<%BANNER%>

UFPKY NEH LSTA SLAF



The Kissimmee Valley
ALL ISSUES CITATION SEARCH THUMBNAILS MAP IT! PAGE IMAGE ZOOMABLE
Full Citation
STANDARD VIEW MARC VIEW
Permanent Link: http://ufdc.ufl.edu/UF00087095/00038
 Material Information
Title: The Kissimmee Valley
Alternate Title: Valley
Physical Description: Newspaper
Language: English
Publisher: N.S. Harris and W.B. Harris
Place of Publication: Kissimmee City Osceola County Fla
Creation Date: March 17, 1897
Publication Date: -1897
Frequency: weekly
regular
 Subjects
Subjects / Keywords: Newspapers -- Kissimmee (Fla.)   ( lcsh )
Newspapers -- Osceola County (Fla.)   ( lcsh )
Genre: newspaper   ( marcgt )
newspaper   ( sobekcm )
Spatial Coverage: United States -- Florida -- Osceola -- Kissimmee
Coordinates: 28.303889 x -81.412778 ( Place of Publication )
 Notes
Dates or Sequential Designation: Began in 1894.
Dates or Sequential Designation: -v. 4, no. 11 (Nov. 17, 1897).
General Note: Description based on: Vol. 3, no. 3 (Sept. 16, 1896).
Funding: Funded by NEH in support of the National Digital Newspaper Project (NDNP), NEH Award Number: PJ-50006-05
 Record Information
Source Institution: University of Florida
Holding Location: University of Florida
Rights Management: All rights reserved. Board of Trustees of the University of Florida
Resource Identifier: aleph - 002001342
oclc - 33274520
notis - AKH8529
lccn - sn 95026776
System ID: UF00087095:00038
 Related Items
Succeeded by: Osceola gazette
Succeeded by: Kissimmee Valley gazette

Full Text
-

',' ".. ...f15i."j /'.'>,, vil'L-i/l1h'V'! / ." '*"'. 't.M'j' _i' i .'..t"'k* -.'-:-. >:':'''l- "; '-> li' i'J.j.L'tL-A' ''.'J'.'? '\ iij\: .>.-' iL
_
_


I _
-..
41 h ,.

_


.:..;-- :.'."IN-tiMi'-. .. A ..0.' "."

'9 .'\ U Y, ._.o'I

2 Jttfo&M MEET* ADVERlS- I "fA 'YEAf :'iNADVAMO '.

I WJ'.i .:t.'+iJ


,9FtI B"-. IN" ,.',hlo
,
.. .. .. .. h '<'.
'". --.- ro\ w" '. .. . .. ., ., :
,
J' : ; "
I :- .' .' -t.-- . .." ,.tr'.;,." ...' I'.
; : : .
1"- : '
'
: .
: : ; ; \" .d. . \ .
: '> q 'l
V > .
t '
VOLUME in. .' .. :; KISIMMEE-9rr.'OSCEO COUNTY., FLQlilDS;"WJbESDATtAfl! H11,; 1807.>: 1"--7- : ,NUBER2. .;', ?rfi./" .._ :.t.I ._

-, .V'V- '
tK-B'd d tiN'' ,.ir..buttb" II' i..t In.' OOo.DI_ 'l t1aSTIt- i In it. aiitiugtjH;,.wiiicli -.- 't s'AHi-imDiI3 W'I'LE" ,TO-au!Oft ,, -i..r J" f /
.Kl ISSIMME1ALLEYNIIarrIs I V .: VVVV:: :;z-.- r_. ..1 "'. ,'-"V :' PUCi'WJTH GO lz.f. -.--' .- .. :
.t' not cumulative ibr..u'U.1V'!: olSotrstate. :To 'r : '
/. ofl er Institutions'and. the cor- strength'will prove ;; .. -BlDJ I-J" I'-M'- :t 1''
KoneofTbemShoBld lx> tile State f. .
J'1 ; and W.;,U.; ., ,>ttM .Puporf3tii I lvthe greatest but wilj_ wane a*)the/fight( progres V Thin Henth. make'muck:I'M ay lUble")| for plant 'Chi go.. _,A. special to: the Record .r" '.i ..- ,_ :t1f '"
"
:Publishers and Proprietors.., n\ibjearth is builded. ...' "'< It i conceded by all Who are po* food a* stable 'm nure'. 'the- n tick front Havana; :;fron\'U"stXKiacorresjpon'denkjln : c.: -sit i.a ,, ':

7li """ 1 ._ i No-'country onterarth' has,. ever V ::Il1s chief'antsgonist'v tl 1 be,.his ted thai '|March nd- April are the' should be compo' to! withf quick this field, saym t. -' j .L'i -.'. *.J
t .t' .
Entered .t the |'postofllc.'11KI..lram. tl.'adva.and achieved he. old enny, Colonel.VV. D. Chi play, most delightful 1 month of tha year lime', say and inch;of t, i lime to every From Information, rcceivaLLaannotytcepoiltively'thst '".?

ftl V 'aVsedondUelass; mall tom'tteiy results of civilUationand the;knlglTTof; .the far, .we.t._;"ho In_,Fllorlda.. ,Qur tourist friends foot Of bruck,' "or' wh \i t II better; } : CSptain-' "

& V wnder the ame form iU1l.tcome down'to the capital with should! jtnak*..a. .note of .t'biIt foety gdliard .wood -!ftc41nace r ) of General l Woyler has had.!ol'dolYt" jWhotesale ,* and: ;*Jletaili l;' .t':

\ V Subscription'lutes: '. government that ''the \American *narray' .large as' that of ",the and not be in'a hurry to leave'ihe lime. With, alternnti ;'niuck and seek'; Gotnek and to offer fiim '.wii.t. e. c 'V ._ ._. .. "
'
't'lOne i T 11 IuuIVCOpy copy.,0". .. TU onth.; .'t.. .-'_. ,' ple ha' ;e. What other nation* senior senator.' -' VI" state. '!he-following editorial I"from u.henmako; \ thp' p'ilejA J' ,.btgUWypumay'jL&L : ever terms are necesiarjfta, 'end the.'. -::_:'.'' 1.' ."... .. _'. r"i" ." .'- ."II'"" .V -._, -..' .\,- .U', .. -... ....11'

4.VV .COne copy, 4hr months .- .... ,. .. ,. to do America ha accom For uekor-two_ 'so the'prophet ,Tuesds'ys '.Ti 1.-UntOD i II, timely t ; it cn'ietitt.VDurIg 1 jjartTho"deta'iis: :; in'.' unknown, ". ... tI tr -_-. .. ,. '1' ,t.l. ;

f1 J Alt subscrlpUous parable, In advance.IJ.ON. .' Where it 'ha*. ..bt-eo. pre with! a leaning to tbe dark hor- Th tourist of Florida often make the winter the,pilo.ho uld' >bO forkOTover. t3tibelieydthey'eztend-al" .11fb .. '4i ., -, ._--. ,"j''r"S" I V.._'_.." '. -V.-.Vt7.r .V"'''_ J' I', J''" '

: Zr.'S, d'and argued from the 'fate"of, iiay. there will be wire-pulling V.a'great ''mistake l in the lengtli'ottheiritayln'tbe :' '"Ajimall sprfnKlng! of 'l land f jway' f ronu \tonomyto tba sale ..PJllsbui7Fl" ii ,.,-, 'Faney. Groceries. =.;b-' : :
:
that we would and war'and' fbetther man win Generally, plaster ovi7.the'j"'top': prevent ; ; .' : :*?? ; -
.. ItPITOa---- ancient republic { state. of-the island tothe..,Cubans. "r" : crahi : ..V.' L.'v"'

:., -----.4'---, ._-- c America has succeeded and all in that time, neither c...win. they come ,to'-escapthe; .ce..1va'' the escape'otjthe'aiflirionjavJJut It:Isujaid Spain l "' will grant'"any. .ti' :iFortiljzcrs- Sporting, Goods' ,, .. !4 *

f W: A. HKKTDIIRSON b. cle. to her progress and.civili ''The withdrawal ,onV ,the cld, and,.when.the"weather grffWswafin V ,asthe Ruraf "J ew Yorker thing to obtain peacewith honor, M6aJ|! CratoMater1jt1, : It V :. *. /

"O.;announced that bit would not bo have disappeared by one other they soy would be'"an: acknowledgement 'here; they .4-'fei.r.nted suggests, mhy not make the mucfk before the new conir..'tikes hold. 'Grts op{ "
S
1 candidate for.election to the (Uni.jt' today she' proclaims.herselfb.JnhstrP1ILnrth&orIdjhe of defeat. Then ,that the' winter" over and they better than the maourej while,) you This,of Bourse,'will be denied but I., % ,V t:1"r": 'OaIdenee" ,I.' V. V '. V

) "p ted State Senner.i .lore- come, the_crises,'and new names can live at home without di-" are.jibpu itr You,manurfc. would it 4s known positively that it 1 i.f i. I. V V 1' '-:< ; \ V '

o > V t''ati n oflhiilb" "" wnbe; \ mentioned. V comfortvthev r sought to' avoidTjy be-niujch better'ityou!! could mix-100pound's .-:, At a bunquet at the palace ',H.,4.
; TIII FIKTY-FIFTH CONGRESS a.I The primary element .which Juts The Call array will swing over coming a southern climate. of baVan4..30" pound of issFnight General yler..id pub- .. .';., \" ""' o.J\VVBa11aidiQb .0

( ; sembled i in ordinarvsession far controlled tfie destiny the candidate "the *tourist come to.the state because muriate ofpcrtasfC with every-ton, !! elist '
} to some-.otnec jnd" Many lip ly the"war would be OveMn three : : ::: ..F1Quij- '
,noon Monday, pursuant to the people, has been the te- Chipley army will be mobilised Into they cannot stand porthorow4nteraw1tboua..iIanger.to because you woud,! 'hare moro 'J t- week Ie hi* left for Villa Clara : :; ;,: .

V -ofthePresidentJfhos... -* -have-beld-te anti-Call ..tlteic.health. ash! and .phosphoric JjcldTlw! where ., r.LV .1" ____L-t. ( ,I., :.. ". ( '. .
an -armyr-with-chang. large bodies .of troop have ...I. .', c.:.. I p. :' 'J .t
Y Vt "V Speaker of tlio House.f Tho idea of.the education of the mas-. here and then in individual vote ( If it is wortfi while for muck needs tlic4eui9tances" more been'ru.hed for the 'I lait two day.; I'4'

cV;' V rnd perhaps the only duty .of of the people. JJ' "ect-'tbo-i them, to eom6tVailitV1j i"po.l'ta t- _. ._ \ p !!craPutpu.uuaeekin'gforGeme.! : :' 1 -: kirig :, ro1\rd ALWAYS ; : :," '.
.
,;.: : ioiFw11l=e"Vr: '- foremost tliat .Jar i 11Jr l1iii'I. Pbe..rartCTbcobt1tinU1l81l111'tJU JK-JtE, LIABLE.. .
V To-day America rank up-* the rootb.aIi..ta! express- it. they and to make terms of pea .. ; '' 'r .
jfJ measure, which is intended to educational matters of the na It is at this point tn the game is passed. It I I. not parsed with the can ,ofio'rd-ryou ,aJ 't yse too 'much V The steps leading to this 'result S '. j 1" V ,"t. 1.'1:1_,.

f.J ever $50,000,000.The Jaw is ( n. of the earth and her system of that the dark horse black and'weILgomed >- begining of warm weather.in Florida anil! mix them thoroughly'wfth'the are interest jGenerttWeyler re". : We havTR-Speeial ArrangomenU for iriarketihg Xfegefables\ FnHides o' t:

.J :t1, 'posed"to| be. enucted for schools clialenge'the admi will be entered in the ,,nor even when the weather be- muck. The limo In'tho ashes will turned to havana on the 6th insf. V ", V
h purpose bf revenue and protection.tTh answer for ".weotenn," the muck. Furs, .Diaeswttx'andafl 'Country .Produce,; : ;. /
I 'of all other countries. No- race to make'the run of his life, come permaneAtly warm here. So and reported to Spain by cable. He .;' .

:.new tariff.:'Ja 9I'PI' Tr P??? : &el CTs literature'-50! .widely V 7r s"useleu to discum:: the etisnccsOf -, far a* health is Concerned, wore danger If..you.ca n.o!pbtain! .a.he*, use the admitted-that 'Gome. and. Carillo V which.>ye will" uy, outrigh't Lj or kandleT'J. .' Jon .

: will impose.specific duties on and nowherll.elM have the dark horses until the first comes from sudden change thai" lime| lope, and as the; pile! i i. made had crossed his line* and were now'' .. :,-- V .mm\\ io.. Give c V-": .

.f tain articles rather than a poor the opportunities for se- element In the fight the sequence from steady coljl.,,Jn the South Atlantic up, use two parts of! jlne'ground west of his' forces.; He-"explained i .C V .r. V "" us "V'V' ,.. _. ._V <15V. J.tl. %. '

tariff. Tfiese will embrace a commou. school education {he Call-Chipley struggle Is mad states nth ( Florida,March bone and on', patvfmuriate of potash that he had tried to negotiate with V 'I, __.-trial.. : .
r
f all :chemicals and many other articles America.The is the most month so that about .o'oundof the -- V V .
into a known quantity trying on persons Gomea, but the latter had refused ; -
i, such as steel sugar.agricultural schools of our state willompare have, with weak lungs or those subject mixture will be added to each ton Wesellfor. Cjish b '
owp However. the dark horses to treat with him, and would only and : ?:
: and sundries. of If hri.v.eIl ,. ;
JI. products muck. this be'weJl mixed and
favorably as to length of situation to colds. In the North Atlantic V
great 'hopes. They think the -, treat with Campos, and that for in :
t rates on farm products, tobacco; and of there in Aprit.arid' worked over you will certainlyhave' VS : -Q 1jb V "
Capabilities imparting the that : stales are changes .
warrants prediction: dependence. It is believed, he added S : l' ,
'Lf.U ., ., "
wines and liquors are the same of of better .1\1 .
the schools of in May4liat endanger a pile cohipp.t ..,..
any the men now most prominentlynamed even that the situation wa desper; .. ..1' : '
the McKinley bill. The bill ". I in the Union, will not be heard of when health. V quality' ton for ton, than good stable at. lIe asked for orders. Como buy for Cash where you cansaveMoney.:, :'Il.-"

b, and given means to the:Monday committee afternoon on Osceola County spends a* much I the coveted conclusion is reached. The invalid who leaves Florida manure.* Meanwhile it is whispered, Du- I V . __ :. ....o.. _...,.;..p.tL..J4: :jV V

r per topi ta and her school Within two weeks the forces will too soon looses .11 the benefits of TOBACCO GKOW1NU 124 FLOU1DA. puy PeLome made wore"reforts e :: ', JTow-is the time V to make '.F

': J. .ant now engaged considering compare with any in the state be mustered in the historic city of his visit to the .tat.. If he ha. remained to Spain concerning the of your,- ,, :M'x. .VV

7Vr: .' details. _ the percentage of illiterates in TalltttfSWoi and the contest 'Will here }long his system l'e' J. \Y, White of this tr. who the new Congress, which temper meets today. ,.. :FB-1TIT: : :tA.EJ" I. -. "'!(' :/ V'4

,t LEGiSLATiON. is perhaps as great as any be itoade more interesting Ihto any' come lest .bl to withstand the effects was appointed by. the county commissioners He said even Cleveland had .
that has since *0' '
,
thing transpired 76 to attend the Ftbrida You will need .ti.
: : : -
in fi.mericsThis; in not as of sudden changes to colder : .
\ V Throughout the Country when Grant's troops camped in the State been scarcely able- restrain the V
V Stale Legislature seems tI, be vieang shdTlld be and we dq not believe shadow of the capitol._Times Union oreven cool.r 'weather than .if he Tobacco Growers' Association last Congress.. This one will be Citron, Orange, Lemon" Peal/Currants V V '
.
returned ,
V with the others us to which is the fault of either the system or ._ had not come at all. It i., then, in January, to Jacksonville worse. He referred to Cleveland's .V .' VV

V 4 pas the most absurd and ridicu4' schools, but on the contrary it FIBST ECCLKS1AST1CAL LAW; !important tha't. be should remain ,this morning,, and nays the tnessage of possible\ intervention, Raisins, .Figs, Dates,, Almonds, Walnuts. '.' V 2

lous'laws. One wants to enact directly |he fault of the people until the; weather )bpCQme* prmanenly'warin convention \rhjcH' 'adjourned last and said McKinley would probablythink Extracts .
V School Board of Osceola night! WHS a inagnilicentauccess., Spices. Etc. VV
of this of The home. It
'ten commandment. into a law, anV are neglectful duty. at is fplly the time had como He'cer '
othcMo Impose a heavy penalty 'that they owe to them county entitled to the credit of to do anything worth doing by Mr. White ..say there were fully tainly was not so friendly to Spain To get \\hese' nkeandfeghgoto'j'i V'V ,1'. .

i -.. "that prints an ugly and O their cuontry.. enacting the fit ecclesiastical law halves. It certainly Is folly'to adopt (two hundred people; prejent from a* Cleveland had been- He declared '
any newspaper :
known Florida. It has all over the State,.and .the subject }: V
to prohibit ;
picture of a citizen without histon3YjHti half-way measures in the protection that something must be done soob. W'BMakhtOneQt1tpa11Y7"

,. ... ..Another. to fine!! any THE SEKATORUDCOSTKSTd.Politiciin_.' : .. e4 the school teacher .of tbe county of healthr of tobacco growing' was mOat. enthusiastically' General Weyler received long VV;

V TfTreTTd.whoge.cmployee flirts ot 11'loridaar.- now Prom"dancingunderpetiaUyof' 4n- Put thfrmoo'itr; of Florida tou'rI.t. discussed, as it .ha. piipatch on the 8th. It was of such I' ",

sLant dismissal. Henceforth Osce- well' and to this class waiavp .eq proved IjeyondJ question \that character that be declared Fregli ( -
female along the line. engaged in the interesting are the a t It Joodjf Awiving Eyeifl 'Dan:"

MT sought to limit the lines I !4t gues.-ing who-wtlKte! 01.'. scholl marms ntust not trip )a_suggestion to.make, If theyare tobacco fully equal, to finest would end the war in .month? it ., .1. ,
the light fllntutl '.\oe. 'The- pious Havatina. product cajir.ba! raised suci it 1 ;
t.-.aid. to
climate instrjjcta-jiwi Tenew
_jods one an- or one-firm next s.iatorfom Florida-who seeking a temporate or. ,
__ V carry.. Another hi* passed an .: succeed lion Johd A.'Handar 1 and godly school board has decreed even seeking p.Jea..ureoaly.: t-bey .eessfCTly W l"lorlda.j' his effort to secure pc. He must FRESH. QADEN 'SEED... r 1 '

.r V prohibiting every merchant o thmho Statr!Jy quadrille! the gallant should'remain at least through May. Some of the leading spirits' in tty'cnorznous1ribes Thai failing CaulMlowcr, Celery arid: Bermuda'Onion Seed a

doing his usual business atthe 1'I There are many declared candi V lancers and the jcy snd r"i tivp Till {. tbp mos( ,pleasant' month. in (his! movement were' Col. ,W. D; be it to offer autonomy. If_that_ I is. f\ S pee I a It'y.- .., =- ,' -v, .
waitsare whose Immorality Chlp1'1L Fensacdtot t rrof'O f ,
abominations reTOied he thust
Vt *fnd.7hd; the Ji.t'mlgbt be lengthened in the field and'' a stableful of Florida, and even 'through the hot ; Ovenftr 'to set
with such ,nonsensical" trash will transmitted t'tlie test months of summer the heat I I. Clutev 'Lake.CitT" Pro/. F, F, the'Island {J to the Cuban on guaranty : V. V
horses. those.-
Among'
men.
: (hat ark to encumber the ed for! scholsrr the'teachers, Indulge in opt sokOppresslve here a* It become Moody, ot Lake City,|WmCorry',\ bends' He must,make peace on

." books ..'" ) 1! ,the.11endea place' are' fJohn ,,'.,."_'.".,...:' terpslchorean pleasures, it time In more northern latitude..! of Quincy__ (president of the con. "ventioji ant terms almost before Congress Rollins Co11egi ;
.t'r: ., ., a'result of this' .religiousenactment -- ) j ex-Congressman R, H.! M, baa time- # ..
; 'The statute book of Florida! W,'D. CBipley 'V"' ': -fl-As, In January, 'Febunry, -March-and to act., ,If.he fails he-wfll{ ,
<:': !lred3LL e1llmtl'y' m.b Kisslmmep It It. 'dull as far.tnt9.Aprp. Florida is the,center D V dllOn r..Qptn 1o i__ GeneralHoward be iec l1d': Meanwhile, the'United .
j
fii ( George! PiRneyj__ Chicago o
theIr ; of and Professor
: .1', with useless 'legislation"and .Charle Dougherty. ditch ate"Th.ilrl. ; pa. Of J nation's social pleasures, ]JUI'i State roust b* 'keptqulet byucc6sslv WlNTERpARK.: FL.A.
irj. time alternating between Curtis, agricultural( and immigrant. Iease those im- .0.H .. V..
T; '.; .iTvi4yfihe fact that the. spirit M, H; prayer- as N.wporiand Long Branch -and .i among : '
.b" '
meetings, .d retailing 'scandal, agent of the F" C. & r.' pnllOned " '. D.URINO the p..i Summer VV v
}i. fraak'legislation i n the incres.aand Frank i Mark. Saratoga are in the summer; but I' < '. : extenslvs, imcrovements have'been r
V while the school teacher are confined social NIIIO' Jt was, clearly shown.that the tobacco made upon the bujlding; and addition. arebei r '
.
planned
4 spreading. it might be w.ll ] lurford. after the tourists! is V V V 1.iJtlI'8 E_________ accommo'T. .
'J.4 .
+ _
date
V ': -admonish our Florida Solon*, wh : V to Foi'. Book .Martyr and ended.there..are plea.uren'.ln.thi.tsts.that .! Industry bad pasM>4 thev experlmental : .- .: tw-Uaes-of.work institutsd -Student* oLboth, s xes"are"laviSS', _>> ,..t."
John E 1 HartridgeJefTerM I ceiled Jn the -vsrion, _"
Milton'Paradise Lost stagy and TO* befngez' 'Florida will mskcanreiih'ibUtonat departmentt-Collegiste; Academic, Pwparatoiy*? "
; Stag parties : .i .,
sit J in 1.- be duplicated ? '' ;
& .
rjTr oa' to ; can n tpry .
it Sub-PraparatoryMII.IC "Abet'
"c D[Browne., and'! in An; ,Tbe faculty i is mado np-o. pfofe % jV"V .
; ;;" tbe'destiriies._ ; of th<"ytate.., Charier! MY Cooper.Etoekar :.'" are liow In.order'in the Klsslmmee few parts of.the.Union,. and in no tenslvely. profitably raised the'great Tennessee), ,Centennial, ors of the highest grade,'Specialist in their departmentf location ,

V V teer clear of 1 le-gislalive-follies' : -WiA: >; V V V ValleyssidU a dance is gotten up, section east erfThe Mississippi{ river. : d_,. olldJ. f\-. atJf! s1SffliVfK njiLMaV. ..t.jo'.No. of Institution speaks for.ttself."..Sickness is almost unknown; Th2" tiS._r-

V leave'beh1nd them no ng..i m ;: tho merl hive to' tie a bandke'rchieferbandthrfr Nowhere is found such a field for' der tbe better ;undrstoodnetbods velll tt.t.1897';.' :Fr bff 'Rhode equipment for work i. the beUvWib' cartful and accomplished teach.fjj: *" J'
W' D 1zhiti ,
; V- upon tfa Vtatute book of thestate.ire :, ; V inns B n4 ("M.he pi***? the sportsman; Httnjlrijj! ,n41sh. ofch1tIyatIo 'l.; tripg1-b.coin, Island wilt be there.with ori4 of the er*, the tine of a fine library reading room. snd modern gymnasium; stu"rja -' 'r.t'r ,' f.
\ p SomemaIt dents
these' '
V .oL.; -,'puer$1eorusetesi.$ fl' .J ';t1-\.. 1 1 .,- o the|_backgrourid.\0tli-gentlemen-:preferin : -of-lsdIu., "J_ V ing nowhere' ollOoft'e the same tern one..of,the greatest .Industrie*of the hand ortiestj$ .::julldings'_;'pn:. ::1'the Tbe !institution.i are assured a entirelynon-sectarian happy,,healthful, l.1d ,profitablosojourn-at and underva liberal RollinV,"..'ti., : r, .
V .
.V ,. .Legtll tie f act.. :' of, .VtW' : of the nT are.not':working. for' the, Heaven know* our learned legl tations of ')jcce7T. ;ll leaitani i 'excu r?11 State and South, '"\\rV:"iWr" -j-; gixHindss-, .majority of>;'the almslo-fit young mcu and:-women-to"take' thrkr', places fa.management the .ao..., if"' V \\JI, V

<; '.d..N.yi.f ..ThoN that ..Iai) : ;'an I thesei; lat rs have; crowded our Statute sionsby_ ."nMg'or.by rail :can oe V wa.-t..rned'.t". 'the meeting -Sts4esrbe'apaceba.tr.adybeenaeleted eial as-welras busaiess wuild..' Oieat-carn wilt. be*' taken'1_to elvT ":'! '.. V '
I ; perhaps, may jrusji. wrt: sierabndance r. njpt ; 1b it$flfcjnin jiL'IMi'fioir 1 "county, 'the Florida. each stoUent tbe tralnmg.needed for tbe fialdof. : 11-.
.jprlvatW ,Individualsconcerna I : > a, l(taken to various parts' of r-'t.te 1 r for --building, special labor to, be.en< '
j' : ]
n ; : !# prio and djthiy, :ra p it / tered as a life work;, In
the
ol. 'h l'-gre'at' upon aim
V opomtlous4jn, iwhichUht pubJic *7LegIlatIonbvt."tbIs.; ,. School' The tourist"who5 1reciateithe( planted seVern-eigth anace'tla : and and varied resources; every case ,Is-.to. -make .yearsofpj-;
V i f They wilI"pie.s.'no, J JJoard. 41 r0PJhl( '17* : I 'cost of;* fioo:: nd :realized 'over' properly' .tleod, *w1) --nsrk our study spent in the College Practical, aw;to the students; byfitting"them "'" : -
'bars'' general. x50lt.nil0,5 R besutlju1can'4njoyh.r''atter the for ",
'
: BO ? that t. .H 1Th1 I JI.rJuu., ,bot some.useful. field of l labor'in;which l allying maybe gain.d; 'V '' f V
.
3. -f.bMe.th.; relato'jto') .'the:pl.lblit3lii they were" candidate, but that lance.of the day,. 'tskes.tho cslc-! cniH U-'ovsr;s! 'life of,."n"ritteq aebA-'Vnei1hhoA-, Stai *\Iieworld, as.,tho>Jnost"desirab4e : .The term are lower than In any except free- luatitiilions.r f ;,>",v"lr". 'hP'-t .rb.
taille" netweeQ
V, .; .ieralitn: which'.very nanes ha ve'beefi';.mentl ned, With refreshing 1 unsophisticated- but not unfelt pbet?y"VilifJnjf brni{. .; even better'' ro'sijlts. mnd, deliglitfal :and:prosperoua -. Each tudent ossigned a sepayate room',.without' ,extra cbarEC. : %(?! ; ,
V. ness the School Doard.vOf Oscepfa ,'r' two'and; three' .thoussnd Wcres; I lii of thetnall.Tt'V : V rtermsctaloguesctcapp1Pio *- V "1
t l ;
i Ittate Is.concerned,:ind the'ti ention'of their, .'name* In over with : pleasure.' .',. .. ,. : i t-f_, 3!
.J..I.1atabould. conault"tb. :.- bounty did not-reallte .J : 1 So we's!ykc"tbe10urt.tawhetb."i (!ad dencounty: Jire/JX>w.planned .Tci'nia'ks a:failure; j in Uhe'State's *''**; Ct'Rev: "
V -i; p i k n'with so lTghaplacecan.; ,GEO.M.'WARrWintcrParkr: ,Ffa.r .r' rA" .:
) \ '
with tobacco seed n&many:: othercoMdei ,vCiuld'm. ,loss ,
/I '. Of bobrd1nsncewiuu anrrnsdltto seriou* to <
(/ ;: -_ '*
'PT. repreiecUwhowlIbeV TVb.eo aid iW ip other light sago acii l'otbW1tl1.*.?| ;pl** any oE : .
'\ their In Middle I and West Flora t 'l >r wma < t-i i|a*j MBf ) Jir fi r.Th.toli fL. "
:'s'ctto ;-ber_re-he dare, e."'* 4 schoolteachers and J to'everytypmrtJn.Oc to r'in"ala..n. Florida : a.t.w l1 7 thepeope generlyiincc ,'Thi jV 'i fV
.
fected'bjrthe an'nonorV( $ l*? atj.,, i ; '
; ,10' "who V Ida will .. t&ls wlnr l -I lift[ .of Wtirjknbwfi'.jrtM'a'toM.'irho pcwlaliy iof'lhe -#., \
.ten.Inlylcu1ti..te wilf
indulge' ord'f "
oIa
yhIto'rs'wlIl judge'or.fdshey. V
V .../ yoU to p. >*k* uch ,'a'n t'fjatrJaw. :) Colonel John"At Jlonderson for 'county Into May; and if they.}wish to livenj.bsicIim.toof \\t. .- ." work cIona at RoITI6s and for' Mr. '"" """ to ctth.' testWy ';
; ? & a iostUMUo, potan .
:
'\ .:; .. :' ---.: *D i,.]'to. biscommunicatlon''.to. In th(>.h rP.1te** piaetjM: ( I ( 1 the *Union cropthi.'eai. *: : 'wilt, judge,'the"oUter thstandlncof dJ9 Collet. brrondt, ].eatfoA.- /'' ,- ,.,,.. ,4; ".; \ 'i /.'
; '
.' t.r--V .tt !p1: ra j !I t.H.O.1 JlU K.1b.ad. (ntef > dancing' .',The resolution I I 1.I noVoW. 1C.p;jptense.heat. *i 1 well as i iIpte" -TOOKaANIZE"l ______r-_ ":" ,.FOK &aonjCOLWyifTliennfT : ;j It, !tel,'hy'the:>Vhbtloti| ; tb.y may jCh 2X.*.'Ji.1Srk". J\JThwlnr.'.D'"D"Dr D.4'I'I'eIIdant"res. Western of OartmouOi'CoIletev.Rsstrr* Unl"t.rty.V'V.' !r4s.. ) \il 1 1 ,
render if& or .; f tplcSleuloul'l-tmpl'OplJr-hdt.' cold would ImHe '! mau..tbemaeh.f.i'_ -" :r.\G;'; ;-\4\ ; f1i l VV
"-1 ndl"ldA&t ,. $ has declare .thtt they :" E.frr'Chlrnianof NOI'thep.J..L D.r-P..lclen Vnl r..n.r. V V =.. ," '
in .t' tn.tI4..nd sectarian tlntolerance, ( ''f: ''.{"I hope the-- commissioners' of tv; Egbert C.I'Smyth D..I).. f'realdeDt of,An"na.cal I\,il F"' ,.
1aw ;
.. .lI ld '. ,nt .' teceV. 1s-ot In therac.. !, bl. 1oc ijIai'a' ; I mistake by remaining permanentfy the-State Executive 'Committee ? .5 CactI f'..n rofPI1.D. t..L 1).4 Pritt. S-taal7'' ) ; ;
I ';"arily fail and beeOtnoV useless enieiirnbance i 5n huT. cart' "has" caused/many" but 1 Iris afsoV:'violation" of tbejconstit.irtl9n to enjoy tbe'.cooliBg sea. ..breezes''I b&e'issued *> ; 'all fojMt" pie ll'la oftbe.Executlve i .unjwi'* "yhold'meeUng'ai { I cha 8Miirklaad; D. D.. Pn.ldent N..mpa H.Agrlcultesalolieg.Aedemy, ndo..ri', "" ;V'": ,".\:.:'V fl"!_? fit t.I t.d

.:V t&pontb4statlst. books. .aipi rant fW,Florida to breathe and |iaw* of the credit state:iofFloTid'andrej1ect :!ulJIne,; j ".!;.t i" b Iawlnt Conimltfeetobeheldjrd the!'d1et-4ay.poa.Ibi.and.: ntjy 4t'Rev.'S.C.Bart.t-Ex.Prss1d.nt1)artmouthcoLMye.Fnnet.lt: RU. I). D. ProL Gen'Theii1ogcal$ &eUl''i'' ; &' '' J"t', ; 11 \ '/'.,
I ;
.
:: The'l Wl 6hjtIIit1.: know *po either : r'j" ;4 H .r" ; i 5,5, twha&.insounttheyeaan.i4bwta 011" If Wrt .. n.i.Pnd..llarnttt V )' .', .),4"'Y'"Mj' V
t : a4gprac.Is Ijh'odep,jnelief1 l .foMhejrv; '. ., ,:. ., IJ vll : r"e t.i.J tIi.. J. IJIol'enott4. ". (
lao.litt f' upon the;)nteligeVeof'; rtern\ .,/. ; : t. ;/sadA;wb.t; .terfiil In the Adaml.1v U. ProfJohns Hopkiaa UDiYe"'I:1' ; 1r 7.lili' ti.
'
i bUlty '
: "
'C i
t.
r. Ddeiao If.jf.d. 11'
1J y Q&Jm.) :. .
F
( ,
; I L.iQIlId..I'h n. Pro '
.
ib..JlopklD'' :
; PabU p .' riof1.1.: txer* of.t .b rd/ r.-.upon thc'peoof -.ii'l, KUCJC.1',. ','' Way: o(t orei flora,,''agricultural l 1 |>ro> Jotla B. Clar n Ualftnlty. "" ? '
i.,4, YJ 1- .ded'M' .. - Osceola' county It .is an att.ntpttoJnjcct'rc1iIous(4 ducU*i6,1.tnc fact;:of:*ferjrtMnKhaf 'Cbariea""EmeJ'loniUeaD'U' ,_I1Co ) : '.t( '. 'N ta
,
.l4ffo' ugti. trelt"-.pea--the : The 'resemblanctt 'h.'is )'fJ.t'li
: ,t ,ID '\ib''ilnf',poljti i.; :, o pornts ot and lion will be-formed, and _eeet1r'.boped. srn : 'Prof.-W. 1I 'WaddeD "aIU.'f. 'Yu' r ',
t booVs riot backed tip i by the. ttle,I ba U!:.iitere.tednium.\ I ( n9mlnfttIcnatoct7In 'differenc.betweei''muck'V ; and'stablo that every it1zen! : of.the \ r rWiU.I r i\ allpngo; thq, ,.t'f1 '*:*ttention i ,i::w.CIIunb1U V n. D,. Prof. Aodoer7li.olog4&; 8"t*ieary VV V ,;.,. ,,'1 ''.-." VV' \\1''''If\ i'iff.' ,o-1&;ttit i& V
;f t" ''ntf 1tfof/tbe'" V.d.tffeciiiganalit j< "and :prejudlc' 'Into'tour : 'Jq'1fI.fJm. irtii at, ,l admlratlbu., and attract. j 1 G5itrg. 1l1U'It. b.. n., Pt'of Andover'l'hIorkal.lMullla.r,., ; 'f" j\tf: ;
public )
entlyJo:eiclfi l \. ",snjtn. A *nanuroar: explained byth tijntH.-4 4 i tff +i> -i.f. l.iv.- -vvt -. ,O-Carl., H. WUooxt.ProI LawreDCe9'ln.SchooL -. V ., :,
.:. ; : ; ? Vigierbon '..tf'orO V),1 'C' .r, ".y V,, 1',.." ,, .' law ;: 4 t.h',.'Q9"fr)..v.Scbool "e 9 Jtq I.I'Y.. ':toflqs} J...:: '1 q ''tl !)tit be.f.r. !'Qa.tR'orgeni4atOI '' nirt9& ,. ..T ; '. ". \1../. I t. B,T11u.. D.u. Proj.mhe.t.ColI r..4 I ,pi Iir'&V. V /II'+ ,. 'd 1 I. '' '. \' .
"'' : 'l ; 'I Board oT' OsceoU county 'rescindsaction. V Jhope to>Miv th* h : lUlls a, WardEx.Pld.nt Med Hol,1Olto .. I. ", llt
$ arty 'I' ,
., ,. .... 1- .No._ !ht- : 'sft.r.'polit I" : an. ., .i:Both'are, derived,''f rota.d .Y!4 I \ ,? } )St.t. : CO-OI'I :x.. kmU1 HutIDCW Mm.r.J.olwO.coa '' k11.clr
\ Its. .. 3 ml i*Jscksony1flesd i yhas" it..II"pjw.I: pr.'Poe.tef l' .geUbU Walter, l eft her bo.ino'rplant $ ira especiallyinvited( 'to-'attend .lusbodiiand oration aad jprorofiil H.ponMfth.j?! I< -'c"' .", ". ., ',; ,' ." .- .". "" '.. ."ri.,'. '"'N.V..t1.penlt1''i._'. ..... \ _'., < t1r.. 'tyV ,
.
.
1" : : : : ; "
the better It Vill be for the I ; BosrdVof C V V V V It v
!'p.i liib; b..I t J d: been men- ..., -. nutrition than, ,th.:ripriginal\ d eg i J J' V ysirliws' '" ; "" V' i." (, ,J i\ll '119 V 1"1. l r. V ,

V '_" -. .-:".'!., "0 J"I'- :':'' t : !, .' ; rA'EPevv : .;_- I Joo. ,;of( the. couniv'Tevarese" I materialsroinjwhith, :'l6.$' ".," "|j 'r..e.fi :s4smsotbas: ..enmaa4 ,.ili>n.'' arid*, of; public J 'd.pfrited( pri&vi ; t* :1 7'w" JIfI'' '-'fIN', I.' 1"0't' _r .: fj. h": ,.. !

1r.1l; n honesty. ,. '; t.i nt.h.ac.I tea ndJ : $. I r. '
th cd.t401.1iabt.'wnuf- tit'
G ; u ttnougb : '
.
panc J 2S.iS
(
V f. v L ,
It'l. booei4If \ :' .d. t' ,'" ,' 1 : :
)
ddeth'prteiit .N .ij
; L V VV'4 VV f.' : "' 'l:4'
IeitaMtjat' nt i :r" !
> V.i9S
..:"; ) ( .'of Colonel! "ckl'lOft.",one111otyetutMj4 r voided fmmity, "strow" 'gTain'andjegetble"r Tha r.1ldshi ogrnted. a. spe- j 'f' L .tr..t:.; .' 4'b "'
: V .timeiJ"' .. .,.b i: "''1l' : ; i. 1&'count7Ilo ti'1iatt t ) .'m" O"l." ';' I taw"or'', resolution refer;i Vo/in the ; -\tatbt.\ ceaw.-t.. 00101' '*" 7iAt. ";::'. / Sa9t1... f .. .4.44W' :. !. .
V ( QLb4 i..et'e l brok.rt ushedndrecel f row all poJntf.ln t J the Stare'J' ticket ; <1'\f\ ; :;
... l' to : 'tif'tb'ei11t ifedei .4} t:; ,. .lIy ssq.44IaP'i' .... 7tsw.* 'r "l't' i ". ''. 'iJ1'k1 ,1, '
d !
loD".1ITaldfl. tbi t jejwas;j>*fs : r fItC to ; soid l ; lU'cJt: jlmitei% : .. ,1' 1Jtirt1'1''0
r4 tath
.,. altVoiLThjU fight promise*to be '' .1\1t the< ( n; r ., ) r.leL Pai-kft". F1ouMeatCannedG .' ::
n
r4j f". '"' complicated t '.''*ndlntkeaiiagvtugbtJDPiads I e.s.r. 0 *,.Ift'"f'IlfJSr:1'( rJr..I: .of.oMcqIAt .' c. aAfmai's",tomach," and j!. #:|ithf\ThV 1oIEijiu41bote rates TeaisJo.iib-yrp. predti,1dli*. : '..t"'f' \' :
,
-
< "d"h4t4a l U'' rtIIUht"1 U "'alia' .. ,\ v
i'i't .1.9-! .
*- ,, ,
be
+ .
-
[t'i1', ,. I :1 ; h ; .i.s hav. jjpeiiiaeepwtd JfijNew..'Dtfval a'.t -' mv-; -r.'" 'I .i\ .. 1\ t'
.-. .4. ,. ; sed.4um "t# : csin-ths-tnnurs b-t ta i CoWrHOWSCBOM;'.SOT* 'ft1Wltoopl ,. ,: "ii-hf. #' _.
V -tG1u.eODfU. \' t.' (t" 1'. change c indltio| iVT d1",_. .11-\7..hjrhlsasg ..dMuC1u; iketa4do' ""yd.:y.gtb4tatter 't"-, and Placid*,' :'1.50 per dayjOrandtwojin Coogh' Croup OC mar ptiss ff ov.in ",' .". ,.; '1." .."i''t'EI.It'.2, .," ,...J.. -'rf1". '-' .F'.";.,t.. .,:. .'1 ",l.1.. ''H,.t", ..f.,_;I"h:!
; IsIilo ohlMPIeMnt-. -Ii-
1Wt- U"'r 'I recommend 1aJa1.g Cod Live.OH to vettCMUomjitlon tnrtt,o.CJar4, e t$3oq eo1Id. t ; ,-1i
(V 4,, ''' > gktewlngthtbALPrOPhOej( i ." I Bivachltls spd'all w*< tlriaisa | ,pot haying served the, toO.fti; "f' .;:,. ,.. tal.and C Pets rsniedy-lor'd111d1'oetip.ot5e' ;1'I. \ '" '''. I 1. .' .'tQ.. .uttJ .''from'afar- 'off,: f or:'tQ.lRtl\atlQll 'I es.'>- ,This_fatty oil ,Un -__nyr so pup! ts4of n .trit 1
tta '. the 'I
Is
I.xtr.iii.Iy P.t : E1 .y i'-.t !
V \ .M' :; '* ; i ...,1...t.w 'a f 1Jtoqatl-OIII,. ""'raj. "rt. ,1 y t.,.. =' t*.e.h.jack.onPII1IrB0ard'OfTradohave _. "T""'' l ''& ;ltIXl'rltM C !. :; ,
'' .
_. J .uOn JaWIIa. Jeoclott *use Ie their 1n7..1I.'N '
tt wttl Wiiilu.to-Vbatrly.7uHT' J'49ftb11.w. ) )y-Lk a 1 Iii } = c-L.
-'' ir >; k f '..*. VJ ( ; I '; .f i 1 sd't. ] .V B*. w" iw mmmIwUaA <..' .. ,,. .,.,.. :. ..,..._. :1.. ,. ,.-
a & .ili.sfr yearn agor ',..Utr o.: p. C-p fiJJ. I ff't ..1........... ;v.. t1V i jtos,4wsa. *lfkiM.tlM l- ; -7-. l ..-. _. V' . ,., ..r \
.
1L':7 .
:.v : <
I.ab "";" ':' .1Jftr .by' ':.perb. f 1D t t"i T. Cf' 0. .W5TxtVtVifrInF ( ; ": at aAalasii nati) !' T! ,..r-'Snrvtr.-; '-rif.J -,? ::' 1.wr. ; "
; ck QIDJ1Utt. -tit.. alrite tOlianl. *ril. WUliaM> : "
:1' -:; >'' ,;T'-I reprssoisdng .anri'flllt.l. W"" 1 r ", -i 't ,
a uIAt.'IIt't.t. WIth duI Hypqhabft'e. of j.imi D/I",'. itIlidflUoed. el., p ";4"" ._ .,. .' .I )11aI_,& J. 11"I'.. 011'1' 1 .
".l > Of" !
", i 1-t i .J; ; Irga.ls sn..a4.eaaase,II 1IICIIed-l b P1155 a".ltc'"lt f tile prtt. "PENNYR ; t tc'
..
:
.
beU
: ck jJ..t n I ,
,- ', ", r. Y :
\ ,)C .g .." 1-110,...,1 ..II ieee aa.l1ItIUr/". o; kverVb *)' ; _
.z'',.. _I\1 t _. Jbe.. I u'.t' ii..rv. d'0pfInSOrsppd : !\ = .,: : ::.c I'Md-t ,"\10.f1lly, : \ '-11 \ .,.,it
m V'" '. III .. diIflE b..ar 101'pc aadIO r bcI-n' asv ."- : :
; '..
'' .. e .. '. .--. la' C, W".c.' ".roGCO.; .. ; } .t..l
\ 'l' ,
J" .
l T", ,_ Jtc. : { >. : ,
.. 1 1&.J1 : ii""
'
of'I'N -
.
VVVV V '1'1 t ,\.">";- 'U .A r. ti J.9 "fA i"t'f.iI''i .6 .i\" !,; ; ;: V .
.
'f qi (.r ( ). ..t"if tg "; : rTV.ir4' ., 1. .. ,. ". "I ., ,,' ', ,. '. I.J ,..11.-
f r. ... '.J'}. h; ( .< ,. 'I"-/t JI, r!_,,"Z:.iIo1.t.: jJ"J./'I' 1' I, J -' ; ": JI. 7'-'i' : < -- '. .- ,- ',.,..,." .,' .", .'Y9.1' "I'.. ., .-,'). (,.'.,, .,.,. ",('.
v .,' .; 4fc* ? .>< .: ; J f"-"
,
.". .'i ;'" :.; u. \ -.,,. ..' ., '-' lV'; 'r "N -.. : m:1 i, : ",:1,fItr.Sl"\l" '., 1J'
'
.
.
v. I. 'C .
VV V' V ". '. "\ .\\:: '" .:.oI

1''V.. .
- '
-J
-u-- .
:
V' :1
-r 'r



'V "T1 ljFr40111x > -' _ 5-- S_ _

/ -j

) .*'/., fr
., 4:4 '
t' : "; .

.. J." ., .-, ,. ,
:1. .l"
: r ,. "' ,, "' >,l" -
r "g foil'jy""' I'J .
.
\ n' I t'I\lfJt .. 'flr" /" ss qt443.nJlJIr1pJT
;: '. ... .' I''1" '" ; f'I..:.,' *irJS V& Jtfllj') [Vs Iff "" J *!. v" J. 4*. -55 5/ : -- -. St, '

;; r _i. :- 1J-I -i-r -4J: ,f 11,1'II .- J "l'' r. -. II5IiJmIntrft: i7iIS. [1TIrI11L ; '.iIri5aii -. r -LII I' pSif 'S-i" S .

;.mm <_: k 7 _. .<,, ..- ; : _!" .'-#: ;' r., .

