havird_j_Page_025.QC.jpg
a074639e8cc086fd5844aeb232fcb908
49cc99a57d80b0b828d5e3d949aad591675ac1ba
37830 F20101106_AABKFB havird_j_Page_049.QC.jpg
79e7871504958f1820b5fc29cc1808d8
f63d57f142f7fb08529cfa0503fac7c33e9c2b77
17079 F20101106_AABLID havird_j_Page_035.QC.jpg
0481a11f788b72bed6dbc7fd16275003
dbd6867e064d8b06e4e8bdb68e8eb2546cfbac7b
52253 F20101106_AABKEN havird_j_Page_110.pro
e98294eb90145a0421367a3edfddfe92
3d7904889744cc25b52a6e64067516abbd92fd65
8229 F20101106_AABLHP havird_j_Page_026thm.jpg
941d20ede8a15e47ca9d82c595cca2e1
355773cf729dec1a6998bc3ce852eb79b4c3f566
1327 F20101106_AABKFC havird_j_Page_103.txt
4ad8e219d36c97a2e069403a5d52daad
58904677640d1e2805bb353c47f5c707e2a1cd07
20573 F20101106_AABLIE havird_j_Page_036.QC.jpg
c18eca5a61fa44550de3559eefd98c3a
0dd7b2a5efe1af17cffd89e396a33c8521b3cd8b
F20101106_AABKEO havird_j_Page_085.txt
c3fc522f67a4a236d06ff9268e37f32e
ca10f5ba85b6bdc3fe15d5ac165c43f73ea171a2
33454 F20101106_AABLHQ havird_j_Page_027.QC.jpg
ac56d8e4a2028ebd29a93169836fb358
1c856deb33edc27c341711f024ac322ce160973c
F20101106_AABKFD havird_j_Page_041.tif
4b6ece5719403f1eb09ee602103bbbba
68cb957196f8c1403f9631666a2e512520e8b757
5043 F20101106_AABLIF havird_j_Page_036thm.jpg
bdf9216460b4e24a4771eec7c56470fb
4f72ca979ce1fdb28a124ea6f2ae869db47354b8
5139 F20101106_AABLIG havird_j_Page_037thm.jpg
82119586694c14a7834f621dee3e2148
787ea7992ab8f1a6db1d818843ff29bb6515b0ae
9223 F20101106_AABKEP havird_j_Page_111thm.jpg
03f01fef6b4bcd2f2d67ed244607f2f5
7ab07eeeb0d599782b3c9254273b75507698f7b4
8564 F20101106_AABLHR havird_j_Page_027thm.jpg
c52b7580918f8988780e6ea81ae813c0
a0d1bd74332ca405f5930645834b7cb361e57783
F20101106_AABKFE havird_j_Page_060.jp2
ff9250c387c78488624dc32e94f039f6
e1ffcbebc92a8ce529fd194850880a2c87d79d36
2970 F20101106_AABLIH havird_j_Page_038thm.jpg
6bdde26da6e9b44fe0fdbedc495046a3
47756b12b891aeb32085033bc7524c82e7e7cdd8
F20101106_AABKEQ havird_j_Page_018.jp2
6f492d011e9af278cd7cdfb8ec0aa097
c95b078706a78f31e1f40b3e0a2dc6a789355f9d
38323 F20101106_AABLHS havird_j_Page_028.QC.jpg
b2a136b989bce1f356b53a9fa29bd0d9
e53c05c661e071ed7cb35bb0a785e7c6ea093f27
169149 F20101106_AABKFF havird_j_Page_075.jp2
30fef7aeab87ee4226c6f4307ba41bdc
dccc113e0d6955dcd28276324b672e8c17a87285
35217 F20101106_AABKER havird_j_Page_017.QC.jpg
47bda64dd85f521d1e6b458521c51215
fac716dc07dcbb97b3d7b9eeadbbb8778199b763
9280 F20101106_AABLHT havird_j_Page_028thm.jpg
8bb437776d27ae30fe4bbe9e8405a9a6
19050e902066cb3242c7cc14fd38205954bf8658
37237 F20101106_AABLII havird_j_Page_039.QC.jpg
3202094de04971aa6f5c7bc560d55e5d
1d6145c6760336c02e9850793c367acd55b54b50
1989 F20101106_AABKES havird_j_Page_105.txt
10f66094c45f45efa24db78d1975f00c
e1c93cb02e70bff7ac32d76a2ac5ba55a7205954
36391 F20101106_AABLHU havird_j_Page_029.QC.jpg
de709df70bbf8e3441cebcae0105edcb
91e7d440faf51e39e3df5f1d7ceb3477eaaff8fe
36975 F20101106_AABKFG havird_j_Page_055.QC.jpg
77baeb1676a8ce68b6e5f0f675041387
28374915d3d5cf28fb82f26162c0e3b5b90ab06e
8909 F20101106_AABLIJ havird_j_Page_039thm.jpg
a5a77d109878909f32fa6bea6399ee3b
de58ed3c2bf5b97df4dd93277e3d22009381a49b
21456 F20101106_AABKET havird_j_Page_090.QC.jpg
d8359e8812e05bfd1bcb365f62ce0b53
120ddbb1eb04a2a3e6ee8d380564a9993444e95d
9067 F20101106_AABLHV havird_j_Page_029thm.jpg
c6daddd179bf5cf4c4a1712563dbb003
bcb9edef8c89260598b66d3c2e9d371059ff202c
40781 F20101106_AABKFH havird_j_Page_012.jpg
5b41746af69268d0ca24fcae2e50a6a8
5c51ee9978e52fc1f3d7e54a7ce20e174a9b16f1
36947 F20101106_AABLIK havird_j_Page_040.QC.jpg
168f76895ead9276392f1a773fba6162
a86e63c43c6c5be26c30a3837df44f7ca5031719
8830 F20101106_AABKEU havird_j_Page_017thm.jpg
1a646f8c5b6c5b422db750e259bb0e13
bebf22b9cb6ab0c7245f3f535749f8987cccd8ed
34590 F20101106_AABLHW havird_j_Page_030.QC.jpg
9965e39f3d09e8bcb3aea7f3c5b097bd
8dbd6cc7d31c2f9108cb0b8e05d574c63c70529b
F20101106_AABKFI havird_j_Page_083.tif
88eefa124873bcf9938c9bf09fb257fe
aa82591eb3519a024e4910ce057d3e35508154d9
9114 F20101106_AABLJA havird_j_Page_049thm.jpg
7e26a639f6b9400736209f1342371677
e62db6b048e7326b67361e38ecd0868cff98f1d1
9230 F20101106_AABLIL havird_j_Page_040thm.jpg
af23945e11cb73a6bd0eff283c230ea2
6a853341a87dded859cd06b1d06d11f014f76d39
1691 F20101106_AABKEV havird_j_Page_069.txt
a0f3d24e6b207de883dbb43e06c4a388
62c90af8224a6d9f9399c82c2a13e1d6618ebfe0
8528 F20101106_AABLHX havird_j_Page_030thm.jpg
2af74bc3d32a4496f8417c92a9447e93
6782cc28872b9f877320033bedd4d9f6d7129ebc
1051900 F20101106_AABKFJ havird_j_Page_015.jp2
92025196ef5292744222673f643a6150
bc675fe3bc7c0349b8d951ff49ad154c9630cac1
37516 F20101106_AABLJB havird_j_Page_050.QC.jpg
ad4d9a865415ade831c9213d4c9c5e60
ae302950bc55562f9c41a28f6cb4175b7e889257
36486 F20101106_AABLIM havird_j_Page_041.QC.jpg
111ba63245c42ea64689c93d62364f0e
9495b51cecb172f0bf97e4fe78aed0aad0115a80
11616 F20101106_AABKEW havird_j_Page_072.QC.jpg
c69ab15f0bf4442776b65f960f8423c1
f0e4a7ca5de28add040256f8cbf1a481fcd49e45
34125 F20101106_AABLHY havird_j_Page_031.QC.jpg
9223fd584e22fde7fe3893853d32c291
c133f076f8bbe2eec4faa06e7214e860f25929fd
53576 F20101106_AABKFK havird_j_Page_058.pro
e82b1dd34f8bfcc6ef521b71077cabe5
f5c4505fab5b6f168d468e88ecd48ef2aaade503
8799 F20101106_AABLJC havird_j_Page_050thm.jpg
1a29b556db2737ff8f9c2ac7928f7cab
7d63cc17edd6565ef0cf4dd118d2283e9e44fda4
8818 F20101106_AABLIN havird_j_Page_041thm.jpg
4b67389e072e9c25fba134fb56e08927
88d825a0a653d9b944164fc35b55007267af2719
54784 F20101106_AABKEX havird_j_Page_024.pro
08e0b313c247bc5b328207c4fbc03193
37c3fe952b35f132162e870c1391f078998ec929
8627 F20101106_AABLHZ havird_j_Page_032thm.jpg
270d1a0ebd9d56c95d3e480992617144
2dfdafed797a3f17f7184ff5489828c403586540
F20101106_AABKGA havird_j_Page_084.tif
9d7b071a404cbe12ab40a13955b3a6ce
67ccd8498968ba7dc6b82bf2e0f8ad350b8568b3
22131 F20101106_AABKFL havird_j_Page_097.QC.jpg
6da098b34e4fb0ac855d37b164aec490
5ad2b4e1f843c8bd7be93123b681f5fd10859dbd
37357 F20101106_AABLJD havird_j_Page_051.QC.jpg
95f7a0671e295582e9cdcc433153dfba
af18da4b1dc406d3eb898590565c55fc3a71487e
33498 F20101106_AABLIO havird_j_Page_042.QC.jpg
ea94fd6767f5622eaae0c5cc68398c05
5ec972ba5ab6e45a17c231be9404bc8a99d70461
1007 F20101106_AABKEY havird_j_Page_099.txt
79318abee603c59d8fdaf9125bfb007e
bc85af92aee68c445b64cf3e31d9a101959ecd8d
8713 F20101106_AABKGB havird_j_Page_033thm.jpg
0167217ac3675bda20b5427c21d998ce
57db8a07904343e05475cd2ab7077a23f31824df
116956 F20101106_AABKFM havird_j_Page_057.jpg
0e145d370f16269bfc5200a76443f08d
e0e9d68fc09231797c137ff218d2f727ebeb7fb2
9191 F20101106_AABLJE havird_j_Page_051thm.jpg
00c35a4510f4b0c852c36e1ba689085f
c1f042c6c1668d8df122b643efc444cf3222413b
8481 F20101106_AABLIP havird_j_Page_042thm.jpg
2293866b8938f89696ce8b29b474a07f
f051f051c58670f05948f16e09376ea5f8532272
5632 F20101106_AABKEZ havird_j_Page_102.pro
07822b0aee1a5391888ec827c19509c6
86b91ec4d936b546f2074858d19dc8cd4889f9e8
8363 F20101106_AABKGC havird_j_Page_023thm.jpg
c64439f5f2c4553aab84caace1639ce9
b83d462fa109a774f51c63eaf552fb9a241663da
F20101106_AABKFN havird_j_Page_025.txt
a16916eb639ee31e662f852c7b29ab6d
154c2f179daa59a25f6c56904d120f23f9c7a4c9
37528 F20101106_AABLJF havird_j_Page_052.QC.jpg
1a916d2b51777a130e6674bdec63f183
316b5b0d9058b5d1c70e0b05007c8dcba3590005
9259 F20101106_AABLIQ havird_j_Page_043thm.jpg
1bd8196823b05fbcb0bfdd5a9176306e
c7d9079e36d1e6268c016bc3ad4272ccbb320b33
8941 F20101106_AABKGD havird_j_Page_057thm.jpg
fe41376bf0bfd8600a2423ceb7f8a45f
5a7f99bb03f888633b7bf9b0d0a84de4d86be12c
449189 F20101106_AABKFO havird_j_Page_098.jp2
8fff7726e96229499d6435cc234d77c8
ad9d2b53fe9827927fd611f359bf3800fb3cda72
8968 F20101106_AABLJG havird_j_Page_053thm.jpg
377aaf632f1c45c6843f409dae7ca7d5
341dd31cab49aea07521e6ed82730715a4baf4d6
35025 F20101106_AABLIR havird_j_Page_044.QC.jpg
df8b7a97287c1b7d7d62b317f315db63
3535f3b6d8ae79681fe40f6f06fba3ff699b836a
F20101106_AABKGE havird_j_Page_118.tif
ee7785ca3859e06bbc33e23b6fe42d35
ab60625616bca5cc44ce82658b8c1488b23686b6
9937 F20101106_AABKFP havird_j_Page_094.QC.jpg
cf5a37e9b92f42a592c49331bce83da7
4d2bcd79aa74e9035f185adb97cdf7d1ec764fe9
38085 F20101106_AABLJH havird_j_Page_054.QC.jpg
b7f4276fe61c261fe65d4aa5917d9798
4e2a71a36fc96435beeca61d7e7eb4ff52c69060
8816 F20101106_AABLIS havird_j_Page_044thm.jpg
e96d8b1a9e82b085639f05f7bd770b9a
e01ce8d58991349b3ac8ec58e76c56cac8a6d1d3
F20101106_AABKGF havird_j_Page_090.tif
eb947b3dbd36729bc0496d1893364199
7cb8eeb3a338e0fc90cc2a5d558aa5274ed1cdb8
109174 F20101106_AABKFQ havird_j_Page_045.jpg
fa59ed4ed805436621b93cb9c87281d8
0df4b15bfc8a8c4e1518d580a52430a413d25d16
9236 F20101106_AABLJI havird_j_Page_054thm.jpg
c1c3bfa00a7f8da499e207d833498af0
39bffed61887cfd98be09ba9dec99f0da8978332
35317 F20101106_AABLIT havird_j_Page_045.QC.jpg
60b1b48d3891acd814fbbae34ca1c578
561484692b279b5c876c1ed980b45e31e502bd68
61400 F20101106_AABKGG havird_j_Page_120.pro
8cd6ba381fd1af2bc40d7f9b1d37fc88
4456b5dcd888ffd211e1eb38eef27fe4b86af778
1948 F20101106_AABKFR havird_j_Page_017.txt
decc04e15aa883b63d37d5da5c85be98
28670e0a014d0a2e8d49397fa966b9d49f2dc4e3
8914 F20101106_AABLIU havird_j_Page_045thm.jpg
310cebc14d71b9afff8988e1dfa399c0
b8e27a0f2dc4cda93c8cc1196622fde8fd345e74
F20101106_AABKFS havird_j_Page_053.tif
3a167cf1a34394a62c1dc01b29b73855
a047717ecdaefcb87ffb17290264c14a0aa2b7a6
9165 F20101106_AABLJJ havird_j_Page_055thm.jpg
89deedea84427a1fb21816eeaa4a474e
3062951c4439033c12a0dae8f2f2a3f0a68fa7ab
36550 F20101106_AABLIV havird_j_Page_046.QC.jpg
2864d28f3398958061939506b3cc8db5
93cf1bb59c93c1c7f19b9e15d07328513ee5624e
8802 F20101106_AABKGH havird_j_Page_131.jpg
5847bc993ab14d3c5f3225a0f6acaa1a
eeb968956bbabde47b8d94e168622112611a18a6
452363 F20101106_AABKFT havird_j_Page_103.jp2
bc8bee1d7af96d8c1558dd7b47e8a499
112fd242fde28357e3610427ec2981e32b431bff
34608 F20101106_AABLJK havird_j_Page_056.QC.jpg
26967107a4d67ebadfcded605467cba4
5c672401179ed9cb58701a92591dd18ec178e506
8893 F20101106_AABLIW havird_j_Page_046thm.jpg
1b16dfefe23b620dbf358538ea4424aa
441754b86888c03042788981ed4e39b48a2c59d1
42209 F20101106_AABKGI havird_j_Page_097.pro
377782bcffeb67e7a04cc73ef8f7bfbd
3738c8d07a9b74c0373c67489bcbb882098b1a5d
F20101106_AABKFU havird_j_Page_080.jp2
19e615b15318505950e0faf53339bc9d
998085da942d8719e62989e066d1c3361300b066
10829 F20101106_AABLKA havird_j_Page_067.QC.jpg
dfd799f3ad4a5b690f4b3466d0d6d638
b10f1aaaeed7ed64ae18908bf02ebc3f46fd7bc6
8544 F20101106_AABLJL havird_j_Page_056thm.jpg
9ac6d6a0a45c982ba6a3ac8c82e61410
a4e5537207c8bbc9c29e8e20894363d3d2de03a7
33771 F20101106_AABLIX havird_j_Page_047.QC.jpg
d10fc96b5804a2a8c765b8d11982ba38
ca31461229059a4e831274e8ffdaadc43a471b22
F20101106_AABKGJ havird_j_Page_126.jp2
26631af4664effdec4b265663ea7a3c6
23aa7b7b34fea28a458daef61a30474ca065f281
15919 F20101106_AABKFV havird_j_Page_091.pro
e7cb9560e8e86a31b45d62c644974ec9
44534df840b66fc3c1e310ce950bbc8fe0e060b7
F20101106_AABLKB havird_j_Page_067thm.jpg
491246227a8ed2f11cf1d7cb9e7614f1
554b1f8a2ffdcbc5559170c14b937beb62ec9c80
8758 F20101106_AABLJM havird_j_Page_058thm.jpg
19a9bcfd5bbefe91614423bb7b5771d2
5b03c7fa8c178c22e1972b840e2e5da2a3ef614b
8368 F20101106_AABLIY havird_j_Page_047thm.jpg
e6cc1243c0efd00f1ddcfd19cac3c32d
82f5137676104db93c494b4917414a471dc900e3
8788 F20101106_AABKGK havird_j_Page_004thm.jpg
59bffc29366ee096c08883b967796ec4
47c5ee42bf6c9dca11e6d11b4fd4db1d013d779f
F20101106_AABKFW havird_j_Page_115.tif
58b76759335873542fb3a6ac5ede61b6
7fd30adba991f2b531a8d32ce85dfa71b29c1cde
14007 F20101106_AABLKC havird_j_Page_068.QC.jpg
42e9a30feb01788bf2131d084d6dad0b
6bcde81d134641410eae8cafda46c82f46d0a2d0
36980 F20101106_AABLJN havird_j_Page_059.QC.jpg
9115bbf407ec14449cfa6c9d614802ec
c48a7778d1004b718143afd0db84610fd633acd4
30005 F20101106_AABLIZ havird_j_Page_048.QC.jpg
808ce9a1a462de39f36938d89d8489cf
ebe63c2f8409632c860b437792fca9736cef9046
F20101106_AABKHA havird_j_Page_001.tif
2176feefd51a3250ca301d03a3f8ea22
ee3b9322a1ac1c660878f05eff589fd609cbbc82
F20101106_AABKGL havird_j_Page_074.tif
f9c8f7a2ddd8c6e9bd77544c420a4995
209d2a2dad5854b1647a8f07181072e2cfefcbcd
408320 F20101106_AABKFX havird_j_Page_072.jp2
5993347fdb48c333b54f8c528721ce50
f26ee210940e97115fba1cd93102277e718fb5ad
27776 F20101106_AABLKD havird_j_Page_069.QC.jpg
e980ad0fe811557080988092927d99be
2adb16cc9b926795dff6e79cafdc518bd3ff7d14
35118 F20101106_AABLJO havird_j_Page_060.QC.jpg
41ab6f95d0cbd3ad4e3fa010aa9a564d
b1a23d8600361ea5ae1cf2ef581824951d783083
50350 F20101106_AABKHB havird_j_Page_106.pro
8062fe66e2249f46ed4304d2e639a31a
47d350cbec4d527b17d3e6a781c5fe546af3c732
18623 F20101106_AABKGM havird_j_Page_081.jpg
a478544b3a9433b324e1b2b0f8822b6b
20674632833c36c02931410b94c778c9ecdde6d7
586031 F20101106_AABKFY havird_j_Page_035.jp2
b467568ca458095292e52fc017db4f4b
f38323c1eb63359e24f60d92016bb73d820d1950
6097 F20101106_AABLKE havird_j_Page_069thm.jpg
a3fb53e320b7e53c5f0b4c8620f440ff
dc4695454ac80a05ede194ff286afe13f9cadef5
8768 F20101106_AABLJP havird_j_Page_060thm.jpg
a004550f34c1b6bc8e95ef4dc423c838
e972d9037c15eb04ffa84942c5bf1420a1813f00
11389 F20101106_AABKHC havird_j_Page_086.QC.jpg
d61ddbc3f30dc71a28d0c6346b3866da
f09de451f1964dc39637a1f1de7b90a63bc1d218
16804 F20101106_AABKGN havird_j_Page_104.QC.jpg
ca0afd3392bdde91918a2873cccd5b81
2e77beabc5145e720d6f1c06a4864fee10b6d996
151333 F20101106_AABKFZ havird_j_Page_082.jpg
43a6dcf81f626297fbaac9146caadabe
6c165e79b7602d59671a2a379b6a9b94d8999262
8393 F20101106_AABLKF havird_j_Page_070thm.jpg
eaf71f8567c62c0e40817e8be19385d1
94e0757d6222b7dc03ee31edf68bdde02567f806
37608 F20101106_AABLJQ havird_j_Page_061.QC.jpg
57e84e502fb84c8b956549f833594778
1e02249ea73d29fca9d405bb4e5412e3a56636c5
37413 F20101106_AABKGO havird_j_Page_064.pro
cae47b5e30231e340bcd262e1d5d9800
9dbc9738a6a838c1c6675444622fea2702ea6a71
22949 F20101106_AABKHD havird_j_Page_035.pro
889fbb39248294b6db28b603bfa8a02a
866d4164c913efa21e139b2798d5fb01d32f6957
1755 F20101106_AABLKG havird_j_Page_071thm.jpg
5e2adb37ee9013377912866a606fa1e5
96fe575a97e9980251f52a0873978b72d69ddcf6
9166 F20101106_AABLJR havird_j_Page_061thm.jpg
87dbb6d9620695f74e87597ecd7ac420
4d0ba71831b36325def870faffa2bb890167c2ae
F20101106_AABKGP havird_j_Page_120.tif
1fbae9c0371610988917424c84702bc6
5ccee51a73f751451873ddbfd796ac5cb5c6b686
2066 F20101106_AABKHE havird_j_Page_053.txt
3c43c1f9d3c67ddbf1cd250a9e25faef
e44cd0759be15a18ba102a88cb044b79c0509b1b
18896 F20101106_AABLKH havird_j_Page_073.QC.jpg
2bc5c96799d22588e47aaabdede0abc7
2aaa255a001ea5cf3aba5213eb844c1ada62695f
38084 F20101106_AABLJS havird_j_Page_062.QC.jpg
adf64deef50c95c7e75aecd939bd5812
55a83a7b9eb5baa11f296fd8e03840516dfb912f
96900 F20101106_AABKGQ havird_j_Page_048.jpg
bec2af02b19d181b6a2673cdfa2d8ffc
2a6398db503155b264d092bcbf2bb9e26f16c479
594901 F20101106_AABKHF havird_j_Page_037.jp2
25d55f63151033f1a0172b7c0894873b
76cd8e0954bd9a18f8ff918ec9176bb86f14f185
4458 F20101106_AABLKI havird_j_Page_073thm.jpg
cbded5d248775cc3bdb3e6eb394afbd4
7138046e6e91f312af9d876be220d4634c2692db
9185 F20101106_AABLJT havird_j_Page_062thm.jpg
3f154cf24dd8c743da2a437e3edeebc4
1dc9e47e4d0e236bce159729b885a0802f0ef819
29086 F20101106_AABKGR havird_j_Page_086.pro
4fb60f045c94e9a7028f4aab2e40ce27
1ca8488218f0324acc3ac6ad64cde8ec415f2324
37305 F20101106_AABKHG havird_j_Page_108.QC.jpg
53d789dddb7d3982d89a1584a6b62748
1536e23de50c97900800a89f9f4b77c49a0caefa
48105 F20101106_AABLKJ havird_j_Page_074.QC.jpg
052b9bfabdefa8824d937845ee2ce3f1
d4acd11429e12e524c7b741315c3fa1b1b019b81
22046 F20101106_AABLJU havird_j_Page_063.QC.jpg
3e2dba58329b3b4d658a1f15e2e0da53
567e8be5d21946d86e3a72a650ffe8c085080136
34054 F20101106_AABKGS havird_j_Page_026.QC.jpg
6964d940a4febcdc2aaefbe340538fa9
f467d558acb854c966f48d4181335fdf4b566a98
F20101106_AABKHH havird_j_Page_100.tif
5872c284c8aa8daf6e26b28002f5ffbc
58c2ed5025b498bfa72dcf9e37572b2e9a59f5cf
5276 F20101106_AABLJV havird_j_Page_063thm.jpg
e237f3628f72bc34f86ea04691b5e1b9
6fd325affeeeb74d38d7c9b72cc85080ae56fc9a
16555 F20101106_AABKGT havird_j_Page_089.QC.jpg
fe63ba547768646a8cb2f08299a957af
c4dbfe2ef4e964c505fcff703fd6cb2bc007c333
11679 F20101106_AABLKK havird_j_Page_074thm.jpg
46213b1433716057dfc474627b6f1ac7
aa6db010ea748d9de29d89353d41582548ee5520
6010 F20101106_AABLJW havird_j_Page_064thm.jpg
191322c112dc523d0dd0bc9da14dcf4a
ec10297fe76be1eedcb33a2f206c5bd63a32dc2e
8855 F20101106_AABKGU havird_j_Page_052thm.jpg
17a41599c279fa3c1b51d3b7ccbdc002
fc1be2adbbbd7d6033f294ca2baa330d1ae8d279
8179 F20101106_AABKHI havird_j_Page_025thm.jpg
f80f6abe05106085ef44023ebaa5f7d5
516005158b15ed950258a581f9fc8dfc02b1078e
3729 F20101106_AABLLA havird_j_Page_084thm.jpg
0c52bc3ed4a79be3b9837b925fe9af00
06735c2084ecbb8c378af7712664b705f480b2ac
4966 F20101106_AABLKL havird_j_Page_075.QC.jpg
d52a8eb7167163ac709fbe1f382bd47a
6f9c58b1db22860b0dc0fdedbc31d9e872df9fbe
25576 F20101106_AABLJX havird_j_Page_065.QC.jpg
77ad41c680f433fc50ce1c487ef62d0f
9ca826e70aa1edc42f182e07d81b4c05853e5fef
F20101106_AABKGV havird_j_Page_088.tif
11b16fa332f7c7e2328c812d9f5b7e8b
2c29b60283619e9263ee8ed971468d6610952a09
F20101106_AABKHJ havird_j_Page_117.tif
e844244f41a7f8dffa7647b0e37b584e
5f94eea8c18a48920dbc33574678263f9d763fc5
6451 F20101106_AABLLB havird_j_Page_085thm.jpg
fdb61589aba4f0bc7689b0fce7a96fd9
f73da79e5478a9abced49d7219ad511536f3e1a4
1594 F20101106_AABLKM havird_j_Page_075thm.jpg
7265d93f0e6f478e9ac04880e33e5db7
2471c39a8825fe3ed142c29eb08c99490f606d48
5855 F20101106_AABLJY havird_j_Page_065thm.jpg
230f61fae6f735c9111137b7eddc7665
d10a5ddd3737baf5dad6547cdd3338287d8b5e08
1961 F20101106_AABKGW havird_j_Page_019.txt
e815c8da79824c9d7a73c058ba1b0a55
b49ca9d27cd458f330578acb7d137abf79c0a834
F20101106_AABKHK havird_j_Page_125.jp2
d231ccdc176bfea6fc064ca3f3ff2715
8610e03d983b50ff5f1be1c33b68026543e5d066
3120 F20101106_AABLLC havird_j_Page_086thm.jpg
2eb07563ba85a8ac2d308089d88a5c6f
c6d0bf5ea189799c3e46b747d19c00287c18f760
43543 F20101106_AABLKN havird_j_Page_076.QC.jpg
bb9ce6387986547b6b2a53345f489e7e
61172de9c845008553c38763d08e76c15e5e7551
18695 F20101106_AABLJZ havird_j_Page_066.QC.jpg
fbcba484f535e35355a32e96fd8a7c1f
2af60e9b3ad6380e1feb51d703c1aba402e2a409
F20101106_AABKGX havird_j_Page_089.tif
508f1c41184e6349217c16e0c3f206b5
6a86189b891a750745a335b209e7209b23dc2114
5455 F20101106_AABKIA havird_j_Page_129thm.jpg
2264a087b3d9bc73e8b6cbc3ff3b8291
71f38257ecd722a3fddc91ebc2f572f9a9ef5e1f
36815 F20101106_AABKHL havird_j_Page_036.pro
7e456e9707ef2f81b9e1b5447a665ed0
ee3452688f2a876f18bf41c5a496b4b6b0da3b69
16692 F20101106_AABLLD havird_j_Page_087.QC.jpg
05d4d2ce417978bc21e3be69573fb397
9348f60a2de7602fd87f2dab10643bf90c2f0956
3743 F20101106_AABLKO havird_j_Page_077thm.jpg
b2483a5875888bd9a06283ffb21f0137
ba6e923a8dccc75fd220c0e62cb4789507673f2b
39537 F20101106_AABKGY havird_j_Page_043.QC.jpg
86d138eb2ffad2a5f4b6c9ccd67eeffa
7b2684b72abcc33ce95620656c919edf240ba90f
1051894 F20101106_AABKIB havird_j_Page_039.jp2
1a8e558a12d2f7f88363ecc04400e4f1
e13ab0be9c4ac48d012469606380ef0bf3964683
49469 F20101106_AABKHM havird_j_Page_019.pro
4a60390cf11b6017df06234713a766c0
b0e5054f8b28cc40633f9c32922cd3d7bc2480c2
3786 F20101106_AABLLE havird_j_Page_087thm.jpg
3faa2c3ef35879dc6813c652ce4e7af8
2deaf9f2236bfaf4f8538aad3d27f550cda912ad
42177 F20101106_AABLKP havird_j_Page_078.QC.jpg
d3f82a2eec4f4d527124535aa89a9807
8ce245b8f1f7da09069b32add14bb04478e5b3db
974 F20101106_AABKGZ havird_j_Page_084.txt
115ada312fb4eb0ddba3d896cf6a28c7
c24da2c691338bb945faf827c18d9f86b3b0a2ec
83731 F20101106_AABKIC havird_j_Page_076.pro
aef81ae932352fe1db02740da9448a97
20355da7f9cd12fb33766a78d4fc9654210c30a8
F20101106_AABKHN havird_j_Page_126.tif
6964cc2e2b849c9d411a990f5dcb5d5d
251cfbeb548309a28e94c85347b3b6519dbeb7d9
11842 F20101106_AABLLF havird_j_Page_088.QC.jpg
5abf5b94870ba4f9f08feaf92c318da2
c4ecc8ea5b674b90481356c935b45673363c1d9c
10221 F20101106_AABLKQ havird_j_Page_078thm.jpg
8a925a211c0588dd401aaaefd2c41a46
01ae10279749982d2aab96b0202c94d66dd66a22
2607 F20101106_AABKID havird_j_Page_124.txt
a03703d6c1318f5d0cec835019bc25a7
f071f7f1cffda23fda883bff646ad6320a18d42a
48826 F20101106_AABKHO havird_j_Page_013.pro
e330b0b0d43099d682943547dba73d06
2ce774d8234e4478a2ce2501075bde00a635f642
F20101106_AABLLG havird_j_Page_089thm.jpg
6dba593f3c33906a5cd370afc2c271ea
8a0f3bfb12103ea4391420e341d73515a50780f8
15886 F20101106_AABLKR havird_j_Page_079.QC.jpg
1681bc197076f6bfd670f54e50419b84
c4401af7dc9fdb2a86587e1b90a8f04a72f901e4
426821 F20101106_AABKIE havird_j_Page_012.jp2
455fa4fca3159f999cd1eef4e077b9bf
40519a2086128ca893925a53906e4e67db2a955b
49227 F20101106_AABKHP havird_j_Page_017.pro
c0643e5f88fd707608b854ff87687a6e
abcdba974b750276222f85cac233b9bef97bcbfa
5442 F20101106_AABLLH havird_j_Page_090thm.jpg
1bb5d0b82ace293912f35fc1c6d9d421
0ac6aab679c6f32021fc729eeb4859f00ffe1acc
10472 F20101106_AABLKS havird_j_Page_080thm.jpg
aeb6873f7777120338eb4fdadb61a8e8
e969b2d3776116dc861e755566df36e2e59ffe95
45499 F20101106_AABKIF havird_j_Page_101.jpg
283497f0cef6695dc8c405a541d79c6f
dbf036b3e89e6a0aec5464b262bde5a936b0be1f
37760 F20101106_AABKHQ havird_j_Page_034.pro
4239e78032939f7e8a7dc520c2b6e3d4
189ef76de009c145cdc5f5bbf0a6057bbafb6906
14307 F20101106_AABLLI havird_j_Page_091.QC.jpg
22d90e8dd2a22366601b473ff0276397
a82498bbca70381899b8819ff047c3a1ac2b4142
5355 F20101106_AABLKT havird_j_Page_081.QC.jpg
515c12746312a46f8ef0dc79c32b918e
8679eee75735b876c55cca972c0c2c065f24ccd8
1051948 F20101106_AABKIG havird_j_Page_022.jp2
b498d2f896ef2f442a793b0cb62c3e2a
f11225569411390b0a9cf2576233d3c64b3b5cb9
F20101106_AABKHR havird_j_Page_037.tif
3db6b660d96bbf65b6e5d4da8609c0ff
d5d5b7e4bebe958405dcf3a30f08b2395788ee3d
13760 F20101106_AABLLJ havird_j_Page_092.QC.jpg
3ad6a22495327b9136ce78de98fee272
e41c37f9b5ad09a2e298275481a137c8d1516109
1737 F20101106_AABLKU havird_j_Page_081thm.jpg
e6c01e5372f32ff2952989b75b9df0c2
2bb6fa7054e2b19f1cb1a005bf1382378639fade
36644 F20101106_AABKIH havird_j_Page_070.QC.jpg
44bb0ac43769786eea9d7f5303eaae61
c660fc2c0f913ea7140517b6c35a27e16c738a6e
35440 F20101106_AABKHS havird_j_Page_120.QC.jpg
7b6d71c63ce6ca3a997b09c628bd8ab8
daf4d2512c0d78619471c3b761235844dcd3ec69
3182 F20101106_AABLLK havird_j_Page_092thm.jpg
c19630a581fafe35eac3a03c88fb5f65
065fff527fdb0ffcedbce27409ccb5312beae336
37282 F20101106_AABLKV havird_j_Page_082.QC.jpg
cba126611c31cd1ceb56c244d098d10b
75d51aee1b53befe1c117b213ccc707192e09070
F20101106_AABKII havird_j_Page_042.jp2
88f64e7be5a10b68cd4aea2f363c0663
72966c12101d98d0080e56ab9a89dc280e467a99
813636 F20101106_AABKHT havird_j_Page_129.jp2
6543e90db3f41781d0a57007341f2a23
505fa535f92c55e52ba4e721be8da0a338f46407
8895 F20101106_AABLKW havird_j_Page_082thm.jpg
35c673f1a660369459502961ffe4db10
3f56728558ba21a5093c43c927d55ee68229fc7f
F20101106_AABKHU havird_j_Page_024.jp2
01054881ea62451a7cbb43d3915b0a64
2b2f4bfc51a01d178a0830fd359dc972711c6bbc
33289 F20101106_AABLMA havird_j_Page_105.QC.jpg
a3faa17253276697a11f1c0010d95ef3
d6c359c62ba320fdf5c8067bfbe54909e2ee18b8
4946 F20101106_AABLLL havird_j_Page_093thm.jpg
6491898caa80cb24799b982a27c6a5bb
ef965d5493d5a0d194ef4016ec3da5ada8a69ac6
45566 F20101106_AABLKX havird_j_Page_083.QC.jpg
d21ddf771df379bac790608be4ee1c34
fb388100e9d6aeae95382e6751bab44c59b45e02
101472 F20101106_AABKIJ havird_j_Page_016.jpg
9d7a390f04e245fea621f83b0679fd88
fa1eb68c06cbe0e4502ccefbbdc3d36270fb0b8c
10710 F20101106_AABKHV havird_j_Page_076thm.jpg
7892b8599b7ccb416937a2b49cd87fb5
900a964903897a8fec9842a682acc7c929384122
8045 F20101106_AABLMB havird_j_Page_105thm.jpg
960d10b459c4ad84212b3306951fb596
b7979f88c390e16fe8d2595d1b33163e4b53556f
2374 F20101106_AABLLM havird_j_Page_094thm.jpg
f3bf5a5f79383197b94abc452a27c3a3
241e6a609d207fe60b1fd4a31182557aa1a99ac9
10769 F20101106_AABLKY havird_j_Page_083thm.jpg
fa6f13c93fabc7a8097626099dc3dbca
6f44f5e6c16eb3c8898b9cb37647f6dc6c36d524
2064 F20101106_AABKIK havird_j_Page_041.txt
ee0953fbdf0a90cc36c35f0aabe67019
5a56c61207385f6da287ea30633285737adf2595
F20101106_AABKHW havird_j_Page_113thm.jpg
548f509d9e33ac0b9dc54c84e96baece
a7e49e0b306290c1bbf3e02fadbf7dfd16769490
35347 F20101106_AABLMC havird_j_Page_106.QC.jpg
0bae5a3b4afbd47b08555b2cc45a3bbf
42ceb6bbd98cb3e722f992b116718a7d71bf4b70
14537 F20101106_AABLLN havird_j_Page_095.QC.jpg
e4aac01f9b2f8092051b4704ef3d60e5
2bdae3563124fbda59c9191ceedf4b1af64fb13f
13922 F20101106_AABLKZ havird_j_Page_084.QC.jpg
6a6646f8af1d53624d2fb11064683197
4bc824df15a318e5798b75bf013f17c8b2d01eb8
3375 F20101106_AABKJA havird_j_Page_088thm.jpg
cc2b27bbcbb7193e1732770c8d2fecc1
e9d6092de59106f56af0a3c4e2fc9a3c3e0ecd59
36770 F20101106_AABKIL havird_j_Page_058.QC.jpg
ad36e7ed93bda0110a3f0a6856a1fdc8
0d451ffe3a6ee04b501b6a8d82bafa5ef1dbc715
9158 F20101106_AABKHX havird_j_Page_121thm.jpg
a838cf9813f21def8804c6de7a68666c
02a29a77bcbff9f51b51003a5f5381766e9fc6f7
8425 F20101106_AABLMD havird_j_Page_106thm.jpg
b1a379f16ae0c9359995c15bae6429bd
8d3c6bb25142543023116edce72efb4a182ab4f3
10674 F20101106_AABLLO havird_j_Page_096.QC.jpg
b42c1b353e3b2b7ef51754843400f030
095ac4773858ef6095a690e37fb5e2ccca1cbbf8
33618 F20101106_AABKJB havird_j_Page_038.jp2
96c2f8110be779cba26d306149cc975d
03a3a1e9c1b2bb1b588eef96dbe5964e601ce1cf
1476 F20101106_AABKIM havird_j_Page_089.txt
10745c2717ba9e710643111c0fbd794a
a664b2fb447e3992fb426ed8f4833f9195e1078f
F20101106_AABKHY havird_j_Page_071.tif
b7aff1857c13c8e75aa3bdec87256082
762f16a74036fce61be1d843c3173bacde67e8b4
8888 F20101106_AABLME havird_j_Page_108thm.jpg
18fcf3d6bac3ec40c69bb857b4ac3c48
e696e628082994baceeb73820f1923890757a983
5377 F20101106_AABLLP havird_j_Page_097thm.jpg
8a1e61d419d007034401fb5e4e160541
ace8323c40eb924bea361ac0e3780b9b94d85d49
80210 F20101106_AABKJC havird_j_Page_007.pro
d6cc1c91856eddc065d4e718d8763d4e
83b87df92905b7026232fedca40794b07db65ed2
9301 F20101106_AABKIN havird_j_Page_125thm.jpg
165baedc97486c48d4ef2859ff38b778
08b4d46356bc62bfc5ecff2691504e062c026756
F20101106_AABKHZ havird_j_Page_025.jp2
fe02ace4bc382c7633dfc649e7f57d81
0fbf89f9b3de3f6f5e1b566036d428202fd4fc8f
37339 F20101106_AABLMF havird_j_Page_109.QC.jpg
780605081004a186724d3e3d8dae4f9e
0908ae50703e55f0d2f86cd385204f1e1a2b24e0
15236 F20101106_AABLLQ havird_j_Page_098.QC.jpg
39c1364e584d0a778d18dcba764bec07
9027ad796d94faba111aa78faf9256a9a6d3c045
59256 F20101106_AABKJD havird_j_Page_093.jpg
372ef79b26b023b20b093a69a88ab4dc
bca875d1bd836bbf9c7ce5f8934bf6cbe90c03c2
18784 F20101106_AABKIO havird_j_Page_037.QC.jpg
61d3da7c7162109632d3f58f8381443e
cb327c274b07ec42ba0a0cfdcf221129d4f9c7e7
8890 F20101106_AABLMG havird_j_Page_109thm.jpg
6558daa8895831e2f0c477c4d6eb3f53
e71f31949781e5f42f6688a6e153df924ecd14d8
4342 F20101106_AABLLR havird_j_Page_098thm.jpg
26896a4c88ecba36c24b917e24a64b00
c8b3c2ef63732315273226da24b21cf0a3bf6ef4
F20101106_AABKJE havird_j_Page_122.tif
4716d41c8874797c17c5e6afd03c132b
4dfeff3f43cd21a57b531db156b8d7613fd74367
834334 F20101106_AABKIP havird_j_Page_113.jp2
355306a981e90cc48bac94cab3d486a3
507bebb10c87e77af4cf6218986272b6d5f9ecb1
36049 F20101106_AABLMH havird_j_Page_110.QC.jpg
3a771b9059ed1b28a0d1c55cef5a2a46
a863b482c1dc8dfbce86be2b96f441cdb3dfdf15
2788 F20101106_AABLLS havird_j_Page_099thm.jpg
0c136c589411d07dab3feed46ae65700
56f64632e73b7551d850fa7dfd2b447707c79c72
F20101106_AABKJF havird_j_Page_007.tif
f96b90b7a42797acbb3cb69dbcd840e5
8af6485a4c60aa4ef66c9d3506d0d5bc13280688
2803 F20101106_AABKIQ havird_j_Page_123.txt
e3d7cb88c18ac49c6d8f771f75bfdb62
423dfff58f2390ed6779b2661f05dad8542fb7eb
8837 F20101106_AABLMI havird_j_Page_110thm.jpg
6f51b5f1f8a1f965cd94918b836a407f
aea4b678a2c9681b7535ff79f83f0c21bcc882c5
23931 F20101106_AABLLT havird_j_Page_100.QC.jpg
e0cea1b056df916231b5f8e3853164e4
daee84bf43427841148032ebdd51a7e2da03870c
F20101106_AABKJG havird_j_Page_123.jp2
e5b691eeeb247e3e326ea86e430f1d2f
d180c14b993ebba84091956291f7ceadb3cddb1a
55172 F20101106_AABKIR havird_j_Page_015.pro
bf6e6737cbfae3c7888c312b6146161e
03eec531e375f6da47c25e98960428831153f174
38159 F20101106_AABLMJ havird_j_Page_111.QC.jpg
6c4ff6b4045b3a06e2c948978c62e378
3bb25be50885e88643eeb4008bd0e401ec7086b1
15490 F20101106_AABLLU havird_j_Page_101.QC.jpg
88306d7b1f8fc226835821fb835737d2
f6c4ff740c675c167e9582ae9de7c092abdae348
18401 F20101106_AABKJH havird_j_Page_007.QC.jpg
ec2e8e2e3eed92ef681527c2159bfc59
c57ac5c3589f6704ba4bb74fa0977a012b83aa6e
F20101106_AABKIS havird_j_Page_118.jp2
246d904feda2ed29df3e5795393a6724
911647c2a0b782f0bb7f529cb91e41eeba7cdf8d
17904 F20101106_AABLMK havird_j_Page_112.QC.jpg
8ee84aa41dbf711a4062212c045fad2c
ec3081c57f36a7ad09267b75498bbae98ecd1c63
5466 F20101106_AABLLV havird_j_Page_101thm.jpg
a9690c60c22e90d4f536984f5a4464db
9a9864c7e9b17a8a361af1cc9e55f82539cfdd96
8699 F20101106_AABKJI havird_j_Page_018thm.jpg
dacc135ea775f94ab7f1fabca04f5eeb
ab00b8f11beb54ef8ec5768d3ab196f715c5dd1b
8294 F20101106_AABKIT havird_j_Page_009thm.jpg
e769d9c4dc94f39d2329fcc52ceecb0e
b6af181be7904622a98b4bf4c87c226bf2d8b85b
4451 F20101106_AABLML havird_j_Page_112thm.jpg
8bcffad250d88f6cfbec57316788613d
64cff8188bbf560f98d72d5a952fb6bf428d57cc
16201 F20101106_AABLLW havird_j_Page_102.QC.jpg
c32d822385dc4df352b56f103686ff73
c6bf0ec56330f380b3acb18d66fe622329a43c3e
50343 F20101106_AABKJJ havird_j_Page_026.pro
b6073ecfed14672a548793fb88a847d9
a423a25c5ff5167c963dbdaef424d20156589723
2182 F20101106_AABKIU havird_j_Page_055.txt
da24ae465e3ff78b646009abc59503f6
edc7fc06aafb4b2abf7ee6f7b915faa2b75485cb
36490 F20101106_AABLNA havird_j_Page_125.QC.jpg
811f2b910a11f186bf93ef7e25a7fe40
9202ef51190fecae9d06d596fb45bed4732685df
15254 F20101106_AABLLX havird_j_Page_103.QC.jpg
84a79bacdf437fd734348b4cffc5582d
4747aefd961b79d55941d7ac17efbcf52c74537f
874668 F20101106_AABKIV havird_j_Page_090.jp2
036285594c0fb9fe3f75c0ae782efca8
bca0482ada215f09944f21b6b46ee5698d34dfc7







EVOLUTION OF CYCLOOXYGENASE IN THE CHORDATES


By

JUSTIN CHASE HAVIRD

















A THESIS PRESENTED TO THE GRADUATE SCHOOL
OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT
OF THE REQUIREMENTS FOR THE DEGREE OF
MASTER OF SCIENCE

UNIVERSITY OF FLORIDA

2008


































2008 Justin Chase Havird




























To the teachers who inspired, directed, and challenged me. My high school marine biology
teacher, Larry Joye, first introduced me to the fascinating world of life in the water and since
then my endeavors have never strayed far from it. Dr. David Evans enthusiastically welcomed
me into his lab as an undergraduate, although I had no former research experience. What started
as a part-time project soon evolved into an academic career as I was given the opportunity to
conduct original research. During this time, Dr. Keith Choe was an invaluable asset and
inspiration. Growing from this original partnership, I continued working with David on my
master's research and he has always supported my academic and research endeavors; I cannot
envision a better advisor.









ACKNOWLEDGMENTS

I most of all thank my supervisory committee chair, Dr. David H. Evans. Although

David was nearing retirement and had resolved to not accept any new students, he welcomed me

as a graduate student without any hesitation. He has guided me in developing research

strategies, implementing those strategies, and interpreting the results. He has always supported

my projects and none of them would have been accomplished without his enthusiasm.

I also thank my supervisory committee members for their commitment to my research

and their willingness to share their expertise. Dr. Michael Miyamoto contributed heavily to the

phylogenetic aspects of my project and encouraged me to be thorough in my analysis. When I

started this project I knew very little about generating meaningful evolutionary relationships.

Michael selflessly took the time necessary to make sure I understood how to develop a

biologically relevant reconstruction of evolutionary changes that took place over 600 million

years ago. He also put his own projects aside while I used his computers for months at a time.

Finally, his guidance was absolutely necessary in interpreting the conflicting results of my

analyses. Dr. Marty Cohn was a great influence on my research and prompted me to think in an

integrative and comparative framework. He generously allowed me to use his lab space. His

expertise working with evolutionarily interesting chordates was invaluable. His students also

graciously helped me learn many of the techniques used in this research.

I am also indebted to several colleagues for their assistance. Dr. Keith Choe pioneered

and taught me many of the molecular techniques now commonly used in the Evans' lab that were

critical to this research. He spent countless hours with me in multiple laboratories

troubleshooting problems, explaining theory, and developing this research. He also encouraged

me to work with the hagfish, lamprey, and amphioxus and continually helped me develop new

ideas and strategies. Dr. Kelly Hyndman was also constantly supportive of this research. She









taught me the localization techniques used here and also helped with many aspects of retrieving

and analyzing genetic data. Finally, she was always receptive to critical discussions of my

research and tackled every circumstance in a friendly, often contagious manner.

I am very thankful to my family and friends for their continued support of my education

and research. My entire family has been very interested in the research I have undertaken and

when they were not interested they feigned interest in order to make me happy. My parents,

Kurt and Dawn Havird, have encouraged my desire to be a scientist, and have been

overwhelmingly supportive during my academic career; often in the form of food, clean laundry,

or money. My friends have also been very supportive of my research interests: fellow scientists

have empathized with the typical problems associated with research and non-scientists have

given me the confidence to persevere.

I also thank the following people for providing help with this project in particular, other

related projects, or the daily support needed to become a successful student: Dr. James B.

Claiborne, Rachel Rose, Dr. GuangJun Zhang, Donovan German, Justin Catches, Andrew

Diamanduros, Sara Takeuchi, Jim Stidham, Curtis Lanier, Julia Curtis-Burnes, Oriana Galardi-

Este, Rebecca Kreh, Dr. Susan Edwards, Gini Luchini, Makesha Foster, Emily Cornwell, Dr.

Larry Page, Pete Ryschkewitsch, Frank Davis, Diana Davis, Cathy Moore, Karen Pallone, Vitrell

Sherif, Dr. David Reed, Dr. Paul Lewis, and the laboratories of Dr. Lou Guillette and Dr. David

Julian.

My research was primarily funded by National Science Foundation grants IBN-0089943

and IOB-0519579 to David Evans. A grant-in-aid of research to Justin Havird from Sigma Xi

also supported a portion of this research. Finally, initial support was provided in part by a

University Scholars award to Justin Havird.









TABLE OF CONTENTS

page

A CK N O W LED G M EN T S ................................................................. ........... ............. .....

L IST O F TA B LE S ......... ..... ............. ................................................................... 8

LIST O F FIG U RE S ................................................................. 9

A B S T R A C T ........................................... ................................................................. 1 1

CHAPTER

1 GENERAL INTRODUCTION ............................... ......................... 13

Introduction ............................ ... ............................. ...................13
Cyclooxygenase Evolution ............................................................. ...................... 16
M a m m a ls .........................................................................................................................1 7
F ish e s ................... ...................1...................8..........
O th er V erteb rates ................................................................................ 19
O th er C h o rd ate s ......................................................................................................... 19
Cyclooxygenase Function in M ammals................................. ................... 20
G gastrointestinal Tract .......................................................................... 20
T h e K id n ey ................................................................2 1
P late lets ................... ...................2...................3.........
R e p ro d u ctio n ............................................................................................................. 2 3
N ervou s Sy stem ....................................... ................................................... ............... 25
Cyclooxygenase Function in Non-Mammals ......................................... ............... 27
Fishes ................. .................................................................27
Osmoregulation .................................. ..... ....................... 27
R production .............................................................29
D differential functions of novel form s ............. .. ......................... ....................30
O their functions .................................................... .... ..................... 30
A m p h ib ia n s ................................................................................................................ 3 1
Reptiles ...... .................................. ......... ........ ....... ....... ............... 31
B ird s ...........................................................................3 2
Stu dy O v erview ................................................................33

2 CYCLOOXYGENASES IN THE ANCESTRAL CHORDATES: SEQUENCE AND
PHYLOGENETIC ANALYSES ............................ ........ 39

Introduction ............................................. ..................39
M materials an d M eth o d s ...........................................................................................................4 1
Animals and Holding Conditions ................................................41
Tissue Collection ............... .... .. ......... ... .. ................ ................ 42
Reverse Transcription, Primer Design, PCR, Cloning, and Sequencing......................43
5' and 3' Rapid Amplification of cDNA Ends (RACE)..................................................45


6










Sequence Analysis............................... ... ...... .... ............ ......45
Phylogenetic Analysis .................................... ..... .......... .............. .. 46
R esu lts .. ............ .... .... ....... .....................................................4 8
M olecular Identification of Cyclooxygenases.............................................................. 48
B ra n ch io sto m a ................................................................................................... 4 8
M y x in e ..............................................................................4 8
P e tro m y z o n ......................................................................................................... 4 8
F u n d u lu s ............................................................................................................. 4 9
Myoxocephalus ............................................. 49
Sequence Analyses ................... ......................... 50
Teleosts COX-la, COX-lb, and COX-2 .................................... .................... 50
Lamprey, hagfish, and amphioxus COX forms............................................... 52
P hylogenetic analy ses ............................................................53
D iscu ssio n ................... ...................5...................6..........
N o v el C O X F o rm s ..................................................................................................... 5 7
P hy log en etic A n aly ses............................................................................................... 5 8
S u m m ary ............................................................................... 6 2

3 SUMMARY AND FUTURE DIRECTIONS ................................................105

S u m m ary ................... ...................1...................0.........5
N ovel COX Sequences ............................................................................ 105
P hy log en etic A n aly ses............................................................................................. 10 6
F u tu re D ire ctio n s ............................................................................................................ 10 6
Completion of Novel Sequences ......................................... ...............107
Additional Phylogenetic Analysis ................................. ........................... ...107
Additional Sequences ......................................... ................... ...........108
A d d itio n al T ax a ....................................................................................................... 10 9
Function of C yclooxygenases ........................................................................ 110

L IST O F R E F E R E N C E S ....................................................................................................... 117

BIOGRAPHICAL SKETCH .........................................................................130



















7









LIST OF TABLES


Table page

2-1. Degenerate primers used in PCR ........................................................ ............. 64

2-2. Amphioxus COX specific primers used in PCR..................................... ............... 65

2-3. Hagfish COX specific primers used in PCR........................................... ............... 66

2-4. Lamprey COX specific primers used in PCR ............................................ ............ .... 67

2-5. Killifish COX specific primers used in PCR.................. ...... ...............68

2-6. Sculpin COX specific primers used in PCR ................. .......................................... 69

2-7. Sequences included in phylogenetic analyses......................................... ............... 70

2-8. LRTs between amino acid based models of COX evolution.................. .....................72

2-9. LRTs between tree topologies with altered positions of hCOX and 1COX .......................73









LIST OF FIGURES


Figure page

1-1. Cascade of reactions depicting the conversion of arachidonic acid to the primary
prostaglandins via catalyzation with either cyclooxygenase (COX) form ......................35

1-2. General phylogeny representing the different COX forms in the fishes .........................36

1-3. Accepted evolution of ancestral chordates (Pough, et. al, 2005)...................................37

1-4. Evolution of COX forms in the chordates, based on Jarving et al. (2004).....................38

2-1. Amino acid alignment of the forms of COX sequenced from the gills of the
euryhaline killifish (Fundulus heteroclitus)..................... .... ......................... 74

2-2. Amino acid alignment of the three forms of COX sequenced from the gills of the
longhorn sculpin (Myoxocephalus octodecemspinosus): COX-la, COX-lb, and
C O X -2 ................... ........................................................... ................ 7 6

2-3. Amino acid alignment of the forms of COX sequenced from the gills of the lamprey
(Petromyzon marinus), hagfish (Myxine glutinosa), and amphioxus (Branchiostoma
lancelolatum), along with sCOX from the dogfish (Squalus acanthias, Accession
#A AL37727) ............................................................... .... ...... ......... 78

2-4. Amino acid alignment of 1COX sequenced from the gills of the lamprey (Petromyzon
marinus), with COX-1 and COX-2 forms from vertebrates (Accession # NP_032995,
NP_035328, XP_425326, XP_422297, AAS21313, and NP_705942).............................80

2-5. Amino acid alignment of 1COX sequenced from the gills of the lamprey (Petromyzon
marinus), with COX-1 and COX-2 forms from vertebrates (Accession # NP_032995,
NP_035328, XP_425326, XP_422297, AAS21313, and NP_705942).............................82

2-6. Amino acid alignment of COXc and COXd sequences from the lancelet
(Branchiostoma lancelolatum) with COXa and COXb sequences from the sea squirt
(C io n a in testing a lis)............................................................................................... .. 8 5

2-7. Evolutionary history of COX sequences inferred using the minimum evolution
method with a distance optimality criterion ............. ............................................. 87

2-8. Evolutionary history of COX sequences excluding hagfish (hCOX) and lamprey
(1COX) sequences inferred using the minimum evolution method with a distance
optim ality criterion ........ ......................................................................... ....... .. .... 89

2-9. Evolutionary history of COX sequences inferred using a maximum likelihood
optim ality criterion ........ ......................................................................... ....... .. .... 90









2-10. Evolutionary history of COX sequences excluding sequences from the hagfish
(hCOX) and lamprey (1COX) inferred using a maximum likelihood optimality
criteria n ....... ......... ......................................................................... 9 2

2-11. Alternate likelihood ratio test (aLRT) scores for branch support of COX sequences.......94

2-12. Alternate likelihood ratio test (aLRT) scores for branch support of COX sequences
excluding hagfish (hCOX) and lamprey (1COX) sequences..............................96

2-13. Evolutionary history of COX sequences inferred using a Bayesian optimality
c rite rio n ................... .......................................................... ................ 9 7

2-14. Evolutionary history of COX sequences excluding hagfish (hCOX) and lamprey
(1COX) sequences inferred using a Bayesian optimality criterion ..................................99

2-15. The 21 alternate tree topologies generated to test the effects of relocating the hagfish
(hCOX) and lamprey (1COX) sequences on the likelihood score (Ln L) ......................100

2-16. Unrooted phylogeny showing the most likely scenario for COX evolution in the
chordates based on several other analyses ............................................ ...............104

3-1. Euryhaline killifish (Fundulus heteroclitus) COX-lb mRNA expression following
procedures outlined in Choe et al. (2006) ............................ .................................... 113

3-2. Longhorn sculpin (Myoxocephalus octodecemspinosus) COX-la and COX-2 mRNA
expression following procedures outlined in Choe et al. (2006)...................................114

3-3. Atlantic hagfish (Myxine glutinosa) COX (hCOX) mRNA expression following
procedures outlined in Choe et al. (2006) .................................................................... 115

3-4. Sea lamprey (Petromyzon marinus) COX (1COX) mRNA expression in various
tissues following procedures outlined in Choe et al. (2006) .................................. 116









Abstract of Dissertation Presented to the Graduate School
of the University of Florida in Partial Fulfillment of the
Requirements for the Degree of Master of Science

EVOLUTION OF CYCLOOXYGENASE IN THE CHORDATES

By

Justin Chase Havird

May 2008

Chair: David Evans
Major: Zoology

Cyclooxygenase (COX) is the enzyme found in animals responsible for converting

arachidonic acid into prostaglandins. These prostaglandins can then perform multiple functions

including regulation of inflammation responses, changes in vascular tone, and ion

transport/osmoregulation. Before this thesis, only two main forms of cyclooxygenase (COX-1

and COX-2) and one ancestral form (Ciona COX) were known from the chordates. I sequenced

COX genes from several hitherto uninvestigated chordates in order to determine a more

comprehensive scenario for the evolutionary history of cyclooxygenase in the chordates.

After designing primers, partial COX sequences were obtained from the Sea Lamprey

(Petromyzon marinus) and amphioxus (Branchiostoma lancelolatum). Complete COX

sequences were obtained from the Atlantic Hagfish (Myxine glutinosa), euryhaline killifish

(Fundulus heteroclitus), and longhorn sculpin (Myoxocephalus octodecemspinosus). These novel

sequences along with other known COX sequences were then subjected to a variety of

phylogenetic analyses using standard techniques. The results of these analyses suggest a

complex history for the evolution of cyclooxygenase in the chordates.

There appears to have been at least 3 evolutionary independent origins of COX in the

chordates. The forms from the sea squirt (Ciona intestinalis) (COXa and COXb) represent the









most ancestral forms, the forms from amphioxus represent another independent origin (COXc

and COXd), and the vertebrate forms (COX-1 and COX-2) represent yet another origin, with the

hagfish and lamprey as likely basal members. Furthermore, the teleosts appear to have duplicate

COX-1 (COX-la and COX-lb) or COX-2 (COX-2a and COX-2b) forms. These results agree

with previous studies and reveal novel information about COX forms in the chordates. More

intense sampling of other chordates could reveal other novel origins of COX or contribute to a

more robust understanding of COX evolution. Finally, the function of most non-mammalian

COX forms remains to be investigated.









CHAPTER 1
GENERAL INTRODUCTION

Introduction

Cyclooxygenase (COX) is the enzyme responsible for the rate limiting step that converts

arachidonic acid to Prostaglandin G2 and Prostaglandin H2. Arachidonic acid is an essential fatty

acid required by most mammals and can be obtained by the conversion of linoleic acid found in

plants (occurring in herbivores). Some animals cannot convert linoleic acid into arachidonic acid

and therefore must obtain it from other animals (obligate carnivores). COX oxidizes arachidonic

acid to make the hydroperoxy endoperoxide Prostaglandin G2, which is then reduced to form the

hydroxy endoperoxide Prostaglandin H2. Prostaglandin H2 can then be converted to the primary

prostanoids (Prostaglandin 12, Prostaglandin D2, Prostaglandin E2, Prostaglandin F2u, and

Thromboxane A2) by a variety of enzymatic and non-enzymatic pathways. Therefore, the

expression of COX can directly influence the amount of prostaglandins that are synthesized due

to the arachidonic acid cascade (Vane et al., 1998, Fig. 1-1).