S-S p
.
.
p.. -
'at' ; ;, "iJ.. ,\ .....- .,. ftl 11'11 .
.5. ., S SS -. ",
{ "5fr' '
r '
.. '. II" ,'. ,!;1"y..._.', +."iI't.rrrr..."-'t". .t '.. { -;- .. .11.. .. '. IJIf8IIa _?:_ : :: .t{: .A e" .ee 'scaIs .--' ,lit- I T1te1'rJ1i".' '' "

-" .,::4iO--Aa. 0tJIM : "..ri ., A,P1W. "i:1. 3!' "J-.r UAI A" A t. wVattOMH WMMMVMy,"
17'f i' "''. '." zt=Jbaceo = .o "
-
17 -, ; r ''w4r WI'' 5- :
.. '-" J" 1g.Dr. 'ea'I'. =
TO .P r.
: : .I" '
"r- S .
HECVL4 .
.
.q. 'W_ 4r )P. 5
: L II IIJ' ,. .( l.
: -
o t r.rI7.e. : ": .'JueObaeetIw $ 0.. .. .Oa2p '. pste.Thass -
'
ow.l >1 I,. 's. j1r'r- 'U' ;f'1w' tb* original ."oA..wwJnla .. eI .
". ". 'W,.''D tt i JI89errWrd.n ; '' 7A58tJPEME I ,i.t '' '''I''t-I'1o'j .''I' ,, 4 OJMJoa o .' ."JIJp.' k,;; \ ,l. ';''- I 'JFRIEIDS'Olr ; "u..: Jmupjup ay: __* end 1'J'l"- Haute.ra"t.oualy .
'. S ,
the bUl I -
iDg .ari'fi.pneeet : ,:rlIlf;DlUPPOlmDQ' ; feriMe "** __ ; kUlicl'ii .
COuR DEthON '- .THE I8IOIIIIDJOOdS mES .
j '' ,'. ''.1 ,tb..CJoo. 1 i iS"M RENDER8. gation against A* eompme.] ;"r'", ; ;A'jj .. t"- I:yor& *$th.1 *. .-"- .c ..- _E.JJiV2nfSm. Akeedni iajnred aafnUow! *! __
.5 5I the ofth. vIce chance" i'1\.jt, t ; "' tiel .w be .pcetfl.rote \ ;f fr' {
language .I- : f''r en e.g. s ,.
: "< 'aay'that.'tbework'of' A ':" (' S \y 1. .M. .... :, t .ir"Ir .''S. ,. ,.,.'1._ '. ;,.. learned: tb*" Oxauatoddr* Bxtoook Tbe. aodden.. wa the .. .
,. m: Ion; the action wa*brought .... cf $124W .kw.dve4 pounds of .T'.. .7 !,!,.....' latter in wmthwoaatarday. IldhIScUhlI ,',
.T..n. to the rain
tloflng tbir.,iuprlaonmeqkt n. w. .. ...C P.i.j U>. defendant from tranaaettog tkirmanner .: n.t.s..ai.it T"P"T tam4 and .amtosIse:. ._ ..,'. war + ? heavy
i' 1-.lUp) = : ,lM GI..ad orbjd laiI 'Vb.lt rireroe r.ovarnowed _
.
IM.r- "., .Wamheel WMS < &
rij f"r Ht'n \9u4 a. i .r 9mm1IAl! bii.inend-*.ea v. -' ,= 11''XCt e } k f*rV ..t'\ .. (SlatS. th.ws, sithoegh' be and the back water .

r I S u _;, J 'prejudicial tol!;tb* ocpplafa 1;_";S_ *.'s.w. ..P-etsseshvk5. 5 .t...U, ? (" ,i' ** 'i'd I\.i\ .I had assepi.4 tha I ..ioB to do 10.. out the track of Uie Terra .
fl''t'-v' '
Dto and fujuriow.ta th.peopl. pi the "" ." y.; 'c"rel1dou.Wedn.edsy ""Tla ndecerab1ybssavorag. !' 'll '_ ',' "t
.1' !
-
'Th.i.rgauaniLimporiid. : Ia. that worn Train on how
; SIt .poeulM ; were running .
'
_
J'J J.
"
,' dtJ'.r .. 'Th ,of eorijla" ba tate of Nw JerMyJ"' ..J>* " ;.d 1p rite'than -.;*.. agar, > &i 11.i ,1Lu '5 rtfi&{ wilt b mad to Oncv but Waeu the cwnnwr baU I traito i itb iti ",
.{ ,"t.i, ar* 800.000,00*ubU Eoff-.. *npr m*c nrti\ .X ..Th. bill.we* ftlei'by Attorney Genera eohedul a4njfl add abont.lwaaty'million $. > t. ,, 1 }iBry, ( i ftonooactoa .
agreed ta. port arW.that h ntad ll.WedOeday. teomiagbankmcmt .amn
rendered < decision agalntt iU>a.Koblet. ( outy ooantry eotn .
.t' land,, 20,000,000; ,O r.By;. Hb* : Stockton, on the petition of f.-K, dollar to the annual revenue : ,Wty acaroety! ever contained! j"isrjermoroentbaulasUO :
.the .withOr nd .
:ndde '
., wba'Aardared-her hatbanO 'A.1..ba"bou.cJ.rr'" treaty;. filet 1 lubmieaioa' the. J**>* yof !ll"1acI *,
: .
.'Ji' aia* ia Italy.; 18.000,000, In'8pain:> dPwrtpgaL and IIJtl.*'IOID. othef and' ncoeMfalffort a Frank-: Miller, "jobber* to pap t Britain .'wthoat{ ', amndmeat, M .,.5 points',which .remain to be daw "" oil iIa.Uaitcnia'"t' the 'WWI..t'" ( nh; ";T .l'nr.* ', ; part of the mokx dropped into about "_ _

r' ztz: .. ; .) in her, behalf> i* madeabe. ,...' cigarette; with "whom the American, ...baasJ., k* J., ; aided M* the 'dUlribntion of tb. dutJ'on o ". "."than'orowdodlUpaoe.tt : f "There,ar* igna (ia 0.2; .-blxf.etei.wter.. '.._ _

: "I offer the death penalty.TbU ) .- Tobacco. .Company. 'fu ed, to'. deelaccording ,. -S The arbitration treaty wa not eo*i auger- shove and below alnety-, I > tte do r* nanclll7..l.h' ,Tdo** that tfcpown hall apply.sen! ; rntb4r'. William MeOntobexw '

:: .U ho elght-hour-a-dty Idea'Oould: ODe of the moat 'retabl.' _to_the allegation of .Ui* .*ldrd.bat U.will; be taken Up eta .lDo1dID.tJa.differential *. Miller, '..'they persisted In alec ipeolal meeting of the. oommltte* tob refined ngar and u.ooonterraUlng1d ral14 .'14.1:the;: arbitration .exento- bedrt BcW an..wa. killed,: CtMbdnotorOorge
b Mteblii&dltwonld **j* the.Tol- oa*** to 'the 'criminal bictory.ef the (, .. ;treaty I the Ork troop ar. .
t I 5
r j tielp ..' Tbel.gel 1 proceeding weTa.thetnoef handling a brand of cigarette. mean-. .,*bld Fri ,, ., ;ty to. btl.vied ,upon,*-5. "' 1r7lngpoutl.s5 1// now: pend1ngatheVnit.4.8tctei:, r from s'epoci41 perUo_iioaI .'!''' .It: ,jBeanC.of. Terr '&11" who '

r.f.f.c -e4,rt (Oblo'Bee) /probably ,inoretfrol hotly contented' and many new featured by a rival corporation.' Th appointment of W; B.Jwtt atotmaterkt -- : > it'. ienete-- ,,.,- '* S S ... ,from Con.tanUnopU**ytIt wee to tie eraok vw, (4l*< killed Ai

,*tbo labor problem 'Ihan.alllb* palate Uwrb tU 'federtl' and tUte,. Vice Chancellor.Beei hold that thee1tfbontbuen1tidlotionflbnt .Kraniton, III.- wa re.eaiTed -- S ..I'&OR- : SJ Mayor Strong',:dellrerdtabrWeechTIa :: i I j U believed here that the diplomatic. rejported that. there were IB paateneT .

S -t 'eot* 'of ,Itgltlatloo/'that( : : "b* *n* were .trodu*. i, .-th* ate] po.tma.i* reported., UIoaIacQ7EIflrt.* "which"heaaid."In. Jiarir''"" : iireNDk.U".7'OIua..arur ."- .Tir-We raHJttaCAli I..J\w ',thai _
'
N" S .5 .Th. dllChioD _I. "the -fate?? of Oa' tit* proceeding hottld'"UT*> been .Liba,.JIu ll4* i rtl tha '."..wan. eliI, W.s.. .. "-''W*-are-eaJied her*_.to_ah. out 111'doreemoat -urjvw |{rwiwH* wv- permit .tb war* killed tf", 5m' ;.., .AM ., ">7"i ;'

e ,- Gamble also, ai bU 'centeno*-wa' -gbt-br1II..tun'lIt" "lit.nd the reading; a letter from Governor, KarrHM*The Waeeken Ove Bile Bier,, to that ezpreeai of one o( Pnwk troop to co-operate under Euvropean "i SJborWy after;tb*' *to-;".(_ ;

r BT..,.th* Bo ton 'qTob ( j'WIf*' only prolonged o nsItth.4.ct.touof/. that corporation bnv. e right .Bra41.,, of..Kentvoky, annonnelng Edward-Otedding. 'a ''._..liviag* the greatest toiUtary men of hi* tUn"Let < : 'Jofflcen1 to paoiflcaUoB-of the ctevaa aiiread'antU>1t.... ,100ieetwIde'Th'

Si S 7 :wtnU4"- *.*---r--'sign lit fronl oF -TbonMon tbe vupreme oouri" when-legally) f ormed,to deal the cam the appointiaent of Andrew T; Wood neat S.mw"tI.O.M4 been' itt for a* hare peao*.' ". :' the lsIand-ef--Onet ..",Greece. hAl ; ,. :.t : _ _
.
tb. Bldiletord 'Fool road' and' at anFtmblwa) r the direct j can.* a* individual The' point relied by a* ataatoc to nooeed Mr. BJackbnra. eeveral week with the prevaUnt grip.' S :.&11; Seth Low;wao :1. a* signified her" *ubmiwlo*."te.,.; tb*:..altirmatnl ". .tTh. *Vagjag ear as&thS'amoks,;- _

of Mr*.'Noble*' arrest, foP a* oon a* the complainant cud vlo* ianocllceBeOd's S Mr. ROM wa* oa him feet ."-jino A ...",5agi. h* became, won and .th* first apaekonP j *Midi T. ; *.of the power1'. <,' which'contained the'Ol-lated.sapnt. _
| ><)t hub. acoonat* it bad not been taken In, full view b* inferred ( .5fll \.oat.ec1'f DC 'iMo kntb SeldWhere ,
th'e offlcer"beean, to ;r&Deitlon'bim be may with,a notion tha) )the _-.,b* Monday morning died at leant h* was ,'Xatamatioaaf law fa !ponation. : "

S report th. Z.hneb.ofrns1., And; told .very Ihlngf and. bnplicated1' not from the following ayllsLnswhlch h* worn.. ,_* ", -, pronounced dead.; by'' ,doctor,.' anne .. There ar.no tribunal! In .xUtentf lZ1ZTVNDEZ.. -- .1VATE11- tt' *col.I.at.osUrr.hth.NIs ; :1'
yet the women hav 'outunmbered th* S orjy- himself but MrNoble, Mary ba attached to the decitlon.ft. .' Mr, Oonaan mad motion that th. and relative SS *.to' enforce .UUtrnatl6naI law. "w"rio: We i rl'a ?Q. ;ttreteb'fof ,embanks ..
.3in45 i **
men *in'Mtlu* for 130 yeu Ftmblea;, Debby Noble) ,'-a daughter A court.of eqatty.doee not puie UM credentials* of Mr.;Wood be !referred to Tb* coffin wa ordered ana the body Bach a thing a* eyaUmatio arbitration I $S Ui.1 Ja '_. flte ..,. meat', upon which .'the traek i*.

S of the inurdervdi'' n.ii5snd5DaLton;, power to rmtreM *oirporaUoa ercaatzad the committee on privilege and-election wa p pared for buriaU-Jto after* p..un. .. great thing whoa I No bodie-wer'n6overed 3bundayfromtb laid., This wa surrounded. with bank _
under the form 'of law fro'pertorialeg that the UTolTed two rued will aoffcrin I water1 from White river. It I* uppoeed
*, .tjoae.y1h'
JollIlII'' remarking queeUoae aooa it wa' placed to.the eeflto, and ( of tli* Evansville and '
X reUar nt in Nw" York 7a1epl.7itll. ; S _U within'. It"* rr- ." rt"- '. that- Fewndhog'bu.t-r.w.4n&.th* '. I
The** flye were boond over' to tt.grand fpoHU> / were'weli anderctoodT : the iCU.Gt.0 tekl>la(*_Tu-, war |nv'AT* yeural -, tty 'Tern IJaute paaBengeiTbalariarWBlterivernear

.'ltfu "Oycte'r* Cooked. OneS < Hon--, Jury. ',Excitement ran bighiand; sense some*f ue steps> taken'la orfaaltlatth Mr. Hoa said that h..o' not cbs day morning .' jr .'' .. i* th*begiaalngOf a new Stein cpread- Er-.w., 'Ind ..WdneeETan.Tille embankment to?' en...a, aa'a _ _

; .dred Way*." and a German in: }. li' Judge Smith'of that circuit 'called a .compan/niay Jitae.beta. jUiecularbecautathe .lees to that notion and th*"eredeatialf- S S '- Daring th* availing% wbenthe'roomwa Inglaw. Without the detail)*,the treaty day mOJ'llID' :' ; : "- flood '.M..that. th.wMei followed., .
the
b*<,writteA a'T>ook"in whloh h* :d.,. ipeciat term o.f Twigg superior conr\, purpo..ofthi. ueorperatloB were referred.. full, of the dead man'. frindiwhowen iton abonU winks acceptable to alL ''nl'' death lIetbe$. 1AilgnOf xeaking' .w.-.we.- '.
SloSriy otAtoA'f14 -*. which 0nyened tw 1'B.ka thereaftBr.on nar haT bam to cttabltoh a _01'017. Then JBoarpreentod written' talking to low tone, a voiee n at Hon.'Charles 8.-& ilel hen,.*' read'th ,- ,:who wa a door-keeper at Th. alepraad Jadiee'Teooh" wa*
*:>o/pook/ '
oribo
S C the TIlL Jay of July"- Gut Parables, : ."I..Under_ oondltlou fai| >wwraatoI notice of twa-pTDfoeead' ...eIIII.D&4I to beard leaning from th.eoffla" On of tj1gresolnUonsi th*. lat MMion' of the bdlena,Jegia- taken back to' Tindnne-aay' BvancvUl S5,
yet th.*) bmt .r i*: the oyiter"that the to the of radical people wore-In tb* deeper, to-: "
EUcabeth Nobl..lary Famble ;end pnxwodlnv ebaUmc might, the rale lot the senate of a &. bolder man opened 'be $lid sad ""Whareac/AOerionaMUd patient nacotlaUon laIn 1* oonflrmed.\ '. ,
I all'; cooked' all,.and .'tbrvbct Dalton Joiner were Indicted.by' the tile eorporatlon to uoreIM Its franobl.*., .tue. ,:' i-c,: h" Oaddiag roee to a lilting poator and a trwUy fir the, arbitration wtthlaH S vjt I ta also known that W B.Tblllip. i eluding Btat 8nl0r "Leteb and wJIe '.,,.-

S ': : .l..iJ.uIJ llUbat ba"ad. ; Xrandjnfy; and put'npon $trial'They S f.1A tnuUaff or aiuintaotarli oorpota. Tb moat Important we":::*, according' jpoknte !1rTn. 5Hsdre.se4 i yTl'ly'i"rand euUef f"Fwf'W1IfII Ia=IIre.-' ,i.ter.4ngIiicla-paU-- .
: "aner.--lililJ 1Iif T tMr7Hoerns It'00'ha4 wIfe cad lee. E. -' --
notice be
wrilfan -
.
; i alt trtadlogelheranil" \. bed and at last there
wer* put to. so. Matte la dlfferenoe between theVailed It i* b.UevM'by:many:that ar* .
: Mexican p.per"' commenting ,ppoi Jlth of Saly) the trial ended, tie jury proceeding. .jew,ba* the seme aothorltya "enable the aeaate to act oa legislation count;h. U.,reported Improved' and Rate and OVM*Britain.wa Vlgaed oa the twelv or fifteen bod ie* .in the wrecks.. o5-x.turnIag1rctn5l&is.jauguraUe.' .ad

5 .Jreee. football pm.la th ,city r : of briDgfag ba a ".rdl,''ot irnilty a* to an Indlrldaa trxln or BattvCaotanr to when U declrea after a rea onabl*de Use ere now hopes of.his recovery, lila d&t of Jaanary >aU,l>r toe repeaUveplalpo Tb*ester 1* rising andTiotliTag can ,,01'PresIdent .NoKhl"/. .. 'l'be1" ) I
Mr... Noble, (Ins, Famble ..0H.rl-! lieU or eonilcn II*cood to eMt i ) It*Millar bate.It provide that on any bill or Doctor .,-i, 1* .'<('r.markabl ceec eatlarleetwOBaUoaia, >d, be S dona Invthe.e arch-) 'until the then reeairartog telegram ft JbWr *aley,- 'r"

b. ,. ;:Mexico";: declare" that' th. p... muoh FamblwC Debby Noble and Dalton: agents and to Impoi condition* a*to whom rolntion under',eoniideration more of anipendid animation and r the 'elm-. ."W_, The, VaIW. ha*.alway falja, which may not b*'until several : I1IrHo u.ri !'Lt '

: nQratrtitaL5'than' -bull: fighting... >*It, Joiner were released. No appeal'.g &Iae1 shall oU sad.lbs term -npon whluh- thai en* day a'aeaator may demand pie folk In the ...". ate all. agog ease an eara et adToeato -of latoraaUonal da '" S \'FATAI. FIHBKUlMTatWI .

o4 :-%-xuu.t, 1>* nCOltIu ..that *o.fat a* th* mad for a n.w JLrlal or. an. ,appealof, t. 'they eIa..holl.0- 'that the dbat b* olo.ed.'':lf a majority with. *opei titlou. excitement arbltntloaiaad.i j 1T .. .. ..
ao.- a-yewrtla
."t A 4.-Nlb'aln1AC the offlam aa&Igenti : 'of the Mnalori',*o" :lelrad there -- r .' n U'8LEOfSLATYBE. Three I 5.r-
:7 T 4p6tso engaged in&..ej a"lI III.D" any nitur take. ,: j-f, = ."_. XW'propoeea' beatT'tUelf; ,: "" .z'-r -l.' : .:;r.. :., .:
from t.
or aoorporaUoa moating oorporat hoold bee TO* without farther delay -ilJ.iiVEhIiLEvLZ5 '
A the for the execution 1 TMrs. -
d.y" f> ;, w'hMk I* lot th*trial tent ot only Aw. .an, .AjBroblJtn.TerkT, ,
are.oenceratd! bull .fighting dittble* *oU to the MUM em the teen..cjolai and no motion ,should be Jn"oed.r. a-hItI_ '1.- us..e..te .1.li. .. ,
., : N oble :
< approached .organised. .. ', I*atarked thronf boot by trial oonMrraUoaandoMtMoat th.rg.e by :. :;
to b.Jh. work -of
fowor .then th American .' .tag the. pending :th YoM baonetoadJourn. $0.45 .p or .1s stS. day nppoed aa-
I men *
0 iMsrpeMsIs.
: gam the th..tat.
movement' w en--o rportlUOD..IMoIr.- .
among > be .. The *.- .
S S therefore, It A Nashville dispatch _
,' i...r Htui HKf iaaugnrated to bare Mr:No* ortotakesreo.pe. .. "JT." '. > .. I. Tt.sac c.rccss.A ." J._ yi incendiary,"_.a lbs cJ uftbree3&1& .
wa* 1 ". :That U with lcU4ettlMo >
at
; aooor our paesed..billjueorporstingthe.Centennisi '
TRIAL FOR > tf
S NEW JBTDKH.? .Th. other amendment propoeed wa diipatoh'from 0-.n.lDoe''alloate pereoD..d iuJarect..oth.1IadJr" .
ble from the ._ '
gollow ., : : '
AcUntiflaJourbalt7! *: VA burnS -. '" *tanmchovt the Und,W*reipeotfoilyaetltloB City and both; .bouao* that It I* that th* /will' die4'
M. to l'J'.t.D' the tntermption.of the *nato enbject In oeneotlonwith thought .t
'. hulls .ni'r. ,Motion for new trial bar been esp.q ,'<3*.f*V 0... .II". .. oar natloaal isaste l for In.raUflotloa *- p..aed..b111. .x.o.ri1k. _
,, '11' tb. bet* < oord:far;: axnlle ,. ." and'provided that if Ta.Mniitor tb. big fight wa broached Wedfneedey .Th. *.dead *rs'J: : .
mad to both stat and federal eonrte, ChaM rae U IJf .
l < -of the M signed bf the. .tax of 8 seats 'tor : treaty ipreeoBtaUre Ivy s .J15 Mr.Annie Duncan Charle!
-
dittene S
ooverlog the Ja'balfjxninute. mad a'01 notua there when the referee ,
a
conrt 0-.811.
,
and the effort to ccv.bee life bve Th. o-Georgia by a a.q !
supreme of the high eentraeang centennial hlbi&! : '
partle making .
:; ,Thn alxJloon ba.'cfoae the been th. most vigoron in the history *derision rendered Friday revereed Ibe .would be a:roll call, and U the rrM S submitted to Oorbett and Fituimmon > the a *" Jard forty yean old;' "7ohnDnnoan." .' ,.
:, Bew>lT.d, Thai we heartily ooaoor la :.In' th. boat" };. Bedman. totrodaoed mntb old.. '
r :;xnile .ln\\ ,.,ty' _*epond The: daf.<' of- the at.to- The cai*.,wee carried to' decision of the superior court of.: Talbot !- one of a quorum wa diooloaed fmatne > his interpretatioQ" .the Qneeneberry 4eolaratloan -a n. Iett.r2wss:: .thrown from :the _
{ ; ; tbe United t..te. .upr.ui.. court. county and granted-a new trial tow Should be proceeded.with.1 1. rule _,: ;_- 5--- ; S'S ?- '. "
c jl>Iao I b.Ia by the 'an..i'.Dii in I the treaty pr Mot* to the world the pnbliabed a certain newspaper that fourth etory wipdowby his notber,
Xa xeontiv ..eeeaioa the senatereooniildered Biler'a aommunloatioa.which wa to
Li |
'The la t centenoe wa paued on Ryder, the layer of MieJalli) .. :
eertala to lie followed by member bad been offered$loOO to '
CtorMu eianple a ,
"V
Annte Duncan
L57. tIt we mnt get downteepeed its action the of letter.waCnftVreceived ."JVC. .
; adjourn until nature a forma. -
Ir and the _
)* :;-Nobl. Jane. 28, 1890 Emma 0.*. cad laid.. rorther anqaallBed See!. abeent-'biniMlf wb.sth.' vote:, was "
S' > 1 ob4 cannon bah laid the burroon !: Monday at 1100 lock and agreed with manifestation of-joy at : othenf She followed beraelf a DWi.after:'
: <)ate cot for.her execution Angu : -The Byde "baa"attracted more Ollun'I..loia bill
;, nUoalull 'la rtaDoo sad moral laaoeaeeot taken on th.railroad ;i >
p ;
and died lets in. the :HomeopathioJ
t ,,..... a a..h of'tiglaLl1lJ1noa Ui w1t i" T" '- attention than any otheroferbeinal .that an adjournment abonld be_sIns either pamp.:IThe big_fUow*.read j thsrtiflo.tl of snob a treaty-bard .that DrrJameeTiampsonwae.ffer.bag .- cI'kulJ; -
\ : ds.All !along whIle Uxoio Innumerabl since the famous Woolf oik die Tbia wa found expedient a* no their Utter thoughtfully reserved I IJ boapttat"fromar'a' ,; : if1
bill, ando.n.Krnpp proceeding .' .. ly h*BTorWlmrted to*eaoM ot sdvasolavWaaUo" < > to for signatures toagainst. *a petition
pay 1ln.Oodd.1'Il..f'ialRpCltl.." _
-
-" : -
: r' baeiaee _Ll-be tranccot.41fihi ell' "" :
1 ( J .
proceeding Love been taken in Mr*. trial. : ; '
,
I.
.the bill and .for'apMial .
", Sb. ball an boor IfJDoalut.1o..foouJdbe U5UcibayitIoubtes. : 1 .: ,k5 j. providing cams Urn and received internal injxle *- :
4' I. !goblet. ebatf-the povernofha been record 1 ta the largestthat Monday and even : tb* propriety '
.S he great German: ..xotnufaoturer '5 ,Wa.pe.1e4 so- __ -' .r'eommitte* to, tove U ete Ui* that the doctor mcf'', ,
.. reepitingtht1? .* from'timer to theconrthe* bad' to-dT"wita to made'* that of hi action' to outlining- hi* i i'S noipUal ay .
'
'
:.: of onaonTU] ** lately;'opmplted time and be< declared pa\lit'l7' that'' year*. '" : w" bait boat they would fail ot being 1m, view at thia time, they must H'' dliripated 1,After-tli resolution werV..r read *ndaa querge.- ., r..uUtoherdeaUu-. V" SS .z.11 -

,a number of piper fltld-piac (or th* On "tboulil iio.t bang until Mr*. 1. 'W.,L. flyf.r-shot" with a. doublebarrel mediately-< At 2:40 p. m. now..'Tb fighter could never : the chairman waayabout to put the ETAK8!' TEHBERED AK. OFFICLrsebas.I.vheH. .) '. : r :- '
Noble* decided.- hotrnn Ml.8111.Emma Owe Lbs apeoial a**ion adjourned ale di*' bav agreed upon the rule after > en- 1 question iI..Tuei" _adoption''Wanhop !J ..8TJt .' i
i;. i I'* of"the .G.rmtn!ilnfntry.J:;;.Their.otlibrai cat* was . .Wait .-, !.... .,
S a little:1_ tlianAwo tnb*| :Mary Famblee) i* in the Dade coal .on*the night of April t. (,-IntentlyjailctL f' :WplUtINO-rd \ teeing the ring. Each man appear to Lynn aroa* and asked to be S .:....;.5 ._. ( ._, : nine ..,. a life enteno Dalton :-1ier. Jealouy' was the _rtBATT..Th :: ;J" be pitying poeenm jntnow,' a.4.aI" Permifaioa-wa* given and Mr.lleard.1: A Washington dipatoh oiThnndayay | -5-vs.s.4iUos.u7f "-, ,' '." _

;S .,and tli* j'ko.r. .0' iIbitbet one Joiner baa. gone to. part.-unknown, incentive for the deed.- v /,7 5TamdSssI Tllr tog for the other to oommit bimaelf, mad* an aSftr*** which fairly! '. *:"'Mr.; H. Clay Evan*, of '. .. _'The great strike of tile metalMo m. .

.aoldler. OaD'.n oarr",ODO' .' vBul the Debby. .Noble* ha married."..- .' / Byder was> indicted ,convicted and 11.KI.bo5.iisi7.e 1s Ise.- :It 1 a not unwise boweter, to predict' audience .frantic. ,,: .1 05.baa.'.been -tendsdth. -eflleeofoommia worker* at LeadTille,,CoL,'which h*',;

.- -XMlttAno*!*i ir .& .r'' than :.that 'of !fa The i' two'' principal actor .. in XJ i* sentenced 'to lie hanged. Hi attorney
;M fleld-pieoe bt C tteel of the tarn oaJlbr. drama,:'JI ra,. -.EUrtb". (objes and ; moved for a new trial. which the .fo55tk.5ratJAaUDn .01 the arbitratioriIreety. sad tb* repreeentetive of the princiFOBEtdS tbe treaty ro 1813 and rabied troop probability :'will accept the: appoint.maut has beeneeJleJ Xinooaditionally by7).,
.F are' naw In' tli* Maoon"ail Zcwsr.oert.weecl.dByderwsa i paI.-will be a.-- before (he IDa". 1 and built war veel for the onfdV ____
.--1'0 : ..bie'ClII. of Jib .th.nni.nuicsj.j; s
-P ff.m ri4e1t-toni.r Chairman I, *f U* n>olf. impor* vjv.t ;
S waiting for a re-tentence. defended "by the very bet legal talent len. 01 iw.les Ie hall,HUled. noT during the civil war"and eo again taU-'- U dcparimental '.nlt'A.at For sefeIAtoalbs there-h been\,
in movement oommitto on f oralgn relation*.Senator I S T" >* : _ _
: itj.UwLr. :'of .
t .in S.S rmii.'j,i .-5 '.i..**", ._. I, ia the elateand, not.'at all diaoonr- Gallon and other.aenaion who bar _j f" 5- "broke .' >, Waabington outside the cabinet office .much dlatifaotion I'oJlr.t.h. i an '1'
-S S 'Jlold.Lm.r,.-14_be 'impraoticabl, '; .ALIBABA CODRTrthedlal I5tl'lIUTIOl..1T aged they carried the eaaa* to the' TBOOn AT,CASE A._' /Tb aptrit of New York}I 1. ;'a atot trik T is
-, \ reotntly called npon .him, PrldnMcHUnJiy 4.S. t S--S S : ," S Mr.-Evan i* \,known *rpnblioIhen men with.tha.way' tb*:> *) .
42 :- ; :- ;. SC.eepir.ey .- ."' -ceer-cltiag--sI.nt7-t'wb manifMtod the deepest I.- '... sad i.h..._ With 5.1. nola.J'Uomtlon.* (Oi'pat' ulieei*). throughout' tb*' country and JaM ''condneteJ. .* r __v ) -f
_.. of .T
; SS 'Virtu. 1 ie not aI'.p'ta'nra' ..nrd *<'S _.. .. ground1\why 'a,'.. *..','tria"Lhould. beganted. tenor In the pending. treaty and arged S d'-tbsApss s.ms.S "I car not' for -dcpreoiaUon long bean recognized a* a leadeceonthern -t withdrawn and. tbe'fund* 1uI..J\ ,
.'; : P paeAN co eeuritie. I ease more for the depreelaUcu ( '
evea"with; prla. Tb.,'-Prlne& of A' from S Si -. seek of tht, xrt.hi bet eflbrto .Idrioee from'Cane state that the of;) W. republicans. : daily growingmallri_ : (m**
teadaf" initloct peolal Otxltden. All'r.r : 'i'IJlID ZXECUTO. .: > to Insure it* prompt '.rUn ation>'ln reply of Greece to the demand of the American patrotinv| ?.n ba been generally beli.Ted.that Eugene* T...ebol.wee present *MoeoUiv 1
't 'ValM.I*. man. of andJoonrtMv Th* cult ot Danforth A ,, i can )bar*ao pao with the robber na' "i.
praotloally the aaiaabap M wa cent pow_for tb* vaeuation of the .It, 5 h*would tie Ant,B itnt postmaster I meeting s and addressed:t

axalted raafcv the Tennetcee'and Coosa,railway for .s1awv4.ip.1. __ OvtrtUv aa 4 Her .to tb* aaatv .. ? ? 111( the -Greek troope and -th*'* Srlbdrawalot.tb '. Hon Englauva.,t .. 5 5 5. general, but th* position of eornmltaion -' I union' After-a JOD."'.Dd'AI time a",_ _
'; .ape.- 'd.y.1st. --.;,.!.-' ;Tork M.'l| breach of contract to,the( amount of S LJttl _a awl DIM Oa O ._ '. rrealdent M.Kinly .UOak**o well Greek fleet from Cretan '"W* aak no war, but in th.word*of of pnlon *it of more Import. I b.eteddiaonsahon U"v/a agreed by*5''J

:' .,' ,- '_4 J1spr." -aligbttaii..froni' a cV 1150,000 ha bean' In 'court for year .Toh. E. Sullivan wa banged Fridayat -.f tb*. good work' eeeomplUhed'bySecretary water ba been acted upon:promptly. .the gnat Washington which this call M6*.lX1m. plao pay*$3,000 a.resr," I vete.of 1.10O to:900 te declare tb* ;
it baa doer .
t. .ro\ >Four time*, beentriedandeach Doroheiter; N. B. Hi crime wa Olny .and' Bir Jtilian to some extent,' bjass4twqoftbgpov.TU.4ns not faeorpor MWght.'W *ee while that 01 first aitant postmaster I Irifce o ,- :Tb..o_*of,tht""IUIioII"'
the Prince blind and _
4j taw a bi.S I. .
( : ,man' time reverted. The verdict : eJliano- with .ionignnation
.. creptup the.murder of 'Mr*. ElUa Dntohar and S S ao-'cntaagltog- '
'' Famnoaf.that he, etande aad only 1U.OOO.. I refuse to discus the &u OIL
ready kdit
general pay
; ;
,
; .In1j.ad.IonI.g5lo. '.ft.ot from fe.OOO" to"1100.000..Th. attorney her aoo., 6 year old.' at Uaedowbrook,4 *. (Applause.5 .) / :. 1 1
S to aimi tWkea tb IBB' 't
willing begin negoUationa for .'PoseWednecdiymesnidag -
., '. '. ." ."aoroMl. lar treatie .with, other Bnropeen 1Iew'- ;! 1 U wa* seen that:there neil Mr. Lynn then offered the following Fog BAFI_I ri.aS ;' 1)) ;:I.: : -'. -.,. 9ftn r'it ,
misted[ that the juries wr tampered l>nUh email b.t ( reaolution all .' ubftltate" for those -. '
.: .,:. ; ;;1' ......t .i th..olllE 01.'...arr.cs.9 *. *'kept a tavern, sltwasbisbcpstbitth.senatws.ldgaS .trance-veeeel at .nohos'sad it soon '' '" '
._'". .
_: -.
:
? presented
.1 the only inmate of th place at the already 1.-
*
-Si' to.work-on'tba after developed that Britiah .. .
: 51Ii.b.r.etor.tI. ,.00elID.0"1I1.> treaty atone they were 'itlJ ;
Ia the jeHr.Pourt' F..ld.y-th rail tim were hereelf. her little.eon and c *. U order that it might be-finally and tItUiaBr--tranport loaded with.It '?:Vwberea*;the tTattod State*foUowuf thepege T.Orad and. '

._,; ;PrifrM.w. at.at once to.the ree ue,,and rjad'e attorney* ,movd to dimia the daughterT"jear vold.' Balllran dlapoeed',ot,'before the and.t.of 'the S :. evid.nUypaxt'of th* foreign advle C111faala1actGD and the"tatUn tba murderer,Beynold.Merchant B1I41a-n. ;...poogi1asdlag a. _ _
of VXXHunt
-S /. t.IiiDghI.nnoonsooui, Jo1aer.E by th* oa* for'the reaaon';that-it .wee being entered the'pla for thE purpose of atth republle hat everwvolded I xntoialer, mtttom wkh th. re-, _
between the'; we kv :In thin;ho"... b* 'wee di* f oroo whloh. a* th* edniIrls.rsccesa.nendedwUiOeoepr entangling 5ot Belton Oa... war*i k, locked ,, ;arm'tf, .ly-piloted) .him and bi* dog to proMonted plaintiff and bbery--------. .pple&L -" a-r-* ; all thprinclplpott sfllanoes nub Znropeaa power*v aad puaaad > ;;Patton at AUanUrTfaV I,maini of J'ocbna OcXafly,promfnaa :
iail
Dr..D.'H.Baker, the taU..to receive '. >nlohr"wMi .h.ed'bi tl J" ;: : -county I. ,died
Mra. who
J ,
> ..awearyman. [ _ _
5-- -.r 'j."t'othll'ald. or. the>tfeeta With ) town of-th "Ulead.,;; .r, tt .of.r.J -.-.progr*. BatramauM 'day forl'Mf 'keeping. ( '
.,yhy ere .
10 consideration ; | !
per oentofther.cpyety.In BoUe sad madeaa The robs TUXHAH UBEAXD .nox.. r- at Jeff Ala, j jr4"X"Cuday
) oot4Sry.
Jaomday ;
5- f' MAi Ili Bcyat fiRghaeWxraa :: Th Turk assert,that .theee troop Dy4 eUe*rettriotlji* ,M* beeat hearlly manacled end wr* ln..c"bara*
_; a* '
of.hioh"b."u.to killed --S'-- :
: procure br attacked and her 5 ." night an* -
: .. ioideAt'e.' at verdict for Jib bribery thereupon .OsesH..se.t-s Ssee..5eet- will b* udto drive the QrMk. force Interest la lbs wsstorcbseeJ.pb4r.'Md ; of the ..0 .Jaok.on,Bounty. and ,, .
'JI ; ., $ an nd- large plaintiff* by with anax, after which h* awaulted ,. of pcPoa-s. .
Sera n..4 uw.ej4 ,"-", out of Orete, put thi* beli<: i* otahared Trher a .; tfce, Monroe-doetriM, i*' theproUoall : ereral .u.lI"i' ;.' -". ... "
\; .; :,.*ko4rtlimrterwardi" "how.v.f, .a and Corruption.r' ,.. .?\i.c UsahiIdraXUUing-: boy. and, S bthl1ciclgnpepuItLoiLgsatSraly. *. ofnntjee4tow >1.'I; ** D.<'WbQ'_.
.J iaa 'at .
: I'ipeelal'front Charlotte. lThei. .
"I Letter*concerning-I 'deal':'toAs badly 'injurin -the gIrL: 8allr rK.l. : > I amain of areaio.UAlma ,
T liiaiijii-by
.uI.k.taa4 .u z..a ; .55 .,' 55 prevailing oathl.ontintntf ,
: "Senator B. B. Tillman. f Booth .nd45 tanoe of Jndp.rNpI Hatohinr..wofarin
".." theiur'written>by .Baker and O.iE... lent tll7 : bed: :,OwUi to i.'racelpVof .Mt Tioe :, 1 vThtr*** **
'. S\ rqou.-oai ,. Danforth and"addr4j8- Jack EJag : Carolina, in an interriew/ ,hare today ;arMtraUoatnaty'Mw :: ;,:mob e ffq Bthro4 : _
; .S flame*/arronaed. th neighborS. teidi.'I ses7oiarsllinA devil of Ingtbata band .of,:armed-, .* I'ft1II-c IM-.s.M.M. I1Iite4 the r geronhil _,.a.'cMbenbave-. --- '-
tbu otl 1'1' a M7-l *againt tirfMniaca, -
Iptianr fttJI'I1"
\ ( o read'.andi' _. .iMopt
ofBome,5O.Pera worn and to ante th .
S they 'W able '
: *; muddle hereabout ,railroad-matters front-: Greece 'Trer* .on. .their:' lIsts 1*to teeUng to el inr*at* at Una-nay* { .'"*rri d*AtlanU untUtbatr .ti4. 1'1 "S.- .
'them.
: .Th.r litton- urea.'rom
to
ofW.iSromton.,'whet Mv ; 'WIII'*. houa through the rear door andrewra* Crete with tb.itenUo.of */ ana*o eonnltoiitad to eoattnotlb** a*ta Ian I '; .JJoW. *were poisoned Ja -
*
SimontontorlTe trial
_'Y.11';701& expect Judge oei in the coast of
anptirlM
f. Ktoff by/threwd:fleteetive' ,,-. In the-UtIle girl.;::The remains ;of'th. may vp I.*pat.aces.; of! ,the, anenio ,tie '
: 1dIuab.ft. aeroe. iba.: the -Southern anything they the Ortteji tnurgBte7; th* forln admiral v tv..III'a revenal otthe tnie.bonce.at 1&C1boa'COU". X; epoaial;.term: at -
: .
r -'J"t. J.meaorJii! kind and Chiitttaa -, addition to-theMtnn;'* Arnutrong contract and'Dr7 betwaen'Danforth' > th.mother Ria.and."other"" child' -wr. .foaadia_ lot' t y 'awn1' him. body; and. agreed to dispatch a, ruietto y.01,.%aeIaIDctIoa ;.d,lbS settingslid. court wiU,bevaQwd'for. ...6. to I.thoeshi. to 'hav* I .
',"'"' aeMcnTb. name of "'the giver Baker u" i&. cowl.. :' ; .: ; pr.mntth.1qis4Ing.; .f ,::. et" S--5, Waproduced,; j :Th.injwdchUd. ; njiaBy' ,.ecI.'rOSTOITICZ'ECEuft. _- ". -"" > .- : ..'"' ...! ."'. ,"" .fA ,..
5..S.,5 : .
'S ..1Jio..a.".. '.: :, T ,- i "" .r*, -i d 1., iju. -bet5 "S .. S .. : .'.j.r, > --'f: = S.
'.., ,..---l, 5- -_ ': zAinzwELzcrovvTgD.: ; FBAKCE. M lH | ., ; olvei. That_,'.ef XewJn'mev '1REUu". ,. ."OV" LU1 10k ZAUIIUAD41 ,
., _.-oIto.1c'..rt.I'.. S ..' ".,... "" ,. S D.ZJrnrQt1IT' ; : ,1"-- ._ : 5-". : ; tor- -V--- M S- nt* Ung_bIe4.raptetrally ttrre .to'..t .'1... _S _-_. ...._" -

;'. .'. "55Thr.Iub._S. ," .o J J..Hb''J:fiveS ,t .. AmSmtnil td-***ao.ooOW.rtb ivy Kl>.- of..atfaj rcep.rt7 In rMiee a. is4erbi.. iSicrssIe" .bsePWVseSS y**>tae S >_>>..u..ut M lt._%.ry r."(I.Artiinr .. ; -...- ..S" DaM' _"M......orse.*cc**g5-lhe.: ;...S ..IIae.th*unqoaUfled rejeottea.' ofsal4arbItisUo rJ?Fp;jagK&nv ', 1a .c, --

"r t to'rBU<>B'el, upo.ltloha. diff.r.n* T the mott' destructive are ever *emi S' Th..t7.iiw7.t5eS., J 5 ,'Mayhew ,wa', ileobvcnteditk4 rifllsce.stta4E1 ens t7 wIth nng1an&' "Tb .<"' ..H' .fti... ui i Mt.- .

'' :.. ''jikoi tbe globe.during"18D1..' :Aa: to- qnitman.: ,Ue.,; occurred khortly tlll tei .1a.irP" 1. p..Jte !yv"VlB'JJ5niMt: .atknltzq&b. 5- 5-- 5- .''tak wt 4, ._ .baa .eMi 4 from B e.' United, "

)t; S o .PIar .".J" llJlt after 3o'olookPntdy afternooa. .The' Ofet,a ttmnt showing the grot poetalreeelpU rlday.rTT5 :"f'*-<,":.t..:i3.,_. tag StOWS iurngar4apr.. I neat .wnen tOw.W W._ ._i vu- / iiaaina'> v j ewyofIbe' S -anyxamattpnJbill -j'' .Hf. 'SWii lanAoinoa ai WaattitTtou&.eer- .