Prostaglandins are found in vertebrates, some invertebrates, and possibly even in plants

(Rowley et al., 2005; Ryan, 2000). In mammals, they are expressed in virtually all tissues and

have a myriad of physiological functions, but they mainly regulate vascular tone in smooth

muscle by acting as vasodilators and vasoconstrictors. In addition, prostaglandins are key

regulators of such diverse processes as salt and water homeostasis in the mammalian kidney

(Harris and Breyer, 2001), protection of stomach lining (Kargman et al., 1996), platelet

aggregation in blood (F6rster and Parratt, 1996), birth (Challis et al., 2002), and central nervous

system function (Hopkins, 2007). They also may play prominent roles in pathological states

such as fever, inflammation, and cancer (Vane et al., 1998).









Prostaglandins were first extracted from semen, prostate (hence the name prostaglandin),

and seminal vesicles by Goldblatt and von Euler in the 1930s (von Euler, 1936) and were shown

to affect blood pressure. The reaction that catalyzes Prostaglandin G2 synthesis was first

characterized in the 1970s (Hamberg and Samuelsson, 1973; Hamberg et al., 1974), but it wasn't

until 1988 that cyclooxygenase (COX) was first described as the enzyme responsible for

endoperoxide synthesis by three separate groups (DeWitt and Smith, 1988; Merlie et al., 1988;

Yokoyama et al., 1988), all of which described a COX from sheep seminal vesicles which was

later named COX-1. However, before COX-1 was isolated there was early evidence that

multiple COX forms existed, based on prostaglandin activity in the rat brain and spleen (Flower

and Vane, 1972). In the early 1990s, a second COX form was cloned from mouse and chicken

fibroblast cell cultures and was named COX-2 (Kujubu et al., 1991; Xie etal., 1991; O'Banion et

al., 1992). This discovery would later prove to be of major importance in the field of

prostaglandin biology due to the development of drugs that could selectively inhibit the different

forms of cyclooxygenase.

Both forms catalyze the reactions that form prostaglandins from arachidonic acid, but

early studies suggested that COX-1 was constitutively expressed in many tissues, while COX-2

was an inducible isoform that was expressed in response to physiological stimuli (Funk, 2001).

Because basal expression of COX-2 was low in some cell types and COX-2 was found to be

expressed much more so than COX-1 in response to mitogens and cytokines, it was assumed that

COX-1 was constitutively expressed at basal levels and served a housekeeping function and that

COX-2 was inducibly expressed to serve in inflammatory functions (Kujubu et al., 1991; Xie et

al., 1991; O'Banion et al., 1992). However, this was later shown to be an oversimplification

(Funk, 2001). Notably, it was shown that COX-2 is constitutively expressed in the mammalian









kidney, where it regulates blood flow and ion transport in the Loop of Henle (Harris and Breyer,

2001) and plays a role in cell survival in medullary interstitial cells during dehydration (Yang et

al., 2002; Yang, 2003).

Despite their potential functional differences in different tissues, COX-1 and COX-2 are

biochemically very similar. Both are inhibited by nonsteroid anti-inflammatory drugs

(NSAIDs), such as aspirin, due to competition with arachidonic acid for the active sites of the

enzymes or irreversible acetylation (Vane, 1971). Both proteins in humans are -600 amino acids

and share about 63% sequence similarity with each other. However, the proteins originate from

different genes on different chromosomes and encode different mRNA transcripts. COX-1 comes

from a much larger gene (22 kilobases) than COX-2 (8 kilobases). The amino acid residues that

form the binding and catalytic sites (the functionally important sites) as well as the adjacent

amino acids are all identical in human COX-1 and COX-2, except for two substitutions. At

positions 434 and 523, valine is substituted for isoleucine in COX-2 when compared to COX-1.

These substitutions have been implicated as the most likely reason behind the biochemical

differences between COX-1 and COX-2. COX-1 appears to be more selective in terms of the

fatty acids it will accept as substrates than COX-2 (Otto and Smith, 1995). COX-2 selective

inhibitors have offered an insight into the biochemistry behind the different forms. These

inhibitors can differentiate between COX-1 and COX-2 with over 1000 fold specificity

(Griswold and Adams, 1996). The rationale behind these selective inhibitors is that the smaller

size of valine on position 523 in COX-2 allows the inhibitor to bind to a side pocket in COX-2,

but the larger isoleucine on position 523 of COX-1 appears to prevent this binding. When this

position is altered in both forms to the alternate amino acid, the selectivity for inhibitors is

reversed (Wong et al., 1997; Gierse et al., 1996; Guo et al., 1996), suggesting that this residue









plays a critical role in differing biochemical activity. COX-2 selective inhibitors were thought to

be a major medical breakthrough due to the ability to stop disease induced inflammation without

affecting normal prostaglandin levels produced by COX-1 and therefore causing minimal side

effects. However, due to the constitutive expression of COX-2 in certain tissues (especially the

kidney), COX-2 selective inhibitors may not be as affective as once thought. It is important to

remember that COX-1 and COX-2 are very structurally similar and that their main difference is

due to expression.

As outlined above, COX form and function have been extensively studied extensively in

mammals, especially humans. However, non-mammalian COX forms and their functions have

not been examined in great detail in other chordates. The goal of this research was to

characterize COX evolution in the chordates, with specific attention on the more evolutionarily

ancestral chordates. Describing ancestral COX forms is the first step in elucidating the evolution

of COX function, which may lead to a better understanding of overall COX function, and even

the development of new drugs. In this chapter, I give a brief overview of COX evolution and

function in the chordates, concluding with a brief summary of the research described in the

following chapters.

Cyclooxygenase Evolution

Like mammals, most vertebrates appear to have two homologous copies of

cyclooxygenase named COX-1 and COX-2. However, other COX forms exist throughout the

chordates, including variants of COX-1 and COX-2 as well as forms representing independent

origins of COX that are not closely related to COX-1 or COX-2. There are also COX forms in

corals and other invertebrates (Jarving et al., 2004), but the focus of this section is to review the

forms found in the chordates.









Mammals

COX-1 and COX-2 sequences have been either cloned or derived from genomic

sequences for most of the classic mammalian model species, including mouse (Accession#

NP_032995 and NP_035328), rat (Accession# NP_058739 and NP_058928), dog (Accession#

NP_001003023 and NP_001003354), cow (Accession# XP_869575 and NP_776870), sheep

(Accession# NP_001009476 and NP_001009432), and rabbit (Accession# NP_001076150 and

NP_001075857). COX sequences also exist for rhesus monkey, guinea pig, pig, horse, and

mink, but these are either partial sequences or are not available for both forms.

A third COX variant has been proposed to occur in mammals (Flower and Vane, 1972)

based on inhibitory studies (see below). This form is known as COX-3 or COX-lb because of its

close similarity to COX-1. Recently, a potential COX-3 (Accession# AY547265) was cloned

from mouse (Kis et al., 2006) and rat (Accession# AY523672, Snipes et al., 2005). However,

these forms likely do not participate in prostaglandin synthesis (Kis et al., 2006) and are not a

separate COX form. Furthermore, a similar study using an artificially created human COX-lb

found no inhibitory similarity to the proposed COX-3 enzyme (Censarek et al., 2006).

Therefore, while a third, genuinely different COX variant may exist in mammals, its sequence

remains elusive.

Analysis of the recently completed gray short-tailed opossum genome yielded the

predicted COX-1 and COX-2 forms (Accession# XP_001370514 and XP_001375945), as well

as two additional COX-1 forms, named COX-lb and COX-lb2 (Accession# XP_001370542 and

XP_001370595). These forms are complete and differ in amino acid composition and length.

These are the first COX-1 variants in a mammal that do not represent modified versions of

normal COX-1 and although is has not been suggested, it is possible that one of these forms









represents the elusive COX-3 variant. Functional studies to determine how these forms differ

from normal COX have not been published to date.

Fishes

Cyclooxygenase has been sequenced in several fishes, including the rainbow trout

(Oncorhynchus mykiss) (Zou et al., 1999), brook trout (Salvelinusfontinalis) (Roberts et al.,

2000), Atlantic croaker (Micropogonias undulates), and zebrafish (Danio rerio) (Grosser et al.,

2002). These fishes, along with genomic sequence data from the stickleback (Gasterosteus

aculeatus), green spotted puffer (Tetraodon nigroviridis), pufferfish (Takifugu rubripes), and

Japanese medaka (Oryzias latipes) suggest that fishes posses both COX-1 and COX-2 forms

(Jarving et al., 2004). Furthermore, COX-2 has recently been sequenced from European sea bass

(Dicentrarchus labrax) (Buonocore et al., 2005) and euryhaline killifish (Fundulus heteroclitus)

(Choe et al., 2006), supporting this prediction.

A cyclooxygenase has also been sequenced from the spiny dogfish shark (Squalus

acanthias) (Yang et al., 2002). However, this form was not designated as COX-1 or COX-2

because of its near equal identity to both forms (it is only slightly more similar to COX-1). This

form was named sCOX by the authors and may represent an evolutionarily distinct form of

cyclooxygenase found in the elasmobranchs.

Ishikawa and colleagues have recently further characterized COX evolution in the

teleosts by demonstrating that both the zebrafish (Ishikawa et al., 2007) and rainbow trout

(Ishikawa and Herschman, 2007) have two functional COX-2 genes (named COX-2a and COX-

2b). In addition, by analyzing sequence databases, they concluded that not all teleosts have two

COX-2 forms, but that the stickleback, green spotted puffer, pufferfish, and Japanese medaka

have two COX-1 forms instead (named COX-la and COX-lb) (Ishikawa et al., 2007). They

concluded that a genome duplication before the teleosts, and a subsequent loss of either one









COX-1 or COX-2 form characterizes the species mentioned (Ishikawa and Herschman 2007)

(Fig. 1-2). This is supported by the apparent genome duplication events in teleosts (Crollius and

Wessenbach, 2005).

Other Vertebrates

Although functional studies on prostaglandin roles and cyclooxygenase are not

uncommon in other vertebrates, cyclooxygenase sequences from non-mammalian and non-

teleost vertebrates are lacking. Cyclooxygenase forms have been predicted from the chicken

genome (Gallus gallus), suggesting that birds have both COX-1 and COX-2 forms (Urick and

Johnson, 2006). Both forms have also been found in the African clawed frog (Xenopus laevis)

and COX-2 has been found in the western clawed frog (Xenopus tropicalis), suggesting that both

forms occur in amphibians (Klein et al., 2002). Functional studies suggest COX exists in reptiles

as well (Seebacher and Franklin, 2003) and the recently completed Anolis carolinensis genome

contains both COX forms.

Taken together, the presence of COX-1 and COX-2 forms in the mammals, teleosts,

birds, and amphibians suggest that both forms originated in the early vertebrates, possibly from

the duplication of an ancestral COX gene. The presence of sCOX in the dogfish indicates that

COX forms in the early vertebrates may not have diverged (in sequence or possibly in function)

to the extent that allows them to be labeled as COX-1 or COX-2, although it is predicted that two

COX forms exist in all vertebrates, since sCOX groups with COX-1 and is not ancestral to the

COX-1/COX-2 split (Fig. 1-2, unpublished phylogeny generated using the online program

PHYML) (Guindon and Gascuel, 2003; Guindon et al., 2005).

Other Chordates

Although the subphylum Vertebrata includes the majority of species in the phylum

Chordata, two other subphyla are included in the chordates: the Urochordata (sea squirts or









tunicates) and the Cephalochordata amphioxuss or lancelets). These other subphyla are basal to

the vertebrates and represent evolutionarily distinct monophyletic groups (Fig. 1-3). There is

some debate as to whether the urochordates or cephalochordates represent the base of the

chordate phylogeny, although urochordates have been generally been considered basal (Pough et

al., 2005).

Interestingly, the genomes of sea squirts (Ciona intestinalis and Ciona savignyi) predict

COX genes that are not homologous to COX-1 and COX-2. These forms (named COXa and

COXb) are basal to vertebrate COX forms and indicate an evolutionarily distinct branch in COX

evolution (Jarving et al. 2004) (Fig. 1-4). This separate branch is situated between the COX of

corals and the vertebrate COX forms (Fig. 1-4). This suggests that the COX-1 and COX-2 forms

originated sometime after the origin of the sea squirts but before the origin of the elasmobranchs

(around 550-600 mya).

Cyclooxygenase Function in Mammals

Cyclooxygenase was first described from mammals, and due to its medical importance,

its function has been intensely examined in mammals, specifically humans. Since COX

stimulates the production of prostaglandins, COX function is intrinsically linked to the roles that

prostaglandins play in everything from water balance to reproduction. Here, I review the major

functions of COX-1 and COX-2 in various mammalian physiological systems (modeled after

Vane et al., 1998), but it should be noted that mammalian COX studies are ongoing and that

COX likely plays many roles not described here.

Gastrointestinal Tract

In the stomach, prostaglandins play a cytoprotective role, guarding the stomach lining

against digestive acids and enzymes. The mechanism behind this protection is an increased

mucosal blood flow caused by the vasodilating properties of prostaglandins (specifically









Prostaglandin 12). It has generally been accepted that these prostaglandins are synthesized by

COX-1, although COX-2 is present in small amounts (Kargman et al., 1996). This is supported

by studies showing that irradiated mice have further reduced numbers of crypt cells

(cytoprotective mucosal cells) when indomethacin (a non-specific COX inhibitor) was

administered, but not when a COX-2 selective inhibitor was administered (Cohn et al., 1997).

COX-2 expression in the esophagus of patients with gastroesophageal reflux disease was

upregulated in response to acid exposure, suggesting a protective function in the distal esophagus

(Lurje et al., 2007). This may indicate that throughout the gastrointestinal (GI) track, COX-2 is

inducibly expressed in response to inflammation responses.

Furthermore, throughout the GI track, inflammatory mediators such as COX may also

serve to repair damaged mucosa (Martin and Wallace, 2006). While it seems that COX-1 is

responsible for baseline prostaglandin expression in the GI tract, COX-2 and not COX-1 seems

to be more involved in response to GI tract cancers (Ristimaki et al., 1997). However, recent

studies on patients with gastric cancer from Dalian, China showed that COX-2 expression was

infrequent in gastric cancers due to hypermethylation and that a COX-2 focused strategy for

treatment would likely be ineffective (Huang et al., 2006).

The Kidney

Prostaglandins can modulate blood flow in the kidney, as in other organs (Vane and

Botting, 1994). In addition, COX-2 has been shown to play a major role in ion regulation and

water balance in the mammalian kidney (Harris et al., 1994). It has also been shown that the

COX-2 selective inhibitor SC-58236 and several non-selective COX-inhibiting NSAIDs

(including sulindac, ibuprofen, and indomethacin) cause medullary interstitial cell (MIC) death

in the kidney, but the COX-1 selective inhibitor SC-58560 was 100-fold less potent for inducing

MIC death (Hao et al., 1999). COX-2 knockout mice also develop terminal nephropathy









(abnormal kidney function) which results in death by the third month (Morham et al., 1995).

These results suggest that COX-2, and not COX-1, plays a critical role in kidney function via

MIC cell survival. This is contrary to the original description of COX-1 as the constitutively

expressed form responsible for maintaining homeostasis and COX-2 as the inducible form

responsible for inflammatory responses.

In the kidney, COX-2 is present in a subset of tubular epithelial cells located in the cortex

and outer medulla (Vio et al., 1997). These cells are part of the medullary thick ascending limb

(MTAL), the part of the nephron that regulates extracellular fluid volume by establishing the

osmotic gradient in the medulla that concentrates urine (Hebert et al., 1981; Hebert and Andrioli,

1984). In vitro MTAL preparations have demonstrated high levels of Prostaglandin E2 (PGE2)

(Ferreri et al., 1984; Hirano et al., 1986; Lear et al., 1990) which has been shown to inhibit

basolateral Na+/K -ATPase (NKA) and apical Na+/K+-2C1 cotransporter (NKCC) in the MTAL

(Kaji et al., 1996; Stokes and Kokko, 1976; Wald et al., 1990). These proteins are critical for

NaCl reabsorption in the MTAL. Furthermore, the COX-2 selective inhibitor NS-398 has been

shown to prevent tumor necrosis factor (TNF) mediated PGE2 production in cultured MTAL

cells (Ferreri et al., 1999). TNF is a cytokine expressed in the MTAL that may be an important

mediator of ion transport by inhibiting ion uptake via a prostanoid dependant mechanism

(Escalante et al., 1994; van-Lanschot et al., 1991). Taken as a whole these results show that

COX-2 may influence ion uptake via TNF mediated prostaglandin production in the MTAL.

Therefore, COX-2 is involved in cell survival and ion transport in the mammalian kidney.

This finding is critical for treatment protocols using COX inhibitors. NSAIDs are the

most common drugs used to treat pain and inflammation with over 30 million uses per day

worldwide (Singh and Triadafilopoulos, 1999). Although the negative side effects









(hypertension, renal ischemia, and GI toxicity) associated with chronic NSAID use have been

known for some time, the discovery of COX-2 selective inhibitors suggested a treatment for

inflammation without causing disruption of normal COX function (thought to be mediated by

COX-1). The role of COX-2 in the kidney has reduced the supposed power of these new drugs

and negative side effects associated with COX-2 selective inhibitors are now well documented

(see Harris and Breyer, 2006 for a review). Furthermore, in 2005 the Food and Drug

Administration (FDA) required additional warning labeling of celecoxib to highlight side effects

and required Pfizer to remove valdecoxib from the market, both of which are selective COX-2

inhibitors.

Platelets

Interestingly, COX-1 seems to be the only form expressed in mammalian platelets.

COX-2 was not detected in human platelets using western blotting techniques (Reiter et al.,

2001) or in canine platelets using northern blotting techniques (Kay-Mugford et al., 2000). In

the platelet, COX-1 is involved in platelet aggregation (clotting) through the production of

Thromboxane A2 (TXA2). When inhibited with aspirin, COX-1 mediated production of TXA2 is

irreversibly inhibited, causing reduced platelet aggregation (blood thinning). This effect occurs

about an hour after oral ingestion of even low doses of aspirin and can inhibit platelet function

for several days after a dose (Vane et al., 1998; Vane, 1971). Inhibition of COX-1 by resveratrol

and other components of red wine is responsible for the anti-platelet activity associated with the

cardiovascular benefits of red wine consumption (Szewczuk and Penning, 2004).

Reproduction

Cyclooxygenase and the prostaglandins it produces play critical roles in almost every

aspect of reproduction in mammals, although its role in pregnancy has been studied the most









intensely. Both isoforms are likely involved in reproductive processes, with COX-1 expression

constitutive and COX-2 expression inducible (Chakraborty et al., 1996).

In a recent study, COX-2 was shown to contribute to fertility in male mice (Balaji et al.,

2007). COX-2 expression was intense in the epithelial cells of mice vas deferens and the COX-2

specific inhibitor nimesulide was shown to decrease sperm motility six hours after administration

(Balaji et al., 2007). Interestingly, although prostaglandin levels initially dropped after

nimesulide administration, they tended to rise after sustained COX-2 inhibition (Balaji et al.,

2007). This suggests that COX-1 expression may recover COX function or at least contributes

heavily to prostaglandin production in the vas deferens. A similar situation exists with respect to

human female fertility, in which COX-1 expression can recover function in cases where COX-2

is lost or inhibited (Wang et al., 2004). It also seems that COX-2 is critical for follicle

development and ovulation in women and that COX inhibitors can have severe effects on female

fertility (Sirois et al., 2004).

Prostaglandins are also important during pregnancy and labor. Generally, COX-1 is

expressed more than COX-2 during normal stages of pregnancy, and COX-1 may play an active

role in maintaining a healthy pregnancy (Trautman et al., 1996). COX-1 is expressed at high

levels is the fetal brain, kidneys, heart, and lungs (Gibb and Sun, 1996). However, both COX-1

and COX-2 are expressed in the uterine epithelium during early pregnancy and may play roles in

implantation and placental formation (Chakraborty et al., 1996). This was recently confirmed

for COX-2 in rats (Diao et al., 2007). COX-2 may play a dominant role in inducing labor.

During labor, contractions are stimulated by prostaglandins and therefore any effect causing

increased COX activity will induce labor. Up-regulation of COX-2 during intrauterine infection

may increase prostaglandins to the point of causing premature labor (Spaziani et al., 1996).









Furthermore, a similar up-regulation in sheep may reduce progesterone levels to the point that

pregnancy cannot be maintained (McLaren et al., 1996). However, it was recently shown that

during the course of pregnancy there is a gradual change in COX expression, with COX-1

dominating during early pregnancy and COX-2 dominating in later stages (Johnson et al., 2006).

It was concluded that while COX-2 is expressed at high levels in late stages of pregnancy, it is

not up-regulated suddenly to induce labor (Johnson et al., 2006). COX inhibitors can halt

premature labor by inhibiting prostaglandin production (Sawdy et al., 1997). However, as in

treatment strategies that use COX inhibitors for other problems, there are negative side effects

associated with the kidneys: renal clearance and glomerular filtration were reduced during the

first weeks of life in babies that were exposed to COX inhibitors to stop premature birth

(Allegaert et al., 2006). As in other cases, COX-2 selective inhibitors were thought to eliminate

these negative side effects but have not proven more effective than non-specific NSAIDs (Olson

2005).

Nervous System

COX-1 and COX-2 are both expressed in the mammalian nervous system and may

participate in nerve transmission, sensory processing, thermoregulation, and pain effects. As in

other systems, the use of COX inhibitors to treat neural diseases (such as Alzheimer's) is

prevalent, but is accompanied by undesired side effects that are not prevented by using COX-2

selective inhibitors.

The brain is one of the few organs that constitutively expresses COX-2 and contains high

amounts of COX-2 in the cortex, hippocampus, hypothalamus, and spinal cord (Breder et al.,

1995), whereas COX-1 is abundantly expressed in the forebrain, where it may be involved in

sensory information processing (Yamagata et al., 1993). COX-2 is expressed in both neuronal









and non-neuronal cells in the brain and is up-regulated in response to abnormal nerve activity,

suggesting a role in nerve transmission (Breder et al., 1995; Breder and Saper, 1996).

COX-2 in the spinal cord has been shown to modulate pain responses (nociception) in

both humans and rats due to peripheral pain stimulation (Martin et al., 2007; Gardiner et al.,

1997; Willingale et al., 1997). These results are expected since prostaglandins are generated at

the ends of sensory neurons during inflammatory pain (Ferreira 1972; Woolf et al., 1997).

However, the up-regulation of COX-2 over COX-1 in the spinal cord during inflammatory pain

suggests a role during pain processing in the central as well as the peripheral nervous system.

This up-regulation has been detected via increases in COX-2 mRNA (Gardiner et al., 1997;

Beiche et al., 1996) in the spinal cord of rats during inflammatory stimuli. Furthermore, COX-2

selective inhibition also affected the withdrawal reflex of rats when stimulated using a non-

inflammatory, electrical stimulus (Willingale et al., 1997). This supports the general role of

COX-2 in nociception in the spinal cord.

COX-2 also plays a thermoregulatory role in the brain by increasing prostaglandin

production in the hypothalamus during periods of fever. Injection of bacterial

lippopolysaccarides (LPS) into mammals causes a monophasic fever characterized by a single

rise in core body temperature. It has long been known that PGE2 levels increase in the

hypothalamus during fever and likely mediate the response (Ivanov and Romanovsky, 2004).

Early studies suggested that an up-regulation of COX-2 was the cause of increased PGE2 levels

during fever (Cao et al., 1997). This initial hypothesis has been confirmed, recently in COX-2

deficient mice which do not respond to LPS injection, in contrast to COX-1 deficient mice or

control mice (Steiner et al., 2005).









Cyclooxygenase Function in Non-Mammals

Although COX has been extensively studied in mammals due to its role in inflammation

and the correlating drug market surrounding COX inhibition, studies in non-mammals are

lacking. Unfortunately, it seems that although non-mammals posses the mammalian COX-1 and

COX-2 forms, these forms may be substantially different (both in structure and function) from

their mammalian counterparts (Grosser et al., 2002) and may also represent independent

evolutionary events, such as duplications of an isoform (teleosts) or independent origins (sea

squirts). In this section, I review the major studies investigating COX function in non-

mammalian chordates.

Fishes

Cyclooxygenase has likely been studied in the fishes more than other non-mammals due

to their status as model organisms. As noted above, COX forms have been found in several

fishes and along with genomic sequence data there is a general consensus that fishes possess

both COX-1 and COX-2 forms that are homologous to those found in mammals. However, there

is recent evidence that teleosts also possess an additional form of COX-1 or COX-2 (Ishikawa et

al., 2007; Ishikawa and Herschman, 2007) and some functional data also exist for these forms.

Osmoregulation

In fishes, the gills are the dominant site of acid/base regulation, nitrogenous waste

secretion, gas exchange, and ion transport (Evans et al., 2005). Several studies have investigated

the osmoregulatory role of COX in the gills of the euryhaline killifish, Fundulus heteroclitus.

This teleost can withstand instant salinity transfer between full strength seawater and fresh water

without any apparent physiological stress (Wood and Laurent, 2003). One study showed that

short circuit current across the opercular epithelium (a tissue with known ion transport

capabilities) was reduced by using a non-specific COX inhibitor (Evans et al., 2004). This









suggests that COX-2 plays a role in ion transport in fishes that may be similar to its function in

the kidneys of mammals. Further studies supported this initial hypothesis by showing that COX-

2 is expressed most abundantly in the gill, opercular epithelium, and kidney of the killifish (Choe

et al., 2006), tissues that are known to be involved in ion transport in fishes. This is supported in

the zebrafish, which shows the highest levels of COX-2 in the gills (Grosser et al., 2002).

Furthermore, COX-2 was localized in mitochondrion-rich cells in the gills of killifish, the main

sites of ion uptake and secretion in the gills (Choe et al., 2006). Finally, COX-2 expression was

shown to significantly increase following either hypotonic or hypertonic salinity transfers,

suggesting COX-2 may play a role in maintaining cell homeostasis or promoting cell survival

during periods of osmotic shock (Choe et al., 2006). Taken together, these results strongly

suggest that COX-2 in the gills of teleosts acts in the same way as COX-2 in the kidneys of

mammals, including regulating ion transport and promoting cell survival.

Cyclooxygenase has also been shown to play an osmoregulatory role in the rectal gland

of the dogfish shark, Squalus acanthias. Sharks rely on the rectal gland rather than the gills for

regulation of salt secretion and a COX form (sCOX) has been cloned from the rectal gland (Yang

et al., 2002). This form was expressed most abundantly in the rectal gland of the shark, where

PGE2 production was also high (Yang et al., 2002). Finally, using a COX-2 specific inhibitor,

vasoactive intestinal peptide mediated chloride secretion decreased in the rectal gland, but then

recovered following removal of the inhibitor (Yang et al., 2002). Even though sCOX is slightly

more similar to COX-1 of mammals than COX-2, this result can be explained by the presence of

valine at position 523 instead of isoleucine (and thus conferring COX-2 inhibitory properties).

This result suggests that sCOX plays a role in ion transport in the rectal glands of sharks that

may be similar to the gills of teleosts or the kidneys of mammals. The osmoregulatory role of









COX in fishes needs to be examined in greater detail using other species and diverse techniques.

This may be highly feasible because COX sequences exist for a wide range of teleosts.

Reproduction

As in mammals, COX has been shown to play a role in reproduction in fishes. By using

the non-specific COX inhibitor indomethacin, it was shown in the Atlantic croaker

(Micropogonias undulatus) that COX pathways may play a role in the maturation of ovarian

follicles and ovulation through prostaglandin formation, although other proteins may play a more

dominant role (Patifio et al., 2003). Results from the European sea bass also indicate a similar

role for prostaglandins in ovulation, with indomethacin inhibiting follicle maturation (Sorbera et

al., 2001). However, it has been shown in the brook trout that indomethacin does not block

ovulation (Goetz et al., 1989), although it does in other fish species (Goetz et al., 1991). This

apparent loss of function in the brook trout may be explained by changes in the levels of COX-1

and COX-2 during ovulation. It was shown that COX-1 levels remained constant and high

during ovulation but that COX-2 levels did not increase prior to ovulation as they do in mammals

(Roberts et al., 2000). This is supported by data from the zebrafish which show high levels of

COX-1 but not COX-2 in the ovaries (Grosser et al., 2002). This suggests that COX-2 function

in the reproduction of the brook trout (and perhaps other fishes) is different than in other

vertebrates. In the Japanese medaka, it was shown that low chronic levels (perhaps comparable

to those found in waste water) (Metcalfe et al., 2003) of the non-specific COX inhibitor

ibuprofen causes altered reproduction by decreasing the number of spawning events but

increasing the number of eggs per spawning event (Flippin et al., 2007). This conforms to

delayed pregnancies associated with NSAID use in mammals. These results indicate that COX

likely plays a role in fish reproduction, although it may vary among species.









Differential functions of novel forms

Recently, the discovery of novel COX-2 forms in the zebrafish (Ishikawa et al., 2007)

and rainbow trout (Ishikawa and Herschman, 2007) and analyses of genomic sequence data

indicates that all teleosts may posses at least three COX forms: either COX-la, COX-lb, and

COX-2 or COX-1, COX-2a, and COX-2b. Preliminary data on the described COX-2 forms

suggests that they are functionally different from each other. In the zebrafish, COX-2a and

COX-2b are expressed at different levels in the gill, kidney, and other tissues and respond

differently to 12-O-tetradecanoylphorbol-13-acetate (TPA, which is known to induce COX-2

expression in mouse) (Ishikawa et al., 2007). A similar result was found in the rainbow trout,

with differential expression of the two forms due to TPA (Ishikawa and Herschman, 2007).

Interestingly, COX-2a and not COX-2b was up-regulated in response to lippopolysaccarides

(Ishikawa and Herschman, 2007). Clearly, the discovery of these new forms indicates a new

chapter in studying COX function and further studies are needed to determine the functional

differences among the teleosts' forms of COX.

Other functions

Cyclooxygenase has also been implicated in determining body plan development during

embryonic stages in the zebrafish (Grosser et al., 2002; Cha et al., 2005; Cha et al., 2006a; Cha

et al., 2006b; Yeh and Wang, 2006). Briefly, COX may function to signal cell motility during

gastrulation (Cha et al., 2006b), and COX-1 function has been shown to participate in vascular

tube formation during development (Cha et al., 2005). COX-2 expression has also been shown

to increase in response to lippopolysaccarides in the rainbow trout (Brubacher et al., 2000;

Holland et al., 2002), suggesting an immunoregulatory role for COX-2 in fish as in mammals

(e.g., fever induction). Clearly, the function of COX in fishes is just beginning to be explored,









and further studies will likely indicate more similarities and differences with COX functions in

mammals.

Amphibians

As in other vertebrates, there is evidence that COX is involved in ovulation and

reproduction in amphibians. Indomethacin was shown to inhibit oocyte ovulation in the frog

(Rana temporaria), while Prostaglandin F2u was shown to promote ovulation (Skoblina et al.,

1997). This suggests another mediator may be influencing PGF2, production in the frog, but this

contrast between seemingly related proteins has not been confirmed in other species. COX may

also function in testosterone synthesis via PGE2 in the crested newt, Triturus carnifex (Gobbetti

and Zerani, 2002). Ion and water transport have also been studied and non-specific COX

inhibitors reduce short circuit current and voltage potential across the frog skin, bladder, and

corneal epithelium (Shakhmatova et al., 1997; Carrasquer and Li, 2002). As in reptiles, fever

and thermoregulatory changes are behaviorally induced in amphibians. Injection of

lippopolysaccarides (LPS) normally causes a behaviorally induced fever in toads. However,

when indomethacin is administered, the fever induced by LPS is completely blocked in the toad

(Bufoparacnemis) (Bicego et al., 2002). This indicates that the COX pathway plays a role in the

behaviorally induced fever caused by LPS and that this response has an ancient origin that may

be conserved in all tetrapods.

Reptiles

Cyclooxygenase has not been studied extensively in the lizards, crocodilians, snakes, and

turtles although some data suggest prominent roles in thermoregulation. Reptiles undergo

behavioral thermoregulation to adjust their body temperatures, and this process is amplified by

changes in heart rate. Specifically, an increase in heart rate (heart-rate hysteresis) accompanies

an increase in temperature. Prostaglandins and cyclooxygenase were shown to play a role in this









process in the lizard Pogona vitticeps. Inhibition of COX-1 and COX-2 resulted in no increased

heart rate during heating (Seebacher and Franklin, 2003). Furthermore, administration of

Prostaglandin F2a and Prostaglandin 12, but not Thromboxane B2, caused an increased heart rate

(Seebacher and Franklin, 2003). However, this effect was not seen in crocodiles (Crocodylus

porosus) (Seebacher and Franklin, 2004) or the lizard Phrynocephalusprzewalskii (Liu et al.,

2006), suggesting that thermoregulatory functions of COX via changes in heart rates may vary

between closely related species.

Interestingly, COX was also implicated in tail regeneration in the house lizard. Twenty

days after tail removal (the time period associated with tissue differentiation), an increase in

cyclooxygenase activity occurred along with the appearance of endogenous Prostaglandin E2,

which may signal a cascade resulting in tissue differentiation (Jayadeep et al., 1995). Finally,

indomethacin was used in the turtle bladder to show that prostaglandins likely do not play a role

in the inhibition ofNa+ or H+ transport due to high intracellular calcium (Arruda, 1982). COX

function in reptiles obviously needs further study as many functions associated with COX in

mammals have yet to be investigated in reptiles and there have been no COX targeted

sequencing efforts.

Birds

Cyclooxygenase and prostaglandin function have been studied somewhat in model avian

species, specifically chickens, where there is support that COX is involved in similar processes

as in mammals, (e.g., reproduction). COX-2 (but not COX-1) and prostaglandin activity was

shown to increase with administration of transforming growth factor in granulosa cells of white

leghorn hen follicles, suggesting that COX-2 and not COX-1 plays a role in granulosa cell

proliferation during follicular development (Li et al., 1996). It was also shown that

indomethacin reduced the proliferation of granulosa cells (Jin et al., 2006). When using COX-1









and COX-2 specific inhibitors, it was found that both types reduced granulosa cell proliferation,

but that COX-2 specific inhibitor showed a stronger effect, supporting original studies that COX-

2 is the dominant form in granulosa cell proliferation (Jin et al., 2007). However, COX-1 was

found to be expressed highly in the brain and seminal vesicle of the chicken (Reed et al., 1996).

COX-1 (but not COX-2) is also up-regulated in ovarian cancers occurring in hens, suggesting a

target for treatment (Urick and Johnson, 2006). COX inhibitors, both specific and non-specific,

were shown to decrease sperm motility in the domestic turkey, demonstrating a further role for

COX in bird reproduction (Kennedy et al., 2003).

As in mammals, COX-2 has been implicated with the detection and persistence of

peripheral inflammatory pain in chickens. The number of COX-2 containing neurons increased

significantly in laminae under inflammatory conditions, but not under control conditions, 12-24

hours after injection of Freund's adjunvant (Yamada et al., 2006). This suggests that the numbers

of COX-2 containing neurons are related to inflammatory pain as in mammals. It appears that

COX may not play a thermoregulatory role in birds as it does in mammals because indomethacin

did not cause any change in rectal temperature during heat stress in chickens (Furlan et al.,

1998). However, COX and its prostaglandins may play a role in memory retention in birds,

because inhibitors produce amnesic effects (Holscher, 1995). Finally, COX-2 is expressed in the

kidneys during development in chickens (Mathonnet et al., 2001) and at high levels in the

kidneys of adults (Reed et al., 1996).

Study Overview

As outlined above, the family of cyclooxygenase genes has an interesting and

functionally important history in the vertebrates. Drugs derived from cyclooxygenase function

are among the most important and widely used treatment methods in medicine. However, COX

function and evolution is not fully understood in the ancestral chordates, specifically the teleosts,









sharks, hagfish, lampreys, cephalochordates, and urochordates. Indeed, the origin of the

mammalian forms of COX is unclear since the sea squirt possesses evolutionarily distinct COX

forms. Resolving the evolution of COX in the chordates could prove invaluable in determining

new targets for drug development (Searls, 2003).

In Chapter 2, I describe the cloning and characterization of 9 new COX genes in the

chordates. These include COX-1 and COX-2 forms from teleosts as well as novel forms from

the hagfish, lamprey, and amphioxus. In phylogenetic analyses, these forms indicate that several

origins of COX occurred during chordate evolution, with the mammalian COX-1 and COX-2

forms likely originating with the hagfish craniatess). Data from the teleosts supports the findings

of Ishikawa and colleges that teleosts in the Acanthopterygii posses two COX-1 forms and one

COX-2 form, whereas earlier teleosts such as the zebrafish and rainbow trout posses two COX-2

forms and one COX-1 form. Furthermore, analyses of protein alignments from novel sequences

indicate conserved and derived functional residues and areas between novel COX forms and the

COX-1 and COX-2 forms of mammals.

In Chapter 3, I summarize the findings of this research and suggest future avenues of

research based on the results presented here. I also present preliminary data investigating the

possible function of cyclooxygenase in these ancestral chordates.














Arachidonic Acid


COX-1
or
COX-2


0
0






Prostaglandin 12



HO C ,-OOH


OH OH
6-keto-Prostaglandin F1

OH


o OH
Prostaglandin D2


ODH
Prostaglandin G2

COX-1
or
COX-2

: %-Q--^G^^OOH
0 .... V
OH
Prostaglandin H2








H iH
-- oOH


OH
Thromboxane A2




HO C -H
OH
Thromboxane B2

v\ COOH

OH OH
Prostaglandin E2


Prostaglandin F2a



Figure 1-1. Cascade of reactions depicting the conversion of arachidonic acid to the primary
prostaglandins via catalyzation with either cyclooxygenase (COX) form. Arachidonic
acid is obtained from the conversion of linoletic acid found in plants or directly from
other animals. It is then oxidized by COX to produce Prostaglandin G2 which is
subsequently reduced by COX to form Prostaglandin H2. Prostaglandin H2 can then
be converted into the other prostaglandins via other enzymes (Vane et al., 1998).











COX-2a Danio


I COX-2a Oncorhynchus
COX-2b Danio
COX-2b Oncorhynchus
COX-2 Acanthopterygians


sCOX Squalus
COX-la Acanthopterygians
COX-1 b Acanthopterygians
COX-1 Danio

COX-1 Oncorhynchus
Figure 1-2 General phylogeny representing the different COX forms in the fishes. Based on
recent studies, it appears that teleosts have multiple forms of COX-1 or COX-2
(Ishikawa et al., 2007; Ishikawa and Herschman, 2007). It is hypothesized that with
the origin of the teleosts, COX-1 and COX-2 underwent duplication, but that in one
lineage (represented by the zebrafish and rainbow trout) one COX-1 form was lost
and in another lineage (represented by the Acanthopterygians) one COX-2 form was
lost. Also included is the form cloned from the spiny dogfish (Yang et al., 2002)
which loosely groups with COX-1 forms, although it shares near equal identity with
COX-1 and COX-2. This phylogeny was simplified from an unpublished phylogeny
generated using the online program PHYML (Guindon and Gascuel, 2003; Guindon
et al., 2005). Abbreviations: Danio = Danio rerio (zebrafish), Oncorhynchus =
Oncorhynchus mykiss (rainbow trout), Squalus = Squalus acanthias (spiny dogfish).
The Acanthopterygians clade is represented by the stickleback (Gasterosteus
aculeatus), green spotted puffer (Tetraodon nigroviridis), pufferfish (Takifugu
rubripes), and Japanese medaka (Oryzias latipes).













Precambrian Paleozoic Mesozoic Cenozoic
Cambrian Ordovician Silurian Devonian Carboniferous Permian Triassic Jurassic Cretaceous Tertiary
600 mya 543 490 443 417 354 290 251 206 144 65

To
tetrapods



-Teleostei


Petromyzontoidea

Myxinoidea

Cephalochordata

*Urochordata



Figure 1-3 Accepted evolution of ancestral chordates (Pough, et. al, 2005). Black lines show
relationships only; they do not indicate times of divergence nor the unrecorded
presence of taxa in the fossil record. Bars shaded red indicate ranges of time when
the taxon is known to be present. The subphylum Vertebrata includes the
Myxinoidea hagfishess), Petromyzontoidea (lampreys), Teleostei (teleosts), and
tetrapods. There is some controversy over whether the Urochordates (sea squirts) or
the Cephalochordates (lancelets) represent the most basal chordate lineage. Also, it
has historically been suggested that the hagfish and lamprey constitute a
monophyletic group (the Agnathans or Cyclostomes).










COX-1 Vertebrates




COX-2 Vertebrates


COXb Urochordates

COXa Urochordates

Invertebrate COX forms


Figure 1-4 Evolution of COX forms in the chordates, based on Jarving et al. (2004). The
Urochordates (represented by Ciona intestinalis and Ciona savignyi) have COX
forms that represent an evolutionary distinct branch ancestral to the COX-1 and
COX-2 forms of the vertebrates. In this tree, the vertebrates are represented by the
teleosts, mammals, Xenopus, and Gallus









CHAPTER 2
CYCLOOXYGENASES IN THE ANCESTRAL CHORDATES: SEQUENCE AND
PHYLOGENETIC ANALYSES

Introduction

Cyclooxygenase (COX) is the enzyme that catalyzes the oxidation and subsequent

reduction of arachidonic acid to form Prostaglandin G2 and Prostaglandin H2 (PGH2). PGH2 can

then undergo additional reactions to produce the primary prostaglandins, which act as vascular

tone regulators in the vertebrates. Prostaglandins and COX participate in a variety of

physiological functions in the vertebrates, including inducing fever, maintaining pregnancy, and

regulating ion transport in the kidneys (Steiner et al., 2005; McLaren et al., 1996; Harris et al.,

1994). These functions have been extensively studied in mammals (Vane et al., 1998), but

comparatively little functional data exist for other animals. However, COX has been sequenced

in several evolutionarily more ancestral chordates, particularly the teleosts (Zou et al., 1999;

Roberts et al., 2000; Choe et al., 2006). Based on functional studies of COX in the teleosts, it

seems that some functions are conserved (Choe et al., 2006; Sorbera et al., 2001; Brubacher et

al., 2000; Holland et al., 2003) while others may be altered in some species (Goetz et al., 1989)

or novel (Cha et al., 2006b).

In mammals there are two main forms of cyclooxygenase. The first form was isolated

from sheep seminal vesicles in 1988 and later named COX-1 (DeWitt and Smith, 1988; Merlie et

al., 1988; Yokoyama et al., 1988). A second form was isolated from mouse and chicken

fibroblast cell cultures in the early 1990s and named COX-2 (Kujubu et al., 1991; Xie etal.,

1991; O'Banion et al., 1992). Originally, COX-1 was considered to be a constitutive form that

maintained normal cell functions and COX-2 was considered to be an inducible form that was

up-regulated in inflammatory responses (Funk, 2001). However, studies have shown that this is

an oversimplification and COX-2 is expressed constitutively in the brain (Breder et al., 1995)









and kidneys (Harris and Breyer, 2001) of mammals. This has led to the abandonment of COX-2

selective inhibitors (e.g., celecoxib and valdecoxib) which were thought to treat inflammatory

pain without the negative side effects associated with non-selective COX inhibition. Although

structurally and biochemically similar, COX-1 and COX-2 vary in expression in the vertebrates

and participate in different functions. For example, COX-2 but not COX-1 plays a role in

granulosa cell proliferation in chicken follicles (Li et al., 1996; Jin et al., 2007). Although the

amino acid sequences of COX-1 and COX-2 share about 63% similarity, the presence of valine

in COX-2 at position 523 instead of isoleucine is thought to be responsible for their differences

in substrate selectivity and sensitivity to specific inhibitors (Otto and Smith, 1995). Inhibitory

studies in mammals have suggested a COX-3 form also exists, but it has not been characterized

(Kis et al., 2006; Censarek et al., 2006).

Analyses of genomic sequence and targeted cloning efforts have demonstrated that, like

mammals, other vertebrates have COX-1 and COX-2 forms (Jarving et al., 2004). However,

some variation exists in the COX-1 and COX-2 dichotomy, notably in the more evolutionarily

ancestral chordates. Ishikawa and colleagues (Ishikawa et al., 2007; Ishikawa and Herschman,

2007) have recently shown that teleosts posses three forms of COX. The zebrafish (Danio rerio)

and the rainbow trout (Onchorhynchus mykiss) both posses two COX-2 forms (named COX-2a

and COX-2b) and one COX-1 form, whereas the stickleback (Gasterosteus aculeatus), green

spotted puffer (Tetraodon nigroviridis), pufferfish (Takifugu rubripes), and Japanese medaka

(Oryzias latipes) posses two COX-1 forms (named COX-la and COX-lb) and one COX-2 form.

They also showed that COX-2a and COX-2b are functionally different in the zebrafish and

rainbow trout. Also, a COX form (named sCOX) has been cloned from the spiny dogfish

(Squalus acanthias) and groups with COX-1 in phylogenetic analyses, but shares strong









sequence identity to COX-2 as well (Yang et al., 2002). Furthermore, sea squirts subphylumm

Urochordata) possess two forms of COX (named COXa and COXb) that do not correspond to

the COX-1 or COX-2 of vertebrates and represent an ancestral origin of COX in the chordates

(Jarving et al., 2004).

The current view of the evolution of cyclooxygenase in the chordates represents an

interesting but incomplete account of this gene family, both from a phylogenetic and functional

standpoint. Therefore, the first goal of this study was to pinpoint the origin of COX-1 and COX-

2 in the chordates by searching for COX forms in the sea lamprey (Petromyzon marinus),

Atlantic hagfish (Myxine glutinosa), and amphioxus (Branchiostoma lancelolatum). A second

goal was to confirm the findings of Ishikawa and colleagues by searching for the 3 forms of

COX in the euryhaline killifish (Fundulus heteroclitus) and longhorn sculpin (Myoxocephalus

octodecemspinosus). It was hypothesized that both teleosts would posses COX-la, COX-lb, and

COX-2 since both are in the Acanthopterygii clade of Teleostei and all other acanthopterygiians

posses COX-la, COX-lb, and COX-2. Here, I report the cloning of 9 novel COX sequences

from the species mentioned above. Sequence and phylogenetic analyses suggest that ancestral

COX forms may have had similar functions as COX-1 and COX-2 in mammals, which likely

originated with the origin of the vertebrates, although the hagfish and lamprey may have COX-1

and COX-2 forms that represent novel lineages.

Materials and Methods

Animals and Holding Conditions

All procedures were approved prior to beginning the experiment by the University of

Florida Institutional Animal Care and Use Committee (IACUC). Euryhaline killifish (Fundulus

heteroclitus) were captured from Northeast Creek near the Mount Desert Island Biological

Laboratory (MDIBL), Salisbury Cove, Maine using minnow traps. They were transported to the









MDIBL where they were kept in fiberglass tanks containing 100%, flowing seawater from the

Gulf of Maine. The tanks were exposed to natural conditions. Longhorn sculpin

(Myoxocephalus octodecemspinosus) were purchased from fishermen and were housed in a

similar way at the MDIBL. Atlantic hagfish (Myxine glutinosa) were also purchased from

fishermen and were housed at the MDIBL in 100% seawater and maintained on a 12 h light/dark

cycle. Female, non-migratory lampreys (Petromyzon marinus) were a generous gift from the

USGS Great Lakes Science Center at the Hammond Bay Biological Station in Millersburg,

Michigan and were dissected there. Lancelets (Branchiostoma lancelolatum) were purchased

from Gulf Marine Specimens (Panacea, FL) and were kept in the bags they were shipped in for a

few days before they were sacrificed. All housed animals were fed to satiation regularly.

Some killifish were shipped to the University of Florida (Gainesville, FL) for further

experiments. These killifish were housed as described previously (Choe et al., 2006). Some

hagfish were also transported to the University of Florida (Gainesville, FL) for further

experiments. These hagfish were housed for a few days in a large Rubbermaid tank in 100%

seawater at 4 C before they were killed.

Tissue Collection

After initial anaesthetization with MS-222 (-600 mg L-1), killifish, sculpin, and lampreys

were pithed and/or decapitated. The gill arches (1st and 2nd arches for lampreys, 2nd and 3rd

arches for teleosts) were then removed using sterile, RNAse free dissecting tools. Hagfish were

decapitated and all gill baskets were then removed using sterile, RNAse free tools. Lancelets

were cut in half with sterile, RNAse free tools. After removal, tissues were immediately placed

in liquid nitrogen and stored at -80 OC for 2 weeks to 4 months before further processing.









Reverse Transcription, Primer Design, PCR, Cloning, and Sequencing

Reverse transcription, PCR, cloning, and sequencing were performed as described

previously (Choe et al., 2006) with modifications. Total RNA was isolated from the gills of

killifish, lampreys, sculpin, and hagfish as well as the anterior half of lancelets using TRI-reagent

(Sigma, St. Louis, MO), and reverse transcribed with a SuperscriptTM II or SuperscriptTM III

reverse transcriptase kit (Invitrogen, Carlsbad, CA) following the manufacturer's protocol and

using oligo-dT as a primer. The resulting cDNA was stored at -20 OC until used for PCR.

Degenerate primers (those labeled as CH COX, Table 2-1) were first designed to amplify

non-specific cyclooxygenases in the hagfish, lamprey, and lancelet based on conserved amino

acid sequences between COX-1 and COX-2 of Mus musculus, COX-2 of Fundulus heteroclitus,

sCOX of Squalus acanthias (GenBank accession numbers: NP_032995, NP_035328, and

AAS21313), and predicted COXa and COXb of Ciona intestinalis based on genomic data.

These primers were also later used to amplify COX-2 in sculpin. Another set of degenerate

primers (those labeled as CH COX-1 in Table 2-1) were designed to amplify COX-1 forms

specifically over COX-2 forms in teleosts based on conserved amino acid sequences between

COX-1 in Oncorhynchus mykiss, Danio rerio, Salvelinusfontanalis (GenBank accession

numbers: CAC10360, NP_705942, and AAF14529), and a predicted COX-1 of Tetraodon

nigroviridis based on genomic data. These primers first amplified a COX-la form in sculpin and

a COX-lb form in killifish (see below). A further set of degenerate primers (those labeled as CH

COX-la in Table 2-1) were designed to amplify COX-la forms specifically over COX-lb in

teleosts based on conserved amino acid sequences between predicted COX-la forms in

Gasterosteus aculeatus, Oryzias latipes, and Tetraodon nigroviridis based on genomic data and a

COX-la found in sculpin earlier in this study (see below). A final set of degenerate primers

(those labeled as CH COX-lb in Table 2-1) were designed to amplify COX-lb forms specifically









over COX-lb in teleosts based on conserved amino acid sequences between predicted COX-lb

forms in Gasterosteus aculeatus, Oryzias latipes, and Tetraodon nigroviridis based on genomic

data and a COX-lb found in killifish earlier in this study (see below). All degenerate primers

were designed using the online program Consensus-Degenerate Hybrid Oligonucleotide Primers

(CODEHOP) (Rose et al., 1998).

Initial PCR reactions were performed on 1/20th of a reverse transcriptase reaction with a

TaKaRa Ex TaqTM Hot Start DNA Polymerase Kit (Takara Bio Inc., Japan) in a PCR Express

thermocycler (ThermoHybaid, Franklin, MA) with the following parameters: initial denaturing at

95 C for 5 minutes, then 35 cycles of 30 seconds at 95 OC, 30 seconds at 60 OC, and 1.5 minutes

at 72 C. A final elongation step of 7 minutes at 72 C was performed for each PCR and then the

reaction was held at 4 OC. Initial PCR products were visualized by ethidium bromide staining on

1-2% agarose gels and then ligated into PCR4-TOPO vectors and transformed into TOP 10

chemically competent cells using a TOPO TA Cloning Kit (Invitrogen) following the

manufacturer's protocol. Plasmids were then isolated using a High Pure Plasmid Isolation Kit

(Roche, Germany) following the manufacturer's protocol and plasmid DNA was sequenced in

both directions at the Marine DNA Sequencing Center at the MDIBL.

After initial fragments were sequenced, Primer Express software (Applied Biosystems,

Foster City, CA) was used to design specific primers based on the initial fragments (Tables 2-2,

2-3, 2-4, 2-5, and 2-6). These specific primers, along with the original degenerate primers, were

used to extend COX sequences. PCR was completed as above with slight modifications to

annealing temperature and elongation time for each reaction, as well as nested PCR reactions in

some cases to increase specificity. Products were visualized, cloned, and sequenced as above.









5' and 3' Rapid Amplification of cDNA Ends (RACE)

After initial sequences were extended with specific primers, the 5' and 3' ends were

sequenced using 5' and 3' RACE. Following the manufacturer's protocols, a GeneracerTM Kit

(Invitrogen) was used to make 5' and 3' cDNA for hagfish, killifish, and sculpin. Initial

sequence data was used to make 5' and 3' RACE specific primers for each species (those labeled

with 5' or 3' in Tables 2-2, 2-3, 2-4, 2-5, and 2-6). These primers, along with kit primers that

anneal to the ends of the 5' and 3' cDNA, were used in touchdown PCR reactions with the

following parameters: 5 cycles of 30 seconds at 94 OC and 1.5 minutes at 72 C; 5 cycles of 30

seconds at 94 C and 1.5 minutes at 70 OC; and 25 cycles of 30 seconds at 94 OC, 30 seconds at

60 C, and 1.5 minutes at 72 C. As above, a final elongation step of 7 minutes at 72 C

terminated the reaction, which was held at 4 OC. For some reactions, annealing temperatures and

elongation times were slightly altered and nested PCR reactions were performed for some

reactions using specific primers (Tables 2-2, 2-3, 2-4, 2-5, and 2-6) to increase specificity.

Products were visualized, cloned, and sequenced as above.

Sequence Analysis

Initial sequences from degenerate primers, sequence extensions, and 5' and 3' RACE

were assembled using GeneTools software (BioTools Inc., Edmonton, Alberta) and the resulting

sequences were searched for open reading frames. The predicted amino acids were aligned with

other COX proteins using PepTools software (BioTools Inc.) for phylogenetic analysis. Multiple

alignments were also generated using ClustalW to search for conserved protein domains across

COX sequences. Alignments were manually adjusted and the N and C-terminal areas were

realigned using Microsoft Word based on previous COX alignments (Ishikawa et al., 2007; Yang

et al., 2002; Kulmacz et al., 2003). For the novel sequences, COX forms were aligned with









other relevant COX proteins and annotated using functional amino acids and domains

highlighted from Ishikawa et al. (2007), Yang et al. (2002), and Kulmacz et al. (2003).

Phylogenetic Analysis

To investigate the evolutionary relationships of the different forms of COX in the

chordates, phylogenies were generated using the novel amino acid sequences generated in this

study and several other COX protein sequences from GenBank and genome databases. All novel

protein sequences were included in the data set. COX sequences from teleosts were included in

the analysis only if all 3 forms of COX were available. These included the zebrafish, rainbow

trout, green spotted puffer, stickleback, euryhaline killifish, and longhorn sculpin. COX

sequences from non-teleosts were included in the analysis if at least two forms of COX were

available and both sequences were designated as Reference Sequences (RefSeqs) in GenBank.

These included the chicken, frog, mouse, rat, human, rabbit, dog, cow, sheep, and opossum.

COX sequences were also included if they represented an evolutionarily interesting group.

These included the dogfish shark and the sea squirt. In total, 50 protein sequences were included

in the analyses (Table 2-7).

Models of evolution to be used in phylogenetic analyses were evaluated to account for

amino acid substitutions, among-site variation, and invariable sites. Using likelihood ratio tests,

a model using the WAG rate matrix (Whelan and Goldman, 2001) and the gamma (F)

distribution for among-site variation was chosen (Table 2-8).

A distance phylogeny was first generated using Molecular Evolutionary Genetics

Analysis 4 (MEGA) software (Tamura et al., 2007) with a minimum evolution (ME) analysis

and 1000 bootstrap replicates. In this analysis the a parameter was fixed to the value estimated

from maximum likelihood (ML) analysis (a = 0.737, see below). Additionally, a JTT rate matrix

(Jones et al., 1992) was used instead of a WAG matrix because a WAG matrix is not available









for MEGA 4. A complete deletion option was also selected. After comparing results between

ML, ME, and Bayesian Phylogenetics (BP), lamprey and hagfish sequences were identified as

possible rouges and another distance analysis with identical parameters (but with a = 0.742) was

performed excluding these two sequences.

A maximum likelihood phylogeny (ML) was generated using the program PhyML

(Guindon and Gascuel, 2003). An initial phylogeny was generated using WAG analysis, 1000

bootstrap replicates, 8 substitution rate categories, and a gamma shape parameter with an

estimated a. Again, the analysis was repeated with the rouge lamprey and hagfish sequences

removed. To evaluate support for monophyletic groups, an approximate likelihood ratio test

(aLRT, Anisimova and Gascuel, 2006) was performed both including and excluding the lamprey

and hagfish sequences. This test used the minimum of Chi-Squared and Shimodaira-Hasegawa

(SH) support values.

Finally, A Bayesian phylogenetics (BP) analysis was also performed using an initial run

with 2 million generations and a final run with 10 million generations using the program

MrBayes 3.1.2. Once again, analyses were performed with and without hagfish and lamprey

sequences. Each run consisted of one cold and three heated chains (T= 0.2). The WAG + F

model was used with an estimated a. After discarding the first 10% of each run as burning,

posterior probabilities were calculated based on trees sampled every 500 generations.

Due to inconsistencies in tree topologies between the three methods used above,

alternative topologies were generated in which the positions of the hagfish and lamprey

sequences were forced to be included in different clades (Figure 2-15). These alternative

topologies were generated and viewed using TreeView 1.6.6. Alternative topologies were









evaluated using Ln L scores generated by maximum likelihood criterion with online execution in

PhyML (Guindon et al., 2005).

Results

Molecular Identification of Cyclooxygenases

Branchiostoma

Initial PCR reactions using the degenerate primers CH COX F3 and CH COX R2 (Table

2-1) amplified two 532 bp products from the lancelet (Branchiostoma lancelolatum). These two

products (referred to hereafter as COXc and COXd) were found to share the most identity with

COXa and COXb from the tunicate. COXc was 50.9% identical to COXa from the tunicate and

COXd was 58.8% identical to COXb from the tunicate. All attempts to extend these sequences

using specific primers designed against these sequences (Table 2-2) were unsuccessful. After

searching for open reading frames, two putative 177 amino acid proteins were predicted from the

lancelet.

Myxine

Initial PCR reactions using the degenerate primers CH COX Fl, CH COX F2, CH COX

R1, and CH COX R2 (Table 2-1) were used to amplify a single 1454 bp product from the hagfish

(Myxine glutinosa). This product (hereafter referred to as hCOX) was found to be 63.8%

identical to COX-1 of the zebrafish (Danio rerio). RACE primers (5' and 3', Table 2-3) were

designed against this initial product and used with kit primers to completely sequence the 2416

bp product. Searching for open reading frames yielded a putative 610 amino acid protein.

Petromyzon

Initial PCR reactions using degenerate primers CH COX F3 and CH COX R1 (Table 2-1)

amplified a single 541 bp product from gill tissue of the lamprey (Petromyzon marinus). This

product (hereafter referred to as 1COX) was later extended using degenerate primers (Table 2-1)









and specific primers designed against the initial 541 bp product (Table 2-4). Despite all attempts

to amplify the complete 1COX product (including RACE) the sequence was only extended to 860

bp. A 286 amino acid open reading frame was predicted from this product.

Fundulus

Because the COX-2 sequence for the euryhaline killifish (Fundulus heteroclitus) was

previously completed (Choe et al., 2006), the degenerate primer CH COX-1 F2 (Table 2-1)

designed to amplify COX-1 forms over COX-2 forms was used with the degenerate primer CH

COX R1 (Table 2-1) to initially amplify a non-COX-2, 1335 bp product (hereafter referred to as

COX-lb Fundulus) from killifish gill tissue. This product was then extended and completed

using specific primers and RACE primers (Table 2-5). The completed 2226 bp sequence

contains a 598 amino acid open reading frame that was nested inside the teleost COX-lb clade in

all phylogenetic analyses (see below), prompting the design of degenerate primers (Table 2-1)

that were used to amplify COX-la forms in teleosts over COX-lb forms. Using the degenerate

primers CH COX-la Fl and CH COX-la R1 (Table 2-1), a 759 bp product was initially

amplified in PCR reactions. Using RACE primers designed to complete this sequence (Table 2-

5), the 3' end of this product was completed, resulting in a 1655 bp product (hereafter referred to

as COX-la Fundulus) that contains a 452 amino acid reading frame. However, the 5' end of this

product was not sequenced despite multiple attempts. This putative protein grouped with the

COX-la sequences of other teleosts in all phylogenetic analyses (see below), leading to the

conclusion that the COX-la, COX-lb, and COX-2 sequences included in the analyses all

represent different COX products expressed in the gill tissue of the euryhaline killifish.

Myoxocephalus

Using the degenerate primers CH COX Fl and CH COX R2 (Table 2-1), a 977 bp

product was initially amplified in PCR reactions using cDNA from the gills of the longhorn









sculpin (Myoxocephalus octodecemspinosus). This product (hereafter referred to as COX-2

Myoxocephalus) was then extended and completed using RACE and specific primers (Table 2-

6), resulting in a 2618 bp product that contains a 605 amino acid open reading frame. This

sequence grouped with COX-2 forms from other teleosts in all phylogenetic analyses, inciting

the use of COX-1 degenerate primers (Table 2-1) CH COX-1 F2 and CH COX-1 R2 in PCR

reactions to amplify a 1000 bp product (hereafter referred to as COX- la Myoxocephalus). This

product was then extended and completed using RACE primers (Table 2-6), resulting in a 2633

bp product encoding a 622 amino acid open reading frame. This product grouped with COX-la

forms from other teleosts in all phylogenetic analyses, prompting the design of degenerate

primers used to amplify COX-lb forms in teleosts over COX-la forms (Table 2-1). Using the

degenerate primers CH COX-lb Fl and CH COX-lb RO (Table 2-1), an initial 895 bp product

(hereafter referred to as COX-lb Myoxocephalus) was amplified in PCR reactions. This product

was extended and completed using specific RACE primers (Table 2-6), resulting in a 2332 bp

product containing a 600 amino acid open reading frame. This product grouped with other

teleost COX-lb forms in all phylogenetic analyses, suggesting that the COX-2, COX-la, and

COX-lb forms sequenced represent 3 different COX forms expressed in the gills of the longhorn

sculpin.

Sequence Analyses

Teleosts COX-la, COX-lb, and COX-2

Three different COX forms are now available from the teleosts studied here: the COX-2

sequenced from the euryhaline killifish (Choe et al., 2006), the COX-2 sequenced here from the

longhorn sculpin, and two the COX-1 forms sequenced here from both the killifish and sculpin,

named as COX-la and COX-lb (following Ishikawa and Herschman, 2007). COX-la and COX-

lb predicted proteins from the killifish were more similar to Mus COX-1 than COX-2 (70%









versus 64% for COX-la and 68% versus 59% for COX-lb, respectively). Similarly, COX-2

from the sculpin was more similar to Mus COX-2 than Mus COX-1 (70% versus 60%) and

COX-la and COX-lb were more similar toMus COX-1 than Mus COX-2 (53% versus 47% for

COX-la and 67% versus 57% for COX-lb, respectively).

An alignment of COX forms from the killifish (Figure 2-1) shows that all the important

amino acid residues for cyclooxygenase function are conserved in all forms. However, because

COX-la is incomplete it is unknown whether the N-terminal characteristics are conserved in this

form. These include an active site tyrosine (Tyr-385, using ovine COX-1 numbering), haem-

binding histidines (His-207 and His-338), and the aspirin acetylation site (Ser-530) (Ishikawa et

al., 2007; Ishikawa and Herschman, 2007; Yang et al., 2002; Kulmacz et al., 2003). In addition

the COX-2 form contains a C-terminal amino acid insertion and the COX-1 forms contain an N-

terminal amino acid insertion. This is consistent with the COX-1 and COX-2 forms of other

vertebrates (Herschman et al., 2003; Kulmacz et al., 2003), although killifish COX-2 seems to

have a shorter than average insertion. In mammals, the amino acid residues thought to give

COX-1 and COX-2 their differing affinities for substrates are positions 513 (His in COX-1 and

Arg in Cox-2) and 523 (Ile in COX-1 and Val in COX-2) (Guo et al., 1996). However, as

previously noted in other teleosts (Grosser et al., 2002; Choe et al., 2006; Ishikawa et al., 2007)

these differences appear to be absent in teleosts, with Arg and Val present in positions 513 and

523, respectively, in both teleost COX-1 and COX-2. This is also the case in the killifish with

Arg in position 513 and Val in position 523 in all COX forms reported here.

As in the killifish, alignment of the three COX forms sequenced from the sculpin (Figure

2-2) shows conserved amino acid residues characteristic of COX function in all three forms. The

characteristic terminal amino acid insertions found in mammalian COX forms are also present in









their respective sculpin counterparts. However, COX-lb from the sculpin seems to have both N

and C-terminal insertions. Disulfide bonds near the n-terminus of sculpin COX-la also seem to

be altered due to the substitution of other amino acids for cysteine. It also appears that some

functional amino acid residues near the C-terminus of sculpin COX-la are not conserved with

the other forms. These include the substitution of Leu for Arg at position 513, Leu for Val at

position 523, and Phe for Ser at position 530.

Lamprey, hagfish, and amphioxus COX forms

The one incomplete putative COX protein obtained from the gills of the lamprey shares

near equal identity (63%) with Mus COX-1 and COX-2. The gene, referred to here as lamprey

COX (1COX) (Yang et al., 2002) shares the most identity (70%) with a form from the lancelet

(COXc), but shares notable identity (64%) with the form from the hagfish as well. Based on an

alignment of COX forms sequenced from select non-mammalian and non-teleost chordates

(Figure 2-3), the partial COX form sequenced from the gills of the lamprey has the predicted

histidine site (His-207) critical for peroxidase activity as well as conserved haem-binding

domains. However, the membrane binding regions near the Arg-277 loop that differ between

COX-1 and COX-2 forms appear to be different from both COX-1 and COX-2 in the lamprey

form. This is seen when the lamprey form is aligned with COX-1 and COX-2 forms from

vertebrates (Figure 2-4).

The putative COX protein from the gills of the hagfish shares slightly more identity with

Mus COX-2 than Mus COX-1 (63% versus 60%). The gene, referred to here as hCOX, shares

the most identity (> 60%) with vertebrate COX-2 forms, but also shares notable identity with

1COX (64%) and forms from amphioxus (> 60%). An alignment of hCOX with other non-

mammalian, non-teleost COX proteins (Figure 2-3) shows that all important amino acid residues

and binding sites critical to cyclooxygenase activity are conserved in hCOX. An alignment of









hCOX with COX-1 and COX-2 proteins from various vertebrates (Figure 2-5) shows that hCOX

has an insertion of amino acids near the C-terminal; characteristic of COX-2 proteins in

vertebrates. However, there are several regions where COX-1 differs from COX-2 but hCOX

shows no identity to COX-1 or COX-2 amino acids (indicated as sites with a + over them in

Figure 2-5).

Two putative incomplete COX sequences were obtained from amphioxus. These

sequences, referred to here as COXc and COXd, are most identical (81%) to each other, but also

share notable identity with hCOX (66%), 1COX (67%), vertebrate COX-1 (> 60%), and

vertebrate COX-2 (> 60%). They are the least identical to Ciona COXa (48%) and COXb

(55%). Based on an alignment of non-mammalian, non-teleost COX proteins (Figure 2-3), it

appears that amino acids critical to COX function are conserved in COXc and COXd. However,

the first haem-binding domain seems to be very different in the amphioxus forms. This is also

the case for Ciona COX forms and COXa, COXb, COXc, and COXd all share notable identity in

this region as shown by alignment (Figure 2-6).

Phylogenetic analyses

A phylogeny (Figure 2-7) generated under a distance optimality criterion with 1000

bootstrap replicates using VMEGA4 shows predicted COX clades. COX-la and COX-lb forms

from teleosts form monophyletic sister clades. The novel COX-1 forms from the killifish and

sculpin group together with other teleosts in these clades as expected based on their designation

here. Eutherian COX-1 forms group together in a monophyletic clade sister to the teleost COX-1

clade. The COX-1 proteins from Gallus, Monodelphis, and Xenopus are located at the base of

this monophyletic vertebrate COX-1 clade, with sCOX being the most basal. Vertebrate COX-2

forms group together in another monophyletic clade that is sister to the vertebrate COX-1 clade.

There are two monophyletic clades within the COX-2 group: a teleost clade and a tetrapod clade.









The forms from lamprey and hagfish (1COX and hCOX) are basal to the vertebrate COX clade,

while the forms from amphioxus (COXc and COXd) form a monophyletic group basal to these

forms. The forms from Ciona (COXa and COXb) form another monophyletic group that is basal

to all other COX forms. Bootstrap values give robust support for vertebrate clades, the

amphioxus clade, and the Ciona clade, but give weak support for placement of hCOX, 1COX,

and sCOX. Based on these results and other generated phylogenies (see below), hCOX and

1COX were identified as possible rogue sequences due to their inconsistent positions depending

on the type of analysis used and another distance analysis was completed without including these

sequences (Figure 2-8). The topology of this phylogeny is very similar to the complete COX

phylogeny. However, sCOX is basal to the vertebrate COX clade and not included with the

other vertebrate COX-1 forms. Additionally, bootstrap values for most clades are considerably

more robust than when hagfish and lamprey sequences are included.

To further test relationships between COX proteins, a phylogeny (Figure 2-9) was

generated using the maximum likelihood criterion, 1000 bootstrap replicates, and the program

PhyML (Guindon and Gascuel, 2003). The topology of this tree is very similar to the one

generated using distance criterion. Briefly, it contains well supported, monophyletic clades for

COX-1 teleostt COX-la, teleost COX-lb, teleost COX-1, mammalian COX-1, and vertebrate

COX-1 with sCOX as the most basal sequence) and COX-2 teleostt COX-2, mammalian COX-2,

and vertebrate COX-2). The lamprey (1COX) is also basal to the vertebrate COX clade, the

amphioxus COXc and COXd form a basal monophyletic clade, and the most basal clade in the

tree is a monophyletic COXa and COXb from the sea squirt. However, in the ML analysis, the

hagfish (hCOX) sequence groups at the base of the vertebrate COX-2 clade instead of being

basal to the vertebrate COX clade. Again, the analysis was repeated without hCOX and 1COX









(Figure 2-10), causing bootstrap values to increase dramatically. Also, the estimated gamma

shape parameter increased slightly from 0.737 to 0.742.

To further evaluate support for COX clades, an aLRT analysis (Anisimova and Gascuel,

2006) was performed. This type of analysis provides values of support similar to Felsenstein's

bootstrap support values but is much faster because bootstrap sampling requires many (1000 in

the previous analyses) runs while aLRT is run only once. The fundamental difference between

the two is that bootstrap support values are based on repeatability whereas the aLRT is a measure

of the likelihood gain of including a branch versus collapsing it (Anisimova and Gascuel, 2006).

The resulting aLRT statistics can be interpreted using parametric Chi-Squared distributions or a

non-parametric Shimodaira-Hasegawa-like (SH) procedure (Anisimova and Gascuel, 2006). The

former seems to be more liberal (giving values similar to Bayesian posterior probabilities) and

the later more conservative (Anisimova and Gascuel, 2006). Here, the most conservative

approach was used and values represent the minimum of Chi-Squared and Shimodaira-Hasegawa

(SH) support values. When all species are included (Figure 2-11) clades of interest have robust

support (> 0.90) except for the vertebrate COX-2 clade (containing hCOX, 0.683) and the clade

containing 1COX (0.87). When hCOX and 1COX are excluded from the analysis (Figure 2-12),

support values generally increase, with a notable increase in the vertebrate COX-2 clade (0.883).

A Basesian phylogenetics (BP) analysis was also performed (Figure 2-13) using the

program MrBayes 3.1.2, with one initial 2 million generation run, and one final 10 million

generation run. The topology of the consensus tree (with burnin = 10%) is similar to those

described above, with well-supported aforementioned vertebrate COX clades. However, in BP

analysis 1COX groups at the base of the amphioxus COXc/COXd clade instead of being the basal

member of the vertebrate COX clade. This grouping is well-supported by posterior probability









scores (0.93). As in ML analysis, hCOX groups with vertebrate COX-2 proteins at the base of

the clade. Also similar to previous analyses, when 1COX and hCOX are excluded (Figure 2-14)

scores improve and all clades have robust support.

Due to the contrasting topologies generated using distance, ML, and BP methods, 21

different tree topologies (Figure 2-15) were generated by using the most likely tree from ML

analysis (Figure 2-9) and relocating hCOX and/or 1COX sequences to other branches of the tree.

Positions of all other sequences were not altered from the most likely tree. A Ln likelihood score

(Ln L) was generated for each topology using online execution of the program PhyML (Guindon

et al., 2005). Likelihood scores were compared to the most likely tree. These tests indicate that

1COX and hCOX can be moved somewhat freely around the base of the tree without resulting in

a noticeably different Ln L than the most likely topology (Table 2-9). It appears that moving

1COX to the base of the COX-1 clade causes the smallest change in Ln L, whereas moving

hCOX or 1COX deeply into COX-1 or COX-2 clades causes the largest changes in Ln L.

Discussion

Here, I present the first forms of the enzyme cyclooxygenase (COX) sequenced from the

hagfish, lamprey, and amphioxus. I also show that the killifish and sculpin conform to the

current hypothesis that teleosts posses additional COX-1 and COX-2 forms. The phylogenetic

relationships among the various COX forms are still not definite, although the results presented

here allow some conclusions to be drawn and predictions to be made. Specifically, it appears

that COX sequences in the chordates form at least 3 well supported phylogenetic groups: the

urochordata, cephalochordata, and vertebrata. Hagfish and lamprey positions are variable

depending upon the analysis used, but likelihood scores seems to favor placement within the

vertebrata clade.









Novel COX Forms

Although the two COX sequences from amphioxus were not able to be extended, they

aligned readily with other COX sequences. They show a first haem-binding domain that shares

little conservation with vertebrate forms (20%), as in the urochordates. However, the second

haem-binding domain is completely conserved in these forms, as is histidine-207 which is crucial

for peroxidase activity. The arginine-277 loop region does not resemble COX-1 or COX-2

forms. Due to the truncated nature of these proteins, it is difficult to determine if COX in the

cephalochordates plays similar roles as in the vertebrates, but some functions are likely

conserved. Following the nomenclature used by Jarving et al. (2004) these forms are named

COXc and COXd. The COX sequence found in the gills of the hagfish was extended to

completion and readily aligned with other COX forms. It has conserved amino acids, binding

domains, and bonds critical for COX function. Therefore, it likely plays a similar role in the

hagfish. The hagfish COX has an N-terminus deletion and valine-523 characteristic of COX-2

forms, but there are multiple sites where it shares equal or no homology with COX-1 and COX-2

of vertebrates. Therefore, following the nomenclature of Yang et al. (2002) this form is named

hCOX. Although incomplete, the one COX sequence cloned from the gills of the lamprey

readily aligns with other COX sequences and contains amino acids and regions critical to COX

function. However, like the hagfish sequence it shares no biased homology with COX-1 or

COX-2 forms. This form is therefore named 1COX. As predicted based on phylogenetic

position, COX-la, COX-lb, and COX-2 were found in the gills of the euryhaline killifish and the

longhorn sculpin. With the exception of COX-la in the sculpin, all COX forms from these

teleosts contain conserved regions critical to COX function. As has been reported in other

teleosts (Ishikawa et al., 2007), these forms all contain valine at position 523, unlike in

mammals. COX-la from the sculpin does not have several amino acids critical for COX









function located near the C and N terminus of the sequence. These include disruption of

disulfide bonds near the N terminus due to cystine replacements, little conserved homology in

the membrane binding domain, and alternate residues for arginie-513 leucinee), valine-523

leucinee), and serine-530 phenylalaninee). This is not the case in the other acanthopterygiians,

where all COX forms have these conserved regions. This may indicate that in the sculpin COX-

la has partially lost function, and COX-lb or COX-2 may therefore have additional

responsibilities.

Phylogenetic Analyses

As has been seen when tracing the evolutionary histories of other gene families in

evolutionary deep time (Abbasi and Grzeschik, 2007; Goudet et al., 2007), the pedigree of the

COX family is littered with duplications, losses, and uncertainty. Despite utilizing a multi-

faceted approach to depict COX evolution in the chordates, the results indicate that COX has a

complicated and under-examined history of evolution in the chordates. This is not surprising,

considering the complex functions COX has been shown to have in the chordates. Because of

these complex functions, duplications, partitioning of roles, differential expression, and multiple

forms with multiple functions are to be expected.

In all phylogenetic analyses, the more recent history of COX evolution is more clear and

consistent than the relationships of the "ancestral" taxa. The teleosts consistently form

monophyletic COX clades nested within the gnathostomes, as expected. The gnathostomes

consistently form two COX sister clades in phylogenetic analyses: COX-1 and COX-2. This is

expected based on previous phylogenetic analyses in the vertebrates (Gu, 2001; Gu, 2006). The

COX-1 clade is consistently rooted with the sequence from the dogfish (sCOX), although

support values are not robust for this relationship when hagfish and lamprey sequences are

included. In distance analysis excluding hagfish and lamprey sequences, sCOX groups outside









the COX-1 and COX-2 clades, representing another COX gnathostome lineage. These groupings

are as expected, based on Yang et al.'s (2002) original description of sCOX as neither a COX-1

nor COX-2. These are the first phylogenetic analyses of COX to include sCOX and it is

concluded that sCOX is most likely a basal member of the COX-1 clade.

In all analyses, the COX-1 clade contains robustly supported, monophyletic teleost and

eutherian mammal clades. In the teleost clade, COX-lb and COX-la form well-supported,

monophyletic clades. Although this is expected based on initial studies (Ishikawa et al., 2007;

Ishikawa and Herachmann, 2007), this is the first study to use sophisticated tree-building

techniques to show the monophyly and legitimacy of the COX-1 forms in teleosts. It is also

shown in each analysis that the non-duplicate COX-1 forms from the zebrafish and trout are

more related to COX-lb forms from the acanthopterygiians, grouping with them at the base of a

monophyletic COX-1/COX-lb clade.

The mammalian COX-1 group is not as robustly supported using all types of analyses.

The expected relationships (based on assumed evolutionary relationships in the tetrapods) are

shown and supported with some confidence in the maximum likelihood analysis (ML) when the

hagfish and lamprey sequences are excluded. In this anlaysis, the tetrapods form a monophyletic

group with the frog and chicken at the base of the clade, followed by the opossum sequences,

and then the eutherians. Even in this analysis, the frog and chicken sequences group together,

contrary to what is biologically expected (the frog should be more basal, representing an

evolutionary ancient non-amniote lineage, and the chicken should be a sister to the mammals).

However, this grouping is not well-supported in any analysis. When hagfish and lamprey are

included in ML analysis, the chicken/frog clade occurs at the base of the mammalian/teleost

clade, contrary to biological predictions. However, this relationship is poorly supported. These









low support values are confirmed in the aLRT analysis. In Bayesian and distance analyses, the

frog is basal to the chicken, but these sequences are again at the base of a biologically irrelevant

teleost/mammal clade. However, unlike distance and ML methods, Bayesian posterior

probabilities strongly support this relationship. Bayesian posterior probabilities traditionally

overestimate support values for a variety of reasons (Cummings et al., 2003: Lewis, pers.

comm..) and can give incorrect clades strong posterior probabilities. This may explain why this

biologically unexpected relationship is strongly supported only in the Bayesian trees. Therefore,

ML analyses (supported by bootstrap and aLRT scores) show the most probable scenario for

COX-1 evolution in the gnathostomes: a basal sCOX, followed by a teleost COX-1 clade (as

described above) sister to a tetrapod COX-1 clade.

The COX-2 groups within the gnathostomes mirrors the same general trends as the COX-

1 clade. Teleosts consistently form a well-supported, monophyletic group. The COX-2a

sequences from zebrafish and trout group together to form the most basal members of this clade.

The COX-2b sequences group with the non-duplicate COX-2 sequences from the

acanthopterygiians to form the other teleost COX-2 clade. Sister to the teleosts, the tetrapods

form another COX-2 clade in the gnathostomes. In this tetrapod COX-2 clade, frog and chicken

sequences form the most basal (although not well-supported) clade, with the mammals as a sister

clade. This biologically relevant relationship between COX-2 sequences is predicted in all

analyses.

Basal to the COX-1 and COX-2 clades in the gnathostomes are two clades that are

consistently and robustly supported in all phylogenetic analyses: a urochordate COX clade and a

cephalochordate COX clade. The cephalochordate clade consists of the two COX sequences

obtained in this study (COXc and COXd) and the urochordate clade consists of the two









sequences from Ciona (COXa and COXb). The urochordate COX forms always forms the base

of the entire tree and the cephalochordate COX forms always group as a sister clade to the

gnathostome COX clade. This study is the first to show this biologically relevant relationship

between COX forms in these "ancestral" chordates.

The hagfish (hCOX) and lamprey (1COX) sequences have alternate phylogenetic

positions depending on the technique used to reconstruct their evolutionary histories. Also,

when these sequences are removed from analysis, bootstrap, aLRT, and posterior probability

scores supporting COX clades increase. Because of their uncertain placement in COX evolution,

these sequences are designated as "rogues" and analyses excluding them likely show a more

accurate representation of COX evolution. In distance analysis, both hCOX and 1COX are

placed outside the gnathostome COX clade and form two separate COX lineages between the

cephalochordate and gnathostome clades. In ML analysis, 1COX remains basal but hCOX is

placed at the base of the gnathostome COX-2 clade. In BP analysis, hCOX remains in the COX-

2 clade but 1COX is placed within the cephalochordate clade. Support values for hCOX and

1COX placement are weak in all but BP analyses. Clearly, the placement of hCOX and 1COX in

COX evolution is not clear and without further evidence, placing them with any degree of

certainty becomes difficult. In an attempt to find the most likely placement of these sequences,

21 different phylogenies were generated based on the most likely tree with hCOX and 1COX

placed in variable positions. The trees were then evaluated in a maximum likelihood framework.

It is important to note that although Ln L scores were generated for each topology, other

biological factors may influence which topology or type of topology is actually the most likely.

For example, placing hCOX in the COX-2 clade and 1COX at the base of the tree (technically the

most likely tree) implies that another COX lineage exists for all vertebrates (the lineage









represented by 1COX) because the hagfish is biologically ancestral to the lamprey. This would

mean that dozens of novel COX forms have yet to be discovered in well-examined groups such

as the mammals and teleosts. With genomes of several of these groups available, it is unlikely

that such a vast amount of sequence data have yet to be found. Therefore, the most likely

scenarios for COX evolution would imply that either hagfish is basal and lamprey is derived,

both are basal, or both are derived. However, placing 1COX, hCOX, or sCOX in the COX-1 or

COX-2 clade implies that another COX form has yet to be found in these species.

It appears that moving 1COX into the base of the COX-1 clade causes less of a change in

Ln L scores than moving hCOX outside the gnathostome COX clade. However, it is apparent

that either sequence can be moved somewhat freely throughout the tree without resulting in

noticeably worse (-10 Ln L) tree scores. This leads to the conclusion that although hCOX and

1COX may represent independent, basal lineages of COX, they are most likely basal members of

the COX-2 and COX-1 clades (respectively) in the gnathostomes. If this is the case then at least

one other form of COX should exist in the hagfish and lamprey, as well as in the dogfish shark.

Summary

Presented here are the first COX sequences from amphioxus, the hagfish, and the

lamprey. All predicted COX sequences from the killifish and sculpin are also described. These

sequences all likely represent functional forms of COX found in the chordates based on

conserved amino acids and domains critical to COX function. For the first time, a sophisticated

phylogenetic analysis of COX forms from the majority of representative chordate lineages was

attempted. Although still not definitive, a general hypothesis for the evolutionary history of

COX in the chordates can be made (Figure 2-16). In this scenario, there are three main COX

groups corresponding to the three subphyla found in the phylum Chordata: the urochordata,

cephalochordata, and vertebrata. Each contains two main COX groups, with the well-









documented COX-1 and COX-2 forms only found in the vertebrata clade. These forms contain

monophyletic groups for the teleosts and the tetrapods, with multiple forms in the teleosts

confirming previous hypotheses (Ishikawa et al., 2007; Ishikawa and Herschman, 2007).

Hagfish and lamprey placement is uncertain, but most likely these sequences represent basal

members of the vertebrata clade. This does not support the timing of genomic duplications in the

chordates according to the most recent view of the 2R Hypothesis (Kasahara, 2007), indicating

two rounds of genome duplication after the origin of the urochordates but prior to the radiation of

the jawed vertebrates. However, several developmentally important proteins have been shown to

not support this timing and indicate an earlier duplication (Hughes, 1999). Multiple COX-1 and

COX-2 genes in the teleosts do support the hypothesis that the teleosts are characterized by

another round of genome duplication after the origin of the vertebrates (Li et al., 2007). Clearly,

this uncertain period representing some 600 million years of evolution is characterized by many

losses and duplications and remains to be resolved definitively.










Table 2-1. Degenerate primers used in PCR


Name
CH COX Fl
CH COX F2
CH COX F2.25
CH COX F2.5
CH COX F3
CH COX F5
CH COX R1
CH COX R2
CH COX R3
CH COX-1 F4
CH COX-1 F5
CH COX-1 R2
CH COX-la Fl
CH COX-la F2
CH COX-la F3
CH COX-la F4
CHCOX-laF5
CHCOX-la R1
CH COX-la R2
CH COX-la R3
CH COX-lb Fl
CH COX-lb RO
CH COX-lb R3


Orientation
Sense
Sense
Sense
Sense
Sense
Sense
Antisense
Antisense
Antisense
Sense
Sense
Antisense
Sense
Sense
Sense
Sense
Sense
Antisense
Antisense
Antisense
Sense
Antisense
Antisense


Nucleotide sequence (5' to 3')
ATG GAC GAC TAC CAG TGY GAY TGY AC
GAT GTT TGC ATT TTT CGC TCA RCA YTT YAC
TGG CGT GGA CCT AGG TCA NRT NTA YGG
CGA GCT GCG GTT CCA TAA ARA YGG NAA RYT
CCA CTA TAT GGC TGC GGG ARC AYA AYM G
CAT GTG GAA TTC CAT CAC CTG TAY CAY TGG CA
CCC CGA AGG TGG ATG GYT TCC AVY A
GCA TCA GCG GGT GCC ART GRT A
TCC TCT TTT AGT ATG TCG CAG ACT CKR TTR TGY TC
TGC CAG ACA GCA TCC ACA THG AYG GNG A
CAG CAG ACA ATG CGC AGG NCA RAT HGG
TGG GTG TAT GTT GTG TCC TCC NCC DAT YTG
CCC CAC CAA CCT ACA ATA CCA ART AYG GNT A
AAA GTG CTG ACT GAR MGN TTY TT
GGA CTA ATC TGA TGT TCG CGT TYA TGG CNC A
AGC GGA AGG CGG CTT YAC NAA NGC
CAA ATA GTA AAT GGG GAR AYN TAY CC
ATA GGG AAT GTC GTC NCC RTC DAT
GGG GCA CGT TTT CCG GRT ANA YCA T
ACC TCA GTG ACA GTG GGA GGR TAN RTY TC
CGG ATG GGT GTG GGC TTY ACN AAR GC
GGA GAA GGG AGC ACC CAT YTC NAC CAT
CCA GCG TCC GCG CDA TYT CYT C










Table 2-2. Amphioxus COX specific primers used in PCR


Name
COXa Fl
COXaF2
COXa F2.5
COXa F3
COXaF4
COXaF5
COXa R1
COXa R2
COXa R3
COXa 3' Fl
COXa 3' F2
COXa 5' R1
COXa 5' R2
COXa 5' R3
COXbFO
COXb Fl
COXb F1.5
COXbF2
COXb F3
COXb R1
COXb R2
COXb R3
COXb 3' Fl
COXb 3' F2
COXb 3' F3
COXb 5' R1
COXb 5' R2
COXb 5' R3


Orientation
Sense
Sense
Sense
Sense
Sense
Sense
Antisense
Antisense
Antisense
Sense
Sense
Antisense
Antisense
Antisense
Sense
Sense
Sense
Sense
Sense
Antisense
Antisense
Antisense
Sense
Sense
Sense
Antisense
Antisense
Antisense


Nucleotide sequence (5' to 3')
TAC TCC ACC GTG TGG CTG C
TGG GAC GAC GAG AGG CTC
ACC GGT GAG ACC ATC AAC ATC AT
CAC CTG AGC GGC TAC AAC TTT
GAC CTG TTC TGG GAC CCT GAG
CCA GTA CCA GAA CCG CAT CTT C
CGT ACG GCG GGT AGA TCA TG
GCT GCC GCT CCA CGG
CCC GTA GAT ATG GCT CAG GTC A
GAG GCT CTT CCA GAC AGC CA
CAC CTG AGC GGC TAC AAC TTT
TGG CTG TCT GGA AGA GCC TC
TGG AGT AGA CGA ACA GGC CC
CCC CGT AGA TAT GGC TCA GGT
CAG ACA GCT AGA CTC ATT CTT ATC AGT GA
TAT CAA CAT CGT CAT TGG AGA GTA TG
GGC TGG CAA AAA CTT CCA ACT
TGC AGT ACC AGA ACA GCA TAT TTG
AGC ATA TTT GTG GAG TTT AAC CAC TTG
CGT CCG GAG GGT AAA TCA TGT
ACT TCA GTT TCC CGT CCT GGA
CGT AAA CAT GGC TCA TGT CCA CT
GTC CCC GAG AAG AAG CGA TT
GAA CGG CTC TAC CAG ACA GCT AG
TGT TCT GGG ACC CTG AGC TG
TGG TAG AGC CGT TCG TCG TC
GGA GGG TAA ATC ATG TGT ACG GA
ACA TGG CTC ATG TCC ACT GC











specific primers used in PCR


Name
hCOX 3' Fl
hCOX 3' F2
hCOX 3' F3
hCOX 3' F0.8
hCOX 3' F0.6
hCOX 3' F0.4
hCOX 3' F0.2
hCOX 3' F0.1
hCOX 3' FO
hCOX mid Fl
hCOX mid F2
hCOX mid R1
hCOX mid R2
hCOX 5'R1
hCOX 5' R2
hCOX 5' R3
hCOX 5' R4
hCOX 5' R5
hCOX 5'R6


Orientation
Sense
Sense
Sense
Sense
Sense
Sense
Sense
Sense
Sense
Sense
Sense
Antisense
Antisense
Antisense
Antisense
Antisense
Antisense
Antisense
Antisense


Nucleotide sequence (5' to 3')
TTA ACC ACC TGT ACC ACT GGC AC
CTC AAC CAT GGA GTA CGA GGT CT
CAA TGC TAT GGA GTT CTA CCT GGG
CAG TAC AGC AAC CGC ATC TCA
AAT GGG ACG ACG AGA GAA TCT TT
GGT TTG CTG TTG GTC ACG AAG
AGT CCA CCC ACA TAC AAT GCC
CTC ACG CAC TTT GCT CCC TT
GAA CTG CAC CTA CCC CGA GAC
GTT TCG AGT CCA CCC ACA TAC AA
CAT ACT CCA ACC TCA GCT ACT TCA CT
CAC ATC GAG TAC GTC ACA CAC G
AAG GGT CCC GTA GAG CAT GA
TCT CCG AAT AAA GCT CCC TGT C
TGC TGC CAT TTC CGT TTC TC
CAT GTT TGA TGG ATG CTG TTG C
AGG CGA GTG AAG TAG CTG AGG TT
CCT CCC AGG ACT TGT ACC GTA AT
GAG GAA GTA ATG CAC GGT ATC TGG


Table 2-3. Hagfish COX











Table 2-4. Lamprey COX specific primers used in PCR


Name
1COX Fl
1COX R1
1COX R2
1COX R3
1COX 3' Fl
1COX 3' F2
1COX 3' F3
1COX 5' R1
1COX 5' R2


Orientation
Sense
Antisense
Antisense
Antisense
Sense
Sense
Sense
Antisense
Antisense


Nucleotide sequence (5' to 3')
GAG GAA CGC TTG AGA GAC AAC A
TCT TGT TGA TGT TTC GAC CGC
CCA CCG CCA ATC TGG C
AAT CAG GAA GCT CTC AGG CAT C
GAG TTC CTC TTC AAC CCC GG
TCG AAA CAT CAA CAA GAA CCT CC
TTC ACC TCC TTC CTG GAG CTC
TGC TGC ACG TAC TCC TCG ATC
GCA GCT GGT GTT GTC TCT CAA











Table 2-5. Killifish COX specific primers used in PCR


Name
Fh COX-lb 3' Fl
Fh COX-lb 3' F2
Fh COX-lb 3' F3
Fh COX-lb 5' R1
Fh COX-lb 5' R2
Fh COX-lb 5' R3
Fh COX-la 3' Fl
Fh COX-la 3' F2
Fh COX-la 3' F3
Fh COX-la 5' R1
Fh COX-la 5' R2
Fh COX-la 5' R3


Orientation
Sense
Sense
Sense
Antisense
Antisense
Antisense
Sense
Sense
Sense
Antisense
Antisense
Antisense


Nucleotide sequence (5' to 3')
CTT CAC CGA TAG CGA GGA GAT AG
AGC TCT ACG GTG ACA TCG ACA CT
GGG TAA CCC CAT ATG TTC TCC AC
CCC ATG TGA GAG AGC CTT AGT GA
CAG CCT CTC AAA CAA CAC CTG AG
GTA GTA GGA TTC CCA GCT GAG GTA GT
GGT GTA CCC CGA AGG TTT CC
GAG TAC GTG CAG CAC CTG AGC
AGT ACA CCA ATC GCA TCG CC
GAT GAT AAG TCT GGC GGT CTG G
GAT GGT GGC ATA CAC GGT GA
TTT ATG AAG CCG AAG CTG GTG











Table 2-6. Sculpin COX specific primers used in PCR


Name
Mo COX-2 3' Fl
Mo COX-2 3' F2
Mo COX-2 3' F3
Mo COX-2 3' F4
Mo COX-2 3' F5
Mo COX-2 3' F6
Mo COX-2 mid Fl
Mo COX-2 mid F2
Mo COX-2 mid R1
Mo COX-2 mid R2
Mo COX-2 5' R1
Mo COX-2 5' R2
Mo COX-2 5' R3
Mo COX-la 3' Fl
Mo COX-la 3' F2
Mo COX-la 3' F3
Mo COX-la 3' F4
Mo COX-la 3' F5
Mo COX-la 3' F6
Mo COX-la 5' R1
Mo COX-la 5' R2
Mo COX-la 5' R3
Mo COX-lb 3' Fl
Mo COX-lb 3' F2
Mo COX-lb 3' F3
Mo COX-lb 5' R1
Mo COX-lb 5' R2
Mo COX-lb 5' R3


Orientation
Sense
Sense
Sense
Sense
Sense
Sense
Sense
Sense
Antisense
Antisense
Antisense
Antisense
Antisense
Sense
Sense
Sense
Sense
Sense
Sense
Antisense
Antisense
Antisense
Sense
Sense
Sense
Antisense
Antisense
Antisense


Nucleotide sequence (5' to 3')
CCC CGG TCT GAT GAT GTA CG
ACC GAG TGT GTG ACG TGT TGA
TCG AGG ACT ACG TGC AGC AC
CAG GTC TAA CGC AAT CTT TGG G
CCT CAA GGG CTT AAT GGG AAA C
AAC ATC GTC AAC ACC GCC TC
ACA GTT CAT TCC GGA TCC ACA
CAC CAG CCT GAT GTT TGC ATT
CGA AGC GGT GAG ATT CAG GA
CTC CAT CCA GGA CCT GAT ATT TAA G
TCC GGA ATG AAC TGT CTT CTC A
AGG TCG GAG GAC TAT CAA TCA AGT
GAA GGA GAT GGA GTT AAT GAT GTT CC
CAT CAC CTC CGG CTT CAT AAA
GAG GGA GCA TAA CAG ACT CTG TGA
CTG GAG TTC TGC CAC CTC TAC C
GCA GCC CTT CAA TGA ATA CAG G
CAT GCT GGA GAA GAC CCT TCC
GAG TAT GTT GGA GAT GGG TGC TC
GCC GAA ATG TCT TCC TCC TAA A
CAT CGG TAA AGG GCA GTC CTC
TGA CCG TCA GCA CTA ATC TCA TG
TCA CAC ACT ACG GCA TCG AGA
TTG GCG GTG GCT TTA ACA TC
CAG CCC TTC AAC GAG TAC AGG
GAG CGA TAC GGT TCC CAT ACT G
GTT GTG CTC CCT GAG CCA GA
AAT AGC CAT CTG AGC CTC AGG A









Table 2-7. Sequences included in phylogenetic analyses


Name
COX1a Fundulus
COXlb Fundulus
COX2 Fundulus
COX1 a Myoxocephalus
COXlb Myoxocephalus
COX2 Myoxocephalus
COXa Ciona
COXb Ciona
COXc Branchiostoma
COXd Branchiostoma
hCOX Myxine
1COX Petromyzon
COXla Oryzias
COXlb Oryzias
COX2 Oryzias
COXIa Gasterosteus
COXlb Gasterosteus
COX2 Gasterosteus
COX1a Tetraodon
COXlb Tetraodon
COX2 Tetraodon
COX1 Oncorhynchus
COX2a Oncorhynchus
COX2b Oncorhynchus
COX1 Danio
COX2a Danio
COX2b Danio
COX1 Monodelphis
COXlb Monodelphis
COXlb2 Monodelphis
COX2 Monodelphis
COX1 Gallus
COX2 Gallus
COX1 Bos
COX2 Bos
COX1 Xenopus 1
COX2 Xenopus 1
COX1 Canis
COX2 Canis
COX1 Homo
COX2 Homo
COX1 Rattus
COX2 Rattus
COX1 Mus


Organism
Fundulus heteroclitus killifishh)
Fundulus heteroclitus killifishh)
Fundulus heteroclitus killifishh)
Myoxocephalus octodecimspinosus (lh. Sculpin)
Myoxocephalus octodecimspinosus (lh. Sculpin)
Myoxocephalus octodecimspinosus (lh. Sculpin)
Ciona intestinalis (sea squirt)
Ciona intestinalis (sea squirt)
Branchiostoma lancelolatum amphioxuss)
Branchiostoma lancelolatum amphioxuss)
Myxine glutinosa (Atlantic Hagfish)
Petromyzon marinus (Sea Lamprey)
Oryzias latipes (Japanese medaka)
Oryzias latipes (Japanese medaka)
Oryzias latipes (Japanese medaka)
Gasterosteus aculeatus (stickleback)
Gasterosteus aculeatus (stickleback)
Gasterosteus aculeatus (stickleback)
Tetraodon nigroviridis (Green Spotted Puffer)
Tetraodon nigroviridis (Green Spotted Puffer)
Tetraodon nigroviridis (Green Spotted Puffer)
Oncorhynchus mykiss (rainbow trout)
Oncorhynchus mykiss (rainbow trout)
Oncorhynchus mykiss (rainbow trout)
Danio rerio (zebrafish)
Danio rerio (zebrafish)
Danio rerio (zebrafish)
Monodelphis domestic (gr. S.t. opossum)
Monodelphis domestic (gr. S.t. opossum)
Monodelphis domestic (gr. S.t. opossum)
Monodelphis domestic (gr. S.t. opossum)
Gallus gallus (rd. jungle fowl)
Gallus gallus (rd. jungle fowl)
Bos taurus (cattle)
Bos taurus (cattle)
Xenopus laevis (Afr. Claw. Frog)
Xenopus laevis (Afr. Claw. Frog)
Canis lupusfamiliaris (dog)
Canis lupusfamiliaris (dog)
Homo sapiens (human)
Homo sapiens (human)
Rattus norvegicus (norway rat)
Rattus norvegicus (norway rat)
Mus musculus (house mouse)


Size (AA)
452
598
610
622
600
605
653
600
177
177
610
286
605
606
609
598
598
620
1023
589
456
624
607
609
597
601
606
625
627
729
608
649
603
600
604
587
604
633
604
599
604
602
604
602










Table 2-7. Continued.
# Name
45 COX2 Mus
46 COX1 Oryctolagus
47 COX2 Oryctolagus
48 COX1 Ovis
49 COX2 Ovis
50 sCOX Squalus


Organism
Mus musculus (house mouse)
Oryctolagus cuniculus (rabbit)
Oryctolagus cuniculus (rabbit)
Ovis aries (sheep)
Ovis aries (sheep)
Squalus acanthias (spiny dogfish)


Size (AA)
604
606
604
600
603
593









Table 2-8. LRTs between amino acid based models of COX evolution


Evolutionary Model*
WAG
WAG + I
WAG + F
WAG + I + F


Ln likelihood (Ln L) Score (Ln Li-LnL2) 2 A d.f.@
-26632
-26315 317 1
-25294 1021 1
-25294 0 2


*Evolutionary models are arranged from the most simple to the most complex. Only models
using the WAG matrix were evaluated. I represents an invariable sites parameter and F
represents an among site variation parameter
A d.f. indicates the difference in free parameters between the complex and simple models
#P values represent the comparison of simple to complex models and were obtained using a chi-
squared distribution test


< 0.01
< 0.01
> 0.05









Table 2-9. LRTs between tree topologies with altered positions of hCOX and 1COX
Tree Topology Name* Ln likelihood (Ln L) Score Estimated ag (Ln L1-LnL2)-2T
COX2 Hag (most likely) -25294.22 0.737
COX1Lamp/COX2Hag -25295.57 0.737 2.70
COX2 Agnatha -25299.09 0.737 9.74
Lamp/Amp -25299.27 0.737 10.1
COX2 Vert -25299.61 0.736 10.7
COX1 Hag -25300.92 0.735 13.4
COX1 Vert -25301.22 0.735 14.0
Ancestral Hag -25301.56 0.735 14.6
COX1 Agnatha -25301.78 0.735 15.1
COX1Hag/COX2Lamp -25302.19 0.735 15.9
Ancestral agnatha -25302.55 0.735 16.7
COX1 Lamp -25303.25 0.735 18.1
COX2 Lamp -25303.85 0.735 19.3
Agnatha/Amp -25308.82 0.735 29.2
Hag/Amp -25308.90 0.735 29.4
Hag Internal -25321.15 0.737 53.9
Lamp Internal -25322.77 0.736 57.1
Lamp Mammal -25341.41 0.732 94.4
Lamp Teleost -25344.68 0.735 101
Hag Teleost -25350.30 0.734 112
Hag mammal -25408.58 0.731 229

*Each tree has the same topology as the most likely tree (Figure 2-9) but with alternative
placements of hagfish (hCOX) and lamprey (1COX) sequences as noted in Figure 2-15.
@a represents the shape value under the F model
Where Lnl is the most likely tree score and Ln2 is the tree score of the topology in question










COX-lb MRASVLGSVCALLVLLREPGCQGDEVTTSTVNPCCYLPCKHWSVCVRYGEDKYECDC 57

COX-2 MNRITFAVFLLALC--------FSFHKEVLGNACCSEPCQNRGVCTAMGSDSYECDC 49
-N 68 .........................................................................................
COX-lb THTGYYGENCSIPELWTRVRQFLKPSPDVVHYILTHFHWLWDIINN-TFLRNVLMRL 113
COX-2 TRTGYRGQNCTTPEFLTWIKISLKPTPNTVHYILTHFKGFWNIINNISFLRDAIMKY 106
*R120 *N144 -
COX-la I" NLSYYTRLLPPVPKDCPLPMGTKGKPVLP 29
COX-lb TARSNLIPSPPTFNSKYNYLSWESYYNLSYYTRILPPVPEDCPTPLGVKGRNGLP 170
COX-2 LLTSRSHMIDSPPTYNADYGYKSWEAYSNLSYYTRALPPVPEDCPTPMGVVGKKELP 163
Q203/H207
COX-la DIKEISERYFKRTEFRPDPQGTNLMFAFMAQHFTHQFFKTSHKVDAGFT LGHVD 86
COX-lb DPQVLFERLLKRRTFRPDPQGSNIMFAFFAQHFTHQFFKTYNRMGLGFT[ALSH[VD 227
COX-2 DVKVLAEKLLVRRRFIPDPQGTSLMFAFFAQHFTHQFFKSDMKNGPAFTAKGHVD 220
------- -----R277----
COX-la ASNIYGEELERQHQLRLHKDGKLKYQLINGEMYPPTVSEVPVHMVYPEGFPAEQRLA 143
COX-lb AGHIYGDSLERQHLLRLFRDGKLKYQLIDGEVYPPSVTDAPVRMSYPPGIPVEKQMA 284
COX-2 LGHIYGENLEKQHKLRLFKDGKLKYTMVNGEVYPPLVKDVGVEMHYPPHVPDSQRFA 277

COX-la IGQEVFGLVPGLTVYATIFLREHNRVCDELKGEHPTWDDEQLFQTARLIIIGEIINI 200
COX-lb IGQEVFGLLPGLSLYATLLREHNRVCD LKAEHPTWDDEQLFQTTRLIIIGETIRI 341
COX-2 VGHEAFGLVPGLLMYATIILREHNRVCD LKGVHPDWDDERLFQTTRLILIGETIKI 334
Y385/H388
COX-la IIEEYVQHLSGYYLKLKYDPSLLFGVRFQYTNRIALEFCYLYHWHPLMPDSFLIDGD 257
COX-lb VIEEYVQHLSGYLLQLKFDPTLLFNSNFQYGNRIALEFSQLYHWHPLMPDSFHISGD 398
COX-2 VIEDYVQHLSGYHFKLKFDPELLFNQRFQYQNRIASEFNTLYHWHPLMPDSFHIEEK 391
*N410
COX-la ELPYSQFLYNTSILMHYGVEKLVDAFSRQPAGQIGGGRNIHQAVLRVAEMVIRDSRA 314
COX-lb ELSYSQFLFNTSVLTHYGVEKLVDAFSRQAAGQIGGGHNINAVITKVIVGTIEESRQ 455
COX-2 DYSYKEFVFNTSVVTEHGINNLVDSFSKQIAGRVAGGRNVPGPIMYVAIKSIENSRK 448
*R513
COX-la ARLQPFNQYRKRFNLKPYSSFYELTGDEEMARGLEELYGDIDALEFYPGLLLEKTRP 371
COX-lb LRIQPFNEYRKRFNLEPYTSFRDFTDSEEIASTLEELYGDIDTLEFYPGLLLEKTRP 512
COX-2 MRYQSLNAYRKRFSMKPYTSFEDLTGEKEMAAILEELYGDVDAVELYPGLLVEKPRT 505
*V523 *S530
COX-la SSIFGESMVEMGAPFSLKGLLGNPINSPEYWKPSTFGGETGFNIIKTSTLKKLVCLN 428
COX-lb GAIFGESMVEMGAPFSLKGLLGNPICSPQYWKPSTFGGKVGFDIVNSASLKKLVCLN 569
COX-2 NAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFGGTAGFDIVNTASLQRLVCNN 562

Figure 2-1. Amino acid alignment of the forms of COX sequenced from the gills of the
euryhaline killifish (Fundulus heteroclitus). The COX-2 sequence is from GenBank
(Accession #AAS21313) and the others were obtained in this study. Amino acids that
share at least 60% identity across sequences are highlighted. *Indicates amino acids
(numbered based on ovine COX-1) involved in COX function: active site of COX
(tyrosine-385, histidine-388, and serine-530), substrate binding site (arginine-120), N-
glycosylation sites (asparagine-68, 144, and 410), sites for peroxidase activity
(glutamine-203 and histidine-207), and the two sites which define conformational
differences in channels between COX-1 and COX-2 in mammals (arginine-513 and
valine-523) (Ishikawa et al., 2007). The black boxes indicate the two domains that
define the haem-binding sites and the dashed box indicates the membrane binding
domain (Kulmacz et al., 2003; Ishikawa et al., 2007). The solid lines represent
disulfide bonds, with the beginning and end of the longest bond represented by
arrows (Kulmacz et al., 2003). The dashed line represents the arginine-277 loop
region, which has been shown to differ between COX-1 and COX-2 forms in
mammals (Yang et al., 2003). The numbers to the right of the sequences indicate the
amino acid number of each sequence.











COX-la TK-WCPYVDFHVPRNEEERKPS---------------------TEL 452
COX-lb SR-TCPYVAFSVPAEEEPGRNDGKERS--------------SEL 598
COX-2 VRGPCPVASFYVPDVKETGSMTINSSTSHSRDSNINPTVILKERTSEL 610

Figure 2-1. Continued.













COX-la MKRANLSNYFLETNHCEQNISDNYHFITLITIL-SRES--KSLASFPSGLTFCCWGA 54
COX-lb MRSPVLGPVCALLLL-LREPAC------------------RGDEVTSDTVNPCCY-- 36
COX-2 MYRFTFA-VF---LLALGVLVC--------------------- EGGNPCC--- 25
N6 8 : ................ ..............
COX-la HVLLTQVLIPVVITLVRTQECVCDSVQIT-TNVTAL LASMETTALSRSSGPEFVRS 110
COX-lb --FPCQHWGVCVRYGEDKYECDCTRTGYTGGNCTVPEFWSRVHQFL-KPS-PEVLHY 9
COX-2 -SEPCQNRGVCTALGTDNYECDCTRTGYHGHNCTTPEFLTWVKISL-KPS-PNTVHY ,79
...................................................... .......... RY.U ...................................
COX-la RTRRSSSSSPTSIGCWHLVNN-SFLRGTVMRLVETVRSDLIPSPPTYNTKYGYLNWE 166
COX-lb LTHFN-------WLWDIINH-TFLRDVLMRMVLTVRSNLIPSPPTYNSKYDYLSWE 138
COX-2 .LTHF.K....-......-.GFWNLNSSF.F.RDAIMR TSRSHLIDSPPTFNADYGYKSWE 129
*N144
COX-la SYYNISYYTRLLPPVPEDCPLPMGTKGRPDLPDPKVLTERFFRRKTFRPDPQGANLM 223
COX-lb SYYNLSYYTRILPPVPKDCPTPLGVKGKAGLPDPELLVERLLKRRTFRPDPQGSNLM 195
COX-2 AYSNLSYYTRTLPPVPEDCPTPMGVVGKKELPDAKLLAEKLFMRRQFIPDPQGTSLM 186
*Q203/H207
COX-la FAFMAQHFTHQFFKTDHELQGGFT LGVDAGNIYGDNLAKQHHLRLHKDGKLKY 280
COX-lb FAFFAQHFTHQFFKTYNRMGVGFT ALAH VDAGHVYGDNLQRQLKLRLHKDGKLKY 252
COX-2 FAFFAQHFTHQFFKSDMKKGPAFT ATG VDLNHVYGGSMERQHKLRLRQDGKLKY 243
--------------*R277----
COX-la QIVNGETYPPTTSEAPVHMMYPEDVPPEKRLAIGQEVFGLLPGLTMYATI LREHNR 337
COX-lb QLVDGQIYPPSVVDAPVKMSYPPGVPPEAQMAICQEVYGLLPGLGMFATL LREHNR 309
COX-2 QVLDGEVYPPTVKEVGADMHYPPHVPESHRFAVGHEAFGLVPGLMMYATILREHNR 300

COX-la LCDILKAEHPTWDDEQLFQTTRLIVIGEIINIIIEEYVQQLSGYQLKLKFDPTLLFN 394
COX-lb VCDELKAEHPTWDDEQLFQTARFVIIGETIKIVIEEYVQQLSGYLLQLKFDPALLFN 366
COX-2 VCDJLKEVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFN 357
S* *Y385/H388 *N410
COX-la ERFQYSNRIALEFCHLYHWHSLMPDSFLIDGDDIPYSQFFYNTSILMHYGVEKLVDA 451
COX-lb SNFQYGNRIALEFSQLYHWHPLMPESFLINGDELPYKRFLFNNTVLTHYGIENLVTA 423
COX-2 QRFQYQNRIASEFNTLYHWHPLMPDSFHIEEKDYSYKEFVFNTSVVTEHGIGNLVES 414

Figure 2-2. Amino acid alignment of the three forms of COX sequenced from the gills of the
longhorn sculpin (Myoxocephalus octodecemspinosus): COX-la, COX-lb, and COX-
2. All sequences were obtained during this study. Amino acids that share at least
60% identity across sequences are highlighted. *Indicates amino acids (numbered
based on ovine COX-1) involved in COX function: active site of COX (tyrosine-385,
histidine-388, and serine-530), substrate binding site (arginine-120), N-glycosylation
sites (asparagine-68, 144, and 410), sites for peroxidase activity (glutamine-203 and
histidine-207), and the two sites which define conformational differences in channels
between COX-1 and COX-2 in mammals (arginine-513 and valine-523) (Yang et al.,
2002; Ishikawa et al., 2007). The black boxes indicate the two domains that define
the haem-binding sites and the dashed box indicates the membrane binding domain
(Kulmacz et al., 2003; Ishikawa et al., 2007). The solid lines represent disulfide
bonds, with the beginning and end of the longest bond represented by arrows
(Kulmacz et al., 2003). The dashed line represents the arginine-277 loop region,
which has been shown to differ between COX-1 and COX-2 forms in mammals
(Yang et al., 2003; Kulmacz et al., 2003). The numbers to the right of the sequences
indicate the amino acid number of each sequence.











COX-la FSHQPAGQIGGGHNSHAVVLKVAEMVIRESRETRVQPFNEYRKKFNLQPYTSFYDLT 508
COX-lb FSRQVAGQIGGGFNINAAVTKVSVLTIKESRKLRMQPFNEYRKRFNLKPYTSFREFT 480
COX-2 FTNQIAGRVAGGRNVPGPIMYVAIKSIENSRKMRYQSLNAYRKRFSMKPYSSFEDMT 471
*R513 *V523 *S530
COX-la GDIEMAKGLEELYGDIDAVEFYPGLMLEKTLPTRIFGESMLEMGAPLFPERPVGKPH 565
COX-lb DNEEIARELEEFYGDVDALEFYPGLLLERTREGSIFGESMVEMGAPFSLKGLLGNPI 537
COX-2 GEKEMAAILEEFYGHVDAVELYPGLLVEKPRSNAIFGETMVEMGAPFSLKGLMGNPI 528

COX-la LLPV-LEAQHLWGRDGFQYRNFHSEETGVPQHQVVSIRGL-PCSPKGRRNQTNKSI- 620
COX-Ib CSPVYWKPSTFGGKVGF---DIVNSAT---LKKLVCLNTR-TCSYVAFRVPTEEQLK 587
COX-2 CSPEYWKPSTFGGSEGF---NIVNTAS---LQRLVCNNVQGPCPVASFSGPDVKDSG 579

COX-la -----------------------YTL 622
COX-lb TGNDDSKTRT------------ DEL 600
COX-2 SMIINSSTSNSDINPTVILKERTTEL 605


Figure 2-2. Continued.











sCOX MEAARIILLLLPLCFLKMADTTAINPCCYYPCQNKGICVNVGKEGYECDCTRT 53
hCOX MTSEVFVVLCVAVVFAGAA--AADDPCCGSPCENKGVCVSVGFEDYECDCTRT 51
t *N68 .................................................................................
sCOX GYYGVNCTFPFSWSRVHKFLKPSPSSMHHVLTHYKWLWYIINNISFFSDTLMR 106
hCOX GYYGSNCTYPTWTWIVNMLKPLPDTVHYFLTHFAPFWSLVNRAAFLRDRVMR 104
*R120 N1 -""
sCOX L.LTVRANIIPSPPTYNSDYTYVSWEGYSNISYLTRLLPPVPKDCPTPTGTQG 159
hCOX -.LMSRAHMVSSPPTYNADYGYKSWEAYSNLSYFTRLLPPVPQGCPTPMGRTG 157
*Q203/H207
sCOX YKKLPDSEQLAEEFLLRRKFIPDPQGSNLMFAFFAQHFTHQFFRTDLDRGPGF 212
1COX HQFFNTDPVRGPAF 14
hCOX KKELPDAQKLAERFLLRRTFIPDPQGSNLLFAFFAQHFTHQFFKTDFKRGPGF 210
COXc HQFFKTDFKKGAGR 14
COXd HQFFKTDFKKGPGR 14

sCOX TCALGH3VDLTHIYGDSLERQHHLRLFKDGKLKYQVVNGEVFPPSVKEAPIQM 265
ICOX TPALGH[VDLNHIYGGTLERQHQLRLFKDGKLKFQMIDGEAYPPVVRDAPVHM 67
hCOX TCALGH3VDLSHIYGDTLDKQHKLRLHNNGKLKFQMIDGEVFPPLVSEAPVDM 263
COXc TY-GDH3VDLSHIYGETVERQHQLRSFTDGKLKFQRVEGEVYPPSLADAPVHM 66
COXd TV-SDHVDMSHVYGETVERQRQLRSFQDGKLKYQLVDGEAFPPSLQDASVHM 66
--*R277----
sCOX KYPSTLPEEKRLAIGHDTFGLIPGLMMYATI LREHNRVCDILKEEHPVWSDE 318
1COX VYPEHVPASLRFAVGHEVYGLLPGLLVYATVILREHNRVCDJLHARHPRWDDE 120
hCOX IYPPHVPEAARFAVGHEAFGLVPGLMLYGTL'LREHNRVCDJLDVDHPEWDDE 316
COXc IYPPYVPEGKRFAIGHEFFGLLPGLFVYSTVILREHNRVCDJMKELHPDWDDE 119
COXd IYPPDVPEKKRFALGHEFFGLLPGLFVWATV LREHNRVCDJMKDLHPDWDDE 119

sCOX QLFQTTRLILIGETIKIVIEDYVQHLSGYNFRMMFNPELLFTEHFQYSNRIAV 371
1COX RLFQTARLILTGETMKIVIEEYVQHLSGYNFHLKFDPTLLFGVNFQYSNRMSL 173
hCOX RIFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPKLLFGQPFQYSNRISV 369
COXc RLFQTARLILTGETINIIINEYVQHLSGYNFDLFWDPELLFSDQFQYQNRIFV 172
COXd RLYQTARLILISETINIVIGEYVQHLAGKNFQLFWDPELLFEEQXQYQNSIFV 172

Figure 2-3. Amino acid alignment of the forms of COX sequenced from the gills of the lamprey
(Petromyzon marinus), hagfish (Myxine glutinosa), and amphioxus (Branchiostoma
lancelolatum), along with sCOX from the dogfish (Squalus acanthias, Accession
#AAL37727). Amino acids that share at least 60% identity across sequences are
highlighted. *Indicates amino acids (numbered based on ovine COX-1) involved in
COX function: active site of COX (tyrosine-385, histidine-388, and serine-530),
substrate binding site (arginine-120), N-glycosylation sites (asparagine-68, 144, and
410), sites for peroxidase activity (glutamine-203 and histidine-207), and the two
sites which define conformational differences in channels between COX-1 and COX-
2 in mammals (arginine-513 and valine-523) (Yang et al., 2002; Ishikawa et al.,
2007). The black boxes indicate the two domains that define the haem-binding sites
and the dashed box indicates the membrane binding domain (Kulmacz et al., 2003;
Ishikawa et al., 2007). The solid lines represent disulfide bonds, with the beginning
and end of the longest bond represented by arrows (Kulmacz et al., 2003). The
dashed line represents the arginine-277 loop region, which has been shown to differ
between COX-1 and COX-2 forms in mammals (Yang et al., 2003; Kulmacz et al.,
2003). The numbers to the right of the sequences indicate the amino acid number of
each sequence.














*Y385/H388 *N410
sCOX EFDHLYHWHPLMPDSFIVKGQDFSYKDFLFNTDILLNLGVDALVESFSKQIAG 424
1COX EFNHLYHWHPLMPDSLLIDGRNYSYDEFLFNPGLLADKKLMPLVRSFMRQRAG 226
hCOX EFNHLYHWHGLNPDAFRVGTQEYQYSQFLFNNTILLNHGVRGLLEAFNVQQAG 422
COXc EFNHL 177
COXd EFNHL 177

sCOX RIGGGRNIHQSLLHIAIATIEHGRLLRFQPYNEYRKKLGLTPYKSFQELTGER 477
1COX TVSGGRNINKNLLHVATSIIEHGRTLRLQSLNQYRHRFNMRPFTSFLELTGDE 279
hCOX RIGGGQNIHGALLHVATASIKHGRKMRFQSLNQYRKQFGLQPYQSFEQLTGET 475
*V523 *S530
sCOX EVAARLEKLYGHIDAMEFYPALLLEAPNKNSIFGESMVEMGAPFSLKGLMGNP 530
1COX AMAAEME 286
hCOX EMAADLAELYSDINAMEFYLGLMVEKPRQGALFGETMVEAGAPFSLKGLMGNA 528

sCOX ICSPDYWKPSTFGGKTGFDIVNTATFEKLICLNVK-KCPYVGFHVPY------ 582
hCOX ICSPEYWKPSTFGGNRGFEIVNSASLRRLVCLNLQGPCPDVAFHVPRDNQQDV 581

sCOX NVDNDYEREKGKP----------- STEL 593
hCOX VVNVTGSQGGSDGVTTTPHYVADQQSREL 610

Figure 2-3. Continued.