/anil alebtrieat./laipi'ovamenU''' .wiU: .' flr* tertei to the large:.wooden build- of lb.) thIrty1arg.etposloes.roriswyjze ,:M U o1eloobogth.night' ofMarchTtb freh:note to'Greece, giving of- seeded.5Maycv'atrong? a* 'ebpJrm.a for tb* e* euUv*and Jndietal d. U1dUstof..7aaree'oflas4Of 5 ._
/ : ,
S ..*.*- Jb :1. J &1 pted bribe Bionst T.rpentrne-* *97 eomparad wiUi th* ,** 8. Pewallrth To-, ar ldperintendnt in. their Intention to J'eIOd'1o' J..pecUo1aI..el.saidr 5 't.:, prtwoste,1.or.the..' p 'Wbilb'betoto> a** to be iaudte: .
l .
t'. .' b.M zq..u.EIIS1. a..Jo.--' Tool Company,' s ,vr.The :. earns. fnoath lass year, ,-' j-*' .': orB nrptead14,1';'gas measures t 4:*nforeath4iP3i "FiloVcitl -tnlUXo, ntry and the varion ciarfto U -4 _. Iho ChH.r; aa Ship Wand: 'raIl'j'''
S. ,Q' '." "'r tf 01 'b. ehtle ,Clt' fir*aterted from 'an Improvised :'.Ther. wa*."a. a.t.Inoreaae of-91Ut- ., wo#*,:closed hit office-...4;*tar. Greece doe
"5' 1 r" ', Tioiri'' 't'T" irc.ns dry kiln, o J&d by O, M.BadgnvBa 019.' ,,vThe flrat.':.... offle**-Mew bone varda.'r;lt'jnr.
;" i"4teMur! r..ti n a va.ic outlay undertook tW?dry .ome lumber bathe Tork,. Philadelphia foetok 0Uf71.r.' *nm, 0'.Aer..P his peraen. '..France 1'a under4 imdJ ,,1" yielded'to' bln*>with Jhe.jfreateetH4 for ih* fnilor to pace slat .yatrauiiln to b*Hated by tb* '

r'T% "- .-- -- buiWin-_'Carried by-the<\\wlnd-tb e oIDD.t.I..wd Brooklyn-i : When b* 14;almoe| reached only power bowing tatty.that ,| *. : mu*
,: o" *? 1It pro otra& flame.led from .building to building 4 i-'deereeeee,"OhioagrfalUBgiff < his borne. Arthur }*T *",'who. bad take 'part.to',a blockade and JI wn eoneinoe.T\ .**_ :jr poaitivelT refuted. to xtendvtli; ajdoa **-, ante =
; ,**p.L'. _th. onflprU)1v4t7 ,) with;qu.Dehab)4o'tU'J) and spread J Jover. : $39.' and .Phaadelphla been hIding'*behind a treerwaiting forth refute:'toparticipate; ; the'-bl< At this*tag*bl the] DC panda irad the governor- will be:eompeUed alibIs.ltZsp of GJ1 and Ship

: : n f WfK 1 !ot h..t.ft" ;awidrea!J befor they finally $32.629., Of .tb* thirty;offloe* .only- *'old naa' Illd Jai with __.-tab- will b* undertaken without bar.,L .: *nnu r-gne-wi. "; :?. ** W'Call an extra i ..s1enni.s.. .- Tss.sA1Sfliad..agktoidlie.:
"- '
S '" t'' '\1' .9. ..n'irr 25U, burned t thmelreei'o' "Tot$ loci t* 5.rea .increased
4 '" ,about_ WO,000Vand4n.nraneeivl" *"* .. .... Chairmen;.Low"aaidfQ.jJ'We wlH. wow U JWI ;
? .
:1' ; <&* *w.naf) B.,-;. io1tjo ,; J i0.esec.ts! .. ,," '--4-; S. .' _5 w" '5- 5- ,, -S
"" th.--i.s 4Uonaoered tht _
than one-half. fa ; ".J 40150U by -r.-- 'If" _
'5S 4 ; ... 'Aa.J"'Jr ',..4qJa'{ fotf' .. }/ llghL'5_ The igs.r.l--s. iras.uj. ., XisP1cai6otfi1flth'S. .... all tho favor '. .-
S* S : 0 :- \ ,. .. _.. .. __ .. < ,.., meeting; a lay Aye !tt : ,." .
: _' UK. oi a eUoj .of flxta a.an4 .pp1l.1 QCOI1TIARTULEDw; u : LJL.lr r '- .---.-, S 4-.L-"Wasisgton! icpetOh of:,*,dnc*.' -';,A J cry o(, 'ay,1).we* ; at?amp i ; \ i e _
/\\' i i r 1-.L AT-T: B Lwnn1sovsL.4. : ,: .The ar.w'Yedt'8Mb.omnedent U\I 1 S
"S. ..c i.N' '. j'cde.\ .i-01'. ro.. ; General Ookdoiuiade hIA'eIIdICtOgjI .dayitaytl Another;. naval Vtyn; >a1iter eard sad s pleasant) enpresatoc sameover ;:;
'j .. B & all
to )* t.eI.ecraPIaa
a. .o.a ViUtaryiCamiipeat'A : > ,
a .
-
( : r -- sAdness to the cezmsWWedne.d.jI Jaaa.rlJWt tof out without leata r.'Lov'I face :a* b* aake4-tor .
_'*in 4iriioni" I )Sl -
xmto lhi lndair14. ,
L'* t / ",Ii"-t "" "-.r ; ,j 11,1uaimw-en.bt.s I Se. .AthoweVar that martial law bn bank o'wlareJ to gi. -
; and M. the' ertea that ho. u'A. _
I wa* ia good veiee vpok* Ute oOcar aavtHlTed to tUte ease being'Wflh1sPtawls7,4re7dlIie'cl 'nayi.rCThe reoired '
.d.11"U ,dl'c'l \A eourbharllal fowtb. UAD ,,-.t"I7- !, lesS .bIie ; BhIa-wa th '
.vs1 : .,. e oist.ti44bet'agen the staId r* *.ftoatlaa aecq.pepi1tirgsspitv. in B-
\ I grace:that lid .9...; aaaator were 4ea1aahac.WeIr
'1.)" .... ",wlltk WcI'J ArtUlary% ba been ordered for OoT ffl:1 Ir0tthebttm *'Mitassuming I AII4ltM.;, gafle.owdmd.hjngunttonthitOrif1beotust the aoa'AWaaU squadron, *tettendr Un J-.cto lietr foei ,und**?'jaiafepni OeaSeibS4rO c. S veans. dMtcreiOiiatai Wyl?bas t -
: Atklntoa and"'it.f nay.imngforth, .tlielr normal 2& andiherU. rehaiP '. '!
/ '. gwIttbf pr aome enMtiqaual a.etoazta1l.'!: % *I a>marked ,failing .tt'oI' th*. :4m t Montevideo., .*'"T !.v.} } w Sham bU and ahoatfll* at the \IIIe; hA e Wioca reoirAporUv* ..rihrw., from Jwiil .Madrid,f"....
fIr : draw *jslveentbe. t' Mf''Ttftee7.ct. KofarwttbitandiagtbU 4 lco.-o to led M --
.w.er' jeried -
t. 1OO eqntu ISIAM IUI i1---The inUrnal waiwhiem;wa* "."wage1i : crowd vK pokl...*'and ot-th."ta* mpoain inaugtxra.Jtig ''. topl $ eras flao.bin* nftas-. .3 ...,.,
.
>a.; romoai":;';Tnuraday and the U* .ccp.4s; which i< not ; 'A4Jo",, -L.. .o.miso?. :,
rifi !.r .f.J i..1Ma. i 'tl .oni.:" ha ,eollDRaraWii't S
Ume ; oJUry
,. I ArtlllM7l', ago eral tITter*"wa ) featarMJ1 1 heel La$5kI7thsL i n'H.Tb laac1 tore* th*nbata to w MM ... I ,. 10 if\ .,:
plalnJiutprs.sive ** the with tiMUauvy;ID... bet-. .
_l' ;1 "bit.r ended,in tie .C onrtnl*rtial that ha* j jkell "',Tnir day> :,w1.Ponw'* "" battle-wiMk tb* troop bay'tog'eapturad "" ".
.o/i'N- '. ;.. "' f' ,.I.I'It' jJz th that ntnaJMntton intoji c*of John Adam*. >h* wife of*broUtejr *fHc aateoom. th
fa "Tlreltean atod ta *
-t. CUorIi oAoe of
,
plane '
[ :n... "1I1'11&? .> _" _. hundred years a o, wa*...m Mia la Boutb QarOSInIen.' I. M .We< UgJeU.w** ndd nly uUlapl maay. theiyguae.. :f W !
.
/ and barn proved 10'be'"beUi. .1..tiol. .:' president was able .to;igl";,oonidr-- Lyowng M C ':1 .Ii..to..rot >f--*" -4. : ,zu w-
i" '. 'i fMtia.\d ..,"f iIIel W ; I U taant ent5ne. .. ,$ d.. t"5 I ". _1o. .- man--... *.ja4_ tg. fnaeting Iwob., M i .:cUaor4eI 57t2fl$5Cit : 'l ,
; to .
S day itar'1 L 1oot, FItI .Urn pebUe.bnaine.s.4'.fleayyMO < : ",. .krI..". .. \\I \: ti.t : .
5. 4N
I' > tO
.of; 1.1 .c ,. 'tlsi 1 order W d.... ;
': .. \ Wayler'a are,
ro __
". 'o ',-" ( \ \ .
$ .o\ I. .siX. u
&u aJl ; $f-1N' '-'C'X( (f1f '''Fy--T-"r. )/ ,u Dr'YILI.1L".r. ,$v i' : :_,. "' 1' "' .. "
'_ .'r lj..,b Mi.1wh 1"f S' > OCJuft, J.l1CU8. II. i Pmnnuecns. :-ipisskliipdse.i..Klaeri.r .r.I.. .., ,..I..i. .b' ma- --. r.-. ** urj:r0' AIJUlIW. ''if.
; .r..1f.
1
,
,. 1'14. frfJ "
/ ,"., ,.\,",,4 S,''". I ...4.w"" '..r It "... .'A*.xpUion' rMd ia tk*BerwiaWkH _. .< MMriir}. ew oVB** 1* Lon I; ... : -
; % p ,t. & t.bt-. J Peenh.d .ta $.ekIeS. ... *aeiip4c" .!,Tb.orwslsdvtamsat 1M 1a *eoal Iief.J -;,.' : ",}..- MfMBtaa.. Boatb OarcUn' to&sItur.and of the J..'A.epcolal1rom1? 0aN0ea: aan: Bob .t4c :

'J S. : .,." ..AIr" Bn oipfttou. .4 "\1 '' \1 '.",eli h-- r 'f'' '.;.'5- =.'= 'DM4at 1I/I: ,100 ... .:w_,J.niag.iasbeiU'TeDu.r .- Bryan "ree e atata IMior boarAi killed 3,, &:and W.1B. Fitetimuiont'ha' balhed 'otTlUreraeBilere _. 'II ,i,,

:., 'ciiJfai.ia..l."W' r.XW .l. :t", .'-:1IwI'.q: | go* Get 'Waunatyj>nomtogand .,..Sejiit*."' brother*,".a* a;'churchin tutoriu ataalaa IS tb*- QiTlfaborry.vuba. ._. ,;w. .. ,r

:r" f/ w,J4'/J'i': '1 1t .' 4.' rw .i* a.oa (_)) fornHhaalmdaf month A rv bn 314 .!Mor41:: _ek ,I.lay that I wa* atortatoed br.Xational: JBd...aJ-a.) -.s.erl' BMmthaago L Tb. Hi* kpMatto .. .1':1' _
"
See .. d_: hat..1. tbe r-&a: I-Borway.. .*i.thiagt. knows at, tU vf th* I OteiSinu'' """.""IVaT aje*.;;VenI of Bdg fMd Wednesday are not feated. bOt' Iwdco&ra '
*.J-7
.- .. **s 4tj.t -. r 11f".o..a01'11I": : ;; _kmin: aweOn: .o4tQe. ; JMin'j I L. KlrkniBOwr*****Taylor SMIs.- .* ssg 10 flwi a true boll; to William *Ml>a wanob ..fo .t' ir t'uMe ; ._

lt -uo \ I C eoiIttM'* .tttlltM'.bU.. and *teonirj* cedni Mid tby.imHbW. I --WoI) ..O* 0 :)TreJM>i .* > -, J : "- ." tIiaetI CeraTat .
: of 1 .0.'. a;mild. e Ir" ."" r o*.' :".
_
." ": > w-r tois ajS : yoded '
01 eati '- > -rt' 'i .y' ; J
S .. .-NII = ibt .' 'irn' i. l1ift. .ls.s wi- bit.ea.1tees gi, fibs em.s'i 1.rd of By"a* wrdwof- awrtth* Matthew d eteion> .'' I ._ SNl. '.

\jpoeos Ia .1114 The sscatlors ASybitt1S md Terror vi-dag'' bsoIt.. of the 1 ltfshee.9:. the t t.tDni'- esposit1en.sM.M.diedls4 sutton mill.. in tM3es*. Ala.' rill b* 11 "e4IttL< .. .". .',. .

of, enator Oorman, r teamed oat of tkOlfa &O. ww."4tod-W.dsSq nlt M Ida' ". I_ _- Thstdsf15'a ; l *ter 4ee antler fere-, Isytisfi .osss. t.14Npgala. I.. ', : .'

;, ",.-.H. .t dae M *, b appofce ill' poet little before:uoo< Tu.eaey ..mm&pioccsded..for & rcctdeu e 1 tit Washlnpos.fporai, ,l.4.s; 01 10015! t.DotI the past fib* .plaoed S N.. :. .. \- ) ." '
j 0" "' f unmtte wittt slier. m.* aausl'S4ema1 ,' [ r. : r : .{ -:
;
,_ ..#..." jcousibuartojj occupied hUtia, <.wnfl Mtcmty. jtlQU1 ,', ,- 55 -_ .
r. ,b ,- ''" ,". ..d. and nJQT their heary gJnaa.U._ tat .4. I
:
p" t.. .,: .. -. -." .u.-r.r. "=.1. ".. "". ,.: ..ift,1' 5 D'.un* QUAt.S .oJ ,,: S Tht4tJS ( .. '"
S .
: =, .a.LA a 'S'S 'S

r-1 5- e .. S S IUtifs, _.. : .I y.,,., .--1 .. "

''.... t: Tbeof 1\Ij'; S _. -.t .-' ., .. .,.

;: : '.,+ 4pJ. J:. .::,!:f S' TM. e.. ': .U .1 w ; \ ,., ., '". '" .' '.' ,

-,-.- ..-.-. ... .. otI.S Jrill. r i. i.'" ',tvIf
-" M4 IIf ,
't ,
.j
: '1I'r.
S 55 5 S S 1* tofrIikiha of S "

5. ._.. y :. aojHdt bta}''It ..$ ie '" .' ':\ -: .7 '. _.

- -.S I. 7".i". S-S. fw OteP'I .'." L 1 : ,

S 6 ; yj3f/S.i-iBl/ ? ?ff*.'''l'i!: .. ..- .cza. .. .. :

M yKf.VffSSSfr l". wc"f |
; '- S ** .f. ) .. lj -Ic-----

S I ,

S m -,

$ I te : S ,
: .5

S 5-
-
.



.".,...-.J'-f, r, J t lM&V4-; \ '.".J..'tt. '"...r: :- ,--1'1\,.;" ,\"1r..J-,, \: ": .---p : .- '-," :' --,-'-- -. $" "".',.,.-..:.,-.. '..-.-' $ "".'\'.,.ti,,.,._.....-,.._401 ,--:,",._-.,ccFJLi .,,.'...- .i-------c. '::,(..'I: .,,",. ". ."'", .J.-.j 3." ,. : -.

,, ,' ., : ."" > "v", c.-< ;' '
.:;/ :: > ; ,; .,. .:. :."\ '.- ,' ., '...t!. : \ r<,,. ,-" \' \ -: _! I ". ( ."I'. : ,',. .' '
.
p. : ,- ,. .. >.pA' ;.,* .'! .., .", ." .*. '\..,;". ,;. fl l. ". 4'I\ -- I : .\. ''* ... "l, '' ___ -i- j. ,. .t'Th )" -' ,
.
\I" o.c. "" _" .1 .t' ., 1 Iv I" ., fr7." 4 7 -."CII'" -> "","i oil; j.i. .. ., 1 t .,.,"':'". ., ''f'p..l'J .:" ;t '' ]i ., \/j'l'\,. .1 .i ', "l: .I .'. .. ) if :
.. I '
> =, ? I. L. ; l
.. ", '.LI.;:' 1)oo.J 1
f ; f' ; ,
> ( i '' _
J :
> .1t''lt.J.f .
\, "Jr i' 11" I '' 'j t. .." 'rt" tur1.j'u. '?t. .'\ .-" I'- < ', :J' ", / ,.. --_. -.. '
I1"i iiq4I
l 'oIrt,0 \ 4 1,1J.o : ft .1"iJj..t.k' : 1' ", 1 it.. tor" (' i, T r" ." ,./. 'Jl -. t' :
"
1" 11 c" oI1\'h ( < : .
ji.I. i ., 4 J. :. j// I
J "J I ( 'Y.ot1'ttt' dITLU .
; .. { ') "I, \. ) "
.a rh'I'' .oi1i11 '1
., .' ', I"i.i \\i.f. ,.' .t,' \ .j'Ii '.l '"ItIIjo-, -: ;,. : ; 'iI'.i. rr .''f' _-J."tjlt' .-.--//if'-- "i ".'"'"'."' I: '- f"I' ,.., J. "' :0',-'',.J..;lf r. -.i -- '-S- '1",. :: -. _., "t, : l'. ': .. C : ll

..l" ---I : --- ir I _Ij r : 1J r"[ ,- 7'1'. .1 l1DJ1'11' J1 JIOhl: 11 t [ I I J i J I rL -. _-_ t1" d r r 1r -
.r.. ',1'0. + ; .
'f '
.\ ''f/l,1/<."Ij" --.LAa. .c" ..I \".. nUJaKr"'OF .qN.TCXOM.1 d.bos ).kl..aid;...( .;:;' El) R { rtl V....: '.N"l' : ,. _DHa -. :;;) ... J"11.. .'- _c% ---
j ,. .. J. ,' _
'. :: tank of water it I ia-theAiA1ac: itebur&oIoJTs1sgrapb,j- : than .omaef' the' beat pictnrea.-.Obe t ; j J: 'fa.c n eiak .
';" ,3, tent.wberain raN, attd,,;, arv>u./Jdh, -, 1 ]. ,f' was an animated water Mot'braU., 'l M.3.y.4. ***,*1PC.ai.? ; ? .- :

p.:t ,j,I '' '",. ;... placed for the professor' leiinre- JIoaoos aIUDTOR1CS : -11I'1,., :. .J a.. ,liiRnon. .or,",VA niua' "'oJ jl Mie*,Viola Jjltn* tilt and.;.dark : -0.,' ,- .. ; tLe i ., r-. :.
',: ly examination. Among theae one*4VrJte : ., '. V&ftIOU5 OUBC1CS. ,. ; I a J''" wo.uJIIJl.':. ,.-" ,1Ib. I ;LI'W',. .eiatavdueeyeeitolCiaa
-
,' -----I- -.M'I'J'-t 1s....4..6.. y-. .., Ogure Juat&.pijn|*:.-.oq.. for.'"-. .---v .
.
-aoomm. Iir.Im-.om.wh* 1Impe..loee'Tbl- P Ul "b", ..?te.k.r. \a, -,.0'' -' .H -- "- \ clear 'white -oomplexica and.eye of ,.MUt., Dtafca-.Dvn'l.ml e _-. 1Iet' :. .
4' liJ1'o fliktl )1Mk4ah. ".It"aoniU wa narrnad OostselaWasted namotandam ot the :d... of people I ':iprtgtt.idi. Tellor-vnade u UewajThe i deep bine.., She would not be picked tome truth that ha a b $-'bilge youol.: felI .lu.toeniflj IGItr bran away. ..,. ..- -

;: ". ,foo\lclln.od, .. .wa* Wealth-The Baasoa Why. meat oa.diffarapl aaMatial' topicm,.yon I '.- i fcetest Chat,About'Meir ":;: out for'a"-beauty;::aa the >ordinary wlfe'e thumb. 'I. "_ : aDa-..- no ,appearance ethI1O.biiego .
-_;''lIdU. :. .... :'tl\8"JlroleH kaow. ... _' ". Ubdarua face While admitting ,r "co"t.Boe&m.i ; 1IMa
] I ma.kV.r.aa..t..tl.U.r.U. ., ; > yoo any:jpbjaotion t< Verkj .oel'Q.. .. anTheir' ,; go. buk-be. eipraaslve Pi.. .. .
wr,:.veryrar. ?" '- I "- "* ;,breuaa-. -" woold. attraaV attenVoap any" ..- menViiaw_ .in* to introduce.Captain Crawler.:' I' '. ,.. '

: ,.cloee down 0xamioe. thj l.'wbed and- : Mr. Maakar.'nVnWhy1 .ttally, .I / .' ; She ta noted for tor eteeHaal taste In xUnnation that it t r Kin Pranoer (who caiut bavo been "_..I&rtu ft& '
.$), tbe- .b truck opod" aelxed Mla '*.. I bar 00.axperlenoa iwbloh ] dree*, alwsj* .II'.D.11111 ->'i.s colors in little tUumb to be 'Gcrmau-TonkiiowBsbtW?; 1f1It.
"- Jhim-flrtuly by h*..;flOsL. Here waa a *u. m.Tllt* >' to baaa an opinion npua that I.'JiT..' T 1Atter." her private gown*. ,OA.. recent afternoon Whan ba bad .ai.weel/y.'/} Very'happy-'bilge yon has rtn.tbrongh with MhM.
4 demonstratian 1 wife} BELlE It nothing in tbe world: she '.J. the fUtiethtima won tip at aiL -TwoS him hi* father left bhnv:: -4
t if It. aetifinal, "cluu-ao- Dombey J'W.htn. 'your g etii nbjaoi.: I ant-a beOI'Woh.) wore a handsome blue .
). teriaUc. Tbis gah Va* -.ure.. It *'ry._won't_b. peak te you?*' mood plipatob. -" at"" 1 I of,'fasUon to .fadioate bard broaialoth skirt,, plain and. pressed ba rae nxoriotta/ again i--; thank".you-BoU>n door-. .- MUgeWIMaalpaUiMf:., ," "i"'V';

]lwa, now doubly valuable aa a museum /'fr Captain OttUU- '.3be won't do any o .' 1 tim._All the;great-(oelataflairs M*.tail R-l1l1t1tnllullLJ rl| by| Inist of freniu I aw}aome- "_-_-".__ -- -- -.n. Oorman atartedOnro :/:.; ,$,.p0. ,. .

S ,epeoimen. ,The,prof eeeor waa inetxatacy. thing. el e-"_Hsrtford Time*. l'etrJra#. by ArtiDelal Mean.chaI .. are ueiag aplcndiilly"palrnulaed. enL with ao 'Dp'.- "O_ natty "inality: 'Brlekeef 119.- Boston'r---- aaampt.I_'-_-_' .' -
_' d' _The Grand Op.r..oa.j little coat'tTght'uttfn *In tlie-backr. .Jt waa730 o q'v": ,
In the Mat of tlie next meal '
( m ( ; '
; D. and P.o.k T. 0W1CIL Pkrd; 'I i
#' 80101.loa; at lb. Metropolitan baa been brilliant \ Bniahed dinner; 'Th.'br. cke'mad.,to tbla oouri-
hrrBOTMtorjo wnb.lDedhl .laod I. of jmaltonkleevei.
: .b. waa dbpla (a,bi* cars, proud a*a ot t Chicago think they b.. dUooTaradlaethoil t ..*sawfctltrvthataataattemptthvre<__4 _.
G rm. .t$] fent and BotUing would :Ilruband:"! '''don't believe sooorii front all point tof vi.w. .' : .' log* aero..tha- ::r 'building pnrpoeeOvare mabu- ran.,. KaMBa liliiini. aol otu.r. S '
4" yon a o( larnio Lamn boilla*into Tb. tbeatera belter .... Ing''of 'luittrioi aint.Unn.wit bloodm.lkJlm*. TmMrtse i IstBs V .- .
tf principal are The I..tltr'01 Ibe eoat wa a aiogle by ooUnUt in'.Virginia-;
do but aift h. khow aooount. ... .
; sunM oa tha Math can keep of tbe money yonipend. atone aud proMfTlnii them forerer.la 517 I aba4CIS$7$ .aI.Slid o.rtslfl -w.. -. '
c of th1': But tbe flaV goo, "- Ti I, d." than they were' twelve montb dart on .soli .Id. ranning from, theahoalder / blace b. lu4. hint .- They 'were'need lathe eon- ttcnro Is aur*. .'. on "_...' SO wita att' \ -
waa. ( 'i', ,, ,? tba iaemAt.;"of their' aitabliabmeatoa :, "TBvea the .Kational Oyole Kx and tobi. whole of dnursiMo or ky man for Boo.ta(tools*tram J. '
-LtX4 wui'-- 'pj 1i:1.moneT ; < making it cling closer to glow church edifice *t Junes- .
.)jar rateU'lilm, air, the i"l| 1 ._, Oolia.Orove4v.onod lb.r, T.. upa.ne.avenncaft.-- -- j jkowlL '
bibitlon Grind J. .
at the Central
FsJoa
cook I the waist with a very pretty effect Qathia forth tremble Teat and the reaidenoe-of the-gover l
explained.JThe-'profeseor'a disappointment oeu..keep.UrookynLife. I. the 'bodr f 1O( a youofr womin who drew WrowJ, Caoo.mu mlmmttMi ttWT8 .., .."
; ont large If there j I. were five gray frog of a darkershade bean his habit, of thejtete- Apart of theJatnee- aM'
$ watT too appv.o"n.* __;i- \, died July 18th laa TbLa.bod7pio fi ever_e n.ak.a or ertplll". -
'lck ot i not notlosabi.among '
inoneyli
She iota .ir
any ,_ wore a bionic frontof be bald church U till tending, and the \
; ; miglit fosaihly *ecnre >uolhet-apeci I it was treated by them bat turned to < _dp".tI'2i.-1-" .
those aponr'whom aaeh fnne- ereani
stopped fzse
1 C w ebUTon-wlta slip of cream thumb and finger; ] are *in s good atate of
tnen, but b&1'dI1-ou which would leap .G flLL .t6ao, or to a 'Q .tall8t roambling lW tione preeervn- flts nrior anM das see of l>n. ilL..'. pnrNsar *.'".J'
-teJ nl.cf lha tankta..aeUe blmbyrhe ... Ib.1tiN&. aad to b. imOerUhabl. laaa depend for (their anpport. 1_ Insertion let in. A. .err. 'etlfl ."Edwln"t': : bowing that the- oolonUU be RnsToiian. Proo Ito ami _.._., 'II,. _
w .r, i* appears Nothing shows thi *o atrlkiagly-e* double bow of chiffon held in. proachfuJIy, :"do :, In.making article to resist wear *,, eend to l>r,kttno till A"II&)kU., ,,;3 '. .
"JIJ-,' 'a.r.s to .venture th.xp.rIw.nt.4.w out. Ton won't to room ot the itabliabiont ii l
forget mention:that upper '
\ the toU.h. of the women/wherever the centre diamond bncUa Jt
by a waa
mel : to all kind of weather "Mm,
expoanre "- BaMhlnrr p for aklldreatooirtlnf 'J
York another of womab60I.dAugi.t
EvenjngJo- called? body lh. ._at the 01tbea JOulrolOleea .. : _
0" see m opera worn at the throat. -White glov.sb don't ,noftons gums, roduoos InflnTmniw ,

*. '<: ,1.. ... J41.0... lbs "C'IP" .J ". iadade' or. Out ran roltth,1apau' bvoume 2.. whloh' appeafe'alao' "" *"to"**"bar" "tre,.alono; Fifth avirnjiejJBra.sdwa/ *"?ily."Ut hed.anile boaa_pl41ur.halootupleled ., JL'Tbat, you-." Budget., 1' ._ ___ llnya. poln.wtnd oom., -l t- oowiev; -

Hosts ol Ift"1I4.< tamVI S. de-ttruotlon mlmplr telt ber'1ow.CbstsoogE'tiine& pctrHflil. ,,'1I1laT a .tr..t"cr at 'themore the an ontflt that made with more of ,_ - -a.-- _.-
_- taMUM Ui.,will ..KIM Bo uloontloa In litematton v The brother hare been experiment'' exclusive gatherings in art elrclei. many an eye follow her with envy.- any ,- r 9))) (( :
medicine.
; of Minn.ai Iak1n 004 Ui ToliU.oo patbio !
__ .. .. .(.. lag for ,..r. but the dinoorery of aptooeia. of the latter ", a ; ,
; Speaking .oal. Mra.
4_ .l&lu__sod, U. In U-o l-om olTh maot Onus Wilson who. aa every ;,',?ThU'i* not
Th.4kU(.. .r porslst IBn4 doaIne ..m.I"" ntOOt o. IHTCUiBXTC of pntnUotion was in aoma reipaota tbe American Water Color -- -
Sooiety' know wet Mis Caroline
body Aster
.. dear he -
.
I. out. .;i4 g.I...on and with ki.F.dr.uulu pi4..o..04wioloul "Well. Saribb ha* provel himttlf .001.1.0" :.. -_otb. ago exhibition at the Academy of Design.- i I. Ins leader of the youthful net of thl "o/attd;;l. it le_ .' ,. .
U. bo :
Th* b.st, ileol.Uio p1oanto boUuiMBtomMb a ganmi after all." ] they begin to. traat' He* with a It i* the leading event of the kind here Four hundred and delig.hto- chap- Pill, Clothes. j I I1
for _uwiU ,. .Pormeut :
t taurtful o.r.m.dh Ui I'--r' to the .
prrpantipaaimilar
BtUar*.potent for..,.rlal.rb.uaaaUa "What baf he dene}" 1 ODe they dnrlng.theyeer, and tlli- 'lprlo .t>- crone young girl to natinee I aaw .'y.. for '
4jrp..pU],sionroiM and .Wou.uompI.0Ui. "Quit writing ..1 rtow believe ba petrtfjiui pro>.rtle. tract more alteallon than usual be you l pill coat
.' _. poetry opened a ., ber tha Cent,. of a group of bewitoh. ent state of public- --1 The good btM a ffood ooat. The pIll .
>
Calltornia -- sandy bop,neit to a bohoobou.e.fbiasgQ:1t.cor& ."'_ When tbdboly. of the yeuaff woman canre publio inlnrnt bat bean altered ingly miave last week. -
.r.IdpS.rsprtn.Ip&iI, .ay., pretty yonna; .. an'8.-tw W'JO..f.t.pro:! the pill. Pabliog -
-"-'-- wbbi.sti4h.Boy4etoucilia '
C --p.r.-- : t. -up by receoi.alurotn.Uyrtett.oulteotlone 'j wobgthslrlioph.upnrtywaaIbeantifu| ,
,K.-IBM_ nftjr :.. -, ,; wee obtained by Ih.1Dbe1 da- ,"'like that of-" Marshall O. } miss ef perhaps iiit.. *ommr .milliaery" "in it to. retain fell its remedial' value;end4tta ;. \ ;'

0 Over _.000 ".. Wbf not lot Itn.To.BMroffulato DI.AKK VHXSC. term ned to make a flo'l teat. All,of Bobnrta the millionaire and philaOlhrojl who attraoted ...rat.alt.DtiO. ., Look. he' b.-' >t for thti, polataV Som., pOlkr '-ct: '

IterM non.r.or :=..year:kealtk dnolro.and lor'mnnbood.toboooat:!I _Rprngt'oet-'I.houl4like( to write th. blood was withdrawn There and the petfifylng -- -' | t.: _, :, I Her fair half banf.loosely over..b r her--And kneaa a cryof In .. -ooa.t. to,..vi-thq''t:1,1..0C, diaaoivoji : .:
"Cvr _KuMni. o4.. M..nto ana . yonr paper. m onloript ,
; he from ., 'th..JItom ndth., they -
J sbeete blank on One aide don'tyour deoompbiitien( two waakaaftor brought tOlllthei.lIOm. of theo lioted notieable for lie jaunty air.: It waa of. aa polled ,pi1l / cater pans,
-ro- A big Mlmry eooa not alwejs VremppoM. a MHood's < tb,t body had beeb treated with the latest style in ,thronah ;tlie aatem.amIerwIees: a. :ca bread '
i '
: ,
'In hate bad ,
"another week the which
.__________. preparation. -
Msn 5On both coats too light. nd permit the ,
deal had beffon to'btrJan.Tba body&bs..msmsrbI..whtt. Chicago l> ] ,
U JQi1._ ,7it.uJ.ta _._ .c isy&t4Eawall' 7 ; earit '
fHIMjer80
-- .- -- = aineA ofneea ----= --- -===---r =--- -_- a -u -- "-"- r-ir 9rAMW *_ ai'e17iatnr10rHg1Ti

-akrr: TBK > l"l"Arthnr that had coins with death and \ -- expotl nt''A yer--ftroiePillUuiTw-.b .n' : '
OBr AOIa. : __)
almo
elate that tuna baa remained
It baa been the from labor I'if
-"I would marry that girl the cams oolor._Every week the body ( found as eftooUve se if Juat trealv the

BsrsapiurlllaVew. mnt expel from rauv bat for one thing." ha become harder. ../ .fLabsLuathai 200 sails ia ?) atory. Jfa a good pill r1Ui"eood.ooat., Ask ,'
a*
blood It-e iainirltlM wblek bare xwunaUlsd4aiioir ( Oh..ter-.u to pop the one-- The Moond boJyl tbiit 1 of a woman many druggist tor J : .-.
the bay there at year i .;
tion' .
winter. Tkos
provent bamors, Bolla ality-aix year old, and bows* aimilarreata .
pfaivles, srvptlcu and soi-loo UlnMs,.".11. Arthur'"So. Afraid to qaeitton under the tame .treatment It when whaler made -
tmnrt, uUrijL M.lt dablllty of tko srMp- the pop.." Brooklyn Life. i. believed that th.- bodies will lad a / quarter, and Ay@ Cth1kPi1! I : -

: Sarsa' For when treated the taL't.,_ .: -
LI i0I&mb age by new pro Honblnln) .
I UJJJ S TJTB BOAeoit war. oea*.-San Fraaoieoo Examiner. liter*pill itsrllcwlare U Ayer Cee.bOOk.ne.. ,
.
parllla The t-eao Man_"I don't aea bow it ,jI _ the bay wan dotted 5551 J;{C-A7.r Co, Low.lt., M"s. -
I.th.b.l.-lo fuel(ImOn.1u.Blood' .. I I. tbat tha contractor turned off i ine, and they ; : .
a goo ". Lat J. .a41et1. ._ "
8o14by.UdrugIM. gl.iI&gur$5.U tbe ,.. ; -' -
pat
.10 Dill* arl harmonious.y wttb .'ively'mkn-rortble. body Uk. myaelf lilt.:.and."( kept a fat, "In the niann'aotura' of ..end.11I. ,," i ha been. yearr- ) 4 ((p)) l ) (q ,)J-(( )-l( )l.l ) (r@J'I)) c )' ) ie

liwuel S ruiip Mood's H r.-.M.Lrul. --Tb. Fat ;tisu-"Oil, bethel to a diplomatic ufBccr of experivnoa, J Daring the post
get '
"there i. no donbtbu\ that America in Honolulu ha*
Drspcraden of Aa Unleved 0... rid of his apare men Ii..' y>u ku w."
now lead the World. Ameriotu oan- tlcrfnl degree and

A Wnaliiagton lady who- has been die ar. about Ibo only one mud of _. tong the iTnt'r ANDY '
CATHARTICURECOMSTIPATIOH
abroad with he* little danKliter-t lle "tTAVrkD WCALTX.Wayworn '. nagar that can .e b..ltlfbt in 1'aria. lion of a rcTiral' -

this atory:JThe little maiden bad aTrench' \V.t.on-"I wleht I had Though the Fror ch, twrj&O.zJS'l.'h.iMirliin -- Honolulu wa

name, of whom *be wa very ill the money r". spent fooliab." this line, tUoj h.". tlr..IJJ, '# I shipping master .
'T'
fond, mid who supplied bar with most Perry .P.setIla-"Me. too. Many but surely managed to io awajr'withiingar week there have

qf bar amusements. One day thiannrae U the good old aiokel I've bl ..] for in their o'adi"., .rzavyt where flying th.'Japanese
.
departed and bfir email charge rob before i hadVnattereij. the. free they make them for consumption in time, a

didn't know wbat to' do with beraelf, uneh .,.I.." UTDoiiiostt Enquire ohrr oonntriM, aod in Amerioa in Aj occurred before in

Bhe' ndered-'aIbont the bowtenp- L particular. Tba F/tuou people will olulu.--' la

irtairt and down--into the garden and UTPTJO.Mn' not buy a confection which I. made of be noted that .

back ajain, and finally bung abont her Brown (in an awed whisper)_ and sugar alone, They want combination I1,,, / / forelgttJjeMBor .. 10 AU.DRUCGISCS. rif

mother,.who Vaa busy just then with' "3b b I I hear a burglar In tba pan depeniinori. upon atarohea thennjrar. / /1 ,/ / I It tetter evidence of 2A.SOt-

the baby.Deceiving no attention the try. lbeU.. he i I. going to steal theMka parlance of f ABSOLUTELY GUAKIITEED inne ..04ommlp.IbIs. eea me iii 15.4 LassI ,
"I thtuk I am eafe In laying-that tbe.some or tgs.iet mm...sysMmsiIsmiU. --
tamed I cooked thia. vp
away Baying dejectedly:, "No to-dav. i b I ilsooS beseiM 4W.. 4. UULUQ_sss.v cO..cibs,.,soobsat.ibs.. Pi.w 5.1*. Sit. '
body love rue, I guess III go down Mr. Brown(.I.rpli7)-"Poor) fellow I IFl. nuar-made candy rsrelyjV.v.r, -/t : ; There are In port .aasp.s.a.u.sa.s.psa.s.as-.s.s.s.sa.siwp.* ,.
old in Pari would b.m.d.'if .
in the garden and eat bugs. I ate Ire.yeidato may bare a faooil.-toq"-Up to- Of eonrae ik veuel discharging
,
Oat. i) wa* d..iroi.ot the people /
and the .
atnoove one on.apik majority
_. of Farii prefer aoin,HllniJ .1... Two_ I '' / i'wo
I tween the I'aclfio
If"' C --- weeke before Obristmaii I wa fn p..rl. II /
_
n .SeIed. C..1CR&DoP.rk."J and I haj to j.41 to ., least half I__ -' -- .- been most running of them being la ;
can remember before 1 doien ao Oitlad faruona candy maou- *
She trembled. .married that was ''tire'J of everything faolu.refa' before' 1 could' bay any when the business _

uUy tait," ahe faltered, "1a a aeml- -utterly blase." .nar
od book." Lan"Thiigs are different aO"1 ot combinitiona, marabma-llowa, PAINT POD STRUCTURAL PURPO8E8.Sm ,

He gladfy offered"her $75 per week.rVpto -'I abonld say to; now ifs a real ,".b- ltOlataDd iu that line faOermeny TAILOn.Mi.lTE BROADCLOTH SIX WEEKS ._ 21t.sm It' -. -.-.Ond sad Dssmrlpdveii.sLbo fins by neL1. .
thing BOW OF 840.8LAn HT.UK WITH A
the point of view of art the next pleasure to go to. the elub." 'Brook -- : _..." .'_r.. .__ ..!.. _''._ ..'Rises... ..,E!" ,.
it i. maoh the'aarne way. QUEEN AKD FAWN BEBDXD MATTT LITTLK COAT TRIM MID -- I_ .. .,-- 1_..V orb-.:' ./11 l h
I TEISg to a terrible: part wa a pact that lyn Ult. Waablngton Star. .' 1I1XrUBIi WITH FITS OKAY raoaa. A SnAsfl *! HVW.JOHU-S KAIU1J'Aa.nJJUNG 00.: / 'i ,
.
waa a sealed 'book.-Detroit Journal.Japaa .- ./ IIT MB*. .O -. 87 Maiden Lan.. New.York. : ,' .'- ,:-
A FAnrr JIO j' people town. Ik a thrcog ef richly the new ooara olotn 'in large ebeoke .511 a_.-ndoliaimt. mii IILPB1Ar..ftJl.II.. Boaro-rtvrarst'osrtsji, M-; ;
.qT inte&da to. spend a* 'vasthmonnt Firt Actor (aavag,lf)'_"I wcnder Fleak af Pel ol money in etab.liahinff ore If the region wilt ever The toiioity of' the flaah of poi ned Ogden Mills who apisea> toaneeeed blue, red and green, oheoked off witha .tI.g rl_ Made $on H, 00 R *>rd In 6eU IA&UUB

'I -tending dookyarda at llyono-Mojir b. .PIIOPI'ZII ; animal may ..alll.P "'. a aoaroa of Mr*. WiD I.. Astor a* leader of ,the emotbe'red white line. ''The skirt -All *to.. 0. _. Won w rtnrrrtmtr ro-v ..

Uraga Hakodate and Tokohema, (\ )-"I don't danger and at a reemt jnaeting of the Four Hundred ..d. teraelf .. enthuuastie fell to the boot tops and the eoat wa from A* Jftne JTra", lW.LDOUCLAS' 'In *o wood n AUTlHH. oro ntno meSa lottom. foniowl 2 C'
oooock lo OMko tourI.m* se
know; Eofhapa. in time, they may Medical Society of Berlin I win reeoanted pstrcnesa,I'.f the brenb. brat and open-fronted. Tb. revers, Three mile 100.111 .,. Si.mum i end U TOO do ron will r.o.iS n ronod.. j%, IL

f- A Wondetiul Statement bHoaae1aama. enough to nee bard oma'interaiting ezperimeotimade" Mme. Emma Cal"'war there. ,Tb.celebrated pook.u,aod. bott.olll.1, .'!:luk." ally of MoMlanvilU. :---- --. _wotdBEAUTiml otno o loftor moro* U-II.only,. Ibaa n IUk II oonnte wol Ttg IB._*'

: .age..-Pook..r ?, jf. 'U, to' determine the'tuxloity of'neb opera singer rwa resplendentin which wa rounded at lbs corner, had the foot Of the beam. Boimkrld HonnnoldTooiolionioo rnUtohln.ood PrUttaOo.will liBBllfiigTVof Sol's '
teah.; "HaTinjKiTon twenty, eantl two tone of red."oely a i French two rows of .tHabfD,. ;And in,harmony Lomond" mountain,- gold Tko lo tkk poraun H.l. Cm.li.tli.bojo.1 iy "" ,ij -
iiroo.i r.,31vGIfla$ riakaiuu. : gramme of eiryohnina- a .fowl bi womaa and ,a CaJve ,ecald .combine with thlh war'a plain bin eomfortaule komea.- Eniii.k,v i_> r,>m tfc.l iunUikoWOM, SI'ji k] -
.LAD TO J.OIfI 1Litnlb5b. rc TIFUL 5Lnlortb.nes4 Laml
gave it* flaib to a do* to ..k'AI&.. th.m. allk shlrt-weist.with white linen collar ad haded; b/.araad thIrSt ShIm ooeh Cor tbo oodMlvo,sad P1
t> ,-X think It mydutyj dear Mrex U to be married next the firm* 2i9 gramma the anImal be- Another BraDd.I\IIIR' dame >was and "a blue Windsor' bow. Nothing lor.ii..HOBI 100 lolWfOl UK. 1110 nboTor. a.
Iho of
(1-H troo.ood oilolr to. parnoM i iloo
bam, to tell whit jiri>nderf ul month and abe will live -. ill after aaoond it woo -' .. _
you your oame } a portion Mr*. George Oonld, wife of the multisanrHoaaire could have looked *we ter or more 111.tale tceallly km. octootkto 4 our kondonitto Iwm'. i
t.'. Compound ba done forn-ot. )1.It 'j1Lbe ,.bard- -forJ>*rpareata aaiaed with tetanio.oontoUion anti ,, Bb* -... a lilac more girlish. the bat wa rough blue.tr.w. with r ._,- ._ ins uoUHB&OL4.sal ?Wmi.si.t.Ct5vx1Qn.f..t.I.kS itmtrtbii.s c
;:. I waa dreadfully lUr thr docf&re aoldaae to loee bet. L di d.- The experimenter fonn.d.' that o ti.rUi..iter.,Cr.iiiia.Ca.S1.
but' nonIth 1 lew of the sailor with
charming.than '
matronly, pattern, largejroeetlea ..Uaderstaadln*; list Mumeboi4 Btalto....cad,ind by the ea -
T nR) Ltb Ohl) :; ldfla.li kaovrh.yby.beeatryingbar4tolo. aoma'a. 'laiU ar Tety' tolerant of certain he wae tea years ago'a* the of green meline. at sash aide, ojit muly-.lit,' .1d Mtkoni p lill bar for the for example .to wl 't flaK rnta. a :> pott yoiaona, Edith'Kiagdon, of Daly' company. of which blue wl. .* stack -defiantly. ...ta toM neim abs am
laat' tan ya" *" ., atryehaUe,}.oaUJrt<. k.mlo k.Tparl- lira Could) .wa eiquleHely gowned InS Sb. wore one nf the near green.leather Ht* JTraaoarht la now aa \ ...ne- for yen pmi nub 705r tiM In atuvgEs
a < S -
$ bemt $tome.er MM
; ; 7" -' ridges jo areenic' rabbit to niaotlaa, reception toilet o( pearl gray noire- b. jt-. r/r.r: ** e.Mn,0affla. :. i-) wit-i alit S.iItI.so. 4.S bail-Is..'.sa

:.;. ., Hiai>'a-ra or U. He-ooDlider*. eayfike barmaaaatieal velour, the entire bodied covered with .. Violet are more than aver la"... em ot hors ptaeaiat. laTHs 0 tkO OkOTO MoUaMOUOOMPAa1OM.*CUM WS Will(toot..t.qy.ee Iie.
.'Bo,'. Old F l.nd.;. journal that- alkbonb>' animal may 'U*** sequins, tod wore.a '(mall boa Entire hat brims are made of tb... an t.nil k.now aad 1. MOIMotfwirMmor oorowonloo i iSo. '
; ,
t.c1Fi : man I. .Da I And yoa i-edaoed to ply', have ingested,poleon:without laooavenienea net of sequins'with three gray ". Jeweled belte of every.deo rptloa'a jto' 'recatftnir port.-aeorXPM ebaaaw.* la 5-_! .mI S54 uM 50.Mile J1 Ikoo t iauId*reU'is*jp"J? '

: ::4i ig m eornet on th4- .atreet.eoMr" .somekea themielvee, U may wily Over bee arm ..b''rrled40a, little be'worn"thi*-sprintr., 00..10V.Dd.rbU" 4tte objwt ol tha.".. .3SHOE": ?. *the 1,104 a.sa bI lb..1 Lou. __ ._ .') C
U.iarr' : T'jyff- .;; folio that thalr-flaeb Will prove toxic boulder"- cape-a combination of Dnehae ol Marlborongb. IT ivepoadvliT-'Well, t"or UUMPL1IZOII.- prorlta.ta so* ,
M tklo *< irl kaa.n
>ou kjr
I | tlnssi .
rn > Bogga"I_.ln't'doig thli to makealivtagr to- man .if used, a. food.-BonntlflAmeriaaa. / black, turquoise blue velvet, and set thin fashion last saaaon In LoadTh. way I should.ebjeat M aoll oowpotHorl.-- .gms esor I.s..a. = --
.
,
? My wife won't l it .. .? j-f. t'-ffi report Is ao* indoame *1 J0 vooron ; rM
; : < me ., $ ;; 11 eoetnme illustrated herewith laovbted te Da'WIlIIs M-4 4.1el_'
r, Uoe In the Iao_"-Tit-Bite. '" .' -' _-__ Oloa behind'.Mra 'doaU-andKnitrong ,were lDad.' b, The ;national -Cloak '_7 loj-ltaeay esjt be. 7.:1itr: '

: :-' ;r'' .10' nr *., ( ,., .ThJa'. .ae*:. Farmer;> cOntrast ",to .bar"-came Mia Company, ol STw. .Jork.. ,s- sane seraly OB aog-bt* at-or not wfca te .. J ad of ov_ TorMIl.of___ .._...mL -- '

; ((1 J' -.- ?\....mft oo-H'urunuw' ZapanIson.; jail, JKarda*, ant atyoa Mary Mannerlag the young end ben I "A year ace hiM 0 0.:11. YIJr' amsipi 1. .1 ANEASLIVINJ

4ibt1 .;rEthel t 'JIoreaee ta engaged to Ita .look over She 4.W. jon son 1maglae tlfal new leading woman of the Lyceum -, r .Dmaken I1 ,_ 04 wblek reeata-d .. $ rc.-- ... Wtm _,_e.,e.sa l or wnolia'viseD!4.ewe

Barrytona.Jt'e' -qalI" iateraning. thai tbef.are covered with toy Theatre,*who*la 'quaking a very ,] The Bootoh aewapaper* are 'Juirt nctfpminJnga Hit seed.Maar plastoou mea sod> .* en_ ._ fcono erlo.news.i.-a om, ..ssek4a7 1 _am s.aa.s.or.4.rs. sale,-

TOUT: know it atarted by her parmadtnf farm* where tba abildrea araplaylniwith fine Inpraaslonhere ia the thaatrioal (tory:of "drankennataTnu; ia1a.d-very Jftti.r.u.: ._. '_, ..veinhim aaiam.
I 4 t so bl11d. Z eoul4aot ,him that be*aonld r>ng, and play. the lawa of nature aad iUlageample world. Her draaa Iwa*-a* simple aaMra. poultry.1.'. H tppear that on*) John, 1"lIowtD. I dkl .01 I. .. ItwUloaMrvnnwnlnckortlo -roforonaon 11:7: U.
*. for aeveral minute*. !"" / fag hUacooHapanuaeate& for .:*.-. *o(differ eat kinds oivegstabbooad..ggsInL. Oonld'a wa elaborate'aDd ev,n- Tamer of Laggan, complained to the: say acre nMII March. | --(1 smoiptnooo*n*oon Bin and onUofoolory booornbloooollne,wow o>*Iioolr

U1; rI: toold not atandwry* tana;without f.JIa..I.H., now wiehe berto Eyer7.hlo"- U1' on.: I more ttriklng on 'aeoautt of it* aimplleiyoJ3h magtotrate that the refute from a dii l And palu la..few'>k_aeronda"'.' iotton., send a sam o< our ntodlolnoo to ne.rca sxpreloOoeelMrotpropoldl

L i : *i foe nf1 IeW aad voraltingi K;I could not _aoootapany,him all threugh-UlV--r dimInuUvo.e.i.nndtbs work lies .urli l i the **. 01 .early' tUlery wa eJI w.&.. _.I.to anad-j (oft shin a, axtondlBK. ,... : 4-J. told tor tolr so TOO oou ihont>rwo.Modlclni,_Aconts SM or
: breathe along! breath without eeream- "': '' flee and aecnrate sa that applied to i Spring ia an extremely ct.ppej-falIO joining .u_ The fact that the ; to-.amy konlo : P Saltier selling. Our modkAno glee porllofoottoa

r 1gybeartnod. .' --; :'.; '. .u0ee.ii"I. -. Oloiaonne va..,What would an tlliaoli mad.gown ol a age green,and fawn stream eontainad aometblna' ;mare'than) sail front ..tIme.. tbe 'With careful. rotation. 'of nAord to nmno wnorotor too aoovo tnlrodwood.Uborol oloo off or-005. $1*