COX1 Mus
COX1 G.gal
COX1 Danio
1COX
COX2 Mus
COX2 G.gal
COX2 F.het

COX1 Mus
COX1 G.gal
COX1 Danio
1COX
COX2 Mus
COX2 G.gal
COX2 F.het

COX1 Mus
COX1 G.gal
COX1 Danio
1COX
COX2 Mus
COX2 G.gal
COX2 F.het

COX1 Mus
COX1 G.gal
COX1 Danio
1COX
COX2 Mus
COX2 G.gal
COX2 F.het

COX1 Mus
COX1 G.gal
COX1 Danio
1COX
COX2 Mus
COX2 G.gal
COX2 F.het


*H207
HQFFKTSGKMGPGFT ALGH VDLGHIYGDNLERQYHLRLFKDGKLKYQVLDG
HQFFKTSGKMGRGFT ALGH VDLGHLYGDNLQRQHQLRLFQDGKLKFQVVNG
HQFFKTHNRVGLGFT GLGH VDAGHIYGDSLDRQLELRLHKDGKLKYQVLNG
HQFFNTDPVRGPAFT ALGH VDLNHIYGGTLERQHQLRLFKDGKLKFQMIDG
HQFFKTDHKRGPGFT GLGH VDLNHIYGETLDRQHKLRLFKDGKLKYQVIGG
HQFFKTDHKKGPGFTCAYGH VDLNHIYGETLERQLKLRLRKDGKLKYQMIDG
HQFFKSDMKNGPAFT AKGH VDLGHIYGENLEKQHKLRLFKDGKLKYTMVNG
-------- --*R 77----
EVYPPSVEQASVLMRYPPGVPPERQMAVGQEVFGLLPGLMLFSTIILREHNRV
EVYPPSVTEVPVHMVYPPAIPKEKQLAMGQEVFGLLPGLCMYATLLREHNRV
DIYPPTVLHAQVKMSYPPSVPPEQQLAIGQEVFGLLPGLGMYATLLREHNRV
EAYPPVVRDAPVHMVYPEHVPASLRFAVGHEVYGLLPGLLVYATVILREHNRV
EVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIILREHNRV
EMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVFGLVPGLMMYATI LREHNRV
EVYPPLVKDVGVEMHYPPHVPDSQRFAVGHEAFGLVPGLLMYATI LREHNRV

7D jLKEEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQHLSGYFLQLKFDPEL
:DILKQEHPTWGDEQLFQTARLILIGETIKIVIEDYVQHLSGYFLNLKFDPEL
:EILKQEHPTWGDEQLFQTARLIIIGETIRIVIEEYVQHLSGYRLKLHFDPTL
:DJLHARHPRWDDERLFQTARLILTGETMKIVIEEYVQHLSGYNFHLKFDPTL
:DILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPEL
:DJLKQEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPEL
LDLKGVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPEL
*Y385/H388 *N410
LFRAQFQYRNRIAMEFNHLYHWHPLMPNSFQVGSQEYSYEQFLFNTSMLVDYG
LFEQQFQYRNRIAVEFNQLYHWHALMPDSFTIQGQEYSYEQFLYNTSMLMDYG
LFNSQFQYQNRISVEFNQLYHWHPLMPDSFYIDGDHIQYSKFIFNTSILTHYG
LFGVNFQYSNRMSLEFNHLYHWHPLMPDSLLIDGRNYSYDEFLFNPGLLADKK
LFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHG
LFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHNQEYTFQQFLYNNSIMLEHG
LFNQRFQYQNRIASEFNTLYHWHPLMPDSFHIEEKDYSYKEFVFNTSVVTEHG

VEALVDAFSRQRAGRIGGGRNFDYHVLHVAVDVIKESREMRLQPFNEYRKRFG
VEALAESFSMQTAGRIGGGQNINANVLGVAVGVIEESRQLRLQPFNEYRKRFG
LEKLVEAFSIQPAGQIGGGHNIHPVVSGVAERVIVESRELRLQPFNEYRKRFN
LMPLVRSFMRQRAGTVSGGRNINKNLLHVATSIIEHGRTLRLQSLNQYRHRFN
LTQFVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFS
LSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEYRKRFM
INNLVDSFSKQIAGRVAGGRNVPGPIMYVAIKSIENSRKMRYQSLNAYRKRFS


Figure 2-4. Amino acid alignment ICOX sequenced from the gills of the lamprey (Petromyzon
marinus), with COX-1 and COX-2 forms from vertebrates (Accession # NP 032995,
NP 035328, XP425326, XP422297, AAS21313, and NP_705942). Amino acids
that share at least 60% identity across sequences are highlighted. *Indicates amino
acids (numbered based on ovine COX-1) involved in COX function: active site of
COX (tyrosine-385 and histidine-388), N-glycosylation site (asparagine-410), and
sites for peroxidase activity (glutamine-203 and histidine-207) (Yang et al., 2002;
Ishikawa et al., 2007). The black boxes indicate the two domains that define the
haem-binding sites (Ishikawa et al., 2007). The dashed line represents the arginine-
277 loop region, which has been shown to differ between COX-1 and COX-2 forms
in mammals (Yang et al., 2003; Kulmacz et al., 2003). The numbers to the right of
the sequences indicate the amino acid number of each sequence.















COX1 Mus LKPYTSFQELTGEKEMAAEL 493
COX1 G.gal LKPYTSFQELTGEEDKAAEL 536
COX1 Danio LKPYTSFAELTGEQEMSKEL 491
1COX MRPFTSFLELTGDEAMAAEM 285
COX2 Mus LKPYTSFEELTGEKEMAAEL 477
COX2 G.gal LKPFKSFEELTGEKEMAAEL 477
COX2 F.het MKPYTSFEDLTGEKEMAAIL 482

Figure 2-4. Continued.














COX1 Mus
COX1 Danio
COX1 Ovis
hCOX
COX2 Mus
COX2 F.het
COX2 Ovis

COX1 Mus
COX1 Danio
COX1 Ovis
hCOX
COX2 Mus
COX2 F.het
COX2 Ovis

COX1 Mus
COX1 Danio
COX1 Ovis
hCOX
COX2 Mus
COX2 F.het
COX2 Ovis


++ +
MSRRSLSLWFPPLLLLLLPPTPSVLLADPGVPSPVNPCCYYPCQNQGVCVRFG
MRECNFLLKWTVI--LLLSVSFCAGEESPTSSNTANPCCYYPCQNQGICVRYG
MSRQSISLRFPLL--LLLLSPSPVFSADPGAPAPVNPCCYYPCQHQGICVRFG
MTSEVFVVLCVAVVFA-GAAAAD------------DPCCGSPCENKGVCVSVG
MLFRAVLLCAALGLSQAA-----------------NPCCSNPCQNRGECMSTG
MNRITFAVFLLALCFSFHKEVLG------------NACCSEPCQNRGVCTAMG
MLARALLLCAAV-VCGAA-----------------NPCCSHPCQNRGVCMSVG
---- +*N68 ,...+...........+..... ..................
LDNYQCDCTRTGYSGPNCTIPEIWTWLRNSLRPSPSFTHFLLTHGYWLWEFVN:
LERYECDCTRTGYYGENCTIPLWTRVYRLLKPSPNVVHYILTHFDWLWDLINi
LDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVN:
FEDYECDCTRTGYYGSNCTYPETWTWIVNMLKPLPDTVHYFLTHFAPFWSLVN:
FDQYKCDCTRTGFYGENCTTP FLTRIKLLLKPTPNTVHYILTHFKGVWNIVNi
SDSYECDCTRTGYRGQNCTTPEFLTWIKISLKPTPNTVHYILTHFKGFWNIIN:
FDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPDTVHYI.THFKGVWNIVN
+ ++ + *R120+ *N144 +
.A'Tn'REV'LM~A7LfLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVP
R-SFLRDWLMRK LTVRANLIPSPPTYNSRYDYLNWEAYSNITYYTRILPPVP
-ATFIRDTLMRL LTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVP
kAAFLRDRVMRHVLMSRAHMVSSPPTYNADYGYKSWEAYSNLSYFTRLLPPVP
NIPFLRSLIMKY LTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVA
SISFLRDAIMKY LTSRSHMIDSPPTYNADYGYKSWEAYSNLSYYTRALPPVP
ISF.LRNMIMR.LTSRSHLIESPPTYNVHYSYKSWEAFSNLSYYTRALPPVP


Figure 2-5. Amino acid alignment of ICOX sequenced from the gills of the lamprey
(Petromyzon marinus), with COX-1 and COX-2 forms from vertebrates (Accession #
NP 032995, NP035328, XP_425326, XP_422297, AAS21313, and NP705942).
Amino acids that share at least 60% identity across sequences are highlighted.
*Indicates amino acids (numbered based on ovine COX-1) involved in COX
function: active site of COX (tyrosine-385, histidine-388, and serine-530), substrate
binding site (arginine-120), N-glycosylation sites (asparagine-68, 144, and 410), sites
for peroxidase activity (glutamine-203 and histidine-207), and the two sites which
define conformational differences in channels between COX-1 and COX-2 in
mammals (arginine-513 and valine-523) (Yang et al., 2002; Ishikawa et al., 2007).
+Indicates amino acids unique to hCOX. The black boxes indicate the two domains
that define the haem-binding sites and the dashed box indicates the membrane
binding domain (Kulmacz et al., 2003; Ishikawa et al., 2007). The solid lines
represent disulfide bonds, with the beginning and end of the longest bond represented
by arrows (Kulmacz et al., 2003). The dashed line represents the arginine-277 loop
region, which has been shown to differ between COX-1 and COX-2 forms in
mammals (Yang et al., 2003; Kulmacz et al., 2003). The numbers to the right of the
sequences indicate the amino acid number of each sequence.











S+ + + *Q203/H207
COX1 Mus KDCPTPMGTKGKKQLPDVQLLAQQLLLRREFIPAPQGTNILFAFFAQHFTHQF 211
COX1 Danio NDCPTPMGTKGKIKLPDPKLLVEKFMLRRNFRLDPQGTNLMFAFFAQHFTHQF 209
COX1 Ovis RDCPTPMDTKGKKQLPDAEFLSRRFLLRRKFIPDPQSTNLMFAFFAQHFTHQF 209
hCOX QGCPTPMGRTGKKELPDAQKLAERFLLRRTFIPDPQGSNLLFAFFAQHFTHQF 199
COX2 Mus DDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGSNMMFAFFAQHFTHQF 195
COX2 F.het EDCPTPMGVVGKKELPDVKVLAEKLLVRRRFIPDPQGTSLMFAFFAQHFTHQF 200
COX2 Ovis DDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGTNLMFAFFAQHFTHQF 194
+
COX1 Mus FKTSGKMGPGFT( ALGH3VDLGHIYGDNLERQYHLRLFKDGKLKYQVLDGEVY 264
COX1 Danio FKTHNRVGLGFTKGLGH3VDAGHIYGDSLDRQLELRLHKDGKLKYQVLNGDIY 262
COX1 Ovis FKTSGKMGPGFTCALGH3VDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVY 262
hCOX FKTDFKRGPGFTCALGH3VDLSHIYGDTLDKQHKLRLHNNGKLKFQMIDGEVF 252
COX2 Mus FKTDHKRGPGFTrGLGH3VDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVY 248
COX2 F.het FKSDMKNGPAFT[AKGH3VDLGHIYGENLEKQHKLRLFKDGKLKYTMVNGEVY 253
COX2 Ovis FKTDIERGPAFTk KM3VDLSHVYGESLERQHNRRLFKDGKMKYQMINGEMY 247
--+-----+---- *R277 +--
COX1 Mus PPSVEQASVLMRYPPGVPPERQMAVGQEVFGLLPGLMLFSTILREHNRVCD-j 317
COX1 Danio PPTVLHAQVKMSYPPSVPPEQQLAIGQEVFGLLPGLGMYATLILREHNRVCEr 315
COX1 Ovis PPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIILREHNRVCD- 315
hCOX PPLVSEAPVDMIYPPHVPEAARFAVGHEAFGLVPGLMLYGTLLREHNRVCDV 305
COX2 Mus PPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATI4LREHNRVCDj 301
COX2 F.het PPLVKDVGVEMHYPPHVPDSQRFAVGHEAFGLVPGLLMYATIrLREHNRVCD 306
COX2 Ovis PPTVKDTQVEMIYPPHIPEHLKFAVGQEVFGLVPGLMMYATILREHNRVCD 300
+
COX1 Mus LKEEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQHLSGYFLQLKFDPELLFR 370
COX1 Danio LKQEHPTWGDEQLFQTARLIIIGETIRIVIEEYVQHLSGYRLKLHFDPTLLFN 368
COX1 Ovis LKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFG 368
hCOX LDVDHPEWDDERIFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPKLLFG 358
COX2 Mus LKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFN 354
COX2 F.het LKGVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFN 359
COX2 Ovis LKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFN 353
+ *Y385/H388 + *N410 + ++
COX1 Mus AQFQYRNRIAMEFNHLYHWHPLMPNSFQVGSQEYSYEQFLFNTSMLVDYGVEA 423
COX1 Danio SQFQYQNRISVEFNQLYHWHPLMPDSFYIDGDHIQYSKFIFNTSILTHYGLEK 421
COX1 Ovis AQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEA 421
hCOX QPFQYSNRISVEFNHLYHWHGLNPDAFRVGTQEYQYSQFLFNNTILLNHGVRG 411
COX2 Mus QQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQ 407
COX2 F.het QRFQYQNRIASEFNTLYHWHPLMPDSFHIEEKDYSYKEFVFNTSVVTEHGINN 412
COX2 Ovis QQFQYQNRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGVTQ 406
++ + + + ++ + +
COX1 Mus LVDAFSRQRAGRIGGGRNFDYHVLHVAVDVIKESREMRLQPFNEYRKRFGLKP 476
COX1 Danio LVEAFSIQPAGQIGGGHNIHPVVSGVAERVIVESRELRLQPFNEYRKRFNLKP 474
COX1 Ovis LVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKP 474
hCOX LLEAFNVQQAGRIGGGQNIHGALLHVATASIKHGRKMRFQSLNQYRKQFGLQP 464
COX2 Mus FVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKP 460
COX2 F.het LVDSFSKQIAGRVAGGRNVPGPIMYVAIKSIENSRKMRYQSLNAYRKRFSMKP 465
COX2 Ovis FVESFTRQIAGRVAGRRNLPAAVEKVSKASLDQSREMKYQSFNEYRKRFLLKP 459
*V523
COX1 Mus YTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCQPNSIFGESMIEMGA 529
COX1 Danio YTSFAELTGEQEMSKELEELYGHIDAMEFYPALLLEKTRPGAVFGESMVEMGA 527
COX1 Ovis YTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGA 527
hCOX YQSFEQLTGETEMAADLAELYSDINAMEFYLGLMVEKPRQGALFGETMVEAGA 517
COX2 Mus YTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEKPRPDAIFGETMVELGA 513
COX2 F.het YTSFEDLTGEKEMAAILEELYGDVDAVELYPGLLVEKPRTNAIFGETMVEMGA 518
COX2 Ovis YESFEELTGEKEMAAELEALYGDIDAMELYPALLVEKPAPDAIFGETMVEAGA 512

Figure 2-5. Continued













COX1 Mus
COX1 Danio
COX1 Ovis
hCOX
COX2 Mus
COX2 F.het
COX2 Ovis

COX1 Mus
COX1 Danio
COX1 Ovis
hCOX
COX2 Mus
COX2 F.het
COX2 Ovis


*S530 + + + + +
PFSLKGLLGNPICSPEYWKPSTFGGDVGFNLVNTASLKKLVCLNTK-TCPYVS
PFSLKGLMGNPICSPDYWKPSTFGGKTGFDIVNSATLKKLVCLNTK-WCPYVS
PFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTK-TCPYVS
PFSLKGLMGNAICSPEYWKPSTFGGNRGFEIVNSASLRRLVCLNLQGPCPDVA
PFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKG-CPFTS
PFSLKGLMGNPICSPEYWKPSTFGGTAGFDIVNTASLQRLVCNNVRGPCPVAS
PFSLKGLMGNPICSPEYWKPSTFGGEVGFKIINTASIQSLICSNVKG-CPFTS
+ + + ++
FR-VPDYPGDDGSVLVRR-------------------STEL
FHTPPSDYKPQRTS-----------------------HGEL
FH-VPDPRQEDRPGVERP-------------------PTEL
FH-VPRDNQQDVVVNVTGSQGGSDGVTTTPHYVADQQSREL
FN-V-QDPQPTKTATINASASHSRLDDINPTVLIKRRSTEL
FY-VP-DVKETGSMTINSSTSHSRDSNINPTVILKERTSEL
FS-V-QDAHLTKTVTINASSSHSGLDDINPTVLLKERSTEL


Figure 2-5. Continued













COXa Ciona
COXb Ciona
COXc
COXd

COXa Ciona
COXb Ciona
COXc
COXd


*H207
HMFFKTDPMKGMPYQ-GDQ-VDLSQIYGHGEKRQHELRSHVNGKLKVSLVDGH
HQFFKTNTIKGMPFQIGEH3VDLSHVYGHTIQRQHELRSHIDGKLKVFETNGE
HQFFKTDFKKGAGRTIGDH3VDLSHIYGETVERQHQLRSFTDGKLKFQRVEGE
HQFFKTDFKKGPGRTISDH4VDMSHVYGETVERQRQLRSFQDGKLKYQLVDGE
------------* 77----
EFPPLSNQTTANMSNINLLPQEYQFVFGHQGFSLMPTFLIWSTI LREHNRIC
VFPPLTESANVTMSGEKLM-RGRKFAIGHPGFGAFPSFFVIATLLREHNRVC
VYPPSLADAPVHMIYPPYVPEGKRFAIGHEFFGLLPGLFVYSTVILREHNRVC
AFPPSLQDASVHMIYPPDVPEKKRFALGHEFFGLLPGLFVWATVILREHNRVC


COXa Cional D[IKEENPAWDDERIFQTARLVLTGETIKVVIEDYVQHLSGFHYKLLYDPELV 385
COXb Cional DLKDLHPDWDDERLFQTARLILTGETLKIIVEDYVQHVSGFHFQLSYDPEIL 332
COXcI DMKELHPDWDDERLFQTARLILTGETINIIINEYVQHLSGYNFDLFWDPELL 159
COXd DJMKDLHPDWDDERLYQTARLILISETINIVIGEYVQHLAGKNFQLFWDPELL 159

COXa Ciona QGGSHSFHNQIHVEFQL 402
COXb Ciona HKSTFSYNNQIHAEFHI 349
COXc FSDQFQYQNRIFVEFNH 176
COXd FEEQXQYQNSIFVEFNH 176

Figure 2-6. Amino acid alignment of COXc and COXd sequences from the lancelet
(Branchiostoma lancelolatum) with COXa and COXb sequences from the sea squirt
(Ciona intestinalis). Amino acids that share at least 60% identity across sequences
are highlighted. *Indicates the amino acid (numbered based on ovine COX-1)
involved in peroxidase activity (histidine-207) (Yang et al., 2002; Ishikawa et al.,
2007). The black boxes indicate the two domains that define the haem-binding sites
(Ishikawa et al., 2007). The dashed line represents the arginine-277 loop region,
which has been shown to differ between COX-1 and COX-2 forms in mammals
(Yang et al., 2003; Kulmacz et al., 2003). The numbers to the right of the sequences
indicate the amino acid number of each sequence.














94 COX1b Gasterosteus
44 0ICOX1b Myoxocephalus
60 COX1b Oryzias

50 ICOX1b Fundulus
3 COX1 b Tetraodon
72 0COX1 Oncorhynchus

54 COX1 Danio
SCOX1 a Tetraodon

70 COX1a Fundulus
92 0COX1a Oryzias

22 79 COX1a Gasterosteus
55 0cOX1a Myoxocephalus
Sr COX1 Mus
COX1 Rattus

30 COX1 Oryctolagus
2 COX1 Homo
87 COX1 Canis

45 0COX1 Bos
86 COX1 Ovis
COX1 Gallus
81 0 COX1 Monodelphis

3 COX1b Monodelphis
56 84 COX1 b2 Monodelphis
COX1 Xenopus
sCOX Squalus
83 COX2 Gasterosteus
44 ICO2 Myoxocephalus
538 COX2b Oncorhynchus
53
40 COX2 Oryzlas
3 COX2 Fundulus
34 COX2 Tetraodon
74 COX2b Danio
COX2a Danio
27 COX2a Oncorhynchus

77 -COX2 Xenopus
94 COX2 Bos
26
23 COX2 Ovis
80 COX2 Gallus
4 COX2 Homo
434 COX2 Canis

57 COX2 Oryctolagus
38 COX2 Monodelphis
2 COX2 Mus
32- COX2 Rattus
1COX Petromyzon I
|hCOX Myxine
[COXc Branchiostoma
99 0-COXd Branchiostoma
COXa Clona
100 COXb Ciona


0.05









Figure 2-7. Evolutionary history of COX sequences inferred using the minimum evolution
method with a distance optimality criterion. The optimal tree with the sum of branch
length = 6.63322594 is shown. The percentage of replicate trees in which the
associated taxa clustered together in the bootstrap test (1000 replicates) is shown next
to the branches (Felsenstein, 1985). The tree is drawn to scale, with branch lengths in
the same units as those of the evolutionary distances used to infer the phylogenetic
tree. The evolutionary distances were computed using the JTT matrix-based method
(Jones et al., 1992) and are in the units of the number of amino acid substitutions per
site (scale bar = 0.05 amino acid substitutions per site). The rate variation among sites
was modeled with a gamma distribution (shape parameter = 0.737). The ME tree was
searched using the Close-Neighbor-Interchange (CNI) algorithm at a search level of
1. The Neighbor-Joining algorithm was used to generate the initial tree. All positions
containing gaps and missing data were eliminated from the dataset (Complete
deletion option). There were a total of 147 positions in the final dataset. Phylogenetic
analyses were conducted in MEGA4 (Tamura et al., 2007). Sequences enclosed in a
box are novel and reported here for the first time.














94 COX1 b Gasterosteus
44 I= COX1b Myoxocephalus
61 COXlb Oryzias
51 COX1b Fundulus

37 COX1b Tetraodon
1 COX1 Oncorhynchus

60 COX1 Danio
I- COX1a Tetraodon

71 COX1a Fundulus
92 COX1a Oryzias

26 80 -[ COX1a Gasterosteus
57 COX1a Myoxocephalus

99 COX1 Mus
COX1 Rattus

32 8 86 COX1 Bos
98
COX1 Ovis

87 COX1 Oryctolagus

35 34 COX1 Homo
62 COX1 Canis
COX1 Gallus

91 COX1 Monodelphis

99 COX1b Monodelphis
85 COXlb2 Monodelphis
COX1 Xenopus

82 COX2 Gasterosteus
43'1 COX2 Myoxocephalus

52 3 COX2b Oncorhynchus
41 COX2 Oryzias

40 COX2 Fundulus
34= COX2 Tetraodon
0 -- COX2b Danio

COX2a Danio
26 CO)X2a Oncorhynchus

77 COX2 Xenopus

S94 COX2 Bos
0 COX2 Ovis
83 CO)X2 Gallus

3 COX2 Homo

383 COX2 Mus
COX2 Rattus

38 COX2 Monodelphis

13 COX2 Canis
41 COX2 Oryctolagus
sCOX Squalus
COXc Branchiostoma
99 COXd Branchiostoma
COXa Ciona
100 COXb Ciona


01









Figure 2-8. Evolutionary history of COX sequences excluding hagfish (hCOX) and lamprey
(1COX) sequences inferred using the minimum evolution method with a distance
optimality criterion. The optimal tree with the sum of branch length = 6.18990857 is
shown. The percentage of replicate trees in which the associated taxa clustered
together in the bootstrap test (1000 replicates) is shown next to the branches
(Felsenstein, 1985). The tree is drawn to scale, with branch lengths in the same units
as those of the evolutionary distances used to infer the phylogenetic tree. The
evolutionary distances were computed using the JTT matrix-based method (Jones et
al., 1992) and are in the units of the number of amino acid substitutions per site (scale
bar = 0.1 amino acid substitutions per site). The rate variation among sites was
modeled with a gamma distribution (shape parameter = 0.742). The ME tree was
searched using the Close-Neighbor-Interchange (CNI) algorithm at a search level of
1. The Neighbor-Joining algorithm was used to generate the initial tree. All positions
containing gaps and missing data were eliminated from the dataset (Complete
deletion option). There were a total of 147 positions in the final dataset. Phylogenetic
analyses were conducted in MEGA4 (Tamura et al., 2007).












COXb Clona
COXa Clona


Canis


COX2 Xenopus
COX2a Oncorhynchus
COX2aDanio


COX2 Tetraodon


sCOX Squalus
CCX1 Monodelphis
995 60 COXlb2 Monrdelphis
100 COX b Monodelphis
978 r-l I Rattus

10Q X1 Oryatolagus
1 66*i1X1 Homo
34 -83Eril Canis





ICOXla Fundulus7
COXb a Tetraodon

ICOX II Ca taratmsus
I COXI a1 :aaphals
COXI aryziaa
614 COXIa Fundulus






0-7
SCOXI Cncorhynchus
CCXI Xenopus
L .57 COXI Gallus
4 CXd BranchiOs tora-4

0.1



Figure 2-9. Evolutionary history of COX sequences inferred using a maximum likelihood
optimality criterion. The most likely tree with an Ln L score = -25294.222410 is
shown. The number of replicate trees in which the associated taxa clustered together
in the bootstrap test (1000 replicates) is shown next to the branches (Felsenstein,
1985). The tree is drawn to scale, with branch lengths in the same units as those of the
evolutionary distances used to infer the phylogenetic tree. The evolutionary distances
were computed using the WAG matrix-based method (Whelan and Goldman, 2001)
and are in the units of the number of amino acid substitutions per site (scale bar = 0.1
amino acid substitutions per site). The rate variation among sites was modeled with a
gamma distribution (shape parameter estimated = 0.737). Phylogenetic analyses were
conducted using PhyML (Guindon and Gascuel, 2003). Sequences enclosed in a
rectangle are novel and reported here for the first time.











COXb Ciona
COXa Ciona


COX2 Monod
QOX2 Canis


COX2 Xenop
Gallu
COX2a Onco
COX2a Dani
IX2b Dani
OX2b Onco
COX2 Tetra
,SY2 Myoxo


COX a Tetr


4 /Ud COX1a Myox
691 COX a Oryz
L 9 COX1a Fund
997
8 COX1b Tetr
COX b Myox
1000
I OXl b Gast
954
1 dCOX1b Fund
681 675
65 COXlb Oryz
946
1000 2 COX1 Danio
1000 724
COX1 Oncor
COX1 Xenop
COX1 Gallu
COX1 Monod
6G9 COXlb2 Mon
1000
COX1b Mono
981 COX1 Rattu
Mus
Oox1 Oryct
693DX1 Homo
80COX1 Canis
7Q 1 Ovis
Cu(1 Bos
COXd Branc
979
COXc Branc
0.1









Figure 2-10. Evolutionary history of COX sequences excluding sequences from the hagfish
(hCOX) and lamprey (1COX) inferred using a maximum likelihood optimality
criterion. The most likely tree with an Ln L score = -24242.30059 is shown. The
number of replicate trees in which the associated taxa clustered together in the
bootstrap test (1000 replicates) is shown next to the branches (Felsenstein, 1985). The
tree is drawn to scale, with branch lengths in the same units as those of the
evolutionary distances used to infer the phylogenetic tree. The evolutionary distances
were computed using the WAG matrix-based method (Whelan and Goldman, 2001)
and are in the units of the number of amino acid substitutions per site (scale bar = 0.1
amino acid substitutions per site). The rate variation among sites was modeled with a
gamma distribution (shape parameter estimated = 0.742). Phylogenetic analyses were
conducted using PhyML (Guindon and Gascuel, 2003). Sequence names are
abbreviated from Figure 2-9.














COX Petromyzon
COX Myxine
COX2 Monodelphis

,&W canis
- COX2 Oryctolagus
0 Rattus
_QR6g2 Mus
000 COX2 Homo


SCOY2 Bos
COX2 Gallus
)0000
- COX2 Xenopus


Danio
b Oncorhynchus


! Oryzias


Monodelphis


COX1a Myoxoi


1 a Oryzias
I a Fundulus


I ... COXlaTetraodon

0.999 COX1 b Tetraodon
1 b Myoxocephalus
C- OX1 b Gasterosteus
0.939000
.74 0 0.59901 b Fundulus
COX1b Oryzias
COX1 Danio
0.776000
COX1 Oncorhynchus
COXd Branchiostoma
-- C c Branchiostoma
0.1


COXb Ciona
COXa Ciona


COM1 Bos









Figure 2-11. Alternate likelihood ratio test (aLRT) scores for branch support of COX sequences.
The most likely tree is shown and the topology, branch lengths, and model of
evolution are the same as in Figure 2-9. Scores represent the gain in likelihood when
collapsing a particular branch and are independent of bootstrap scores (Felsenstein,
1985). Scores were interpreted using a conservative estimate of the minimum of
parametric chi-squared and non-parametric Shimodaira-Hasegawa-like (SH) support
value interpretations (Anisimova and Gascuel, 2006). Analysis was performed using
PhyML (Guindon and Gascuel, 2003). Support values of interest to the present study
are enclosed in boxes.












COXb Ciona
SCOXa Ciona


COX2 Monod
CQX2 Canis


X2b Onco
COX2 Tetra


COX1a Myox


COXa Tetr


COX b Oryz


COX b Mono


O"uWX1 Canis

0.O99' 51)
L- CI1 BDos


COXd Branc
Branc


0.1









Figure 2-12. Alternate likelihood ratio test (aLRT) scores for branch support of COX sequences
excluding hagfish (hCOX) and lamprey (1COX) sequences. The most likely tree is
shown and the topology, branch lengths, and model of evolution are the same as in
Figure 2-11. Scores represent the gain in likelihood when collapsing a particular
branch and are independent of bootstrap scores (Felsenstein, 1985). Scores were
interpreted using a conservative estimate of the minimum of parametric chi-squared
and non-parametric Shimodaira-Hasegawa-like (SH) support value interpretations
(Anisimova and Gascuel, 2006). Analysis was performed using PhyML (Guindon
and Gascuel, 2003). Support values of interest to the present study are enclosed in
boxes.












COXb Ciona
- COXa Ciona


sCOX Squalus
- COX1 Xenopus
COXI Gallus
COXi Oryctolag a
1Fl.98COX1 Homo
00COX1 Canis
J 49?X1 Bos


COX1b Monodelphis


1 1. COXlaMyoxocephalusl
COXla Gasterosteus
COX1a Tetraodon
COX Myxine
COX2 Monodelphis
COX2 Oryctolagus
aOX2 Canis
53COX2 Homo
0.94 1 L po i 2 Bos
1.01 1 L COX2 Ovi
1C9X2 Mus
COX2 Rattus
COX2 Gallus
0.91
COX2 Xenopus
0.9 COX2b Danio
0COX2b Oncorhynchus
1.00 COX2 Tetraodon
COX2 Fundulus
S 1.0 COX2 Oryzias
1. OX2 Gasterosteus
-COX2 Myoxocephalus
SCOX2a Danio
SCOX2a Oncorhynchus
[COX Petromyzon
0.93 COXe Branchiostoma
0 COXd Branchiostoma
0.1



Figure 2-13. Evolutionary history of COX sequences inferred using a Bayesian optimality
criterion. The consensus tree is shown. The posterior probabilities (10 million
generations) are shown next to the branches. Trees were sampled every 500
generations with a burnin of 10% (401 trees). The tree is drawn to scale, with branch
lengths in the same units as those of the evolutionary distances used to infer the

phylogenetic tree. The evolutionary distances were computed using the WAG matrix-
based method (Whelan and Goldman, 2001) and are in the units of the number of
amino acid substitutions per site (scale bar = 0.1 amino acid substitutions per site).
The rate variation among sites was modeled with a gamma distribution (shape
parameter estimated = 0.672275). Phylogenetic analyses were conducted using
MrBayes 3.1.2. Sequences enclosed in a rectangle are novel and reported here for the
first time.












COXa Ciona
COXb Ciona
sCOX Squalus
COX1 Xenopus
1.) COX1 Gallus
COX1 Oryctolagus

1.00 98COX1 Homo
OOCOX1 Canis
1 9 OX1 Bos
1.00
SCOX1 Ovis
0.92 COX1 Mus
1. 1.00
COX1 Rattus
COX1 Monodelphis
S 1.00 d1 COX b Monodelphis

COXlb2 Monodelphis


0.97 COX1 Oncorhynchus
COX1 Danio
0 6 COX1b Tetraodon
COX1b Fundulus
9 COXlb Oryzias
0.99
1.00 r .0COX b Gasterosteus
1.00 1.00
COX1b Myoxocephalus
COX1a Fundulus
0.98
COXla Oryzias
1.i0 COX1a Myoxocephalus
COX1a Gasterosteus
C0.88
COXI a Tetraodon


S COX2 Monodelphis
COX2 Oryctolagus
8a0X2 Canis
75COX2Homo

1 00OX2 Bos


1 'XK
I "TTM 1.00


L COX2 Rattus
COX2 Gallus
0.96
COX2Xenopus
10 COX2b Danio

COX2b Oncorhynchus

1.00 COX2 Tetraodon
COX2 Fundulus

S 1.0 COX2 Oryzias
COX2 Gasterosteus
1.00
0COX2 Myoxocephalus
COX2a Danio
CO1.00
COX2a Oncorhynchus


COXc Branchiostorna
1.0 Branchistma
COXd Branchiostoma


- 1.00


I 1.0(


0.1









Figure 2-14. The evolutionary history of COX sequences excluding hagfish (hCOX) and
lamprey (1COX) sequences inferred using a Bayesian optimality criterion. The
consensus tree is shown. The posterior probabilities (10 million generations) are
shown next to the branches. Trees were sampled every 500 generations with a bumin
of 10% (401 trees). The tree is drawn to scale, with branch lengths in the same units
as those of the evolutionary distances used to infer the phylogenetic tree. The
evolutionary distances were computed using the WAG matrix-based method (Whelan
and Goldman, 2001) and are in the units of the number of amino acid substitutions
per site (scale bar = 0.1 amino acid substitutions per site). The rate variation among
sites was modeled with a gamma distribution (shape parameter estimated =
0.667978). Phylogenetic analyses were conducted using MrBayes 3.1.2.








a) b) .















c) d)
















Figure 2-15. The 21 alternate tree topologies generated to test the effects of relocating the
hagfish (hCOX) and lamprey (ICOX) sequences on the likelihood score (Ln L). Each
topology is simplified, but all relationships remain the same as in the most likely
topology (Figure 2-9) with the exception of hCOX and ICOX. Each topology was
generated using TreeViewl.6.6 based on the most likely topology. Ln L was
calculated for each topology online using PhyML (Guindon et al., 2005), branch
lengths and model parameters were estimated. The topologies are named in Table 2-9
as follows (from most to least likely): a) COX2 Hag (most likely) b) COX1
Lamp/COX2 Hag c) COX2 Agnatha d) Lamp/Amp e) COX2 Vert f) COX1 Hag g)
COX1 Vert h) Ancestral Hag i) COX1 Agnathaj) COX1 Hag/COX2 Lamp k)
Ancestral Agnatha 1) COX1 Lamp m) COX2 Lamp n) Agntha/Amp o) Hag/Amp p)
Hag Internal q) Lamp Internal r) Lamp Mammal s) Lamp Teleost t) Hag Teleost u)
Hag Mammal.





100






e) f)








g) h) .



L mi m



i)j)..
-,.







Figure 2-15. Continued.


101









k) 1)



--- ______________ ^ ^-- --- -- -'llli














m) n)


















o) p)













Figure 2-15. Continued




Figure 2-15. Continued.











q) c := r) c


u~tot

















s) t)}
_____ ______ Cm~ltianu m^







hillashwites







u)l
|- ---- .. ----- L-2--
L*"raxlhumar
























Figur 2-5.
^. -I103



)) t> ,nvs
ua :*Brram
SQ ~n ic, _co! l?
















coooor*au






Figure~ 2-15.Contnued
103 .r- =
I r ^ ':,*.'*
__________________ ~ BLJ| O.K'S. BE~tfifct`





L ^ f "- _F,.,.
J ^ f
l nh __ ^ ^
___________~r ""**_____
I-f C ^ ^ ^ ^ ^ ^ ^ f
^ -------------------- ^ 1

Ui "2 ^NL RI-,~I

I- ------- ^^^^ = ^ ^h.^.
-- 0 X L .----------

1~ ~ 1 TeE -tt-s --
---^----^ |i I&'l-iWU~i ^^^^^^^^^^^^ ^



^^|},-.K1








Figur I--lj- C01CS'Oida












103













CQOXd BrarLosboina
COxa Crona


COX2 GaRlus-
COxq Xerpus
CGO2 Ovi
COX2 Manodel*his
COX2 Cuiis


COX2 Pru
COX, MiVS

cox2 aa oi
cCX20 riasw
COX2-a OrLshynd s
COX2 Ga$terWisV
COX2tb Dan
COX2b OQnXWhyrthvS
COx2 Tw"raod
COX Oryzias
CoX2 Fridukis
G0X2 WOiaOMMlu
1COX Petronmyrmn
SCOX Squalus j


COX1 Bos
COX1 M~nidelpis

COXl Monodflophis
COX1 laindel s
coxi Ws
COX1 Rautus
COX1 Orycolagus
COX HTna'
Coxi Cams
COXi Crdas

COXIa Tetaodrn
COX 1a Galserosiem
COX 1 a Myoocephaks
COXa Funrdulus
COX1 Danio
COX Oncorwhhtus
COX1b Funailus
COX b Tetrankn
COXlb Gasierole-us
COXib Myonxccihakus
.U*i it .jr,:iia


Cephalochordata
Urochordata


2a


2b/2


















la


1



lb


Vertebrata-2






















Vertebrata-1


Figure 2-16. Unrooted phylogeny showing the most likely scenario for COX evolution in the
chordates based on several other analyses. Clades of interest are highlighted on the
right and sequences that represent unclear placements are highlighted in red boxes.









CHAPTER 3
SUMMARY AND FUTURE DIRECTIONS

Summary

This thesis is the first attempt to characterize the evolution of the enzyme cyclooxygenase

in the phylum chordata. Traditional molecular protocols such as cloning and polymerase chain

reactions were used to search for cyclooxygenase sequences in a wide range of evolutionarily

key chordates. Using these novel sequences and pre-existing sequences from GenBank and

genomic databases, phylogenetic analyses were performed to reveal the identity of the novel

sequences and create the most likely scenario for the evolutionary history of cyclooxygenase in

the chordates.

Novel COX Sequences

Chapter 2 describes the process of obtaining and characterizing novel cyclooxygenase

(COX) sequences in amphioxus (Branchiostoma lancelolatum), the Atlantic hagfish (Myxine

glutinosa), the sea lamprey (Petromyzon marinus), the euryhaline killifish (Fundulus

heteroclitus), and the longhorn sculpin (Myoxocephalus octodecemspinosus). Total RNA was

isolated and reverse transcribed from gill tissue (or whole animals in amphioxus) and the

resulting cDNA was exposed to PCR in the presence of degenerate and/or specific primers. The

products were then visualized and cloned. The resulting plasmids were sequenced at the Marine

DNA Sequencing Center at the MDIBL. Complete amino acid sequences of putative COX

proteins from the hagfish, killifish, and sculpin and incomplete amino acid sequences from

amphioxus and the lamprey were predicted based on the sequences found. These putative amino

acid sequences were aligned with known COX protein sequences and conserved domains,

regions, and residues critical to COX function were described. Based on the novel sequences'

identity to known COX forms and phylogenetic analyses (see below), it was concluded that









COX-la, COX-lb, and COX-2 are found in the sculpin; COX-la and COX-lb are found in the

killifish; a new COX form named 1COX is found in the lamprey; a new COX form named hCOX

is found in the hagfish; and two ancestral forms named COXc and COXd are found in

amphioxus.

Phylogenetic Analyses

Chapter 2 also describes the phylogenetic analyses used to reconstruct the evolutionary

history of cyclooxygenase in the chordates. The nine novel COX protein sequences described

here, as well as 41 additional COX protein sequences from GenBank and genomic databases,

were subjected to phylogenetic analyses using three optimality criteria: minimum

evolution/distance, maximum likelihood, and Bayesian phylogenetics. In each analysis, two

clades were well-supported in the gnathostomes: a COX-1 clade and a COX-2 clade. Each of

these clades contained a well supported teleost and tetrapod clade. In the teleost clades, clades

for COX-la, COX-lb, COX-2a, and COX-2b were well-supported, confirming the findings of

Ishikawa et al. (2007) and Ishikawa and Herschman (2007). The placement of the more

evolutionarily ancestral chordates was ultimately uncertain, although it appears that the

urochordates, cephalochordates, and vertebrates (containing COX-1 and COX-2) each represent

an independent origin of COX proteins. The hagfish and lamprey sequences most likely

represent basal members of the COX-2 and COX-1 clades of vertebrates, respectively; however,

these forms may belong closer to the root of the tree.

Future Directions

Although here I report 9 novel cyclooxygenase (COX) sequences from a range of

chordates and present a likely scenario for the evolution of this gene family in the chordates,

many questions remain regarding COX evolution and function in the chordates. These include

determining the true history of COX evolution in the earliest chordates, pinpointing the origin of









COX-1 and COX-2, and investigating the history of COX duplication and loss in the teleosts.

Finally, the physiological function of COX in the earliest chordates has only been preliminarily

investigated.

Completion of novel sequences

Several of the novel sequences documented here could not be completed despite multiple

efforts using many primer sets and PCR techniques. Notably, only 532 bp were obtained of the

sequences from amphioxus (COXc and COXd). Compared to the complete open reading frame

of COX transcripts in other chordates (ranging from about 1700-2500 bp), this indicates that

about 75% of these sequences remain unknown. Completing the rest of these sequences or

thoroughly searching the recently complete genome of Branchiostomafloridae may yield

putative proteins that provide novel groupings in phylogenetic analyses. Based on the available

sequence data, however, COXc and COXd are well-supported as being near the base of the

chordate COX lineage, sister to the vertebrate COX-1 and COX-2 clade. The 1COX sequence

obtained from the lamprey is also only about 40% complete. Completing the open-reading frame

of this putative protein or searching genomic databases could possibly give a more definite view

of its identity as this sequence groups with different clades depending on the phylogenetic

analysis used. In actuality, the short size of 1COX compared to the other COX sequences used in

the phylogenetic analyses may have contributed to its tendency to appear in different clades in

different analyses. Finally, the COX-la sequence obtained from the sculpin may warrant further

investigation and reaffirmation via additional sequencing since many residues critical to COX

function are missing.

Additional Phylogenetic Analysis

Unfortunately, the evolutionary relationship of the COX proteins in the chordates was not

able to be unequivocally resolved, despite the use of three different phylogenetic approaches.









This may be due to the incompleteness of some sequences and a lack of sufficient sampling

across taxa or may represent a history that is irresolvable under the current circumstances.

However, the phylogenetic techniques used here may also be improved upon in future analyses.

Phylogenetically uninformative areas of the sequences (such as near the C and N terminus,

which show little homology across sequences) could be removed. Here, protein sequences were

used to gain insight into the evolution of COX functionality, but insights could also be gained by

performing similar analyses using DNA sequence data instead of using their inferred protein

amino acid sequences. This would allow for greater complexity of models to estimate

substitution rates and could take additional factors into account such as codon bias. Using

nucleotide versus amino acid would also enable additional search strategies and phylogenetic

programs to be used. Choosing the optimum search strategy and computer program may be

critical in finding the optimum evolutionary reconstruction. For example, maximum likelihood

analyses PhyML (the program used in this study) may find suboptimal likelihood scores when

the data-set contains little phylogenetic information (Morrison, 2007). However, programs such

as RAxML (Stamatakis, 2006), GARLI (Brauer et al., 2002), and PAUP* (Rogers and Swafford,

1998) may perform better under the same circumstances (Morrison, 2007). Also, evaluating

alternative tree topologies using frameworks other than maximum likelihood may yield

alternative results.

Additional Sequences

Based on the most likely scenario of COX evolution in the chordates, there are several

COX sequences in the chordates examined in this study that remain to be characterized. If

hCOX in actuality represents a basal form of COX-2, then there should also be a COX-1 form in

the hagfish. Similarly, if ICOX and sCOX represent basal forms of COX-1 in the lamprey and

dogfish, then they should also contain versions of COX-2. These additional forms of COX may









be harder to clone and sequence due to accumulated mutations over evolutionary time, which

would render the sequences unidentifiable and possibly non-functional. However, this is not the

case in the other vertebrates, as COX-1 and COX-2 seem to each have critical functionality.

Using Southern blotting techniques (Southern, 1975) to identify COX DNA sequences in the

DNA of hagfish, lamprey, and dogfish could immediately reveal the presence of two forms of

COX in these animals. If two forms are present, it could be concluded that they likely represent

COX-1 and COX-2 forms, and thus the origin of these forms would coincide with the vertebrate

lineage (as predicted in the current phylogenetic analysis). However, if only one form of COX

was found the results would suggest a more recent origin of COX-1 and COX-2. This technique

could be applied to a wide diversity of chordates to determine how many COX variants they

contain.

Additional Taxa

In this study, a comparative evolutionary approach was taken by sampling a wide range

of chordates, most of which had no previous record of COX genes. However, there are still

many evolutionarily interesting chordates that have not been examined for COX genes. While

COX genes are known from multiple mammals and teleosts, other chordate groups have only

been minimally sampled. Most notably is the lack of any reported COX genes from any reptile.

COX has also only been documented from a single avian species (Gallus gallus), a single

elasmobranch species (Squalus acanthias), and a single marsupial (Monodelphis domestica.

These groups represent major lineages within the vertebrates and may contain novel forms of

COX. The results of this and other recent studies also warrant further investigation within

certain chordate groups. For example, evolutionarily ancestral fishes such as the sturgeon,

paddlefish, and bowfin could likely contain a single COX-1 and COX-2 gene, while the teleosts

studied here have multiple COX-1 or COX-2 genes. Ishikawa and Herschman (2007)









hypothesize that a genome duplication in the teleost lineage and subsequent loss of either a

COX-1 (in the zebrafish/trout lineage) or COX-2 gene (in the acanthopterygian lineage) is

responsible for this observation. If this is the case, then examining taxa near the base of the

teleost lineage may reveal fish with all four variants of COX (COX-la, COX-lb, COX-2a, and

COX-2b). The COX variants from the dogfish shark, lamprey, and hagfish all group weakly

with either COX-1 or COX-2. Obtaining COX sequences from other species of hagfish,

lampreys, and elasmobranchs may confirm this initial relationship or reveal novel groupings.

Finally, although support values for the urochordata and cephalochordata clades are strong

regardless of the phylogenetic technique used, only one species from each subphylum was

included in phylogenetic analyses. Including more species could give a more complete view of

COX evolution in the evolutionarily ancestral chordates. COX sequences from these additional

taxa may be readily available in the near future due to the growing regularity of genome

sequencing across many taxa. For example, the recently completed Anolis carolinensis genome

contains COX-1 and COX-2 genes. However, due to the length of time required for whole

genome projects, the limited number of genomes available, and the difficulty of searching

recently completed, non-annotated genomes, studies that specifically target sequencing COX

genes in these taxa are needed.

Function of Cyclooxygenases

As reviewed in Chapter 1, cyclooxygenase plays several roles in chordates because of its

role in prostaglandin production. These functions have been examined in some detail in the

mammals and to a lesser degree in the fishes. However, no studies have examined the functions

of the novel COX forms presented here or any non-vertebrate COX forms in the chordates.

Therefore, I have begun preliminary studies investigating the function of these COX forms.









One preliminary method used to infer possible functions for a gene is to determine where

its mRNA transcript or protein product is expressed in the organism. For example, Choe et al.

(2006) concluded that COX-2 may play a role in osmoregulation in the killifish partly due to its

high level of expression in the gills and its presence within mitochondrion-rich cells. Following

similar procedures, I have found that COX-lb mRNA is also expressed highly in the gills of the

killifish (Fig. 3-la). Similar results were also found for COX-la and COX-2 in the sculpin (Fig.

3-2a, Fig. 3-2b), hCOX in the hagfish (Fig. 3-3a), and 1COX in the lamprey (Fig. 3-4). To

investigate which cells express COX mRNA transcripts, in situ hybridization (ISH) was

performed using probes designed against the novel COX sequences described here using

previous protocols (Choe et al., 2006). However, no staining was observed for COX transcripts

in the gills of the killifish (Fig. 3-1b) or sculpin (Fig. 3-2b). This is likely due to errors in probe

design or hybridization protocol, since COX mRNA was abundant in the gills of both the

killifish and sculpin. In the hagfish, probes designed to show hCOX mRNA expression did

produce staining patterns in a population of epithelial cells lining gill filaments and lamellae

(Fig. 3-3b). This gill structure is similar to those ofteleosts but may be functionally different

(Evans et al., 2005) and since ion transport mechanisms in hagfish may not be directly related to

those in teleosts (Choe et al., 1999), it is difficult to assign an osmoregulatory function of hCOX

based on this staining pattern. Finally, since COX-2 mRNA expression was shown to increase

following salinity transfers using qPCR (Choe et al., 2006), a similar procedure was used to

investigate COX expression after salinity acclimation in the gills of the killifish (Fig. 3-1c) and

sculpin (Fig. 3-2c). The only significant result from this experiment was that COX-lb was

expressed more abundantly in killifish chronically acclimated to fresh water than seawater.

However, the same general trend shown for COX-2 in the killifish (Choe et al., 2006) was also









shown for COX-lb in the killifish: an increase in expression 3 hours after salinity transfer

(although P = 0.06 in this case) and a return to pre-transfer expression levels by 8 hours after

transfer. Taken as a whole, these preliminary results suggest that the different COX forms may

be playing various roles in osmoregulation in the killifish, sculpin, lamprey, and hagfish.

Clearly, COX function in the non-mammalian chordates has just begun to be investigated

and many questions still remain. Future studies may investigate COX roles in these chordates by

examining protein expression patterns using immunohistochemistry, blocking COX function via

commercially available COX inhibitors, or examining COX expression during reproductive

events. Of particular interest are the differential roles of the various COX forms in the teleosts

and the possible partitioning of functionality between COX-la and COX-lb or COX-2a and

COX-2b.









A)


COX-lb

18S


GOB HS K

1111111


Tkm(h)


Figure 3-1. Euryhaline killifish (Fundulus heteroclitus) COX-lb mRNA expression following
procedures outlined in Choe et al. (2006). A) COX-lb mRNA expression in various
tissues in the killifish. Expression was constant across tissues for the ribosomal
protein 18S. COX-lb expression was most abundant in the gills (labeled as G),
followed by the heart (H), kidney (K), opercular epithelium (0), stomach (S),
intestine (I), and brain (B). B) In situ hybridization of COX-lb in the gills of the
killifish. C) Expression of COX-lb mRNA in the gills of the killifish following
salinity transfers. Expression is normalized to the ribosomal gene L8 and is shown
relative to seawater (SW) (FW = fresh water).










GOBH S IK


iUUU11


A)







COX-la
18S


B)


40
35
30
25
20
15


05
00
24 hrs


72 hrs


GO BH SI K


[ [ [


iOX-2
18S-


COX-la 16 COX-2
o Seaw ater
14
20% Seaw ater

S10
10

W 06
04
02
00


24 hrs


72 hrs


Time
Time
Figure 3-2. Longhorn sculpin (Myoxocephalus octodecemspinosus) COX-la and COX-2 mRNA
expression following procedures outlined in Choe et al. (2006). A) COX-la and
COX-2 mRNA expression in various tissues in the sculpin. Expression was constant
across tissues for the ribosomal protein 18S. COX-la was most abundant in the
opercular epithelium (labeled as O), followed by the gills (G), kidney (K), heart (H),
brain (B), intestine (I), and stomach (S). COX-2 was most abundant in the gills,
followed by the opercular epithelium, and kidney. B) In situ hybridization of COX-
lb and COX-2 in the gills of the sculpin. C) Expression of COX-lb and COX-2
mRNA in the gills of the sculpin after 24 and 72 hours following salinity transfers to
100% and 20% seawater. Expression is normalized to the ribosomal gene L8.











A)


hCOX

18S-


.\lllisejise ''

S.-.. .o -..., .
,".'*''\,i ^



I .w ^'^ <^ ;


Sense


Sense


Figure 3-3. Atlantic hagfish (Myxine glutinosa) COX (hCOX) mRNA expression following
procedures outlined in Choe et al. (2006). A) COX mRNA expression in various
tissues in the hagfish. Expression was constant across tissues for the ribosomal
protein 18S. COX (hCOX) expression was most abundant in the gills (labeled as G),
followed by the heart (H), kidney (K), stomach (S), intestine (I), muscle (M), and
brain (B). B) In situ hybridization of hCOX in the gills of the hagfish from two
contrary gill cross-sections. Arrows highlight staining, indicating hCOX mRNA
expression. Staining for antisense and sense (control) probes is shown.


G M B H S I K

i i i i






















1COX---

18S--


Figure 3-4. Sea lamprey (Petromyzon marinus) COX (1COX) mRNA expression in various
tissues following procedures outlined in Choe et al. (2006). Expression was constant
across tissues for the ribosomal protein 18S. COX (1COX) expression was most
abundant in the heart (labeled as H), followed by the intestine (I), stomach (S), gills
(G), kidney (K), muscle (M), and brain (B)


G M


B H S I K









LIST OF REFERENCES


Abbasi, A. A. and Grzeschik, K. H. (2007). An insight into the phylogenetic history of HOX
linked gene families in vertebrates. BMC Evol. Biol. 7, 239.

Allegaert, K., Rayyan, M., and Anderson, B.J. (2006). Impact of ibuprofen administration on
renal drug clearance in the first weeks of life. Methods Find. Exp. Clin. Pharmacol. 28,
519-522.

Anisimova, M. and Gascuel, 0. (2006). Approximate likelihood-ratio test for branches: A fast,
accurate, and powerful alternative. Syst. Biol. 55, 539-552.

Arruda, J. A. (1982). Interaction of calcium and cyclooxygenase inhibitors on transport by the
turtle and toad bladders. Arch. Int. Pharmacodyn. Ther. 257, 319-334.

Balaji, T., Ramanathan, M., and Menon, V. P. (2007). Localization of cyclooxygenase-2 in
mice vas deferens and its effects on fertility upon suppression using nimesulide: a
preferential cyclooxygenase-2 inhibitor. Toxicology. 234, 135-144.

Beiche, F., Scheuerer, S., Brune, K., Geisslinger, G., and Goppelt-Struebe, M. (1996). Up-
regulation of cyclooxygenase-2 mRNA in the rat spinal cord following peripheral
inflammation. FEBS Lett. 390, 165-169.

Bicego, K. C., Steiner, A. A., Antunes-Rodrigues, J., and Branco, L. G. (2002).
Indomethacin impairs LPS-induced behavioral fever in toads. J. Appl. Physiol. 93,
512-516.

Buonocore, F., Forlenza, M., Randelli, E., Benedetti, S., Bossfi, P., Meloni, S., Secombes, C.
J., Mazzini, M. and Scapigliati, G. (2005). Biological activity of sea bass
(Dicentrarchus labrax L.) recombinant interleukin-lbeta. Mar. Biotechnol. (NY). 7, 609-
617.

Brauer, M. J., Holder, M. T., Dries, L. A., Zwickl, D. A., Lewis, P. 0., and Hillis, D. M.
(2002). Genetic algorithms and parallel processing in maximum-likelihood phylogeny
inference. Mol. Biol. Evol. 19, 1717-1726.

Breder, C. D., Dewitt, D., and Kraig, R. P. (1995). Characterization of inducible
cyclooxygenase in rat brain. J. Comp. Neurol. 355, 296-315.

Breder, C. D. and Saper, C. B. (1996). Expression of inducible cyclooxygenase mRNA in the
mouse brain after systemic administration of bacterial lipopolysaccharide. Brain Res.
713, 64-69.

Brubacher, J. L., Secombes, C. J., Zou, J., and Bols, N. C. (2000). Constitutive and LPS-
induced gene expression in a macrophage-like cell line from the rainbow trout
(Oncorhynchus mykiss). Dev. Comp. Immunol. 24, 565-574.









Cao, C., Matsumura, K., Yamagata, K., and Watanabe, Y. (1996). Endothelial cells of the
brain vasculature express cyclooxygenase-2 mRNA in response to systemic interleukin-1:
a possible site of prostaglandin synthesis responsible for fever. Brain Res. 733, 263-272.

Carrasquer, G. and Li, M. (2002). Effect of ibuprofen and rofecoxib transport parameters in
the frog corneal epithelium. J. Membr. Biol. 190, 127-132.

Censarek, P., Freidel, K., Hohlfeld, T., Schr6r, K. and Weber, A. A. (2006). Human
cyclooxygenase-lb is not the elusive target of acetaminophen. Eur. J. Pharmacol.
551, 50-53.

Cha, Y. I., Kim, S. H., Solnica-Krezel, L., and Dubois, R. N. (2005). Cyclooxygenase- 1
signaling is required for vascular tube formation during development. Dev. Biol. 282,
274-283.

Cha, Y. I., Solnica-Krezel, L., and DuBois, R. N. (2006a). Fishing for prostanoids:
deciphering the developmental functions of cyclooxygenase-derived
prostaglandins. Dev. Biol. 289, 263-272.

Cha, Y. I., Kim, S. H., Sepich, D., Buchanan, F. G., Solnica-Krezel, L., and DuBois, R. N.
(2006b). Cyclooxygenase-1-derived PGE2 promotes cell motility via the G-protein-
coupled EP4 receptor during vertebrate gastrulation. Genes Dev. 20, 77-86.

Challis, J. R., Sloboda, D. M., Alfaidy, N., Lye, S. J., Gibb, W., Patel, F. A., Whittle, W. L.
and Newnham, J. P. (2002). Prostaglandins and mechanisms of preterm birth.
Reproduction. 124, 1-17.

Chakraborty, I., Das, S. K.,Wang, J., and Dey, S. K. (1996). Developmental expression of the
cyclo-oxygenase-1 and cyclo-oxygenase-2 genes in the peri-implantation mouse uterus
and their differential regulation by the blastocyst and ovarian steroids. J. Mol.
Endocrinol. 16, 107-122

Choe, K. P., Edwards, S., Morrison-Shetlar, A. I., Toop, T., and Claiborne, J. B. (1999).
Immunolocalization of Na+/K(+)-ATPase in mitochondrion-rich cells of the atlantic
hagfish (Myxine glutinosa) gill. Comp. Biochem. Physiol. 124, 161-168.

Choe, K. P., Havird, J., Rose, R., Hyndman, K, Piermarini, P. and Evans, D. H. (2006).
COX2 in a euryhaline teleost, Fundulus heteroclitus: primary sequence, distribution,
localization, and potential function in gills during salinity acclimation. J. Exp. Biol. 209,
1696-1708.

Cohn, S. M., Schloemann, S., Tessner, T., Seibert, K., and Stenson, W. F. (1997). Crypt stem
cell survival in the mouse intestinal epithelium is regulated by prostaglandins synthesized
through cyclooxygenase-1. J. Clin. Invest. 99, 1367-1379.









Diao, H. L., Zhu, H., Ma, H., Tan, H. N., Cong, J., Su, R. W., and Yang, Z. M. (2007). Rat
ovulation, implantation and decidualization are severely compromised by COX-2
inhibitors. Front. Biosci. 12, 3333-3342.

Crollius, H. R. and Wessenbach, J. (2005). Fish genomics and biology. Genome Res. 15,
1675-1682.

Cummings, M. P., Handley, S. A., Myers, D. S., Reed, D. L., Rokas, A., and Winka, K.
(2003). Comparing bootstrap and posterior probability values in the four-taxon case. Syst.
Biol. 52, 477-487.

DeWitt, D. L. and Smith, W. L. (1988). Primary structure of prostaglandin G/H synthase from
sheep vesicular gland determined from the complementary DNA sequence. Proc. Natl.
Acad. Sci. USA. 85, 1412-1416.

Escalante, B. A., Ferreri, N. R., Dunn, C. E., and McGiff, J. C. (1994). Cytokines affect ion
transport in primary cultured thick ascending limb of Henle's loop cells. Am. J. Physiol.
266, C1568-1576.

Evans, D. H., Rose, R. E., Roeser, J. M. and Stidham, J. D. (2004). NaCl transport across the
opercular epithelium of Fundulus heteroclitus is inhibited by an endothelin to NO,
superoxide, and prostanoid signaling axis. Am. J. Physiol. 286, R560-R568.

Evans, D. H., Piermarini, P. M. and Choe, K. P. (2005). The multifunctional fish gill:
dominant site of gas exchange, osmoregulation, acid-base regulation, and excretion of
nitrogenous waste. Physiol. Rev. 85, 97-177.

Felsenstein, J. (1985). Confidence limits on phylogenies: An approach using the bootstrap.
Evolution. 39, 783-791.

Ferreri, N. R., Schwartzman, M., Ibraham, N. G., Chander, P. N., and McGiff, J. C. (1984).
Arachidonic acid metabolism in a cell suspension isolated from rabbit renal outer
medulla. J. Pharmacol. Exp. Ther. 231, 441-448.

Ferreri, N. R., An, S. J., and McGiff, J. C. (1999). Cyclooxygenase-2 expression and
function in the medullary thick ascending limb. Am. J. Physiol. 277, F360-368.

Ferreira, S. H. (1972). Prostaglandins, aspirin-like drugs and hyperalgesia. Nature 240, 200-
203.

Flippin, J. L., Huggett, D., and Foran, C. M. (2007). Changes in the timing of reproduction
following chronic exposure to ibuprofen in Japanese medaka, Oryzias latipes. Aquat.
Toxicol. 81, 73-78.









Flower, R. J. and Vane, J. R. (1972). Inhibition of prostaglandin synthetase in brain
explains the anti-pyretic activity of paracetamol (4-acetamidophenol). Nature 240,
410-411.

Forster, W. and Parratt, J. R. (1996). The case for low-dose aspirin for the prevention of
myocardial infarction: But how low is low? Cardiovasc. Drugs Ther. 10, 727-734.

Funk, C. D. (2001). Prostaglandins and leukotrienes: advances in eicosanoid biology.
Science 294, 1871-1875.

Furlan, R. L., Macari, M., Malheiros, E. B., Secato, E. R., and Guerreiro, J. R. (1998).
Effect of indomethacin on hyperthermia induced by heat stress in broiler chickens. Int. J
Biometeorol. 42, 73-76.

Gardiner, N. J., Giblett, S., and Grubb, B. D. (1997). Cyclooxygenases in rat spinal cord:
selective induction of COX-2 during peripheral inflammation. Br. J. Pharmacol. 120,
71P.

Gibb, W. and Sun, M. (1996). Localization of prostaglandin H synthase type 2 protein and
mRNA in term human fetal membranes and decidua. J. Endocrinol. 150, 497-503.

Gierse, J. K., McDonald, J. J., Hauser, S. D., Rangwala, S. H., Koboldt, C. M. and
Seibert, K. (1996). A single amino acid difference between cyclooxygenase-1 (COX-1)
and -2 (COX-2) reverses the selectivity of COX-2 specific inhibitors. J. Biol. Chem. 271,
15810-15814.

Gobbetti, A. and Zerani, M. (2002). Pituitary adenylate cyclase-activating polypeptide
induces testicular testosterone synthesis through PGE(2) mediation in crested newt,
Triturus carnifex. J. Exp. Zool. 293, 73-80.

Goetz, F. W., Duman, P., Ranjan, M. and Herman, C. A. (1989). Prostaglandin F and E
synthesis by specific tissue components of the brook trout (Salvelinusfontinalis) ovary. J.
Exp. Zool. 250, 196-205.

Goetz, F. W., Hsu, S.-Y. and Selover, A. (1991). Stimulation of prostaglandin synthesis in fish
follicles by a phorbol ester and calcium ionophore. J. Exp. Zool. 259, 355-364.

Goudet, G., Mugnier, S., Callebaut, I., and Monget, P. (2007). Phylogenetic analysis and
identification of pseudogenes reveal a progressive loss of zona pellucida genes during
evolution of vertebrates. Biol. Reprod. Epub. Ahead ofPrint.

Griswold, D. E. and Adams, J. L. (1996). Constitutive cyclooxygenase (COX-1) and
inducible cyclooxygenase (COX-2): rationale for selective inhibition and progress
to date. Med. Res. Rev. 16, 181-206.









Grosser, T., Yusuff, S., Cheskis, E., Pack, M. A. and FitzGerald, G. A. (2002).
Developmental expression of functional cyclooxygenases in zebrafish. Proc. Natl.
Acad. Sci. USA 99, 8418-8423.

Guindon, S. and Gascuel, 0. (2003). A simple, fast, and accurate algorithm to estimate large
phylogenies by maximum likelihood. Syst. Biol. 52, 679-704.

Guindon, S., Lethiec, F., Duroux, P. and Gascuel, 0. (2005). PHYML Online--a web server
for fast maximum likelihood-based phylogenetic inference. Nucleic Acids Res. 33,
W557-559.

Gu, X. (2001). Maximum-Likelihood approach for gene family evolution under functional
divergence. Mol. Biol. Evol. 18, 453-464.

Gu, X. (2006). A simple statistical method for estimating type-II (cluster specific) functional
divergence of protein sequences. Mol. Biol. Evol. 23, 1937-1945.

Guo, Q., Wang, L., Ruan, K and Kulmacz, R. J. (1996). Role of Val509 in time-dependent
inhibition of human prostaglandin H synthase-2 cyclooxygenase activity by isoform-
selective agents. J. Biol. Chem. 271, 19134-19139.

Hao, C.-M., Komhoff, M., Guan, Y., Redha, R. and Breyer, M. D. (1999). Selective
targeting of cyclooxygenase-2 reveals its role in renal medullary interstitial cell
survival. Am. J. Physiol. 277, F352-F359.

Harris, R. C. and Breyer, M. D. (2001). Physiological regulation of cyclooxygenase-2 in the
kidney. Am. J. Physiol. 281, F1-F11.

Harris, R. C. and Breyer, M. D. (2006). Update on cyclooxygenase-2 inhibitors. Clin. J. Am.
Soc. Nephrol. 1, 236-245.

Harris, R. C., McKanna, J. A., Akai, Y., Jacobson, H. R., Dubois, R. N. and Breyer, M. D.
(1994). Cyclooxygenase-2 is associated with the macula densa of rat kidney and
increases with salt restriction. J. Clin. Invest. 94, 2504-2510.

Hamberg, M. and Samuelsson, B. (1973). Detection and isolation of an endoperoxide
intermediate in prostaglandin biosynthesis. Proc. Natl. Acad. Sci. USA. 70, 899-903.

Hamberg, M., Svensson, J. and Samuelsson, B. (1974). Prostaglandin endoperoxides. A new
concept concerning the mode of action and release of prostaglandins. Proc. Natl. Acad.
Sci. USA. 71, 3824-3828.

Hebert, S. C., Culpepper, R. M., and Andreoli, T. E. (1981). NaCl transport in mouse
medullary thick ascending limb. I. Functional nephron heterogeneity and ADH-
stimulated NaCl cotransport. Am. J. Physiol. 241, F412-F431.









Hebert, S. C. and Andreoli, T. E. (1984). Control of NaCl transport in the thick ascending
limb. Am. J Physiol. 246, F745-F756.

Herschman, H. R., Talley, J. J., and DuBois, R. (2003). Cyclooxygenase 2 (COX-2) as
a target for therapy and noninvasive imaging. Mol. Imaging Biol. 5, 286-303.

Hirano, T., Yasukawa, K., Harada, H., Taga, T., Watanabe, Y., Matsuda, T.,
Kashiwamura, S., Nakajima, K., Koyama, K., Iwamatsu, A., Tsunasawa, S.,
Sakiyama, F., Matsui, H., Takahara, H., Taniguchi, T., and Kishimoto, T. (1986).
Complementary DNA for a novel human interleukin (BSF-2) that induces B lymphocytes
to produce immunoglobulin. Nature 324, 73-76.

Holland, J. W., Pottinger, T. G. and Secombes, C. J. (2002). Recombinant interleukin-1 beta
activates the hypothalamic-pituitary-interrenal axis in rainbow trout, Oncorhynchus
mykiss. J. Endocrinol. 175, 261-267.

Hilscher, C. (1995). Prostaglandins play a role in memory consolidation in the chick. Eur. J
Pharmacol. 294, 253-259.

Hopkins, S. J. (2007). Central nervous system recognition of peripheral inflammation: a neural,
hormonal collaboration. Acta. Biomed. 78 Suppl. 1, 231-247.

Huang, L., Zhang, K. L., Li, H., Chen, X. Y., Kong, Q. Y., Sun, Y., Gao, X., Guan, H. W.,
and Liu, J. (2006). Infrequent COX-2 expression due to promoter hypermethylation in
gastric cancers in Dalian, China. Hum. Pathol. 37, 1557-1567.

Hughes, A. L. (1999). Phylogenies of developmentally important proteins do not support the
hypothesis of two rounds of genome duplication early in vertebrate history. J. Mol. Evol.
48, 565-576.

Ishikawa, T. O., Griffin, K. J., Banerjee, U. and Herschman, H. R. (2007). The zebrafish
genome contains two inducible, functional cyclooxygenase-2 genes. Biochem. Biophys.
Res. Commun. 352, 181-187.

Ishikawa, T. 0. and Herschman, H. R. (2007). Two inducible, functional cyclooxygenase-2
genes are present in the rainbow trout genome. J. Cell. Biochem. 102, 1486-1492.

Ivanov, A. I. and Romanovsky, A. A. (2004). Prostaglandin E2 as a mediator of fever:
synthesis and catabolism. Front. Biosci. 9, 1977-1993.

Jarving, R., Jarving, I., Kurg, R., Brash, A. R. and Samel, N. (2004). On the evolutionary
origin of cyclooxygenase (COX) isozymes: characterization of marine invertebrate COX
genes points to independent duplication events in vertebrate and invertebrate lineages. J.
Biol. Chem. 279, 13624-13633.









Jayadeep, A., Reddanna, P., Sailesh, S., Das, U. N., Ramesh, G., Kumar, K. V., and
Menon, V. P. (1995). Prostaglandin metabolism during growth and differentiation of the
regenerating vertebrate appendage. Prostaglandins Leukot. Essent. Fatty Acids. 52, 235-
239.

Jin, Y., Zhang, C., Lin, X., and Zeng, W. (2006). Prostaglandin involvement in follicle-
stimulating hormone-induced proliferation of granulosa cells from chicken
prehierarchical follicles. Prostaglandins Other Lipid. Mediat. 81, 45-54.

Jin, Y., Zhang, C., Zeng, W., Taya, K., and Tan, T. Q. (2007). Interactive actions of
prostaglandin and epidermal growth factor to enhance proliferation of granulosa cells
from chicken prehierarchical follicles. Prostaglandins Other LipidMediat. 83, 285-294.

Johnson, R. F., Mitchell, C. M., Giles, W. B., Bisits, A., and Zakar, T. (2006). Mechanisms
regulating prostaglandin H2 synthase-2 mRNA level in the amnion and chorion during
pregnancy. J. Endocrinol. 188, 603-610.

Jones, D. T., Taylor, W. R., and Thornton, J. M. (1994). A mutation data matrix for
transmembrane proteins. FEBS Lett. 339, 269-275.

Kaji, D. M., Chase, H. S. Jr, Eng, J. P., and Diaz, J. (1996). Prostaglandin E2 inhibits Na-K-
2C1 cotransport in medullary thick ascending limb cells. Am. J. Physiol. 271, C354-C361.

Kargman, S., Charleson, S., Cartwright, M., Frank, J., Riendeau, D., Mancini, J., Evans, J.
and O'Neill, G. (1996). Characterization of Prostaglandin G/H Synthase 1 and 2 in rat,
dog, monkey, and human gastrointestinal tracts. Gastroenterology 111, 445-454.

Kasahara, M. (2007). The 2R hypothesis: an update. Curr. Opin. Immunol. 19, 547-552.

Kay-Mugford, P. A., Benn, S. J., LaMarre, J., and Conlon, P. D. (2000). Cyclooxygenase
expression in canine platelets and Madin-Darby canine kidney cells. Am. J. Vet. Res. 61,
1512-1516.

Kennedy, J. H., Korn, N., and Thurston, R. J. (2003). Prostaglandin levels in seminal plasma
and sperm extracts of the domestic turkey, and the effects of cyclooxygenase inhibitors
on sperm mobility. Reprod. Biol. Endocrinol. 1, 74.

Kis, B., Snipes, J. A., Gaspar, T., Lenzser, G., Tulbert, C. D. and Busija, D. W. (2006).
Cloning of cyclooxygenase-lb (putative COX-3) in mouse. Inflamm. Res. 55, 274-278.

Klein, S. L., Strausberg, R. L., Wagner, L., Pontius, J., Clifton, S. W. and Richardson, P.
(2002). Genetic and genomic tools for Xenopus research: The NIH Xenopus initiative.
Dev. Dyn. 225, 384-391.

Kulmacz, R. J., van der Donk, W. A., and Tsai, A. L. (2003). Comparison of the properties of
prostaglandin H synthase-1 and -2. Prog. LipidRes. 42, 377-404.










Kujubu, D., Fletcher, B., Varnum, B., Lim, R. and Herschman, H. (1991). TIS10, a phorbol
ester tumor promoter-inducible mRNA from Swiss 3T3 cells, encodes a novel
prostaglandin synthase/cyclooxygenase homologue. J. Biol. Chem. 266, 12866-12872.

Lear, S., Silva, P., Kelley, V. E., and Epstein, F. H. (1990). Prostaglandin E2 inhibits oxygen
consumption in rabbit medullary thick ascending limb. Am. J. Physiol. 258, F1372-1378.

Li, G., Zhang, Q. J., Ji, Z. L., and Wang, Y. Q. (2007). Origin and evolution of vertebrate
ABCA genes: a story from amphioxus. Gene. 405, 88-95.

Li, J., Simmons, D. L., and Tsang, B. K. (1996). Regulation of hen granulosa cell
prostaglandin production by transforming growth factors during follicular development:
involvement of cyclooxygenase II. Endocrinology. 137, 2522-2529.

Liu, C., Li, R., Liu, Z., Yin, S., and Wang, Z. (2006). The role of prostaglandins and the
hypothalamus in thermoregulation in the lizard, Phrynocephalus przewalskii (Agamidae).
J. Comp. Physiol. [B]. 176, 321-328.

Lurje, G., Vallbohmer, D., Collet, P. H., Xi, H., Baldus, S. E., Brabender, J., Metzger, R.,
Heitmann, M., Neiss, S., Drebber, U., Holscher, A. H., and Schneider, P. M. (2007).
COX-2 mRNA expression is significantly increased in acid-exposed compared to
nonexposed squamous epithelium in gastroesophageal reflux disease. J. Gastrointest.
Surg. 11, 1105-1111.

Mathonnet, M., Lalloue, F., Danty, E., Comte, I., and Lievre, C. A. (2001). Cyclo-
oxygenase 2 tissue distribution and developmental pattern of expression in the
chicken. Clin. Exp. Pharmacol. Physiol. 28, 425-432.

Martin, G. R. and Wallace, J. L. (2006). Gastrointestinal inflammation: a central component of
mucosal defense and repair. Exp. Biol. Med. (Maywood). 231, 130-137.

Martin, F., Fletcher, D., Chauvin, M., and Bouhassira, D. (2007). Constitutive
cyclooxygenase-2 is involved in central nociceptive processes in humans.
Anesthesiology. 106, 1013-1018.

McLaren, W. J., Young, I. R.,Wong, M. H., and Rice, G. E. (1996). Expression of
prostaglandin G/H synthase-1 and -2 in ovine amnion and placenta following
glucocorticoidinduced labour onset. J. Endocrinol. 151, 125-135.

Merlie, J. P., Fagan, D., Mudd, J. and Needleman, P. (1988). Isolation and characterization of
the complementary DNA for sheep seminal vesicle prostaglandin endoperoxide synthase
(cyclooxygenase). J. Biol. Chem. 263, 3550-3553.









Metcalfe, C. D., Koenig, B. G., Bennie, D. T., Servos, M., Ternes, T. A., and Hirsch, R.
(2003). Occurrence of neutral and acidic drugs in the effluents of Canadian sewage
treatment plants. Environ. Toxicol. Chem. 22, 2872-2880.

Morham, S. G., Langenbach, R., Loftin, C. D., Tiano, H. F., and Vouloumanos, N. (1995).
Prostaglandin synthase 2 gene disruption causes severe renal pathology in the mouse.
Cell 83, 473-482.

Morrison, D. A. (2007). Increasing the efficiency of searches for the maximum likelihood tree
in a phylogenetic analysis of up to 150 nucleotide sequences. Syst. Biol. 56, 988-1010.

O'Banion, M., Winn, V. and Young, D. (1992). cDNA cloning and functional activity of a
glucocorticoid-regulated inflammatory cyclooxygenase. Proc. Natl. Acad. Sci. USA 89,
4888-4892.

Olson, D. M. (2005). The promise of prostaglandins: have they fulfilled their potential as
therapeutic targets for the delay of preterm birth? J. Soc. Gynecol. Investig. 12, 466-478.

Otto, J. C. and Smith, W. L. (1995). Prostaglandin endoperoxide synthases-1 and -2. J. Lipid
Mediat. Cell Signal. 12, 139-156.

Patiiio, R., Yoshizaki, G., Bolamba, D., and Thomas P. (2003). Role of arachidonic acid and
protein kinase C during maturation-inducing hormone-dependent meiotic resumption and
ovulation in ovarian follicles of Atlantic croaker. Biol. Reprod. 68, 516-523.

Pough, F. H., Janis, C. M. Heiser, J. B. (2005). Vertebrate life: Seventh edition. pp. 16-48.
Prentice Hall.

Reed, D. W., Bradshaw, W. S., Xie, W., and Simmons, D. L. (1996). In vivo and in vitro
expression of a non-mammalian cyclooxygenase-1. Prostaglandins. 52, 269-284.

Reiter, R., Resch, U., and Sinzinger, H. (2001). Do human platelets express COX-2?
Prostaglandins Leukot. Essent. Fatty Acids. 64, 299-305.

Ristimiki, A., Honkanen, N., Jinkilii, H., Sipponen, P., and Hark6nen, M. (1997).
Expression of cyclooxygenase-2 in human gastriccarcinoma. Cancer Res. 57, 1276-1280.

Roberts, S. B., Langenau, D. M. and Goetz, F. W. (2000). Cloning and characterization of
prostaglandin endoperoxide synthase-1 and -2 from the brook trout ovary. Mol. Cell.
Endocrinol. 160, 89-97.

Rogers, J. S., and Swofford, D. L. (1998). A fast method for approximating maximum
likelihood of phylogenetic trees from nucleotide sequences. Syst. Biol. 47, 77-89.









Rose, T. M., Schultz, E. R., Henikoff, J. G., Pietrokovski, S., McCallum, C. M., and
Henikoff, S. (1998). Consensus-degenerate hybrid oligonucleotide primers for
amplification of distantly related sequences. Nucleic Acids Res. 26, 1628-1635.

Rowley, A. F., Vogan, C. L., Taylor, G. W. and Clare, A. S. (2005). Prostaglandins in non-
insectan invertebrates: recent insights and unsolved problems. J. Exp. Biol. 208, 3-14.

Ryan, C. A. (2000). The systemin signaling pathway: differential activation of plant defensive
genes. Biochim. Biophys. Acta. 1477, 112-121.

Sawdy, R., Slater, D., Fisk, N., Edmonds, D. K., and Bennett, P. (1997). Use of a cyclo-
oxygenase type-2-selective nonsteroidal anti-inflammatory agent to prevent preterm
delivery. Lancet 350, 265-266.

Searls, D. B. (2003). Pharmacophylogenomics: genes, evolution and drug targets. Nat. Rev.
Drug. Discov. 2, 613-623.

Seebacher, F. and Franklin, C. E. (2003). Prostaglandins are important in thermoregulation of
a reptile (Pogona vitticeps). J. Exp. Biol. 206, 1143-1151.

Seebacher, F. and Franklin, C. E. (2004). Integration of autonomic and local mechanisms in
regulating cardiovascular responses to heating and cooling in a reptile (Crocodylus
porosus). J. Comp. Physiol. [B]. 174, 577-585.

Shakhmatova, E. I., Kuznetsova, A. A., Prutskova, N. P., Bogolepova, A. E., and Natochin,
I. V. (1997). The effect of cyclooxygenase inhibitors on ion and water transport in the
human kidney and frog skin and bladder. Ross. Fiziol. Zh. Im. I. M. Sechenova. 83, 68-
75.

Singh, G. and Triadafilopoulos, G. (1999). Epidemiology ofNSAID induced gastrointestinal
complications. J. Rheumatol. 26, 18-24.

Sirois, J., Sayasith, K., Brown, K. A., Stock, A. E., Bouchard, N., and Dor6, M. (2004).
Cyclooxygenase-2 and its role in ovulation: a 2004 account. Hum. Reprod. Update. 10,
373-385.

Skoblina, M. N., Kondrat'eva, O. T., Nikiforova, G. P., and Huhtaniemi, I. (1997). The role
of eicosanoids and progesterone in the ovulation of the oocytes in the common frog.
Ontogenez. 28, 211-216.

Snipes, J. A., Kis, B., Shelness, G. S., Hewett, J. A. and Busija, D. W. (2005). Cloning and
characterization of cyclooxygenase-ib (putative cyclooxygenase-3) in rat. J. Pharmacol.
Exp. Ther. 313, 668-676.









Sorbera, L. A., Asturiano, J. F., Carrillo, M., and Zanuy, S. (2001). Effects of
polyunsaturated fatty acids and prostaglandins on oocyte maturation in a marine teleost,
the European sea bass (Dicentrarchus labrax). Biol. Reprod. 64, 382-389.

Southern, E. M. (1975). Detection of specific sequences among DNA fragments separated by
gel electrophoresis. JMolBiol. 98, 503-517.

Spaziani, E. P., Lantz, M. E., Benoit, R. R., and O'Brien, W. F. (1996). The induction of
cyclooxygenase-2 (COX-2) in intact human amnion tissue by interleukin-4.
Prostaglandins. 51, 215-223

Stamatakis, A. (2006). RAxML-VI-HPC: Maximum likelihood-based phylogenetic analyses
with thousands of taxa and mixed models. Bioinformatics. 22, 2688-2690.

Steiner, A. A., Rudaya, A. Y., Robbins, J. R., Dragic, A. S., Langenbach, R., and
Romanovsky, A. A. (2005). Expanding the febrigenic role of cyclooxygenase-2 to the
previously overlooked responses. Am. J. Physiol. Regul. Integr. Comp. Physiol. 289,
R1253-1257.

Stokes, J. B. and Kokko, J. P. (1977). Inhibition of sodium transport by prostaglandin E2 across
the isolated, perfused rabbit collecting tubule. J. Clin. Invest. 59, 1099-1104.

Szewczuk, L. M. and Penning, T. M. (2004). Mechanism-based inactivation of COX-1 by red
wine m-hydroquinones: a structure-activity relationship study. J. Nat. Prod. 67, 1777-
1782.

Tamura, K., Dudley, J., Nei, M., and Kumar, S. (2007). MEGA4: Molecular Evolutionary
Genetics Analysis (MEGA) software version 4.0. Mol. Biol. Evol. 24, 1596-1599.

Trautman, M. S., Edwin, S. S., Collmer, D., Dudley, D. J., Simmons, D., and Mitchell, M.
D. (1996). Prostaglandin H synthase-2 in human gestational tissues: regulation in amnion.
Placenta 17, 239-245.

Urick, M. E. and Johnson, P. A. (2006). Cyclooxygenase 1 and 2 mRNA and protein
expression in the Gallus domesticus model of ovarian cancer. Gynecol. Oncol. 103, 673-
678.

Vane, J. R. (1971). Inhibition of prostaglandin synthesis as a mechanism of action for the
aspirin-like drugs. Nature 231, 232-235.

Vane, J. R. and Botting, R. M. (1994). Biological properties of cyclooxygenase products. In
LipidMediators, ed. F Cunningham, pp. 61-97. London: Academic.

Vane, J. R., Bakhle, Y. S. and Botting, R. M. (1998). Cyclooxygenases 1 and 2. Annu. Rev.
Pharmacol. Toxicol. 38, 97-120.









Vio, C. P., Cespedes, C., Gallardo, P., and Masferrer, J. L. (1997). Renal identification of
cyclooxygenase-2 in a subset of thick ascending limb cells. Hypertension. 30, 687-692.

van-Lanschot, J. J., Mealy, K., Jacobs, D. O., Evans, D. A., and Wilmore, D. W. (1991).
Splenectomy attenuates the inappropriate diuresis associated with tumor necrosis factor
administration. Surg. Gynecol. Obstet. 172, 293-297.

von Euler, U. S. (1936). On the specific vaso-dilating and plain muscle stimulating substances
from accessory genital glands in man and certain animals (prostaglandin and
vesiglandin). J. Physiol. 88, 213-234.

Wald, H., Scherzer, P., Rubinger, D., and Popovtzer, M. M. (1990). Effect of indomethacin
in vivo and PGE2 in vitro on mTAL Na-K-ATPase of the rat kidney. Pluge'i \ Arch. 415,
648-650.

Wang, H., Ma, W. G., Tejada, L., Zhang, H., Morrow, J. D., Das, S. K., and Dey, S. K.
(2004). Rescue of female infertility from the loss of cyclooxygenase-2 by compensatory
up-regulation of cyclooxygenase-1 is a function of genetic makeup. J. Biol. Chem. 279,
10649-1058.

Whelan, S. and Goldman, N. (2001). A general empirical model of protein evolution derived
from multiple protein families using a maximum-likelihood approach. Mol. Biol. Evol.
18, 691-699.

Willingale, H. L., Gardiner, N. J., McLymont, N., Giblett, S., and Grubb, B. D. (1997).
Prostanoids synthesized by cyclooxygenase isoforms in rat spinal cord and their
contribution to the development of neuronal hyperexcitability. Br. J. Pharmacol. 122,
1593-1604.

Woolf, C. J., Allchorne, A., Safieh-Garabedian, B., and Poole, S. (1997). Cytokines, nerve
growth factor and inflammatory hyperalgesia: the contribution of tumour necrosis factor.
Br. J. Pharmacol. 121, 417-424

Wood, C. M. and Laurent, P. (2003). Na+ versus Cf transport in the intact killifish after rapid
salinity transfer. Biochim. Biophys. Acta. 1618, 106-119.

Wong, E., Bayly, C., Waterman, H. L., Riendeau, D. and Mancini, J. A. (1997). Conversion
of prostaglandin G/H synthase-1 into an enzyme sensitive to PGHS-2-selective inhibitors
by a double His513 to Arg and Ile523 to Val mutation. J. Biol. Chem. 272, 9280-9286.

Xie, W., Chipman, J., Robertson, D., Erikson, R. and Simmons, D. (1991). Expression of a
mitogen-responsive gene encoding prostaglandin synthase is regulated by mRNA
splicing. Proc. Natl. Acad. Sci. USA 88, 2692-2696.









Yamada, S., Kawate, T., Sakamoto, H., Aoki, K., Hamada, Y., and Atsumi, S. (2006).
Cyclo-oxygenase-2-immunoreactive neurons in the lumbar dorsal horn in a chicken acute
inflammation model. Anat. Sci. Int. 81, 164-172.

Yamagata, K., Andreassson, K. I., Kaufman, W. E., Barnes, C. A., and Worley, P. F.
(1993). Expression of a mitogen-inducible cyclooxygenase in brain neurons; regulation
by synaptic activity and glucocorticoids. Neuron 11, 371-386.

Yang, T. (2003). Regulation of cyclooxygenase-2 in renal medulla. Acta Physiol. Scand. 177,
417-421.

Yang, T., Forrest, S. J., Stine, N., Endo, Y., Pasumarthy, A., Castrop, H., Aller, S., Forrest,
J. N., Jr, Schnermann, J. and Briggs, J. (2002). Cyclooxygenase cloning in dogfish
shark, Squalus acanthias, and its role in rectal gland Cl secretion. Am. J. Physiol. 283,
R631-R637.

Yeh, H. C. and Wang, L. H. (2006). Profiling of prostanoids in zebrafish embryonic
development. Prostaglandins Leukot. Essent. Fatty Acids. 75, 397-402.

Yokoyama, C., Takai, T. and Tanabe, T. (1988). Primary structure of sheep prostaglandin
endoperoxide synthase deduced from cDNA sequence. FEBS Lett. 231, 347-351.

Zou, J., Neumann, N. F., Holland, J. W., Belosevic, M., Cunningham, C., Secombes, C. J.
and Rowley, A. F. (1999). Fish macrophages express a cyclo-oxygenase-2 homologue
after activation. Biochem. J 340, 153-159.









BIOGRAPHICAL SKETCH

Justin Chase Havird was born in 1984, in Valdosta, Georgia to Dawn and Kurt

Havird. Justin has one younger brother, Joshua. The Havirds soon moved to Lake City,

Florida, where Justin spent the majority of his childhood and adolescence. Justin

attended Columbia High School in Lake City and graduated with top honors in 2002.

Justin then attended the University of Florida in Gainesville where he majored in zoology

after an initial interest in aerospace engineering. While at UF, Justin was heavily

involved in the university's band program, playing trumpet in the marching, basketball,

volleyball, concert, and symphonic bands for several years. As an undergraduate, Justin

worked in the laboratory of Dr. David H. Evans for a number of years, investigating ion

transporters in the gills of fishes. His senior thesis was titled "Neuronal Nitric Oxide

Synthase in the Gill of the Euryhaline Killifish, Fundulus heteroclitus." Justin graduated

summa cum laude from UF in 2006 with a B.S. in zoology.

In 2006, Justin entered graduate school at the University of Florida in the

Department of Zoology. Continuing to work with Dr. Evans, Justin spent three summers

at the Mount Desert Island Biological Laboratory in Salisbury Cove, Maine where he

collaborated with other researchers investigating fish gill physiology. During his

graduate studies, Justin has earned several awards and grants, including a GIAR from

Sigma Xi. Justin has also presented his research at scientific meetings and conferences.

While earning his M.S., Justin also designed experiments and instructed students in a

senior level animal physiology course for 2 years. Justin has also collaborated with other

scientists on a wide range of marine life science projects, most notably a revision of the

cobitid genus Leid,11/ I'h1/li /////\ in SE Asia with Dr. Larry Page. After earning his









M.S., Justin plans to continue his academic career by completing a Ph.D. in a related

marine science field.





PAGE 1

EVOLUTION OF CYCLOOXYGENASE IN THE CHORDATES By JUSTIN CHASE HAVIRD A THESIS PRESENTED TO THE GRADUATE SCHOOL OF THE UNIVERSITY OF FLORI DA IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF MASTER OF SCIENCE UNIVERSITY OF FLORIDA 2008 1

PAGE 2

2008 Justin Chase Havird 2

PAGE 3

To the teachers who inspired, directed, and challenged me. My high school marine biology teacher, Larry Joye, first introduced me to the fa scinating world of life in the water and since then my endeavors have never strayed far from it. Dr. David Evans enthusiastically welcomed me into his lab as an undergraduate, although I ha d no former research expe rience. What started as a part-time project soon evolved into an academic career as I was given the opportunity to conduct original research. During this time, Dr. Keith Choe was an invaluable asset and inspiration. Growing from this original partnership, I conti nued working with David on my masters research and he has always supported my academic and research endeavors; I cannot envision a better advisor. 3

PAGE 4

ACKNOWLEDGMENTS I most of all thank my supervisory comm ittee chair, Dr. David H. Evans. Although David was nearing retirement and had resolved to not accept any new students, he welcomed me as a graduate student without any hesitation. He has guided me in developing research strategies, implementing those stra tegies, and interpreting the resu lts. He has always supported my projects and none of them would have been accomplished without his enthusiasm. I also thank my supervisory committee memb ers for their commitment to my research and their willingness to share thei r expertise. Dr. Mi chael Miyamoto contri buted heavily to the phylogenetic aspects of my project and encouraged me to be thorough in my analysis. When I started this project I knew very little about generating meaningful evolutionary relationships. Michael selflessly took the time necessary to make sure I understood how to develop a biologically relevant reconstr uction of evolutionary change s that took place over 600 million years ago. He also put his own projects aside while I used his computers for months at a time. Finally, his guidance was absolutely necessary in interpreting the conflicting results of my analyses. Dr. Marty Cohn was a great influence on my research and prompted me to think in an integrative and comparative framework. He gener ously allowed me to use his lab space. His expertise working with evolutionarily interestin g chordates was invaluable. His students also graciously helped me learn many of the techniques used in this research. I am also indebted to seve ral colleagues for thei r assistance. Dr. Keith Choe pioneered and taught me many of the molecu lar techniques now commonly used in the Evans lab that were critical to this research. He spent coun tless hours with me in multiple laboratories troubleshooting problems, explaining theory, and developing this re search. He also encouraged me to work with the hagfish, lamprey, and amph ioxus and continually helped me develop new ideas and strategies. Dr. Kelly Hyndman was also constantly supportive of this research. She 4

PAGE 5

taught me the localization techniqu es used here and also helped with many aspects of retrieving and analyzing genetic data. Finally, she was al ways receptive to critical discussions of my research and tackled every circumstance in a friendly, often contagious manner. I am very thankful to my family and friends for their continued support of my education and research. My entire family has been very interested in the resear ch I have undertaken and when they were not interested they feigned inte rest in order to make me happy. My parents, Kurt and Dawn Havird, have encouraged my desire to be a scientist, and have been overwhelmingly supportive during my academic caree r; often in the form of food, clean laundry, or money. My friends have also been very suppor tive of my research interests: fellow scientists have empathized with the typical problems asso ciated with research a nd non-scientists have given me the confidence to persevere. I also thank the following pe ople for providing help with this project in particular, other related projects, or the daily support needed to become a successful student: Dr. James B. Claiborne, Rachel Rose, Dr. GuangJun Zhang, Donovan German, Justin Catches, Andrew Diamanduros, Sara Takeuchi, Jim Stidham, Curtis Lanier, Julia Curtis-Burnes, Oriana GalardiEste, Rebecca Kreh, Dr. Susan Edwards, Gini Luchini, Makesha Foster, Emily Cornwell, Dr. Larry Page, Pete Ryschkewitsch, Frank Davis, Di ana Davis, Cathy Moore, Karen Pallone, Vitrell Sherif, Dr. David Reed, Dr. Paul Lewis, and th e laboratories of Dr. Lou Guillette and Dr. David Julian. My research was primarily funded by Na tional Science Foundation grants IBN-0089943 and IOB-0519579 to David Evans. A grant-in-aid of research to Justin Havird from Sigma Xi also supported a portion of this research. Fina lly, initial support was provided in part by a University Scholars award to Justin Havird. 5

PAGE 6

TABLE OF CONTENTS page ACKNOWLEDGMENTS...............................................................................................................4 LIST OF TABLES................................................................................................................. ..........8 LIST OF FIGURES.........................................................................................................................9 ABSTRACT...................................................................................................................................11 CHAPTER 1 GENERAL INTRODUCTION..............................................................................................13 Introduction................................................................................................................... ..........13 Cyclooxygenase Evolution.....................................................................................................16 Mammals.........................................................................................................................17 Fishes...............................................................................................................................18 Other Vertebrates.............................................................................................................19 Other Chordates...............................................................................................................19 Cyclooxygenase Function in Mammals..................................................................................20 Gastrointestinal Tract......................................................................................................20 The Kidney......................................................................................................................21 Platelets............................................................................................................................23 Reproduction...................................................................................................................23 Nervous System...............................................................................................................25 Cyclooxygenase Function in Non-Mammals.........................................................................27 Fishes...............................................................................................................................27 Osmoregulation........................................................................................................27 Reproduction............................................................................................................29 Differential functions of novel forms.......................................................................30 Other functions.........................................................................................................30 Amphibians..................................................................................................................... .31 Reptiles............................................................................................................................31 Birds................................................................................................................................32 Study Overview................................................................................................................. .....33 2 CYCLOOXYGENASES IN THE ANCE STRAL CHORDATES: SEQUENCE AND PHYLOGENETIC ANALYSES............................................................................................39 Introduction................................................................................................................... ..........39 Materials and Methods...........................................................................................................41 Animals and Holding Conditions....................................................................................41 Tissue Collection.............................................................................................................42 Reverse Transcription, Primer Desi gn, PCR, Cloning, and Sequencing.........................43 5 and 3 Rapid Amplification of cDNA Ends (RACE)..................................................45 6

PAGE 7

Sequence Analysis...........................................................................................................45 Phylogenetic Analysis.....................................................................................................46 Results.....................................................................................................................................48 Molecular Identification of Cyclooxygenases.................................................................48 Branchiostoma .........................................................................................................48 Myxine ......................................................................................................................48 Petromyzon ...............................................................................................................48 Fundulus ...................................................................................................................49 Myoxocephalus .........................................................................................................49 Sequence Analyses..........................................................................................................50 Teleosts COX-1a, COX-1b, and COX-2..................................................................50 Lamprey, hagfish, and amphioxus COX forms........................................................52 Phylogenetic analyses..............................................................................................53 Discussion...............................................................................................................................56 Novel COX Forms...........................................................................................................57 Phylogenetic Analyses.....................................................................................................58 Summary..........................................................................................................................62 3 SUMMARY AND FUTURE DIRECTIONS.......................................................................105 Summary...............................................................................................................................105 Novel COX Sequences..................................................................................................105 Phylogenetic Analyses...................................................................................................106 Future Directions..................................................................................................................106 Completion of Novel Sequences...................................................................................107 Additional Phylogenetic Analysis.................................................................................107 Additional Sequences....................................................................................................108 Additional Taxa.............................................................................................................109 Function of Cyclooxygenases........................................................................................110 LIST OF REFERENCES.............................................................................................................117 BIOGRAPHICAL SKETCH.......................................................................................................130 7

PAGE 8

LIST OF TABLES Table page 2-1. Degenerate primers used in PCR.......................................................................................64 2-2. Amphioxus COX specific primers used in PCR................................................................65 2-3. Hagfish COX specific primers used in PCR......................................................................66 2-4. Lamprey COX specific primers used in PCR....................................................................67 2-5. Killifish COX specific primers used in PCR.....................................................................68 2-6. Sculpin COX specific primers used in PCR......................................................................69 2-7. Sequences included in phylogenetic analyses....................................................................70 2-8. LRTs between amino acid based models of COX evolution.............................................72 2-9. LRTs between tree topologies with altered positions of hCOX and lCOX.......................73 8

PAGE 9

LIST OF FIGURES Figure page 1-1. Cascade of reactions depicting the co nversion of arachidonic acid to the primary prostaglandins via catalyzation with either cyclooxygenase (COX) form........................35 1-2. General phylogeny representing the different COX forms in the fishes...........................36 1-3. Accepted evolution of ancestral chordates (Pough, et. al 2005).......................................37 1-4. Evolution of COX forms in th e chordates, based on Jarving et al (2004)........................38 2-1. Amino acid alignment of the forms of COX sequenced from the gills of the euryhaline killifish (Fundulus heteroclitus ).......................................................................74 2-2. Amino acid alignment of the three forms of COX sequenced from the gills of the longhorn sculpin ( Myoxocephalus octodecemspinosus ): COX-1a, COX-1b, and COX-2................................................................................................................................76 2-3. Amino acid alignment of the forms of COX sequenced from the gills of the lamprey ( Petromyzon marinus ), hagfish ( Myxine glutinosa ), and amphioxus ( Branchiostoma lancelolatum ), along with sCOX from the dogfish ( Squalus acanthias Accession #AAL37727)......................................................................................................................78 2-4. Amino acid alignment of lCOX sequenced from the gills of the lamprey ( Petromyzon marinus ), with COX-1 and COX-2 forms fr om vertebrates (Accession # NP_032995, NP_035328, XP_425326, XP_422297, AAS21313, and NP_705942).............................80 2-5. Amino acid alignment of lCOX sequenced from the gills of the lamprey ( Petromyzon marinus ), with COX-1 and COX-2 forms fr om vertebrates (Accession # NP_032995, NP_035328, XP_425326, XP_422297, AAS21313, and NP_705942).............................82 2-6. Amino acid alignment of COXc a nd COXd sequences from the lancelet ( Branchiostoma lancelolatum ) with COXa and COXb sequences from the sea squirt ( Ciona intestinalis ).............................................................................................................85 2-7. Evolutionary history of COX sequen ces inferred using the minimum evolution method with a distance optimality criterion.......................................................................87 2-8. Evolutionary history of COX seque nces excluding hagfish (hCOX) and lamprey (lCOX) sequences inferred using the mi nimum evolution method with a distance optimality criterion........................................................................................................... ..89 2-9. Evolutionary history of COX se quences inferred using a maximum liklihood optimality criterion........................................................................................................... ..90 9

PAGE 10

10 2-10. Evolutionary history of COX sequen ces excluding sequences from the hagfish (hCOX) and lamprey (lCOX) inferred using a maximum liklihood optimality criterion..............................................................................................................................92 2-11. Alternate likelihood ratio test (aLRT) scores for branch support of COX sequences.......94 2-12. Alternate likelihood ratio te st (aLRT) scores for branch support of COX sequences excluding hagfish (hCOX) and lamprey (lCOX) sequences..............................................96 2-13. Evolutionary history of COX sequences inferred using a Bayesian optimality criterion..............................................................................................................................97 2-14. Evolutionary history of COX sequen ces excluding hagfish (hCOX) and lamprey (lCOX) sequences inferred using a Bayesian optimality criterion....................................99 2-15. The 21 alternate tree topologies generated to test the effects of relocating the hagfish (hCOX) and lamprey (lCOX) sequences on the likelihood score (Ln L )........................100 2-16. Unrooted phylogeny showing the most likely scenario for COX evolution in the chordates based on several other analyses.......................................................................104 3-1. Euryhaline killifish ( Fundulus heteroclitus ) COX-1b mRNA expression following procedures outlined in Choe et al (2006)........................................................................113 3-2. Longhorn sculpin ( Myoxocephalus octodecemspinosus ) COX-1a and COX-2 mRNA expression following procedures outlined in Choe et al (2006).....................................114 3-3. Atlantic hagfish ( Myxine glutinosa ) COX (hCOX) mRNA expression following procedures outlined in Choe et al (2006) .......................................................................115 3-4. Sea lamprey ( Petromyzon marinus ) COX (lCOX) mRNA ex pression in various tissues following procedures outlined in Choe et al (2006)...........................................116

PAGE 11

Abstract of Dissertation Pres ented to the Graduate School of the University of Florida in Partial Fulfillment of the Requirements for the Degree of Master of Science EVOLUTION OF CYCLOOXYGENASE IN THE CHORDATES By Justin Chase Havird May 2008 Chair: David Evans Major: Zoology Cyclooxygenase (COX) is the enzyme found in animals responsible for converting arachidonic acid into prostaglandins. These pros taglandins can then perform multiple functions including regulation of inflammation respons es, changes in vascular tone, and ion transport/osmoregulation. Before this thesis only two main forms of cyclooxygenase (COX-1 and COX-2) and one ancestral form ( Ciona COX) were known from the chordates. I sequenced COX genes from several hitherto uninvestigated chordates in order to determine a more comprehensive scenario for the evolutionary history of cyclooxygenase in the chordates. After designing primers, partial COX sequences were obtained from the Sea Lamprey ( Petromyzon marinus ) and amphioxus (Branchiostoma lancelolatum ). Complete COX sequences were obtained from the Atlantic Hagfish ( Myxine glutinosa ), euryhaline killifish ( Fundulus heteroclitus), and longhorn sculpin ( Myoxocephalus octodecemspinosus). These novel sequences along with other known COX sequences were then subjected to a variety of phylogenetic analyses using standa rd techniques. The results of these analyses suggest a complex history for the evolution of cyclooxygenase in the chordates. There appears to have been at least 3 evol utionary independent origins of COX in the chordates. The forms from the sea squirt ( Ciona intestinalis ) (COXa and COXb) represent the 11

PAGE 12

12 most ancestral forms, the forms from amphioxus represent another independent origin (COXc and COXd), and the vertebrate forms (COX-1 and COX-2) represent yet another origin, with the hagfish and lamprey as likely basal members. Fu rthermore, the teleosts appear to have duplicate COX-1 (COX-1a and COX-1b) or COX-2 (COX-2a and COX-2b) forms. These results agree with previous studies and reveal novel informa tion about COX forms in the chordates. More intense sampling of other chorda tes could reveal other novel orig ins of COX or contribute to a more robust understanding of COX evolution. Finally, the function of most non-mammalian COX forms remains to be investigated.

PAGE 13

CHAPTER 1 GENERAL INTRODUCTION Introduction Cyclooxygenase (COX) is the enzyme responsible for the rate limiting step that converts arachidonic acid to Prostaglandin G2 and Prostaglandin H2. Arachidonic acid is an essential fatty acid required by most mammals and can be obtaine d by the conversion of linoleic acid found in plants (occurring in herbivores). Some animals cannot convert linol eic acid into arachidonic acid and therefore must obtain it from other animals (obligate carnivores). COX oxidizes arachidonic acid to make the hydroperoxy endoperoxide Prostaglandin G2, which is then reduced to form the hydroxy endoperoxide Prostaglandin H2. Prostaglandin H2 can then be convert ed to the primary prostanoids (Pro staglandin I2, Prostaglandin D2, Prostaglandin E2, Prostaglandin F2 and Thromboxane A2) by a variety of enzymatic and non-en zymatic pathways. Therefore, the expression of COX can directly in fluence the amount of prostagla ndins that are synthesized due to the arachidonic ac id cascade (Vane et al ., 1998, Fig. 1-1). Prostaglandins are found in vertebrates, some invertebrates, and po ssibly even in plants (Rowley et al ., 2005; Ryan, 2000). In mammals, they are expressed in virtua lly all tissues and have a myriad of physiological functions, but they mainly regulate vascular tone in smooth muscle by acting as vasodilators and vasoconstr ictors. In addition, prostaglandins are key regulators of such diverse processes as salt and water homeostasis in the mammalian kidney (Harris and Breyer, 2001), protecti on of stomach lining (Kargman et al ., 1996), platelet aggregation in blood (F rster and Parratt, 1996), birth (Challis et al. 2002), and central nervous system function (Hopkins, 2007). They also may play prominent roles in pathological states such as fever, inflammation, and cancer (Vane et al ., 1998). 13

PAGE 14

Prostaglandins were first extracted from se men, prostate (hence the name prostaglandin), and seminal vesicles by Goldblatt and von Euler in the 1930s (von Euler, 1936) and were shown to affect blood pressure. The reac tion that catalyzes Prostaglandin G2 synthesis was first characterized in the 1970s (Ham berg and Samuelsson, 1973; Hamberg et al ., 1974), but it wasnt until 1988 that cyclooxygenase (COX) was first described as the enzyme responsible for endoperoxide synthesis by three separa te groups (DeWitt and Smith, 1988; Merlie et al ., 1988; Yokoyama et al ., 1988), all of which described a COX from sheep seminal vesicles which was later named COX-1. However, before COX-1 wa s isolated there was early evidence that multiple COX forms existed, based on prostaglandin activity in the rat brain and spleen (Flower and Vane, 1972). In the early 1990s, a sec ond COX form was cloned from mouse and chicken fibroblast cell cultures a nd was named COX-2 (Kujubu et al ., 1991; Xie et al ., 1991; O'Banion et al ., 1992). This discovery would later prove to be of major importance in the field of prostaglandin biology due to the development of dr ugs that could selectivel y inhibit the different forms of cyclooxygenase. Both forms catalyze the reactions that form prostaglandins from arachidonic acid, but early studies suggested that COX-1 was consti tutively expressed in many tissues, while COX-2 was an inducible isoform that was expressed in response to p hysiological stimuli (Funk, 2001). Because basal expression of COX-2 was low in some cell types and COX-2 was found to be expressed much more so than COX-1 in response to mitogens and cytokines, it was assumed that COX-1 was constitutively expressed at basal le vels and served a housekeeping function and that COX-2 was inducibly expressed to serve in infla mmatory functions (Kujubu et al ., 1991; Xie et al ., 1991; O'Banion et al ., 1992). However, this was later sh own to be an oversimplification (Funk, 2001). Notably, it was shown that COX-2 is constitutively expressed in the mammalian 14

PAGE 15

kidney, where it regulates blood flow and ion tran sport in the Loop of He nle (Harris and Breyer, 2001) and plays a role in cell su rvival in medullary interstiti al cells during dehydration (Yang et al ., 2002; Yang, 2003). Despite their potential functional differences in different tissues, COX-1 and COX-2 are biochemically very similar. Both are inhi bited by nonsteroid an ti-inflammatory drugs (NSAIDs), such as aspirin, due to competition with arachidonic acid for the active sites of the enzymes or irreversible acetyla tion (Vane, 1971). Both proteins in humans are ~600 amino acids and share about 63% sequence similarity with each other. However, the proteins originate from different genes on different chromosomes and en code different mRNA transcripts. COX-1 comes from a much larger gene (22 kilobases) than C OX-2 (8 kilobases). The amino acid residues that form the binding and catalytic sites (the functi onally important sites) as well as the adjacent amino acids are all identical in human COX-1 and COX-2, except for two substitutions. At positions 434 and 523, valine is substituted for isoleucine in COX-2 when compared to COX-1. These substitutions have been implicated as the most likely reason behind the biochemical differences between COX-1 and CO X-2. COX-1 appears to be more selective in terms of the fatty acids it will accept as substrates than COX-2 (Otto and Smith, 1995). COX-2 selective inhibitors have offered an insight into the bi ochemistry behind the different forms. These inhibitors can differentiate between COX1 and COX-2 with over 1000 fold specificity (Griswold and Adams, 1996). The rationale behind these selective inhibitors is that the smaller size of valine on position 523 in COX-2 allows th e inhibitor to bind to a side pocket in COX-2, but the larger isoleucine on position 523 of COX-1 appears to prev ent this binding. When this position is altered in both forms to the alternat e amino acid, the selectivity for inhibitors is reversed (Wong et al ., 1997; Gierse et al ., 1996; Guo et al ., 1996), suggesting th at this residue 15

PAGE 16

plays a critical role in differing biochemical activ ity. COX-2 selective inhi bitors were thought to be a major medical breakthrough due to the ability to stop disease induced inflammation without affecting normal prostaglandin levels produced by COX-1 and therefore causing minimal side effects. However, due to the constitutive expres sion of COX-2 in certain tissues (especially the kidney), COX-2 selective inhibitors may not be as affective as once thought. It is important to remember that COX-1 and COX-2 are very structur ally similar and that their main difference is due to expression. As outlined above, COX form and function have been extensively studied extensively in mammals, especially humans. However, non-ma mmalian COX forms and their functions have not been examined in great detail in other ch ordates. The goal of this research was to characterize COX evolution in the chordates, with specific attention on the more evolutionarily ancestral chordates. Describing ancestral COX form s is the first step in elucidating the evolution of COX function, which may lead to a better understanding of overall COX function, and even the development of new drugs. In this chapter, I give a brief overvie w of COX evolution and function in the chordates, concluding with a br ief summary of the research described in the following chapters. Cyclooxygenase Evolution Like mammals, most vertebrates appear to have two homologous copies of cyclooxygenase named COX-1 and COX-2. However, other C OX forms exist throughout the chordates, including variants of COX-1 and CO X-2 as well as forms representing independent origins of COX that are not closely related to COX-1 or COX-2. There are also COX forms in corals and other invertebrates (Jarving et al ., 2004), but the focus of this section is to review the forms found in the chordates. 16

PAGE 17

Mammals COX-1 and COX-2 sequences have been either cloned or derived from genomic sequences for most of the classic mammalian model species, includ ing mouse (Accession# NP_032995 and NP_035328), rat (Accession# NP _058739 and NP_058928), dog (Accession# NP_001003023 and NP_001003354), cow (Accession# XP_869575 and NP_776870), sheep (Accession# NP_001009476 and NP_001009432), a nd rabbit (Accession# NP_001076150 and NP_001075857). COX sequences also exist for rhesus monkey, guinea pig, pig, horse, and mink, but these are either partial sequences or are not available for both forms. A third COX variant has been proposed to occur in mammals (Flower and Vane, 1972) based on inhibitory studies (see below). This form is known as COX-3 or COX-1b because of its close similarity to COX-1. Recently, a potential COX-3 (Accession# AY547265) was cloned from mouse (Kis et al ., 2006) and rat (Accession# AY523672, Snipes et al ., 2005). However, these forms likely do not participate in prostaglandin synthesis (Kis et al ., 2006) and are not a separate COX form. Furthermore, a similar study using an artificially created human COX-1b found no inhibitory similarity to th e proposed COX-3 enzyme (Censarek et al ., 2006). Therefore, while a third, genuinely different COX variant may exist in mammals, its sequence remains elusive. Analysis of the recently completed gray short-tailed opossum genome yielded the predicted COX-1 and COX-2 forms (A ccession# XP_001370514 and XP_001375945), as well as two additional COX-1 forms, named COX-1b and COX-1b2 (Accession# XP_001370542 and XP_001370595). These forms are complete and di ffer in amino acid composition and length. These are the first COX-1 variants in a mammal that do not represent modified versions of normal COX-1 and although is has not been sugges ted, it is possible that one of these forms 17

PAGE 18

represents the elusive COX-3 va riant. Functional studies to determine how these forms differ from normal COX have not been published to date. Fishes Cyclooxygenase has been sequenced in several fishes, including the rainbow trout ( Oncorhynchus mykiss) (Zou et al ., 1999), brook trout ( Salvelinus fontinalis ) (Roberts et al ., 2000), Atlantic croaker ( Micropogonias undulates ), and zebrafish ( Danio rerio) (Grosser et al ., 2002). These fishes, along with genomic sequence data from the stickleback ( Gasterosteus aculeatus), green spotted puffer ( Tetraodon nigroviridis ), pufferfish ( Takifugu rubripes), and Japanese medaka ( Oryzias latipes ) suggest that fishes posses both COX-1 and COX-2 forms (Jarving et al ., 2004). Furthermore, COX-2 has recently been sequenced from European sea bass ( Dicentrarchus labrax) (Buonocore et al ., 2005) and euryhali ne killifish ( Fundulus heteroclitus ) (Choe et al ., 2006), supporting this prediction. A cyclooxygenase has also been sequen ced from the spiny dogfish shark ( Squalus acanthias ) (Yang et al ., 2002). However, this form was not designated as COX-1 or COX-2 because of its near equal identity to both forms (it is only slightly more similar to COX-1). This form was named sCOX by the authors and may repr esent an evolutionarily distinct form of cyclooxygenase found in the elasmobranchs. Ishikawa and colleagues have recently fu rther characterized COX evolution in the teleosts by demonstrating that both the zebrafish (Ishikawa et al ., 2007) and rainbow trout (Ishikawa and Herschman, 2007) have two functional COX-2 genes (named COX-2a and COX2b). In addition, by analyzing sequence databases, they concluded that not all teleosts have two COX-2 forms, but that the stickleback, green sp otted puffer, pufferfish, and Japanese medaka have two COX-1 forms instead (nam ed COX-1a and COX-1b) (Ishikawa et al ., 2007). They concluded that a genome duplication before the te leosts, and a subsequent loss of either one 18

PAGE 19

COX-1 or COX-2 form characterizes the spec ies mentioned (Ishikawa and Herschman 2007) (Fig. 1-2). This is supported by the apparent ge nome duplication events in teleosts (Crollius and Wessenbach, 2005). Other Vertebrates Although functional studies on prostagla ndin roles and cyclooxygenase are not uncommon in other vertebrates, cyclooxygenase sequences from non-mammalian and nonteleost vertebrates are lacking. Cyclooxygenase forms have been predicted from the chicken genome ( Gallus gallus ), suggesting that birds have both COX-1 and COX-2 forms (Urick and Johnson, 2006). Both forms have also been found in the African clawed frog ( Xenopus laevis ) and COX-2 has been found in the western clawed frog ( Xenopus tropicalis ), suggesting that both forms occur in amphibians (Klein et al ., 2002). Functional studies sugg est COX exists in reptiles as well (Seebacher and Franklin, 2003) and the recently completed Anolis carolinensis genome contains both COX forms. Taken together, the presence of COX-1 a nd COX-2 forms in the mammals, teleosts, birds, and amphibians suggest that both forms orig inated in the early vertebrates, possibly from the duplication of an ancestral COX gene. The presence of sCOX in the dogfish indicates that COX forms in the early vertebrate s may not have diverged (in sequence or possibly in function) to the extent that allows them to be labeled as COX-1 or COX-2, although it is predicted that two COX forms exist in all vertebra tes, since sCOX groups with COX1 and is not ancestral to the COX-1/COX-2 split (Fig. 1-2, unpublished phyl ogeny generated using the online program PHYML) (Guindon and Gascuel, 2003; Guindon et al ., 2005). Other Chordates Although the subphylum Vertebrata includes the majority of species in the phylum Chordata, two other subphyla are included in the chordates: the Urocho rdata (sea squirts or 19

PAGE 20

tunicates) and the Cephalochordata (amphioxus or lancelets). These ot her subphyla are basal to the vertebrates and represent evolutionarily dist inct monophyletic groups (Fig. 1-3). There is some debate as to whether the urochordates or cephalochordates represent the base of the chordate phylogeny, although urochordates have been generally been considered basal (Pough et al ., 2005). Interestingly, the genomes of sea squirts ( Ciona intestinalis and Ciona savignyi ) predict COX genes that are not homol ogous to COX-1 and COX-2. These forms (named COXa and COXb) are basal to vertebrate COX forms and indi cate an evolutionarily distinct branch in COX evolution (Jarving et al 2004) (Fig. 1-4). This separate bran ch is situated between the COX of corals and the vertebrate COX fo rms (Fig. 1-4). This suggests that the COX-1 and COX-2 forms originated sometime after the origin of the sea squirts but before the origin of the elasmobranchs (around 550-600 mya). Cyclooxygenase Function in Mammals Cyclooxygenase was first described from mamm als, and due to its medical importance, its function has been intensel y examined in mammals, specifically humans. Since COX stimulates the production of pros taglandins, COX function is intrin sically linked to the roles that prostaglandins play in everythi ng from water balance to reproduc tion. Here, I review the major functions of COX-1 and COX-2 in various ma mmalian physiological systems (modeled after Vane et al ., 1998), but it should be noted that ma mmalian COX studies are ongoing and that COX likely plays many roles not described here. Gastrointestinal Tract In the stomach, prostaglandins play a cy toprotective role, guarding the stomach lining against digestive acids and enzymes. The mech anism behind this protection is an increased mucosal blood flow caused by the vasodilating properties of prostagl andins (specifically 20

PAGE 21

Prostaglandin I2). It has generally been accepted that these prostaglandins are synthesized by COX-1, although COX-2 is present in small amounts (Kargman et al ., 1996). This is supported by studies showing that irradi ated mice have further redu ced numbers of crypt cells (cytoprotective mucosal cells) when indome thacin (a non-specific COX inhibitor) was administered, but not when a COX-2 sele ctive inhibitor was administered (Cohn et al ., 1997). COX-2 expression in the esopha gus of patients with gastro esophageal reflux disease was upregulated in response to acid e xposure, suggesting a protective function in the distal esophagus (Lurje et al ., 2007). This may indicate th at throughout the gastrointe stinal (GI) track, COX-2 is inducibly expressed in response to inflammation responses. Furthermore, throughout the GI track, inflam matory mediators such as COX may also serve to repair damaged mucosa (Martin and Wallace, 2006). While it seems that COX-1 is responsible for baseline prostagl andin expression in the GI tr act, COX-2 and not COX-1 seems to be more involved in response to GI tract cancers (Ristimki et al ., 1997). However, recent studies on patients with gastric cancer from Dalian, China show ed that COX-2 expression was infrequent in gastric cancers due to hypermethylation and that a COX-2 focused strategy for treatment would likely be ineffective (Huang et al ., 2006). The Kidney Prostaglandins can modulate blood flow in the kidney, as in other organs (Vane and Botting, 1994). In addition, COX-2 has been shown to play a major role in ion regulation and water balance in the mammalian kidney (Harris et al ., 1994). It has also been shown that the COX-2 selective inhibitor SC-58236 and seve ral non-selective COXinhibiting NSAIDs (including sulindac, ibuprofen, a nd indomethacin) cause medullary interstitial cell (MIC) death in the kidney, but the COX-1 selective inhib itor SC-58560 was 100-fold less potent for inducing MIC death (Hao et al ., 1999). COX-2 knockout mice also develop terminal nephropathy 21

PAGE 22

(abnormal kidney function) which results in death by the third month (Morham et al ., 1995). These results suggest that COX-2, and not COX1, plays a critical role in kidney function via MIC cell survival. This is contrary to the or iginal description of COX-1 as the constitutively expressed form responsible for maintaining hom eostasis and COX-2 as the inducible form responsible for inflammatory responses. In the kidney, COX-2 is present in a subset of tubular epithelial cells located in the cortex and outer medulla (Vio et al ., 1997). These cells ar e part of the medullary thick ascending limb (MTAL), the part of the nephron that regulates extracellular fluid vol ume by establishing the osmotic gradient in the medulla that concentrates urine (Hebert et al ., 1981; Hebert and Andrioli, 1984). In vitro MTAL preparations have demonstrat ed high levels of Prostaglandin E2 (PGE2) (Ferreri et al ., 1984; Hirano et al ., 1986; Lear et al ., 1990) which has been shown to inhibit basolateral Na+/K+-ATPase (NKA) and apical Na+/K+-2Clcotransporter (NKCC) in the MTAL (Kaji et al ., 1996; Stokes and Kokko, 1976; Wald et al ., 1990). These proteins are critical for NaCl reabsorption in the MTAL. Furthermore, the COX-2 selective inhibitor NS-398 has been shown to prevent tumor necrosis factor (TNF) mediated PGE2 production in cultured MTAL cells (Ferreri et al ., 1999). TNF is a cytokine expressed in the MTAL that may be an important mediator of ion transport by inhibiting ion uptake via a prostanoid dependant mechanism (Escalante et al ., 1994; van-Lanschot et al ., 1991). Taken as a whole these results show that COX-2 may influence ion uptake via TNF mediated prostaglandi n production in the MTAL. Therefore, COX-2 is involved in cell survival and ion transport in the mammalian kidney. This finding is critical for treatment prot ocols using COX inhibitors. NSAIDs are the most common drugs used to treat pain and inflammation with over 30 million uses per day worldwide (Singh and Triadafilopoulos, 1999) Although the negative side effects 22

PAGE 23

(hypertension, renal ischemia, a nd GI toxicity) associated with chronic NSAID use have been known for some time, the discovery of COX-2 se lective inhibitors sugge sted a treatment for inflammation without causing disruption of nor mal COX function (thought to be mediated by COX-1). The role of COX-2 in the kidney has reduced the supposed power of these new drugs and negative side effects associated with C OX-2 selective inhibitors are now well documented (see Harris and Breyer, 2006 for a review). Furthermore, in 2005 the Food and Drug Administration (FDA) required additional warning la beling of celecoxib to highlight side effects and required Pfizer to remove valdecoxib from the market, both of which are selective COX-2 inhibitors. Platelets Interestingly, COX-1 seems to be the onl y form expressed in mammalian platelets. COX-2 was not detected in human platelets using western blotting techniques (Reiter et al ., 2001) or in canine platelets using northe rn blotting techniques (Kay-Mugford et al ., 2000). In the platelet, COX-1 is involved in platelet aggregation (clott ing) through the production of Thromboxane A2 (TXA2). When inhibited with aspiri n, COX-1 mediated production of TXA2 is irreversibly inhibited, causing redu ced platelet aggregation (blood th inning). This effect occurs about an hour after oral ingestion of even low doses of aspirin and can inhibit platelet function for several days after a dose (Vane et al., 1998; Vane, 1971). Inhibiti on of COX-1 by resveratrol and other components of red wine is responsible for the anti-plate let activity associated with the cardiovascular benefits of red wine consumption (Szewczuk and Penning, 2004). Reproduction Cyclooxygenase and the prostaglandins it produc es play critical roles in almost every aspect of reproduction in mammals, although its ro le in pregnancy has been studied the most 23