'. I alao) bad female weakneaa, InflantttatVjo *. ..Mm, indeed :Ur*. Haeh.it or an Iowa- farmarv think,of planting fcoeded mixture, with a perfectly plain mere water was anon onad oat by bbs 'koarabla.-' During' for that$ 1 ( ps and ,liberal:fertilitatio'ns;" tine to too very unsent liseuttint cootmsolonront ror l0Tue7

; of $ eIulnfu1.meDun< :. t". wae a Ana ear-Ben.. You.:would ble:etJr.. Wheat,'oats and bat-lay."i* kirt, flarino;prettily at tharaide ant complainant'.:-daekt/: and"by some walks and naay lands will improve., The I iik Ltaad.P.ld gob s ibede mU.mspins.*

Tl.ttotti dliplaccment of th*WomOi itohw& -. ihave ..IO'. .1&:'*<- '."-""'"" bnnoha, thenwhaa it 1* _thtee ol back.7r.Tba; J Jacket wsi&Oloself fitting ineapa or oth.-bla beD. g t'onjte the t. I I rrm.m. Only soon portion sa sa '
W
lilt<4f thekejriamal parts, and nleerat -.Landlady-"Wbat 1 ae the textr'arder .' font Inehe nlffh. traneplaating'avarjpear Elonv.open front wltht' doable prier.reaching 'good thing". and'paabed .the tht.. .did...ml. say vnltl-.I eoald' I tationTa.o. :pro M', >tl L roforonron aooo and nSO nood sag wrHo(ITO Ihoroqulsltoo to rUg ran,

1 ttoa ef the womVL X have had, all- theeeVyhuabandtoldme., .. -"'' 'WM :'that pauager of 1 U in row a* far apart a4 you to' the arntat tb*,'top and .along to each an extent that they were all, and kp okl kow I dM containingufna nt'..Pot I I MKltlClHM VOMrAJir, ,AUootoCVAZI0 ,

;, t .eo..pl11ti. -' .- ;which t.Ve
,,The pdn.I bid to t.n4 woo'. ..ome.1y1 eoliolton about what we !.. lo -eataad wee.i* hi. wheel Bald Just aa i _. except on Bnndsya, when bias dtallllery Marcoi to puT" : '
*, ? Ooaaeotient -weed hi .-; .<',_" .7 --.c- .'rink ,t twe rC. profitable and
farmer 0
thI* drea4.L ) drink ". : ::k.:4e- :; Orion t failed to sure out it,inebriating refnae. .crop BOIEE&.
.IIID"4 lay
ItwtL. 'to try; m bottle .4 ty<_la E. nnjcban- ''..- _J-."-V't.. .*",i, .. '... =. : '*. bad. and cnltivating! hU potato* and --- 'They however, made up for'lost.Mm* Be bron..the boa Usefertilirers contain. It'uI eteoc-ripea '*4 dba.ti'
-, *knAdlcitta;whkb I did.aa4 aSter taktar'tdMo ... buley.'with. M'muah sara' ii a trf>D$ 4 rI oa Honda1?*, and a* lad bad to b4 enredep awe tbem eneordlBsj te no't leSs Jo'.X' t **stUng, PuU.ju 0s5 ,
mQJa,. ewm .= :;'" Island -farmat':bMtowa .'npon_hit $ .- : ciallyti I loek na lo.I llJIOOft..D> ),the : .LsDaz.e.Hangom.Sin---. -. -a.L
: \ : ___w4aM-.w1 da, week 4 ----j jLOMULEDI&o.W0UM
?rh... aald Air Wa't8e"c1MGtibt. gout rtatemantTurner fovrtb'-erefikpllW "
mnehrooma him
'
aeparagn or ot 1a'irooF obl "
1. .' *
4 n dMnefo.lneMlonraayaa.snalrtCdpiponid. "" IlIoelr. ; .(.. ..tie bo. 1 wan :' !
.
4c .''!hope every woman. tht.eburo who bad bee." entertalament too filtoko,to>Hhe bl.Jona.wife. ,era,.-.Boiton. .Jonrnal.. c'1"'' '. :0. .' ,,,..! ,. prodaoed court ..,*hiehvaalnaafaolplentitage ) aoald walk about fUal: Ppt3iJi.r r_ :TO ATf D 8CFPLT C01'.AJY)
'3;s who au er>will take'yotir Compotrndaa4 .V. '-i -. : of delirIum .' tat._boor box.-; '- -' APO.tjaTA,
t'M? / pie got nn aad BABg rlolo-** .," 7. TII' : Xin"U..".1 J -r----r- ; and the remainder said l IN a year sad I bave. owQMoi'.i: ;
; be eer.-M& a t fcQiUUAa, '.'A aole r .d Mra,.WatU. "Howeoald : : : .- :- I tramana, 'were Every morala wkee.I $ ;i .l.I sa.co4kt l ,specific" :-
.
tii* y.nI._ seeI.s.ThWi'& two pjreone.t.. aaolo f s : ?, ,' "One 'of the Boel remarkable) of war .- (>- i to bav bean;$oq,tipay lot preeenU'tlou. aad ihuk h w (rood k r t"RIt.7- ',/ ,
*' Uventioae, i* .attributed to the.inanaity -' 'l'i ;.t .; *' .. fort.'I thank Or. I 31 -
MSBYOMfANY TbeyonlyhadliUfa.voloeap.eoe. I. f' won-1>rt"*lr, ll....y I okont >nook-ikinnkiWm .,sby ssmsl s.. .
.-1dsiepo1te. Jori1.' '' oI' :.. oLe Frwoohman.fan QiSord.* I: :ni fl.iI UB. C.ali I'' : "-pld vo* ben, "a\'O ._oo ko ko* a,w -lo ino Uokod Suuta .%wa raokoi sold lad.?a ss.ant..
11 $. Y.eej *..*tla.dl.. :' S '- ,. Ill "mirotogu" i* a repealing ride :, akl-d.f'WHI, "...I In a kulo took nibs wo foMik o.d e41|Udly sad b.azMip.ewatne. .-
"
.f' .
; 51.1 ,. .
5.ee.In AnMrCo wkowUI wttM., .!brels. be 1$tulsa
1r4 r$1lIosWIst *-wt1o suan11.- which _1110;.no aninpftwdar.Iiqaa-. :_,::! b.vi.riend who u (tonneoted .ommhW aboal'tke .t|o, any,JtRll4s. '' ed te oare eeta..respeosgbs and
; KAt. wo.aS.1 :
'" fled air 'obtained under with one of the largest aboe/atore; 'of aotklas more or few ,
praaaar a I I. / .IssmUbbblm ,mb..4
E InisandBQIv ; ..;.aQr.-Btkbhyrm.To'p I1Yj! .,'That,doea' baraditary' temparatafa handrada of 'degree* be, e : : ;-; 1: : lbs .il,. "}>A. day or two-ago r b* wa hip&r.41.William'wan aa.-Flak. -. "c .9' :1G'm'i' BS&ssess&FBeator
; t'
.
i aO : .
WM.e.s Pa Ob'1a low aero,* nod thni.repreeen.tinx aaanormoutpanlr I called to attend to the waste .1 a en* .aoa.leased form, all' ,' -
pi- : .vo.4! da. ,/. ,. powerte; tha : tomer.'andhl* firMquesttoabrought toltt...w$llfeaad.. N ESaOOLLCE(: ,
ometbiaf that goes tram parenfT to -- r<-nor, hatund OEO_... I -v.-.' gmrtb.
projecting tore.bi..rifle, i* :'daaariwa4. out the :fact. ,.that tbe.man wanted;a '.. .. .
ebthf.Now II 19..OfIalJi.. me an I I1111Jt apseifle f._ l t = sass amen Ikmt-. -' "- -- -- -
pair rol (bo*. Ot'ocnree reyfrfn.dnil.ln4 .
mack -
< beiag UfhtrIn -
: \ ; toe alazl. partial ; --I
._;. ',- example oIl: -.of-.eomelhfnjj_ _,_.thkt,:!- :J; heradiKJBobby .,' -, weight than..P_<3inaryrln. rhaateel ; : -H lr dtli."ilie,'-and.tberrby elatiits,-nitnratHJa,1. : :
teTf nartridga nine In.be.'loaf.;and : : bangs the tale.', The eattooter looked bavUebeIIUallWrff. r.I.'P.J8R.Br.rrIMk' 'i
-T .. I'I '
: > got'e'a froni .JIIIIII*,ra'.eI for &mlantobnS. lie. lailoa pf the heart, pile. :
*5 t thick j a*r ene'a ; tbnmb-?eontainr ( 'ZE. ej.aen.amI.O ,. .
1 lime ll t1
( of
.0Uau Sr? )oUyn IJfe.; ''Y'---- urata ....
not to be fated by p- Ui.'
bI.L-j J threw haadrad bulletarwbioh'm.y. badiaahargad ( ,. it' *neka lrapl'qu.oe. fe l-aliv-'Pak| fit$!*.. ; ,n-.ur.
; t v ,- f. ,tt ;I aa qatckly.a* tlowiy tiote and finally he blcrisd ont I,';;,A*J: ,wh$ be neat paC phki r-i

r.II'IICSIDaD, rvurrae-._ .:I deairadThere !Ie BO.amok I aad" aafla ';'.W.'... Wdpu'i know eKxaetty. bat ...(>alias orM* bo n Li iiut.owai.Tianer: sssssss' .,

: ir.n I nnd poslare la r.*si' -:TJifg* >'flaU. old"man.t" '. '00' h.-'a1y a sharp and low :..:;. t<'wear ..IU... and a half eoJlnr.--'t' ,.las a<_]Dr.aulil willluw In bulb*$or by& ) ( mama....0.'.JtI'W AnaaaryurL,& 4.'jii1. r-i.. vit". #,... .'...-.T.I

-A ftOnW nigg-'E.e.: .. air r you have soon a*.t eartrtd$ a--l.aeapty., aathe'ri ; 'Hadld hi* beat.but jay friend wa 0ady. 11.f ., : ._ ?
u...b&ll.. 01 me.-' ".''. .: ''1 ean- be ..... O.>.intntlr i2 : y not.nmoleatlypoeted In.*U relativeproportloc :; v'i.scWs ':. -_- : -

.' e sti-ls ..J Mltte,Cotes**Ma otaokxlnwovr -'-.:- f;..*Iaa>J lfat have .Wsw.g.... tit, ...drecl.ltote eaetiaff; but two( *of..'.'..:'.. ao badt0.makeroeeakth ,. girt_ plck : (fttP! '- ; '

saoV.M' Or04* )*nawa p is,a i wT s. v.yjirittP oeiaadLJ&HTv. geg.aso ". .gIrt bet Lyon. meg.d.4 aad a half oeateu -". w'1;'. M? "V'I't -- : ( atM required; Upet'ab alwaya ,. : : .

.,. bero.Tt-i.rr, 'fJ- ; _'.,r. ., II V i ij -: ndiry d1t.reDtpaine .nntU.he bad Wte .heel baoLl : ,
..
_
"i"r' k ki loa"-.1..1.' t.,8ot4 '"< 'I, --l.
I
04'ot
j I"1.fWNiRg.Ie.p t WUbS..g. .'iJ. i f ,C1 proper,tlk.-S, -z
J"I'
1J"I 'f _
1Cs.: : z..i. ; I { .iW. *slvsa$ : -
.
( ... L ,"- '-. :Profaaaof Blaekie 'we..s-stayingt4mbIL'tBEfoe ..... .".:. .- .."V"p/, .-i >-r ( 5)1 ) .o..iO'" r.' ."' ,0-, I
Ii'- ; _
= UiIS -i -- _
; Kobbi. Wa Iuti yr1Pt -j ( 0
) -
'W.014 "
-, _K1 **.t.iriallo jrcat .wai ; ?-IIWa--" 'J ) -
2K Oen-taiW trtwyH K.4t... y..toOk. "I..I >'': -1 if'I "-jjN JJt...1b.' ba had two ,:-eJs1l, ,: enacinu aP.Yq1l' nnnn_.X 't 1) J eaUto41fli.the. : \ :

F we cur. E 04 '. P ,..Bobb1a. .wfullywrr.U, I rwo*.' onak.>t. 7iraitbat; they ;i\.";. J_lID'L':01fWJIJ''. 'f W ; i neat-u'er' lt;ta\i.r.swk.; t -"- :
fftf.A TlaeeJd ba.not, I Idv.bno4rgd
< V. .= '.=a.ve. msa .4-my,ialaf-r. waold.aUawhl*bedroom-dftoi to atan\d ward 'faofe. raw ad.piqdbj'. raomH ap- ; ,
.
? ;
4llare.;.V"l ';' ; front mettbeingfW = : :
'r wiasgi .1a4.IIIeODd ."&t1I3.ut5tueSto i o fnbww $tba1Ior peiba..Tb.asieniiib..be.0pandc .. '
.z BobbI-"rdo'I Me ". 111Wac. 1'' I be aMi1 1ll4..U.1.. U>* waist" ..to.hnnhv taW4a4._4 *> .1tIa1hIiiI: ifiiidril-tIM for ; I It
... "' '' ,
-
.BobbfIf.1; ---4.-1 ibb ltn4tltlehhattb&- ....a.-.. 'qV'II 1'- '- ._tl f"T t. "-'
..111., I It. ''CII'{ We :hi enoUaU.e.le.p.. <*!T_*nove-tyat the'eoUm-m waafhibeln.whle ., .l
,
lit 'ijniaaj sgre-b.7 I "IIIIoo'" tllfW' ongA ,. *r-part\>,f tjae jacket atii il i:

Wt t. .!'T ''(''*J.: ''ii\ "7Ar1.pesbE4rf r '. ila"Ia. _.wa vb* fneea tie_t.. raj-atta : \ VV !

4Jf 1' (.n ..&_ ''x. .t-l..:1. I }-'Ji.. ,'j s.et1o4 -.beneath tfce): .. end .-.., ,. '_" "'/ .'. \ '
'yII-&fl1! I:Mreugejtonast iOtn-Wbn U. Inohkiwa;'at tbe'left'.;..;aennyBy rM -r ---( 'IJf.1 '

i:_ jts'.,: ,W...AW ,. ihia utter davie4Hha.eo* Weea> 'ij ..FF i" we i r

: ..' :1.'jI' "-Ic.. ,. i : -.at ..,:,.w..t well Ii"ta--baelr.'ttOIi, '- sicge'-a.iiea !1hiatre b. bean

: : ,._ 'UJl"ct,*' .Ji9. -awe. I" .4nepIbt.lr-zastrsdsI4' "... g-5 ene. 1*
.. cat :
-,: *asip 'tin2 : ; ,
I" .
I W
t ,
.
"" .- I -
-- :

:1'.1'"I. ,. .1"g.: $ -
.
'
.01".r" ., ". : -s-- : '
-1 ,; ';-<1 .c.1 'Z
a
k d -- -- -' ,_-c', a-
: .
1r1,
.
== = t '" : _. --I
? i 4 = -c- ---- '.- : -' :: Tc- -



'
j :. ," t--w, ; ,A-. e
\I'
._ : ', ,;, ; .
.. j.;, ..",e.", "1 i'" ",'" :t'J1 .,-.. ..1 ,01' :1.. ,. ,. "
<{ i "
'Ii.1' -- ,l"f ,t .
; "k-" -
; 5 j'\ ,
: ;J.;, ;" I"y. \ i1 ; '. 1 ,' ,
., \ ;
,I .M"1:
.
Jt. 0.1"" 10 '" .1.'J 11' :t1II',' : ; .
; 4
.
J.A, -... ,:'A' ",.;, itt: W.I' .c'c, \'l'' *, r I1,' ':': .;1 ; nW-'i 4: r'Lrzd \4I'.4' : l!J ., ,' \
.
1 .1. i c ,. .
ff .1' 1. j.-/t' 'i"I'J .
ht "
.. 4', ;( ,)' ., .""IJ ...;! : s,5"u .J- I i :', .';""" IV, '"", I' '.1. ., .. "

p j 'S ., .. _r 1' j _
t; -> _. "- ''I ; ;
.- .J' \
-"tJijr 1. i r t i 'b"1t j flo o CAi.t: '.t Kata'.; ; ; for'Cish; at Katt'!. 'At: ;r i':, 'j.r-wvr frt. : "'' ; : t',!
( '
: HISIMMEE L : .. ,. < "r ;
I 1 eanrfMaU
: aaiTUI.WZaa ZaiI$ 7 J. 1ersbr.DHaDC"inyaeif. 'GJi"' : t''on. : ;
.h 1.Ana J .' -.._ ,; .E .
.
:nottons\ 4dcs'fIres ', -Chsrey bam made business f''trip 1J 1'IJ1ws2' "lS
TCSSBAT Ivavm. Starch .t. ,Ii'"" o Ie or.U ctfoB to-tb*.II HSMT'vf' ,-1-.1f' -
1'VDL8IID: BEBYj'Vttill 8ri.i." -4 4" .! lIaWlt '; good. 'to, suit everybody v>" O.lall40. .'., !.. ..'.; o/I' \. %-i < 'S-' the town e4 sCuwlinai**'Cter,at the ap. '. \ : '. ,-t', ., ;.2 '
'
.':'r' 'p- .. -. / 11,.'a*.., ; ,I' .-Captaia Clay Johnsn il", came up froroFoft < "Wbn..'only'_ about_ two.lf'Ontb. preaching city .1ectIoa. And, U reetoe.Md ; ,. '" .1-, ,' 'Ii" ". Y' :'f, ". ., ;.4\\ '"
... will the doll ci hat omc
W. ,... II'J perform ** .
< ,; : '
;1." at&J..Z..R '
rIOD'\b.: Meyers l'1i1i1diYcl'j.. .. and.a half left in which';w-may:, W the bwfiol .billla th* .Inter** ,But we arc still lathe ring,'wh m lwrgklf (
". .t.W..DiI"a .Y. .MAcu; 17, 1897.ft .- J t .::.': : : .-',::;: : I I'IMoia7. \ :grocery.man -j < *,_ say : "I < i ir1' :
.' ...: ,. ",' .... .4oel ,-ba.'moved his stock Jntoh( -'D' Johai Pleroe, of BkMlojer, Is "gFow In Jt'11owledK. ..by .r.t\j: c4tLse"entirepopulation.f' ttgijrrr _
} .
-F i. : 1.'ad.J' ,, .. ..u.I, .148.. .-vacatedby'H. t ti"fhi basInIspEngIaer9Ubert : -MI..Mal".Jobofty" of the ''-."--.J. QUATBB-' ; 'I\ ., '."
--.J ... ... .-.. ..,-..- =' :: corner building"recently1 h1t -i' one __ :1srQrt: 't"ft""A'yr-.E'L.' : "
.' "i'v'jj '''-. -- .', =:,;: .::'Z-:3: ::;:;; :: '! -t. .. ; : ;. ,
9i. HUftCIecal. 54. !. C. Stanford's racket. store. of Steamer, ROMsda county teachers entered the school 1 v' 3ee-Xsmbi1L '. "i ', ...'h', .''f' .. .
j i 1 \
: ; "e'rT j,: ; -, .,. few ast'-Monday, that .she 'may be I -. ,\ : :
,atavtgtAlIseIer un ,EIoQQfifi&c: : u'oaiosrd Is at. .home. a days.Mils, week.R.meinbe .. I thereto-announce "'Mila'candidate .. t"
--''J fey at it .. tn. and 7 145. p. I. fnlpf) .LOAL N WS.: LianbeT for l cheap at graham's S ,-- ,_ 'the festival, tomorrow' more' able to-csrry 'on the work! tbrftbe oAea. City MarshaU-oi Kisalm.mete. .. '. "_ "
r.: '' Meting Tharsday evening.t j:ijoojclock. which abe l1u undertaken..Kedcctlorf .-- i.j-j .:',J my duty. iROCE1IES' : -,\
school at, 9145 $. DI.j{ Gu.K aw null. evening, at Store room next to Racket., ,elected.J..rs_ _a.' :. _
.1 Sunday f .
: .._. at r .4. ; -t :: 10. .
.ItetluctionorCaab, r. '" J One'of: this''pupil* In'the "' .f"
Pastor. .
A. PODOS "fe ; .
U. '
Snpt. JHsrt'who "
I Parker. -J"R-Gr. Jr.. 1..W''nati.and : : / Mrs. .. ,ha "pen,As I' 5'c' .L.-'
other '.m'' J
r that "
M.THOD.-se"I. ar* held regwlarly grade remarked day -J'oianJa : '
,1 : --.Thu N. V, Racket Store jsthe J.. BeeVnan prayed Imvoc greater portion of the winter in Jscksom- : '. .' :-. "
".,{ at It .. In. and *t 7 toorp. m. each J.. 1 he intended teaching school next I h'ereby announce myself,a candidateTor .:. '
"oW "Sabbath. Sabbath school at 9:45: *. m., r'of lowprices. ;- ,. with the feathery tribe.. a few day. YIlIiI, .. at.r.d to Ki.sIrnqtd* term,. :He haiur best 'wllh.i"1 fIUCCUi. reelection to the office of Marshall of ,' .A 't'.J' ;BCn I. : .: "

-',- 141*. Hughey.Supt ..Prsyw-meellng! -Mr.' and; Mrs<' Huffman .and; [alt: \,---",,;--'- .5 _, )r, -'and Mr ,,E..Li't-Mler* ;.wpred :--_ S KUalmtnM City at the approaching City .. ', f": .S'S t. ,"" ','," S
"
night.Codaelft' us wshlp. '-- --- -S S 'S
*130 Thursday visit of In tile City few Hours Friday"onr[ their election and refer to my past record ol .J '
.... Epworth League 6 p. mi. Mils Huffman are 'on a several -25 yd of36incb'Iiomestlc f pr Lassoing was 'i-eIgiiingiupreme 4 years as tit, Marshall as torn,, fltness WILL. TAKE' ORDERS, EVERY MORNIG./I ,
M S.'LA-wintaj', Pastor' i week* to Mrs. C. Jonet'at: |conery day \he'weekat'N.. return to 31aasingcr4vuiu..TaThpsw3erethey foUf or Vive days 'ItO, out had to be and ability to All the position. -. I '
IIA"'I.--8e"lck'n ,
the Baptist Lakeland., .. .11' a' hsve been visiting for the-past. two : ___ J.. ;, GOODS' PROMPTLY 'DELIVERED'a'
Y. R rketStore. T V': McPMATTBli!
''Church ery Sunday at 11.'m..nd 9100 ; : ; ) weeks.' ."., :- topped by Prof..Shlpp. 4 _" '

p. m. Prayer meeting Thursdsy.night. .t at i;--'Stsnforde.boe.. will' go, Jtheprices ...All"of the; trio.t reliable family Parker's' SarsaparllU oj'' is 'the_>JCIng, ot We regret very much to.announe- C.' 'It rT $t e".,' FREE. OF CHARGE.. _, % '
I:to,' Sunday '''School every Sunday sell them. \ the belt the loss off two of the of the
and
and medicines pupil.
patent 'Blood of valuable 'I candidate .
.. ).C. olAuaa.f Pastor. Pursers. Composed hereby announcemyself a '
a n. "
< .
: :?-94.KriscorAU-i-St.John.j Services every There beingno quorum present drug. ..usedin, compouI14ng'pn.acpptlonl purifying and tonic herbs.and roofs.-An school. Misses, ,AlinCL.a d.Nanl.ka for reelection to ihe,Bice of City Treasurer ) "L' iIOEEIY '

., Sunday at 11 too a.m.,and on 4th Sunday there"was no meeting of the by an, experienced druggist .. unequaled remedy for all diseases of the MdoR d'.' : '". iF'rewell at the City solicit'election to b* held ;TpE TLOR : ro ;
Liver, Stomach and Including ( the'vbtes Of ,
and Blood Kidneys M.rc"Ib'"nd'
t.- month io m. 7 230p.m. every
each .
i
13G" -tttke' .
::1 the
Communion on 4th Sunday of every Board of Trade last WedneJsday.evening dl'1lgatore.( Rheumatism, Neuralgia, Sciatica to pleasant day of quslifled voter of Klsilmmee City.-.--.' .' : > .

secondmonthathamorningsenrlce.Holy ,. _* ..- V ..-,Tha salt of.life(JniBinew: 1 1 .etc.. ,ForSaleby C..Leake.- 10. winter and welcome' ,or is'it unwel. .-_,. ]1-,.J.) A., LAncASTfcar'Tor .; 0. ., ,; ....

Week-day servhsBery Wednesday_._. at -For best shoes at living prices want moreoik.jt3Iling pure -The Rocafbrd,Gazette thinks I coma to'the- ach rching". -heats of :5' '. _' _- .,-- ..". -- ;...:: '._ :.O. -".,..-.
4
7
_
Clerkstd'A.ditor; .
-130 p mL --- immrner.- < .
NAa -J "PeteE1flv1neitrvIce'oii 'N YRck'r. h_"_. 1 re.h drugs and tre.ting,011 right that *'if 'a country' edit wm. to : 1
"
'lIt and srd sund.r... 'of each '-Mr.and.Mr..Thorn who have mount, to anythirtg l I. -wiljl) get )it I map at all the InduCejffcpts held I.' The racecourse Js now in "fullwin" I the hereby oOcof announce.CJerk.nd myself a Auditor'candidatefor at ... :"I "
,
month at ro: JO a. ebratlon of J.CLEieI. out he would soon be a million are,i at -acb ot .Thp manager tbe ctttnint-City election and-solicit.tmr.. : "" I I5
-, ,Holy Communion on jrd Sunday of each beenat the Lake, .House for-the 1 an entertaining' hour to all friends. : &
promises of
to
month at'morning service.* -* p! month, 'left Sunday for New '-The protracted meeting at the; If he runthe notionhe paper, would according be in visitors oji:receipt of a pin." .support. S my W!-a.-Iflo.". a.r.tJ '" '_""_' ..___. .WK'P4s :.'t. ." '
M. A., Rector. "* everybody's ,
RavA. KiMMKT IIALL 'X ork, 'vhertI1eTwiI1eside. Christian church will close to-night, e e. \
CHBIHT**.-Services at tile Church with the subject "Tho Blasphemy' the poor ho .. If. he published One, youngatt. in ..the High -C :'. "
; ;
each Ixtrd's day at 11 'o'clock a. m...ann vee those 8 day clocks .at the .. Holy Spirit" oral it is sometimes half the item that are sent to him school has_been sto'ring in.his mind .'ti -. -. 1 .. ': i, _: \ ., -- .:"j
".nd. -ttonl t_. m. -
'r-- IJ p al-9:. New York_Knchft. .. he-would be In j jlQ.l > lf- -tha--time Ll.ougb ltowardMr ---i- -r-- 1
t "
at l tailed the Uajmftlottuble Sin. -PO '
Thursday nights 7:30.Stranger :
meeting
rayer visiting the city and public -Rev. Stuart Martin will conuctervice.nttheEpiscopal Go and hear. and in the hospitalthe) other Wentworth, the 'ou bor. of the '" t'l
,. :
..
'
+_ grnetslly-41vited.-------- r --- half. __-_--_--- ___ -S u acltoola..A1gebrJ1&___ '. '-" .' ,
-Dcii Mlllai-"ha. the Anest.hslr tonicIn 'AO.K'ETUndethisytludorsCIl. .
church next. Sunday at the nsuitl the land. It'.eradicate! all dandruffand .pipti-CaWwell. S The lecture given not long ago -H ft.r4 ar.F1It"irqr r : 1: .&

MASONIC NOTICE.OrangeTttostonv hour. for services.Ittdiirtion'fnrCanli..- '1.I > keeps the hair In fine condition. It : on;.the. subject of 'beautifying' is ?, '"
r Lodge No. 80 F. and is for baldnes hot- Last Thursday night, at the residence ."'. "
sure. cure 500 per having food effect on the'pupils, : .
,, A. M.: Regular meetings on Monday at Knt .!'g< tie of J. A. I..ancaster, in this who have been adorning our.walls e QckeryHarn'ess'J
before the full moon In S
,
: es evenings I month on,or at '10 o'clock. Visiting -J: I. Lewis and'T. W. ILirfordwhoare ( :J_.H yoy_want to plant tobacco city. Miss Mittie Caldwell most and witlr pictures.- n I > ,
Walter C. Bass of'the *
., 'brethtvu cordially Invited. wintering at Hotel Kissim leave your order and a dollar for two Theegtbradels having se. S S

.c. S. R. BASSET, W.. M. men are off/'on a business visit' to ,000 planU-of the finest cigar leaf popular young people of Kissim ries of examinations which seems WE ARE 1IE11E TO STAY! rI. ; S
S. Ml Lit*, Secretary. mee were united in marriage Rev. ." ".
thin week.
.
Charleston with W. L. Van Duzor.RtUcttowtorCnslrtK1&s. '
,
"
.- to re.nw-tftein-.oracioul and "fus- 'o r "
-'------ -------- -- ---"- = S-W--Lawlei Methrctmefathi -
pstor.f tht .,
; ;
'
-VVaL. ? OQO 29 f. OZ 0--.. -.- rborve rnoney-'py= gAt the -.' oar.rc ';. ----- ._- ] us-Jl.: ": -:.:-, .. S -: _._-.___--_ ____.._ .__. -m-__=: BUILD1Nc-MAT9R1AL. y

N. Y Kacket Store.S'undTay.'Vva's .,. One brfght scholar .inTornxed .
Arguments on a motion for a Mr. Bass is bndof; the most progressive history Curling Iron 030_ t '. "
--- .
KNtOHTSOP PVTHIAS HOTICK.Krlendshlp the hottest of and substantial bus Prof. Sln'pp' in his examlria- 1 .
day new trial were heard in the Drought young "T' "
Lodfce,No, 10 hoTd regular the 'season. The mercury almostclinied case in Atlanta last week and a mess men of Kissimmee and is to tion paper that Columbus. discoy Swan Down 050 Cash or Installment.. S S ': :
8 I $4
*
Wednesday erenlnr at '
meetings every ere'd the'north pole: ,
o'clock, at-their hall, third story. Bran- out at the -top stopping new trial was refused. Mr. be congratulated upon securing a S Paper Pins ole S...

dew block. Visiting brethren'cordially only when'it got up to 94. in the Drought has taken an appeal to the young, lady of so many lovable O. BMABCOOiMKR : '
-t Invited to attend.. chnrms and traits for his bride. a S Ten Slate Pencil Ole TAKR
State Supreme Court. -'S SYSTEM'jj1
). A. DAMW C. cLJ. 1a.de.StanCordl ; This couple numbers the HOTK8. p ::

J. W. WATson.TC. of R. & S.FOSTO'FFIOB Racket is Underbuy -Best quality of seasoned lumber entire population young o( Kisiimmee This section Safety Pin, per dozen, 030


_; >JOTICK.Mail UJidersell._Messrs.. Rose bauin and, Min- prices.always L.on D. hand Graham's,at reasonable saw mill. 1 among to their'them friends cougrstulatior.s, who will! and extend dry And.rain is of ne the.deJ country badly is very fothevegetables Collar Buttons, -- "_._ 04 cHat -' NORTH-, EAST' SOUTHWEST.- -. '

closes going"north at n;54$ a. m. for northern mar- VIA "YIAackattriTille .: Vi" 'vli: L
erd .Who have been at the LakeJlorule wihhes fur life of wed- / S '
C.' with Mi best a long Pins '
and 7 130 p.ro.;..south i :jo p. ui Sugar -J. Thompson ; __: ': 050 { Jacksonville, Plant j 1 t>upont,' ,
Belt tit. Cloud,-7 10.. m. Narcoosse. for the past week, left Monday Ha.a,nnd S-C..CJutplin with MiMi .led bliss. kets.Mr.. '. IJllaponl.nd Uubonl and SteamshfpTlfton, Jeaup ," '
M. Hasull has
night for their homes at Atlantic John startet Carpet Tackjs, box, oic _Jtyaycross.
-4r-,. STiyand 7::3t>, p.m. Turner of Lakeland were a pleasant aWsycross. Line.- -.nd Montgomery.
idIOt of Letters at WhiUiw. (10 erect a in of the *" '
dwelling
CifBce hours-Week, from 7,a. m.to City N. J. from Luke- place RAPID TRANSIT AND UNSURPASSED SERVICE .
c 7 130 p m. Sundays from 8:130 to 9:30. party that came up LT T or )fellers remaining; In the poitolnre one destroyed by fire a short time Double Pointed Tacks, box oi p

m.. and iroia, :oo to 3 oo p m. -Look at the Clocks to be given. land and ;pent Sunday at Hotel at Whiltler Fla i ,' V New West Coast Line. .
D. C I.... P. Kigsimmee. .
l If0Mr. Finishing Braid IB
away-atS. Kosenmeyer's.Harmon" $
Muse 'J llndall. 4', Willie Watklnt. a; John Enni. Is living witl 05

Steffeleft Sunday (flay Itt A W ('rotley, Arthur Drawdjr. his family in their .
Bargains houne
every After days will be seat to the dead betweenL. Oxford Tie 750 -;.
night) for Macon Ga.where lie will the N. Y. Racket. I letter omce.30 )J-W A..I..DI' M. Ue don.and A.' ,. .soas to be .Vepartureao ..oalrojre..t..B97.l. ,_' _

rw.twneral J IHOjllPSOJ; try to get a business situalion. Harman nc.tr his truck farm. which is in fine Men Plow Shoes 750 S S *tg*<..< **)T". 3Slek.MOBTH '.
-
: -Billy McCool came down from 'Last JCxcnrslon lor Jamaica .
.is a J>arJ working boy and deserves condition. _V.D. : 'il
.
success'iil whatever he Beaver Full., arriving here on Sun- leaves Port,jJTampa M rch- an, uPys1Siliita 70C .
may Mr.:Frank has -S 'Solid VhUbuled'Trat.p. '
Campbell fine '
,
a
Jay morning, on his second trip to Plant Line steamship Olivette due ..
undertake No. 78Daily DAILY, for Jacksonville intermediate ,
points,
Director two acre patch ot cucumbers which! Linen Collar -S connect
Kissimmee this winter and will to arrive Kingston, Jamaica morning 050lioy Ing-at Jacksonville with trains for Northern points via Plaa i.../

and Embalmer ''Ideavege'tnble\ fertilizer spend a month here fishing and enjoying lid, allowing three days on the are fruiting very well. Hat 1>20 p. m. System.' Pullman sleepers' Jacksonville to Newt York by Pus. ''.
,
:k only $y>f per ton. -. the climate. :.Iand. sailing at 6 p. m., March Captain Brack has had a bad attack 2oc Sr.tem Bnd A. C. L., ," '.

4 -' Keeps Metal and Wood I \\ ATER'a CARSON GHO. Co. Do you know that Mart's Eaience liin 35 ; due to-arrive Port Tampa *8th. of the LaG ippe from which Ladies" Sleeved Vest, IOC No. 83Dally DAILY for Sanford and Jacksonville, connecting with ''

-The Kissimmee Dramatic 'Club has received the hlghvit premium Application for berths and infor.matiolTmould' -. he is slowly recovering. trains on Plant System for all pol... This train carrierS : ,
._ _. grr ,
; -.Ca. .t., Ladies' and_Oevtt''a {
; LadieCorsets Pnllman < -
"Tumio errgHgedinrcheirrBing- .a whatevereahil4e4.for--4p111tVpur3i -'-Runnymede Pineapple-corn -,- --- -2SCjot 1 1 :110- ft ra -- steeping- car Port Tampatoacksoavllle*Knd'JBCt'M -'f -
-- liurlal Robe., b-madeItODe-t sonrlll to Cincinnati. Plant .
Jbnwel System,
mind atngt-k-s&ians--aU aln'Hon Montgomery and L, \js
-. ."- I av entitled "Naval JJoUjes < ., tones the digestive organs.and C. Mills ticket, agent"""," \p. I pany are enlarging their pinery to Toweling, per yard & N.* )lacksonnll to Mew York 6. Jacksonville) to St. Louis. '" -., r
.New and Second-Hand hicrTVitlj ijeiJU-BamucTat thel>p-: strengthens the system.* Ask. for llart'v.( Bay Hotel, 'tampa,' !1.. accommodate I ha I large number of 050 __,__7.. 830 Mondari WedDCMUraandfriday. for SaDlon andaHIntermediats -', t

era house at an early date, for. the -For Sale by )J- C. Leake. plants which they'are about to act Men' Suspender" Z" .oc points. Conch between Klaaimroe and SanfonT ',
Furniture r MI"pltlln Na-rt C.plared. 9' 13 a. m. -' -- .<)
benefit of a public library. -For take ouH _>. '. I .
Indigestion Pepsin ,
.
-
., Sunday morning J.-C.: 'An- Several l 250 Envelope .;- oc BOUTir BODWD.AILY '. .". S
; Also Agent for the Geoage -Four thousand feet of hickory and Pineapple Cordial a pleasant I"K, Sheriff of Orange. county large "rattlers" have No. 11 J for Lakeland, Port Tampa T.mpa.nd sill Inters j, '. .< S

W. Clark Co., Manufacturers lumber also a lot of magnolia and stimulating tonic and positive aid ,mndj.|,-B. Gordon, his deputy, J>ep-; been see and killed recently .near Narcoos. 24 Sheets Paper i'e ..Dallyjtoos.: mediate. points T_Thurs,,* Sat, lor,Barlow, Punta Corda."., .J., i S
Runnymede.S
: ofMonuments cedar lumber for sale at a bargainat to digestion. An invaluable rem thy Sheriff O'Quinn 'of Osceolacounty ,m."t .

,,. ..... i I L. D. Graham's saw mill. edy in loss of appetite. Price 5<). and McPhatler ef Mrs. Harry Bullock has been under Best Parlor-Broom-. -2SC Ho. 881.No. Tuesdays, Thursdays and Satardays for"Vosf Tamp*; ;i

}: Headstones at Leakers drugstore. M.nhal the doctor's core for the pas T.ml..nd.U| Intermediate points. Coach carried between;' '
,. -The Board of County Commissioners Kissimmee three Pair Blankets .
captured negroes few is I ; = jcfodnd'I.a.berPillow ,:as .. m. Sanford and Kisslmm, ,.
'r and Iron Fencing. will meet next Saturdayin __Q.. A. Stevenson manager-Af near Campbells station wh.f. daysbut now improving. "A \

,' extra session, at which time ,the the Florida celery company of Ilun- supposed to be the'men .who tnur The Runnymede3ii>i n- "- JOC 5- 5 Solid Vestlbaled Train .=" Xf .. ..-

business of the regular! meeting of nymede VK.IS in the' City Monday.The dered two men Barfleld and Turner continue, shipping thejr! product. 13Dally DAILY and for all BarUrw Intermediate Punt Gorda LakehndrTanipa rf' "
Crank Beater Tampa points. Connects Mondays sin .
tc '!If.I: PERDUE, first Monday in April will be trans celery crop of the cOIn puny and robbed their stores atJuJcUasWednestlay They have made arrangement* for Egg i zcSKoe Thursdays with Plant teanuiilp Lin* for Key.vVst and HBi -

.ct*d. There will be no meeting this year is a success and shipmentshave night and who held up refrigeration during. ,:' the Avsrmwe .Brush 9:13 p. rn. vans and ereiy Saturday with Plant Steamship i tin*,for MOo.' .' \

: .Watcbnfater., and Jeweler, firstrMpnday in April. begun. There is no doubt that a man ,near Leesburg Friday. '. .. ',|bei. ': S -yocShoe /1' 'blle.S. .,. v '_ v.',, ,."' v., ., ''**' VC- -' : ."' .., I
.
'..L. ; Graham the saw. mill. Hut crop will be marketed at. s good The negroes when'.treted were. ,Mr.F..W.Hill is Improving and Blacking. *r .V: *' :It./.ole .- < : S, : S :.' ." .. ,'4 'S
pU '
of kinds :
AVstches .ndJeetrv .all repaired. price.j *" walking along the railroad track enlarging his store so as to make '" :' Su Cloud Sugar Belt. I .:' ,:; : _. '''
Prices Reasonable.Office on hand Bpojiintpf y ? .
'
at Ltake's Urugstofe.KIS8IMMEE. \ manalwapkecp.) hntjjjumber ',and is any'pre. -" Tbur.dal the ladies of(the going towards Tampa having more room for stock and customer Fine. Laundered. Shirt '-ise. S. S' .Mv>aTH., : (; I' SOUTh IIOV rIl.7', .. .-.-...t.. : !; :.,".