PAGE 24

intensely. Both isoforms are likely involved in reproductive processes, with COX-1 expression constitutive and COX-2 expres sion inducible (Chakraborty et al ., 1996). In a recent study, COX-2 was shown to contri bute to fertility in male mice (Balaji et al ., 2007). COX-2 expression was intense in the epithe lial cells of mice vas deferens and the COX-2 specific inhibitor nimesulide was shown to decrea se sperm motility six hours after administration (Balaji et al ., 2007). Interestingly, although prostagl andin levels initially dropped after nimesulide administration, they tended to ri se after sustained C OX-2 inhibition (Balaji et al ., 2007). This suggests that COX-1 expression may recover COX func tion or at least contributes heavily to prostaglandin production in the vas defere ns. A similar situation exists with respect to human female fertility, in which COX-1 expres sion can recover function in cases where COX-2 is lost or inhibited (Wang et al ., 2004). It also seems that COX-2 is critical for follicle development and ovulation in women and that COX inhibitors can have se vere effects on female fertility (Sirois et al ., 2004). Prostaglandins are also important during pr egnancy and labor. Generally, COX-1 is expressed more than COX-2 during normal stages of pregnancy, and COX-1 may play an active role in maintaining a healthy pregnancy (Trautman et al ., 1996). COX-1 is expressed at high levels is the fetal brain, kidne ys, heart, and lungs (Gibb and Sun, 1996). However, both COX-1 and COX-2 are expressed in the uterine epitheliu m during early pregnancy and may play roles in implantation and placental formation (Chakraborty et al ., 1996). This was recently confirmed for COX-2 in rats (Diao et al ., 2007). COX-2 may play a domi nant role in inducing labor. During labor, contractions are stimulated by prostaglandins a nd therefore any effect causing increased COX activity will induce labor. Up-regul ation of COX-2 during intrauterine infection may increase prostaglandins to the poin t of causing premature labor (Spaziani et al ., 1996). 24

PAGE 25

Furthermore, a similar up-regulation in sheep may reduce progesterone levels to the point that pregnancy cannot be maintained (McLaren et al ., 1996). However, it was recently shown that during the course of pregnancy there is a gr adual change in COX expression, with COX-1 dominating during early pregnancy and COX-2 dominating in later stages (Johnson et al ., 2006). It was concluded that while COX-2 is expressed at high levels in late st ages of pregnancy, it is not up-regulated suddenly to induce labor (Johnson et al ., 2006). COX inhibitors can halt premature labor by inhibiting pr ostaglandin production (Sawdy et al ., 1997). However, as in treatment strategies that use COX inhibitors for other problems, there are negative side effects associated with the kidneys: re nal clearance and glomerular filtration were reduced during the first weeks of life in babies that were expos ed to COX inhibitors to stop premature birth (Allegaert et al ., 2006). As in other cases, COX-2 selectiv e inhibitors were thought to eliminate these negative side effects but have not proven more effective than non-specific NSAIDs (Olson 2005). Nervous System COX-1 and COX-2 are both expressed in the mammalian nervous system and may participate in nerve transmission, sensory processi ng, thermoregulation, and pain effects. As in other systems, the use of COX inhibitors to tr eat neural diseases (such as Alzheimers) is prevalent, but is accompanied by undesired side effects that are not prevented by using COX-2 selective inhibitors. The brain is one of the few organs that c onstitutively expresses COX-2 and contains high amounts of COX-2 in the cortex, hippocampus hypothalamus, and spinal cord (Breder et al ., 1995), whereas COX-1 is abundantly expressed in the forebrain, where it may be involved in sensory information processing (Yamagata et al ., 1993). COX-2 is expressed in both neuronal 25

PAGE 26

and non-neuronal cells in the brain and is up-regu lated in response to ab normal nerve activity, suggesting a role in nerve transmission (Breder et al ., 1995; Breder and Saper, 1996). COX-2 in the spinal cord has been shown to modulate pain responses (nociception) in both humans and rats due to peri pheral pain stimulation (Martin et al ., 2007; Gardiner et al ., 1997; Willingale et al ., 1997). These results are expected si nce prostaglandins are generated at the ends of sensory neurons during in flammatory pain (Ferreira 1972; Woolf et al ., 1997). However, the up-regulation of COX-2 over COX-1 in the spinal cord during inflammatory pain suggests a role during pain processing in the centr al as well as the peripheral nervous system. This up-regulation has been detected via increases in COX-2 mRNA (Gardiner et al ., 1997; Beiche et al ., 1996) in the spinal cord of rats during inflammatory stimuli. Furthermore, COX-2 selective inhibition also affected the withdrawal reflex of ra ts when stimulated using a noninflammatory, electrical stimulus (Willingale et al ., 1997). This supports the general role of COX-2 in nociception in the spinal cord. COX-2 also plays a thermoregulatory role in the brain by increasing prostaglandin production in the hypothalamus during periods of fever. Injection of bacterial lippopolysaccarides (LPS) into mammals causes a monophasic fever characterized by a single rise in core body temperature. It has long been known that PGE2 levels increase in the hypothalamus during fever and likely mediat e the response (Ivanov and Romanovsky, 2004). Early studies suggested that an up-regulation of COX-2 was the cause of increased PGE2 levels during fever (Cao et al ., 1997). This initial hypothesis has been confirmed, recently in COX-2 deficient mice which do not respond to LPS injec tion, in contrast to CO X-1 deficient mice or control mice (Steiner et al ., 2005). 26

PAGE 27

Cyclooxygenase Function in Non-Mammals Although COX has been extensively studied in mammals due to its role in inflammation and the correlating drug mark et surrounding COX inhibition, studies in non-mammals are lacking. Unfortunately, it seems that alt hough non-mammals posses the mammalian COX-1 and COX-2 forms, these forms may be substantially different (both in structure and function) from their mammalian counterparts (Grosser et al ., 2002) and may also represent independent evolutionary events, such as duplications of an isoform (teleosts) or independent origins (sea squirts). In this section, I review the major studies i nvestigating COX function in nonmammalian chordates. Fishes Cyclooxygenase has likely been studied in the fishes more than other non-mammals due to their status as model organisms. As noted above, COX forms have been found in several fishes and along with genomic sequence data there is a general consensus that fishes possess both COX-1 and COX-2 forms that are homologous to those found in mammals. However, there is recent evidence that teleosts also possess an additional form of COX-1 or COX-2 (Ishikawa et al ., 2007; Ishikawa and Herschman, 2007) and some functional data also exist for these forms. Osmoregulation In fishes, the gills are the dominant site of acid/base regulation, nitrogenous waste secretion, gas exchange, a nd ion transport (Evans et al ., 2005). Several studies have investigated the osmoregulatory role of COX in th e gills of the euryhaline killifish, Fundulus heteroclitus This teleost can withstand instant salinity transfer between full strength seawater and fresh water without any apparent physiol ogical stress (Wood and Laurent, 2003). One study showed that short circuit current across th e opercular epithelium (a ti ssue with known ion transport capabilities) was reduced by using a non-specific COX inhibitor (Evans et al ., 2004). This 27

PAGE 28

suggests that COX-2 plays a role in ion transport in fishes that ma y be similar to its function in the kidneys of mammals. Further studies suppor ted this initial hypothesis by showing that COX2 is expressed most abundantly in the gill, opercu lar epithelium, and kidney of the killifish (Choe et al ., 2006), tissues that are known to be involved in ion transport in fishes. This is supported in the zebrafish, which shows the highest le vels of COX-2 in the gills (Grosser et al ., 2002). Furthermore, COX-2 was localized in mitochondrionrich cells in the gills of killifish, the main sites of ion uptake and secr etion in the gills (Choe et al ., 2006). Finally, COX-2 expression was shown to significantly increas e following either hypotonic or hype rtonic salinity transfers, suggesting COX-2 may play a role in maintaining cell homeostasis or promoting cell survival during periods of osmotic shock (Choe et al ., 2006). Taken together these results strongly suggest that COX-2 in the gills of teleosts acts in the same way as COX-2 in the kidneys of mammals, including regulating ion transpor t and promoting cell survival. Cyclooxygenase has also been shown to play an osmoregulatory role in the rectal gland of the dogfish shark, Squalus acanthias. Sharks rely on the rectal gland rather than the gills for regulation of salt secretion and a COX form (sCOX) has been cloned from the rectal gland (Yang et al ., 2002). This form was expressed most abundan tly in the rectal glan d of the shark, where PGE2 production was also high (Yang et al ., 2002). Finally, using a COX-2 specific inhibitor, vasoactive intestinal peptide mediated chloride se cretion decreased in the rectal gland, but then recovered following removal of the inhibitor (Yang et al ., 2002). Even though sCOX is slightly more similar to COX-1 of mammals than COX-2, th is result can be explained by the presence of valine at position 523 instead of isoleucine (and t hus conferring COX-2 inhibitory properties). This result suggests that sCOX plays a role in ion transport in the rectal glands of sharks that may be similar to the gills of teleosts or the kidneys of mammals. Th e osmoregulatory role of 28

PAGE 29

COX in fishes needs to be examined in greater de tail using other species and diverse techniques. This may be highly feasible because COX seque nces exist for a wide range of teleosts. Reproduction As in mammals, COX has been shown to play a role in reproduction in fishes. By using the non-specific COX inhibitor indomethacin, it was shown in the Atlantic croaker ( Micropogonias undulatus ) that COX pathways may play a ro le in the maturation of ovarian follicles and ovulation through prostaglandin forma tion, although other proteins may play a more dominant role (Patio et al ., 2003). Results from the European sea bass also indicate a similar role for prostaglandins in ovulation, with indom ethacin inhibiting follic le maturation (Sorbera et al ., 2001). However, it has been shown in the brook trout that indomet hacin does not block ovulation (Goetz et al ., 1989), although it does in other fish species (Goetz et al ., 1991). This apparent loss of function in the brook trout may be explained by changes in the levels of COX-1 and COX-2 during ovulation. It was shown that COX-1 levels remain ed constant and high during ovulation but that COX-2 le vels did not increase prior to ovulation as they do in mammals (Roberts et al ., 2000). This is supported by data from the zebrafish which show high levels of COX-1 but not COX-2 in the ovaries (Grosser et al ., 2002). This suggests that COX-2 function in the reproduction of the brook trout (and perhaps other fishes) is different than in other vertebrates. In the Japanese medaka, it was show n that low chronic levels (perhaps comparable to those found in waste water) (Metcalfe et al ., 2003) of the non-specific COX inhibitor ibuprofen causes altered reproduction by decr easing the number of spawning events but increasing the number of eggs per spawning event (Flippin et al ., 2007). This conforms to delayed pregnancies associated with NSAID use in mammals. These results indicate that COX likely plays a role in fish reproduc tion, although it may vary among species. 29

PAGE 30

Differential functions of novel forms Recently, the discovery of novel COX2 forms in the zebrafish (Ishikawa et al ., 2007) and rainbow trout (Ishikawa and Herschman, 200 7) and analyses of genomic sequence data indicates that all teleosts ma y posses at least three COX form s: either COX-1a, COX-1b, and COX-2 or COX-1, COX-2a, and COX-2b. Prelim inary data on the described COX-2 forms suggests that they are functionally different fr om each other. In the zebrafish, COX-2a and COX-2b are expressed at differe nt levels in the gill, kidney, and other tissues and respond differently to 12-O-tetradecanoylphorbol-13-ace tate (TPA, which is known to induce COX-2 expression in mouse) (Ishikawa et al ., 2007). A similar result was found in the rainbow trout, with differential expression of the two forms due to TPA (Ishikawa and Herschman, 2007). Interestingly, COX-2a and not COX-2b was upregulated in response to lippopolysaccarides (Ishikawa and Herschman, 2007). Clearly, the discovery of these new forms indicates a new chapter in studying COX function and further studies are needed to de termine the functional differences among the teleosts forms of COX. Other functions Cyclooxygenase has also been implicated in determining body plan development during embryonic stages in the zebrafish (Grosser et al ., 2002; Cha et al ., 2005; Cha et al., 2006a; Cha et al ., 2006b; Yeh and Wang, 2006). Briefly, COX may function to signal cell motility during gastrulation (Cha et al ., 2006b), and COX-1 function has been s hown to participate in vascular tube formation during development (Cha et al ., 2005). COX-2 expression has also been shown to increase in response to lippopolysaccarid es in the rainbow trout (Brubacher et al ., 2000; Holland et al ., 2002), suggesting an immunoregulatory role for COX-2 in fish as in mammals ( e.g ., fever induction). Clearly, the function of COX in fishes is just beginning to be explored, 30

PAGE 31

and further studies will likely indicate more sim ilarities and differences with COX functions in mammals. Amphibians As in other vertebrates, there is evid ence that COX is involved in ovulation and reproduction in amphibians. Indomethacin was shown to inhibit oocyte ovulation in the frog ( Rana temporaria ), while Prostaglandin F2 was shown to promote ovulation (Skoblina et al ., 1997). This suggests another medi ator may be influencing PGF2 production in the frog, but this contrast between seemingly relate d proteins has not been confirme d in other species. COX may also function in testosterone synthesis via PGE2 in the crested newt, Triturus carnifex (Gobbetti and Zerani, 2002). Ion and water transport have also been studied and non-specific COX inhibitors reduce short circuit current and voltage potential across the frog skin, bladder, and corneal epithelium (Shakhmatova et al ., 1997; Carrasquer and Li, 2002). As in reptiles, fever and thermoregulatory changes are behaviorally induced in amphibian s. Injection of lippopolysaccarides (LPS) normally causes a behavior ally induced fever in toads. However, when indomethacin is administered, the fever indu ced by LPS is completely blocked in the toad ( Bufo paracnemis) (Bicego et al ., 2002). This indicates that the COX pathway plays a role in the behaviorally induced fever caused by LPS and that this response has an ancient origin that may be conserved in all tetrapods. Reptiles Cyclooxygenase has not been st udied extensively in the lizar ds, crocodilians, snakes, and turtles although some data suggest prominen t roles in thermoregulation. Reptiles undergo behavioral thermoregulation to adjust their body temperatures, and this process is amplified by changes in heart rate. Specifically, an increase in heart rate (heart-rate hysteresis) accompanies an increase in temperature. Prostaglandins and cyclooxygenase were shown to play a role in this 31

PAGE 32

process in the lizard Pogona vitticeps Inhibition of COX-1 and COX2 resulted in no increased heart rate during heating (Seebacher and Fra nklin, 2003). Furthermore, administration of Prostaglandin F2 and Prostaglandin I2, but not Thromboxane B2, caused an increased heart rate (Seebacher and Franklin, 2003). However, this effect was not seen in crocodiles ( Crocodylus porosus ) (Seebacher and Frank lin, 2004) or the lizard Phrynocephalus przewalskii (Liu et al ., 2006), suggesting that thermore gulatory functions of COX via changes in heart rates may vary between closely related species. Interestingly, COX was also implicated in tail regeneration in th e house lizard. Twenty days after tail removal (the time period associated with tissue differentiation), an increase in cyclooxygenase activity occurred along with the appearance of endogenous Prostaglandin E2, which may signal a cascade resulting in tissue differentiation (Jayadeep et al ., 1995). Finally, indomethacin was used in the turtle bladder to sh ow that prostaglandins likely do not play a role in the inhibition of Na+ or H+ transport due to high intracellu lar calcium (Arruda, 1982). COX function in reptiles obviously needs further stud y as many functions associated with COX in mammals have yet to be investigated in re ptiles and there have been no COX targeted sequencing efforts. Birds Cyclooxygenase and prostaglandin function have been studied somewhat in model avian species, specifically chickens, wh ere there is support that COX is involved in similar processes as in mammals, ( e.g., reproduction). COX-2 ( but not COX-1) and prostaglandin activity was shown to increase with administration of transfor ming growth factor in granulosa cells of white leghorn hen follicles, suggesting that COX-2 a nd not COX-1 plays a role in granulosa cell proliferation during follicular development (Li et al ., 1996). It was also shown that indomethacin reduced the prolifer ation of granulosa cells (Jin et al ., 2006). When using COX-1 32

PAGE 33

and COX-2 specific inhibitors, it was found that both types reduced granulosa cell proliferation, but that COX-2 specific inhibitor showed a strong er effect, supporting orig inal studies that COX2 is the dominant form in granulosa cell proliferation (Jin et al ., 2007). However, COX-1 was found to be expressed highly in the brain and seminal vesicle of the chicken (Reed et al ., 1996). COX-1 (but not COX-2) is also up-regulated in ovarian cancers occurring in hens, suggesting a target for treatment (Urick and Johnson, 2006). C OX inhibitors, both specific and non-specific, were shown to decrease sperm motility in the domes tic turkey, demonstrating a further role for COX in bird reproduction (Kennedy et al ., 2003). As in mammals, COX-2 has been implicated with the detecti on and persistence of peripheral inflammatory pain in chickens. The number of C OX-2 containing neurons increased significantly in laminae under inflammatory c onditions, but not under control conditions, 12-24 hours after injection of Fr eunds adjunvant (Yamada et al ., 2006). This suggests that the numbers of COX-2 containing neurons are re lated to inflammatory pain as in mammals. It appears that COX may not play a thermoregulator y role in birds as it does in mammals because indomethacin did not cause any change in rectal temperat ure during heat stress in chickens (Furlan et al ., 1998). However, COX and its prostaglandins may play a role in memory retention in birds, because inhibitors produce amnesic effects (Hlsc her, 1995). Finally, COX-2 is expressed in the kidneys during development in chickens (Mathonnet et al ., 2001) and at high levels in the kidneys of adults (Reed et al ., 1996). Study Overview As outlined above, the family of cyclooxygenase genes has an interesting and functionally important history in the vertebrates. Drugs deri ved from cyclooxygenase function are among the most important and widely used tr eatment methods in medicine. However, COX function and evolution is not fully understood in the ancestral chor dates, specifically the teleosts, 33

PAGE 34

sharks, hagfish, lampreys, cephalochordates, a nd urochordates. Indee d, the origin of the mammalian forms of COX is unclear since the sea squirt possesses evolutionarily distinct COX forms. Resolving the evolution of COX in the chordates could prove invaluable in determining new targets for drug development (Searls, 2003). In Chapter 2, I describe the cloning and characterization of 9 new COX genes in the chordates. These include COX-1 and COX-2 form s from teleosts as well as novel forms from the hagfish, lamprey, and amphioxus. In phylogenet ic analyses, these forms indicate that several origins of COX occurred during chordate e volution, with the mammalian COX-1 and COX-2 forms likely originating with the hagfish (craniates). Data from the teleosts supports the findings of Ishikawa and colleges that teleosts in the Acanthopterygii posses two COX-1 forms and one COX-2 form, whereas earlier teleosts such as the zebrafish and rainbow trout posses two COX-2 forms and one COX-1 form. Furthermore, analyses of protein alignments from novel sequences indicate conserved and derived functional resi dues and areas between novel COX forms and the COX-1 and COX-2 forms of mammals. In Chapter 3, I summarize the findings of th is research and suggest future avenues of research based on the results presented here. I also present preliminary data investigating the possible function of cyclooxygenase in these ancestral chordates. 34

PAGE 35

Arachidonic Acid Prostaglandin G2 COX-1 or COX-2 Prostaglandin H2 Prostaglandin D2 Prostaglandin E2 Thromboxane A2 Thromboxane B2 Prostaglandin I2 6-keto-Prostaglandin F1 COX-1 or COX-2 Prostaglandin F2 Figure 1-1. Cascade of reactions depicting th e conversion of arachidonic acid to the primary prostaglandins via catalyzation with either cyclooxygenase (COX) form. Arachidonic acid is obtained from the conversion of linolet ic acid found in plants or directly from other animals. It is then oxidi zed by COX to produce Prostaglandin G2 which is subsequently reduced by COX to form Prostaglandin H2. Prostaglandin H2 can then be converted into the other prostaglandi ns via other enzymes (Vane et al., 1998). 35

PAGE 36

COX-2a Danio COX-2a Oncorhynchus COX-2b Danio COX-2b Oncorhynchus COX-2 Acanthopterygians COX-1a Acanthopterygians COX-1b Acanthopterygians COX-1 Danio COX-1 Oncorhynchus sCOXSqualus Figure 1-2 General phylogeny repr esenting the different COX forms in the fishes. Based on recent studies, it appears that teleosts have multiple forms of COX-1 or COX-2 (Ishikawa et al ., 2007; Ishikawa and Herschman, 2007). It is hypothesized that with the origin of the teleosts, COX-1 and C OX-2 underwent duplication, but that in one lineage (represented by the zebrafish and rainbow trout) one COX-1 form was lost and in another lineage (represented by the Acanthopterygians) one COX-2 form was lost. Also included is the form cloned from the spiny dogfish (Yang et al ., 2002) which loosely groups with COX-1 forms, although it shares near equal identity with COX-1 and COX-2. This phylogeny was simplified from an unpublished phylogeny generated using the online program P HYML (Guindon and Gascuel, 2003; Guindon et al ., 2005). Abbreviations: Danio = Danio rerio (zebrafish), Oncorhynchus = Oncorhynchus mykiss (rainbow trout), Squalus = Squalus acanthias (spiny dogfish). The Acanthopterygians clade is represented by the stickleback ( Gasterosteus aculeatus), green spotted puffer ( Tetraodon nigroviridis ), pufferfish ( Takifugu rubripes ), and Japanese medaka ( Oryzias latipes ). 36

PAGE 37

Figure 1-3 Accepted evolution of ancestral chordates (Pough, et. al 2005). Black lines show relationships only; they do not indicat e times of divergence nor the unrecorded presence of taxa in the fossil record. Ba rs shaded red indicate ranges of time when the taxon is known to be present. Th e subphylum Vertebrata includes the Myxinoidea (hagfishes), Petromyzontoidea (lampreys), Teleoste i (teleosts), and tetrapods. There is some controversy over wh ether the Urochordates (sea squirts) or the Cephalochordates (lancelets) represent the most basal chordate lineage. Also, it has historically been suggested that the hagfish and lamprey constitute a monophyletic group (the Agnathans or Cyclostomes). 37

PAGE 38

38 Invertebrate COX forms COXb Urochordates COXa Urochordates COX-2 Vertebrates COX-1 Vertebrates Figure 1-4 Evolution of COX forms in the chordates, based on Jarving et al (2004). The Urochordates (represented by Ciona intestinalis and Ciona savignyi ) have COX forms that represent an evolutionary dis tinct branch ancestral to the COX-1 and COX-2 forms of the vertebrates. In this tree, the vertebrates are represented by the teleosts, mammals, Xenopus, and Gallus

PAGE 39

CHAPTER 2 CYCLOOXYGENASES IN THE ANCEST RAL CHORDATES: SEQUENCE AND PHYLOGENETIC ANALYSES Introduction Cyclooxygenase (COX) is the enzyme that catalyzes the oxida tion and subsequent reduction of arachidonic acid to form Prostaglandin G2 and Prostaglandin H2 (PGH2). PGH2 can then undergo additional reactions to produce the primary prostagla ndins, which act as vascular tone regulators in the verteb rates. Prostaglandins and C OX participate in a variety of physiological functions in the vertebrates, incl uding inducing fever, maintaining pregnancy, and regulating ion transport in the kidneys (Steiner et al ., 2005; McLaren et al ., 1996; Harris et al ., 1994). These functions have been ex tensively studied in mammals (Vane et al ., 1998), but comparatively little functional data exist for ot her animals. However, COX has been sequenced in several evolutionarily more ancestral chordates, particularly the teleosts (Zou et al ., 1999; Roberts et al ., 2000; Choe et al ., 2006). Based on functional studies of COX in the teleosts, it seems that some functions are conserved (Choe et al ., 2006; Sorbera et al ., 2001; Brubacher et al ., 2000; Holland et al ., 2003) while others may be altered in some species (Goetz et al ., 1989) or novel (Cha et al ., 2006b). In mammals there are two main forms of cyclooxygenase. The first form was isolated from sheep seminal vesicles in 1988 and later named COX-1 (DeWitt and Smith, 1988; Merlie et al ., 1988; Yokoyama et al ., 1988). A second form was isol ated from mouse and chicken fibroblast cell cultures in the early 1990s and named COX-2 (Kujubu et al ., 1991; Xie et al ., 1991; O'Banion et al ., 1992). Originally, COX-1 was considered to be a constitutive form that maintained normal cell functions and COX-2 was c onsidered to be an inducible form that was up-regulated in inflammatory res ponses (Funk, 2001). However, stud ies have shown that this is an oversimplification and COX-2 is expressed constitutively in the brain (Breder et al ., 1995) 39

PAGE 40

and kidneys (Harris and Breyer, 2001) of mammals. This has led to the abandonment of COX-2 selective inhibitors ( e.g., celecoxib and valdecoxib) which were thought to treat inflammatory pain without the negative side effects associ ated with non-selective COX inhibition. Although structurally and biochemically similar, COX-1 a nd COX-2 vary in expression in the vertebrates and participate in different functions. For example, COX-2 but not COX-1 plays a role in granulosa cell proliferation in chicken follicles (Li et al ., 1996; Jin et al ., 2007). Although the amino acid sequences of COX-1 and COX-2 share about 63% similarity, the presence of valine in COX-2 at position 523 instead of isoleucine is thought to be re sponsible for their differences in substrate selectivity and sensitivity to specific inhibito rs (Otto and Smith, 1995). Inhibitory studies in mammals have suggested a COX-3 form also exists, but it has not been characterized (Kis et al ., 2006; Censarek et al ., 2006). Analyses of genomic sequence and targeted cloning efforts have demonstrated that, like mammals, other vertebrates have COX-1 and COX-2 forms (Jarving et al ., 2004). However, some variation exists in the COX-1 and COX-2 dichotomy, notably in the more evolutionarily ancestral chordates. Ishikawa and colleagues (Ishikawa et al ., 2007; Ishikawa and Herschman, 2007) have recently shown that teleosts posse s three forms of COX. The zebrafish ( Danio rerio) and the rainbow trout ( Onchorhynchus mykiss ) both posses two COX-2 forms (named COX-2a and COX-2b) and one COX-1 form whereas the stickleback (Gasterosteus aculeatus), green spotted puffer ( Tetraodon nigroviridis ), pufferfish ( Takifugu rubripes ), and Japanese medaka ( Oryzias latipes) posses two COX-1 forms (named COX-1a and COX-1b) and one COX-2 form. They also showed that COX-2a and COX-2b ar e functionally different in the zebrafish and rainbow trout. Also, a COX form (named sC OX) has been cloned from the spiny dogfish ( Squalus acanthias ) and groups with COX-1 in phylogene tic analyses, but shares strong 40

PAGE 41

sequence identity to COX-2 as well (Yang et al ., 2002). Furthermore, sea squirts (subphylum Urochordata) possess two forms of COX (named COXa and COXb) that do not correspond to the COX-1 or COX-2 of vertebrate s and represent an ancestral or igin of COX in the chordates (Jarving et al ., 2004). The current view of the evolution of cyclooxygenase in the chordates represents an interesting but incomplete account of this gene family, both from a phylogenetic and functional standpoint. Therefore, the first goal of this study was to pinpoint the orig in of COX-1 and COX2 in the chordates by searching for COX forms in the sea lamprey ( Petromyzon marinus), Atlantic hagfish ( Myxine glutinosa ), and amphioxus ( Branchiostoma lancelolatum ). A second goal was to confirm the findings of Ishikawa and colleagues by searching for the 3 forms of COX in the euryhaline killifish ( Fundulus heteroclitus ) and longhorn sculpin ( Myoxocephalus octodecemspinosus ). It was hypothesized that both te leosts would posses COX-1a, COX-1b, and COX-2 since both are in the Acanthopterygii clade of Teleostei and all other acanthopterygiians posses COX-1a, COX-1b, and COX-2. Here, I re port the cloning of 9 novel COX sequences from the species mentioned above. Sequence an d phylogenetic analyses s uggest that ancestral COX forms may have had similar functions as COX-1 and COX-2 in mammals, which likely originated with the origin of the vertebrates, although the hagf ish and lamprey may have COX-1 and COX-2 forms that re present novel lineages. Materials and Methods Animals and Holding Conditions All procedures were approved prior to be ginning the experiment by the University of Florida Institutional Animal Care and Use Committee (IACUC). Euryhaline killifish ( Fundulus heteroclitus ) were captured from Northeast Creek n ear the Mount Desert Island Biological Laboratory (MDIBL), Salisbury Cove Maine using minnow traps. Th ey were transported to the 41

PAGE 42

MDIBL where they were kept in fiberglass ta nks containing 100%, flowi ng seawater from the Gulf of Maine. The tanks were expose d to natural conditions. Longhorn sculpin ( Myoxocephalus octodecemspinosus ) were purchased from fishermen and were housed in a similar way at the MDIBL. Atlantic hagfish ( Myxine glutinosa ) were also purchased from fishermen and were housed at the MDIBL in 100% seawater and maintained on a 12 h light/dark cycle. Female, non-migratory lampreys ( Petromyzon marinus ) were a generous gift from the USGS Great Lakes Science Center at the Ha mmond Bay Biological Stat ion in Millersburg, Michigan and were dissected there. Lancelets ( Branchiostoma lancelolatum ) were purchased from Gulf Marine Specimens (Panacea, FL) and were kept in the bags they were shipped in for a few days before they were sacrificed. All housed animals were fed to satiation regularly. Some killifish were shipped to the Univers ity of Florida (Gainesv ille, FL) for further experiments. These killifish were housed as described previously (Choe et al ., 2006). Some hagfish were also transported to the Universi ty of Florida (Gainesville, FL) for further experiments. These hagfish were housed for a few days in a large Rubbermaid tank in 100% seawater at 4 C before they were killed. Tissue Collection After initial anaesthetiza tion with MS-222 (~600 mg L-1), killifish, sculpin, and lampreys were pithed and/or decapitated. The gill arches (1st and 2nd arches for lampreys, 2nd and 3rd arches for teleosts) were then removed using ster ile, RNAse free dissecting tools. Hagfish were decapitated and all gill baskets were then rem oved using sterile, RNAse free tools. Lancelets were cut in half with sterile, RNAse free tools. After removal, tissues were immediately placed in liquid nitrogen and stored at -80 C for 2 weeks to 4 months before further processing. 42

PAGE 43

Reverse Transcription, Primer Design, PCR, Cloning, and Sequencing Reverse transcription, PCR, cloning, and sequencing were performed as described previously (Choe et al ., 2006) with modifications. Total R NA was isolated from the gills of killifish, lampreys, sculpin, and hagfish as well as the anterior half of lancelets using TRI-reagent (Sigma, St. Louis, MO), and revers e transcribed with a SuperscriptTM II or SuperscriptTM III reverse transcriptase kit (Invi trogen, Carlsbad, CA) following th e manufacturers protocol and using oligo-dT as a primer. The resulting cDNA was stored at -20 C until used for PCR. Degenerate primers (those labe led as CH COX, Table 2-1) were first designed to amplify non-specific cyclooxygenases in the hagfish, lamp rey, and lancelet based on conserved amino acid sequences between COX-1 and COX-2 of Mus musculus, COX-2 of Fundulus heteroclitus sCOX of Squalus acanthias (GenBank accession numbers: NP_032995, NP_035328, and AAS21313), and predicted COXa and COXb of Ciona intestinalis based on genomic data. These primers were also later used to amplify COX-2 in sculpin. Another set of degenerate primers (those labeled as CH COX-1 in Table 2-1) were designed to amplify COX-1 forms specifically over COX-2 forms in teleosts ba sed on conserved amino acid sequences between COX-1 in Oncorhynchus mykiss Danio rerio, Salvelinus fontanalis (GenBank accession numbers: CAC10360, NP_705942, and AAF14529) and a predicted COX-1 of Tetraodon nigroviridis based on genomic data. These primers firs t amplified a COX-1a form in sculpin and a COX-1b form in killifish (see below). A further set of degenerate primers (those labeled as CH COX-1a in Table 2-1) were designed to amp lify COX-1a forms specifically over COX-1b in teleosts based on conserved amino acid seque nces between predicted COX-1a forms in Gasterosteus aculeatus Oryzias latipes and Tetraodon nigroviridis based on genomic data and a COX-1a found in sculpin earlier in this study (see below). A fi nal set of degenerate primers (those labeled as CH COX-1b in Table 2-1) were designed to amplify COX-1b forms specifically 43

PAGE 44

over COX-1b in teleosts based on conserved am ino acid sequences between predicted COX-1b forms in Gasterosteus aculeatus Oryzias latipes and Tetraodon nigroviridis based on genomic data and a COX-1b found in killif ish earlier in this study (see be low). All degenerate primers were designed using the online program Consensus-Degenerate Hybrid Oligonucleotide Primers (CODEHOP) (Rose et al ., 1998). Initial PCR reactions were performed on 1/20th of a reverse transcri ptase reaction with a TaKaRa Ex Taq Hot Start DNA Polymerase Kit (Takara Bio Inc., Japan) in a PCR Express thermocycler (ThermoHybaid, Franklin, MA) with the following parameters: initial denaturing at 95 C for 5 minutes, then 35 cycles of 30 seconds at 95 C, 30 seconds at 60 C, and 1.5 minutes at 72 C. A final elongation step of 7 minutes at 72 C was performed for each PCR and then the reaction was held at 4 C. Initial PCR products were visualized by ethidi um bromide staining on 1-2% agarose gels and then ligated into PCR4-TOPO vectors and transformed into TOP10 chemically competent cells using a TOPO TA Cloning Kit (Invitrogen) following the manufacturers protocol. Plasmids were then isolated using a High Pure Plasmid Isolation Kit (Roche, Germany) following the manufacturers protocol and plasmid DNA was sequenced in both directions at the Marine DNA Se quencing Center at the MDIBL. After initial fragments were sequenced, Pr imer Express software (Applied Biosystems, Foster City, CA) was used to design specific prim ers based on the initial fragments (Tables 2-2, 2-3, 2-4, 2-5, and 2-6). These specific primers, along with the original de generate primers, were used to extend COX sequences. PCR was comple ted as above with slight modifications to annealing temperature and elongation time for each reaction, as well as nested PCR reactions in some cases to increase specificity. Products were visualized, cloned, and sequenced as above. 44

PAGE 45

5 and 3 Rapid Amplific ation of cDNA Ends (RACE) After initial sequences were extended with sp ecific primers, the 5 and 3 ends were sequenced using 5 and 3 RACE. Following th e manufacturers protocols, a Generacer Kit (Invitrogen) was used to make 5 and 3 cDNA for hagfish, k illifish, and scul pin. Initial sequence data was used to make 5 and 3 RACE specific primers for each species (those labeled with 5 or 3 in Tables 2-2, 2-3, 2-4, 2-5, and 2-6). These primers, along with kit primers that anneal to the ends of the 5 and 3 cDNA, we re used in touchdown PCR reactions with the following parameters: 5 cycles of 30 seconds at 94 C and 1.5 minutes at 72 C; 5 cycles of 30 seconds at 94 C and 1.5 minutes at 70 C; and 25 cycles of 30 seconds at 94 C, 30 seconds at 60 C, and 1.5 minutes at 72 C. As above, a fi nal elongation step of 7 minutes at 72 C terminated the reaction, which was held at 4 C. For some reactions, annealing temperatures and elongation times were slightly altered and nest ed PCR reactions were performed for some reactions using specific primers (Tables 2-2, 23, 2-4, 2-5, and 2-6) to increase specificity. Products were visualized, cloned, and sequenced as above. Sequence Analysis Initial sequences from dege nerate primers, sequence exte nsions, and 5 and 3 RACE were assembled using GeneTools software (BioT ools Inc., Edmonton, Alberta) and the resulting sequences were searched for open reading frames. The predicted amino acids were aligned with other COX proteins using PepTools software (BioTools Inc.) for phylogenetic analysis. Multiple alignments were also generated using ClustalW to search for conserved protein domains across COX sequences. Alignments were manually adju sted and the N and C-terminal areas were realigned using Microsoft Word based on previous COX alignments (Ishikawa et al ., 2007; Yang et al ., 2002; Kulmacz et al ., 2003). For the novel sequences, COX forms were aligned with 45

PAGE 46

other relevant COX proteins and annotate d using functional amino acids and domains highlighted from Ishikawa et al (2007), Yang et al (2002), and Kulmacz et al (2003). Phylogenetic Analysis To investigate the evolutionary relationshi ps of the different forms of COX in the chordates, phylogenies were ge nerated using the novel amino acid sequences generated in this study and several other COX protein sequences from GenBank and genome databases. All novel protein sequences were included in the data set. COX sequences from teleosts were included in the analysis only if all 3 forms of COX were av ailable. These included the zebrafish, rainbow trout, green spotted puffer, stickleback, eur yhaline killifish, and longhorn sculpin. COX sequences from non-teleosts were included in the analys is if at least two forms of COX were available and both sequences were designated as Reference Sequences (RefSeqs) in GenBank. These included the chicken, frog, mouse, rat, human, rabbit, dog, cow, sheep, and opossum. COX sequences were also included if they represented an evolutionarily interesting group. These included the dogfish shark an d the sea squirt. In total, 50 protein sequences were included in the analyses (Table 2-7). Models of evolution to be used in phylogenetic analyses were evaluated to account for amino acid substitutions, among-site variation, and invariable sites. Using likelihood ratio tests, a model using the WAG rate matrix (W helan and Goldman, 2001) and the gamma ( ) distribution for among-site varia tion was chosen (Table 2-8). A distance phylogeny was first generated using Molecular Evolutionary Genetics Analysis 4 (MEGA) software (Tamura et al ., 2007) with a minimum evolution (ME) analysis and 1000 bootstrap replicates. In this analysis the parameter was fixed to the value estimated from maximum likelihood (ML) analysis ( = 0.737, see below). Additionally, a JTT rate matrix (Jones et al ., 1992) was used instead of a WAG matrix because a W AG matrix is not available 46

PAGE 47

for MEGA 4. A complete deletion option was also selected. After comparing results between ML, ME, and Bayesian Phylogenetics (BP), lampre y and hagfish sequences were identified as possible rouges and another distance analysis with identical parameters (but with = 0.742) was performed excluding these two sequences. A maximum likelihood phylogeny (ML) wa s generated using the program PhyML (Guindon and Gascuel, 2003). An initial phylogeny was generated using WAG analysis, 1000 bootstrap replicates, 8 substitution rate categor ies, and a gamma shape parameter with an estimated Again, the analysis was repeated with the rouge lamprey and hagfish sequences removed. To evaluate support for monophyletic groups, an approximate likelihood ratio test (aLRT, Anisimova and Gascuel, 2006) was pe rformed both including and excluding the lamprey and hagfish sequences. This test used the mi nimum of Chi-Squared and Shimodaira-Hasegawa (SH) support values. Finally, A Bayesian phylogenetics (BP) analys is was also performed using an initial run with 2 million generations and a final run with 10 million generations using the program MrBayes 3.1.2. Once again, analyses were perf ormed with and without hagfish and lamprey sequences. Each run consisted of on e cold and three heated chains ( T = 0.2). The WAG + model was used with an estimated After discarding the firs t 10% of each run as burnin, posterior probabilities were calculated based on trees sa mpled every 500 generations. Due to inconsistencies in tree topologie s between the three methods used above, alternative topologies were ge nerated in which the positions of the hagfish and lamprey sequences were forced to be included in diffe rent clades (Figure 2-15). These alternative topologies were generated and viewed using TreeView 1.6.6. Alternative topologies were 47

PAGE 48

evaluated using Ln L scores generated by maximum likelihoo d criterion with online execution in PhyML (Guindon et al ., 2005). Results Molecular Identification of Cyclooxygenases Branchiostoma Initial PCR reactions using the degenerate primers CH COX F3 and CH COX R2 (Table 2-1) amplified two 532 bp products from the lancelet ( Branchiostoma lancelolatum ). These two products (referred to hereafter as COXc and COXd ) were found to share the most identity with COXa and COXb from the tunicat e. COXc was 50.9% identical to COXa from the tunicate and COXd was 58.8% identical to COXb from the tuni cate. All attempts to extend these sequences using specific primers designed against these se quences (Table 2-2) we re unsuccessful. After searching for open reading frames two putative 177 amino acid prot eins were predicted from the lancelet. Myxine Initial PCR reactions using the degenerate primers CH COX F1, CH COX F2, CH COX R1, and CH COX R2 (Table 2-1) were used to amplify a single 1454 bp product from the hagfish ( Myxine glutinosa ). This product (hereafte r referred to as hCOX) was found to be 63.8% identical to COX-1 of the zebrafish ( Danio rerio). RACE primers (5 and 3, Table 2-3) were designed against this initial pr oduct and used with kit primers to completely sequence the 2416 bp product. Searching for open reading frames yi elded a putative 610 amino acid protein. Petromyzon Initial PCR reactions using degenerate primers CH COX F3 and CH COX R1 (Table 2-1) amplified a single 541 bp product from gill tissue of the lamprey ( Petromyzon marinus). This product (hereafter referred to as lCOX) was later extended using degenerate primers (Table 2-1) 48

PAGE 49

and specific primers designed agains t the initial 541 bp product (Table 2-4). Despite all attempts to amplify the complete lCOX product (including RACE) the sequence was only extended to 860 bp. A 286 amino acid open reading frame was pred icted from this product. Fundulus Because the COX-2 sequence fo r the euryhaline killifish ( Fundulus heteroclitus ) was previously completed (Choe et al ., 2006), the degenerate primer CH COX-1 F2 (Table 2-1) designed to amplify COX-1 forms over COX-2 form s was used with the degenerate primer CH COX R1 (Table 2-1) to initially amplify a non-COX-2, 1335 bp product (hereafter referred to as COX-1b Fundulus ) from killifish gill tissue. This product was then extended and completed using specific primers and RACE primers (Table 2-5). The completed 2226 bp sequence contains a 598 amino acid open reading frame that was nested inside the teleost COX-1b clade in all phylogenetic analyses (see be low), prompting the design of degenerate primers (Table 2-1) that were used to amplify COX-1a forms in teleosts over COX-1b forms. Using the degenerate primers CH COX-1a F1 and CH COX-1a R1 (Table 2-1), a 759 bp product was initially amplified in PCR reactions. Using RACE primer s designed to complete this sequence (Table 25), the 3 end of this product was completed, resulting in a 1655 bp product (hereafter referred to as COX-1a Fundulus) that contains a 452 amino acid reading fr ame. However, the 5 end of this product was not sequenced despite multiple attemp ts. This putative protein grouped with the COX-1a sequences of other teleos ts in all phylogenetic analyses (see below), leading to the conclusion that the COX-1a, COX-1b, and COX-2 sequences included in the analyses all represent different COX products expressed in the gill tissu e of the euryhaline killifish. Myoxocephalus Using the degenerate primers CH COX F1 and CH COX R2 (Table 2-1), a 977 bp product was initially amplified in PCR reactions using cDNA from the gills of the longhorn 49

PAGE 50

sculpin ( Myoxocephalus octodecemspinosus). This product (hereafter referred to as COX-2 Myoxocephalus) was then extended and completed usi ng RACE and specific primers (Table 26), resulting in a 2618 bp product that contains a 605 amino aci d open reading frame. This sequence grouped with COX-2 forms from other te leosts in all phylogenetic analyses, inciting the use of COX-1 degenerate primers (Table 2-1) CH COX-1 F2 and CH COX-1 R2 in PCR reactions to amplify a 1000 bp product (hereafter referred to as COX-1a Myoxocephalus ). This product was then extended and completed using RA CE primers (Table 2-6), resulting in a 2633 bp product encoding a 622 amino acid open reading frame. This product grouped with COX-1a forms from other teleosts in all phylogenetic analyses, prompting the design of degenerate primers used to amplify COX-1b forms in teleosts over COX-1a forms (Table 2-1). Using the degenerate primers CH COX-1b F1 and CH CO X-1b R0 (Table 2-1), an initial 895 bp product (hereafter referred to as COX-1b Myoxocephalus ) was amplified in PCR reactions. This product was extended and completed using specific RACE primers (Table 2-6), resulting in a 2332 bp product containing a 600 amino acid open readin g frame. This product grouped with other teleost COX-1b forms in all phylogenetic analyses, suggesting that the COX-2, COX-1a, and COX-1b forms sequenced represent 3 different C OX forms expressed in the gills of the longhorn sculpin. Sequence Analyses Teleosts COX-1a, COX-1b, and COX-2 Three different COX forms are now available from the teleosts studied here: the COX-2 sequenced from the euryhaline killifish (Choe et al ., 2006), the COX-2 sequenced here from the longhorn sculpin, and two the COX-1 forms sequenced here from both the killifish and sculpin, named as COX-1a and COX-1b (following Ishikawa and Herschman, 2007). COX-1a and COX1b predicted proteins from the killifish were more similar to Mus COX-1 than COX-2 (70% 50

PAGE 51

versus 64% for COX-1a and 68% versus 59% for COX-1b, respectively). Similarly, COX-2 from the sculpin was more similar to Mus COX-2 than Mus COX-1 (70% versus 60%) and COX-1a and COX-1b were more similar to Mus COX-1 than Mus COX-2 (53% versus 47% for COX-1a and 67% versus 57% for COX-1b, respectively). An alignment of COX forms from the killifis h (Figure 2-1) shows that all the important amino acid residues for cyclooxygenase function are conserved in all forms. However, because COX-1a is incomplete it is unknown whether the Nterminal characteristics are conserved in this form. These include an active site tyrosine (Tyr-385, using ovine COX-1 numbering), haembinding histidines (His-207 and His-338), and the aspirin acetyla tion site (Ser530) (Ishikawa et al ., 2007; Ishikawa and Herschman, 2007; Yang et al ., 2002; Kulmacz et al ., 2003). In addition the COX-2 form contains a C-terminal amino aci d insertion and the COX-1 forms contain an Nterminal amino acid insertion. This is consis tent with the COX-1 and COX-2 forms of other vertebrates (Herschman et al ., 2003; Kulmacz et al ., 2003), although killifish COX-2 seems to have a shorter than average in sertion. In mammals, the ami no acid residues thought to give COX-1 and COX-2 their differing affinities for su bstrates are positions 513 (His in COX-1 and Arg in Cox-2) and 523 (Ile in COX-1 and Val in COX-2) (Guo et al ., 1996). However, as previously noted in other teleosts (Grosser et al ., 2002; Choe et al ., 2006; Ishikawa et al ., 2007) these differences appear to be absent in teleosts, with Arg an d Val present in positions 513 and 523, respectively, in both teleost COX-1 and COX-2. This is also the case in the killifish with Arg in position 513 and Val in position 523 in all COX forms reported here. As in the killifish, alignment of the three COX forms sequenced from the sculpin (Figure 2-2) shows conserved amino acid re sidues characteristic of COX func tion in all three forms. The characteristic terminal amino acid insertions f ound in mammalian COX forms are also present in 51

PAGE 52

their respective sculpin counterpa rts. However, COX-1b from th e sculpin seems to have both N and C-terminal insertions. Disulfide bonds near th e n-terminus of sculpin COX-1a also seem to be altered due to the substitution of other amino acids for cysteine. It also appears that some functional amino acid residues near the C-terminus of sculpin COX-1a are not conserved with the other forms. These include the substitution of Leu for Arg at position 513, Leu for Val at position 523, and Phe for Ser at position 530. Lamprey, hagfish, and amphioxus COX forms The one incomplete putative COX protein obtained from the gills of the lamprey shares near equal identity (63%) with Mus COX-1 and COX-2. The gene, referred to here as lamprey COX (lCOX) (Yang et al ., 2002) shares the most identity (70 %) with a form from the lancelet (COXc), but shares notable identi ty (64%) with the form from the hagfish as well. Based on an alignment of COX forms sequenced from select non-mammalian and non-teleost chordates (Figure 2-3), the partial COX form sequenced fro m the gills of the lamprey has the predicted histidine site (His-207) critical for peroxidase activity as well as conserved haem-binding domains. However, the membrane binding regi ons near the Arg-277 loop that differ between COX-1 and COX-2 forms appear to be different from both COX-1 and COX-2 in the lamprey form. This is seen when the lamprey form is aligned with COX-1 and COX-2 forms from vertebrates (Figure 2-4). The putative COX protein from the gills of the hagfish shares slightly more identity with Mus COX-2 than Mus COX-1 (63% versus 60%). The gene, referred to here as hCOX, shares the most identity (> 60%) with vertebrate COX-2 forms, but also shares notable identity with lCOX (64%) and forms from amphioxus (> 60%). An alignment of hCOX with other nonmammalian, non-teleost COX proteins (Figure 2-3) shows that all important amino acid residues and binding sites critical to cycl ooxygenase activity are conserved in hCOX. An alignment of 52

PAGE 53

hCOX with COX-1 and COX-2 protei ns from various vertebrates (Figure 2-5) shows that hCOX has an insertion of amino acids near the C-terminal; characteristic of COX-2 proteins in vertebrates. However, there are several re gions where COX-1 differs from COX-2 but hCOX shows no identity to COX-1 or COX-2 amino acids (indicated as sites with a + over them in Figure 2-5). Two putative incomplete COX sequences were obtained from amphioxus. These sequences, referred to here as COXc and COXd, are most identical (81%) to each other, but also share notable identity with hCOX (66%), lC OX (67%), vertebrate COX-1 (> 60%), and vertebrate COX-2 (> 60%). Th ey are the least identical to Ciona COXa (48%) and COXb (55%). Based on an alignment of non-mammalia n, non-teleost COX proteins (Figure 2-3), it appears that amino acids critical to COX functi on are conserved in COXc and COXd. However, the first haem-binding domain seems to be very di fferent in the amphioxus forms. This is also the case for Ciona COX forms and COXa, COXb, COXc, and COXd all share notable identity in this region as shown by alignment (Figure 2-6). Phylogenetic analyses A phylogeny (Figure 2-7) generated under a distance optimality criterion with 1000 bootstrap replicates using MEGA4 shows predic ted COX clades. COX-1a and COX-1b forms from teleosts form monophyletic sister clades The novel COX-1 forms from the killifish and sculpin group together with othe r teleosts in these clades as expected based on their designation here. Eutherian COX-1 forms group together in a monophyletic clade sister to the teleost COX-1 clade. The COX-1 proteins from Gallus, Monodelphis, and Xenopus are located at the base of this monophyletic vertebrate COX-1 clade, with sCOX being the most basal. Vertebrate COX-2 forms group together in another monophyletic clade that is sister to the vertebrate COX-1 clade. There are two monophyletic clades within the COX-2 group: a teleos t clade and a tetrapod clade. 53

PAGE 54

The forms from lamprey and hagfish (lCOX and hC OX) are basal to the vertebrate COX clade, while the forms from amphioxus (COXc and C OXd) form a monophyletic group basal to these forms. The forms from Ciona (COXa and COXb) form another monophyletic group that is basal to all other COX forms. Boot strap values give robust support for vertebrate clades, the amphioxus clade, and the Ciona clade, but give weak support for placement of hCOX, lCOX, and sCOX. Based on these re sults and other generated phyl ogenies (see below), hCOX and lCOX were identified as possible rogue sequences due to their inconsistent positions depending on the type of analysis used and another distan ce analysis was complete d without including these sequences (Figure 2-8). The t opology of this phylogeny is very similar to the complete COX phylogeny. However, sCOX is basal to the vert ebrate COX clade and not included with the other vertebrate COX-1 forms. Additionally, bootstrap values for most clades are considerably more robust than when hagfish and la mprey sequences are included. To further test relationships between COX proteins, a phyloge ny (Figure 2-9) was generated using the maximum likelihood criter ion, 1000 bootstrap replicates, and the program PhyML (Guindon and Gascuel, 2003). The topology of this tree is very similar to the one generated using distance criteri on. Briefly, it contains well supported, monophyletic clades for COX-1 (teleost COX-1a, teleost COX-1b, tele ost COX-1, mammalian COX-1, and vertebrate COX-1 with sCOX as the most basal sequence) and COX-2 (teleost COX-2, mammalian COX-2, and vertebrate COX-2). The lamprey (lCOX) is also basal to the vertebrate COX clade, the amphioxus COXc and COXd form a basal monophyletic clade, and the most basal clade in the tree is a monophyletic COXa and C OXb from the sea squirt. However, in the ML analysis, the hagfish (hCOX) sequence groups at the base of the vertebrate COX-2 clade instead of being basal to the vertebrate COX clade. Again, th e analysis was repeated without hCOX and lCOX 54

PAGE 55

(Figure 2-10), causing bootstrap values to incr ease dramatically. Also, the estimated gamma shape parameter increased slightly from 0.737 to 0.742. To further evaluate support for COX clades, an aLRT analysis (Anisimova and Gascuel, 2006) was performed. This type of analysis prov ides values of support similar to Felsensteins bootstrap support values but is much faster because bootstrap sampling requires many (1000 in the previous analyses) runs wh ile aLRT is run only once. The fundamental difference between the two is that bootstrap support values are based on repeatability whereas the aLRT is a measure of the likelihood gain of including a branch versus collapsing it (Anisimova and Gascuel, 2006). The resulting aLRT statistics can be interpreted using parametric Chi-Squa red distributions or a non-parametric Shimodaira-Hasegawa-like (SH) pr ocedure (Anisimova and Gascuel, 2006). The former seems to be more liberal (giving values similar to Bayesian posterior probabilities) and the later more conservative (Anisimova and Gascuel, 2006). Here, the most conservative approach was used and values represent the minimum of Chi-Squared and Shimodaira-Hasegawa (SH) support values. When all sp ecies are included (Figure 2-11) clades of interest have robust support (> 0.90) except for the vertebrate COX-2 clade (contai ning hCOX, 0.683) and the clade containing lCOX (0.87). When hCOX and lCOX ar e excluded from the analysis (Figure 2-12), support values generally increase, with a notable incr ease in the vertebrate C OX-2 clade (0.883). A Basesian phylogenetics (BP) analysis wa s also performed (Figure 2-13) using the program MrBayes 3.1.2, with one initial 2 million generation run, and one final 10 million generation run. The topology of the consensus tree (with burnin = 10%) is similar to those described above, with well-supporte d aforementioned vertebrate COX clades. However, in BP analysis lCOX groups at the base of the amphioxus COXc/COXd clade instead of being the basal member of the vertebrate COX clade. This grouping is well-supported by posterior probability 55

PAGE 56

scores (0.93). As in ML analysis, hCOX groups w ith vertebrate COX-2 prot eins at the base of the clade. Also similar to previous analys es, when lCOX and hCOX are excluded (Figure 2-14) scores improve and all clades have robust support. Due to the contrasting topologies genera ted using distance, ML, and BP methods, 21 different tree topologies (Figure 2-15) were generated by using th e most likely tree from ML analysis (Figure 2-9) and reloca ting hCOX and/or lCOX sequences to other branches of the tree. Positions of all other sequences were not altered from the most likely tree. A Ln likelihood score (Ln L ) was generated for each topology using onlin e execution of the program PhyML (Guindon et al ., 2005). Likelihood scores were compared to th e most likely tree. These tests indicate that lCOX and hCOX can be moved some what freely around the base of the tree without resulting in a noticeably different Ln L than the most likely topology (Table 2-9). It appears that moving lCOX to the base of the COX-1 clade causes the smallest change in Ln L whereas moving hCOX or lCOX deeply into COX-1 or COX-2 clades causes the largest changes in Ln L Discussion Here, I present the first forms of the en zyme cyclooxygenase (COX) sequenced from the hagfish, lamprey, and amphioxus. I also show that the killifish and sculpin conform to the current hypothesis that teleos ts posses additional COX-1 and COX-2 forms. The phylogenetic relationships among the various COX forms are stil l not definite, although the results presented here allow some conclusions to be drawn and pred ictions to be made. Specifically, it appears that COX sequences in the chordates form at least 3 well supported phylogenetic groups: the urochordata, cephalochordata, a nd vertebrata. Hagfish and lamprey positions are variable depending upon the analysis used, but likelihood scores seems to favor placement within the vertebrata clade. 56

PAGE 57

Novel COX Forms Although the two COX sequences from amphioxus were not able to be extended, they aligned readily with other COX se quences. They show a first haem-binding domain that shares little conservation with vertebrate forms (20%), as in the urochordates. However, the second haem-binding domain is completely conserved in th ese forms, as is histidine-207 which is crucial for peroxidase activity. The arginine-277 loop region does no t resemble COX-1 or COX-2 forms. Due to the truncated nature of these proteins, it is difficult to determine if COX in the cephalochordates plays similar roles as in the vertebrates, but some functions are likely conserved. Following the nomenclature used by Jarving et al (2004) these forms are named COXc and COXd. The COX sequence found in th e gills of the hagfish was extended to completion and readily aligned wi th other COX forms. It ha s conserved amino acids, binding domains, and bonds critical for COX function. Ther efore, it likely plays a similar role in the hagfish. The hagfish COX has an N-terminus deletion and valine-523 char acteristic of COX-2 forms, but there are multiple sites where it shares equal or no homology with COX-1 and COX-2 of vertebrates. Therefore, following the nomenclature of Yang et al (2002) this form is named hCOX. Although incomplete, the one COX sequen ce cloned from the gills of the lamprey readily aligns with other COX sequences and contains amino acids and regions critical to COX function. However, like the hagfish sequence it shares no biased homology with COX-1 or COX-2 forms. This form is therefore na med lCOX. As predicted based on phylogenetic position, COX-1a, COX-1b, and COX-2 were found in th e gills of the euryhaline killifish and the longhorn sculpin. With the exception of COX-1a in the sculpin, all COX forms from these teleosts contain conserved regions critical to COX function. As has been reported in other teleosts (Ishikawa et al ., 2007), these forms all contain va line at position 523, unlike in mammals. COX-1a from the sculpin does not have several amino acids critical for COX 57

PAGE 58

function located near the C and N terminus of the sequence. These include disruption of disulfide bonds near the N terminus due to cy stine replacements, little conserved homology in the membrane binding domain, and alternate residues for arginie-513 (leucine), valine-523 (leucine), and serine-530 (phenylalanine). This is not the case in the other acanthopterygiians, where all COX forms have these conserved regions. This may indicate th at in the sculpin COX1a has partially lost function, and COX-1b or COX-2 may therefore have additional responsibilities. Phylogenetic Analyses As has been seen when tracing the evolutionary histories of other gene families in evolutionary deep time (Abbasi and Grzeschik, 2007; Goudet et al ., 2007), the pedigree of the COX family is littered with duplications, losse s, and uncertainty. Despite utilizing a multifaceted approach to depict COX evolution in the chordates, the results indicate that COX has a complicated and under-examined history of evoluti on in the chordates. This is not surprising, considering the complex functions COX has been s hown to have in the chordates. Because of these complex functions, duplications, partitioning of roles, differential expression, and multiple forms with multiple functions are to be expected. In all phylogenetic analyses, the more recent history of COX evolution is more clear and consistent than the relationships of the ancestral taxa. The teleosts consistently form monophyletic COX clades nested within the gna thostomes, as expected. The gnathostomes consistently form two COX sister clades in phylogenetic analyses: COX-1 and COX-2. This is expected based on previous phylogenetic analyses in the vertebrates (Gu, 2001; Gu, 2006). The COX-1 clade is consistently rooted with the sequence from the dogfish (sCOX), although support values are not robust fo r this relationship when hagf ish and lamprey sequences are included. In distance analysis excluding hagfish and lamprey sequences, sCOX groups outside 58

PAGE 59

the COX-1 and COX-2 clades, representing anot her COX gnathostome lineage. These groupings are as expected, based on Yang et al .s (2002) original descripti on of sCOX as neither a COX-1 nor COX-2. These are the first phylogenetic analyses of COX to include sCOX and it is concluded that sCOX is most likely a ba sal member of the COX-1 clade. In all analyses, the COX-1 clade contains robustly supported, m onophyletic teleost and eutherian mammal clades. In the teleost cl ade, COX-1b and COX-1a form well-supported, monophyletic clades. Although this is expected based on initial studies (Ishikawa et al ., 2007; Ishikawa and Herachmann, 2007), this is the fi rst study to use sophisticated tree-building techniques to show the monophyly and legitimacy of the COX-1 forms in teleosts. It is also shown in each analysis that the non-duplicate COX-1 forms from the zebrafish and trout are more related to COX-1b forms from the acanthopte rygiians, grouping with them at the base of a monophyletic COX-1/COX-1b clade. The mammalian COX-1 group is not as robustl y supported using all t ypes of analyses. The expected relationships (based on assumed ev olutionary relationships in the tetrapods) are shown and supported with some confidence in th e maximum likelihood anal ysis (ML) when the hagfish and lamprey sequences are excluded. In this anlaysis, the tetr apods form a monophyletic group with the frog and chicken at the base of the clade, followed by the opossum sequences, and then the eutherians. Even in this analys is, the frog and chicken sequences group together, contrary to what is biologically expected (the frog should be more basal, representing an evolutionary ancient non-amniote lineage, and the chicke n should be a sister to the mammals). However, this grouping is not well-supported in any analysis. When hagfish and lamprey are included in ML analysis, the chicken/frog clade occurs at the base of the mammalian/teleost clade, contrary to biological predictions. Howeve r, this relationship is poorly supported. These 59

PAGE 60

low support values are confirmed in the aLRT anal ysis. In Bayesian a nd distance analyses, the frog is basal to the chicken, but these sequences are again at the ba se of a biologically irrelevant teleost/mammal clade. However, unlike dist ance and ML methods, Bayesian posterior probabilities strongly support this relationship. Bayesian posterior probabilities traditionally overestimate support values for a variety of reasons (Cummings et al ., 2003: Lewis, pers. comm..) and can give incorrect clades strong poste rior probabilities. This may explain why this biologically unexpected relationship is strongly supported only in the Bayesian trees. Therefore, ML analyses (supported by bootstrap and aLRT sc ores) show the most probable scenario for COX-1 evolution in the gnathostomes: a basa l sCOX, followed by a teleost COX-1 clade (as described above) sister to a tetrapod COX-1 clade. The COX-2 groups within the gnathostomes mi rrors the same general trends as the COX1 clade. Teleosts consistently form a well-supported, monophyletic group. The COX-2a sequences from zebrafish and trout group together to form the most basal members of this clade. The COX-2b sequences group with the non-duplicate COX-2 sequences from the acanthopterygiians to form the other teleost COX-2 clade. Sister to the teleosts, the tetrapods form another COX-2 clade in the gnathostomes. In this tetrapod COX-2 clade, frog and chicken sequences form the most basal (although not well-s upported) clade, with the mammals as a sister clade. This biologically rele vant relationship between COX-2 sequences is predicted in all analyses. Basal to the COX-1 and COX-2 clades in the gnathostomes are two clades that are consistently and robustly supporte d in all phylogenetic analyses: a urochordate COX clade and a cephalochordate COX clade. The cephalochorda te clade consists of the two COX sequences obtained in this study (COXc and COXd) and th e urochordate clade consists of the two 60

PAGE 61

sequences from Ciona (COXa and COXb). The urochordate COX forms always forms the base of the entire tree and the cepha lochordate COX forms always group as a sister clade to the gnathostome COX clade. This study is the first to show this biologically relevant relationship between COX forms in these ancestral chordates. The hagfish (hCOX) and lamprey (lCOX) sequences have alternate phylogenetic positions depending on the technique used to reconstruct their evolutionary histories. Also, when these sequences are removed from analys is, bootstrap, aLRT, and posterior probability scores supporting COX clades increase. Because of their uncertain placement in COX evolution, these sequences are designated as rogues a nd analyses excluding them likely show a more accurate representation of COX evolution. In distance analysis, both hCOX and lCOX are placed outside the gnathostome COX clade and form two separate COX lineages between the cephalochordate and gnathostome clades. In ML analysis, lCOX remains basal but hCOX is placed at the base of the gnathostome COX-2 clade. In BP analysis, hCOX remains in the COX2 clade but lCOX is placed within the cephaloch ordate clade. Support values for hCOX and lCOX placement are weak in all but BP analyses Clearly, the placement of hCOX and lCOX in COX evolution is not clear and without further evidence, placing them with any degree of certainty becomes difficult. In an attempt to find the most likely placement of these sequences, 21 different phylogenies were generated based on the mo st likely tree with hCOX and lCOX placed in variable positions. The trees were then evaluated in a maximum likelihood framework. It is important to note that although Ln L scores were generate d for each topology, other biological factors may influence which topology or type of topology is actually the most likely. For example, placing hCOX in the COX-2 clade and lCOX at the base of the tree (technically the most likely tree) implies that another COX lin eage exists for all vertebrates (the lineage 61

PAGE 62

represented by lCOX) because the hagfish is biol ogically ancestral to the lamprey. This would mean that dozens of novel COX forms have yet to be discovered in well-examined groups such as the mammals and teleosts. With genomes of se veral of these groups available, it is unlikely that such a vast amount of sequence data have yet to be found. Therefore, the most likely scenarios for COX evolution would imply that ei ther hagfish is basal and lamprey is derived, both are basal, or both are derived. However, placing lCOX, hCOX, or sCOX in the COX-1 or COX-2 clade implies that another COX form has yet to be found in these species. It appears that moving lCOX into the base of the COX-1 clade causes less of a change in Ln L scores than moving hCOX outside the gnathosto me COX clade. However, it is apparent that either sequence can be moved somewhat freely throughout the tr ee without resulting in noticeably worse (~10 Ln L ) tree scores. This leads to th e conclusion that although hCOX and lCOX may represent independent, basal lineages of COX, they are most likely basal members of the COX-2 and COX-1 clades (respectively) in the gna thostomes. If this is the case then at least one other form of COX should exist in the hagf ish and lamprey, as well as in the dogfish shark. Summary Presented here are the first COX sequences from amphioxus, the hagfish, and the lamprey. All predicted COX sequences from the killifish and sculpin are also described. These sequences all likely represent functional forms of COX found in the chordates based on conserved amino acids and domains critical to COX function. For the first time, a sophisticated phylogenetic analysis of COX forms from the majo rity of representative chordate lineages was attempted. Although still not definitive, a gene ral hypothesis for the evol utionary history of COX in the chordates can be made (Figure 2-16). In this scenario, there are three main COX groups corresponding to the three subphyla found in the phylum Chordata: the urochordata, cephalochordata, and vertebrata. Each contains two main COX groups, with the well62

PAGE 63

documented COX-1 and COX-2 forms only found in the vertebrata clade. These forms contain monophyletic groups for the teleosts and the tetr apods, with multiple forms in the teleosts confirming previous hypotheses (Ishikawa et al ., 2007; Ishikawa and Herschman, 2007). Hagfish and lamprey placement is uncertain, but most likely these sequences represent basal members of the vertebrata clade. This does not support the timing of geno mic duplications in the chordates according to the most recent view of the 2R Hypothesis (Kasahara, 2007), indicating two rounds of genome duplication af ter the origin of the urochordate s but prior to th e radiation of the jawed vertebrates. However, several developm entally important proteins have been shown to not support this timing and indicate an earlier duplication (Hughes, 1999). Multiple COX-1 and COX-2 genes in the teleosts do support the hypot hesis that the teleosts are characterized by another round of genome duplication after the origin of the vertebrates (Li et al ., 2007). Clearly, this uncertain period representing some 600 milli on years of evolution is characterized by many losses and duplications and remains to be resolved definitively. 63

PAGE 64

Table 2-1. Degenerate primers used in PCR Name Orientation Nucleotide sequence (5' to 3') CH COX F1 Sense ATG GAC GAC TAC CAG TGY GAY TGY AC CH COX F2 Sense GAT GTT TGC ATT TTT CGC TCA RCA YTT YAC CH COX F2.25 Sense TGG CG T GGA CCT AGG TCA NRT NTA YGG CH COX F2.5 Sense CGA GCT GCG GTT CCA TAA ARA YGG NAA RYT CH COX F3 Sense CCA CTA TA T GGC TGC GGG ARC AYA AYM G CH COX F5 Sense CAT GTG GAA TT C CAT CAC CTG TAY CAY TGG CA CH COX R1 Antisense CCC C GA AGG TGG ATG GYT TCC AVY A CH COX R2 Antisense GCA TCA GCG GGT GCC ART GRT A CH COX R3 Antisense TCC TCT TTT AGT ATG TCG CAG ACT CKR TTR TGY TC CH COX-1 F4 Sense TGC CAG ACA GCA TCC ACA THG AYG GNG A CH COX-1 F5 Sense CAG CAG ACA ATG CGC AGG NCA RAT HGG CH COX-1 R2 Antisense TGG GTG TA T GTT GTG TCC TCC NCC DAT YTG CH COX-1a F1 Sense CCC CAC C AA CCT ACA ATA CCA ART AYG GNT A CH COX-1a F2 Sense AAA GTG CTG ACT GAR MGN TTY TT CH COX-1a F3 Sense GGA CTA ATC TGA TGT TCG CGT TYA TGG CNC A CH COX-1a F4 Sense AGC GGA AGG CGG CTT YAC NAA NGC CH COX-1a F5 Sense CAA ATA GTA AAT GGG GAR AYN TAY CC CH COX-1a R1 Antisense ATA GGG AAT GTC GTC NCC RTC DAT CH COX-1a R2 Antisense GGG GCA CGT TTT CCG GRT ANA YCA T CH COX-1a R3 Antisense ACC TCA GTG ACA GTG GGA GGR TAN RTY TC CH COX-1b F1 Sense CGG AT G GGT GTG GGC TTY ACN AAR GC CH COX-1b R0 Antisense GGA GA A GGG AGC ACC CAT YTC NAC CAT CH COX-1b R3 Antisense CCA GCG TCC GCG CDA TYT CYT C 64

PAGE 65

Table 2-2. Amphioxus COX specific primers used in PCR Name Orientation Nucleo tide sequence (5 to 3) COXa F1 Sense TAC TCC ACC GTG TGG CTG C COXa F2 Sense TGG GAC GAC GAG AGG CTC COXa F2.5 Sense ACC GGT GAG ACC ATC AAC ATC AT COXa F3 Sense CAC CTG AGC GGC TAC AAC TTT COXa F4 Sense GAC CTG TTC TGG GAC CCT GAG COXa F5 Sense CCA GTA CCA GAA CCG CAT CTT C COXa R1 Antisense CGT ACG GCG GGT AGA TCA TG COXa R2 Antisense GCT GCC GCT CCA CGG COXa R3 Antisense CCC GT A GAT ATG GCT CAG GTC A COXa 3 F1 Sense GAG GCT CTT CCA GAC AGC CA COXa 3 F2 Sense CAC CTG AGC GGC TAC AAC TTT COXa 5 R1 Antisense T GG CTG TCT GGA AGA GCC TC COXa 5 R2 Antisense TGG AGT AGA CGA ACA GGC CC COXa 5 R3 Antisense CCC CGT AGA TAT GGC TCA GGT COXb F0 Sense CAG ACA GCT AGA CTC ATT CTT ATC AGT GA COXb F1 Sense TAT CAA CAT CGT CAT TGG AGA GTA TG COXb F1.5 Sense GGC TGG CAA AAA CTT CCA ACT COXb F2 Sense TGC AGT ACC AGA ACA GCA TAT TTG COXb F3 Sense AGC ATA TTT GTG GAG TTT AAC CAC TTG COXb R1 Antisense CGT CCG GAG GGT AAA TCA TGT COXb R2 Antisense ACT TCA GTT TCC CGT CCT GGA COXb R3 Antisense CGT A AA CAT GGC TCA TGT CCA CT COXb 3 F1 Sense GTC CCC GAG AAG AAG CGA TT COXb 3 F2 Sense GAA CG G CTC TAC CAG ACA GCT AG COXb 3 F3 Sense TGT TCT GGG ACC CTG AGC TG COXb 5 R1 Antisense TGG TAG AGC CGT TCG TCG TC COXb 5 R2 Antisense GGA GGG TAA ATC ATG TGT ACG GA COXb 5 R3 Antisense ACA TGG CTC ATG TCC ACT GC 65

PAGE 66

Table 2-3. Hagfish COX speci fic primers used in PCR Name Orientation Nucleo tide sequence (5 to 3) hCOX 3 F1 Sense TTA ACC ACC TGT ACC ACT GGC AC hCOX 3 F2 Sense CTC AAC CAT GGA GTA CGA GGT CT hCOX 3 F3 Sense CAA TGC TAT GGA GTT CTA CCT GGG hCOX 3 F0.8 Sense CAG TAC AGC AAC CGC ATC TCA hCOX 3 F0.6 Sense AAT GGG ACG ACG AGA GAA TCT TT hCOX 3 F0.4 Sense GGT TTG CTG TTG GTC ACG AAG hCOX 3 F0.2 Sense AGT CCA CCC ACA TAC AAT GCC hCOX 3 F0.1 Sense CTC ACG CAC TTT GCT CCC TT hCOX 3 F0 Sense GAA CTG CAC CTA CCC CGA GAC hCOX mid F1 Sense GTT TCG AGT CCA CCC ACA TAC AA hCOX mid F2 Sense CAT ACT CCA ACC TCA GCT ACT TCA CT hCOX mid R1 Antisense CAC ATC GAG TAC GTC ACA CAC G hCOX mid R2 Antisense AAG GGT CCC GTA GAG CAT GA hCOX 5 R1 Antisense TCT CCG AAT AAA GCT CCC TGT C hCOX 5 R2 Antisense TGC TGC CAT TTC CGT TTC TC hCOX 5 R3 Antisense CAT GTT TGA TGG ATG CTG TTG C hCOX 5 R4 Antisense AGG CG A GTG AAG TAG CTG AGG TT hCOX 5 R5 Antisense CCT CCC AGG ACT TGT ACC GTA AT hCOX 5 R6 Antisense GAG GA A GTA ATG CAC GGT ATC TGG 66

PAGE 67

Table 2-4. Lamprey COX speci fic primers used in PCR Name Orientation Nucleo tide sequence (5 to 3) lCOX F1 Sense GAG GAA CGC TTG AGA GAC AAC A lCOX R1 Antisense TCT TG T TGA TGT TT C GAC CGC lCOX R2 Antisense CCA CCG CCA ATC TGG C lCOX R3 Antisense AAT CAG GAA GCT CTC AGG CAT C lCOX 3 F1 Sense GAG TTC CTC TTC AAC CCC GG lCOX 3 F2 Sense TCG AAA CAT CAA CAA GAA CCT CC lCOX 3 F3 Sense TTC ACC TCC TTC CTG GAG CTC lCOX 5 R1 Antisense TGC TGC ACG TAC TCC TCG ATC lCOX 5 R2 Antisense GCA GCT GGT GTT GTC TCT CAA 67

PAGE 68

Table 2-5. Killifish COX specific primers used in PCR Name Orientation Nucleo tide sequence (5 to 3) Fh COX-1b 3 F1 Sense CTT CAC CGA TAG CGA GGA GAT AG Fh COX-1b 3 F2 Sense AGC TCT ACG GTG ACA TCG ACA CT Fh COX-1b 3 F3 Sense GGG TAA CCC CAT ATG TTC TCC AC Fh COX-1b 5 R1 Antisense CCC ATG TGA GAG AGC CTT AGT GA Fh COX-1b 5 R2 Antisense C AG CCT CTC AAA CAA CAC CTG AG Fh COX-1b 5 R3 Antisense GT A GTA GGA TTC CCA GCT GAG GTA GT Fh COX-1a 3 F1 Sens e GGT GTA CCC CGA AGG TTT CC Fh COX-1a 3 F2 Sense GAG TAC GTG CAG CAC CTG AGC Fh COX-1a 3 F3 Sense AGT ACA CCA ATC GCA TCG CC Fh COX-1a 5 R1 Antisense GAT GAT AAG TCT GGC GGT CTG G Fh COX-1a 5 R2 Antisense GAT GGT GGC ATA CAC GGT GA Fh COX-1a 5 R3 Antisense TTT ATG AAG CCG AAG CTG GTG 68

PAGE 69

Table 2-6. Sculpin COX speci fic primers used in PCR Name Orientation Nucleo tide sequence (5 to 3) Mo COX-2 3 F1 Sense CCC CGG TCT GAT GAT GTA CG Mo COX-2 3 F2 Sense ACC GAG TGT GTG ACG TGT TGA Mo COX-2 3 F3 Sense TC G AGG ACT ACG TGC AGC AC Mo COX-2 3 F4 Sense CAG GTC TAA CGC AAT CTT TGG G Mo COX-2 3 F5 Sense CCT CAA GGG CTT AAT GGG AAA C Mo COX-2 3 F6 Sense AAC ATC GTC AAC ACC GCC TC Mo COX-2 mid F1 Sense AC A GTT CAT TCC GGA TCC ACA Mo COX-2 mid F2 Sense CA C CAG CCT GAT GTT TGC ATT Mo COX-2 mid R1 Antisense CGA AGC GGT GAG ATT CAG GA Mo COX-2 mid R2 Antisense CTC CAT CCA GGA CCT GAT ATT TAA G Mo COX-2 5 R1 Antisense TCC GGA ATG AAC TGT CTT CTC A Mo COX-2 5 R2 Antisense AGG TCG GAG GAC TAT CAA TCA AGT Mo COX-2 5 R3 Antisense GAA GGA GAT GGA GTT AAT GAT GTT CC Mo COX-1a 3 F1 Sense CA T CAC CTC CGG CTT CAT AAA Mo COX-1a 3 F2 Sense GAG GGA GCA TAA CAG ACT CTG TGA Mo COX-1a 3 F3 Sense CTG GAG TTC TGC CAC CTC TAC C Mo COX-1a 3 F4 Sense GC A GCC CTT CAA TGA ATA CAG G Mo COX-1a 3 F5 Sense CAT GCT GGA GAA GAC CCT TCC Mo COX-1a 3 F6 Sense GAG TAT GTT GGA GAT GGG TGC TC Mo COX-1a 5 R1 Antisense GCC GAA ATG TCT TCC TCC TAA A Mo COX-1a 5 R2 Antisense CAT CGG TAA AGG GCA GTC CTC Mo COX-1a 5 R3 Antisense TGA CCG TCA GCA CTA ATC TCA TG Mo COX-1b 3 F1 Sense TCA CAC ACT ACG GCA TCG AGA Mo COX-1b 3 F2 Sense TTG GCG GTG GCT TTA ACA TC Mo COX-1b 3 F3 Sens e CAG CCC TTC AAC GAG TAC AGG Mo COX-1b 5 R1 Antisense GAG CGA TAC GGT TCC CAT ACT G Mo COX-1b 5 R2 Antisense GTT GTG CTC CCT GAG CCA GA Mo COX-1b 5 R3 Antisense AAT AGC CAT CTG AGC CTC AGG A 69

PAGE 70

Table 2-7. Sequences included in phylogenetic analyses # Name Organism Size (AA) 1 COX1a Fundulus Fundulus heteroclitus (killifish) 452 2 COX1b Fundulus Fundulus heteroclitus (killifish) 598 3 COX2 Fundulus Fundulus heteroclitus (killifish) 610 4 COX1a Myoxocephalus Myoxocephalus octodecimspinosus (lh. Sculpin) 622 5 COX1b Myoxocephalus Myoxocephalus octodecimspinosus (lh. Sculpin) 600 6 COX2 Myoxocephalus Myoxocephalus octodecimspinosus (lh. Sculpin) 605 7 COXa Ciona Ciona intestinalis (sea squirt) 653 8 COXb Ciona Ciona intestinalis (sea squirt) 600 9 COXc Branchiostoma Branchiostoma lancelolatum (amphioxus) 177 10 COXd Branchiostoma Branchiostoma lancelolatum (amphioxus) 177 11 hCOX Myxine Myxine glutinosa (Atlantic Hagfish) 610 12 lCOX Petromyzon Petromyzon marinus (Sea Lamprey) 286 13 COX1a Oryzias Oryzias latipes (Japanese medaka) 605 14 COX1b Oryzias Oryzias latipes (Japanese medaka) 606 15 COX2 Oryzias Oryzias latipes (Japanese medaka) 609 16 COX1a Gasterosteus Gasterosteus aculeatus (stickleback) 598 17 COX1b Gasterosteus Gasterosteus aculeatus (stickleback) 598 18 COX2 Gasterosteus Gasterosteus aculeatus (stickleback) 620 19 COX1a Tetraodon Tetraodon nigroviridis (Green Spotted Puffer) 1023 20 COX1b Tetraodon Tetraodon nigroviridis (Green Spotted Puffer) 589 21 COX2 Tetraodon Tetraodon nigroviridis (Green Spotted Puffer) 456 22 COX1 Oncorhynchus Oncorhynchus mykiss (rainbow trout) 624 23 COX2a Oncorhynchus Oncorhynchus mykiss (rainbow trout) 607 24 COX2b Oncorhynchus Oncorhynchus mykiss (rainbow trout) 609 25 COX1 Danio Danio rerio (zebrafish) 597 26 COX2a Danio Danio rerio (zebrafish) 601 27 COX2b Danio Danio rerio (zebrafish) 606 28 COX1 Monodelphis Monodelphis domestica (gr. S.t. opossum) 625 29 COX1b Monodelphis Monodelphis domestica (gr. S.t. opossum) 627 30 COX1b2 Monodelphis Monodelphis domestica (gr. S.t. opossum) 729 31 COX2 Monodelphis Monodelphis domestica (gr. S.t. opossum) 608 32 COX1 Gallus Gallus gallus (rd. jungle fowl) 649 33 COX2 Gallus Gallus gallus (rd. jungle fowl) 603 34 COX1 Bos Bos taurus (cattle) 600 35 COX2 Bos Bos taurus (cattle) 604 36 COX1 Xenopus l Xenopus laevis (Afr. Claw. Frog) 587 37 COX2 Xenopus l Xenopus laevis (Afr. Claw. Frog) 604 38 COX1 Canis Canis lupus familiaris (dog) 633 39 COX2 Canis Canis lupus familiaris (dog) 604 40 COX1 Homo Homo sapiens (human) 599 41 COX2 Homo Homo sapiens (human) 604 42 COX1 Rattus Rattus norvegicus (norway rat) 602 43 COX2 Rattus Rattus norvegicus (norway rat) 604 44 COX1 Mus Mus musculus (house mouse) 602 70

PAGE 71

Table 2-7. Continued. # Name Organism Size (AA) 45 COX2 Mus Mus musculus (house mouse) 604 46 COX1 Oryctolagus Oryctolagus cuniculus (rabbit) 606 47 COX2 Oryctolagus Oryctolagus cuniculus (rabbit) 604 48 COX1 Ovis Ovis aries (sheep) 600 49 COX2 Ovis Ovis aries (sheep) 603 50 sCOX Squalus Squalus acanthias (spiny dogfish) 593 71

PAGE 72

Table 2-8. LRTs between amino acid based models of COX evolution Evolutionary Model* Ln liklihood (Ln L ) Score (Ln L1LnL2) d.f.@ P# WAG -26632 WAG + I -26315 317 1 < 0.01 WAG + -25294 1021 1 < 0.01 WAG + I + -25294 0 2 > 0.05 *Evolutionary models are arranged from the most simple to the most complex. Only models using the WAG matrix were evaluated. I repr esents an invariable sites parameter and represents an among site variation parameter @ d.f. indicates the difference in free paramete rs between the complex and simple models #P values represent the comparison of simple to complex models and were obtained using a chisquared distribution test 72

PAGE 73

Table 2-9. LRTs between tree topologies with altered positions of hCOX and lCOX Tree Topology Name* Ln liklihood (Ln L ) Score Estimated @ (Ln L1LnL2)# COX2 Hag (most likely) -25294.22 0.737 COX1Lamp/COX2Hag -25295.57 0.737 2.70 COX2 Agnatha -25299.09 0.737 9.74 Lamp/Amp -25299.27 0.737 10.1 COX2 Vert -25299.61 0.736 10.7 COX1 Hag -25300.92 0.735 13.4 COX1 Vert -25301.22 0.735 14.0 Ancestral Hag -25301.56 0.735 14.6 COX1 Agnatha -25301.78 0.735 15.1 COX1Hag/COX2Lamp -25302.19 0.735 15.9 Ancestral agnatha -25302.55 0.735 16.7 COX1 Lamp -25303.25 0.735 18.1 COX2 Lamp -25303.85 0.735 19.3 Agnatha/Amp -25308.82 0.735 29.2 Hag/Amp -25308.90 0.735 29.4 Hag Internal -25321.15 0.737 53.9 Lamp Internal -25322.77 0.736 57.1 Lamp Mammal -25341.41 0.732 94.4 Lamp Teleost -25344.68 0.735 101 Hag Teleost -25350.30 0.734 112 Hag mammal -25408.58 0.731 229 *Each tree has the same topology as the most likely tree (Figure 2-9) but with alternative placements of hagfish (hCOX) and lamprey (l COX) sequences as noted in Figure 2-15. @ represents the shape value under the model #Where Ln1 is the most likely tree score and Ln2 is the tree score of the topology in question 73

PAGE 74

COX-1b MRASVLGSVCALLVLLREPGCQGDEVTTSTVNPCCYLPCKHWSVCVRYGEDKYECDC 57 COX-2 MNRITFAVFLLALC--------FSFHKEVLGNACCSEPCQNRGVCTAMGSDSYECDC 49 *N68 COX-1b THTGYYGENCSIPELWTRVRQFLKPSPDVVHYILTHFHWLWDIINN-TFLRNVLMRL 113 COX-2 TRTGYRGQNCTTPEFLTWIKISLKPTPNTVHYILTHFKGFWNIINNISFLRDAIMKY 106 *R120 *N144 COX-1a NLSYYTRLLPPVPKDCPLPMGTKGKPVLP 29 COX-1b VITARSNLIPSPPTFNSKYNYLSWESYYNLSYYTRILPPVPEDCPTPLGVKGRNGLP 170 COX-2 VLTSRSHMIDSPPTYNADYGYKSWEAYSNLSYYTRALPPVPEDCPTPMGVVGKKELP 163 Q203/H207 COX-1a DIKEISERYFKRTEFRPDPQGTNLMFAFMAQHFTHQFFKTSHKVDAGFTKALGHGVD 86 COX-1b DPQVLFERLLKRRTFRPDPQGSNIMFAFFAQHFTHQFFKTYNRMGLGFTKALSHGVD 227 COX-2 DVKVLAEKLLVRRRFIPDPQGTSLMFAFFAQHFTHQFFKSDMKNGPAFTVAKGHGVD 220 *R277 COX-1a ASNIYGEELERQHQLRLHKDGKLKYQLINGEMYPPTVSEVPVHMVYPEGFPAEQRLA 143 COX-1b AGHIYGDSLERQHLLRLFRDGKLKYQLIDGEVYPPSVTDAPVRMSYPPGIPVEKQMA 284 COX-2 LGHIYGENLEKQHKLRLFKDGKLKYTMVNGEVYPPLVKDVGVEMHYPPHVPDSQRFA 277 COX-1a IGQEVFGLVPGLTVYATIWLREHNRVCDILKGEHPTWDDEQLFQTARLIIIGEIINI 200 COX-1b IGQEVFGLLPGLSLYATLWLREHNRVCDILKAEHPTWDDEQLFQTTRLIIIGETIRI 341 COX-2 VGHEAFGLVPGLLMYATIWLREHNRVCDVLKGVHPDWDDERLFQTTRLILIGETIKI 334 Y385/H388 COX-1a IIEEYVQHLSGYYLKLKYDPSLLFGVRFQYTNRIALEFCYLYHWHPLMPDSFLIDGD 257 COX-1b VIEEYVQHLSGYLLQLKFDPTLLFNSNFQYGNRIALEFSQLYHWHPLMPDSFHISGD 398 COX-2 VIEDYVQHLSGYHFKLKFDPELLFNQRFQYQNRIASEFNTLYHWHPLMPDSFHIEEK 391 *N410 COX-1a ELPYSQFLYNTSILMHYGVEKLVDAFSRQPAGQIGGGRNIHQAVLRVAEMVIRDSRA 314 COX-1b ELSYSQFLFNTSVLTHYGVEKLVDAFSRQAAGQIGGGHNINAVITKVIVGTIEESRQ 455 COX-2 DYSYKEFVFNTSVVTEHGINNLVDSFSKQIAGRVAGGRNVPGPIMYVAIKSIENSRK 448 *R513 COX-1a ARLQPFNQYRKRFNLKPYSSFYELTGDEEMARGLEELYGDIDALEFYPGLLLEKTRP 371 COX-1b LRIQPFNEYRKRFNLEPYTSFRDFTDSEEIASTLEELYGDIDTLEFYPGLLLEKTRP 512 COX-2 MRYQSLNAYRKRFSMKPYTSFEDLTGEKEMAAILEELYGDVDAVELYPGLLVEKPRT 505 *V523 *S530 COX-1a SSIFGESMVEMGAPFSLKGLLGNPINSPEYWKPSTFGGETGFNIIKTSTLKKLVCLN 428 COX-1b GAIFGESMVEMGAPFSLKGLLGNPICSPQYWKPSTFGGKVGFDIVNSASLKKLVCLN 569 COX-2 NAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFGGTAGFDIVNTASLQRLVCNN 562 Figure 2-1. Amino acid alignment of the form s of COX sequenced from the gills of the euryhaline killifish (Fundulus heteroclitus ). The COX-2 sequence is from GenBank (Accession #AAS21313) and the others were obta ined in this study. Amino acids that share at least 60% identity across sequences are highlighted. *I ndicates amino acids (numbered based on ovine COX-1) involved in COX function: active site of COX (tyrosine-385, histidine-388, and serine-530) substrate binding site (arginine-120), N glycosylation sites (asparagine-68, 144, and 410), sites for peroxidase activity (glutamine-203 and histidine-207), and the two sites which define conformational differences in channels between COX-1 and COX-2 in mammals (arginine-513 and valine-523) (Ishikawa et al ., 2007). The black boxes indi cate the two domains that define the haem-binding sites and the da shed box indicates the membrane binding domain (Kulmacz et al ., 2003; Ishikawa et al ., 2007). The solid lines represent disulfide bonds, with the beginning and end of the l ongest bond represented by arrows (Kulmacz et al ., 2003). The dashed line represents the arginine-277 loop region, which has been shown to differ between COX-1 and COX-2 forms in mammals (Yang et al ., 2003). The numbers to the right of the sequences indicate the amino acid number of each sequence. 74

PAGE 75

COX-1a TK-WCPYVDFHVPRNEEERKPS-----------------------TEL 452 COX-1b SR-TCPYVAFSVPAEEEPGRNDGKERS------------------SEL 598 COX-2 VRGPCPVASFYVPDVKETGSMTINSSTSHSRDSNINPTVILKERTSEL 610 Figure 2-1. Continued. 75

PAGE 76

COX-1a MKRANLSNYFLETNHCEQNISDNYHFITLITIL-SRES--KSLASFPSGLTFCCWGA 54 COX-1b MRSPVLGPVCALLLL-LREPAC------------------RGDEVTSDTVNPCCY-36 COX-2 MYRFTFA-VF---LLALGVLVC-------------------------EGGNPCC--25 *N68 COX-1a HVLLTQVLIPVVITLVRTQECVCDSVQIT-TNVTALALASMETTALSRSSGPEFVRS 110 COX-1b --FPCQHWGVCVRYGEDKYECDCTRTGYTGGNCTVPEFWSRVHQFL-KPS-PEVLHY 89 COX-2 -SEPCQNRGVCTALGTDNYECDCTRTGYHGHNCTTPEFLTWVKISL-KPS-PNTVHY 79 *R120 COX-1a RTRRSSSSSPTSIGCWHLVNN-SFLRGTVMRLVLTVRSDLIPSPPTYNTKYGYLNWE 166 COX-1b ILTHFN-------WLWDIINH-TFLRDVLMRMVLTVRSNLIPSPPTYNSKYDYLSWE 138 COX-2 ILTHFK-------GFWNIINSISFFRDAIMRYVLTSRSHLIDSPPTFNADYGYKSWE 129 *N144 COX-1a SYYNISYYTRLLPPVPEDCPLPMGTKGRPDLPDPKVLTERFFRRKTFRPDPQGANLM 223 COX-1b SYYNLSYYTRILPPVPKDCPTPLGVKGKAGLPDPELLVERLLKRRTFRPDPQGSNLM 195 COX-2 AYSNLSYYTRTLPPVPEDCPTPMGVVGKKELPDAKLLAEKLFMRRQFIPDPQGTSLM 186 *Q203/H207 COX-1a FAFMAQHFTHQFFKTDHELQGGFTKALGHGVDAGNIYGDNLAKQHHLRLHKDGKLKY 280 COX-1b FAFFAQHFTHQFFKTYNRMGVGFTKALAHGVDAGHVYGDNLQRQLKLRLHKDGKLKY 252 COX-2 FAFFAQHFTHQFFKSDMKKGPAFTLATGHGVDLNHVYGGSMERQHKLRLRQDGKLKY 243 *R277 COX-1a QIVNGETYPPTTSEAPVHMMYPEDVPPEKRLAIGQEVFGLLPGLTMYATIWLREHNR 337 COX-1b QLVDGQIYPPSVVDAPVKMSYPPGVPPEAQMAICQEVYGLLPGLGMFATLWLREHNR 309 COX-2 QVLDGEVYPPTVKEVGADMHYPPHVPESHRFAVGHEAFGLVPGLMMYATIWLREHNR 300 COX-1a LCDILKAEHPTWDDEQLFQTTRLIVIGEIINIIIEEYVQQLSGYQLKLKFDPTLLFN 394 COX-1b VCDILKAEHPTWDDEQLFQTARFVIIGETIKIVIEEYVQQLSGYLLQLKFDPALLFN 366 COX-2 VCDVLKEVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFN 357 *Y385/H388 *N410 COX-1a ERFQYSNRIALEFCHLYHWHSLMPDSFLIDGDDIPYSQFFYNTSILMHYGVEKLVDA 451 COX-1b SNFQYGNRIALEFSQLYHWHPLMPESFLINGDELPYKRFLFNNTVLTHYGIENLVTA 423 COX-2 QRFQYQNRIASEFNTLYHWHPLMPDSFHIEEKDYSYKEFVFNTSVVTEHGIGNLVES 414 Figure 2-2. Amino acid alignment of the three forms of COX sequenced from the gills of the longhorn sculpin ( Myoxocephalus octodecemspinosus ): COX-1a, COX-1b, and COX2. All sequences were obtained during this study. Amino acids that share at least 60% identity across sequences are highlighted. *Indicates amino acids (numbered based on ovine COX-1) involved in COX func tion: active site of COX (tyrosine-385, histidine-388, and serine-530), subs trate binding site (arginine-120), N -glycosylation sites (asparagine-68, 144, and 410), sites fo r peroxidase activity (glutamine-203 and histidine-207), and the two sites which defi ne conformational differences in channels between COX-1 and COX-2 in mammal s (arginine-513 and valine-523) (Yang et al ., 2002; Ishikawa et al ., 2007). The black boxes indicate the two domains that define the haem-binding sites and the dashed box indicates the membra ne binding domain (Kulmacz et al ., 2003; Ishikawa et al ., 2007). The solid lines represent disulfide bonds, with the beginning and end of the longest bond represented by arrows (Kulmacz et al ., 2003). The dashed line repres ents the arginine-277 loop region, which has been shown to differ between COX-1 and COX-2 forms in mammals (Yang et al ., 2003; Kulmacz et al ., 2003). The numbers to the right of the sequences indicate the amino acid number of each sequence. 76

PAGE 77

COX-1a FSHQPAGQIGGGHNSHAVVLKVAEMVIRESRETRVQPFNEYRKKFNLQPYTSFYDLT 508 COX-1b FSRQVAGQIGGGFNINAAVTKVSVLTIKESRKLRMQPFNEYRKRFNLKPYTSFREFT 480 COX-2 FTNQIAGRVAGGRNVPGPIMYVAIKSIENSRKMRYQSLNAYRKRFSMKPYSSFEDMT 471 *R513 *V523 *S530 COX-1a GDIEMAKGLEELYGDIDAVEFYPGLMLEKTLPTRIFGESMLEMGAPLFPERPVGKPH 565 COX-1b DNEEIARELEEFYGDVDALEFYPGLLLERTREGSIFGESMVEMGAPFSLKGLLGNPI 537 COX-2 GEKEMAAILEEFYGHVDAVELYPGLLVEKPRSNAIFGETMVEMGAPFSLKGLMGNPI 528 COX-1a LLPV-LEAQHLWGRDGFQYRNFHSEETGVPQHQVVSIRGL-PCSPKGRRNQTNKSI620 COX-1b CSPVYWKPSTFGGKVGF---DIVNSAT---LKKLVCLNTR-TCSYVAFRVPTEEQLK 587 COX-2 CSPEYWKPSTFGGSEGF---NIVNTAS---LQRLVCNNVQGPCPVASFSGPDVKDSG 579 COX-1a -----------------------YTL 622 COX-1b TGNDDSKTRT-------------DEL 600 COX-2 SMIINSSTSNSDINPTVILKERTTEL 605 Figure 2-2. Continued. 77

PAGE 78

sCOX MEAARIILLLLPLCFLKMADTTAINPCCYYPCQNKGICVNVGKEGYECDCTRT 53 hCOX MTSEVFVVLCVAVVFAGAA--AADDPCCGSPCENKGVCVSVGFEDYECDCTRT 51 *N68 sCOX GYYGVNCTFPFSWSRVHKFLKPSPSSMHHVLTHYKWLWYIINNISFFSDTLMR 106 hCOX GYYGSNCTYPETWTWIVNMLKPLPDTVHYFLTHFAPFWSLVNRAAFLRDRVMR 104 *R120 *N144 sCOX LVLTVRANIIPSPPTYNSDYTYVSWEGYSNISYLTRLLPPVPKDCPTPTGTQG 159 hCOX HVLMSRAHMVSSPPTYNADYGYKSWEAYSNLSYFTRLLPPVPQGCPTPMGRTG 157 *Q203/H207 sCOX YKKLPDSEQLAEEFLLRRKFIPDPQGSNLMFAFFAQHFTHQFFRTDLDRGPGF 212 lCOX HQFFNTDPVRGPAF 14 hCOX KKELPDAQKLAERFLLRRTFIPDPQGSNLLFAFFAQHFTHQFFKTDFKRGPGF 210 COXc HQFFKTDFKKGAGR 14 COXd HQFFKTDFKKGPGR 14 sCOX TKALGHGVDLTHIYGDSLERQHHLRLFKDGKLKYQVVNGEVFPPSVKEAPIQM 265 lCOX TRALGHGVDLNHIYGGTLERQHQLRLFKDGKLKFQMIDGEAYPPVVRDAPVHM 67 hCOX TKALGHGVDLSHIYGDTLDKQHKLRLHNNGKLKFQMIDGEVFPPLVSEAPVDM 263 COXc TW-GDHGVDLSHIYGETVERQHQLRSFTDGKLKFQRVEGEVYPPSLADAPVHM 66 COXd TW-SDHAVDMSHVYGETVERQRQLRSFQDGKLKYQLVDGEAFPPSLQDASVHM 66 *R277 sCOX KYPSTLPEEKRLAIGHDTFGLIPGLMMYATIWLREHNRVCDILKEEHPVWSDE 318 lCOX VYPEHVPASLRFAVGHEVYGLLPGLLVYATVWLREHNRVCDVLHARHPRWDDE 120 hCOX IYPPHVPEAARFAVGHEAFGLVPGLMLYGTLWLREHNRVCDVLDVDHPEWDDE 316 COXc IYPPYVPEGKRFAIGHEFFGLLPGLFVYSTVWLREHNRVCDVMKELHPDWDDE 119 COXd IYPPDVPEKKRFALGHEFFGLLPGLFVWATVWLREHNRVCDVMKDLHPDWDDE 119 sCOX QLFQTTRLILIGETIKIVIEDYVQHLSGYNFRMMFNPELLFTEHFQYSNRIAV 371 lCOX RLFQTARLILTGETMKIVIEEYVQHLSGYNFHLKFDPTLLFGVNFQYSNRMSL 173 hCOX RIFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPKLLFGQPFQYSNRISV 369 COXc RLFQTARLILTGETINIIINEYVQHLSGYNFDLFWDPELLFSDQFQYQNRIFV 172 COXd RLYQTARLILISETINIVIGEYVQHLAGKNFQLFWDPELLFEEQXQYQNSIFV 172 Figure 2-3. Amino acid alignment of the forms of COX sequenced from the gills of the lamprey ( Petromyzon marinus ), hagfish ( Myxine glutinosa ), and amphioxus ( Branchiostoma lancelolatum ), along with sCOX from the dogfis h (Squalus acanthias, Accession #AAL37727). Amino acids that share at least 60% identity across sequences are highlighted. *Indicates amino acids (num bered based on ovine COX-1) involved in COX function: active site of COX (tyrosine-385, his tidine-388, and serine-530), substrate binding site (arginine-120), N -glycosylation sites (a sparagine-68, 144, and 410), sites for peroxidase activity (gluta mine-203 and histidine-207), and the two sites which define conformational differen ces in channels between COX-1 and COX2 in mammals (arginine-513 and valine-523) (Yang et al ., 2002; Ishikawa et al ., 2007). The black boxes indicate the two domains that define the haem-binding sites and the dashed box indicates the membrane binding domain (Kulmacz et al ., 2003; Ishikawa et al ., 2007). The solid lines represent disulfide bo nds, with the beginning and end of the longest bond re presented by arrows (Kulmacz et al ., 2003). The dashed line represents the arginine-277 loop region, which has been shown to differ between COX-1 and COX-2 forms in mammals (Yang et al ., 2003; Kulmacz et al ., 2003). The numbers to the right of the seque nces indicate the am ino acid number of each sequence. 78

PAGE 79

* *Y385/H388 *N410 sCOX EFDHLYHWHPLMPDSFIVKGQDFSYKDFLFNTDILLNLGVDALVESFSKQIAG 424 lCOX EFNHLYHWHPLMPDSLLIDGRNYSYDEFLFNPGLLADKKLMPLVRSFMRQRAG 226 hCOX EFNHLYHWHGLNPDAFRVGTQEYQYSQFLFNNTILLNHGVRGLLEAFNVQQAG 422 COXc EFNHL 177 COXd EFNHL 177 sCOX RIGGGRNIHQSLLHIAIATIEHGRLLRFQPYNEYRKKLGLTPYKSFQELTGER 477 lCOX TVSGGRNINKNLLHVATSIIEHGRTLRLQSLNQYRHRFNMRPFTSFLELTGDE 279 hCOX RIGGGQNIHGALLHVATASIKHGRKMRFQSLNQYRKQFGLQPYQSFEQLTGET 475 *V523 *S530 sCOX EVAARLEKLYGHIDAMEFYPALLLEAPNKNSIFGESMVEMGAPFSLKGLMGNP 530 lCOX AMAAEME 286 hCOX EMAADLAELYSDINAMEFYLGLMVEKPRQGALFGETMVEAGAPFSLKGLMGNA 528 sCOX ICSPDYWKPSTFGGKTGFDIVNTATFEKLICLNVK-KCPYVGFHVPY-----582 hCOX ICSPEYWKPSTFGGNRGFEIVNSASLRRLVCLNLQGPCPDVAFHVPRDNQQDV 581 sCOX NVDNDYEREKGKP------------STEL 593 hCOX VVNVTGSQGGSDGVTTTPHYVADQQSREL 610 Figure 2-3. Continued. 79

PAGE 80

*H207 COX1 Mus HQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYHLRLFKDGKLKYQVLDG 261 COX1 G.gal HQFFKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFQDGKLKFQVVNG 304 COX1 Danio HQFFKTHNRVGLGFTKGLGHGVDAGHIYGDSLDRQLELRLHKDGKLKYQVLNG 259 lCOX HQFFNTDPVRGPAFTRALGHGVDLNHIYGGTLERQHQLRLFKDGKLKFQMIDG 53 COX2 Mus HQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGG 245 COX2 G.gal HQFFKTDHKKGPGFTKAYGHGVDLNHIYGETLERQLKLRLRKDGKLKYQMIDG 245 COX2 F.het HQFFKSDMKNGPAFTVAKGHGVDLGHIYGENLEKQHKLRLFKDGKLKYTMVNG 250 *R277 COX1 Mus EVYPPSVEQASVLMRYPPGVPPERQMAVGQEVFGLLPGLMLFSTIWLREHNRV 314 COX1 G.gal EVYPPSVTEVPVHMVYPPAIPKEKQLAMGQEVFGLLPGLCMYATLWLREHNRV 357 COX1 Danio DIYPPTVLHAQVKMSYPPSVPPEQQLAIGQEVFGLLPGLGMYATLWLREHNRV 312 lCOX EAYPPVVRDAPVHMVYPEHVPASLRFAVGHEVYGLLPGLLVYATVWLREHNRV 106 COX2 Mus EVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRV 298 COX2 G.gal EMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRV 298 COX2 F.het EVYPPLVKDVGVEMHYPPHVPDSQRFAVGHEAFGLVPGLLMYATIWLREHNRV 303 COX1 Mus CDLLKEEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQHLSGYFLQLKFDPEL 367 COX1 G.gal CDILKQEHPTWGDEQLFQTARLILIGETIKIVIEDYVQHLSGYFLNLKFDPEL 410 COX1 Danio CEILKQEHPTWGDEQLFQTARLIIIGETIRIVIEEYVQHLSGYRLKLHFDPTL 365 lCOX CDVLHARHPRWDDERLFQTARLILTGETMKIVIEEYVQHLSGYNFHLKFDPTL 159 COX2 Mus CDILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPEL 351 COX2 G.gal CDVLKQEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPEL 351 COX2 F.het CDVLKGVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPEL 356 *Y385/H388 *N410 COX1 Mus LFRAQFQYRNRIAMEFNHLYHWHPLMPNSFQVGSQEYSYEQFLFNTSMLVDYG 420 COX1 G.gal LFEQQFQYRNRIAVEFNQLYHWHALMPDSFTIQGQEYSYEQFLYNTSMLMDYG 463 COX1 Danio LFNSQFQYQNRISVEFNQLYHWHPLMPDSFYIDGDHIQYSKFIFNTSILTHYG 418 lCOX LFGVNFQYSNRMSLEFNHLYHWHPLMPDSLLIDGRNYSYDEFLFNPGLLADKK 212 COX2 Mus LFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHG 404 COX2 G.gal LFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHNQEYTFQQFLYNNSIMLEHG 404 COX2 F.het LFNQRFQYQNRIASEFNTLYHWHPLMPDSFHIEEKDYSYKEFVFNTSVVTEHG 409 COX1 Mus VEALVDAFSRQRAGRIGGGRNFDYHVLHVAVDVIKESREMRLQPFNEYRKRFG 473 COX1 G.gal VEALAESFSMQTAGRIGGGQNINANVLGVAVGVIEESRQLRLQPFNEYRKRFG 516 COX1 Danio LEKLVEAFSIQPAGQIGGGHNIHPVVSGVAERVIVESRELRLQPFNEYRKRFN 471 lCOX LMPLVRSFMRQRAGTVSGGRNINKNLLHVATSIIEHGRTLRLQSLNQYRHRFN 265 COX2 Mus LTQFVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFS 457 COX2 G.gal LSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEYRKRFM 457 COX2 F.het INNLVDSFSKQIAGRVAGGRNVPGPIMYVAIKSIENSRKMRYQSLNAYRKRFS 462 Figure 2-4. Amino acid alignment lCOX seque nced from the gills of the lamprey ( Petromyzon marinus ), with COX-1 and COX-2 forms fr om vertebrates (Accession # NP_032995, NP_035328, XP_425326, XP_422297, AAS21313, and NP_705942). Amino acids that share at least 60% identity across se quences are highlighte d. *Indicates amino acids (numbered based on ovine COX-1) involved in COX function: active site of COX (tyrosine-385 and histidine-388), N -glycosylation site (asparagine-410), and sites for peroxidase activity (glu tamine-203 and histidine-207) (Yang et al ., 2002; Ishikawa et al ., 2007). The black boxes indicate th e two domains that define the haem-binding sites (Ishikawa et al ., 2007). The dashed line represents the arginine277 loop region, which has been shown to differ between COX-1 and COX-2 forms in mammals (Yang et al ., 2003; Kulmacz et al ., 2003). The numbers to the right of the sequences indicate the amino acid number of each sequence. 80

PAGE 81

COX1 Mus LKPYTSFQELTGEKEMAAEL 493 COX1 G.gal LKPYTSFQELTGEEDKAAEL 536 COX1 Danio LKPYTSFAELTGEQEMSKEL 491 lCOX MRPFTSFLELTGDEAMAAEM 285 COX2 Mus LKPYTSFEELTGEKEMAAEL 477 COX2 G.gal LKPFKSFEELTGEKEMAAEL 477 COX2 F.het MKPYTSFEDLTGEKEMAAIL 482 Figure 2-4. Continued. 81

PAGE 82

++ + COX1 Mus MSRRSLSLWFPPLLLLLLPPTPSVLLADPGVPSPVNPCCYYPCQNQGVCVRFG 53 COX1 Danio MRECNFLLKWTVI--LLLSVSFCAGEESPTSSNTANPCCYYPCQNQGICVRYG 51 COX1 Ovis MSRQSISLRFPLL--LLLLSPSPVFSADPGAPAPVNPCCYYPCQHQGICVRFG 51 hCOX MTSEVFVVLCVAVVFA-GAAAAD------------DPCCGSPCENKGVCVSVG 40 COX2 Mus MLFRAVLLCAALGLSQAA-----------------NPCCSNPCQNRGECMSTG 36 COX2 F.het MNRITFAVFLLALCFSFHKEVLG------------NACCSEPCQNRGVCTAMG 41 COX2 Ovis MLARALLLCAAV-VCGAA-----------------NPCCSHPCQNRGVCMSVG 35 + +*N68 + + + + + ++ + COX1 Mus LDNYQCDCTRTGYSGPNCTIPEIWTWLRNSLRPSPSFTHFLLTHGYWLWEFVN 106 COX1 Danio LERYECDCTRTGYYGENCTIPELWTRVYRLLKPSPNVVHYILTHFDWLWDLIN 104 COX1 Ovis LDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVN 104 hCOX FEDYECDCTRTGYYGSNCTYPETWTWIVNMLKPLPDTVHYFLTHFAPFWSLVN 93 COX2 Mus FDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVN 89 COX2 F.het SDSYECDCTRTGYRGQNCTTPEFLTWIKISLKPTPNTVHYILTHFKGFWNIIN 94 COX2 Ovis FDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPDTVHYILTHFKGVWNIVN 88 + ++ + *R120+ *N144 + COX1 Mus -ATFIREVLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVP 158 COX1 Danio R-SFLRDWLMRKVLTVRANLIPSPPTYNSRYDYLNWEAYSNITYYTRILPPVP 156 COX1 Ovis -ATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVP 156 hCOX RAAFLRDRVMRHVLMSRAHMVSSPPTYNADYGYKSWEAYSNLSYFTRLLPPVP 146 COX2 Mus NIPFLRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVA 142 COX2 F.het NISFLRDAIMKYVLTSRSHMIDSPPTYNADYGYKSWEAYSNLSYYTRALPPVP 147 COX2 Ovis KISFLRNMIMRYVLTSRSHLIESPPTYNVHYSYKSWEAFSNLSYYTRALPPVP 141 Figure 2-5. Amino acid alignment of lCOX se quenced from the gills of the lamprey ( Petromyzon marinus ), with COX-1 and COX-2 form s from vertebrates (Accession # NP_032995, NP_035328, XP_425326, XP_422297, AAS21313, and NP_705942). Amino acids that share at least 60% iden tity across sequences are highlighted. *Indicates amino acids (numbered based on ovine COX-1) involved in COX function: active site of COX (tyrosine-385, histidine-388, and serine-530), substrate binding site (arginine-120), N -glycosylation sites (asparagine-68, 144, and 410), sites for peroxidase activity (glutamine-203 a nd histidine-207), and the two sites which define conformational differences in channels between COX-1 and COX-2 in mammals (arginine-513 a nd valine-523) (Yang et al ., 2002; Ishikawa et al ., 2007). +Indicates amino acids unique to hCOX. The black boxes indicate the two domains that define the haem-binding sites and the dashed box indicates the membrane binding domain (Kulmacz et al ., 2003; Ishikawa et al ., 2007). The solid lines represent disulfide bonds, with the beginni ng and end of the longest bond represented by arrows (Kulmacz et al ., 2003). The dashed line repr esents the arginine-277 loop region, which has been shown to differ between COX-1 and COX-2 forms in mammals (Yang et al ., 2003; Kulmacz et al ., 2003). The numbers to the right of the sequences indicate the amino acid number of each sequence. 82

PAGE 83

+ + + + *Q203/H207 COX1 Mus KDCPTPMGTKGKKQLPDVQLLAQQLLLRREFIPAPQGTNILFAFFAQHFTHQF 211 COX1 Danio NDCPTPMGTKGKIKLPDPKLLVEKFMLRRNFRLDPQGTNLMFAFFAQHFTHQF 209 COX1 Ovis RDCPTPMDTKGKKQLPDAEFLSRRFLLRRKFIPDPQSTNLMFAFFAQHFTHQF 209 hCOX QGCPTPMGRTGKKELPDAQKLAERFLLRRTFIPDPQGSNLLFAFFAQHFTHQF 199 COX2 Mus DDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGSNMMFAFFAQHFTHQF 195 COX2 F.het EDCPTPMGVVGKKELPDVKVLAEKLLVRRRFIPDPQGTSLMFAFFAQHFTHQF 200 COX2 Ovis DDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGTNLMFAFFAQHFTHQF 194 + COX1 Mus FKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYHLRLFKDGKLKYQVLDGEVY 264 COX1 Danio FKTHNRVGLGFTKGLGHGVDAGHIYGDSLDRQLELRLHKDGKLKYQVLNGDIY 262 COX1 Ovis FKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVY 262 hCOX FKTDFKRGPGFTKALGHGVDLSHIYGDTLDKQHKLRLHNNGKLKFQMIDGEVF 252 COX2 Mus FKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVY 248 COX2 F.het FKSDMKNGPAFTVAKGHGVDLGHIYGENLEKQHKLRLFKDGKLKYTMVNGEVY 253 COX2 Ovis FKTDIERGPAFTKGKNHGVDLSHVYGESLERQHNRRLFKDGKMKYQMINGEMY 247 + + *R277++ COX1 Mus PPSVEQASVLMRYPPGVPPERQMAVGQEVFGLLPGLMLFSTIWLREHNRVCDL 317 COX1 Danio PPTVLHAQVKMSYPPSVPPEQQLAIGQEVFGLLPGLGMYATLWLREHNRVCEI 315 COX1 Ovis PPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDL 315 hCOX PPLVSEAPVDMIYPPHVPEAARFAVGHEAFGLVPGLMLYGTLWLREHNRVCDV 305 COX2 Mus PPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDI 301 COX2 F.het PPLVKDVGVEMHYPPHVPDSQRFAVGHEAFGLVPGLLMYATIWLREHNRVCDV 306 COX2 Ovis PPTVKDTQVEMIYPPHIPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCDV 300 + COX1 Mus LKEEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQHLSGYFLQLKFDPELLFR 370 COX1 Danio LKQEHPTWGDEQLFQTARLIIIGETIRIVIEEYVQHLSGYRLKLHFDPTLLFN 368 COX1 Ovis LKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFG 368 hCOX LDVDHPEWDDERIFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPKLLFG 358 COX2 Mus LKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFN 354 COX2 F.het LKGVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFN 359 COX2 Ovis LKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFN 353 + *Y385/H388 + *N410 + ++ COX1 Mus AQFQYRNRIAMEFNHLYHWHPLMPNSFQVGSQEYSYEQFLFNTSMLVDYGVEA 423 COX1 Danio SQFQYQNRISVEFNQLYHWHPLMPDSFYIDGDHIQYSKFIFNTSILTHYGLEK 421 COX1 Ovis AQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEA 421 hCOX QPFQYSNRISVEFNHLYHWHGLNPDAFRVGTQEYQYSQFLFNNTILLNHGVRG 411 COX2 Mus QQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQ 407 COX2 F.het QRFQYQNRIASEFNTLYHWHPLMPDSFHIEEKDYSYKEFVFNTSVVTEHGINN 412 COX2 Ovis QQFQYQNRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGVTQ 406 ++ + + + ++ + + COX1 Mus LVDAFSRQRAGRIGGGRNFDYHVLHVAVDVIKESREMRLQPFNEYRKRFGLKP 476 COX1 Danio LVEAFSIQPAGQIGGGHNIHPVVSGVAERVIVESRELRLQPFNEYRKRFNLKP 474 COX1 Ovis LVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKP 474 hCOX LLEAFNVQQAGRIGGGQNIHGALLHVATASIKHGRKMRFQSLNQYRKQFGLQP 464 COX2 Mus FVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKP 460 COX2 F.het LVDSFSKQIAGRVAGGRNVPGPIMYVAIKSIENSRKMRYQSLNAYRKRFSMKP 465 COX2 Ovis FVESFTRQIAGRVAGRRNLPAAVEKVSKASLDQSREMKYQSFNEYRKRFLLKP 459 *V523 COX1 Mus YTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCQPNSIFGESMIEMGA 529 COX1 Danio YTSFAELTGEQEMSKELEELYGHIDAMEFYPALLLEKTRPGAVFGESMVEMGA 527 COX1 Ovis YTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGA 527 hCOX YQSFEQLTGETEMAADLAELYSDINAMEFYLGLMVEKPRQGALFGETMVEAGA 517 COX2 Mus YTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEKPRPDAIFGETMVELGA 513 COX2 F.het YTSFEDLTGEKEMAAILEELYGDVDAVELYPGLLVEKPRTNAIFGETMVEMGA 518 COX2 Ovis YESFEELTGEKEMAAELEALYGDIDAMELYPALLVEKPAPDAIFGETMVEAGA 512 Figure 2-5. Continued 83

PAGE 84

*S530 + + + + + COX1 Mus PFSLKGLLGNPICSPEYWKPSTFGGDVGFNLVNTASLKKLVCLNTK-TCPYVS 581 COX1 Danio PFSLKGLMGNPICSPDYWKPSTFGGKTGFDIVNSATLKKLVCLNTK-WCPYVS 579 COX1 Ovis PFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTK-TCPYVS 579 hCOX PFSLKGLMGNAICSPEYWKPSTFGGNRGFEIVNSASLRRLVCLNLQGPCPDVA 570 COX2 Mus PFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKG-CPFTS 565 COX2 F.het PFSLKGLMGNPICSPEYWKPSTFGGTAGFDIVNTASLQRLVCNNVRGPCPVAS 571 COX2 Ovis PFSLKGLMGNPICSPEYWKPSTFGGEVGFKIINTASIQSLICSNVKG-CPFTS 564 + + + ++ COX1 Mus FR-VPDYPGDDGSVLVRR-------------------STEL 602 COX1 Danio FHTPPSDYKPQRTS-----------------------HGEL 597 COX1 Ovis FH-VPDPRQEDRPGVERP-------------------PTEL 600 hCOX FH-VPRDNQQDVVVNVTGSQGGSDGVTTTPHYVADQQSREL 609 COX2 Mus FN-V-QDPQPTKTATINASASHSRLDDINPTVLIKRRSTEL 603 COX2 F.het FY-VP-DVKETGSMTINSSTSHSRDSNINPTVILKERTSEL 609 COX2 Ovis FS-V-QDAHLTKTVTINASSSHSGLDDINPTVLLKERSTEL 602 Figure 2-5. Continued 84

PAGE 85

*H207 COXa Ciona HMFFKTDPMKGMPYQWGDQLVDLSQIYGHGEKRQHELRSHVNGKLKVSLVDGH 279 COXb Ciona HQFFKTNTIKGMPFQWGEHSVDLSHVYGHTIQRQHELRSHIDGKLKVFETNGE 226 COXc HQFFKTDFKKGAGRTWGDHGVDLSHIYGETVERQHQLRSFTDGKLKFQRVEGE 53 COXd HQFFKTDFKKGPGRTWSDHAVDMSHVYGETVERQRQLRSFQDGKLKYQLVDGE 53 *R277 COXa Ciona EFPPLSNQTTANMSNINLLPQEYQFVFGHQGFSLMPTFLIWSTIWLREHNRIC 332 COXb Ciona VFPPLTESANVTMSGEKLM-RGRKFAIGHPGFGAFPSFFVIATLWLREHNRVC 279 COXc VYPPSLADAPVHMIYPPYVPEGKRFAIGHEFFGLLPGLFVYSTVWLREHNRVC 106 COXd AFPPSLQDASVHMIYPPDVPEKKRFALGHEFFGLLPGLFVWATVWLREHNRVC 106 COXa Ciona DLIKEENPAWDDERIFQTARLVLTGETIKVVIEDYVQHLSGFHYKLLYDPELV 385 COXb Ciona DILKDLHPDWDDERLFQTARLILTGETLKIIVEDYVQHVSGFHFQLSYDPEIL 332 COXc DVMKELHPDWDDERLFQTARLILTGETINIIINEYVQHLSGYNFDLFWDPELL 159 COXd DVMKDLHPDWDDERLYQTARLILISETINIVIGEYVQHLAGKNFQLFWDPELL 159 COXa Ciona QGGSHSFHNQIHVEFQL 402 COXb Ciona HKSTFSYNNQIHAEFHI 349 COXc FSDQFQYQNRIFVEFNH 176 COXd FEEQXQYQNSIFVEFNH 176 Figure 2-6. Amino acid alignment of COXc and COXd sequences from the lancelet ( Branchiostoma lancelolatum ) with COXa and COXb sequences from the sea squirt ( Ciona intestinalis ). Amino acids that share at least 60% identity across sequences are highlighted. *Indicates the amino acid (numbered based on ovine COX-1) involved in peroxidase ac tivity (histidine-207) (Yang et al ., 2002; Ishikawa et al ., 2007). The black boxes indicate the two domains that define the haem-binding sites (Ishikawa et al ., 2007). The dashed line repres ents the arginine-277 loop region, which has been shown to differ between COX-1 and COX-2 forms in mammals (Yang et al ., 2003; Kulmacz et al ., 2003). The numbers to the right of the sequences indicate the amino acid number of each sequence. 85

PAGE 86

86

PAGE 87

Figure 2-7. Evolutionary hist ory of COX sequences inferred using the minimum evolution method with a distance optimality criterion. The optimal tree with the sum of branch length = 6.63322594 is shown. The percentage of replicate trees in which the associated taxa clustered toge ther in the bootstrap test ( 1000 replicates) is shown next to the branches (Felsenstein, 1985). The tree is drawn to scale, with branch lengths in the same units as those of the evolutiona ry distances used to infer the phylogenetic tree. The evolutionary distances were co mputed using the JTT matrix-based method (Jones et al ., 1992) and are in the units of the number of amino acid substitutions per site (scale bar = 0.05 amino acid substitutions per site). The rate variation among sites was modeled with a gamma distribution (s hape parameter = 0.737). The ME tree was searched using the Close-Neighbor-Interchange (CNI) algorithm at a search level of 1. The Neighbor-Joining algorithm was used to generate the initial tree. All positions containing gaps and missing data were eliminated from the dataset (Complete deletion option). There were a total of 147 pos itions in the final dataset. Phylogenetic analyses were conducted in MEGA4 (Tamura et al ., 2007). Sequences enclosed in a box are novel and reported here for the first time. 87

PAGE 88

COX1b Gasterosteus COX1b Myoxocephalus COX1b Oryzias COX1b Fundulus COX1b Tetraodon COX1 Oncorhynchus COX1 Danio COX1a Tetraodon COX1a Fundulus COX1a Oryzias COX1a Gasterosteus COX1a Myoxocephalus COX1 Mus COX1 Rattus COX1 Bos COX1 Ovis COX1 Oryctolagus COX1 Homo COX1 Canis COX1 Gallus COX1 Monodelphis COX1b Monodelphis COX1b2 Monodelphis COX1 Xenopus COX2 Gasterosteus COX2 Myoxocephalus COX2b Oncorhynchus COX2 Oryzias COX2 Fundulus COX2 Tetraodon COX2b Danio COX2a Danio COX2a Oncorhynchus COX2 Xenopus COX2 Bos COX2 Ovis COX2 Gallus COX2 Homo COX2 Mus COX2 Rattus COX2 Monodelphis COX2 Canis COX2 Oryctolagus sCOX Squalus COXc Branchiostoma COXd Branchiostoma COXa Ciona COXb Ciona 100 99 94 71 57 80 44 61 99 62 86 87 34 51 92 98 85 37 99 71 60 26 32 35 91 93 52 82 43 39 41 34 40 70 26 77 94 83 39 20 32 38 41 38 13 0.1 88

PAGE 89

Figure 2-8. Evolutionary hist ory of COX sequences excluding hagfish (hCOX) and lamprey (lCOX) sequences inferred using the mi nimum evolution method with a distance optimality criterion. The optimal tree with the sum of branch length = 6.18990857 is shown. The percentage of replicate trees in which the associated taxa clustered together in the bootstrap te st (1000 replicates) is show n next to the branches (Felsenstein, 1985). The tree is drawn to scale, with branch lengths in the same units as those of the evolutionary distances used to infer the phylogenetic tree. The evolutionary distances were computed using the JTT matrix-based method (Jones et al ., 1992) and are in the units of the number of amino acid substitutions per site (scale bar = 0.1 amino acid substitutions per site ). The rate variation among sites was modeled with a gamma distribution (sha pe parameter = 0.742). The ME tree was searched using the Close-Neighbor-Interchange (CNI) algorithm at a search level of 1. The Neighbor-Joining algorithm was used to generate the initial tree. All positions containing gaps and missing data were eliminated from the dataset (Complete deletion option). There were a total of 147 pos itions in the final dataset. Phylogenetic analyses were conducted in MEGA4 (Tamura et al ., 2007). 89

PAGE 90

Figure 2-9. Evolutionary hi story of COX sequences infe rred using a maximum liklihood optimality criterion. The most likely tree with an Ln L score = -25294.222410 is shown. The number of replicate trees in wh ich the associated taxa clustered together in the bootstrap test (1000 replicates) is shown next to the branches (Felsenstein, 1985). The tree is drawn to scale, with branch lengths in the same units as those of the evolutionary distances used to infer the phylogenetic tree. The evolutionary distances were computed using the WAG matrix-b ased method (Whelan and Goldman, 2001) and are in the units of the number of ami no acid substitutions per site (scale bar = 0.1 amino acid substitutions per site). The rate variation among sites was modeled with a gamma distribution (shape parameter estimated = 0.737). Phylogenetic analyses were conducted using PhyML (Guindon and Gascue l, 2003). Sequences enclosed in a rectangle are novel and reported here for the first time. 90

PAGE 91

91

PAGE 92

Figure 2-10. Evolutionary history of COX se quences excluding sequences from the hagfish (hCOX) and lamprey (lCOX) inferred using a maximum liklihood optimality criterion. The most likely tree with an Ln L score = -24242.30059 is shown. The number of replicate trees in which the a ssociated taxa clustered together in the bootstrap test (1000 replicates) is shown next to the branches (Felsenstein, 1985). The tree is drawn to scale, with branch lengths in the sa me units as those of the evolutionary distances used to infer the phylogenetic tree. The evolutionary distances were computed using the WAG matrix-b ased method (Whelan and Goldman, 2001) and are in the units of the number of ami no acid substitutions per site (scale bar = 0.1 amino acid substitutions per site). The rate variation among sites was modeled with a gamma distribution (shape parameter estimated = 0.742). Phylogenetic analyses were conducted using PhyML (Guindon and Ga scuel, 2003). Sequence names are abbreviated from Figure 2-9. 92

PAGE 93

93

PAGE 94

Figure 2-11. Alternate likelihood ra tio test (aLRT) scores for bran ch support of COX sequences. The most likely tree is shown and the topology, branch lengths, and model of evolution are the same as in Figure 2-9. Scores represent the gain in likelihood when collapsing a particular branch and are inde pendent of bootstrap sc ores (Felsenstein, 1985). Scores were interpreted using a c onservative estimate of the minimum of parametric chi-squared and non-parametric Shimodaira-Hasegawa-like (SH) support value interpretations (Anisimova and Gascue l, 2006). Analysis was performed using PhyML (Guindon and Gascuel, 2003). Support va lues of interest to the present study are enclosed in boxes. 94

PAGE 95

95

PAGE 96

Figure 2-12. Alternate likelihood ra tio test (aLRT) scores for br anch support of COX sequences excluding hagfish (hCOX) and lamprey (lCOX) sequences. The most likely tree is shown and the topology, branch lengths, and model of evolution are the same as in Figure 2-11. Scores represent the gain in likelihood when collapsing a particular branch and are independent of bootstrap sc ores (Felsenstein, 1985). Scores were interpreted using a conservative estimate of the minimum of parametric chi-squared and non-parametric Shimodaira-Hasegawa-l ike (SH) support valu e interpretations (Anisimova and Gascuel, 2006). Analys is was performed using PhyML (Guindon and Gascuel, 2003). Support values of intere st to the present study are enclosed in boxes. 96

PAGE 97

Figure 2-13. Evolutionary history of COX se quences inferred using a Bayesian optimality criterion. The consensus tree is shown. The posterior probabilities (10 million generations) are shown next to the branches. Trees were sampled every 500 generations with a burnin of 10% (401 trees). The tree is dr awn to scale, with branch lengths in the same units as those of the evolutionary distances used to infer the phylogenetic tree. The evolutionary distances were computed using the WAG matrixbased method (Whelan and Goldman, 2001) and are in the units of the number of amino acid substitutions per site (scale bar = 0.1 amino acid substitutions per site). The rate variation among sites was mode led with a gamma distribution (shape parameter estimated = 0.672275). Phylogene tic analyses were conducted using MrBayes 3.1.2. Sequences enclosed in a re ctangle are novel and reported here for the first time. 97

PAGE 98

98

PAGE 99

Figure 2-14. The evolutionary history of COX sequences excluding hagfish (hCOX) and lamprey (lCOX) sequences inferred using a Bayesian optimality criterion. The consensus tree is shown. The posterior probabilities (10 million generations) are shown next to the branches. Trees were sampled every 500 generations with a burnin of 10% (401 trees). The tree is drawn to scal e, with branch lengths in the same units as those of the evolutionary distances used to infer the phylogenetic tree. The evolutionary distances were computed using the WAG matrix-based method (Whelan and Goldman, 2001) and are in the units of the number of amino acid substitutions per site (scale bar = 0.1 amino acid substitutio ns per site). The rate variation among sites was modeled with a gamma distri bution (shape parameter estimated = 0.667978). Phylogenetic analyses were conducted using MrBayes 3.1.2. 99

PAGE 100

a) b) c) d) Figure 2-15. The 21 alternate tr ee topologies generated to test the effects of relocating the hagfish (hCOX) and lamprey (lCOX) sequences on the likelihood score (Ln L ). Each topology is simplified, but all relationships remain the same as in the most likely topology (Figure 2-9) with the exception of hCOX and lCOX. Each topology was generated using TreeView1.6.6 based on the most likely topology. Ln L was calculated for each topology online using PhyML (Guindon et al ., 2005), branch lengths and model parameters were estimate d. The topologies are named in Table 2-9 as follows (from most to least likely) : a) COX2 Hag (most likely) b) COX1 Lamp/COX2 Hag c) COX2 Agnatha d) Lamp/Amp e) COX2 Vert f) COX1 Hag g) COX1 Vert h) Ancestral Hag i) COX1 Agnatha j) COX1 Hag/COX2 Lamp k) Ancestral Agnatha l) COX1 Lamp m) COX2 Lamp n) Agntha/Amp o) Hag/Amp p) Hag Internal q) Lamp Internal r) Lamp Mammal s) Lamp Teleost t) Hag Teleost u) Hag Mammal. 100

PAGE 101

e) f) g) h) i) j) Figure 2-15. Continued. 101

PAGE 102

k) l) m) n) o) 2 p) Figure 2-15. Continued. 102

PAGE 103

q) r) s) t) u) Figure 2-15. Continued. 103

PAGE 104

104 Figure 2-16. Unrooted phylogeny showing the mo st likely scenario for COX evolution in the chordates based on several other analyses. Clades of interest are highlighted on the right and sequences that repr esent unclear placements are highlighted in red boxes.