N*. *:_::00; .'? .-FLA.' pared to fill order. on short notice. Christian church a.nd some of their spent the night of Kissimmee.in the woods Sheriff on thoutskirts XI r.: JI..T.. Butler has built"en : '. ; : S .,. y",, '.,-BAV&.ItISIIMJlfalt.. :.' ,AMIvTT. ltII_, .IM. ,*'*. .i7V. !,,,,.',''ffiB:! ,"''\"fSl

k < :_. -i Leave your-j orders 'at the .Waters friend will, at.the tore-ropm. between addition to his residence whic No. 99.pas'r dally*>eept Sunday t-OA A i No. .0000d.lly..cepcS..t.-UA"::4 4- .Hj

n-; _. : L;' : and Carson Groceiy Company'. Mr. John Robinson's and Anderson had been keeping"trac makes jit mucb'Mne corn.rtable;, 'With the abovewe offTruiik No._ pas,dally except Sunday ,: itS r-1 Ne._.Jd daily* C ept Sunday. .,; 8168 >:7t\ *" -1 '
them'sincr left .
," I. : S Stanford's Rocket store, Irom 4 to of they Leesburg. 5'O'' ,. : ,'
.Miss% Julia A._Leake'jWlll ,
1 I o'clock p. m. serve Ice Cream having been notified from there A Hare fbsMee for iaebTrees. .Shoes, Satchels, for Information re'latlv to rat.., complete schedule*,etcv, write( io or call( qt\\ ,;r.
take pii..fNSTUMENTAL* in" -The stockholders of- the Covenant that they were headed thiswsy and I ; ,. ., G. F. Parker \
[. and Str.wberrlel.na Cream. A: have'now at W. B. Msklnaon'sstare ? ? ,Ag .Kiutmmee Fla. onf "'' c-14
Building & Loan Associationof of them him If. S C. S.: Preston SoU'Pas*. Agent. Saalord, Fuu.-!.' '""f ( ,. ,
descriptions sent
Blank Boots
,- .- MUSIC cordial invitation extended to ..tt.McCalMt ). 'a ,O of the finest Peach Kent .Hats! ..
'H. G. Pass. .
KnoxvilleTcnu":, in Osceola notified Marshall McPhatter and 1 ; 10 Travelling Agt.TaorpavFla.i S >; ;
'I ,. : let home. Terms Re K>uable. county are hereby called to meet atthIXiaaunth & Young's "Dl.ckTrilby" the Trees everoffered. In this State, AaIeTrJide&untnd ,, -. H-c-Mciriuid __. -7..JoB7f'; t _"Jteirftsui
; took
4al they together early mornIng I ,
!. 'J'. budded from ,the, .celebrated. ;.- ... .t A _. .J"a..A.tl"Sa .,]
.____: VALLEY office on company 'held the board.atheOperA11b1isetAetnight. train UhjpJacandiocte4 HrrtJ .. 4Af3& -
-
T- ; : .8aftBDllatGe"t' ", .
> -', Friday ..ftel'l1o(4| o'j:1 Ck-. All 2t" the along thejrailroad track. Corcbagdndoyrijjj1aleed. 1 Sailors-rand.*:inany: other '." :. -. -7'" .-. .- ., ... 1'1'WoII'I .
negroes .
J. LEWIS. S '
< \itH.'SEYMQUR, membere. are urged to"be present. fairly good audience were in alien: They got off the.train at Like Lock I ,"" .. .-. -., _. ' S S -- ,

.itesrLecr t-_. rjl. C STANFORD, dance -and, notwithstsndirig"' come back oh a pole car, meetingthe r. 'A SHAKE(STORY. pledge Hammer. Bargains.. I T' ..vNotie. I: .. '

Xl ai"Na r- Florida. Sec'y. Locl Board. company., laboring under diffi. negroes as stated above and taking :1. .' t 'Jlot""hCT..b,.lTii that at ttisi..xt"sow BASS& ; j.-
\ $ creditable The Citizen's Miami( vot14.DO"old', stock. IM ol iha kflauuu.l MM ut. mt ...
.iIIl'I' I A dangerous malady should he treated cuUies a very performance them into custody I cornyondent f -," .. a MU will .liitnxIiKie4 In the H_. al Mm.raMnUtlTM ,
;iI'4'." :Will pr.ctIcanywbevaevIred. Spec prompt and viconnuly. Chills and w.as rendered. This show is a They.answer. the description boldlv assert that the hugeboa aiklns for s special la tanhlUUUH ,; A
"4'1 :tat attention given" to th* collection e< Call and'be wnYJnceAthatjto ok.of San from the Imh : lakaa and "tf l
- claim. ..T.* '. Fever undermine the constitution', weaken new departure, all the artists, male sent out byjhesherlff of,Marion I constrictor, previously an noun. -5"1, v !mtraaait I. OMoui wntnty Florida by a lna oe JOHNSON.--
_, arid .
d.bllittethebndy.JebrIC&ye
".\ t '. andfemalebeIlIgcolored'i -- BarfieldTurnerMJiuricierers ,ed as having been for.yenfs. monarch (*t uf mar MOt davlo or la any ch nianaarwkiumTer -
Sweet ChUt--T wlth-lronJ- CochiIotIha> -- lJ to sare tuus Cub kook sod line.
more
( a\cf
: of all H surveyed on.No Name ,r..I. *557.. "W.WA'I'8OJlh ,
. ; _7 .Administrator' Notice. effective than (Quinine, and being coma The tonic and Nutritive effect of llypophosphltes and when captured could \ 1 w
)
,, blued with Iron as a Tonic and Hlood Purl or soda and time In the system give no satisfactory account of their Key. off the east coast. ha' been Money v "" Fesh'Florjda efPorlc' Vut .
,
11, All pmoni i.rln' rlalms 'ft''u.. MaMI Her. is superior'to all other chill remedies. ;will b* readily observed after using action and doings. They ,'srobe.higheid.ln captured Bun"Lawson,, an snU t, <. "-T .. ;, .. t-.a..._.. eeaM Orlando
i\ .4 and of FoorId.aye b.r.by potv.4 awaiting C StanfbrcU $
,_ ._.w--.rIy aftea JJo eur*,-no payFot..SaIL.b7. LIrer-Vl1-wltb-4iyp0pb0JphIteL-. FwIHid: -
'
.4 wlthlB the II... prmertb by law or they J. C. Leake'. '- most eminent physicians recommend It I rice* f roni" Marion"o tandJ1 tht-"many-yer lg ; r" :. .I .' .
-0 .<.wilt be"''_n< .U-_l ilc.bt._dlanl.li"S Ask for Hart's Emulsion. -Por"Sale by they da not prove to-be the"; men along jn the '+(*, a Vessel, carrying ,t ...1 -- .
_
arm uk *" _" Tbo'lleGlOn for'ibooting'quail -.r ; .
proBWIMrttlemr .
J. C. Leaks. a circus arid menagerie Was Wreckedin > :'# -i' 'a'- -
: .
M1j$ wIbRi.$ "i r XC O. IOHOAI. wanted there Sherlff.AnderIOD. is 1ta11 F.o. n & kIea1Estath _
t turkey ;and other: "game, expu'ed _. t. t _
Q.: '1 A4..tnto. :Th J Monday end hunting should be 'Bids.will be 't.celftCt by'th.. I
'
around KI.limmee are in fine con. they, are-eflmln.t'.oftbe containing this reptile, which'wasthSn : County k '. -- .- -/,*' ,

.t fi M, D, !. stopped rder-dlaLJlIUII6 should maybe dltfon&ndlir.perbap..;doing better : worst lyp* fleeing frpmustidi'and only Ift fee -Jong;'wn* broken Commlstloaers beld March sotli at their 1897;next at te meeting oclpck t"be a. "' ,: :-7 -." 5- '
be ;
pleallfulin seasons-it' '
.' i"1K1S8IMM! **, FtA; ,' i iTCHE8TfAND' protected ou tof season,-ond all' .than in any section of the state a!.re ate&somwhere. by tbe iwaves;::and .his'tnakenhipwarn m. to build .bridge over Cano-creek I "General agents,,for the/:P.age I II I 5 ftepairiniryear1 : ::0T
the free *&*'!.an .11- to the key where he hiss since according to plans sod specifications ou a
are snce.\-.Prife: list ; '
damaged 'They WovenVlrt r.
SURGERY. good citizen, will net only 'refrain by ) 7' .' ; 'z ,. ; c1"b'L 'i
: : fUIh-. abundance .ur-Juty. : _:.. held undisputed *way, fattening lie In J. M l e's mc* I '
z from huntlng.out.-ol but blooming ,.our_in. p ''l'e'-''' -W, WATBOW: furnished 5lTapplicatIon. i experienc* In this Una-.*nd-
If
season medicine is :
,_ io.cu? /A disease, andjgrowtng until now It is : -
,. thirty j-'J. .
fair .
i* en'pooted; '\ ,
jknd ,
a '
\to"Lealk f. ; ,
'
f2.DZo.ie1oor\ < 'Drufff will crop Choi. Co. Com. i will, guaranteW satisfaction ,to all '
t :reP9rL4.1.Lvlol.ti that.may this ;. If for It must be good medicine-the belt eight feet long and as thick through S ', .1"\\ .a:1IIar m.oe. .:. e1e. ; ;,
are looking a "'
Sin ciiineunder year. you .' who will give ma a dalln .) /
/
knowledge "
.! 1r -enougb.-U-Your.-dul barrel.Stories
only asa .
are->told of It* .
to live"Con ten .c11Y.lfd .p V"AttathmenrJf I ,J--
place grow
5
ResidencLakI4ous i ..-Reed'McLain, the Single mill rich Osceola to yourself and to your doctor is togo sWallowing>sevep 'young InuSan .,',_ :; '.0 to'Lo'ri'I sown arNTaylor''litGr.r ;

._ :' ._ man, has closed,down hs| mill at county keep. She your I. eye bound on to become to.. the .,very best druggist you buck; and for that reason the Sem. Steel( or FMBIBA IOV Cl V.,' t. ;1Isesoha ,-; : ." t/}..:, 1 I v -Tuesday and Thuf6daysSPRIGG ; -

';? t.' Shingle-.creek- and wjlljjn! a few the banner county. of .the'state in a can find to get your drugs and prs moles gave the' key a wide berth.. t...1urI.,. .>'.- -I'I.o.l.0..0a.c., < !.,*,._. ':-t. .J7 A : S
'
week remove it up In South'Georjis short tIme.oWtiter.. *' scrlitIoel--6u1ed, without T letting --Jo.f F''How. -" -h---r .. ..W.C. rKOTTi, -. -,_.- ..._ Offef Ms : 5' 5 ---a ,...J'S It 4',
dollars aRd dtstanc7st nd 'In., 11 .. to..tore.... KoeimatismX A-_ 'Yam and *u etber ecreons' t.tereMa4 are ,ProtessiontlVScrvtees' Lpudfla'T'
tbout forty'tnllet ak9 U' Jack. your f
ic..orio, : lodvitle.. :Mr-; McLsnoand the tourists"are ,.beg)nnbg way ,-.I) .::4Jc;:. 1 ; .J\ItAao Coo.-'C."., ..OaOQN. karaby been beiMil MtfStxl sat 01 has saM s writ Court al.aUMknMe>>M FOB and baa .. ;-th. 'citIzens,'\ of{ Klusslmy? y> 5-, '.' -: "i' "14. S 5 ,

to turn..toward home, where' the : Nov>-ib.: iB94-'X I''wish to"inform UPsP.mpri7..tta.h.5 I.sanity 4lat d..ds -S --Lme i' It4 TlclnltyF ,. ':
left _. .
latnily Monday Jacksonville ."Jt1'--t.t 9' A. r.peti I Pseeatlag in ibm mm I. SS ; '4
"$4' ttouS Oxide GL ..Admlipt.red.j where ill'make, their"home.MraMcLane freezes still linger And the flowers ::--TkeDragglst's -tiq ...:.. you of the'gresf good;v Chamber Voilas (ql&U). dow ...'shill _r Diseaaes "Women v rntCh11dren : : -
for he el ht they, : beSor laW Commit _1I1t1l es,oi .
'Snceessfully st os AprIIA.I" .
; j zelir.' ,nd her two charmIng bloometh not, nor-the birds liD geth "lie should fill a prescription lain1 Pain'Ualm ha*done my wife.Sb 3Ps7. Ute_biolq j...day o4. paid eou, I;: o'I I 'IJ '.r.br* ... ., : ,'- -. ,- '' '

130, I.,30 10 ixqfhters I. will*.be very wucb (or a mont1i.or; < 'tw* yet; Better'bid.g cisoly as it\JT written.:: :He/lhol1ldI has- been troubled :wilh'rheumaticm and th.r.iS...a e\md.\asp.r Iudt.ua"od.artr will tultsdseiaeahuu be' mad .; .,. -l" >"I:., '-' p THSF'Sii -'. '- S
Office
g Leaked :
-. :. .7, missed -iC-Kis im'mee"'aocleIYod w e' : and be content.in I not deviate hairbreadth eithei; in of the.'arms and' hands' for = year pmprty Sold i. =. 'C at .Drugstore :, 'i i : i 4 -' 4 S S / 7 7rDo -

indeed the entiri-fMiiily: is a IOSK] to the 'laqdof;. :flowers, 'red-bugs and I quantity k Ind.1 His-:drugs;:and six months,'and has tried many reriiediesprescribed -."-.-+ : Ibis Maish;A.F,-irt asJ A.,J", ., To.the: People.'or; : -' .", ,' I

'K.smrneethat.\ will bejnrgely felt picnic*,,lest on your return you Are medicine'shouI TT>e"the purestVsnibest. for that complaint, ,, :' '' ::i: ,: ', ', ; '
> '* .
i "R'ss' i "f "r u.y- x.yV "I'li arcelyrepIacsdTho"tii.! .by the grip ami,go up like ,.He should shut";his>yef td Jut fCMtOd lffw' """ > "", "" !
.V'J.5 "iT5 '
4' E-Vj "ifc'! <' -" '' -' -, I f .t p community will.wish them, happiness .. a tfisizon'tbeendcf'. .' t. tourfst'stackti ', snythtngbut very,;."b>.t., II. tbisPa1nBalm'one: ( 'bottle of titI:3us. S
'
NILLEI1, in their new bends! and success. S Y should.avoid the,bandlQ:00( :: which' has CompleteJjr cured her I : S 8 ol.C 1i T- -: yost ksp tlat $

iu in.!1I! theif. uudertaklngs; -.. '... liifBick'eopZJ&.t': & iick I rioJruj/ *s.-ie;| 'would any ,*'other t.tepl..N In. \recommending it Moat- venleatly-located :and alMl'rabl ', '' : t'aat '.th tdtbiD_ o'
trimlnal act.w When he J las> done for that trouble,;. YouriJ.tmJylJ *betel property InK|>>
: enough feel TaTyjajidJjlstreisT toha \ ; do all *
Sbop.'prep.are41o
( 'ostoffice r .showed T 't' to a delighted t.M.il,.rau8lenc company r atthe' ve/no.;appetftZTTorsleen';'badly! "all this; be has.:simply;;"don.-hi :A. pu ;ionfc; ..50' c ,nt and, flicxjbottlesJoHleby rklromm.'ins thoroughlr,. equipped Ceod build.;'..Ftn:.1:", S. tier of Wagon;'work'|r Black.man D yOu know,that JjJiiWiAsjsgu&wia jut, :

TLsfLJSffitoSitifii', ,tn' :*li: ;tpe latest opera1. ..house, Wednesday tohavewhat you eat "feet like lead .'.duty'.:'... -Q'moreJ"C.La" a '. ., 'II_ ; :.W..J. .._<*-_rs.._;_ S '",f paironafe, alrscdy:establlsbed,"l....,) rTor S'imttLIag'in"lt' Jtsrcitch.a' ret2i'I
0. Iot .
rf R* br*' alwaysiliarp,> and night'nd.qldom.ci.,'.It. lie ;prlvllega'bf la'iour-.aom.ch./not; sick.enough \ desires us to "i..W.JSea S : : .' .-'. : ,acre" ;. .:.'. "" ', ,; ;.,.v 'RepairloJrJln4.'RepaIJltlaJ./ld boitgbta large stock I
togo to be4or-call! .a' doctor but <.tt-.i ;::14o'IHI i': 1-t. all tim than,everrjg; ', fr' t :
tbine In' g>*tonsoHaJ line will K>i simnieefTJcopIecess" .wlt- ; the following extrtrct froora 'letter BOUQHT! ATlA BARGAIN. styles ,it -experienced.
wT : :L.VotW: *U k rbr iTen taM at .b N den* with neatness and dispatch.OJ :such. srperfonnanc..;; rIM just sick. enough' to.not know what of ChasM Outfield, ot',Reedley; ol UM Liaiatairs(orih MaW ml >ri next..rlo<. 1iI .' c..,rjaeBlarJ'app'ly' to'uie'' "f,:,JT..' : S Plow-Make' '.M .. Coni $fld lookat ouriShoe. '
, go do. Tate a ..tonic-'chat's'what will IntfvdiMMd{.lbs Uao>*. lt.proapia.U ... ., ,> '- vBuggiis aWagn.-; d flats .
sCtniG pffect-was, mapi6cntlcrft4tI Fresno.Co., Cal.;a. he bandlestn ,..,Psk155_a 15.1.1.1 IoeaI met atf t.eit,1*. 'd '" ,
r, *- tnsrvelousv'pro4uctlonarelented Wf" you ought to doa ,good 'sensible remedy_referred to and..uwMit,5hi. tore reuilra t.thyratcotlan.. I., U._ *aaM<. a8 'T f""F'. : ,::"" .- ,to ordrfr oa short notice.: : QetVou.r.pricesiis1 bvbnm..A%?
o .
tonic that wilt i u!umr. .""( -.y r J.11 .. .L'-Uaving
?. 4 AcFaflaad. li-promlnent( with.telling teaJietic'Uj>, -stiarpew-vonranpe. customer to knc/w what splendid( ." ". J"',"... 4'r' I ;, ;.. .' .." v "ad. ao".a1'up vinCed that'we 'reieie ,

i .' ant UZ.v*Oakittr$ PG fect".aniong which vre' a .itesutf tlte and put new lif.ia.'youYou; medicine it U ("i' '> -. ,?v.%' :; .,xambaciJ, ; iai7."J .,, _- .', J: .. _J'. r.", ./ ;. tencc enable* me lo guarantee y-6ii rnoae togi4eqt1ofl

Is.take&Witha very, bean boat" .. plo IoD";.'an 'en ire**- and can get just such' a tonic at 1 lAake'' S ? '!<,> witb'pleasnre .r tell; .ou '! '" ._,:., (1., ., !work lone atnay .' )

4; oId.The fain In.hi(chestw ys f relifht';Strain, "snd.l'passenger'jratiicroeting t1rugs9r0.i S! o/; .. ,f;: "I'ji. > that by ot.a, day's use of,"ChamberIain's tr't,, 'NDo : J.-: .nllL( ..;z-* ', ...:' :ncn.baa' for

: .' thPe had 'Ip3na and the stage'at Ula-r.t*> of 4fnkle .""'JMWIljson; .jr, hea-lust. js Cougb remedy' was relieved I" r' t.f; t.1utd71; ti' ,. ,'W 1r .7 "i'' c.l1 9a _

w 1neUmonIa an'hour.V, The 'scenev of, ceiyed, from the-New York Life In- of_,Vexy.se ver* eoliMy; beaut'wasaimpletelyatopp..pedl'eald ';" '--tj, ixLy"i'I O", ,. ', -1 -;'"._JR--_.-. t"indstypr1c: *. fN-1" k4Q.
- ;
. : ;(' the 1owest f' ,u. '
: t'
agara4Fallwes *
; ery ,bsptifBl -4 aupportraitFo':: ; W- : g
"
- ( cb. berPIn's ,brotigbt forth* t!'J>nrst ,ol.applause. Tobn AjMcCatI, the'presldont ;OfthoCo.Mr.McCalltsoieoftl not-deep at nigbtJ.ti.-an< -. JeC0In- I"._" '.'t Un.i.,1 .,;.t1 .i''t'Cs ...UItP1ii..to"iPt c 1 x'. ,
,,. *ct
:
, iIb .biok 1i gli ..Inter.woven b.th scenery;.was ; >e mend-this tenvidy.-? A:eojADsarly ._A".d1i: ..._, rt >.PU". -..k.,1"''' ...:M!"'.... 1 t.. .lJ' : '

." .aE i"-TlpUWiwtJn -ihrillinft.:>t re.t, few *al larle4 officers 1 of.'lM':Uute4! ,ab"i f y*'rJ..1n. tWjhead.aad afterwards .JjitJi., f eel .t\f JO. iT s-Mhk'!P' '. T ,' ';." : : : -

i .wbich'ijm' *:presented'.by as eomp*. Stat i'who draw*' the;:, Onfurtbl .,..te d.;to:the throat?and .,. .._ ..,,,' a .l'n wi. _

.tent .'*orps of actomas theixt,is on sum of 150,000,;avafThe; i'. lungs.-.By lisfng this remedy freely : JJ l"f: ;',' .., ;

;4bo .dWTakeY ..I ltogaLherjkh., traitf.ereODli.mt to tboiU apnttdoi ) I., soonas the j cold hafj been,con 1#1'11 .Was 1r .\- J .If"Z.'_:, !. '

' Fuc .n'.j;)" '.:, r' 't K a y.qulr4outz "Tnisf? tQCteeS.at"III dIrt ..U. cold at'ohce III.., .;_. 1".1 MtrOtltetihop'iit.lbu5'Sewnj, _

ibowibtittie: oadnsnd,." iil well n for Frfbaarr;. JClsslnvnwaooe and ft$ ;tront< (towftv,1to&Vm .
: 5 .aqd( ifreyent, |j'" -extending' ;!:fli"'A- ,I .... ...

; .I. 1't."hI.It, ,: oftbe, fortDnate'vgencief, '..,.,, r l "oi( -'f.Ji': !& S .. .. "f"1; ,r, 'W.J.'.\;t. ., ':, '. i jr.
t
..; ; 1Aa lufj ;" .,'tl". t1I';. \J't, '"ib.rtif; J' 'l" J'.."., <.i",. t"l. It-' (. ." JfiqJJi.'A-r i UII'''' "" ..j t4 1 tt 1..f$ ,) .. J 2 'otl D" ..; .;0 .;-. ., '\ :If.

, :'e .I.'W : r .. '1I '1 "'h. 1.f.1re! .jII';. .orif.,< \.!. ... ----'Ji .. : ". 'J'r' ) \.i i ; .-il
? .
f ,
.
JAv-w.j5; .1'! .. u ." .l.r .\. .
... nY ., r.'Jtl .f W 'm-rNoj Ir s \ . ) .'',
,.. lif. "t n wMw :: .
-' 'tf"iZlmtt1. i : f 4f m t s j: \ ']..., ., I j; ..1 :' .J
tiJ ,; .
-
,
'. J ?,..'4 :'. -, ti"4 i'.,, l I&AVV( / I.'r' \Vr..' ,,\" ,'<,' ,: ",J1: .. "-, ", _- .- I' X.\. ,""
'Go ,. "
'
( Ii.t: ;.f ,
,
: : t' i '
: .jo ; _. ''f" : / -,1., f.' ; r'c1' .
I
:.,' .:: ;', .'.J J ,,,',,, .: ," '_ : :; ."" ', c,1M',. :; ,. ; .1' ,.: ;C'. :\:'.. :J :" ,' ', \\ ;'. "-".- -_.-- i, -h"ll1-(' S .: '



.



'


L 'if


h -. *
j .A: :

;' .
,
T j \ Y r : -



;





.--

,.
.
.. 'J \

. ." \. 7', ." .
; \ : iH-: : .'t'l.r .
".' .. V. '; .T \. F '
.
r 'VOLUMEW.. : 1 ,1: ".. ''.' ...".. . IM :CITY, $C QLA\CO\ \ .OJ.tD.A.. WEDNESDAY; MAUCg_ 17. lBn. .. .. ': '" .;. .. ....\ .. ., :", .


; __ :. t.
.
; \ free. strength but they declare that this G OOOlVTlVX OCE I In which 1 SPAIN"oRbERs I wEYtr "To> >6 I. I-
TrfE KlSSJMMfifc' VALLEY liberty and indepeddence the. TO OpKSTMU nitrogen, Iv'not.avail sue R 'l" .'.
dom otller Inslitirtionskudthe.c.orncr Strength,.1II00t prove cumulative able tn.it raw ,or aour' 'state., Tomake PEACE WITH COMEf. "W" 'B 00 1.'t' t
mOII'SOI
Ron* 0Theia'ttko.ld !. tn. 8UU : T
:
't'It' :. ''b 1i4i: 'and .%' ,; B. )Harrill( stome t ipissvlihfch' '"gre i bu't";will(wane. as the"fight. -prog'res-. ,I--f TaU M. ._' muck "a* avajlab.teT) i fbr'plant Chicago A-special .to, the lie- : .. I ; .' : .r7'i ;

'1: bli8h.ers ''and'Propiietors.. natiOn uti h'e-eartb4. buitded oNo eEl .-,--"<--r- Jj 'co nc.ded b.ll who are pea-' food; a* (oianurej'the/nuick- ;' cord from JlavaDa.lfrom it t. *rjebial ..-, I. '<
'I
V
I : country on iarth. has. ever 1liciifantaoniit'-wllI be. his ted: that March ana Aprtl 1-r the ,bouid be) composte '
toys : .17.1"10 : .
1 '\Entered at-the. : postoffic. >n KI'' me. made the advance and achieved the oldeneaiy7ColonelVV. D'CblpleTthekDibt.ot : most delightful month of.the year II-an4hhoU. lime-to every ''From i.f rmatioD' received I can < '. .- I \, .". i' ::, .

.*a* second-cUfS mall matter.' marveloua/esultsof civilisation and the far. ,west,.who, l In ,Florida.;\:(pur .!tourist friend food: of muckT or-what tal 1 s .bet't r, ,nnounce. positively that Capttiin- .". 1-' .. ",. .'.1

I 8nbs rlitlonO ( Rat4'II# enlightenment under the tame form will coma down to the Capital withan should1*, make':. note'of this fact) good; hardwood ashes,'in-pl.'"jj jjlime" General iVeyler h'tts!(had, orders toibeek ": flid1esa1. I 1"e. ahd-wa-Rej1-' :.- ,i!'. ,
.
-_ .;: e"copy, one year ,?/v. ,0,.. ,'i..oo of government thattho_ American array as' large a* that of. "the and not be in a hurry jto tear* the : j' With .It. muck anll Gomel and, to ojtfer I hini V whatever -' ..._ '- / :
.. . "other nations editorial ashen, ma'e the pile a*'high as .- .
; 0110 Copy, .Ix! month, v. .50 people. ,have What ? senior senator. state The following from you term .to end thwart '" j : !
"
arc necessary ,
.... .I'
- 4 nsopythreeijwnthi : ,Amsrics hfl nplished. .F it.. I. m6X JhQ. Jt onvenjlentt. During ; ,' "
failed---do *cr" ee wo.t Tuady&Tlmoi.11itttn timely 5 .Th .detail..unJ&no"n, c .x _. .;- v
w
All aubscrlptlous. parable lii ad ranee.Enrromr .- : Where it. ,hat been pretne eta with n leaning to the.dark hbr'ses The tonristot-FJorida often makea the. winter,the pile should be forked but it t I., beiieyed, they extend alltbip 1' : .. ". t; .' '" '. )7 < ..,
.
'
: : --""..-._---. lf1 n'hfi-da'rg t6Ii\"Jb. .tr f say,"t ne'fe"Vilt i "wire-pulling' griiat""mistakb-r t1ii Jength owrr-A-amall sprinkling 'oMand .way frornjsutoriorny .to.the sale Iay,, :11Isbury1Inr1; FancyGr c rI ,. '

; ... ,-" .-..".. '..- ancient republics that we,would! aniw r.an4jjLn ltIn r .wan:wins their stay In J tho, _*tate._ Generally, plaster over the. top will prevenT. ofihJiln&tqjhe Cuban..__.. ., _J. .

t -- -- f fair-Amerlcli hat succeeded ..ad'an IQiUbat tlme"Qelth.-'w&D.,, .; they.coma.to.:eacape.tbo..xcesslT the-eae.pi''Q1 Uie mmow'- It J J. aald-jSpainTwill gVant- anything :.---OraIIlr- ..-,.- ,--.-, 1CrtuIzygM -' ..' ,ij---7 I J llL9.. ft; _

.;\ 110;.. W, 'A. HKNOBHSON. ha* obstacles to her progress and civilization The withdrawal of one or--the' cold and, when the weather grow 'JJutliiT'the Rural 'New"Yorkersuggests to obtain peace, with honor, ; |Jf Crato-MaterlaF Ammunition- -- / :

r .' Announced that he would not' be a 'Have disappeared one by one other, they say, would be. an acknowledgement warm here, they take it for grantedthat why' not 'make thet'muck before the now Congress. takeVho'ld. .. !! ; 't .

I candidate for election to the. Uni.ted'Statec until today the proclaim herself of defeat Then I the winter is over and 'theycan better than -the msnure 'while you This, of'course, will denied but .ants|; .Salt, Oatden.Seee du.- t.'. .

naTeTJrBF.IPTyPIPTIf"c9NGfttS8; -- ----' thfr mi.tr. s of the world,.Jhef?re- coneihecr1sos, and new, names lire at home. without the di*. are about !Uf: Your manure wouldb.in'Ucb. it !is known 'positively thaf it T ._... ,.I
I ,
: most nation of the earth._ will be mentioned. .. comortibeysOught. tb'aroid by better it' you could mix 100: truqir "Atlrban ftfiei-pr| t ha- -. =. ".. .. ,.". '. .- ,-,. .. _. .4. : \ ..:..[
ia. .t :7. 1 .i
: which 1 & 'and '''' .
of 36'po "
ha will southern pounds ne iilid. of .
; The primary element The Call 1 array swing over coming to a climate lest night General'Weyler said f

-c-;;. .emblc over
flQ Monday, pursuant to'the Call American people, has been the tenacity Cbiplcy will be mobilised into they tannot. stand northern I because you would, have more potash ::> .. ,
,
I, of the President. Tho. 'J.) .Reed ) army 1 'without and phosphoric acid.The week He)Jias Jeff for. Villa Clara, __:: .. : :
with which M-e have held'to aiwanti-Call army, with changeshere winters danger to their where of ,- ,
bodies
1" it of Ilouie. The first large troops have : _
& Speaker the ; the idea of the education of the ma** and there in individual" votes healthIf-it is worth while for muck heed these substances more been rushed for the last 1ID. ., t ;
two .
V rnd pefliaps the only 'dutyo"f the se*. of the'peo'ple.. that will hardly affect '"the line.1 them to com at *U, it J.1 importantthat i Han the manure doe*. If wood for the purpose of seeking .for days GoTfaettepHeadfnif -, kingowder ; ALWAYS : ,. .

} aession, will be;Jo- putt_ L t.riff To-day-America ranks, (foremost up1 as the footballUt express it. they should remain till all risk ''a.be.-.r to.be; ,obtained, use all'you mn lInd'tcrm..kln i i .- -- ,--n.E. IA L -- 4F .oJ.
i rp .
---.n-.u.e.wtmt..-rfmtiAA if* .rain . "
,
.canafford --- -
ln educationalmaftersiftlena- '1rtnrtbtrpoinrl1r1he'yamejthat : t.-paaaed--It-k.{ l pavsedwith the yOiLcpntlt u e txt.muck ."
I ,
: ,jvr.< ts ,,. The 1nY'l.I supposed tOns of.!the earth and hpr system of the dark horse, sleek and'well- begining of warm weather in Flor. afad mix I them thoroughly with the General iuth1rrultareinieresting. \ Weyler have Special-Arrangements- for' : -_1._ : .. '" '7'
returned marketing
Vegetables 1
I to.be- enacted for the .doubl l'nzits
schools the admiration ida when the weather become muck. The lime in the ashes will '. ?
public chalenge groomed, will be entered in the nor even to Havana on the 6th inst '.
purpose of revenue and l rotection. of all other countries. Nowhere race to make th. run of his life. permanently warm here. So answer fOI."e tenJn the muck.If and reported to Spain by cable. lie, Ulrica,. Furs, Beeswax and all Country, '"..Produce/, :<:te ,-
The tariff law ;" '
., new a* proposed else is literature so widely It i i. useless to discuss the chances far a* b.slthisvoncamedthore danger you cannot obtain ashes, use the admitted that' Gomez anil Carillohad which we will buy outright, 'or haD ie ;. /, '.' i\ .
.
will dutieson -
: ?
( -
impose specific er- .
,
lime alone, and the- i il
disseminated, snd nowhere cite have of the dark horses'until the first tomes from sudden change than .aa pile made 'cretaed his lines end -- .

.. 1 r lain articles rather than .n general, the poor the opportunities for securing element in the fight, tne" sequence from'steady oold. In the South Atlantic up, use two parts -of 8ne, ground of his forces. He were"7Sowwest explainedthat Coinmissiou. GtveVii"a'T; --- -

tariff. "These' will .embrace nearly common school educationas the Call-Ch'ipley struggle, isxinade states north of Florida MarchIs bone and on* part muriate of pot. he had tried -. a trial. -- .
with
to negotiate .
; all chemicals and other idea !- .
many ar v* ash, so'(&L about of the -" -4 ,
; America. into a known quantify. ", the most trying month on person 40 pounds GomeE, but the latter had refusedto .",
such a* steel, sugar, agricultural The schools of our owh,state will with weak tho4 subject mixture wvH be added to each- 'ton ", We sell "
However, the dark horse have lung or for Cash
with
treat him and 'would and 'have na'.15a.d. : ,
and The only ,( .;
,
t f product sun4ries. of colds. In tb Atlantic of muck. If this be welfmlxed and -- __ .
usJo North -
; compare favorably} length great hope They think the situation J to treat with Campos, and tlvatfor in- '. -.'-'' ,." .._ .-t -'':
tobacco
rattle wine on and farm products the term and capabilities of imparting warrant the predlctfbn that states thor in changes in April worked over, you. will certainly dependence. It !I. believed, )he ad Accounts : ._ .. '

liquor are same a-s knowledge with the school of any the men now* most prominently and even in May, that endanger have a pile of' Compost of better ded, that the situation was desper '. ." .
the bill.] The bill
JtfcKlnley wits *" for '; .
state in the Union, named will not be heard of when health. quality, ton ton, than good stable ate. lie asked for orders. Como buy for Cash ivhoro '* 1'
"given to the committee on you can save Money.. :> .
ways Osceola County spends a* much, conclusion reached. The invalid who leave Floridatoo manure. -
the coveted .Meanwhile _. --
-find mean Monday afternoon, whore .it it whispered, Du. ;: -
its money per'Capita and her schools Within two week the force will soon 1 loose* all the benefit of TOBACCO OttOWlKO. !. ,IN FIAK1DA, puy DC Lome made worse 'reports Now .Is \ ,

now engaged considering. will compare with any in the state, be mustered in the "historic city of his vUlt tojhe atta l I If be' has re. to Spain of? Ihc thnQjomakQYOUcrI ','

details.. __:___.___ yet the percentage of illiterate.. in Tallahassee, and the contest will malned hero long his system be. J. W, WhiteFthls, city, who the concerning the temper : : : .

LEf/ 'LAT.lON. Osceola-4a perhaps a. great as any : be made morex-intrrestirrs ;since'than any' come l lest able to wlth.tnQ the'effects .was apROln .bytb county om.nticsloner .iew Tie Congress said which Cleveland meets today. # : tA.EE .r- ., :_ i- .:'
thing that has transpired 76, even had ,
Throughout the country 'each county in America. This. is tpt] a* when Grant' troop camped in the of sudden change to colder to attend the Florida be n'ocarcely able to restrain the I You will ncea f: : '" .,

State Legislature seems to be vie- it should be and we do not believe shadow of the .capital. ,-Time* Un- or even cooler weather than if h.i State Tobacco Grower Association last Congress This one will be Citron., Orange, or' Lemon Peal Cmraiits .'Tt' r- .

'ng with the'others as to whith can it i is the fault of either the system or 'ion- i had not -cptjie at all. It is, then in January, returned to Jacksonville Worse He referred to Clevela d'. / .
,
pass the most absurd and ridicu- the schools but on the contrary it FIRST ECCLESIASTICAL LAW. Important- he should rtmaln this morning, *nd says the message of possible intervention, Riiislns, Figs Dates, Almonds lV imfs.. .
is directly the fault of the I until the weather become convention, which adjourned last ;-
Jou! law.. One wants to enact the people perm* and snldMcKlnhy-wou'ld) '
who of ibis of The School Board of Osceola night, was a magnificent success. probably Spices, Extracts Etc. -
its into a las an- are neglectful duty : nently wtrm at home. Is i oloanyhIngworibdoIn think the time had .
impose JULalioll: that they owe to them.. Countyil entitled to the credit ofenaetini'ih 111 Sr. White say there were fully come. lie certainly To get,these! nice and fresh, to : : ,
,.:'otjher) to a heavy penu ty on -- g ,yhalves. was not so friendly to Spain go : -
that selc.and to their cuontry. rffrst ecclesiastlcaTTawknown It certainly to W?'b ndr "pTe pT seT rTrenT -
any newspaper print an ugly I folly adopt M. Cleveland hid been. lie declaredth.t
," to Florida. .It has prohibited all over the State, and the subject w:1irkh-o
melare. in the .
'picture of a citizen without his conIt i half-way protec. something must be- done soon. n Company.:; -

j .. '. Another wants to fine any 'filE. SENATORIAL CONTK8TS.! the school teacher of the ounty tion of health. of tobacco growing w.* mo.toen.thusia.tic.lIy' General Weyler received a long ,

flirt with -- from dancing under penalty of instant But the of Florida tourist discussed, aa it has ;
railroad whose employee Politicians ol Florid are now majority pispatch on the 8th. It was of suchA :

0. a female along the line. Another busily engaged in the Interesting dismissal. Henceforth _' are well,' and to this' Lau wehsvasiugi4iao4n.ana.iir. been proved beyond question that character that he! declared It .Fresh q .. f

_I ,baa sought to limiCthe lines of diversion ot gues.ing who will be ola's acholl .inarms roust not trip l If t theyare tobacco' ;eOjUal 'to the finest would end the war in a month! It o. EVeriJ g Daj."WINTER g. -,-". : :. i

I ; \bne man or one firm, might the next senator from Florida-who the light fantastic toe. ThV'piouaand seeking a temperte alimaU or liavanna product aan be raised succefi instruct him, it ia said, to renew .

.q"1'' Another fu.'paned an. act will. succeed lion;John A. lender. godly school' board ha decreed even leaking J pleasure only they lly in Fipi'ida. hi. effort*tp secure peace- lie must FRESH GADEN .SEED., >;J .
\ merchant from that the.stately quadrille;the gallant should remain at least through Borne /',the. leading"spirits in enonnoul
Prohibiting every son. May. try bribes.: That failing, Cunll-FIowcr, Celery cami Tlormuaa Onion Seed :
'ja
"iltig.his usual!! business at the od There are declared Candidates lancers and the gay and festive ThI-7 the most pleasant month In this movement were Col. W. D. he i i. to offer autonomy: 'if thaLis ;

many ; waits are abominations whose immorality Florida and b the hottest ChIpley,of_ Pensacola ; Prof. O, : Specialty.Awivinf. : {
_. J stand, and the list might be length in the field ''and a itableful of even .through refused, he must even offer to cell -: : -- '.-
trash ; will be'transmitted fo the month of the beat Clute, of Lab City ;. Prof F, F, the the : .. : ..- -
c. 'enbd'witla' such.nonsensical, dark horsesT Among those mentioned summer I I. Island tQ Cubans on : .. ; '. ; .
t :that are, 'to encumber' 'th& ;statute for'the place:are i", : scholars if the teacher' .Indulge In not *o oppresslr herons It becomes Moody ol Ivk City j iWm. Corry, ty bond.: lie must make peace guaraiv cal. .
,
'::book.. John A. Henderson.. ,...' terpslchioresnpleasures. at lime in more) northern latitude.. of Qjilncy'president( of the convention any term* almost, before:'Congress, 'R' l'l'-.lIlS
? Co11ege
.
'
j
:
book Florida ..; As a result'bf thi. religion enactment In JrI.ic.aad ) ; ex-Cpngreasmah R. !{, M. ha 'time ;r.
: (: Tb..tutt. of are W, D. Chlpley: *,:.;.' '.;;,. ." January, Febuary, to act If he. fails he will .
I "already; -adequatelyencumbered George. Ra'n' y. ._.Ii'- ,_' Kiasimmee, j Is a* .dull as far into.April, Florida is Jh, center Davidson; of. C Uncy; General be.recalled.: Mean while,JhalLJniSUtes :... .

.- J* rwithuejes i* legislation, and-tnking CharleaPougherty; ditch water. "fhe girl*. pUM (belt, Rf' thv.patioa'aaoclat (>l*'siires,just Ho'wardrQf Chicago. ,mad Protestor hid ,: must be"kept, quiet by .PARK FLA. : '

I!; Jn.view'the fact that 'the spirit! of .'M. HiMabry. r time alternating .between prayer- a* Newport n4t -1
freak legiclatioVi !i. "on the Increase Frank Clark.JU&Jurfora.. meetings. ,and retailing 'candal l, Saratoga mrs in' the 'nromer( | but agent.of the ?. .C,'&: P, DURING the pist Summet'eaten iv.e'lmprovement., : -haves been- '
-
L. I,;; ,-'!4ijgiit. might be well to ._. while the school tEachers. eonflnedto after the touriaU' aaolal wjiton li It wa clearly tbown ,hit.tb to. J'LO UDA'8 'EXHIBIT. ,made upon the buildings"and additions are being plan ed to accommo, ,;

\;aamonish our Florida Solon*,.whoare1jisoon John C. Cartridge.JeflTetton Fox's Book of-M.rt"r.-d endedrthere..are pletisttrc!! 'In.this bacco Industry had passed the experimental .. ,date the new line of wjork instituted- Students both 'sexes are ''je-,

'{ ; to sit, 'In,' councl1' dyer D- DBrowne. MiltonU Paradise Lost Stag partief tate that jp,'be duplicated In very ..stage and was beingex.tenslvely Florida will make an exhibition' ceived. in the various departments_..Colleglstef Academic, Preparator_ 47

,('' "' /the destinies! of the 'state,. .to. Charles M.. Cooper. .. I are now ia order 'in the"Klssiramee.' few parUofjflHUnion) ,. arid in no and, profitably .raised in at the'great Tennessee Centennial, :f bub-Preparatory>r* of the highest, grade Music, Specialists and Art.. in The their faculty is"niade'tap. :of 'location proj*.._ 'I ,,

.1" 1(""'pleer clear-- .of 'legislative .follies and W. An i Valley,and I if a dance I.I gotten, up, sectIon XSStorfhptylssjssfppI! river Florida -and would in future, un tNa.hVtIJe'from; May ut :'to No 'of the In.ti.tutioItJtpo.ka..Ior- Sicknesais departments almost unknown:tTbe .The I 0 l,*

i. f .'lea've behind them no finger rarkir |\\V!. D. 'alo;b.m. 'the men have to tie a handkerchief Nowhere li found-'.uch'a field for #f|sk t fep upr i n"t1ratCIG method ) r gal: 1897, Far-off Rhode 'equipment for,.work is the besU With careful-and accomplished taacl&oOI S ,. 't j

;,i1 tipoaXlie:statute bboks of,the stat u 'Some of these. gentlemen' prefer around j lisle arms and take the placeof the tporUman. Hunting and flh- of cultivation and curing, bepome Island( will! be; ther Wftn one of the I'I''tm1 :ers, the use of a fine Jibrnry, reading.room and modern'gymqasium"; .t udenttare ; i: '.

L;: ',. :puerile or useless.T to remain in the background. OthrFpf ladle Ing Rtt WlMf re else! offer the same temtatlont one of, the greatest Industries' *of the handsomest building 01tbe TberiMtiuU5alentrely aa 0red a happy! 'Jieujthfut% .and. profitable';sojourn' 'at.*RolUnl.. :

r IwegisiatlW. sre Tof tint Ihienfare'hoftiworklng forth Heaven know,our learned I legislators of uccea*.. Pleasant .cur State I .,South., ground*;t< wlt( a majority,of the. len'uh11I'tlt't1t"you.nsrsnenlsnd; non-ectarian' anvndera.liberal manBgev 'n.. -
rwomen
t.;take> yjil t tblr be 1.1Pen".toigiT.placasi" : 'fn- tbe.lOot&'** ..1.":.t' j.

''- '.. ..'" iatebidyIdualsr. concerns' or into print and declare they arm not with a. superabundance of sumpt'uiry. J
,' ., >... corporations. and. which, the pub Candidate! *,.' They whIplease 'n t legislation, but, this School l > "tourUt, who appreciate the planted aeven-cigth of an acre, at arid her great and varied resource, tere' 'upon as a life'work. In every case the aint .ia'tb make years 'bfv u'' ,.
., Board. dict" in the comosesi a pOst of f job and realised. ova study .pent, la the College of Practica11I.e .theTitudentt .. : & ,
; Jlic-tiave no. generalconcern : and &1 ..jb.a .V.lJ h LA ; parianc beautiful can enjoy r ew, ,fUc thp ; properly 'Uli& d,,will-jnark; our. them lot o by-fittlo \ (ytS.f.t
useful
r r 'L rof th day- "tak a the cakerU > ,; : of hisitt.rreiufteletween: jme ,field of labor in,:which/a living be.gained,, '. /
Pet AV-OfUhbof
t411oethat: relate .tth.jIilij1i; .laId IheyTwere candidates,.but that crUsb-1s'overr-lifvof- .unwritten fSP5 State tor the world a* the niptt.do.Ill'Ibii' .i heerm8M: lower than-io any except free institution may ,.*, ."...Ifi' ':.'
'.,general)In which every individual 1 1t their! nausea have-been' laentf onedj With; refreshing unsophisticated 'put not unfelt 'poetry, life brim. Ul ; ;! i varfd deligfitfnl\and prosper .--Each Student i it assigned a.earute- om.lthouttrachnrge.! : /1.d dI '{I I
ee'Ul I ''eon each ness the School Board, of ttfcol.Jtydiioealfsithatthe two- and; three thousand acres* In 6uof; tIIe ria .ll. For terms "
"*:}3I d f *med'Jna and the mention of their- 'n*mea In ming over with 1'1e IUre. : : l cataloRue*, etc.' appljr to t .
::1.IIa1ator.ahould.coluILlb.i : : -pa. So idlasthe whether Gadsden jcounty are' how planted .To make' ffjilum; in tK 'St te i 'I. ,.
; connectionwith so high a place cannot we tocrists, 1

t. \ pie! ;:"he represents,:who4','will be-f' .be considered in any other;light sageoflher-ordiflance was an, insult' in search of health orPt.uU"i with tobji CCQ Isecda'nd' jnsnylothercounsel exhibit would-mean serious., lost to ,::.' -, J eY3! GEO.trRDwjiter.'j"' ., ; i: n.k' ., :!(1.IQ:1. .. .

*'ected by tM act, before .he"dares than"an honor -their. school teachers f.tu. )'to sypry to-remaitr l.: in Florid at least well in Middle and. Weat-FIOr.I .m !r n since l t! '. 'r7 S ,l tf ..I "" f'1/3J'

.F: "," to'void to make such' an act Into'.A Colonel John A. Henderson for I woman in Oaceola.7 whq"ladul Into Ms y"and if they, ,wish to U.e1 ida"wUl'exto'nal.ely"; '; \ world ef vIsltorswilIju4ge FlorIda 'iollovtzi; flat o1'well kiown edatorejt b personally wUhlestIfy-tor th4;' !r" :

J JavtI ," Ila. 'tlue hiwIfH practice of in of cro'P'tbtl'ykr7; j ; as they wilt judgo jUflibinejcStates th work done at Rollins and Jor Mr.Ward's'abhIlt/:,to,conduct the iMtUution. \II < .'I..c) rM
v.4 instance, in communication. to ( 'Hi* bprt flira f' J thp UfJ &*ui Unf of the College! beyond u."lt.loJU .
.
M i ,. ,attem of' legisjaturejorIndivlduil .' dancing The resolution Is not'on intenae ,; TOOBGAN1ZB 1TOK GOOD EOADH; the HWm ..Jh -. > '',' ; f. .
*JVCr7 pi the goVcrnor. CQeptin he-*d tntejrn to escape': beat a* well as \ ; f- -by. ezhibtlotIieyniay/ .
: -.c r ,
I ly ridi"il*lo aly-linproper in lu'doar- '4'4 -- 1 ': ,,' -" "'w --' Chur 11'. Th..lnc. ., .'t"'U'Q.I\.Mt'rII1h1tye"t _, ,
L.. ; tci renderft or Mi"irwjn.Ideas'lnto'Jaw' appointment lime dpcjpircd'tbatbe ;: intense col4b.yo1&inakinOflt -W.M.JZ.neattEsqCbaIrmiot ] ; make .themselves'. % 1 WruN6Tthilp: l.L. D., Preolde.lJ .J j

'(' -r-1".u\ iar,I r must necesli 1 Ii noUn the racer-.Thi.declarattwronrHr -: m.HciJ nd, ,sectarian intolerance' ; by re..t.a l f permanently h.' StateJSxeciittve( ;Committee i -hope-,the coimnaiuionera- .:'of,every ,J Eg.erfYIIi.. v..p..f're.rJen{Univeralyf!Andover'IIeOI MtpQe..ta cal_L I.";.. ,':.i'.''' ',t. 'JY U") .

t. I IIGrU7 all flne become k 'useless en p ?CT)*.: caused -manyan Uit'lt Is also, a .vloiaf''f fon fif f he con7tltulion to_enjoy tbo'cootng) aea-,breeze ta bat I Issued iPcalt for it1) meeting of: coun 1". wiU.. hold "meejtirigs. at ,Cecil Chas P.8.B.ncrotto U.land Plt, Q.1)1). LL Preiidnt l). Fin.-N.t'tilll.-H. A@rfcuU.Academ'Andovep4 1. ... tfI.f'i't? '!1 ? .

w{< -cumbraDCe:upon the'statute books 'aspirant hi'Florida', ":breathe a stud.laws-'of the-state ,of surnte i,. wpll l ''hit' 1 rptbwlnt.r th1ii MI lith'! ConvhHtw beheld' the earliest'day possible' and notify I R... 8. Co WUot1ete. EE.Pr ...d..ftD.rtmotb Collf ., .College' ; ;-.'i. :" ,"!. ,. i. ro-;;'
r 1 1ligb no'credtf ''PraacI' E. RII' ". D .. '" I J .
.. f'fb.: \ hl.t of t &'lIt'lit' tjr and? prac Florida i 4nd reflects pithpr ---- 4 n\e: to what amount they'can J "ro! Gen.'Tbirologleat $.mln'y' lel' oPt1 N. 'hI;'
I' con v. :
deep .know .
.of ,relief.for !they,; j the of J the .'- _. at ]*. 1.I ;:-tueiday, ( Mr 'I'' John H. Wright l'h.I).. Prol. lr.r..rd 'Unl.era'tj.' ,. .
"jiiciibllity; of M act t ot.legislation is bat Col'Henderson: 'I able 1 JPT upon ( inteligence mem* : .1 :.. <'s". ''* '' tribute,:a'nd what nnterlu.1 In the .,!Ilercot; B.'Adsrns Ph. Ia. r">.'Johns Hopkins 1\ "
> 4't;
an i ; '_. m.. J ii ;; : ,
", iJ .i
ij' 'bliiiila.and Q.ct"o: 1 Jegv er'pf l i )b.a board/or:: pea.;the peo- ,'MU 1": .0' : : #; Way Of to.nota 'K H&S Pb. UPrcl. J"hl" "PWn's UBlvenltrfX B
C agricultural .
l.
: el-headed man.whpmakeJ It pretty)I ;.trJ {_. :' 'Yi-\:' I At this meeting ")"atlto'Qrae-: pro;i ,| ( ', Ji" ,,;
.J.l, tron.l1..hou II'w',, "' ,Uett'.upoat".tbe\ ". ann on t iQmJi; p'.in aii1',*poll t1..1 of OsceoU: county1}Jf I*;>sj attempt t'ti'h.i, piq',." f," I"I17n4 tlot will,be faraUid/and it:; U'earnestly =' d. ti.tc.-:.; In}.taciof'eyerythingthat I feWChUrCh'1'4"j? ,! < ; >| ?,.,,i.-r.r. --' r fIri 11F'1 _
to 'Inject 'wligiouf. defwmlflationaldoctrines ; : "" '
v. .tattebooksot" backed up by the Cal, battle, ,he I II, Intereited! in uf5ciently ; difference between 'muck and sta hoped tbai every' .citixen of the 1 .will Challenge.the;;I .orl4.',*,at;1 -' :z '! : ', ,' .. '. 'i!J",. .3.
:
'
bur :
k'ubflq< ntloientj..ofithe.: ; peopte'itenforced ( and :'prejudice Into : tentioa and 'Ilnd, ; : 'f;
: admtratlqo.
? :to exclt his ..niblt1oir'j.wIn' : tLi'II): 1utaN -explained by theSouthern. Slate i lrestedIa this important attract 1 'Tbl'Oloatcat tieD1lnarJ'r' it .
,
i.x_ .:atslIaulitndcannotbsL : '' ) : : ',.. .,!(_ .1.1j a'WI;;'and< the 'sooner he School .'Rureliit'as 1olloV ,I"jj; >. \ question wil JM preaent.Trje Good immljV.Uo'" ; ,l ', 't1l ;.'I l ,John Chari E, Tuttle h1JWlkozp1. lL.p.; LswreU. SchUot.-Jio' --j '- ".."y"t.. j,u ,ri I'IiiS jpRMrsVROYflL .'SBi'JlBiisttjni .|- .

/ ,'fio'.jr.strearnthe': .', canhhihan ..11. ? j eveaI 1I1 .. o.e. ao Bonrd.of 'Oiceola"county'' :rscdnd* 'J Both arde4ed.'froiucay4! Road'orjgartimanon':'[of//the, ." t; ; hopd'. 4_( V t ,tKe heaityo.qp* "", '14.U Jul* E..ward, ProfAmb..tCoU"r. .. .,. ''. ". "-.t 1' r'I : ",'' \''' ..d'.E

$ ,Iteiource.' :' o ,:acL'of .. YJl I"| Illegal a* wells preposterous Neither ha '. 'A4' eratoJt( :*nd prompt response of the EmlbI1W1tln&touILtpDean. of *''? rNwuaI.1; ,. tr J ollt
: A_i Q > yesterday vegetable matter;. 1plaq mor fp"Cni, f yij41, 1 n. _'_ ____ : j.;
,-0 atlon',C& ;; .. a j' "y.e- T41thel ntade'tbe J list'!* ,that h*'I'.; .been 'isien.Djswyoqrenc c1on,I ..Jfi bftJldf$ "mInt/ (fPf 111. >;rutrftpnliir( $ | ) ),. the origlna} .,bod1b1..ad laptel'1, IEtey (ii. rsrlous! Boards of County,Commit.-;. ',1.- "-. -- __.! ": 7. "- -;-. ,'! '---.4. h"t ". :!!PJi t'" "'

; racoijnient.t $ 0 : .; dOlle4. l' .< :',' j : 1'-- good fOttbe'county.Tevarete! lice. materis! froawfllh; t th y wertderived. :)pcrau&erneut' (; .I aioii'sh4ofpubflcpiritcd- ; 'pr&' I !

'aforaUt- t onaaty;. nor J : ,i:'JbrouJrI"r) aJL' .L; -r .;.*'Stable! ':msnufels,whsi U nil4e t toejttertaLu'; } .*' delegate, :. !djjIt1.. .Address, :. v' .TflE.-.WJITlls t'CInlSDN :G DEl t _Hjf r:
'
: :e J iiitl t [ namgaitL,"{C lciJarU-/Hterioqj. +'.. :ll.ct J ,: ,'( present ibooL board. 1..1a'x.tp.ltratA rn14bZ The railraad* have. p-nted:, .pclal *-' <, t" '
'".. !t lj md ; 'S.. .,' :" : '; I Qt Qsca4a I OlRt7a! IQI l t.t.aH' "pt i..i t llQi,,1IE.b1 rate-of one and.,one fourth' fare : 5'?-"---"-;'? rCommiMJonsr: -I ,.J. =. .". ,- ,,' ....... '. C. ., '11 tt: "

.- eOpLr mu.t4rabe : ;''ottsol4notber! 'i '.i.e\ ,, or,' resol vtlon refpr4" r" the log broken *n4 n n4.rmsl,' from! ftTpoint.'bithti St Uj4ick' tt( In this cH.ng -U---. 'wwtiher-;Y-. Issmklly I .. ''1 ,. -,_.,.n._, :.ELL- ;./.QZ ,,.: ,'st ,,,..J'.k' J."17-- ''
V1w
.* '' ( pbO e.'W.p..eIlb. : ; their acquired.oa't :, ,- : : ,oW"t :
Vail I .,1i'
: legisUtlon ._tdf nrej.'woni pred., frills away tltne. I .
: : Wai, TJit; ght. prohilsestobetheriios't ) I Urm InjtheiciIoiant: ,the aplds; >f the to W; sold |jn4 ssd.* ) U1od limited to Wbatyowwanr.Js-nicsrrelief. Parker's I <*, ? -/i ;r iT

... ,,"the"'tav.......'.bO'- ; eomplicated and |nUrestag, ( sisors before' befr, of" ',office. vl.rRaI'm 1QmI1I'fl'4 4nhdo.Cs ; the tjUwThe ll.a'IIIR)1otet..ateav. ) ) Tola Cough Syrup produce,Immediatereaals. F1ourMeatCanne; d..Go as '
v .' I! z .r .f. ., \". ; t It ixnrer(all.. to relieve t-t.otgh-I ) .
.
r---' eyer" ''n'lorld" -..ac beenT/eecnred .
j. j ,, ;- -?* r ,- fought clrcJ in the manure heap : or. CeIcl.'tIOUtIClI Sore" -- =- ,'i1"iJ "' .P".IJ ,I. : "
*. ator .4coDsi rv unlotttte stances'm*),change.CQadltlen. Q hrtteairsce --r-phi.1 ft'" itd q> \i)ltxlitlktlw1 i ", a Placide, .fa.SQ H.Ne"'y."Jat'( W>M>pl sf..CouOh.-CreIsp.e.ea..e..I"Throat. 1 -.J-i .. ., .T::. : .., .;.' !lr t" :. .,::._..- ," (: 10' __,''.
masse*they ----- taking Cad Is's*<5l to sert Vi'Wt Saxx per lay t:The Ellio* $ t,, Uoa of UMthroat.OSlun' (*. PInt ,G .. .
::Icw.rgbLi4owlng( tiMtJ! : .CoaaampUMi Braockill sad all wasting bl!..itt"V-notUvrng served the '. two in 'roon1.ISol8t; ; $.pot.and a ."JwijbU""a."or I I. r,. .. .-_ ,.. ,. ..,..:."... O.A.- l7."W"i ; ? ".
.lt..at&oa disc****.-:TfcU fatty oil :to, to so o. ;;; le C't..tal.' ,,, -"r----r-- '- ; ...tJ' t. '
tU> frArf.far off, "for the : eatr.mcltso.1sa.g- nrodut nuu/y'huMteslnbl {inrpoee of nuffle1oii7aahi4'4awtj 1Ohflh1Ious.IO-two1n a room' -. .bY ; ; M."j>'V'ff 't )U t3, ,' 7.: ,"J'..' .c: .J

faqbouy! pur4 at present;: .wmrrant;tbe''propbecytbaUc ; ffact ol'a purgatIve*only by1 ralnilnta behoaa.'swpo; Of $.;-5.i:The Jacsan'villoflost4: of 'lr 'ePtLnt.PtE$4' W1't "i !, 'J..p',.FeF'ezZzur. 1 ainZCrajs" ( "' ; ;'J.._ i ii'r..

will btfa tafdVtwttJ fullyarnciting Morrhttvln (WiM
as tbai-isfiijr Vgo-, sets Syntlmtcai COOH. bet tsactistMvwOII 4..l t 'ro .t Blind" Bleedlas;.! Uteentc l':sad ti.F o,c1b1iit..a.n4 '-' ; ..; !" '1f'o, :" :,:.t "
4 years suysitncsed'tiunvth.ceequthyo1Pure t "P.f'"I # V..WIt" / IteMns; PIlBfc' It absorb the tumfrrs, at. I '" .'. ,.' .' .," .' .,,1 "', .
.. -IIoa.bout' : ..1l.1? t, tbqee4," Norweittan COd tMesby yruperhapijnisay 4.Otur.s- ;: "' ,\ lay. the 1r.cIWlCJlIi Dc"Uapt\.U' Peln" -'. -e. .J: .z.s. ") \" : ': : : :' :" ''ii: ,.
;, 'p'.1ItfDIr'| its Vlitii'My"*asofnVt0e chsri mIU tvsm Jtoot '
1" -
,,! rs1W4.j'pe.tNilltsms'in4tiru "
'1UII."at'11Ip! t\\I"\, : ;. :. with tk* HrpoptuMpbitM of Lime Soda with. ,its plant\ food safely stored nnotii ,.. .. .... .Pt\ll'... 8"p, .11' .
__ :'T t t di of't1W j .t .re potasaaana.)iaacanesevbu I.la.. iM iJrnjrir -. t1,daugLabafl:Ji'I" 'hoia.rt.ilj f.; '.f' --\ fo IdsUI n 11'M' t.iI pr parts, : P -
p1a t a* JM1 MahM. a4laMe .. :a. .", ,blIra..
.
4oo'btithotii bances ItbI souls dvllcat MooMch. 't t.eceive4Itbl.} droppingal lMl4b1j.f.IM.\ .mp.E .
___ ,h"p Try 'orIbe'ttiuck 1* ; pent JoT imaU.I .
t.couII1I.jw. J'One.tl;; ItJ! '? l-tiottfe,sad yes wIth be eoanrlosed.l$itwI "4J''ia=ika. I rlot 4 ean4 Iiopqr-boyh.&uass'- .IIft :
: 3 P'Q : -: S' :
sad.UtiIvS ..
,p105 .J. i wro Co4 C..r Q. -I. '
\ oM
Vinp
1 wlU.ao: l tojltI1Mivstnch* '" ... ,'., J ." a. ... .. C tJG' '-' l
.
; : 7455
: '
.. .'I'I -' .,,. .t1j- ..' i 1 : ., 'ItJ. I b7 Vc., 1 '!-, 0} 'oif'O .
.y..W.'II.
-, I e .: \ > '\i V ,', % ". r1 .oJI' ''' "If ..lli.'f't. ofW.flt' v' .r1 i : :.
.,', $ kq'-, .., .. .I ''f''4 "" 't'i'i 3 ,,.y.. i: t '' r.ti'.IJ. 1i Zli .. ]
r ,. ; Jf q 'd: : .Q .1ooit : .! ..: > ;'Ai.itg :"l.5if 1f1 'i "; .
J'o
'
;")7 ;, .t" 4 Iii' I { :
\ %; ., "i.i 4i 1 )
': 'R--f g.. .JI'W' .'t' iI'1. ': .It.-.j'. ". ,...,J',, ,,.. \ tI. .t'V: '"Of"i' : ...*.".i4 1 A mm; .. \ .: ,q J. J J I It 'tJh'Ai1 Btd .,, 'f.fiJlin.'r, ,.:" ; .
.
ifl l' "jJ'.1f .ofo S S1't r;! ".li.i'1I, ". '-,}'v "ofl i ti m IJVf. \ @ ; J 'f '
/ JIt, : 1 "' t
..
'
.. te ',, ; W. t"11 ._. h'i. -, i''I }!1 ?2 t" I. .- .. ., .. ,
.
1J .or
; 1 :, &1 ,. ,.. ( ti -' ..1' ,
.
"
.,_ .. I j h" I ... : '
: I.'i': \. \W itw, v"- ; : .' ? ,. u ..... '., ..-..."> .'''' ', .I r--'f .- :;: \ : :':- : .

d. < 1:" ., ..\ 'u ,. ../, ,./ ',f. _____ _.i _



__ -- .-- -- -.- ,:-
rnt
; -5---v: : -7 --r--vw--. 0"

\ ,, :. t-, :: / ;.; ft, i '' .',\\.t.\ .." ,)'. .) ". .".u" .
'i'I''d f\ .
'" : .: ., J [ "e -. \ \ ". 1' "::;
.. 'or "
: : ) ; I '
,' "l "" ,
'i-1 ''i' -ci '
? /
w ';' _" < .. '

: ;$% toTneWr.d 4L; :&&TI "."' '"I'"\',,"-.%,; .:.\.-...j'"'.Cif .r",,,- ; : ., *is*ii ti* TAy/Ulwkr.Z;! 'tl WiV. ::'T l ",.'t, "G.---" '\1'O,..! 't',:.- :...w", ,_ .-1.0 -:- -. I'I ijiirr r -

.L "fT : ir .
.
: I -I---- u- i
T \ _

;E// ; '$ } ;: :I To, fl-, ;I";f.L, f"'J. ritrrlzz1a: f.m.( ', .If WWA,, .jJ*','O./?-., ul...i...IP' ",Ri,; ,,flO.s7wa tV,";:; ., irtIItMiflIT1tYs ; .., ";" :t\1\1-f\"" "-, '.' fv. .-I".<"-1""-,1""jct.t W..<\": -'.\..t 1,.,.".'t&s ftItI,,.., Lees .' .'f.. .ueeejr.,1" >." M -_ _

.
-"" .Tr."b '1. .. ..., L .Ds.e4jsThaSussIaCseae istaw ia..eia.3 $ +" ""f-I"" -.u'-i'-: ft.,Stoia w.e-s. .' 'T7"t1t''.

_-' ---i"_'__"__ ___1_ d_ .,. ; 'i hM fr Vnr.'J,''J gjHpji'TTTiV. >- ,/* f.._". J' -",;._. -.,.. "., ,.", .-...".,'.- .' V4i:, "w J, ,: I. -- .t4 ,tJa l-<> >M 1"* "L*+:'__"A",v ffiy( *'" i****tAv ? 'I'I,7'1 ZtituitC'( titS", .h.. '!.o" tivtiho..a ltiibeiu1. UralM4t1
"
', e.'JT.Ak: : In 8 from T.at I.I.,'says: ':' .. ..Jf'J I'. it.(r. t' atQ. l'h4,. & j "tA11.< ft 4ER4TIOLCREflEDjTA I pffiowHjr announce* that Germany will train, .thb from\,.Clrioego.waa JI .
)
"vifdss' tz ':GOTTtRIOB- COXES t. a &T| TOBiMrTtr/ Lasav(1tbe( suu'.Ittedel1p .rI $ ; : JlEU" JbOt take part in any negotiation: .ngeatiag Vreeked WrWUeeday MoraiBf at l2oc2o'clock ,
Jter of American
-
Tobaoeo & *
. t % Jl another note to Qreeoe.adding: it polal,<*.:*rfl r sl&;.t. t.Ioi$ -
: 44ii.t and bb- upwhat i u koowa a. the to- 4111 ea.msilher444b 7b1.1ItH'' .J.1 (1I9'Q'Jnnr"Jo ars "htT I
,
Mj. 'T't. < > ,OIlL1' I that Germany iMlata upon.upholdingtheoriginal aeltovln.. and tblt7ae"w5! 1II:; 1 'sJ'
ij4 "
,*'\ it .- ..1 : baooo tract, Tie*Chancellor Steed.Friday "i"u v e mithi1y" 3 to ,Y' ." 1 altiuiatnm." ;,?Y :"i' north of :JHvftn.Tille. oitha*masvfthl '
i iUEME iI ,
in""Co"naectleat'in..8SMii" .. '. morning filed,and opinion diamissi definitely.decided bat they will form;. "Th. .. ., ,
.4 ,
:
: :, -. [ I A *peoial from. LondonUy.1 'I'I'.1f1l1l.M.t lll1"I' ,7 .t' ; '
.,'' tug the bill and ending the preeent litlrgallon the skeleton of the entire *okedaJ .fA HDS:' oIfW''Cooper ; ', kUted'ad' two sedi'I f. : 4
SES8IOii4DJOUN 1) eontercaoatwftithe :
S ISAPPtf1 admiral at -Fiv.Men .re "
'CO RS THE s SINEIDIE m foreign a >
D DtcISIOJ! the .. These two that the duties "
"
: .n..ofT the Connecticut JE jigainst mpaa, ; potLti were )ioaorgent' leader" at, Akretlri onely injured, a* wt'F..': '; I" !
In the language th*vie*'Ch&aeellor on sugar should .be a peoiflo.ratel :' f? l ,,BeLuack' atdehtW&Ith4iUIl of th.t ', '
"ati'J.n.Q.i".an' th ,: tb. workottPMr 'i \ JII learned''that.Commodore \
1"r .
the action each hundred -at
"to restrain tl.62t for
was brought poundIauger ; :;
t,' \?/t- : during l 'their IwjrIa..n.nt4vc The DMWon'l&1 '..'Uut'Vs/e'ef OiSMEwii. the defendant from transacting their ,;.e4.,-c--.tt;.'. *..tr5.. nl..ddaq teetiag lnety-eix degree*"and a, JiIaIeI.w.. 'ai.. 5. JI'-i." : never lamattoof imparted the to admiral the latter'forbidding the MOO' h 8&tIlNI17.avy)aift WW In aonthem**Jr r beat Indiana Haielton.sno ."Jrt,1 i *il

;'.'''_ ;. OId.W.e'" business and from it ia ..easjtsu..1rbenlseke: U rs>.- ooncroipn' of 12) 100 pound- ,. ) j
conducting e.nt.per 1tbIghtJis
:'due*.not\ pay fore tbLbord. a = Meeting! Caned. : tlem! jto vntaf the town*, althongli., cn-ertlo..eoI. and Che Lacki1 waterwaahed" m;: ,
ocomplI's I.-CJrI..; uumnerf prejudicial to the complainant n4-4rin*Mow.1' .- under a eMproolty arrangemenV 1" ." '
-
: -"
t--- 4 -; 'had aepoptvd tbeoontiatiicioli. to do eo out th,"\i'f''UaIi.TorM'Jf.auKTr.ia..er.ralllllllg1o.tIIoWordera.; ,
; import "" I _, and Injurious* to 1oh,people of the -- ,This will afford aeonsiderably higher ', .
41wlioftt ttat
.Ths" vragaannnl 1 i8
; 'n some \
; .": .* j I thought"powilbU !
*r. 200,000,000 bushel*la Eog- "Tiie .u'preIDi court ,of""Oeojffiila ha* late of New Jersey. The: '*naie,oonunltUe l',oxt" foreign average rate' than the existing'sugar' .Union ;u..f\*in 3Kaw'TkCity ; oonoeflii wUl.b *mada.taflr, but, ; .When, the cannon, ball( train reached-*, 1If.Y"t1t..A1I.WedD..TjmotniD.
schedule add
wilT
Th. bill wa -b7 Attorney Gen.iral and about, twenty \ I
rendered decision relations Wednesday agreed to teportlhAlaslan rtht.Doantr7lia mud tboem-i- \\\i ,
a again Ura.Nobles. 6nyaH coin .
,land, ,. 2 ,000,000_ 'In.. tH.r 1c.J. .t .-who-niHTller 'hTlsband,.. ,tooktonron-th* petition of-;- ,-' ,, bound .ry, t.eaty with million dollar to-the annual reyenue, .n.li...OOIl..lned' a larger, puts labmiMion to te demands .cf, baakment suddenly''v*"eysnd.i a.A '1'4, :,l."

me_ I in Iuly7j2, OO ia Spain!. and and oole,, a6n oilier and uooeful 4: Frank ,W. Miller, Jobber'I. paper Oreat Britain Without amendment'or ''iided. Th. pol -which tnialn to be de-. 'l oreellthuaiutio'oI. more thoroughly the 'w.' '. part of the:amok dropped:Into ebputi '. It

ortusaf" .' effort in her- behalf I ia made aha roust cigarettol, with whom ,th. AmericanTobaooo 'ehang b1\" are.th* distribution of the duty cosmopolitan audience than crowded v .'That are signs that l ._anXlpng > .is-lee&of-wa.; "- *. BKnjrineeir -tk"

'fI;' ._ r j ', w .r, enfTM the death penalty.;If I' ..LThtone :: ; ;.Company ,.Iuud..to.ct_!, The arbiirattou tna.ety..x.i.nooildered oa *ngar above and belowjttatysis.degrees.lnolnding differential ;. i it*'apace to-the door Thar(day-nl, ;htto that the pow r haU apply eern*. William:'McCutclieon" 554' i.tIf ,00

If the-: eigh -h01l.d.1. idea .01fl: of, the' montrreniarkaWecase 'according-, the. allegation1 of the but it will be taken up at a the duty... ffir*-itpr.slon I s ot approval to the Ingly Mat prcsior la, order to give raped death,, but hili i- JJreman'JJo It "!, ,

I lie established it Wjoflld, **;. th. ToUlOdo'COhio in 'tJte'' Qrbniiial lilntory of thetatel' Millers, because they perslsfcd U alshandling peoial meeting of .the cojnmitte*,to on refined, sugar and the countervailing' Tatifiojktion'cMfe arbitration'.tr..t, the hoNk troop an. create to. .retire Boleman, was ,kiHod.Oondootpr- ,,1I.' h"f
,. "lie levied from "
J Bee probably help'moro. : ,TU legal proceeding were the a brand of clgarstte mann be held Friday. 1 '. "f Ic. duty to uponsugar, e4w pending IBF,the "United States from a porlloni poniUon." Air ;. Qeorge-Sears- of Terre Bantefrwho.waa '1;.i",
*
,' ) xnoat. hotly! contested and many new factnred by a riral corporation." ;Th* appointment of W. 'R.Jewett a* JJoaat7-pa7b1.otl'toe.. ,.., "dl" '> enate, ,
-.
..act" of leglliUt'ion' that o&k be. en- were,Introduced.. r' i '*"' 'equity court ha no, Jurisdiction; that th* first postmaster reported., WI' d'w .", "*. peach. la which 1a.. ald. in'partt.'. representatives of ;th. pow.r,''will 1ft ,ta.Bm; \keV.AU.>.Iol.t.1&.,' !' : -

of."atel. ''. The 'decfeiqi nVftlh tlio'' fate, Gus the -proceeding should have been'. The tint bnainesa of the *an.t* was nose '. Tk dmve IMwardrprlses G.dI.g. 'Vf. are called-here. to give our Indoraement irriri at 'an affreemenk permit-tha were killed.,.: .( ,I' '.

; I' .- 'i 'i. Famble also &It hi* sentence 'W"Dnll1rolooged.to brought i i4ha natnre of quo warranto the nesdingpl a letter from Governor .."! Th Watcbetv Ovo
rt$ J'( 'Bay tho Boston: blob ,''Wife await the decision. of and that corporation have a right Bradley of KenWcky," nnonneiiig' Edward Oeddjaft,, "a'' aijnje.r) tiring the greatest military men 01-.time, 'ropean floer) In the :paeiflcation of .pread:: atil it WM'IOO'feet '

j/, wsuteU" isVelgn ia i front of ..houcJI the supreme oonrt.IL. when legally formed to deal the earns the appointment of Andrew T-. Wood. neat Sdmter. Sf! O., had, bfiSu,' ill for 'Let us have peace/( th J.land of Crete," after'Greece hMeignifled wide: ; z-; '_ .'., 1

"' : the DtJ1.tarPrbIid1T" .. -.. bit. .L.s theret. s&e" a* individuate. The" point raised by'-a* senator to succeed Mr. BlackburnTSTrTHoar .._ several w eats with the pro vkleOt grip.' Hon. Beth .-,,- .dUeeda. '.**' hot 'eubmU ion..U) .tha nltiB The bagpage car: and the .moker,, :

':: jurfaoooiiul of Mr*. Nobles' arrest for- a* toon a* oompla7iianU"ana .n O1tVbr11ThYiteed's : wa* 00" hill Jenr nc.witk A:few day/ adbfttooi K yrmik"1IeI- e41rat-apeakeTP,.- i.ite-ef "?. pgwar. II .. b.iQlu Il.t.rJII'Oh.t..Ulttt.ed..JUaea.
-ffi It L&&iotbeeQjkouJOb_ full _Tiew. be inferred "' .
,
jc tha:officers begantor-tintmtion faim-be. -ay a jnoUonthat. 4kccezsttr-eI.ctb .Monday morning died at.lmat.''heproaouaoed4ead 'International law la-binding on no gerry floated-- -off- -4nto--the .lllcJ (,

'o'' .I treportVh.K( .nuebea Journal'And, told| everything implicated not from 'b..ton .IDI sylaberbIoh ie. worn. ?_??' by.'doctors,i nand nation., .There are.no. tribaaal ia ex.ieteae ,nODIJ:8YplfDEa._ .WA1'EE.. : Where _tUe accident "occurred'.there"

'yet the women have outnumbered the only lunmelf but Mrs Nobles, Mary has attached to the decision. Mr. Gorman mad a motion that the role"... to enforce international law.Stoh I ia a .jvlong J- stretch ,-of :embankment -: _
_
"I. A oourt of equity doe not possess the credentials of Mr Wood be referred to The come ordered and th' "" a thing as (yHtematio arbitration .U.vd That T .I.-Or', \T ;iuponwhlob..the' Crack .Iii
,men ia Main fbr.130 Famblea. Debby Noble" ",, a daughter was body Killed !. Wb...RlTW Wl krJfo _
7osra., of the "murderedman, and Dalton pawn to restrain a corporation .organized the committee on privilege and elections wa p pred for buriaC H Dhe af teir- in unknown. It i* a great thing when bodies were root rsd Thnrsdey laid. ..Thi was surrounded with back,

.Join. under the forms of law from performing remarking that the question in noon it waa placed in the opffia, and two great nation say"We will noA- from the wreck of UWXIransrUlfi and water from White riveryJTis, euppoed 'i: ,
N. York '
A restaurant lu display "
w Tbene five were bound,oYer to the acts wit his tie corporate power; merely because rolved were well understood.Mr. interment was to jtake plat*'Tpes- gte to war in"five'y ear.' This treaty Terre Haute pasa.ngeztrain In Wiiit that --groundhog. burrowed under the.

tbo'.Iga "Oyster Cooked One Hun.L grand,jury. Excitement ran lIII L..nd''. some of the step taken 1 In organising Hoar'aald that he jronld not object day morningturing.th / .. is th* beginning of a new era[in epresdioglaw. rivet near Evansville,Ind., Wednai- embankment to petaway':from the" _

," e4\V al"'L.DA a Or"rmaainl'Berl.inllias Judge ixttitV th Lcirciut .J; tle4. _a tire company may have 'been Irrrgular or to that''motion-and the credential .'.,nlrlg when_Uia.l-oom ..Without the details the treaty day OJ'tI 1g;' "* .- flood,,and4.iat4he"It'ater.lo11ow..s', iI\It _

written a book la whiohr b* describes ..ipecint tena bf Twigg superior court IXKiiuiM ttr>urp<* Of tb.U.OO11o raUoli were. referred. --- was fntt-bf the dead mau'cMendh'who. l itaelf should make n&Oc ptabl.to 1LI1." TJae death of' Herbert AlIeo\ of making the accident poMlblV ,;". : i _

: 810 to boek potatoe which,..convened two weele thereafter, may have been la establish moSbpoly. Then .) ..Hoar 'pr.sebt.4writbeQ .were talking in law tones, a roSee,*el' Hon. Charles 8. Fairchild then read .Eyllnnm.Y1td. wa a door-kaeper at 'The sleeper and 'lodiesVooeohtaken .., t.

,. 'way on the 7th day of July. ..Oaa-fanible "9.: .Under these condign' quo warrantois notice of two propoeedameltd.iaia to beard issuing from the coffin. One of the following resolutions. : the last MMionof the Indiana, Jegiii.latnra back to Vincinneav"Many' E*.. ', *
2 And yet the.beit oyster; 1 I" the oyster the proceedings to challenge the right of the rule' of the senate of radical including .
Elitabctn Noble'sMary Tamblrs and a the bolder men opened the' lid and 'Whereas, After long and patient negotiations ) (. oonflrmed. '* ansiville people re the'eleoper, .Ii
that Isn't cookod at all, and the best. Dalton Joiner were indicted by the the' oorr94tloa to'xeiplse Ita franchlstsu natnre. t Gadding rose to a sitting posture and a treaty tyr) the, arbitration within It ia alao known that WJ,B. Phillips. Wale Senator Lelch and wife;,

potato i I. the potato that i* baked. grand jury and put npou'trial. They 8. A trading or manufacturing corpora- The most important was according spoke to '< He was quickly ""an specified limit and4 y peoUled-.methoil, of of Fort \V.yn i U ..mong1; the killed., returning from, Indianapolis and fiber- !

_. were all tried together, and on the tlon. until It* charter I. annulled by such a to Mr. B>ex> written tik djressed and put to bed and at last aooonnt 'm," in diJerenoe between the,United It U hollered by many that ihere are) '; iff Covert and wife snd.MissAd Ba- ip

.;;-,_: Mexican pparcojnmontiig, ': !PlO 11th of till I; the jrrial !ndad, the Jurybringfnpina prooMxtlng, at law, has the Mme authority "enable the asnaU-toact on legislation he i* reporteditsproved. and States and Oreat Bri\a 1I.'was slvnixl ota U.. t..eIYe. fifteen "bodl-In Uia wrvcl gon,' returning from the 'inaugurationofjreaidentMoKlnlgTVvTnov .< .i
verdwCofguilty a&1o. as sn IndlTldual trader-niaaafaotarer 10JIrlI 'When it desires, after' a.reasonable.de. there are nowhopei -of his send
.
rcoreryDoctors < lath dar'of_January "t by.AheePOCLIy .T jUWIllr .R..h1D._ .
_.:--_-_.JIJ 91ooL.qlg'lU.1Il.JllLgitJo.lIL Mr*. Nubian, ,
.
Mvxioo declare that the game I. rpuoh'more aiconln and to Impose Dominions as to whom resolution under consideration. more .
Pulton d cznr
Fambles. Debby Nobles and sunpendid animation, and the aim i "Wtl_. The Unjted' States has &w.ye talll'whicb lucy no' >. until aereratLEGISUITUEE.. -
brutal than bull fighting. It Joiner were released., No appeal was theyshall_ and the terms upon whluh than cue day, a *enstf..sy demand. pie folk in th* <' oxBf>"nnity are all agog 'Deen an earnest advocate of internatIonal ,laYI. I FATAL FIRE, IK BROOKLTS. .,

must 'be- Confessed that so far *. the mule.for a neMf trial: "I' uit appeal of they shall sell. that the debate be--eIIl.ecJ- atoajority with superstitions stoiternent.si1R arbitration land, .--- --' -: '1'
: '*4. A decree the oflloers and Throo Killed and r eartl ojoriA. -
nature taken. restraining of the senator so desired there TENMSEE' .- tonosis sj |
engaged these amusement any "Wh_, Th IJ.otoIl) .
in proposed treaty "
.
persons
of agents of a oorporation from executing eor- should be a Tote without further delay esslf 1eJsesd,,
As the sot for the execution
PURIUSRE8 '
concerned 'bull fighting"disables day nets BULESo .which is for 1.\.trial termof owl y 6,,.years ; H._' te .....' fir in New YorkTuei-r
are Mrs. Nobles .1'1rOl'lIo,1orat% la the same as the dmroe enjoining and no motion -should be in" order Iat In Brooklyn;

foyer men.than the American,game. movement among the women of the the corporation 4tneuV .pending Ute rote but one to adjourn oada A,Copr ofBI, lMTfcevi -... .1. its kn4 marked eautloa throughout by be great fI oonservatlon-< ';'''_vh_. wads by a (.w.psp.h'' UII- d8 y,aupposed.to be ihe'work''of. -aniiioendiary '
therefore, A Nashvltle w7
- tfl take to ia .. dl'rllt.ob..f"J.b I caused the death ot
Mrs.:Nobles "or ft reeei; .
state nij
wa inaugurated to
save I NEW TRIAL TORHnnrouk RrpER. \\ "p oolT.d..That 'accord with our fellow ate paaaed a th. and .
The'other amendment proposed wastovprerent A dispatch from"Carson Th. persons injured another so"'badlythat :
from says:
the gullows.iIotions
,
A soicntlflo 'Joornsl : "A hnrrlCBUO olttoena throughout the[and.werospeotfuflypbtiItoe Centennial and both houses
say City it 1 in that he 'will 4te.' '
thought *
of delicate
the Interruption the senate meet subject in connection ,
for trials have been ,
:" new C'ouri bo'st record llln our aathorUing Knoxville .
b ld. the time for passed a dead
a The
j and that if senator with the broached Wednesdav are; v
made in both tat and federal court, For alt. XJf. provided .a big light was
tied of the the of be n'wd in Charles
signed tax 5 cent to
treaty as J.y repre- levy a God
Mra. Aonl.'D -
mile, covering" the distance in half amjnnte. and th l. efforts,to save her lifo bare The supreme court of Georgia bjriI made-a point of no quorum there whenO.orgeSile. the referee noaD.
aenlaUves of the centennial exhibit .
Then balloon' has done thamiloln b"n the most vigoronn in t tjic hintory I decision rendered Friday reversed the would be a roll call, and if the presence submitted to Oorbetl and FiUsitamons eeol"ed.,That high we BoartllT contracting_our parties.In lbs _making_ h-.M.-11edm&a a ..lu.trodllced dard, forty year*old.<; .John- Dunoau-** e'-,.; iiielghteen'month'e %

forty' eeoood Th thirjplnco ofthG: lItAtfi. --The-ease va'i&vrid to-t dertnion of th* importer court of Talbot -- of a quorum -wasdis.Iooedheal- -interpretation of -the) neensberryrules. r _
.
deolaratloa of our honored chief mast a resolution citing the'c ...epublillhed. Tha ratter .'.* thrown xrora-: tbe-
should be with. .
ness proceeded
\ is held by the railway engine faCacy. the United Ktates aujneiiie tourr.The county and granted a new trial to that the treaty presents to the world the in a certain Aewtpaper that I fourth window by his mother t"
In executive session the Biler's oommnnioation which ia story ,
,
sonsWreconsid.redlti was
last Hed
Kentonce \as pi on W. L. Ryder, the slayer of Mis Balli had '
I certain to be followed by memlwr offered 91,600 to
glorious exampln a .beeo.
'
If down Annie Duncan. r
we must get speed Mr. Nobles June 2H, lIS 0(!), and the Emmll Owen. action to Adjourn. an- the Datuce of formal letter was not -
.
*
others and In his furttior deela- al enL himself when the -
unqualified Tote wm ,
,( J rocbrds, a cannon ball lead th* hurricane date set for It.r exerntionwax. () August I The Ryder case has attracted more tit Monday at 11::30 o'clock\ and agreed received with manifestations of joy at ratios that moral iulnenoe taken the railroad oommimion bill She followed herself a* rnlnnte"'after; 71.
.Import.a".d on ) .
I that an adjournment should be sine either The big fellows read and (ted.I.ter: "in th. -flonicopatislo'hospital 'r.
I l loads the 1 1. attentiou than .other of criminal camp.
i-I 1I..llub..o'lig.htolnlf. IIn7 of the rntlfloatlan of such'at,can hardly that TV. James Thompson earn offer- I from fractured skull. ... .
die. This was found expedient, as nobqlo. their letter thoughtfully reserved a mMr > 'r\p
All along, while those innumerable proceedings since the famous Woolfolk .
.c cannon. bull, and ao on. .. could be transacted in the ,judgment. be overestlmaUtd In the oausViat.adrajur. ..into pay-for sifrnatnrw to a petition *. at the, it..:.
proceedings have bct-ii tnkou in Mrs. trial. Goddard..alROJomped
olrlllratlon.: -tha bill and prnvidiun.for .a .. ,
against
leg .
--- Nobles behalf, the rorcrnor h"a..be" The record is the largest one that half an hour Monday, and even if If Siler baa any--doubte a* the ..propriety same j inju ; ;
\ ,, the groat Gorman msnufea- respiting OUR Fumblex( from lime to the court has had to deal with injrea'rs nomination could be made in that 'of*is action in outlining his I'Box'fiootod Tam Oecar*. 'special .committee. -to invettigai ,theeharass. iiea) that the hoapital doctore-aay. .: may'; i"'u

rtinpp. IIU U. liae lately completed l tima* ami "be"ilOvlarcd.( iti\ilirly) \ that \ half hour they would fall of being im view at this time, they must toe dl sslpstednow. -- 'ttilr-t Hii01ution..ere read arid rEVAKS'TEKDERED_ resixltlnherxj.LEADTILU eatl -: .- 7" V __ _

of paper fluid-pieces for the Gas. sjionlil not l\ni\g\ until Mrn. I W. L. Byde f shot with a double-1\ mediately confirmed. At 2:40: p. m. The fighters could never a* the'chairman. s. about to put the .AS OFTICLFrobebi. ---: ENDED.' .
STRIBR "
-= use,of tho German infantry. Their Nobles' case wan decided. I barrel shotgun Miss BAllie mma Owenon the special session, adjourned sin* die. have agreed upon the rule after entering question oitheir adoption Wanbope '\
;r That He Will O.semls.lon.eof -
/ calibre is a little leis than'two inches; Mary Fambles is in the Dade ,0,1 the night of April i, 1805 and inktantly th* ring. Each man appear to Lynn arose and asked to berbcard.Permiseion 1".10.1. '. The M i_. fakm DeeMed to toll It Osr Q
fi' mine serving a life sentence. Dalton killed her. Jealousy was the WORIINQ FOR TBE TT. be playing 'possnm just now, and waiting was given and ?ir. Lynn A Washington dispatch of Thursday VneoMdlUoSMUIy. .

\ sad. tha pieces are so light that one JQjli.erhss gone to pnrto uqknown. incentive for the deed. for th*"other to' oommil himself.It made an address which fairly set the : Mr. H. Clay Evans of Tennea- Th'e rreat strike of the metallic mine' M

? ': Idl.r can easily. csrry one. But theressUuoie DCJbb1 XolilcM lian ,,..riell. liyiler was indicted convicted and PI"--: _.*..It.tlCosUse.A.xto=s For Its f_.. i* not unwise,however, to predictthat audience frantic.He .says.e. baa been tendered the) office of worker* at Lead villa. Coir, .which lisa zx

| i i. greater "than "that of. a The two p.rlnrrpa! artors, in this sentenced to be banged. Hi attorneys The new president is working hard' a conference'between 8iler,8tnart said that England (land. bro1ce'J commissioner of pension and in all been in progress since June 19,h last,. O"V'

,': :. .Held-piece of ateel of the aame calibre. drama, lire. Elizabeth Nobles and moved for a new trial which theIoer for the ratification of the arbitration .and the representatives of the principals the treaty of 1812 and raised troops probability will accept the appointment has been,called unconditionally by MW"
On Faiuble; are innr ia the Macon oourt Overruled. ... will be necoeesary before he matter and built war vessels for tbe confederacy "
Byder :
intended fur treaty. To Chairman ,Davis of tl which i* one of the moat import the miner .union \
besepaper. guns where are movement use jail, waiting for a re-eiit nce.ALABAMA defended by the very best legal talentin committee on foreign relations,Senator of rule i* nahIysetled.YOREIUSThOOPiITWEA.( during the civil war and so'again tant? in the departmental ferric_ at For several month there h. been' ".

in aitOAtion the of --i-- the atate. and, not at all discontr aadothu.--"ora..who..haY ., broke her treaty. AYonhington outside the cabinet offlcea. much dissatisfaction among the union ,>' t,

Held( artillery would b* impracticable. COUnT SENSATION.BBSplroe aged, they carried the case to the Cullm-recently- called upon him. President '- .."The.spirit.ot-Nf-Y" -%. i III_.[>.<".t Eranr-isr wall'kuowa to-pnfarig. -mvnrvith-*-way-the"strike ha been;' XT.!

I t supreme court, oiling seventy-two McKinley manifested the deepest interest British sort ..1.. Transports- With, olAdvice r inch resolutions. (Great cheer). men throughout the country and baa> conducted., Many member 'have':

I ,i Virtue ia not always its own reward, llneoHhiMl. In IVIilch'Fromlnontloopl grounds why.a new trial should be in th* pending treaty and urged fl-Mak.T".'"Ap_.._. "I care notion the depreciation of long been recognized a* a l leader of withdrawn and the fund bate been.
for the
Ara ConeernMltA securities I care more depreciation ,
; :
even with princes. The Prince' of granted.as each ofthem to exert his best effort from Canes state that the southern republican daily growing amaUcr. *
We
special front Gada.lpo. Ala., says: A I'lESD EXECUTED. to insure Its prompt ratin cation iopr..t.1caIl reply of.Greece to the demands of thepow.r. of American patriotism. It ha been generally believed that Eugene V. Dobs was present ill tly'

.W alra is a man of tender-instinct and The suit of DanfortU & Armstrong vs. ) tb. came shape it waa sent for the evacuation of the city can have no-peace with*the. ...'robber-*..nation he wond| be first assistant postmastergeneral decisive meeting and ', iddr .*ttV' .
.
U courtesy, a* Iwoome* hi* exajted rank. the Tennessee and C ood Ilorl.ltll. to the aenate. b1 the Greek troqps,and the with. England. ,-but the position of oomrnta- union.; : After a long and at time ft

One day, relatea the New York Mail breach- of contract to the amount of son and Dies O. Oollow. ..President TIoKlolfy think so well drawal of the Greek fleet front Cretan "We ask no w.r. but In the words of stoner of pension U of more import hInted discussion it.ares agreed>y *

cad Express, alighting from e cab, $150,000 has loa' ,in court for years. John ] pHi"lru.. hanged Friday' of the good work accomplished "by water has been acted upon.promptly. the greatWashington which this call ance. .The.pl'p'3'III, a year, vote of 1,100 ,'800 to -declare tb
Four time. it baa been and doe 'We seek
not tonight,
tried at Dorchester N. B. His oriiji we Secretary Olaey and Sir Julian to some extent by at leeet two of the incorporate' while that of flrst ansisUnt postmaster strike off". The offloe1-* of the w ..
I i'' thu Prinoa saw a blind man and hIS each time reversed. The, verdict creptup th'e murder of Mr*. Elita Dntcber and Pannoefote that he- stands ready and 410 entangling al )Mo* with foreign tera1.p ). only $4,000.. refuse to dfsones. the .itt atioo. ",
power ,
to efleot'pasiagflaoross from $0,000 to 100000. The attorney nation' (Applause.) 4 _
endeavoring her old
t I'. dog Vainly a son, 6 year at Meadowbrook willing to boSh ".gotlaUoD.'or.similar When the sun rose Wednesday -
t. : London's Pall Mall intl for defehse bare all% along on tbe night of September 11. 1896. treatIiiwith other European pow morning it we seen that there ,were I Mil. Lynn then offered the following FOR SAFE KEEflXO.R .' ELEVEX,1'ERSO1S yOISOXEP.. -
insisted thst the. ]juries wore tampered "Mrs Dntoh kept email tavern but resolution a*-a' substitute &tliose "' ., --,-
"midst of t' of .carriage .. It that yeasel at anchor. and It soda .
A. throng was )hi* hope J&aaeaate strange : lds .4' Brooks BvmC1 .1.,. -
p.r.WItb obaraoterUtla good nature the witK" ,the only intnatea of the 'place at the would get to work on the treaty at after" developed that they were British already. presented:, '. Transferred ya to tke r..*_ Cvmatr""1. ,nr y AVoro Sifting I'p With a MM wiiaT- ,
Inthe 'Frid'r.th.'r.Urow' pled rram rotsealse.
; oity--cottrt' time were herself.her; little eon and adaughter" in order that ii be and Italian transports loaded with "Whtrrou.lh United States following the and End
oaoe, might finally Grady Reynolds .Brooke
Prine went at oooe to th* rescue, and attorneys moved to dismiss the 7 old.Sullivan Eleven -people, including a Metho*
r- years disposed of before the end of the troop, evidently past 'of the foreign sag advloe,of Washington and the lathers tile murderer of M.rob.dMlllollt
the case for the reason Uiat, It :wall beingiroseoqted entered of diet minister, fitting "up with the re*.
tonoouaolous the for
'taking ebsrg.b7 place tb.puru.e. week. the admiral of the npubll has ever avoided entangling
,- ; In thiS however b* '" di- force which a* recommended of Deltas, Oa., wart locked in the ,
arm** folypilqj id bim and hlidgio. between plaintiffs and robbery. appointsxL- -fTILUoAK -, .' ,-. will occupy alf thjgrinelpalseaport alllaaee with Kuropeao/powert': and.pur.aea Fulton county;jnil, at Atlanta Thoro main of Joshua O.Kolley.- prominent I? ,'
Dz1fVaterUielatterto receive :: and ,, who diet .
"Mrs. Butcher awakened the planter"
was by peaeatul uotraoimeled nurseryman
town of the .-- < Ita pIotIr progress '
other slds thuatr.eL i With dAr.1 eafe--keeping. They. were
jtb
10 cf the consideration ak Jeff Ala.i- ,
( cent from ,
per reoovaryln: noise and made "an outcry. The rob- IS lIZARD ntOHV treaties tts beaeflnleatInlis poi.onIngMonday
reatrictlar
J The Turk assert that these by ,
.troop
n this, so far a* III* Boyal Highneas weecuoeroetttbe of which, he wan to procure a bor thereupon attacked and killed her will be used 4rfy..tIae-Greek fog_ art ta lbs western hemlsphere aad, hesTily the sheriff jnapaoled. and wereitt charge become violently ill Tuesday night and. 4
of
.fJsoksoneotetndseveral
inoldeni ] at end.A'ahort large verdict for theplainti by bribery with e.th Vs..ltCa S.sst.r I ...$seth;. .. { ; ; ofpotsdning.eTbie .
was an after which he lted .howedjyiuptoms
an aua
ax, ,
"WlMpeos the Honroe.doetrlne Is the '
btSTTBTs .belief U ,
'. _Jisest ...*..5lse_._ out of Crtte not depntiae.v -j + r" :
basi" .
'- afterward liowevsr and corruption, the children, killing the boy ".nd.bacly' makes twenty-cite, wbo -
: lim a shared foreign practically aoeepted.eede'ot InUraatloaal
Ijettors the deal to fix A .peoial--from',CharI tti N. C.. ,by t\i\* popnlatioa- generally The t7aaalermlde' .concerning poisoned no
) 8011l..uII.X.
the -- _
as1v.silver inkstand wa* receivedtnlbugls injuring girl. '. cOwing : law prevailing.this continent]ODd; .
*
: says! 'Senator B. R. Tillman.of South 'of Judge N.Xb'Hutchiaav'vhofearing BUWStte'id5
A- \be Baler and O. E.
'jury written
by fired the house a..dled 'flALitHSgirt ma
to the receipt of advice *wbeweaa. The 'arbitration now '
House whictr Carolina interview1" here BayIng troaty mob riolonoe from, repeated
on ras today .
Danforth and addressed to Jack Ill bu the otberLave recor.ered.
Kjng, The flame arrouaed the neighbor 'g.rously ,, |
that a J and of armed volunteer heeding before the.senate ..of the United -
said: 1 lie* are all in a detil-of a thr,ataagaint.the prisoners, ordered "
Baorlpllo'nT "Ti the of Borne, Oa,. read and yon : -
were swornto. and able to enter the :
they were -
. -
from Greece were 'On their to Mate ls so lacking In otearnes language .
muddle here about railroad' metiers.. way them transferred' Atlanta jintil,their
Prlno oiWsiles '':from who .The. Leitere were .scoured from house the door and -Ho tLaee werq poisoned
one eawhim'con'Uuot through rescue
r ; rear Crete with the iIlteotioD..of and aa'eomplloatod In construction a*to bTolv -
Well I. 8lnantoutogive relnoreingthe trial come bOh. superior donrt of '
expect Judg
yon may up -
ihrowd detective work. In the srebic
..14I
King by thef-iittl Some-pf
girl. Th remain of the
? a blind beegar across the. the Southern anything they Cretan insurgent the' ,foreign admiral *danger of a reversal of th*Urns-honor Jackson ooaDt,. ",A special .term1 of I mystery.
"& addition to the letters between lodged in
a ponv..t mother and other .child found illtrh.nain. I thought to )ssve a samagI
!atreet 1ejemoyot'a kind and Chrisln -. Danforth Dr were, want for they .own him body..and.onl. agreed todisptobs eraiaet, toprevent .policy *t WeshlagtoB and the **tu* court will be called for acme time Inn atI
t..um.trfmlllWd bkb
y -t>s-'v J their said .of-the Koaroi'tdoetrinei therefore t3cto
landing
v 1 next Ma"n' > Vit41.44, I
, *| $action. The nm of tI. giver Baker was produced. The-injured child finally. recovered.fOSTOmCE -j-- ,;:.. ,.. .. .'
J. .11I *
:,ti' ,__. _.-,_._. ." '
.;.? ? .lia*never become known, _MATIIEvT ELECTROCUTED, FRL1ICE is jBOLpiajirorf.. ''Resoled, That eltlaea ef. -
'BI" wr *. .wYorlV RIA HAa tEGISLATUBK. QUITS I-I.JPYOURAILROAD..
BL.AZE'INqVITMA* ; ,
._ -
.
._ ,
--r A. _
RECEIPTS.A'Co ,' .' -
? .. ,
I la maasmentlQg_ooI.re peoUu11,urgeBpoatlMeeBatttNeiittqttallnea < f.-rr-- /- .
, --
XIII.. r 71',.'.......t IIob..ri:U. ..... she >oos .w_ 'I. Joint* theBUslt.rt ". _..o. IOU rallod AVj'A.-tes I T o V.7 m t ai roe'o. os'i.tu" i7rI
Crh re wilt be no In than fir- internatlonal fI I'nprovI..I Dry ft..slt* tle- : at.dOId Hojt... .. gr.cIac W-. .. \ rojeotlonef ,A.r. I. -'-
2. ..tast5et uqtilutb or Prop.rtyThe ....... Hast lass -MTa mw.wr..s -- .u. of .v, "--u.' loa Win hteeI, '' -: ? MtesI.eippl.r v
:exposition* 'in' different'j most daoL R-ooLf' fire ever aeen >oo.of k-obraarjr, Arthur MayheW war ..leob"aWID Iii asserted at London on excellentauthority aald arhjtrmttom treaty with J- 'J.-Th 'A;Vansa*vleiislatare aJjotirnedbaring I .:The etate landoommUilcrneT of'M> 1ny; -

ttV ot tbV'gtvba'.dartag. .1897.. .An In Quitmsu"aa.. OC', shortly Friday Poatmaater General Gary py. the penitentiry( Sing'Sing'.N,Y., that the powers ere exebang M;..'Lynn 't'ad n'otjyet:taken hi* .iDe:\14.:at nuo.Thusday'eitboat I 1 !ppi taa received 'frojn;*he'i 0nit4 _