PAGE 105

CHAPTER 3 SUMMARY AND FUTURE DIRECTIONS Summary This thesis is the first attempt to charact erize the evolution of the enzyme cyclooxygenase in the phylum chordata. Traditional molecular protocols such as clon ing and polymerase chain reactions were used to search for cyclooxygenase sequences in a wide ra nge of evolutionarily key chordates. Using these novel sequences an d pre-existing sequences from GenBank and genomic databases, phylogenetic analyses were pe rformed to reveal the identity of the novel sequences and create the most lik ely scenario for the evolutiona ry history of cyclooxygenase in the chordates. Novel COX Sequences Chapter 2 describes the process of obtai ning and characterizing novel cyclooxygenase (COX) sequences in amphioxus ( Branchiostoma lancelolatum ), the Atlantic hagfish (Myxine glutinosa ), the sea lamprey ( Petromyzon marinus ), the euryhaline killifish ( Fundulus heteroclitus ), and the longhorn sculpin ( Myoxocephalus octodecemspinosus ). Total RNA was isolated and reverse transcribed from gill tis sue (or whole animals in amphioxus) and the resulting cDNA was exposed to PCR in the presence of degenerate and/or sp ecific primers. The products were then visualized and cloned. The resulting plasmids were sequenced at the Marine DNA Sequencing Center at the MDIBL. Complete amino acid sequences of putative COX proteins from the hagfish, killifish, and scul pin and incomplete amino acid sequences from amphioxus and the lamprey were predicted based on the sequences found. These putative amino acid sequences were aligned w ith known COX protein sequen ces and conserved domains, regions, and residues critical to COX function were describe d. Based on the novel sequences identity to known COX forms and phylogenetic an alyses (see below), it was concluded that 105

PAGE 106

COX-1a, COX-1b, and COX-2 are found in the sculpin; COX-1a and COX-1b are found in the killifish; a new COX form named lCOX is found in the lamprey; a new COX form named hCOX is found in the hagfish; and two ancestra l forms named COXc and COXd are found in amphioxus. Phylogenetic Analyses Chapter 2 also describes the phylogenetic analyses used to reconstr uct the evolutionary history of cyclooxygenase in the chordates. The nine novel COX protein sequences described here, as well as 41 additional COX protein sequences from GenBank and genomic databases, were subjected to phylogenetic analyses using three optimality criteria: minimum evolution/distance, maximum likelihood, and Baye sian phylogenetics. In each analysis, two clades were well-supported in the gnathostomes: a COX-1 clade and a COX-2 clade. Each of these clades contained a well suppor ted teleost and tetrapod clade. In the teleost clades, clades for COX-1a, COX-1b, COX-2a, and COX-2b were well-supported, confirming the findings of Ishikawa et al (2007) and Ishikawa and Herschman (2007). The placement of the more evolutionarily ancestral chordates was ultim ately uncertain, although it appears that the urochordates, cephalochordates, and vertebrate s (containing COX-1 and COX-2) each represent an independent origin of COX proteins. Th e hagfish and lamprey sequences most likely represent basal members of the COX-2 and COX-1 clades of vertebrates, respectively; however, these forms may belong closer to the root of the tree. Future Directions Although here I report 9 novel cyclooxygena se (COX) sequences from a range of chordates and present a likely scenario for the ev olution of this gene family in the chordates, many questions remain regarding COX evolution a nd function in the chordates. These include determining the true history of C OX evolution in the earliest chor dates, pinpointing the origin of 106

PAGE 107

COX-1 and COX-2, and investigating the history of COX duplication and loss in the teleosts. Finally, the physiological function of COX in the earliest chordate s has only been preliminarily investigated. Completion of novel sequences Several of the novel sequences documented here could not be completed despite multiple efforts using many primer sets and PCR techniqu es. Notably, only 532 bp were obtained of the sequences from amphioxus (COXc and COXd). Co mpared to the complete open reading frame of COX transcripts in other chordates (rangi ng from about 1700-2500 bp), this indicates that about 75% of these sequences remain unknown. Completing the rest of these sequences or thoroughly searching the recently complete genome of Branchiostoma floridae may yield putative proteins that provide novel groupings in phylogenetic analyses. Based on the available sequence data, however, COXc and COXd are we ll-supported as being n ear the base of the chordate COX lineage, sister to the vertebra te COX-1 and COX-2 clade. The lCOX sequence obtained from the lamprey is also only about 40% complete. Completing the open-reading frame of this putative protein or searching genomic data bases could possibly give a more definite view of its identity as this sequ ence groups with different clad es depending on the phylogenetic analysis used. In actuality, th e short size of lCOX compared to the other COX sequences used in the phylogenetic analyses may have contributed to its tendency to a ppear in different clades in different analyses. Finally, the COX-1a sequen ce obtained from the sculpin may warrant further investigation and reaffirmation via additional sequencing since many residues critical to COX function are missing. Additional Phylogenetic Analysis Unfortunately, the evolutionary relationship of the COX proteins in the chordates was not able to be unequivocally resolved, despite the use of three different phylogenetic approaches. 107

PAGE 108

This may be due to the incompleteness of some sequences and a lack of sufficient sampling across taxa or may represent a hi story that is irresolvable und er the current circumstances. However, the phylogenetic techniques used here may also be improved upon in future analyses. Phylogenetically uninformative areas of the se quences (such as near the C and N terminus, which show little homology across sequences) could be removed. Here, protein sequences were used to gain insight into the e volution of COX functionality, but in sights could also be gained by performing similar analyses using DNA sequence data instead of using their inferred protein amino acid sequences. This would allow for gr eater complexity of models to estimate substitution rates and could take additional f actors into account such as codon bias. Using nucleotide versus amino acid would also enable additional search strategies and phylogenetic programs to be used. Choosing the optimum search strategy and computer program may be critical in finding the optimum evolutionary r econstruction. For example, maximum likelihood analyses PhyML (the program used in this study) may find suboptimal likelihood scores when the data-set contains little phylogenetic information (Morrison, 2007). However, programs such as RAxML (Stamatakis, 2006), GARLI (Brauer et al ., 2002), and PAUP* (Rogers and Swafford, 1998) may perform better under the same circum stances (Morrison, 2007). Also, evaluating alternative tree topolog ies using frameworks other th an maximum likelihood may yield alternative results. Additional Sequences Based on the most likely scenario of COX evol ution in the chordates, there are several COX sequences in the chordates examined in this study that remain to be characterized. If hCOX in actuality represents a basal form of CO X-2, then there should also be a COX-1 form in the hagfish. Similarly, if lCOX and sCOX repres ent basal forms of COX-1 in the lamprey and dogfish, then they should also contain versions of COX-2. These additional forms of COX may 108

PAGE 109

be harder to clone and sequence due to accumulated mutations over evolutionary time, which would render the sequences unidentifiable and possi bly non-functional. However, this is not the case in the other vertebrates, as COX-1 and COX2 seem to each have critical functionality. Using Southern blotting techniqu es (Southern, 1975) to identify COX DNA sequences in the DNA of hagfish, lamprey, and dogfish could immedi ately reveal the pres ence of two forms of COX in these animals. If two forms are present, it could be concluded that they likely represent COX-1 and COX-2 forms, and thus the origin of these forms would coincide with the vertebrate lineage (as predicted in the current phylogenetic an alysis). However, if only one form of COX was found the results would suggest a more recent origin of COX-1 and COX-2. This technique could be applied to a wide diversity of chordates to determine how many COX variants they contain. Additional Taxa In this study, a comparativ e evolutionary approach was taken by sampling a wide range of chordates, most of which had no previous record of COX gene s. However, there are still many evolutionarily interesting c hordates that have not been ex amined for COX genes. While COX genes are known from multiple mammals and teleosts, other chordate groups have only been minimally sampled. Most notably is the l ack of any reported COX genes from any reptile. COX has also only been documente d from a single avian species ( Gallus gallus), a single elasmobranch species ( Squalus acanthias ), and a single marsupial ( Monodelphis domestica ). These groups represent major lin eages within the vertebrates and may contain novel forms of COX. The results of this and other recent studies also warran t further investigation within certain chordate groups. For example, evolutio narily ancestral fishes such as the sturgeon, paddlefish, and bowfin could likely contain a single COX-1 and C OX-2 gene, while the teleosts studied here have multiple COX-1 or COX2 genes. Ishikawa and Herschman (2007) 109

PAGE 110

hypothesize that a genome duplication in the tele ost lineage and subsequent loss of either a COX-1 (in the zebrafish/trout lineage) or COX2 gene (in the acanthopterygian lineage) is responsible for this observation. If this is the case, then examining taxa near the base of the teleost lineage may reveal fish with all four variants of COX (COX-1a, COX-1b, COX-2a, and COX-2b). The COX variants from the dogfish shark, lamprey, and hagfish all group weakly with either COX-1 or COX-2. Obtaining C OX sequences from other species of hagfish, lampreys, and elasmobranchs may confirm this in itial relationship or reveal novel groupings. Finally, although support values for the urochorda ta and cephalochordata clades are strong regardless of the phylogenetic technique use d, only one species from each subphylum was included in phylogenetic analyses. Including more species could gi ve a more complete view of COX evolution in the evolutionarily ancestral ch ordates. COX sequences from these additional taxa may be readily available in the near fu ture due to the growing regularity of genome sequencing across many taxa. For example, the recently completed Anolis carolinensis genome contains COX-1 and COX-2 genes. However, due to the length of time required for whole genome projects, the limited number of genomes available, and the difficulty of searching recently completed, non-annotated genomes, studi es that specifically target sequencing COX genes in these taxa are needed. Function of Cyclooxygenases As reviewed in Chapter 1, cyclooxygenase play s several roles in chordates because of its role in prostaglandin production. These functions have been examined in some detail in the mammals and to a lesser degree in the fishes. Ho wever, no studies have examined the functions of the novel COX forms presented here or any no n-vertebrate COX forms in the chordates. Therefore, I have begun preliminary st udies investigating the function of these COX forms. 110

PAGE 111

One preliminary method used to infer possible functions for a gene is to determine where its mRNA transcript or protei n product is expressed in the organism. For example, Choe et al (2006) concluded that COX-2 may play a role in os moregulation in the killif ish partly due to its high level of expression in the gills and its pr esence within mitochondrio n-rich cells. Following similar procedures, I have found that COX-1b mRNA is also expressed highly in the gills of the killifish (Fig. 3-1a). Similar results were also found for COX-1a and COX-2 in the sculpin (Fig. 3-2a, Fig. 3-2b), hCOX in the hagfish (Fig. 3-3a ), and lCOX in the lamprey (Fig. 3-4). To investigate which cells express COX mRNA transcripts, in situ hybridization (ISH) was performed using probes designed against the novel COX sequences described here using previous protocols (Choe et al ., 2006). However, no staining wa s observed for COX transcripts in the gills of the killifish (Fig. 3-1b) or sculpin (Fig. 32b). This is likely due to errors in probe design or hybridization protocol, since COX mRNA was abundant in the gills of both the killifish and sculpin. In the hagfish, probes designed to show hCOX mRNA expression did produce staining patterns in a population of epith elial cells lining gill filaments and lamellae (Fig. 3-3b). This gill structure is similar to those of teleosts but may be functionally different (Evans et al ., 2005) and since ion transport mechanisms in hagfish may not be directly related to those in teleosts (Choe et al ., 1999), it is difficult to assign an osmoregulatory function of hCOX based on this staining pattern. Finally, since COX-2 mRNA expression was shown to increase following salinity transfers using qPCR (Choe et al ., 2006), a similar procedure was used to investigate COX expression after sa linity acclimation in the gills of the killifish (Fig. 3-1c) and sculpin (Fig. 3-2c). The only significant result from this e xperiment was that COX-1b was expressed more abundantly in killifish chronica lly acclimated to fresh water than seawater. However, the same general trend show n for COX-2 in the killifish (Choe et al ., 2006) was also 111

PAGE 112

shown for COX-1b in the killifish: an increase in expression 3 hours af ter salinity transfer (although P = 0.06 in this case) and a return to pr e-transfer expression le vels by 8 hours after transfer. Taken as a whole, these preliminary results suggest that the different COX forms may be playing various roles in osmoregulation in th e killifish, sculpin, lamprey, and hagfish. Clearly, COX function in the non-mammalian chor dates has just begun to be investigated and many questions still remain. Future studies may investigate COX roles in these chordates by examining protein expression patterns usi ng immunohistochemistry, blocking COX function via commercially available COX i nhibitors, or examining COX expression during reproductive events. Of particular interest are the differential roles of the va rious COX forms in the teleosts and the possible partitioning of functionality between COX-1a and COX-1b or COX-2a and COX-2b. 112

PAGE 113

GOB HS I K COX 1b A) B) C) 18S Figure 3-1. Euryhaline killifish ( Fundulus heteroclitus ) COX-1b mRNA expression following procedures outlined in Choe et al (2006). A) COX-1b mRNA expression in various tissues in the killifish. Expression was constant across tissues for the ribosomal protein 18S. COX-1b expression was most abundant in the gills (labeled as G), followed by the heart (H), kidney (K), ope rcular epithelium (O), stomach (S), intestine (I), and brain (B). B) In situ hybridization of COX-1b in the gills of the killifish. C) Expression of COX-1b mRNA in the gills of the killifish following salinity transfers. Expression is normalized to the ribosomal gene L8 and is shown relative to seawater (SW) (FW = fresh water). 113

PAGE 114

GO B H SI K GO B H SIK COX-2 18S COX-1a 18S COX-1a COX-2 0.0 0.5 1.0 1.5 2.0 2.5 3.0 3.5 4.0 24 hrs 72 hrs TimeExpression 0.0 0.2 0.4 0.6 0.8 1.0 1.2 1.4 1.6 24 hrs 72 hrs TimeExpression Figure 3-2. Longhorn sculpin (Myoxocephalus octodecemspinosus ) COX-1a and COX-2 mRNA expression following procedures outlined in Choe et al (2006). A) COX-1a and COX-2 mRNA expression in various tissues in the sculpin. Expr ession was constant across tissues for the ribosomal protein 18S. COX-1a was most abundant in the opercular epithelium (labeled as O), followe d by the gills (G), ki dney (K), heart (H), brain (B), intestine (I), a nd stomach (S). COX-2 was most abundant in the gills, followed by the opercular epithelium, and kidney. B) In situ hybridization of COX1b and COX-2 in the gills of the sculpin. C) Expression of COX-1b and COX-2 mRNA in the gills of the sculpin after 24 and 72 hours following salinity transfers to 100% and 20% seawater. Expression is normalized to the ribosomal gene L8. Seawater 20% Seawater A) B) C) COX-1a COX-2 114

PAGE 115

GMBH S I K hCOX 18S A) B) Antisense Antisense Sense Sense Figure 3-3. Atlantic hagfish ( Myxine glutinosa ) COX (hCOX) mRNA expression following procedures outlined in Choe et al (2006). A) COX mRNA expression in various tissues in the hagfish. Expression was c onstant across tissues for the ribosomal protein 18S. COX (hCOX) expres sion was most abundant in the gills (labeled as G), followed by the heart (H), kidney (K), stomach (S), intestine (I), muscle (M), and brain (B). B) In situ hybridization of hCOX in the gills of the hagfish from two contrary gill cross-sectio ns. Arrows highlight staining, indicating hCOX mRNA expression. Staining for antisense and sense (control) probes is shown. 115

PAGE 116

116 GM BH S I K lCOX 18S Figure 3-4. Sea lamprey ( Petromyzon marinus ) COX (lCOX) mRNA ex pression in various tissues following procedures outlined in Choe et al. (2006). Expr ession was constant across tissues for the ribosomal protei n 18S. COX (lCOX) expression was most abundant in the heart (labeled as H), follo wed by the intestine (I), stomach (S), gills (G), kidney (K), muscle (M), and brain (B)

PAGE 117

LIST OF REFERENCES Abbasi, A. A. and Grzeschik, K. H. (2007). An insight into th e phylogenetic history of HOX linked gene families in vertebrates. BMC Evol. Biol. 7, 239. Allegaert, K., Rayyan, M., and Anderson, B.J. (2006). Impact of ibuprofen administration on renal drug clearance in the first weeks of life. Methods Find. Exp. Clin. Pharmacol. 28, 519-522. Anisimova, M. and Gascuel, O. (2006). Approximate likelihood-ra tio test for branches: A fast, accurate, and powerful alternative. Syst. Biol. 55, 539-552. Arruda, J. A. (1982). Interaction of calcium and cycl ooxygenase inhibitors on transport by the turtle and toad bladders. Arch. Int. Pharmacodyn. Ther. 257, 319-334. Balaji, T., Ramanathan, M., and Menon, V. P. (2007). Localization of cyclooxygenase-2 in mice vas deferens and its effects on fert ility upon suppression using nimesulide: a preferential cyclooxygenase-2 inhibitor. Toxicology. 234, 135-144. Beiche, F., Scheuerer, S., Brune, K., Ge isslinger, G., and Goppelt-Struebe, M. (1996). Upregulation of cyclooxygenase-2 mRNA in the rat spinal cord following peripheral inflammation. FEBS Lett. 390, 165-169. Bicego, K. C., Steiner, A. A., Ant unes-Rodrigues, J., and Branco, L. G. (2002). Indomethacin impairs LPS-induced behavioral fever in toads. J. Appl. Physiol. 93, 512-516. Buonocore, F., Forlenza, M., Randelli, E., Bene detti, S., Boss, P., Meloni, S., Secombes, C. J., Mazzini, M. and Scapigliati, G. (2005). Biological act ivity of sea bass ( Dicentrarchus labrax L.) recombinant interleukin-1beta. Mar. Biotechnol. (NY). 7, 609617. Brauer, M. J., Holder, M. T., Dries, L. A., Zwickl, D. A., Lewis, P. O., and Hillis, D. M. (2002). Genetic algorithms and parallel pr ocessing in maximum-likelihood phylogeny inference. Mol. Biol. Evol. 19, 1717-1726. Breder, C. D., Dewitt, D., and Kraig, R. P. (1995). Characterization of inducible cyclooxygenase in rat brain. J. Comp. Neurol. 355, 296-315. Breder, C. D. and Saper, C. B. (1996). Expression of inducible cyclooxygenase mRNA in the mouse brain after systemic administ ration of bacterial lipopolysaccharide. Brain Res. 713, 64-69. Brubacher, J. L ., Secombes, C. J ., Zou, J ., and Bols, N. C (2000). Constitutive and LPSinduced gene expression in a macrophage-like cell line from the rainbow trout ( Oncorhynchus mykiss). Dev. Comp. Immunol. 24, 565-574. 117

PAGE 118

Cao, C., Matsumura, K., Yamagata, K., and Watanabe, Y. (1996). Endothelial cells of the brain vasculature express cyclooxygenase-2 mR NA in response to systemic interleukin-1: a possible site of prostaglandin synthesis responsible for fever. Brain Res. 733, 263-272. Carrasquer, G and Li, M (2002). Effect of ibuprofen and ro fecoxib transport parameters in the frog corneal epithelium. J. Membr. Biol. 190 127-132. Censarek, P., Freidel, K., Hohlfeld T., Schrr, K. and Weber, A. A. (2006). Human cyclooxygenase-1b is not the el usive target of acetaminophen. Eur. J. Pharmacol. 551, 50-53. Cha, Y. I., Kim, S. H., SolnicaKrezel, L., and Dubois, R. N. (2005). Cyclooxygenase1 signaling is required for vascular tube formation during development. Dev. Biol. 282, 274-283. Cha, Y. I., Solnica-Krezel, L., and DuBois, R. N. (2006a). Fishing for prostanoids: deciphering the developmental f unctions of cyclooxygenase-derived prostaglandins. Dev. Biol. 289, 263-272. Cha, Y. I., Kim, S. H., Sepich, D., Buchanan, F. G., Solnica-Krezel, L., and DuBois, R. N. (2006b). Cyclooxygenase-1-derived PGE2 pr omotes cell motility via the G-proteincoupled EP4 receptor during vertebrate gastrulation. Genes Dev. 20, 77-86. Challis, J. R., Sloboda, D. M., Alfaidy, N., Lye, S. J., Gibb, W., Patel, F. A., Whittle, W. L. and Newnham, J. P. (2002). Prostaglandins and m echanisms of preterm birth. Reproduction. 124, 1-17. Chakraborty, I., Das, S. K.,Wang, J., and Dey, S. K. (1996). Developmental expression of the cyclo-oxygenase-1 and cyclooxygenase-2 genes in the peri -implantation mouse uterus and their differential regulation by th e blastocyst and ovarian steroids. J. Mol. Endocrinol. 16, 107 Choe, K. P., Edwards, S., Morrison-Shetlar A. I., Toop, T., and Claiborne, J. B. (1999). Immunolocalization of Na+/K(+)-ATPase in mitochondrion-rich cells of the atlantic hagfish ( Myxine glutinosa ) gill. Comp. Biochem. Physiol. 124, 161-168. Choe, K. P., Havird, J., Rose, R., Hyndman K., Piermarini, P. and Evans, D. H. (2006). COX2 in a euryhaline teleost, Fundulus heteroclitus : primary sequence, distribution, localization, and potential function in gills during salinity acclimation. J. Exp. Biol. 209 1696-1708. Cohn, S. M., Schloemann, S., Tessner, T., Seibert, K., and Stenson, W. F. (1997). Crypt stem cell survival in the mouse intestinal epitheliu m is regulated by prostaglandins synthesized through cyclooxygenase-1. J. Clin. Invest. 99, 1367-1379. 118

PAGE 119

Diao, H. L., Zhu, H., Ma, H., Tan, H. N., Cong, J., Su, R. W., and Yang, Z. M. (2007). Rat ovulation, implantation and decidualizati on are severely compromised by COX-2 inhibitors. Front. Biosci. 12, 3333-3342. Crollius, H. R. and Wessenbach, J. (2005). Fish genomics and biology. Genome Res. 15, 1675-1682. Cummings, M. P., Handley, S. A., Myers, D. S., Reed, D. L., Rokas, A., and Winka, K. (2003). Comparing bootstrap and posterior pr obability values in the four-taxon case. Syst. Biol. 52, 477-487. DeWitt, D. L. and Smith, W. L. (1988). Primary structure of pros taglandin G/H synthase from sheep vesicular gland determined from the complementary DNA sequence. Proc. Natl. Acad. Sci. USA. 85, 1412-1416. Escalante, B. A., Ferreri, N. R., Dunn, C. E., and McGiff, J. C. (1994). Cytokines affect ion transport in primary cultured thick ascending limb of Henle's loop cells. Am. J. Physiol. 266, C1568-1576. Evans, D. H., Rose, R. E., Roeser, J. M. and Stidham, J. D. (2004). NaCl transport across the opercular epithelium of Fundulus heteroclitus is inhibited by an endothelin to NO, superoxide, and prostanoid signaling axis. Am. J. Physiol. 286 R560-R568. Evans, D. H., Piermarini, P. M. and Choe, K. P. (2005). The multifunctional fish gill: dominant site of gas exchange, osmoregul ation, acid-base regulation, and excretion of nitrogenous waste. Physiol. Rev. 85, 97-177. Felsenstein, J. (1985). Confidence limits on phylogenies : An approach using the bootstrap. Evolution. 39 783-791. Ferreri, N. R., Schwartzman, M., Ibraham, N. G., Chander, P. N., and McGiff, J. C. (1984). Arachidonic acid metabolism in a cell suspen sion isolated from rabbit renal outer medulla. J. Pharmacol. Exp. Ther. 231, 441-448. Ferreri, N. R., An, S. J., and McGiff, J. C. (1999). Cyclooxygenase-2 expression and function in the medullary thick ascending limb. Am. J. Physiol. 277, F360-368. Ferreira, S. H. (1972). Prostaglandins, aspiri n-like drugs and hyperalgesia. Nature 240 200203. Flippin, J. L., Huggett, D., and Foran, C. M. (2007). Changes in the timing of reproduction following chronic exposure to ibuprofen in Japanese medaka, Oryzias latipes Aquat. Toxicol. 81, 73-78. 119

PAGE 120

Flower, R. J. and Vane, J. R. (1972). Inhibition of prostaglandin synthetase in brain explains the anti-pyretic activity of paracetamol (4-acetamidophenol). Nature 240, 410-411. F rster, W. and Parratt, J. R. (1996). The case for low-dose aspirin for the prevention of myocardial infarction: But how low is low? Cardiovasc. Drugs Ther. 10, 727-734. Funk, C. D. (2001). Prostaglandins and leukotrienes : advances in eicosanoid biology. Science 294, 1871-1875. Furlan, R. L., Macari, M., Malheiros, E. B., Secato, E. R., and Guerreiro, J. R. (1998). Effect of indomethacin on hyperthermia induced by heat stress in broiler chickens. Int. J. Biometeorol. 42, 73-76. Gardiner, N. J., Giblett, S., and Grubb, B. D. (1997). Cyclooxygenases in rat spinal cord: selective induction of COX2 during peripheral inflammation. Br. J. Pharmacol. 120, 71P. Gibb, W. and Sun, M. (1996). Localization of prostaglandi n H synthase type 2 protein and mRNA in term human fetal membranes and decidua. J. Endocrinol. 150, 497-503. Gierse, J. K., McDonald, J. J., Hauser, S. D., Rangwala, S. H., Koboldt, C. M. and Seibert, K. (1996). A single amino acid differen ce between cyclooxygenase-1 (COX-1) and -2 (COX-2) reverses the select ivity of COX-2 specific inhibitors. J. Biol. Chem. 271, 15810-15814. Gobbetti, A. and Zerani, M. (2002). Pituitary adenylate cyclase-activating polypeptide induces testicular testoste rone synthesis through PGE(2) mediation in crested newt, Triturus carnifex. J. Exp. Zool. 293, 73-80. Goetz, F. W., Duman, P., Ranjan, M. and Herman, C. A. (1989). Prostaglandin F and E synthesis by specific tissue components of the brook trout ( Salvelinus fontinalis ) ovary. J. Exp. Zool. 250, 196-205. Goetz, F. W., Hsu, S.-Y. and Selover, A. (1991). Stimulation of prostagl andin synthesis in fish follicles by a phorbol ester and calcium ionophore. J. Exp. Zool. 259, 355-364. Goudet, G., Mugnier, S., Callebaut, I., and Monget, P. (2007). Phylogenetic analysis and identification of pseudogenes reveal a progressive loss of zona pellucida genes during evolution of vertebrates. Biol. Reprod. Epub. Ahead of Print. Griswold, D. E. and Adams, J. L. (1996). Constitutive cyclooxygenase (COX-1) and inducible cyclooxygenase (COX-2): rationale for selective inhibition and progress to date. Med. Res. Rev. 16 181-206. 120

PAGE 121

Grosser, T., Yusuff, S., Cheskis, E., Pack, M. A. and FitzGerald, G. A. (2002). Developmental expression of func tional cyclooxygenases in zebrafish. Proc. Natl. Acad. Sci. USA 99, 8418-8423. Guindon, S. and Gascuel, O. (2003). A simple, fast, and accur ate algorithm to estimate large phylogenies by maximum likelihood. Syst. Biol. 52, 679-704. Guindon, S., Lethiec, F., Duroux, P. and Gascuel, O. (2005). PHYML Online--a web server for fast maximum likelihood-ba sed phylogenetic inference. Nucleic Acids Res. 33, W557-559. Gu, X. (2001). Maximum-Likelihood approach for gene family evolution under functional divergence. Mol. Biol. Evol. 18, 453-464. Gu, X. (2006). A simple statistical method for esti mating type-II (cluster specific) functional divergence of protein sequences. Mol. Biol. Evol. 23, 1937. Guo, Q., Wang, L., Ruan, K. and Kulmacz, R. J. (1996). Role of Val509 in time-dependent inhibition of human prostaglandin H synt hase-2 cyclooxygenase activity by isoformselective agents. J. Biol. Chem. 271, 19134-19139. Hao, C.-M., Komhoff, M., Guan, Y., Redha, R. and Breyer, M. D. (1999). Selective targeting of cyclooxygenase-2 reveals its ro le in renal medullary interstitial cell survival. Am. J. Physiol. 277, F352-F359. Harris, R. C. and Breyer, M. D. (2001). Physiological regulati on of cyclooxygenase-2 in the kidney. Am. J. Physiol. 281 F1-F11. Harris, R. C. and Breyer, M. D. (2006). Update on cycloo xygenase-2 inhibitors. Clin. J. Am. Soc. Nephrol. 1, 236-245. Harris, R. C., McKanna, J. A., Akai, Y., Jacobson, H. R., Dubois, R. N. and Breyer, M. D. (1994). Cyclooxygenase-2 is associated with the macula densa of rat kidney and increases with salt restriction. J. Clin. Invest. 94 2504-2510. Hamberg, M. and Samuelsson, B. (1973). Detection and isol ation of an endoperoxide intermediate in prostaglandin biosynthesis. Proc. Natl. Acad. Sci. USA. 70, 899-903. Hamberg, M., Svensson, J. and Samuelsson, B. (1974). Prostaglandin endoperoxides. A new concept concerning the mode of ac tion and release of prostaglandins. Proc. Natl. Acad. Sci. USA. 71, 3824-3828. Hebert, S. C., Culpepper, R. M., and Andreoli, T. E. (1981). NaCl transport in mouse medullary thick ascending limb. I. Functional nephron heterogeneity and ADHstimulated NaCl cotransport. Am. J. Physiol 241 F412F431. 121

PAGE 122

Hebert, S. C. and Andreoli, T. E. (1984). Control of NaCl tran sport in the thick ascending limb. Am. J. Physiol. 246 F745F756. Herschman, H. R., Talley, J. J., and DuBois, R. (2003). Cyclooxygenase 2 (COX-2) as a target for therapy and noninvasive imaging. Mol. Imaging Biol. 5, 286-303. Hirano, T., Yasukawa, K., Harada, H., Taga, T., Watanabe, Y., Matsuda, T., Kashiwamura, S., Nakajima, K., Koyam a, K., Iwamatsu, A., Tsunasawa, S., Sakiyama, F., Matsui, H., Takahara, H., Taniguchi, T., and Kishimoto, T. (1986). Complementary DNA for a novel human interleu kin (BSF-2) that i nduces B lymphocytes to produce immunoglobulin. Nature 324, 73-76. Holland, J. W., Pottinger, T. G. and Secombes, C. J. (2002). Recombinant interleukin-1 beta activates the hypothalamic-pituitaryinterrenal axis in rainbow trout, Oncorhynchus mykiss. J. Endocrinol. 175 261-267. Hlscher, C. (1995). Prostaglandins play a role in memory consolidation in the chick. Eur. J. Pharmacol. 294, 253-259. Hopkins, S. J. (2007). Central nervous system recogniti on of peripheral infl ammation: a neural, hormonal collaboration. Acta. Biomed. 78 Suppl. 1 231-247. Huang, L., Zhang, K. L., Li, H., Chen, X. Y., Kong, Q. Y., Sun, Y., Gao, X., Guan, H. W., and Liu, J. (2006). Infrequent COX-2 expression due to promoter hypermethylation in gastric cancers in Dalian, China. Hum. Pathol. 37, 1557-1567. Hughes, A. L. (1999). Phylogenies of developmentally important proteins do not support the hypothesis of two rounds of genome dup lication early in vertebrate history. J. Mol. Evol. 48, 565-576. Ishikawa, T. O., Griffin, K. J., Banerjee, U. and Herschman, H. R. (2007). The zebrafish genome contains two inducible, functional cyclooxygenase-2 genes. Biochem. Biophys. Res. Commun. 352, 181-187. Ishikawa, T. O. and Herschman, H. R. (2007). Two inducible, f unctional cyclooxygenase-2 genes are present in the rainbow trout genome. J. Cell. Biochem. 102, 1486-1492. Ivanov, A. I. and Romanovsky, A. A. (2004). Prostaglandin E2 as a mediator of fever: synthesis and catabolism. Front. Biosci. 9, 1977-1993. Jarving, R., Jarving, I., Kurg, R., Brash, A. R. and Samel, N. (2004). On the evolutionary origin of cyclooxygenase (COX) isozymes: ch aracterization of mari ne invertebrate COX genes points to independent duplication events in vertebrate and i nvertebrate lineages. J. Biol. Chem. 279, 13624-13633. 122

PAGE 123

Jayadeep, A., Reddanna, P., Sailesh, S., Das, U. N., Ramesh, G., Kumar, K. V., and Menon, V. P. (1995). Prostaglandin metabolism during growth and differentiation of the regenerating vertebrate appendage. Prostaglandins Leukot. Essent. Fatty Acids. 52, 235239. Jin, Y., Zhang, C., Lin, X., and Zeng, W. (2006). Prostaglandin involvement in folliclestimulating hormone-induced proliferat ion of granulosa cells from chicken prehierarchical follicles. Prostaglandins Other Lipid. Mediat. 81, 45-54. Jin, Y., Zhang, C., Zeng, W., Taya, K., and Tan, T. Q. (2007). Interactive actions of prostaglandin and epidermal growth factor to enhance proliferati on of granulosa cells from chicken prehierarchical follicles. Prostaglandins Ot her Lipid Mediat. 83, 285-294. Johnson, R. F., Mitchell, C. M., Gile s, W. B., Bisits, A., and Zakar, T. (2006). Mechanisms regulating prostaglandin H2 synthase-2 mRNA level in the amnion and chorion during pregnancy. J. Endocrinol. 188, 603-610. Jones, D. T., Taylor, W. R., and Thornton, J. M. (1994). A mutation data matrix for transmembrane proteins. FEBS Lett. 339, 269-275. Kaji, D. M., Chase, H. S. Jr, Eng, J. P., and Diaz, J. (1996). Prostaglandin E2 inhibits Na-K2Cl cotransport in medullary thick ascending limb cells. Am. J. Physiol 271 C354-C361. Kargman, S., Charleson, S., Cartwright, M., Frank, J., Riendeau, D., Mancini, J., Evans, J. and O'Neill, G. (1996). Characterization of Prostaglandin G/H Synthase 1 and 2 in rat, dog, monkey, and human gast rointestinal tracts. Gastroenterology 111, 445-454. Kasahara, M. (2007). The 2R hypothesis: an update. Curr. Opin. Immunol. 19, 547-552. Kay-Mugford, P. A., Benn, S. J., LaMarre, J., and Conlon, P. D. (2000). Cyclooxygenase expression in canine platelets and Madin-Darby canine kidney cells. Am. J. Vet. Res. 61, 1512-1516. Kennedy, J. H., Korn, N., and Thurston, R. J. (2003). Prostaglandin levels in seminal plasma and sperm extracts of the domestic turkey, and the effects of cyclooxygenase inhibitors on sperm mobility. Reprod. Biol. Endocrinol. 1, 74. Kis, B., Snipes, J. A., Gaspar, T., Lenzser, G., Tulbert, C. D. and Busija, D. W. (2006). Cloning of cyclooxygenase-1b (p utative COX-3) in mouse. Inflamm. Res. 55, 274-278. Klein, S. L., Strausberg, R. L., Wagner, L., Pontius, J., Clifton, S. W. and Richardson, P. (2002). Genetic and genomic tools for Xenopus research: The NIH Xenopus initiative. Dev. Dyn. 225, 384-391. Kulmacz, R. J., van der Donk, W. A., and Tsai, A. L. (2003). Comparison of the properties of prostaglandin H synthase-1 and -2. Prog. Lipid Res. 42, 377-404. 123

PAGE 124

Kujubu, D., Fletcher, B., Varnum, B., Lim, R. and Herschman, H. (1991). TIS10, a phorbol ester tumor promoter-inducible mRNA from Swiss 3T3 cells, encodes a novel prostaglandin synthase /cyclooxygenase homologue. J. Biol. Chem. 266, 12866-12872. Lear, S., Silva, P., Kelley, V. E., and Epstein, F. H. (1990). Prostaglandin E2 inhibits oxygen consumption in rabbit medullary thick ascending limb. Am. J. Physiol. 258 F1372-1378. Li, G., Zhang, Q. J., Ji, Z. L., and Wang, Y. Q. (2007). Origin and evolution of vertebrate ABCA genes: a story from amphioxus. Gene. 405, 88-95. Li, J., Simmons, D. L., and Tsang, B. K. (1996). Regulation of hen granulosa cell prostaglandin production by transforming gr owth factors during follicular development: involvement of cyclooxygenase II. Endocrinology. 137, 2522-2529. Liu, C., Li, R., Liu, Z., Yin, S., and Wang, Z. (2006). The role of prostaglandins and the hypothalamus in thermoregulation in the lizard, Phrynocephalus przewalskii (Agamidae). J. Comp. Physiol. [B]. 176 321-328. Lurje, G., Vallbohmer, D., Collet, P. H., Xi, H., Baldus, S. E., Brabender, J., Metzger, R., Heitmann, M., Neiss, S., Drebber, U., Holscher, A. H., and Schneider, P. M. (2007). COX-2 mRNA expression is significantly increased in acid-exposed compared to nonexposed squamous epithelium in gastroesophageal reflux disease. J. Gastrointest. Surg. 11, 1105-1111. Mathonnet, M., Lalloue, F., Danty, E., Comte, I., and Livre, C. A. (2001). Cyclooxygenase 2 tissue distribution and developmental pattern of expression in the chicken. Clin. Exp. Pharmacol. Physiol. 28, 425-432. Martin, G. R. and Wallace, J. L. (2006). Gastrointestinal infla mmation: a central component of mucosal defense and repair. Exp. Biol. Med. (Maywood). 231 130-137. Martin, F., Fletcher, D., Ch auvin, M., and Bouhassira, D. (2007). Constitutive cyclooxygenase-2 is involved in central nociceptive processes in humans. Anesthesiology. 106, 1013-1018. McLaren, W. J., Young, I. R.,Wong, M. H., and Rice, G. E. (1996). Expression of prostaglandin G/H synthase-1 and -2 in ovine amnion and placenta following glucocorticoidinduced labour onset. J. Endocrinol. 151, 125. Merlie, J. P., Fagan, D., Mudd, J. and Needleman, P. (1988). Isolation and characterization of the complementary DNA for sheep seminal vesicle prostaglandin e ndoperoxide synthase (cyclooxygenase). J. Biol. Chem. 263, 3550. 124

PAGE 125

Metcalfe, C. D., Koenig, B. G., Bennie, D. T ., Servos, M., Ternes, T. A., and Hirsch, R. (2003). Occurrence of neutral and acidic dr ugs in the effluents of Canadian sewage treatment plants. Environ. Toxicol. Chem. 22, 2872-2880. Morham, S. G., Langenbach, R., Loftin, C. D., Tiano, H. F., and Vouloumanos, N. (1995). Prostaglandin synthase 2 gene disruption cau ses severe renal pathology in the mouse. Cell 83, 473-482. Morrison, D. A. (2007). Increasing the efficiency of s earches for the maximum likelihood tree in a phylogenetic analysis of up to 150 nucleotide sequences. Syst. Biol. 56, 988-1010. OBanion, M., Winn, V. and Young, D. (1992). cDNA cloning and functional activity of a glucocorticoid-regulated in flammatory cyclooxygenase. Proc. Natl. Acad. Sci. USA 89, 4888-4892. Olson, D. M. (2005). The promise of prostaglandins: have they fulfilled their potential as therapeutic targets for the delay of preterm birth? J. Soc. Gynecol. Investig. 12, 466-478. Otto, J. C. and Smith, W. L. (1995). Prostaglandin endoperoxide synthases-1 and -2. J. Lipid Mediat. Cell Signal. 12, 139. Patio, R., Yoshizaki, G., Bolamba, D., and Thomas P. (2003). Role of arachidonic acid and protein kinase C during maturation-induci ng hormone-dependent meiotic resumption and ovulation in ovarian follic les of Atlantic croaker. Biol. Reprod. 68, 516-523. Pough, F. H., Janis, C. M. Heiser, J. B. (2005). Vertebrate life: Seventh edition. pp. 16-48. Prentice Hall. Reed, D. W., Bradshaw, W. S., Xie, W., and Simmons, D. L. (1996). In vivo and in vitro expression of a non-mammalian cyclooxygenase-1. Prostaglandins. 52, 269-284. Reiter, R., Resch, U., and Sinzinger, H. (2001). Do human plat elets express COX-2? Prostaglandins Leukot. Essent. Fatty Acids. 64, 299-305. Ristimki, A., Honkanen, N., Jnkl H., Sipponen, P., and Hrknen, M. (1997). Expression of cyclooxygenase-2 in human gastriccarcinoma. Cancer Res. 57, 1276-1280. Roberts, S. B., Langenau, D. M. and Goetz, F. W. (2000). Cloning and characterization of prostaglandin endoperoxide synthase-1 and -2 from the brook trout ovary. Mol. Cell. Endocrinol. 160, 89-97. Rogers, J. S., and Swofford, D. L. (1998). A fast method fo r approximating maximum likelihoods of phylogenetic tree s from nucleotide sequences. Syst. Biol. 47 77-89. 125

PAGE 126

Rose, T. M., Schultz, E. R., Henikoff, J. G., Pietrokovski, S., McCallum, C. M., and Henikoff, S. (1998). Consensus-degenerate hybrid oligonucleotide primers for amplification of distantly related sequences. Nucleic Acids Res. 26, 1628-1635. Rowley, A. F., Vogan, C. L., T aylor, G. W. and Clare, A. S. (2005). Prostaglandins in noninsectan invertebrates: recent insights and unsolved problems. J. Exp. Biol. 208, 3-14. Ryan, C. A. (2000). The systemin signaling pathway: differential activation of plant defensive genes. Biochim. Biophys. Acta. 1477, 112-121. Sawdy, R., Slater, D., Fisk, N., Edmonds, D. K., and Bennett, P. (1997). Use of a cyclooxygenase type-2-selective nonsteroidal an ti-inflammatory agent to prevent preterm delivery. Lancet 350, 265. Searls, D. B. (2003). Pharmacophylogenomics: genes, evolution and drug targets. Nat. Rev. Drug. Discov. 2, 613-623. Seebacher, F. and Franklin, C. E. (2003). Prostaglandins are important in thermoregulation of a reptile (Pogona vitticeps ). J. Exp. Biol. 206, 1143-1151. Seebacher, F. and Franklin, C. E. (2004). Integration of autonomic and local mechanisms in regulating cardiovascular responses to heating and cooling in a reptile ( Crocodylus porosus ). J. Comp. Physiol. [B]. 174, 577-585. Shakhmatova, E. I., Kuznetsova, A. A., Prutskova, N. P., Bogolepova, A. E., and Natochin, I. V. (1997). The effect of cyclooxygenase inhib itors on ion and water transport in the human kidney and frog skin and bladder. Ross. Fiziol. Zh. Im. I. M. Sechenova. 83, 6875. Singh, G. and Triadafilopoulos, G. (1999). Epidemiology of NSAID induced gastrointestinal complications. J. Rheumatol. 26, 18-24. Sirois, J., Sayasith, K., Brown, K. A., Stock, A. E., Bouchard, N., and Dor, M. (2004). Cyclooxygenase-2 and its role in ovulation: a 2004 account. Hum. Reprod. Update. 10, 373-385. Skoblina, M. N., Kondrat'eva, O. T., Ni kiforova, G. P., and Huhtaniemi, I. (1997). The role of eicosanoids and progesterone in the ovulation of the oocytes in the common frog. Ontogenez. 28, 211-216. Snipes, J. A., Kis, B., Shelness, G. S., Hewett, J. A. and Busija, D. W. (2005). Cloning and characterization of cyclooxygenase-1 b (putative cyclooxygenase-3) in rat. J. Pharmacol. Exp. Ther. 313, 668-676. 126

PAGE 127

Sorbera, L. A., Asturiano, J. F., Carrillo, M., and Zanuy, S. (2001). Effects of polyunsaturated fatty acids and prostaglandins on oocyte matu ration in a marine teleost, the European sea bass ( Dicentrarchus labrax ). Biol. Reprod. 64, 382-389. Southern, E. M. (1975). Detection of specific sequen ces among DNA fragments separated by gel electrophoresis. J Mol Biol. 98, 503-517. Spaziani, E. P., Lantz, M. E., Benoit, R. R., and OBrien, W. F. (1996). The induction of cyclooxygenase-2 (COX-2) in intact human amnion tissue by interleukin-4. Prostaglandins. 51, 215-223 Stamatakis, A. (2006). RAxML-VI-HPC: Maximum likelihood-based phylogenetic analyses with thousands of ta xa and mixed models. Bioinformatics. 22 2688-2690. Steiner, A. A., Rudaya, A. Y., Robbins, J. R., Dragic, A. S., Langenbach, R., and Romanovsky, A. A. (2005). Expanding the febrigenic ro le of cyclooxygenase-2 to the previously overlooked responses. Am. J. Physiol. Regul. Integr. Comp. Physiol. 289, R1253-1257. Stokes, J. B. and Kokko, J. P. (1977). Inhibition of sodium transport by prostaglandin E2 across the isolated, perfused rabbit collecting tubule. J. Clin. Invest. 59, 1099-1104. Szewczuk, L. M. and Penning, T. M. (2004). Mechanism-based inactivation of COX-1 by red wine m-hydroquinones: a struct ure-activity relationship study. J. Nat. Prod. 67, 17771782. Tamura, K., Dudley, J., Nei, M., and Kumar, S. (2007). MEGA4: Molecular Evolutionary Genetics Analysis (ME GA) software version 4.0. Mol. Biol. Evol. 24, 1596-1599. Trautman, M. S., Edwin, S. S., Collmer, D., Dudley, D. J., Simmons, D., and Mitchell, M. D. (1996). Prostaglandin H synthase-2 in human gestational tissues: regulation in amnion. Placenta 17, 239-245. Urick, M. E. and Johnson, P. A. (2006). Cyclooxygenase 1 and 2 mRNA and protein expression in the Gallus domesticus model of ovarian cancer. Gynecol. Oncol. 103, 673678. Vane, J. R. (1971). Inhibition of prostaglandin synt hesis as a mechanism of action for the aspirin-like drugs. Nature 231, 232-235. Vane, J. R. and Botting, R. M. (1994). Biological properties of cyclooxygenase products. In Lipid Mediators, ed. F Cunningham, pp. 61. London: Academic. Vane, J. R., Bakhle, Y. S. and Botting, R. M. (1998). Cyclooxygenases 1 and 2. Annu. Rev. Pharmacol. Toxicol. 38, 97-120. 127

PAGE 128

Vio, C. P., Cespedes, C., Gallardo, P., and Masferrer, J. L. (1997). Renal identification of cyclooxygenase-2 in a subset of thick ascending limb cells. Hypertension. 30, 687-692. van-Lanschot, J. J., Mealy, K., Jacobs, D. O., Evans, D. A., and Wilmore, D. W. (1991). Splenectomy attenuates the inappropriate diur esis associated with tumor necrosis factor administration. Surg. Gynecol. Obstet 172, 293-297. von Euler, U. S. (1936). On the specific vaso-dilating a nd plain muscle stimulating substances from accessory genital glands in man and certain animals (prostaglandin and vesiglandin). J. Physiol. 88, 213-234. Wald, H., Scherzer, P., Rubinger, D., and Popovtzer, M. M. (1990). Effect of indomethacin in vivo and PGE2 in vitro on mTAL Na-K-A TPase of the rat kidney. Pflgers Arch. 415 648. Wang, H., Ma, W. G., Tejada, L., Zhang, H., Morrow, J. D., Das, S. K., and Dey, S. K. (2004). Rescue of female infertility from the loss of cyclooxygenase-2 by compensatory up-regulation of cyclooxygenase-1 is a function of genetic makeup. J. Biol. Chem. 279, 10649-1058. Whelan, S. and Goldman, N. (2001). A general empirical mode l of protein evolution derived from multiple protein families using a maximum-likelihood approach. Mol. Biol. Evol. 18, 691-699. Willingale, H. L., Gardiner, N. J., McLym ont, N., Giblett, S., and Grubb, B. D. (1997). Prostanoids synthesized by cyclooxygenase isoforms in rat spinal cord and their contribution to the development of neuronal hyperexcitability. Br. J. Pharmacol. 122, 1593-1604. Woolf, C. J., Allchorne, A., Safieh-Garabedian, B., and Poole, S. (1997). Cytokines, nerve growth factor and inflammatory hyperalgesia: the contribution of tum our necrosis factor. Br. J. Pharmacol. 121, 417-424 Wood, C. M. and Laurent, P. (2003). Na+ versus Cltransport in the intact killifish after rapid salinity transfer. Biochim. Biophys. Acta. 1618, 106-119. Wong, E., Bayly, C., Waterman, H. L., Riendeau, D. and Mancini, J. A. (1997). Conversion of prostaglandin G/H synthase-1 into an en zyme sensitive to PGHS-2-selective inhibitors by a double His513 to Arg and Ile523 to Val mutation. J. Biol. Chem. 272, 9280-9286. Xie, W., Chipman, J., Robertson, D., Erikson, R. and Simmons, D. (1991). Expression of a mitogen-responsive gene encoding prostagl andin synthase is regulated by mRNA splicing. Proc. Natl. Acad. Sci. USA 88, 2692-2696. 128

PAGE 129

129 Yamada, S., Kawate, T., Sakamoto, H., Aoki, K., Hamada, Y., and Atsumi, S. (2006). Cyclo-oxygenase-2-immunoreactive neurons in the lumbar dorsal horn in a chicken acute inflammation model. Anat. Sci. Int. 81 164-172. Yamagata, K., Andreassson, K. I., Kaufman, W. E., Barnes, C. A., and Worley, P. F. (1993). Expression of a mitogen-inducible cyclooxygenase in brain neurons; regulation by synaptic activity and glucocorticoids. Neuron 11, 371-386. Yang, T. (2003). Regulation of cyclooxygenase-2 in renal medulla. Acta Physiol. Scand. 177, 417-421. Yang, T., Forrest, S. J., Stine, N., Endo, Y., Pa sumarthy, A., Castrop, H., Aller, S., Forrest, J. N., Jr, Schnermann, J. and Briggs, J. (2002). Cyclooxygenase cloning in dogfish shark, Squalus acanthias and its role in rect al gland Cl secretion. Am. J. Physiol. 283, R631-R637. Yeh, H. C. and Wang, L. H. (2006). Profiling of prostanoids in zebrafish embryonic development. Prostaglandins Leukot. Essent. Fatty Acids. 75 397-402. Yokoyama, C., Takai, T. and Tanabe, T. (1988). Primary structure of sheep prostaglandin endoperoxide synthase deduced from cDNA sequence. FEBS Lett. 231, 347-351. Zou, J., Neumann, N. F., Holland, J. W., Belosevic, M., Cunningham, C., Secombes, C. J. and Rowley, A. F. (1999). Fish macrophages expre ss a cyclo-oxygenase-2 homologue after activation. Biochem. J. 340, 153-159.

PAGE 130

BIOGRAPHICAL SKETCH Justin Chase Havird was born in 1984, in Valdosta, Georgia to Dawn and Kurt Havird. Justin has one younger brother, Jos hua. The Havirds soon moved to Lake City, Florida, where Justin spent the majority of his childhood and adolescence. Justin attended Columbia High School in Lake C ity and graduated with top honors in 2002. Justin then attended the Univer sity of Florida in Gainesville where he majored in zoology after an initial interest in aerospace engineering. While at UF, Justin was heavily involved in the universitys band program, pl aying trumpet in the marching, basketball, volleyball, concert, and symphonic bands for se veral years. As an undergraduate, Justin worked in the laboratory of Dr. David H. Ev ans for a number of years, investigating ion transporters in the gills of fishes. His se nior thesis was titled Neuronal Nitric Oxide Synthase in the Gill of the Euryhaline Killifish, Fundulus heteroclitus. Justin graduated summa cum laude from UF in 2006 with a B.S. in zoology. In 2006, Justin entered graduate school at the University of Florida in the Department of Zoology. Continuing to work w ith Dr. Evans, Justin spent three summers at the Mount Desert Island Biological Laboratory in Salis bury Cove, Maine where he collaborated with other researchers inve stigating fish gill physiology. During his graduate studies, Justin has earned several awards and grants, including a GIAR from Sigma Xi. Justin has also presented his resear ch at scientific meeti ngs and conferences. While earning his M.S., Justin also designed experiments and instructed students in a senior level animal physiology course for 2 years. Justin has also collaborated with other scientists on a wide ra nge of marine life science projec ts, most notably a revision of the cobitid genus Lepidocephalichthys in SE Asia with Dr. Larry Page. After earning his 130

PAGE 131

131 M.S., Justin plans to continue his academi c career by completing a Ph.D. in a related marine science field.