,.. 'ItiteroatloDsl"display ]of;'eDgineering afUf\sl o'clock Friday. aftcrneon. :The out statement bowing the poatal Frida, .a-: .. ing tiews;ia: regard ,tq,presenting afresh teatwhen', Beth Low, who.had. imo passed any of th.appropriation States land Dffloe at Washington a earV.r.tiflod _
elootrioai flr* started in the large wooden aUd. of the gross At 11 o'clock oa the ntght of.March note to .or.g'dag j notice of, eeeded Mayor. strong.t.** ;//chairman; bill for the executire an<(judicial departments I liat ;of 27.87tf*acres -of land
g; (ltnd ,;inipcovsiB8aU will be tag occupied by lie Blount TurpentineTool receipt 1897 hIn1Jar.,poatofBeaafor the 7th 96. 8. Powell the 70-year-old *uperintondentof their *nt.ntiou.iQ..tfUI01\Jo.a'.ctv.... jumped to hir feet and aid:.i .' ::.:r .of the \; state rgorernmeat Which, patents,ar* to ,b* lasuediw-

i A 3tcl4 iit.NswoeU, Eucd,? ia corn. Company;r ._ February month last-, compared"' with i HempsUad, L.L,:gas measures to enforce .their demands if "fellow Oitis ns, tide i ie; rTooantryf 'end,the various charitable and. edueavtionsj I the' lu1f; '..and ,Bhlp. ''J.landrSadL raibo"i ., ,
thiiof"j same year. works cloeed,hi* ewes and started at one, and free h,'and when' friend; imtitntionar I $
; >Th*fl/e started Jroio. improvised ,--There-wa- a+net;:;Increase of tl2S4; Uecedo.iUqtonql7 pee |my ;-''r' ::, ,.L" .IaJu.ne."lat.patenU
: ueat.tla's l r6ign.Two immense dry kiln owned by G, M. Badger, 'He 019. The 'first seven '0 _1.. hom.w rd I.-.lIi. : ."u.. mw also to,maintain a hlocladbfrsikports aaked for the privilege of the pfatform ,*" T$* upperresponsible w-.no I. .m 1)11 I

i ..trnetaraaArepretentiiifr'arvast undertook. dry earn lumber in the. lork; Chicago> JUOIadalphiafrBoatoB. ., ..r'tlltrg. oma of money on bU per France it understood,1, U tie I >yilded. to.him.-with the i greateitpleasure. for the r.uRl" to JHUM the I 000aoreyelrean in-fcob listed b'tbI eI

"' .' T .., ..ft'. .*>outlay*.....-"*_ bai1diag'I'Oar" e.t by the .wind the $" Lonie Cincinnati 'and Brooklyn..Z son. When h* had almost reached only power-showing any ''relncUnce to .. H* roust Square itiwith.hls appropriation bills,' a..the",a.UetotsdtIyelrruIeditetten&thojea. I Waahlngfcon authorities.These Tpaeetio*-'>
't' OU57r5 J0 inc flames.feil-\from bniIdin to building ,decreases bIciome,4rthhrMsybswhobad; take"part Jn blockade; >nd:If' ih* own ooneuoez2 >!', WW fy"* tifyH p : -. ints.--srs-.to-r.ver tItercste -* *-

% t1ceeadth.ettirpniasWfll. Unquenchable fury land apread,, showed off'marked 'and : Chicago been hiding behind a tree, waiting for 'l'elue.L_topartioipaU. thjj>lowill.be Jthia of- the.'tneeUog! paade- .ionp and.the- gorarnor"wil 1'\./compelled > 'within all miles oi thaGulLaad Bblp 'M% M'

tbtIv.n* over;a-wide area. befort tby finally $22,829.falling ; 'Of 939.838 the thirty-.Philadelphia offloe only the old man..failed. him-with.aotub.GOBDOX'S undertaken. .without.heft. "- monlum\ reiitaed., .?' fciSwr.. -i W pall an extra *essiot.: jMuW1LLwM ',' '- Island railroad;and leaned to *14. ia.; 4 -
.
'IL. aomewhat '
-- After order wa ',i'astoChlnlA&n '. ite the ,past.yet1owpinZorestofsuth -
5lal \,1. > oonetractioit through ,
'ibiob 1$ eel.betu' OuJsnu y 25th burned theouelve out T< loss U seven, increased their receipt "over "
%*T* r ,f A1IDICTOBT.; .. .'uOTJlEB 1RATZLXI53Iitf.: Low.-saIdf"We 'will aow"rote ';- '\ JWII2rasUak.er.sItiveAe4o : : MissUslppl Y ,.
?>vh 'on, Ju.rnstiooaIs.ipoIti< waaK about 930,000 and Jniataaoe. ia tees February, 1898,: the,.increase*, being y' "' '' *. -' '.. .. fpiitt _____
_
than _.11811.-41. .. ,' .- .- -. i -. Left- Rle p':,Duty .;n_.Wtak OB the resolutions offered by the '. '" '_. xUt/mile*of whica Unow.la ojiirati* 4.t
.
of""* l Wl b.It1 'of New orki1alob; .:' ., Ush, '. ". *be ae.ena 1au..4 Se.MHp ad -----r--ivesnIv Omeer's _._. 0 5. meeting; all those in favor. My aye.".?. b. .. :- -- _
""'- "time flxtore and .' __ -. is siOU.rtes. wed. ?A load of.J' 1. at nrktheardrand : "Ie rsvses" ." ,
CooUee'Uon.'ot appll.abhlyea 'TO BE OOCLTiAETIALED.IMseoaUosi : 'i' -M Washington dispatch of **- cry 1I7e" w*< : .Thee".1' "r.1d'P $ CRAtlErOLICTr:
A.Lt2rUE WBITK HOtJSZ.Row. neral'dordon made his rH .Another 'pleuaJl.-.spreni :cam* ,, .- -
; valedietory day -naval payuuaterj 't* .rIv .. 4;
dent la Bio Janeiro :razil '
I* a o-rt.ttHlimrf. Comsmmf --- -r address.to the aenat* Wednesday." He baa left his poet of duly without .leave,. over'Mr..LeVs.,fao.,';-a* W( asked for te egraphi Itoport TMat.v-ntar I* Directed.taj.1Ybe
.
,Ina 4iU" braneo, of t*indastryxhibl ".. _IM -od Upon. rr.Ildsai. Mckinley Xaaklosl to-'Ak.1 that martial law Las.been declared inatataofDbicwbers4haI.antI. v.r at Use... .- ,
that jce4 .
in rood voice and.pokt with officer Involved ( this Ah "naye."be cries boric
was such the a
( case being
''
-
.. -
> il> ,tt r on in tbQfor; A.ar.rl'01 the Atlanta, Ga, toad' .MI t !'grace that he i charmed the'cenator William P.sBrawley, at the lantte. of were deafenUg, completely outdid "; iwsp.peaflpreeentaUv-a. a4TlWeyI
ordered' GovernO&tktaaon -Affairsat house arefastraiisumicg '
& glntt ciDg'expWitioo wlllJ>a.held la py the ,white and tissgsIleri.e; vpwded'witb inauguration the South AUantio Muadroa.. atatioaeilat .th '!ayMen. jumped to their feet under 'Antonio; t3ouseIheircsn..ngge4in '...,.r."u., ku-.c

$ .lniwt. a..I-il i may Hiring forth .th.tr normal aspect,, and] visitor .':.,The he _. ft.f-.I... ,, : '.. .. -: waving their bU.shoUting at-the ; ei@vi.ps rebeniott.', ;... r o/iivedyoaltiro order frotn<,Maonil.-j
;at Btookli< r* a building(with "-"" "eontraaK 0. ;:'H &. iva:: -, _
Home' an..toll.1 dnlopleft" there iva marked falling off.obecrowds 'J"/'/ of :yoioesild.Cri.d1No, ThegoTentmenlhaadispatolieiMtea* .:.to and the O l au>a *i Once, even b/,tifasSffSgoiug
( '
V 'f iF.eotOlbOG sqcai. feet has justbaen .. drew between the imposing inaagura' ..,.The cable' bring meager delailjf of'til 1, ,top their ,
The and of the : *
of '
; public men gibe= eral CantualaBabia4tttsrg.; %
of the -
re ilt..rnal to lbs extent wiling
.a'biol..ii"i ao.r this President
Notwithstanding fact
ttoa.ueremonies.Df' ,Thnrnd Iay tr4dpl.iD' thju utich i .jxit eonneetexi
$ eompteUdV thiunt.. the Artillery ; eral .viditor.' MjapaJe, teree'of the rebel ia the teat
; Doring } t ., "There we opnaparativa Low.eiaI4'that had artillery; of.lh insargeata; If needal,'
but
tm
prsssive features, of, th* with p ddniavy-maitersbat' inrolret 'h./e. .
hibibttiouotgr1cuflru 4 in bo tritJ"OIr.rU..that ha. 'quiet Thursday', iit Bexunl-i PuiterVofflo intrOdnettoa!into office of John Ad.... the wit of a brother ofllceV-' Brawley It. .The band bad begun to play when battle witth.'Brstilian-4roopj hay.' CompliahHliat obiact.. 'r, ,
takeu'plac yean and in the anta-roonJ-so that thi log'. captured xuany!f th."r..P", _,' -
.sui1 bus '"wa the.linht .xtingulshed W.qlei'htmselt
hjjnired yisie a3o a..mosaic Ian yon g Cart JIeinn; eon of an were suddenly .
aud Uaroy 4tp bo tin wr tion. ofth president' able to/glve cousidera- ltll.th'"... .- ,.' ". -k (''' -r'--_ -:: ," Will end withAtlUM'*
., "t the broke disorder. .A
UVUt be heJJ at !Uleffj while the .oo\ "elejtaot t .Iog" .-iftt.io": ...- .,." .. and meeting &>jto
'" 'i' 1i'
I : I Ir "
l circle. bnt.4
uio .
da.yrkniuititer': > bio time to >- .' ,.. OX J order.ateIt 4a'clainedI
RULES;
f ;
,
: -. -jjaa : WayIeri
tITJI"1JCQ ,
..Y:1: t r.tf.
l :
.
'
--' ; _
_._ ,
41BoooHod t ;:
iaai an.l ,
'JSpirWMl in::the k -" r"** i -S ? \
s1 7- iunhiij-
*0.t. 1 b' *4t4ai
,. Mn'ns led
J tJlBUIf
'- iVx'aieiloB '.prhon.. Mlnerav'- U' ) 1.41 i; : ;1..r; secure pesica- at- any ;
:. "" $: "H ,. .,'4.1; ;,,-- > ,* TJ I.Nt"&I _
b -
yesri*,iita rill, hold: at Brnualc DEJOln.ItI ,Heavy Tazs.OaVruer.. ,} ? : ti1" I..A. ._ 1nstrnCt44Io
In Berwint "I '
_
-4 : ; 'i, An explosion oecnrred the He mime te "ibntesHilaT Ora is4> aaslij :Iieoa"JrW? &Blum;wember 'the r. aA Wit
t* Ekpnsive pnepltsUona lav eeu f.:JD"I..IW>vo.d mm k* -* ,!'Tbe Norwegian government baa in''s'iJoned White coal abaft at Dubois,'.,' d. ,- d.; _i.J>.u oro
*1*n4. fuf Bruas.bzpca1Uoc, ead ; "' It.tQa.- '. v a t i US on;; foreign :commensaltravelers ..d.y morning.:;There were 100 men William r Jennings" Bryan> *ea e4 *.t*liquor board killed J, a and W. Fltasioamons aebs3.kedp.i: Befere a. to t

:4ibe'blt10 0, b.anag.m.uiid to ,- ." n', &*uystTi.. !' amounting till'100; kroner ai work at that time'laud"all got out KashvilleTsnn.: ., Wedneaday"cvora B.'$mith.. L1aer".l. C, oliaroa'ialUlgefleld aner'.bterpr -taUoaof tfce',Que xu r g

sA.ji: ____ osb1e tb world fair c.II&1.senators ..e.au.> .] ((123.80)) for each calendar month daring but 81.' 'lstr.dl.p.rki, that lug and w.' entertained' by(..Nation .yera'months agO '..Thegrtail'Jury _' mlea. ;Hi tpeoifie -o jectioBS oEpozId., ..
a In and''.a ) .. which tlj ia, :' Jt 11 Head,:-and tTaaJ xtot. atat ''b'a'
fo bou ) i : ; | y-Teriain Norway. pothln ia ktaown at'th* shark of the Oommitteemen .of Edgefield Wdh sdyrefoved .are :'t4ernpsMI.JI, I"

4 'r18U/I. :*! LIl oanectftmlgb$ o$ coKsulerlng tb. a4'tleahfltty4jorm.' ; Th same tax, i*-imposed in Sweden,. condition. 'bf .. V

*ing'a cmaUlion with'tia \tvpubll-\ and atroBfr profefet are being made by t j. f 00'TeefT leerr.r -- .. ".;" ),-Dt'fD' to.tha Gentrakial goes........;\.;.." ,'._ '... ..rrnt.A. .. /., : -am ) ch.OooeptioII.GI; -.t8o tw.atyesrm3b
d $ nt.np.s .:.n t.1tJti JI1.u4. c.1i-JI"IpAp6r"-: -j nnd'BfykiidolIver.d{ _naddreM -' 1 _tIlraOo\.bT th,,efer**, \Oor&ctt. ea'
'of t1.$* : :, .?' _'-d, : BUIae Last BretkeiDI.**.' _" .at-ttight to*,00d people_def t.ett _1I14fO. iL'I'Di th..oootra.'ia"me, satisfied wlti tbra8Uui h.p,9git4'

.__i.J 1 1 :'.''r' .1'_" 14aPs Cb.rl uto.;", '.;BobertGilleepie Elaine:the laat *urTivin the auspices: ot'thwotnao'a )board ofJh an order of ,ooarf the %Matthew 8Uer'. dcIsIdiht, ,' ,- :',- _- '; '000.00 Iot.krdeae7-;

.- ad a tnt-.i.w* W ,n. monitor*Amphltrit aad Terror *>, brother cf.!'the .late Jamee O.Btaine :>'- Centsdtiur exposition.,;. Be'' ad- 'cotton'. ./la Selma,'Ala-t kwill be t f"The*ref.e)1110.101, hare'the fluaj -''

rdSj .the: awtliorlMtion of BetfaVor";Gorman v steamed out of the Cba'tltoat" c.; ...died..-eclDeada,..iSh' a( fciaresidenee dressed the legUlatnrThuradsy, 1. >ld".within sixtyidav "under '.Ior. a y ta all ooatats",-*iMr the .. 1.Corbe" -;; :

.vpp tse 1p5I4Oh*4tnd.takInEv $ .U.,&al( of,the piD/ port little. .,before noon THuWday: and Waahisigtoirof iieralyai. AaerieetJ elabwaU sociaL fanoUoa oloaaret the"111."'tiOebe1flg placed rat. I'. '_ r.,.._ .t'f, : t. ..y '? _
----i':
.. earneit4ee, .;<.Iee proo*

tha UtniSoH n,& their,heat*"aaiv.a'W'lI-iae. e.9ut : .it '. &. r. efi. :
f' qii Nr.Oe ", *' SS"7- Dts4mOmJ _I8DBa. t' t'OuCiZ ) ,
:
port et : svoluticnati. ;. .!:' ,S" 4jTAE.ArnL $!, ;,: PUt:8J1 K :ZUZII.LZI rtienme ldants.4 '
,. ..
: witortOtot.
; Viniijl raaji i 1 rT 1-JJamtVJf 1 Jfjn j.1IGtfa Jet*has ta
Q -- F 4 .11 | f. ,' n '- r r .-.h. .. I IWsaPbariseis .' ..s- ,', I 1teb'WflT -' ., .S' /1'--;:" ; l.IjeAted .'
%4POIT_ '(U7 -- :7 TE ( .Si Aettu.Cea ftFS.._ rwnar-stson.M1oea..oe! ,t-
-r.\t
preset ; = ':- ; .A'_. n .''" ''' '-' .. :- ,leesI4 .O.seeI I" vM sey-to tsTab. notate..Tb. -'," ( ,U..n..si-iPe' ,;j\ laeteawe''ef'teenpre wb&roecfecermal & ..144 --- '
: :r'c r vaonrsy ZM.rfo sTMla rteoo it ta Kentucky la preparta* ;kt.lilsc54a&MMLIX14.frotii t
._ : 1'riaH ::ialllU'Ok..ut aeyereij ft 1Ittke:4a-tit: liower.Ling.
,
\',-"J ,1. v *'1PI0AfI ae osef rrOrady .; from )i/e-;In.urae.ecinpantes litmus confirm ItS report x>f th'eture p '
;
i ,|jideaine ,th.ttic1petloot; QermayU anil* ''to recover ., Ia.
: eeacleafluspitnturs Ja
: '
xavy 1 departmaint na4"aealtfo > 'Reynold*;.and:Bud!,Braoka, nhe Mionat' policiesj ea '..or'ot BaJibran,ia Ui.I'bftiiLn. .,
( :of.( t tie geWbOuseTight ti5.' otuB.t ... ia the the Cretan quesUea. Itaaytj I i tWer..WM 11 dmtna rahreuhebboT
J80 Jeb :*aw ."lsn44 I 11-8 th. govirnw.tri
:. 'Ufe-of ex-8teJe"i Treaaorer-i Dick .
Jefferuoe.iaI14foPpe&-tbs be.- _> t U aoyeorrect policyte.rich the the ,' .. .. D'tenvaetwtflM of toe-eommn. -
_
:. ..IU.J.PI Ttto-wtodefalt.d;; ; fer.). ..1a .I'-"Ii'I : ,''p 'I1.nbe' -'
t4sti2ba.Ui.acamy.4i -. ereth.y' hid-- nearly ll l: ZabaU.iI 1 tb..i'Spanish .wfigh .1)slaohIeiry.d
t i ; 9100 ia axtoek jpfte 'h'.t.a01r.BI/., I .41p,_. ,' a.\I'nt a"flqliei.I: Ut be a kep' byhW l ) Iute. aenotbsttt :. etp gly to D'b7Kb' Cblf J _
:
on leading
: I p erna ivIW : '; na4', GbriefI daughter.''end "-.iawl.j'"Tt4P'1aut' force*,-"w..UII"e the when'be waa-axednred.yhioTh $t(
are: our jind fU$ allegod
% .
: ) .
.XTh*c-fldldiU* ar.jWj!'la.Wjt.h'i ;lr tarsal al .o> i/wo gold waUhsw.audtwopisM I $L.tba, IJJ 1If1t.tc.tt I
8 ;
tb\4dm1Mto I Use sMtd b al1lfYMteri a oti'\8o''ollqI 11.ng1t&eMtt not been betel front.ia *Jwo'year. at -upwt1io Ipliurgiate', position. .. i e tame wws>sESjaaB
.
tt., or "\, n' *, II"oUo... t : tk mil will be brought 04 tb*.J1'01I114 ; ibpeIshioIi! $ .
afc.SS!'>' 'lXA! '. OH 'or'k !tMri:(MMtt*. : eIoLkehsi41Ril2Y t b'. ; Hi Kbtbae-gncaM that'Iht -j
.
) '- !; fiT ;.JIif/ : 't." J.'z
tbIt,_.1.waInN id.e4. .l : ( ",. rtteor.mpmtw.T ia
.1i'Uria. .iN **cneTitdot$ iu41stch [ 4t it.i ,.", '' tAl.I/ ;" ; ,4' : it.

i \ .,',:J t4 $r ; i- ts l i .\. t. .; iilt ,4W; ..I,: IP&i k' ht jlf. 1.j. U.;;,<, !: v :; YI ." .1It. 1rti si& sfeg
'
j i.fJI \ .. I t-f ,e "
4. ( j \ 'i' .J.i.'l''i i JiI_ : "\ \ "
f :, ,, j fE : t tS
ri ; j
'. t.d'' "; m.-w. t ; !" ,, lfi t1 i / 3
; 11"-.. _. "i I' .: [*' \ ''' \os.J'l''tJf/2f-l-Jf..t\. ., ,'t'1''r: ,.I't .J,'.. Il'i.f.M. '
; iI' tll{ tI.t"' lti'1.f.J1' .', ilf.fJ1 i ;'I1r j1 3t'f/jX iitTiti'f: .. ., : \\ .

\ ,11 t iU. A : ,..:1 j @ ..1Ii'c r \". ',f I 'f.J.T.i.Jlt4 I'ffl"# \ v*

\ )! "1t.'S f <
,. I '
10'
.
4if/ll;
: "
i ---n.-,.. Iir -

'. -
--




,',.,' ,,- ,,;t f.\ik\ ''' '.:j :*" .: \ ."" .". .." .... ." ;..- \ ,. i '." t.

.I".' "P ,. \ ; ;'. \ ; .' IIi.. .\ ., --4-: -
'fj't.J :', .. 1,7 / ; .
t" ", .. .
{ ,
iJIi'qJI'I h S : (& "' -v [,' j ," \ ., JC :1.:, ;r ', ..' 'T' ,' "..: .' \ .. t' 'm.' ,,1t"f"J f" ""i. 4'1, C; ; .\ .
f .. ;1 i .1"'I'i. ':.' ; ,' ':" "
.
/ : .
.: ," ,.' '' : .. I. : ',' '. ,< _" _, ,. 4f
1.J' ,
'r : .
,
I.0 '.
1'1' ;
,". h $ i f't.." \ c
/ J WW t .
: t .
lI."J '. .if : : l' .t. < 1" ."C r ..J.' Ih'". .- 1'0." "
a _'. < : ', I .i .
l \1' ." ....lr111 ." L-r. 'djfr&fl.. Wi '.. ,;'o.\ f. IIIh" I q"1, : .t. "" } .. -" ..'\; ,0.ot. : -, .1','. v '' .. ".' -" I 'f.
'Jj'f. fir IL 1: : 'M" "'C' ,';.I\t'*. :_ I"f.,"?",p ,'r' ",. .' .i' .. -:,' r. : :1:1: ; J
: .
J ,. t ". ,, ..JJ .- =. I. -P11ir I :-- si l.T : : I ".'..iW'Ir. ..Ji1J'i,: 'rc :__.. _',_,.,_ J, "_A .11,..$. .: ."t.'.. I' .I.L.'W" ..> ,. '.-.' __. ., .iT-

\ 9 --'Ii.. LL. .. .. -
; ." J1
If : 7" #
\ "' Lj -i-I
l .. ; .B1J.l1\JJro 0' lJ' UN ( a**;that j old ckIDbpl3nftpsS,'"i' 1wJtEAW: ', I .ir, .,.-- .-- .r.n ,_
'
-111ft
1 :; I' iMt;. WO 'eft 'l'" .lli. t1mIwj. -'-
tieburg-Vbreul&.Tetlagr.pbi : 1 '." "' .. & .. .. .- *
i : ; 111' air 7 1. ill .
fc"
r 4 .. : '... .". L *otn of tb* b.l pietft i ***, 8H "4. j ', lf. -* : .bI''
1. 4. i an animated am....it,sad 'iar U.ra Ii.- ,1' H SH.are. .toIVancor ;ee.a.ln atrnged :
I ... .KTOfl1t&VJtU3l ::\, -KADvsulwit! :\ lA., 'HJItItUB. 'U. .AIIJI.6K FOB .. Viola wate aoloT brlf. '" 'aI ..t'.t1\} I r .'- . -, ..._ ,_ erHlker4Itu..' .,
VABIOVS ALlti WI and arJti uu ". .
.
: UUBCQS. PDKS8Y} WOJlIII", '. / skelstouVe.'Se.Hd* f.
flee .bit.II'a1ll.D' .QII"_ _
Pr.t.tJaa", .. .ah' laM :. a. baa not bn married orar "a k__ Iei._I
plamp
(f .: ,- :;' ial lbam Ir.. nongh'a forCcptinDoa't 1.I Cr *Y.Twood hod (rownj -'
: : :Weeker./.a: ort otneWoranoVam elect_w complexion and eyeTot fa, *nd hi*' friend* ** Ud, .ithaom ..

1.lo.- .4)bst4eI.-WaaI4d ol the dews of people "pd.Irteu ,in Tallor-tWiid: Uewn deep "Ia..t4 hot be picked *'truth that h* wa _tilt nndav his I _' ip1ab twoking"hef bemtesn4thittsabsrbidtally -

., rO..tJa-TIa. w.aai nw SIUalcVrsUSTnpBtkU,; moet oa dlflferent waaential lopiai.'yo1kbOw.r _TlU.feateal Cnat.Aboal_ *r oat for a.:Bwnty,, aa'th. ordinary *ifa'. _." ', ', '. : out a blW 'blig* you,>dl.
; : Haja. yoa any ,-objection tc York sonlety Qa**< apd atandarda ROt/W| her tpreaaiv taos Wh'lUmdmitting' lh.-,*oft. impeach .* o '

'!Jr... 0aUMt, KMTS -. giving( me yonr'opfftion of ..rp". Their Dresses.-4. would attract' .Vteatlon anywherau, Ass. b* wee_.tomeel to plead in iloon*J'L..U Ql-Mtee1'ran4.et.'ftt.' _kL been-bo". >lo1w.-. >-Ch*;oTXera ,<
.
j--: : J s'. ".. Mr. lee\ar-' \V.r' "'Why, .really,' She i. noted for*eV excellent! taate ia extonaation that iUri .."."OT7 ..Ioe1M. I "I low meld introdaoa'Captain.,O.wlr, iMsMtroas'-------- --- 'ftlol.l- -

M' < Miai Pryer. I h '" .. "ZIJtia Praaoar.(who '
._ ,s-//r ,,.i.A.Tg- Ttax:, X.e Doespul.a: 'oa :' fpelalewfork: ,-1. affeetitfia/xinlet oblorn Ifl themnJe1nter xnuat bav-bn 'i''Oonaan-iTiid know Bobl]
f' Leitea '
which to bna-ta opinion upon 'h.tlabj. bar private OoN Wbmti,1ie bad oraoked Ibis Jok tar' lle"Dilltr-Ver) bappy-"bilge
gown *
:. ...oI8"_' .'Xvbn 7ft,. wife J e" .& I'-. %,b olielor, ;" Kioh. HEBE ia nothing- the'world noon ah. vorir handaomo\- recent after. bloa. *S. flfli,th Urn peopl began to .'say bet weiiy won't' do at .1>.'., Two yes him' ha hi ha*(win through"with*H tnrt.p

I. ; : hepitk to yont"' lDo.oil, Viepatola.t : ,,:'T I ot fashion to Indioat bard broaioloti s'.1'lplain; .a<(ir nii-i ho was Uxorioaa.Several aoonaed hin. beck. aint thank'yon.-Bo ton Cour c father left hint. ->3fe'ia]

; < apta' Oetat.-.fia." won't doTnr. J I IrIr \ timra; lAU Jb. great social a. a tailor..<. woman Invariably of genial IDd sums'0'f pdMvt'Blogorig. i ier; **- fUget-Dieslpaton" ". a : .
w I.. -HirtoriTim8iilnSCTWIOO / I aftalra i Oormni-8tcnte4 ; a'rewep.pw..w.'nt
.'- raeu'Ja by Artlflol! i -01 splendidly aijuta in.with"-an.ope.-fr ..-.atty inality '
,. ': ria"" "- !- I .Iroo''..... 'fbo Grand Oparn aoaaon. little ooat 1U'Ia : Ur10kiQf,101A Boston- TranaoTJpt. :
( ; '* Charlea D..aod: Frank T. .: tight do.,the back, It WM 7:80: o'clock._ 'Tbey.had jnatflniaheJ ; '., .
't ; *, Dbioajo; think they bare )15..< it Metropolittn ha* .been a.bril< with, mdtumn.gea4. Jag'' of,,mutton dinner and'be',
4 1 BII.band-'l"4oll".bit l.", yon a method, of (tarqing balD a", io- han nodea frOm all polnti ot.xluw.-' .1..... *"? 1 ' leg *oroe the hearth rag with .1Iel.\ try for building -Mlrktuwoll trt thuS 5*touM>rap Ui wet-
purpo .Tku
1''. L4,: > an..keep,'-.aooount- '.!f-4b.5* money. you- ,. to atoAo and preferring fbem./orerer; Tb.tended principal tbaatrra are batter .a.j :.The feainre- of( the* ooat wa. a alngl ing of luxurious ease/ Tb, oh\errnl L \.J>y_colonlrt in y, Vuginur mann 4>O>oU nrtn>isIa.'jr* '
twelv
J -; rW.l In be basement of their IIIII.bU.h.l theittbeywefe ""monttiiago. ; I used
TheT
"Ob .' ISreU tb* 'Jv'alional : ExbibiVion were \ the; H our Is sure, it's an ehftumt. oV
j' lean. 'n. Oyol mala
,
y the and making it oling eloa'er to glow, to' lil who! *
I ) meet on Oottatfu Qrof a,. d.lb.h'I. : : being;. H* llrew traction 'ofa church 411\06..1.1118. drOginuu es bf m&fl f.sie."*'*0111"1
I at the Grand, Central '
*, cannot. ktopBrooklyo. la Palac tb* waist with a effeot On forth bl .haoi 'F.bbupn1s, siveansa IM ..
the body eta young woman who very pretty /mm lro ,. -. oroiftla. If governor
drawpntlrx there ia
I. < died Joly,18th lam!.. This looit big .er. five gra.T frogs of a darke T>e ir1iiff habit,, .,Bmajl pill box wbicj : '
,: I boJy, 1 any I.ok"of 1:1I0.11. 1 it i. not of the aUte.:: A part Of the JameitowntburcU Umnlu. tlr r. kias.y 'M
: i ,;,. -, "., VOBUaiKO wa. treated b"'heta..J.ta1 tnrued'toloaf notioeabl* abade: flhe wore 4 soft 1lomia. Iron bo h.ld l ,medirktiveEf rbatween hi,' i i. till bowola.' evr alukoB,west.or srspua i Me, ,,
among those .poG'.bom' ;such. funo- ( atanding, and the
II ?. .: KIM. or to a ttbutanoa ranembling it, tines depend for their eapport.i' o cream chiffon withlripi of.o..in thumb and finder. / ,, /" > __ brink are in a good state of preaerva: pi'ra' tr.ae5 pormnm..nhiyam-s&- 'Its $
lace-
; ri'J_ m sorry t that, Mia Bantam in and .pp... to be idip!riahable., :In < -Inaertion let "in. A very.etil >"Edwlrr't'.xolalmet' the' wife, repruxwrifiilly &tion, ahowingtbat the oolonlaU ; Dlaafwrant d 7'i *. Mtus''. ffius1'' *
Nothing ahpwa this ao trlkingly a* double b bUVd *-' Wear Banoaaa. PiW**
t: oatledr'You'won't. '. "forgst_to_mention.. that an upper room of the tabiabment| i ianother Lu I'i(be" toilet' qt'lb woman, whereveryo4i the emotes"by of oblffon diamond, held beak(iivplaoaln ; "do your. : body of a woman who -
; '::Yo. io<1aa., a r. Oi'l, ran rolght Angnat' 3d, wliiob appears ale to bar I IrS, alonor aett them JPifth'-at the opra- thea' .worn at. lbs throat.' White glove. ."I-na-r-I: don't,", h*cti.sners&,,_ JtoaUn by ds to.1 all I kind;.of weather._ -iMtlilnaaiKtaaa? Wlpalmr'a ibm Bootbu cuina*,Brrup N4I13M OTf lonamrtw.r>*f'' '
arenae..JBroadway..or' '
'au'-UU bar now beautaepetri.ua! heavily atitobfed, and'. a hire pi tnr. :'Tha 1-2 : turn,alUra Ua. wind .'
Chattanooga curse
: -.t Tw< ,th nty street tr itt : .
lbs more bat the .. LMJ
I ** The bro "u have been ozperlmeat completed en oatat that mad with of '
.n3'or. .that ,wretched allopathic "
,,
cx lnaive gatlTeringa In
& art oirolen.Hpea .
.
I; lug Tot year..hnt the diioovcry. of a 'ino of the latter" remind many aii eye follow.hr with envy.1tlrs.O.usjY1lsou I raediojn*' .w (( @. ( "
; '
.
1! wwxw pr>i>rrouBcxC ptooeu of patrilnpUou was in soaps reip ef ih* Am erica a-MTatr Color m ,. .;_*". -"Tbi la not allopatnidxaodicin7my I :. ,

41weu; Sorbb.b.rgjiJpeJ(' ata an aeoidf.( Tea months agoC7b1zr'ttrtTbulL. at the SOlllelr.exblbiUou body know, was Mime Caroline Aster, 'dear,': he retorUoV'."it' 1* .Jiomeopa-- ) '" ..' .: t' I.. .
AoadeyoJpsiq
$ jaiajjjer sfl." : .. "It la tb! UaJlogavantot the: kind hors, 1i.flietinLQItkL3Q.gItbi.u1IAtliI..thL: thinni, I( it I.iMel4ik4 tot yea,_-: H: 'f .. j. .
? "'tb.' bu : >rep'aratiuuiMiiiilar In tb J'onr hundred, and delights to, chap PilFeibthesTho '.
be-donr' : ; pun" "Por me' "
"Quit writing/poetry/' i low believe 'pe'trifylnu propertie Tnring/tb f*ar, and thi. spring attract crone young girl to matin**. I *aw ) .. ( ;,
an opell.,1 a a moo atteatloa than nanal be.saW' "Tea, for yon. In view of the pre "
i'i bar the
Jaloa shop neit"ta 'a..loot-boa.. *."-. Wben the.boly' of the young -we.mctwh1oh pebble Interest baa bean atirrad Ingly pretty centre of a croup miaae of laat bewftob.week. .nt .tt of vnhlio .opinion I have determined : 'Th good pill- _a good ooaKi' :.Th*pffl eotit. ,' .4
record. now rests in the BordatonOtlji yo'ioflr a
,
:-_.d _. ,,..." .lnd by them tby d.- up IBuTlMtlona by:' fceot aaln. of eoatly private Among the girl of .her pa.-t7"'u. millinery in ibot yon aball take TOur .ervea two'pupoae.rlt' protecta"'the 'IJr .1Ito .: ,t-
like
( that of Meranall bomeopathio'tloie I .
term ned O. fcaantifat* mlai of sixteen retain all ita '
r Dr..iIlCnau.*. i to malic final teat. AII-of Roberta 1114 perbap mm "Look" be oiling-U to r.media1a1us.ui4i' .
millionaire and 'added a* ah* gankonher 'S"
philantbropUk
; ( { Spring Poet:" should Ilk* to writ. the blood was withdrawn'.nd the petrifying .. mere Her whO attracted gknaral attention. kneaaJn awtonUbment.j&nd I ) dingulnos' ,the taste for tl\-.palate. Soroo ,p ,
1 faIrhalbuang..Jeae.ly her ,
fluid l over '
your paper Ton want tb. maun- injected. bora was up. The prirato view tb.' o ber' day care is. profusion, and bar Irook .uerof admiration escaped her : coats aro ,too heAvy:' .th7'WiU not'diaaolve. la. : ,_
rae d."ompo.ltlon'two weeke fIr was ,
'. ." blank on bo. 1de,' do.', brought togatbcr aotn of the noted. noticftbl forit It a*, b* palled from tU*. pill box th. (( the tona? "*"" II 1 I h 4rady had been treated with lbs j&ah".ir was 01 latest abl. in Plotke//Invisible theater -'" ':4'J

Managing EJlkor"'*OnbVtU (Mas, reparation.. In, *aotberweek toe hat ..- hloh bad only db t him J25.Chioago .-. ( 'throttgh. 'tha ay t m TBJJ. :IjarinleBi-,aa',.a:broad: :

rrr I, you pla>*."-.TitSits.THK leah had b* .
I. ,
remained of tbe marble' whit ,
same "
-- \
,7g gpento g-
: : leai. that bad com with death, and 'r't ,. "-- -. .' (I@ pood// deterioration of tt _jplU.-vAftT SO years < .
: OBSTiOI.1. ia t ttbe.4Ol0l' ffwsti'.m.r.e :
ArlnnT- lnr tbat time bneremalae4alinom -. .) exposure,.A7era:Sugar Coated 'I1Iaiayobenx, )
f'TwonldJinarry that
gIrL __XL
haa.be.u1eboaat'p1bg.pls.
.. '411. ..ID,... .. Jt.r---kathG-1-- --- --. of Labaloa that in. ''.- -fathd an-effeott''eftvif Junt frech -- '
has "
bC< l.r.. r. 'days goD. bX as r( '
) : CbeaUr" -"AfraiJ to pop the ques Th woond body i* that of a worotn ''od' many as 200 aail hav* bcen...**a in < .tOr'. If G goodpU1-tth4god4eQt..Ak. ii. _.' of '

.Ixty-aix year old, and thowa similar the l>ay there at bn.tim.. This wai ,("\ 7O: I' druggit for ""- /

Arthur-"No. Afraid to qalHtioll resets! tinier Ibo aam'treatment It when whaler mad. this their headquarter = a .j-3 '. ., ( ,
"

> 1 pop., -Brooklyn Life. ; I.for believed ages when that treated the bodies by the new will pro last 1c'f tor. *, and, Lahalna V was the. cap!- o) Ayer Cathartic PiIIS< '. : : -

,
Tfl5 ..'i way at'.-3an Jraooisoo Cxamioer.Ue .. Honolulu resident remember when .. .

p Th rtj.an Man-"I don't a 4 that tbeooatraotor turned # 'f..I. .A pC.--U,'._ -- .' -- ''_
off ina
and remember .
gool bey too
,"a" In Cauatei.; ; 'during ( ) .
.
man like myeelf ant< kept a fat. : the pt\ ';w year; when the harbor ,, .f, "
"In '
I the mana'aatiir of candy .f
])|(".odjIik yon' baa been -
: : practically without saiL
a (
ild ailipldmatio officer OOOOOOO! ( ) --'
f : The Fat II.a-"Ub. he ban to experience, .o ::
411'( "' .'ia* no donbt bat that Americanow DurtttJ the paat. year the chipping '__ "
'of him apare men flr.t "J' kuow." ; in Ifjonolula ha '
incrcaaed to"a
\
',' leada the 'OJJ.J. Am rio.n caa- wonderful sSSps..s SRSflaU5U5RSsSCCe.SSS .$. ,, .
of P: degrNl..nd| to the.eld-tll .l..p.
dies are abVut"tlio onty one nivla of ,

It 4 WA4TUI W&. ugartbaf can b* bunht in r, ri*. along the waterfront it i. an indication 1'ANDY 'CATflARTiCCURECOH5TIPAT10H /
Wayworn W.boa-"I of a revrval of .the dayie wbn ;
.' wiaht I bed Thontb tLi French hove long led the ? '.

I t the money I've spout tooliau." world 'in this line, they bv. gradually HonolulU wa considered a boon to ,

;: .!l, 1. J Perry Pal.tWo-.ue. too. Many but surely manageM, to io away with .. shipping mKatar DuVing the pal.

1 ;' the good otil niokel 1'ro blowej for anger in their e>ndiva except where ili 7 )L 1I i1 /I t u week Shore have been three eteameriHying .

I t 1, .t' before I had mattered the free they make them for. couaumption in a / ,'i41: the Jananeae flag in port at one t'\

4 !,; ayateak."Oinoinaati Enquirer. other countries, and in America in 'I I timed a oiroumataDce th.\ lia. never

l i\ .' I_.particular. The Frouoh people will I f/p'/ occurred before in the hiatory of Hon-

'I V .YMPATuEiOMre. I not buy aeoirfection' whlou ia made of 14.47 /' olifla.\ In conuectiou with this it may

Mrs alonr. They want tiomUinatloon / lie noted. that within two lays seven -
sugar
.
Brown (in awed .
f ._ h hi I I hear a burglar an ) and depend. mpr.. upon. starches. than ;1fr7 1'' foreign ntoamcra arrived in port. No

'I .1J1f, I believe he is going to.hlep.I'j j sugar.-_ ? A better vvidenc of the oomrattreiaT Importance ;
r-x-"J "I think I am sale' -in kayin'g1 that /1 of Honolulu ia needed than
: I oooked, to-day; 1 ABSO LT GUIRLITEED es ib.ISmi
K,a, lugar-made randy ia rarely, if ever, thin. 4.. a,,,, flpshal(sass esy twei rn.m
Brown ('nleepiiy) "Poor fellow plo Sal b..l..Pm,.
I se. .
STPSWe canter ..
I.f ( ;' \ roay have a (anally,.too,"-Up to- sold in "aria. Of oonra*. it would be There are in port at tb,. mae thirty S... 5&4 5 5 55 _S_5 _S_C S_S S cc.C C insre.S C S_s.tesi_S5-0. *._sStm_ tn.5_*SC. an.- '

.;. .. mad if i ii wa desired but the peopl vessels discharging or waiting cargo,

a c- -, of Paris prefer eontethiat 'J... Two 'I the majority being veaatJ plying between

;. weeks before Christmas I was In Paria.and the Pacific coast and Honolulu
"
: : hat to sent to at leait a half most of tbom beingveaeel* which baL

; 1'1'\-1! oin remember before 1 dozen no.oallad- famous candy raaonfaotnrer 1 been running inthistrad. at interval,

:I .:::' married that bl.I wu" (its..1 of ."er- before 1 could buy any when the business warranted$ it, for
-utterly .
: candica. I could bun
'' angar-mftde get 'a. years pa.aL-lIonohtla Advertiuer.SIX .
I .-"Thing! are differ. .nt nowT"
dreda of t combInations, marsbuIlowu.
; should say eo; Bow It'. e. real THE STANDARD PAINT FQR STRUCTUftAI PURPOSES
,
chooolata and in that 'In
nrto 1oto.t2meoldb.UreQk.! things line. TAU.on.'UIE. OOWH OF BAQS _..aLATE BLUKBROAflCLOTHW1TaA.._ _YaIDta'WITHOUT S remI,'Soggsstieas -t--p-- W '
t.,. ". Lif. Oermrny It-' ,'.*'UtD.r-- .- -I.ANIJ-F'WfrBEEDKD! N4.TT LllTLB OOAT TRIMMED Aibes.s'-t..a'ft.iladl. rail.ui.s. Pmhl.z, tidier Csals Plre.P1..f P.la* JCa', ,
t't Washington Star. MIXTURE. Win FIVOaL1 FROGS. A STRvtMOB KXPKRIBVCB KKIwtTCUBT ab.ases R.-4)s.Eaotbeg seE kS.eu-keS Jsa.tuU. )J.VIs.S.. t.)
'.
I t;,'. :' -- MB, alOUBI OArriN.ha _u. w. ZOUNS LA-NUE'ICTURING CO., ,

A raiHT Btorn Fiona of Polxonul Animal people; in town. In a throng of rlehly. tb, new oparae cloth in large oheoka 87 Maiden Lane, ManwYork. '. "
i. OHIOAGO 5 WI ,.
545 ,
.. .' Actor ((8&\&gel-1 wonder 4 us. PBiLApLPflA I kuii 51O11u 4th St. ROa'TOr IY*iS P.yas
a ) dressed women of note, 1-'. Mrn. DOw ao popular stylish mixture of Waa'ta Tarts (OT Tealia-Ktm .J.

I : people in this ration will ever, The toxloity, of the flesh of poiaonad Ogden Mills who aspires -Co *neoedMr bin, red and green, checked off with' dial. Pales ... H.. JJI. a BurdM si is. us p jflfl 00 Reward Gold !t "Os''eO
'
of
alilize,1. animaUmay eaiily prove a source *. Willlanl Actor till leader of the a smothered white line. The kirl _All >.( over wad H.:pl.a*. I .,
*
Actor (dol.rl1l1OII) don't .danger and at a.r.o nt mooting of IbiMeZIi.cat Four Hundred, and I I. herself an en lelUo th boot and the '. the.W.es : ',' W. Pr 11-- n. .
'op. coat *a* .I'rc.MI. ooU.f'ft" ..tk.void BBADTirtrC aIM _' r. ,
of Berlin Ijawin I an .4"
.' O'l .. .Perhaps, in time, they maT Society r- thutmatio., patroness of the braab. abort and open-fronted. Tb rcvuripooketa Threa miles aoaibaaat of Ito loysly little : .Sfl..t _... _ke toUt.wn.-5._ems .
iDe bninaue to hard- counted aom intereatlng expifrlmenti Mm. Emma turl od If.you do yoa will r o l' 15' -
enough use Calve was there. Th celebrated and of th ai ..
bottom _
'made to determine* the jacket, elty-ot MoMInnvilla TODDI' .- aesilag at I eel Mm m fortor roar Umtmm ibm M lbs .
,' tusieity of snob .
egga. -Puok. ) which vord BEAUTIFUL. U> val*KniiliiB ward Tb
opera singer wa resplendentin was ronnded at the oorD.r. bad .tbe..Joqt..ol-tbo( beautiful and "
grand Ben .
flaih. oo4 1.l.Uog 'I0.toprlMra -
.r.. Having1 given twenty oenti two tones of red ..' only I a French two row.''of" atttnbing. And ia bar Lomond" mountain-.rmnnv prettjr'and. t'r -. lt".t Comps.dos. viii piy SiSsi '
gramme of atryohniu* to a. fowl hegave .'..I. u. owloc ibis to.o-SC$5.k.ngsml U.of
; .- ,1, OLD'TO. LOU HaL Its flab to a dog to eat. Aftl( wdanan and" a Calve could combine mall, with this abe wore; a pisl4 bin Iio"roraabItqra.loeata4\ on fertile laa'ds ''' 0.5 "0" n.nn.let .Is 'b.OK"U... '
.
them. f ilk ..iat. with whit linen -rib vi, UseoS..ubssaoa4 loogmU Cm05 toibshtre. .
3h- to be .married next the collar and, haj" by grand and majostlJoraM .. "
-
firit' 2J3. gramm the animal, f IM.SS Mb lor las aems a' sod 55s.oh
'
Another grand-looking dam was I and .-n lno Windaor bow. _. ..
Nothing _
th
and she will) lire abroad .. for San'Imm Loo .u J be pe.dS -
oam.m; after a second portion it was Mr Oeorge Gould of the mnltU conld Ja.. .r.(IvM f r**.and wtlalr for tbs pnriio. of.t -"!. will.be, hard foe her I II aeised with tetanio ooovulaiona and wife$ boblead sweeter or moregirliah Ia Ibl* lUalHy lira. Morris Gama.flies. b,. ...u..,.. $4 our b.ntl' q.. .01. iomsh.s, '

: I" 'I I to 1 loee b..." died. 'The xprimnter found that' millionaire. She' i* a trifle nets The hat waa1 roagbt bin straw, With hermes ln eomfort cad eoatonttaont. 18. UOV.tHOI,1)_.so.ly ua..o-.4.d.4)oPAW5 A\t.J'. mo .

i :,t'l.:_..:','. -"Oh I don't, know,.Tb.,'". seine animal are tolerant of oar mnstronlybut none tb, l has charming of the aallor .tterD,-with larg roe- DnderBtiudlnit that Urn Game bad 1_"- MU.-i IorytsbI_u. S.luriooul'CycU"tJOok i1.CI -
.
JIT..'' ""> I n trying bard to lose bet for, the tain very' fowl "haD.b, 'flU\ ten y t are:ago a* the sites of green incline at each aide, oat I .. ,beuafltmi lq the. 01 Dr Williams"Pink 5d IIbold litalL! p..blL.bsO ui,Cud moohi7.uirt br lbs lto test 'I4.. '
poiaon'for example tc.tr70haln. $
.
,.. "1L. J&litn. of blae rills, a nnoitwrof-the-MeMtnavUle rbok :
? I ten year."-Paok. K.ngdon..of'DaI, *- company whlob' 'winiia stack defiantly/91 it the ioe.-n.'ked
goat to" hemlock, par" 'Mr*. Gould wa exquisitely gowned i in Bba work the Km .Kraaoairht '. With |'h.l : .- -la..ndm in'w *1..'o..nt.et I. ., '.
one of nw gxan.iaatbrbelt __ .1 ,
-- :
.. ridg** to arnie rabbit to nicotine. purpose fit vieW a vlwt was made M the 5berC tot TOO to U.Sdh y.tf JI..r r i
.
.
.cr"T.1In. rGuMiztx JBt suupcTtir IB *?
a 4oilt-of-pearl Mtla
reception pa7.- e- ? .
homttof
It. the Mn. Oaffln amrab wa fonad lobeO5C .'. ,it
Piiarmaceutioal]
onsiuers mtitw
*ay* ', whlrh will TOT to m h l'-' subMrlMlcNSM
velour, the .ntir* bodiee eoveied with .Violate than of tboa little ,.
.' '. are more ever In'Yope. ptwuaut womoa wbaa OB* THE HOUSxMOLOOOWPAsiU.iei4Ut' .i -
:. I Jr" Old Friend-"Oreat enakea. Journal fht< although animal mA j slim sequins. and wore a small bonnet Entire bat brim are.made ot than. "eotawlik, BOW aiadtb.s.-Ia tnaeoBMuttlrrvaarrlnK to tb. h 'r.rI>.to >"ryo .xmllnjl ..,:%..titUMW .
.I Do I Had bay. inoon- U wonts bsB* omatTS)
I yon rednoed to play ingaated poisons without ehauim Ula Bb*
cavelberwpoitrr
'W.LDOUCLAS''S.SHOE _
of aoqnin with' tbre gray tipa.Ovr Jeweled belt of SOOS.I LIStS_ould'wet mom .
_. I a cornet on the .itreet corner,>&i "..I.nGe to .themselves, it may raailj her ba carried little to be every'description' are a_"If,1 wdooaMy and upon Summing I _. sad rru.. ibsa AprIl i 51:so tb LF"jlLl;
arm a flufl/ worn this. apriagt: Oouaaelo. IbTauMS ,
the Ub.Ot call _
elite >ctt abe of "" oplQMMKai.-rb.mlt
nnexp brlsbl- .,
;
'
I Ii living- follow tbat their flaab will toxic
.l$ a" : prove (bouldercap*-a combination 'Yanderbilt, Dnehea of,Marlborough, I ly rnapondeiti "Well, I know olao' reuoajrhy U : -: muted I. th. *rsTi= ., 1 UK MtU. .Ii ,:
I I. :. I $,"I ain't doing thif to make to- tnatt if. n* l. afooi-. aoinUttAmerican. / wMraioM. robe 7. so ". '
--
: ''n U.should flbjsot to.Interview I Ii
-" blaok, 'arq notta b ,Tlvet> and act this fashion last season in London.. II the .= rUtI, ..i.sayemleumrn.an4lme.ej.em..e'psclies.erS4..i.-- '
:
I +Bg. My wife won't 'lt,me ptM-- ; Incn. '. ,. -""-_ herewith. :nport I*Dot exaKvnued.r am fxtrooimllr ImlorpMl ea lbs. .., .. lies -
ilatratd(
. j .lml.-txa.1' to I>r7willlanaIl> IMM .r:1IIr. \ :
in the honae. -Tjt-BiU. Pill, aid If In ;'I sane .4 ul.wkum., ?.w Y.rk t5l. \ lf5t"'f
I !: ifwjjrrrtooirrurpxav Olo beblpJ jJr Gould_od (in _. ... .
** r* sands by The National' Cloak sgy leatlneay ran b*the maaa o( nrn a> < -"---,
: I -. ThJa.*a M faraatr. strong contrast to 'bet-cam* Mia Company, ot few York.* auDIO oe elK who .anlTer *. I effard balpiaf I -sal It I M*t.M.o.7|.in limbs ill lbs, WANT.TO MAKE :- -1 : ,.

|/ |' ;: f ., Japan,. I Ie"one vast r Rar".;, and a, .Mary Mannerlng the young and bean surely eaifht imt te withhold U. a 4.ttktf.a t..:.:IINI** lets ,

I ".'JFlorenoe to iag*ged to Xlt,-.yon..look ovr,tb. field. you can imgiOf ural new leading woman of th. Lyoenm Praaken 1'oiltfy. ', .old-"A wbleb ear.resulted o 1 Int OJtobor IB rnenntaiiam I vaairbt ia a tcvsr left* 1._.,.*. _,r.la_w.Gw..l.| oSIP&..!to,"ofon ,. ,. ANEASY".LIVIN'GJ',r .fl

? I It'e aalU, iatereetiog.-- that 'h.. .a roverd with toy T,e.Lr.1II'bo i* making very riG Scotch are d4 =caufttoff me a RXMU deal of.MfferiBjf.-my 0.05155. i r 'a.- bcness-A.y mas) OT W BIMI Wbo:.11. two -.t I"./'

) know }It atare<)' b h.CJ.nlllll1. farm whjr-fa cbUdr....re plajrlng pus impreionJiera.iQ.tbrJhetrloal. JMUIH.ctab newspapers new -plaa&MB 55g b
him that b. oonld.ataff. and with tb. law ot t nature, ana. ,.i.tal world. HOT dree tons a* simple a* tBtnedTerjrrmiir-rellef flnttl" .aallarf'toIl01ll'Intr. -' ". atiin.L.rltewlt5u et.. p1uo a..4 .rum..r c :,;0.
: plsy. pnoltry.( ; It fppear* that on* John i I did otanftW tbtosevmwpnla '. .a_>. It will ooss-DGI.h1DIJ'try it, To auea.peril. ..-.,., ".
.
.. I hi* aooompammenU for nim. amplaf of different' kind of' "..getablassiad Mrs 0011'' Waa alabprata' and *vnmor Xaroer. of Ijaggan oompl,.lnd. to thmagUtrata say more Seth Mareb, I* _plO a femble o -as sea civs SMI"_rs.r..ae.sm os-.34i .
.. -,-. '"f .. .-now wlabe net. graio .Everything -oa-i *striking on aeaonnt"otl, it* slmplieity. that lbS retua ', (mla street mnHbt In the small 0,the BaaL.I "ott n tbMr __--dW.na.wt. w.
.
front
; bim*ll tbroujhi Uieee dimiaativ aaalo, and -the w.rk i* ai 8h. carried the air ol early a dl. and ta a few seconds bad bntaobed dews my : .md. .1 mar modloinoS bS flumra.t aKprase"_:'fS
.f : ,, omo.-.eeartes' ModlutBtId 4o '*'
_ a..ojIpafl7 tlllery was allowed to flo. into propaM typa.i be %
an I ll l t
: cm Y .' /. -, a..and aoourate that applied toe spring la an xtrmajy dappet tailormad.gowa joining:atramTh; .-taot that.the ad-j -CKtendlnKevca-tomrtoea.. to a>aJM i-1nrethhouse.. Jhadttoesltmysoa M, 'b'. .:..-. .. 't,. :i-'Z. ",. itnc.
$ .r'.r
; : 'i ; ***-* /. BIIJIftJIII1ftL CloUonn?aae. What would an Illinois] of a-aga green and fawn Had frota .., Wth''. 1, 1 ncdunooaAlM "
\ } I ,treanvoontalned something;more than) thai tim* the p _ n4'r; indeed Mra. m..b. or an low* ..farmer thltfk of'plantjnf seeded mixtnf with pcrfaotly plain ; water oat iMavable.. : fa*..5. wa fc bad ao vestal ; to make MM.bCT.IHMtral oB.T" 1. add"- ,
; it.wa4 "fat aermon. "' Toa would his corn, .b...oeta and barley fa.aQ1t..ocl akirt, flarinjr-jireltlly at the sides aad .mere wee aooo foond by tb. Mo-.p. r>ortn ihstlma.1iassd all tb ld'remnillM crops and-Kberalfertiliz : C.sass. $0 the. v.rvlb.ret "= '
oomplaID.n'--daOu.&IId. .. rr a* n niw a nMtaUtai
.,. tbee.WbeniIJi threAJftifaarjsobea baekTh and many aw eaaa, cotton The '
a ... ect I'. ", ."*' lMu'6-4I lung maan* or other hi* h.aa got-on to the 'to Onleagw for m "-"What waa tbs-terr bigb.Iranaplanting everj Eton, *part front*wittr-doubl%l. revere I "good thfng ... wd bdtb'thlne';: 114 m.nay atood. .I was all beat owe aid applcatiQn, :'of .a', 'proper...fertiizer. B=and wbo-ean Onlr*1v snob, tbo iM>'rU rofttiulM a .asttanetorr, '! Ir*
: .,_"It 'wa 'tba& pear of I it in Towe a* tar-apart acyoacan l'8aoblag--'b"( thesr.alba'1cp4nintroing' : to inch extent that drawa up .ltll eonld enamelyg *bo"aT '.".r>D.'.a need writs 5 u THK .Z'gMUVIAi1, '>.' .
passage I along an they were all, aad onl how I did mffertn.u.( -!\. .... ;containing'sufficienl Jot MKU1CUM1I OOMLPAJfy,.. .
; ; : .telbi ot.-that we should( not be sketch your "fingrafrr .JapaoaM downt..the walat th*j in perpetual Id.'. 'ot.:JD'ododloa. ''' J : *' *;aIi''a.
: farmer w**{.late'what fllaa just _. __ _____ __. riaaliy. eia dabI b4 ash often makes- the' ;
about, what w..bav. .to eat. M m n n xoept on San'day; when the dutillery started to !Iowa to Jar Dr. difference
drink." Connection 'farmer, weedl-. onioi WHIbtma' Pluk PIIU|that I bad arlecl profitable and ENGINESafTsa..a5 I i
failed' to tarn ont*inabrlatfngreiate.. every. btetween. :a crop. ffii RS
bed and
eaUivating bit- and hlait :
; I "; __.' .-. i' barley, with a* much ,e..re.potato** a Long TJiey, however, *madA p tot lost _MnanUondaya I \I, Jtiongst 1l1oau41..lIo11'00II.ice box aad lat OSM bama. to; 1(4iIdU: ?e fertilizers; conrtainribt -' :. .
ony Oft YOIC3 jtrwusv t'mDL and a,lad had to be *n-" B,*(IhMia. aesonllaff to dlrafltloaa. and I be. _. eel 5beS .. 4
Ialand
i : Then.'? laid Mr. Watift 'deeoriblng > farmer >bow- 'upon bii gaged eapecially to I look after tbo na to Improve b;lbs Urn I had taken tb-* I i less. :,. t9'.", ;... Dozes,n.. _". :"" ,.,tiesilni, i-A'. F.J
.
? tihnroh asparagus of mushrooms* or his'flow. ,- Hock., III''f roof of. his 'tatmtft .Irlb' or, Glib pHV) >, andiLvbu ,J.,'bid I :. \ .t '. ,"..evum y..,,'.. li.4 b.gs.1 '
enlertalanutDt to hi. wife, Borton JTournal. iBlsaad the box I 1
ra rallemdV
} waawatlrMlf U> "
BAaUURO&:
I II. had been too ill to g*. f-he Jone* _" f fTIt"4Uraeie garner prod le llI. oourIbeawblcbwta1n l aoald watt cheat a* enwt aa a..,. :11 :;:"ctdal" P t sh.' .. .*-;, Airp scprtr'WOILK&i' iA'; ".,
;r <
-t cou..urr.j
got.*and a.oI.-**- *.' 4 incipient *tg ofdelirium eat Sos aaotbaf boXi TbM was In Joae of : ,
sang) .
(5 : ) .A color naked Mtt.' ;" Eow y :' :..1'.1: -.,. ,- 1 r.at.-t1I4 the Jimaindar-* *aia Kvery,Mt ymr moraine, wd t av wbnt*.I*awake.had I am a"I.! < :''K ') i.ia.rc p ct!..p ,..,. APOU.g.TA. .OgOlUalA,.:.,-j- '>'. f,.JMfflit':'.

et-l .
too pevaona aioc .'.oorL'- O 0'' th* soost remarkabts"(- wailaventipn to bays b *noo'" tipeyfor ptnt4- .aad tklak B wgoedkl I Ie to .il*In saah : n..' r..TBd1'" ::. '"-'
'
-p \
'' oly bad half a voloe.apieoe.( *,,"attributed .'to lh.11n. -- 1u llo1..4.M.i ::' ..l"I '. -tori.I thank Dr.William'nfak Plll 'fat the against Rust. _. .. (4L ;

&" i Joan:_,; ." ten Mef a PNaeb..D'.l'anl, aiflontrUi -.4'i .. : '' _.TbtiWi- .- -wUcTut; rwM thy WooHhl ma._' -11 siam ..Nm1u'c.be.WI iipaism RIca'8ooseGrOeLWm.nt.; .&
: 7.' 't .c_ .r "ntiraolo ..", ia &xspeaiiag-r16.; I -, :I H, CavM dive. t"Dtt yea over bar*the tootBaahe" she I um'the hum k> ibt v..r .._, $5 always sold nader a *coamiueese et>.. ).
; : s' I t1"'I1a uk-'d.-, W..I'r.tr, yes /-..con will how .M I. s IinIa beat fclckwufl pmbii.S, .\041,,; "lKl.11tI,
:3rill
')(iAflsa or,imnrranv, whloh.employ no gunpowder. Ll4.i< .> '' ;; ,. -a friend who laVoonaeotedwith sogeikiag shoal IB. pals I had*1 1t wa* k .W aw fsm H Amsdse whp ,-,1,1f : .a.r.It.:1'wsre-.t.4.. J 6'.J. ,,
what doee.hereditary Ad *lr;'btained ander pressure a* a ::4. ; i on*of the'larg.t shoe '' stores ol ad bio*mow ot leas than a tomnach ia tim '*- i CEIUIAJ. KALT ORfur eFt. oaj* eoblknw. -"PoPt :
r 1tJP-t1"t .'' ,, ''A" ". dl.sm .lime 1'.t., them"rliaewar.madr.Xo cure J T I
."v,'1. ': -S'-. ;"* .'m-\t., tawperatar hundred* ot_ degree -be .i tha pity. i A.day or.. twogo'. h*waa ". aa jmniolaitas :'. ,' no gist. ouimJ It'E

:p"'Di- :me nevt Bobby, I low **rov.:and. thus:,rtpreaentingf an ;,called to attend to the waal of a enatomer QS'laaeail IM-' Williams'doves,Pink all' the- Pille eleiaeata oata,_!*, '..a'ry 4- .; cI3IC JSrm'. 'r C'lIKUlT.r'rU.G.. ..1r55.0.0.: $ fl.LAI5' ; ,

: .. she!;,_ 'ro'P.&n..' "to'I .a r..o".sp.nai"e: vpower-;!: i 11 lbs ,,and hi. flrat qnaation brought to KIT amr tlfeen*;Honneaa IB*Wood' saul; flU8INEaqCOLLECE : ;. I'
rNo.. 11 ( projecting-forest Thl.,SIfts 'U daoribed *-' I cadt lbs' fact .that*.the,*an'wanted a. mton,.h.(tared ."_' They are a... '. .'.-" --" -AHOIT T*.. KOHOIA.' ,p
700 ,ss-g .n 1 .
I- **<.blng .mfeateflteetwr1( In I pair of:ahoea.. Of coorM'my friend MlllDtf*'WI''IN> for snot dhwaan as looomo *Animal DWBBM. No SemI book*., .,tta *. 'a.eton'"k".i.4.
0' 8Omothi tba, ill .lasted!. ( top cleric, partial ,aralyala' ,Mr TOua!IIeat. oa..p--! timtmtafmm.:''- **' '. ,!", 4
< .
; toa. .
next' .
oriIar II .
weight, rifle. Tb w
ioqaired/th .aise and .
n.
;.:. :- ;: : t ::/t J. .1:, [ i1l tbertby .... ,."'. *. rketomiUlam.a rTouii ," 1I"&
lJiuJ"? 1 cot 1men tr m t 'te] cartridge; ain,1nob.' lonji and : I bang th* t.le.-.Th.eeslomer looked *e.tdiiobii.tBaai| crffiieicf la urippn. H''P<- mlf vr.l1\l. blp.f..eODS.Bcrrle! &c C ,."..II.oI.. a4aster.t'44 i'I11.
.
"Brpoklyn tlfe, ': as-thick a*;on** _.".b,"'contain ,"" Jimionnded lot a-mlaoto; but b* wa 'atloa ol the b<. :.JMI|*and sallow.omplz. TWI1E A.44ulp'Sabf.d.' u Opvme .o44dlerip.t4.44.lIn4._,
\: 3.- : :
IOu ,nil fwrma wi'aksae Hb IZE :
three Inmate at. '
hundred eymuuSal a.e4.bp' ;
ballet arJ
*, -wbieh not to be fid "'
aye by jraeb. a simple "- ,
** .
..
qn .. .
; .
'r Urns.7..a.
BO SBDM ,
CMIVV Fruit Pllla'are ilJ
sold all d :1'I'
1''J".r .1., ". disehwgad \*.quickly or *. slowijUMdsird. tioa ... .., b* blattid cot:J.:;>,:::, wilt' be_I' pot* |pet OB reenliit by' of prloji", e. II. CI.. 11_.__,._A Ala.: urlc'cmltoto. ,',.. 'JW, 1

<<.."Halloo Biaril1* Thr i II ao amok-andifoOaab ;; : F.il.4: : 4 I''..,HW.'aJ. I don't know *|c aetly.; but ....i,* tio"or.l. !*>_ fee ."IOlbe, are.lunor MflDDUII'Ir *tm BMl Wktskyiesbll.I 01..ses'J'.A.&* .. fI' t:
; old only a sharp and low-report1.JU I wear a lUte,'. and a halt_U..":W.'* aolit U balk' or l.y tb* 10.Wd) l t.Htr II IIU.U.4 at M.es ?Iw.r fatla. ," J :. M.i '
,
I V -"Efamm* maicyoti. bav t soon a* on* oartrldg* imptyan.: : L 1 t \' I. H* did his beat,.bat ,my friend waanotanfflolenUy 't'.,Will..,,''MioLae. owpa.y' .-5el.e1547 .,. 11I--_ oiN o.0m. ..y.a )V.ll.-; ;::. ..v.11..or.f't. ': ,

advantage of .. -' :";. ,7.., 4- .tbsr. .sa, b.aarpw ...T i..aaU,. gJ posted:' in,the relative ,* .1., If. r.. i.lt.a---. "' ,\I
; 1 1aa"W. ,j.t :- 'i
p s J tbn ? -
_______ s. Z ,. ver5 oi nnndrad boU. oitinfy., bat'tiro proportion* of onneokianii *o hadtoT'nakr .t When a girt pioki* a thread off
'
your
the "
$ aame girl.T t -- ; -
'
xe' q > y a 4 **nt* : tro*** at-the-ai..Irdrand'try
..
; -. i..pII, way*,$look*,..'. aju
I-2.; k7.- u. : .
"- '. _, dlff.*nt'i, > lr* ,natil he Led W"'petbe back.. -' "" "
;
.
1 !!. 4 1>T *lr:Ali.,,'.Wleta 8,. '". ; r : .,, fonad-tb*proper: .-Springfield 1.,.., .- ; : ;

; 1101OII. 0fVJtf1'' ''IVofof.! Blacki .waono' *':etaytng 4 .' "orf"'F ." '; (Maa) Onion;:; "h ., *-' .''w.. MIKXM "< a., <_ a'Casoana. ;
- tr.' < .F.r ln..H.- .
-- 'WII" *'?oldt at Tymouth. Bfor rtiriy to reel .m..tJ". ','JnD'f.II\D c :'** .> _'sr.j-1.- _--nMt l--I.:; .'-U.-IJI.-. i.-.. ''strteTa'nttea oV ;.y'ja
: !jewlaiSnMnar 'f
:.r. '' :r-ti*.. 't "' Ufa
.
h/inforiad tO boat Iberhe bad_ .ii '--
.aaa**..tnraocao 'I.aUjbtcI.j ,
anonr-1 ;
or'yrm .: bai an
Wn \?. .i -1r'F s55et di..m. pW *'sIbsT.
; ..
> -V'i'ioaawfully _
& .: cI"" fitt..t- W-4ik.'zF4ra.: and mm tfc, IMS i tow
tbal
.E : ; ? : lby ;&*cuo 'MIla' 0. lot, ; 'i vBath'ra naat'waV.of, > tfmrm was anpyiiai em be'
.. ': old manVhas Just taiaed. say -!- would allow bull bifroT%d wto stand -k-I -r--; -- ', > itatln* an awkward .-.4P. a gross mass r-r doctor.
b.adr.doIlars.* ,v",: "Vl ,.. fact was adopted by a.iwant.* C" : Semi: .
a -. ,:.l1' > !ope4UeoadshaltheOt .. front r vt.ifc.inff-fA cno gh" beloVJh ppltoant sad 5? tal.r
."l don't a** "aayIbfng' M .4 be alarmed :aboigldjbm7 beat waist l/nYlo ( 'onhioS .tor a penaioav, .lli.;.pplioMit I ,! wi" l.si r'.eIasbe pmeaat.o.4 is inuevebiC.ea.oe .
ornLaJlab :
W : \
-' 4. ':.:-I % to worry yo u?'<:; i., v' f 73ifttUy fclri*J Vuigtn-th.mlddlD th*night. ..rI tbi'ee handsome %htWD..7 bad bn womoded while'his regiment misses.=PineS$ ..r p.qii.Se 50 beseememu.esL..seslme.s&eeat..s
.# 40 E f' wife will w. in( retreat .be l b* 4Jd ...
.:iy.-:: want \/'.beabaf.i4ne4 lalTaatoepA( ';vTherxtovi.of 'b. eostan wa*the piotay. if. nall'ta.srrk c't ft8D.ar..c'.Oo. -

___ .ocs IJaOUH4. dalla.flqr- ,,. w oa4 Bo.a ..wtttt h*.ong.aeaobdigiy's ; ,"It, whtotLwa*,part at( the Jacke* and that ..r-t.!r..iYe4mTw09.l.?.b<. hr laSsEs...meaa.obleI.. .a tie ela&el.as5
_ =;
W; l < ," .5k"wh1s ntareblig rapidly in treat SnIsISSOY is 4mo. Se a
1 t? 0'rioelt?t >.. mornlbg*'hi wa*brought trou the right .
-, .. "",' Is_ 41.1" .e .
0 the it. PSeeC as .
_ .'r4-: .O ,f. .;.: old.prof.gsbias i Mar4".nldn.. "an, going'beneath, 'iii"'tata.-.nd snemy-.lrgunsnL, < :: ..,: 4 = .. ..
tb.II' : T.
ri-: L; .; J .a"rr..oI'L' 1tr'"jf. : :"' Wja. lice booking' attbaa:, "letarnr ans: Q ---- be taOs lo, ..same., ,fl.a4 a'. 1 4. "
.i -sad ten..aQsbes. 4 -' ""iF. '
I- daittt.t y$ ala..'. aav
of my "7' '' v-r i4.-f..' "I"l- ,I'UighWndrrontbe< \// ". $'b,/ .JJII'.fat bar j"if 1 4'Ort"w1'' <' .f'a4aU'YuU.Slll.an bbbMfr1\lVB'A ) Kxm groc.ryma't1taz
mtfilOf .jn 'b* AlllpBaai'mf; .tb nJ,bt h* ..dll'plloo"l nan9Jsqotefftt! ,- topIeilrftstored'aad; { Cs now til* 11 ,

JAM r.at isi :.. ''1', ..1"j sang -out"'.'''(B Prow.th, *, Bush** -A-tirt Loaon.4;shirt,' .[long ;bla.kaatl Iusst.DelsQttbst1S.I0 .Ea7Ope. '" .J"at. .** ,a.AnB"fc'V> -4. .

'._o.r ,\\. f; : j:1lt ,'o."-- .. last lia, "*.r.io*' i"taftt* *'If I.,' javii '*IoeregiE-jfpbey' Neal sum.a.'rto..DO ci ILeg4A1 A.. i 4us.,4.Ajrp. ; .'...-...,.urfg,- dl-, '.J__ P1Ul .R'i'k' b. > .. _s -' u .-$ 4vJ"n "

;.th.-tbh$ttaLs. ....Wl) I iibdl.4 te>ni and \ttf\ Wttir W tin- ,kri -ttw LCtZtlrt71mOtbfld ir 4 tH IClnli.uw1ti? h giyia, I I ** a

r.w r.t. .1ex!""< .. H.H.,;Ubi4
I ::.,. j."Yo"'i; "")' ,."(.' JI:".'/;I :. ( .. .. if'1 1 ,1 f t.." "' :,:'-. I J..n.'ft.\ k: '.'E : '.'f.J J..1'\' \ .' ""tJ"I:. ,." l fcr> 'ii-al 1,3', ,.r taWp.ilA1M ; :'.;:; "- .- --- -
: #
; '
{ \ ; 1I
"if't
.
't jICI: .. f 't! tI\' ".tooi ; N' 4.,1 \. A J.wi1\ i.-u,44f't i.- ", "", ii r.1 4. -
It' It : ; ..
:'-t. i.Ii. ..,. ."r i PI', ''. t' "It. 'I. .it.1.0, r .'it \. .! .J : .;.. :, \ '* i\Fl!'
r t'if m
'J\jJ. "' ; tt .w \ ;: t t : "f
l' ." .
.;; .;1l'.i8. .. ". .II .' 1i .' .''. ; stifL. J: I ., ,1"'J. 40' ., .!r1. ,,r: Pj, .:; 'S.Y 'II M't..tX '" ; : ,"; ; .:' I : -


? .
,
iT' -' d.'I

t. _
I '- : -.



,."."t iJi, ;..c ;;.-r. r"i" i\\. {. ." [ .,' -... ,, .- .. '"."f J. V V V ;': Vvl V r'-- "'. ;-" J .:.c..:.. '" "; '" ,. ." .. .
.h ., rJ % :: \
,' T : & .
j '
t tf 'A '
.j ,it: I dt ; "" "" ., ( I' "' 0 I ; y, ,I"" I. oj'I'" 1. ,, y ( '. l'
.
rii, -m AJ. J" '.,111,4', \ '; ,.t, ( ', V : 1 \ ( I .
v\l'
'O' j .\ ; '
"' ; 1'11". : ;
.
VV "i
"J. :
< .w .
n "
!. "; : .
\ -l ; ,
f\ l1't "''i "; rt. .-l1 ." ''I' h";' J.fJ."jJ'(1'1' .u _. .,_ 1R \ ,Ii.. ,_ '
:.r.iIt. I; "f" 1! .I .ff "( !. 4'V \. !&" '' .iP1r iVVL + .1f.oll\ill'l: 3'i' I'I; i-4'-j '>/.." ../ .,.." .::;. :"t; ; .;: .:4.,. "- ,

.- '' ., .
.
'At&Y; -,.0-. Wtbei'V-' V .... rri1 !,;'i tar:CubJitz'i.- ; : ,LJt.ductio: 'fr V Cnst.t ICsts. ;' ,4dIofl i "for Csh,' t'Kail's.I! ,y'V' ,.Ii. For, la,.... ,z,; ; \, I

.Atau..ftU-.AIt. : c M..WMII. ;,.. ; ,i-k i I. I J. : '., 1 1fort..lwdon :
l1orioni.I.di.a' .charle.tJa..4e a tHutn-trip, fMlNaor.an-o.sec ,
,. -Dry '
T.DIo" 1I. : goooay ,
J fiIl.00L1,11,11ir1l. ; 1 to the oAce) '
ot'i .."' ', .K"'dl- .. a it-everybody :Orlando. ,.t.rd.t.r.Vi4 '..1 V. ,
V ; \ _J;_ -j'! 1 tbf sown ot KJarimm ;:
)Iu... *-Ca|'tala Clloiipsce.'camsuj.frem VV. have only about two month proechlncclty alecUon., : ; :'

,. ,,." ';M ""C:"r. 7. Tburmlajl..1Id..I.. .- ...,.;"i'f!.;:<....j..:. 'is'.. Katz'Lf.Z: : ; Roberson i ,, the jfroceryj .rorfMeJrera y..t.rdty';: ,0' a'do a half 'Jeftin which.:we mar .'M ed the wiU best perforM of lIDy the ability datls,ia* : ;! .

_, "'__. .. t 1.F: :: ::: :: has moved hi*:slock"info''tn, .CaptatmrJobfl rterl'a.slhier II **|rrow Inknow1 dg lfa1.bT'day.!' of .the.nd., popalat1on.- :
1_ ... ..... ,'
j -; -- inudsy.l londay ?.,. '.'' building recently vacated I lathe. City, on,buslnet*..J' i' &flJMary Johnsonotia of the '. : 'J. .. :
.cJiVItC., No-t1 ... i .;:::.::::.:: ;;::;: ; I '
; '
; \ i. H. 'C'i'. Stanford, Bracket .,tOt f -Engineer! GI1berCf Steamer ROM county teachers,entered the achool : For ) ..
: PanrtrAM:Sjervele* ey iy Sunf. 1-f' '7' 4. : -30,000. TeeKVJeasrfued" Board- ida, it at horn. fmf'dare tU.week. last Monday so.'tbat be' may be :'Tlierebt announce my : : : i $
,
4ayat u .. In. .. 7145 p. Wrrayer ) .gJjA : ew. T w.-t'.le cheapac-1frsham'I'I. .-Iteittem'beftiiri.lestlTaV-"KtSofrowevening1 mo..bleto"'carry.on.11". ;W6rk for the office of City.. \ :
:: rtln .Thnr i a"*v nlaBat,:j ocl! ck, which she.ha. undertaken. lUee, If elected will try to ; .'
V ; :
'tlunday.school .t 91 .+ ifl.; P- .1". \iikReduction.' l\w'mim: : at ataiti room,II&St"t RaeaeVffiTpfP V JOHB B. $ ,
':\j !. irker, 3npU -'W. *..I l>o{$j Ww ". ., 'for Cash-' at :, rvn'Jr' V,. l3attsndj V : V ;."Hart""whohip nt"." : neof.-th.--ptpfle-1n-th.-.1zth 1, -. ; : ,

., MtTiiooisriJervWes a.'ni. and at" are heW.larlyatkt ,m.'each regu- ;_The N..Y. Racket. ,, IA3eemau; played .jba<" Rreaterj. rtlan of the winter In Jsckson-_. grade remarked the other iday that JPorMarabali.: I ,

\...';\ ,SelJwOi.. Sabbath school 1oop.at "MJ .a.'**.,. originat. '. >flo w.priceMr. *.; V-; \ ,.ith the.feather &!tribe 'k-few days; ''vlUw'fms returned 'to Kluslmme, ern.He he Intended'has teaching our best school wishes next for for 1 reelection hereby announce to the office myself.o :I" I ;

;jt J 4 Hughey, Supt., Prsyermectlnr; .t. and" Mr..- allt-W"e .. .1 J-Mr. and Mrs. E.. Lesley-i lopped Klwlinmee Oily at the )

;o I,* ,.IoID'OTI. .nd.. _Ltaaut".. .Conie.lflt 6 p. tn. ;.M. &".WOI1Bnaiuitli MU 'Itillti ri 4it : .J.s.jj* o't 6'-in( .!:-Domestic for i !tit' the City a feW' hour Friday 1 n-their .success.Lassouig'.'wal 'reigning supreme, election, and refer Marshall Mr mr > : 't
a*City as
year
'. ; turn 4 :
$4.W"'J..AwL.a"P."t(,. etal I week* to .t, C. ] day in the'wck. at.JJ. to Bellinger" tromTamps'wherethey four' five nod fill .
z1oo every or days ago, but hud to be ability to the po ;
; ; 'Church'flAPTIi.SCIVtCCU Sunday In$ia.1n.amd7OO the,:Bsptl't Lakeland.. V44Stan'ford ,;%. '.\ : Racket Store, .,,,, *.,',? have.' "been"visiting. for. .I'the. ,,'past. ,' two ;topped-by r.rof./Shljipw. .,--' % ?-' H.-T' ; VJ.) M : ; / : '
every week I .
.
--rl' \ ''p. n.' Prater-meethig Thursday night at < alioe"* :will '-Ail"" of the most reliable ,family isjtKe. .1 regret-verV.niuch to annourtcethoJ" *' ; -. For ..... : ; ; :
Parker's SaruiparllU "Klht ot ,
'1J't! 'Sunday. ,.School-every"Sunday J. CrMAaaaafPastor.Kncor .at- price, sell them., ): 'p.tent medicine and' _.,best' Blood Purifiers." Compvoi of valuable *s offitwo of the;pupils of}the ,:j hereby announce .. ,

a4< a.nv *r t.. -St, Johns i Services every i There belnj!: 'no .qu used in compounding pre purifying and tonic herbs *nd root An school, MUses'Aline and' Nanvska, fop reelection. lothe I o/e : ij

.0'I f '.Sunday at *ti ;ooa.. m.,and .n3 th Sund ent',"there was 'no metin'g Vtion. by'an experienced.drug unequaled rimed for all OrfteAses. of IMCBlooflVL'lv'efVfitomach .McLafte."V. ,. :.,. ___ ;'J' urerritthe City .Iectlon >
of each month at 10130; a. m. 71 jo..|i, J3oar4.(14&ie"lat We ,_ .Lettke. 'drugstore.. and Kldneysj\ Including 'Farewell'16.tb.'pl as.nt"day. .of, March'7th, and solicit the
Neuralgia,, Sciatica ,
lifled of
Communion on 410 Sunday eve\y KUeuniatism; |u voter ;
\I, ./>..IolT lId mOl'th..t the.!morning service. evening,. : I. The"salt" of Jlr..1* buil esa. 1 etc. tot Sale bjr J.
:.J Week-day service' evry, Wednesday itt -Fo'r best shoes nt tivin want more of it., If celling pure :-The Rockford Gavett.thinks, come'to? 'the. achorching, lieatsolsummer. : : .

< 7'y Pw.. .. if. ,. Store.: resli drugs and 'ifSiTfiyj vou right "if editor For Clerk'and. .
'N\aooo.st. Prterfl' Ittvtn* service N. Y. Racket that a country was .1.0 .
pf-'each LMoiint* anything: 1- will get U. all the l Inducement. -held V The race course is. nowtsvfuljwn" J hereby announcerrtj : '
7 -Od-Tial aad'jrd Sundays": ; snap at ; :
-Mr: and Mrs.-Thorn ('or the office l Clerk and
I--- 1'' month .. m. Celebration of \ .J._C. LXAU.. out he would soon be a millionure..If at slio l. The 'managerprom the coming City f> election, ,
mmunl been at the La Jib ]House ;
., .,$lloly Cc jrASunday of each. .he run the paper according i see,an entertaIning hour* to support of all my friends.Underlpuy .- I :
I' tTfe protrEtr4J3)gtiigittJ '
1 -month tMe>mlng ttK f i- --4- -' pasB-jnonthr.left visitor- -'" VV.- V V .
receipt-iSf-a -
,.. Q;I aa, A.. Kin <*y'HAIL,. M. A.. /lector.CBBISITAK. York, where they will church will close to-night eV rj't5 dfFbotLofibeWould"be1flthe ; pini- '
L .-Services tit the Church 1111 the jsubjett t "Tlia Blasphemy poor house. If published One. 'young man In the High .
l,'J's, day,at u o'clock_a.: m and See-fhose 8 day clots. the IIol ; iit" it is half the iterri that are sent to him, school has been storing in his mind T'HE I :
or as :
:
Up
-* > sqme.tbl3CIt
; .r 7130 p, m. Sunday school at 9:45: a. m.. i. NewYorKRackeT. ';*> Called the Unpardonable, ,he would be in jail half the time murderous thought toward Mr ,- ;
{' night at y !
'ii"-.- Stnn1rfl'l,1.IUng.rarer meeting Thursday-city .nt' publts .Re-V. StUurt M.artin' arid he crten'MUrbs.The.. and. in the hospital the other Werttworth, 'the author.' .of' the'. ,', : :

1.' generullr.InviteoU duct service l at the \ -1- \ finest hair tonic half- schdrIa-Jgebra. ,J\w V .

'. '. : clurCh next Sunday at n the land.vjt emdical.. all dandruff liftsH-CaldweliT Tlie lecturffgiveh Ylofiong"ago R',

/ MASONIC HOTICK. hour for kcrvices. keep .time hair In fine condition. It on t lie) subject /Jbeautifying' i iihaviiggoo&effecon .
Orange Blossom Lodge, No, So F. and a sure cure for baldness' Sue per Last Thursday night, at the res- the i '.
.
.s ." A. M. Regular meetings Monday _Reduction, for luh., at '"* V de'nce of J. A. Lancaster in this have[ been pupilswho walls, I {
In adorning our U ,
each evenings.month or at before"7:30 o'dock.thefoll moon Visiting. -J. I. Lew-U- and T.'W. -If you want t& plant tobacco l city, Miss MiLLie Cl ld ell and with plcturea.Tbeeigtlrgr. .

kbrethr.a r cordially) .Invtte. who are'svinterirfif at Hotel leave-youjr. order:unA: 'a-iil&tl.u'-w.. ..Walter.. .J3BMJlwajfcfJthemos_ dl-jr1m'v p _._ : ___;:_ V 4 :
S.-MiC;BASSET, W. M mee are off on.* business 1,000 plant of the finest cigar leaf popuTai voung people of Kissim, rica of examinations which WE ARE HERE ( : '
,I MII-.It., Sear *PT' thin 'week. witiTW. mee iunite-in marriage Rev. seems
Charleston' L. Vats lJuzor. render .
to them voracious and "fussacipus.
S. W. Cawler, pn,tor of the Methodist -
'. *MVL TLO ?GK,/ 39, I.-O. o F. -Save money by trading Reduction for Cash, at Katr's church ofliciatinK. ." V '

N...Y. Racket jtore.rfundiiy iOnc briglit Jiisbory scholor informed ; ; :
= f -Mvr13.tawi4oneoLihemoaLprogresivaiu3thataptia1 Cux1ngiton&-
Argum it*" --motion or-'
*_w KHtOHTa OF/YTIlfAB NOTICE' i WIIM the I hottest trial were heard in the DrotrgM fUUTlll bunirWM .Prof. Shjpp in. hisexamination .

friendship Lodge, No. 10, hold.regulartnentlnga at : the season. The mercury in Atlunt\ last week and a men of Kissimmee; mil,*e to' paper that Columbus discovered.the .. Swan Down t
evening 8.
o'clock, at every tholr Wedneaday hfll third story Itran. climed Out at" the top, trial was refused. Mr. be congratulated upon securing a ,. north pole. Paper Pina -

dew block. Visiting brethren cordially :' only when \it.got'up\ to 94 ,. Drought has taken tin appeal to the young lady of so many Idvable _o.n.
Incited to attend. *'Iade. State Supreme Courts chiirms and traits for him bride. V. i. Tea Slate Pencils '
A. JJASiX, C. C. KAKCOO8SKK NOTES.
J. .
y J. W. WATSON, K. of R. &,S. -Stanfordi Itacket is fl ust of seasoned lumber > This young couple .numbers the -
-
: quality entire population of Kissimmee -' Safety Pins, per do .
;
c UniernilI.Mes.rs.. always on .hand at reasonable Thisectiunof lio-country ia very
Li t POBT-OFK1OK NOTICE. jicnbuiim, prices. L. D. Graham's saw mill. among their them frienda, who will and-extend dry aiu.eae4e-.ese.d' badly for Collar Buttons, ; :
to congratulations
Nail closes going north at II ::45 a. m the vcgetaDlea for northern mar-
,:. and 7130 p. m.; south s ::50 p. m Sugar erd, who huve been at -J. C. Thompson with Miss best wishes for a long life of wed. kets. .. Hat Pine, )
\- lSelt-l Clopd 7 tjo .. m. Narcoossee, House for the past .week, Ham' nnd S.C; Chnpljn with Miss led bliss. V '_ ,- ---.j.. f
day-night for their homes V Mr. Jolin M. Hasttll has started_ Tacks box
3".od7:30p.m.{ : Turner of Lakeland were plea. Carpet <
Office hours-Week, from 7 a. m. to lantic-City N. J. from List nf" Letters at Wuittier. twerect a dweTTTng in place 'bf lb. :
that Lakeland
7:30 p IISlIlIday.. fro,. 8:jo to 9::30 a party came up List of letters remaining In the po. o7-- one destroyed' bytire" short time Double Pointed
tn., and from a:too to 3:oo f m. -Look at the Clocks and spent Sunday at I IotaKissimmee. .
lice .t Whittier, Fla:
D. C Iwi.P. at S..Ros nmeyer'.. ago. 4
V V ., away MOM 'j Itidall 4; Willie Watkins, 3; Me John IZnnis I Is living with Finishing Braid
_
--7 = .-Harmon. Steffe" left Bargains every tIny nt A W Crosley: Arthur Urawdy. hi,. family in their house betweenL. Oxford Ties L
dead
After day will be Aeiil lo the -
night for Macon Ga, where tll N. Y. nuek t. letter office 30 J W ARNOLD, P M. lien don and A. I. so ail to be i )

J JaW TllDJTIPSO1'e' } try to get a busitiehb --- --- near his truck farm which is in tine Men's Plow Shoes .
man IK -hard working boy -Hilly McCool came down from Last KirurMlon tor, Jamaica ontlIiion- ,
31 llenver Fulls, arriving here on Sunday Suits I
serves success i in whatever Leaves Port Tampa March 30. I Boys' .
undertake. morning, oil his second trip to Plant Line steamkhip Olivette, due Mr. Frank Campbell lias a line!
Funeral Director V Kisnimmee tills winter and will two acrephtch of cucumber which Linen Collars
to arrive Kingston, Jamaica, morning l
'
and Embalmer "Meal"vcgetnble spend a montn"bere fishing and enjoying : 23d, allowing three days on the arC' fruiting very well. :
r ; only $wi, per.tcm. time. climate. ;island, sailing at :p. In., March Captain Brack has had .bad attack Boys' Hats -
\\ ATHK'B CARSON
Keeps Met lic and Wood l\n you know thai llsrt's Kooence Uln: '25 ; due to arrive Port Tampa 8th. of the LaGrippe from whichhe Ladies' Sleeved

1' Caskets. Ladies' nnd Gents -The Kissimmee l lie' has received the Ul{ he. |rremluin, Application for berths and inlor- is slowly recovering.The .

e' V Burial Robes are now engaged in. wherever exhibited for aaW.y) J1'u' n.1I. ion should'be made at once to Runnymcde Pineapple company Ladies' Corsets ;
; play eititled Naval ( mid strength f It rellePu all bowel al'l Ci II. Mills, ticket agent Tampa are enlarging their to
pinery
'f..ii"jio( ::toneS the digestive
organs
Toweling,
; New and SeieoiidlLantlV which. will be preuented at strengthens the .,..... A.k for Hart's, Hay Hotel, Tampa, Fla. accommodate the large number of .per yard
era 1>ouse aT5IT early date, -t'Qr bulajbf J. C. Leake. I --- plant which they are about to let Mens" Suspenders
Fllrntture.II .
Suspicious Negroes Captured.
/ benefit of a public library. out. :
For take j -
Indigestion Pepsinand
Also Agent for the GeoageW. -Four thousand feet of Pineapple Cordial, a pleasant I I.uht Sunday morning r. C. An- Several 1 large .'rnttlfM"" have: 250 Envfloj' -

.V lumber, ulito a lot of tonic and positive aid .l.'ibou' .Sitetill ot Orange county bee* killed ncarQacooa._ '
Clark Co.. MnmtfnCtiirMoiiuiaents mafrnr stimulating: ,lid J. H. Gcirtlon. his deputy, Depuly recently 'i.'STieets Paper- -
1' CfidflT IlirflUcr'fuV tulle 111 a ; tutliiiestion"An invnlimblu; rc.oedy set mid. R inrnymeuttvMr V :
r L. D.- raham's. loss of Price ( Sheriff O'Quiiin of Oaceol Bullock Best Parlor Broom
-t sow in appetite. 51ut Harry ha'- been under -
and Marshall McPhutter of .
: : Headstones Tlje Hoard of Lenke's drugstore. county the doctor's care for the past "
;, l'o)1 ICisaimmee. copttired three negroes few i Pair Blankets :
and Iron Fencing. missioners will meet next -Q A. Stevenson manager of near Campbells station who arsuppoaedto day" but is now improving.The .

'V ; in extra session nt which .-c.l.ity company of Run. -.be- he men who mur- Runnyinede celery company 31 pound. Feather V'i:1

tl'' business of the regular nymede was in the> City Monday. derrd two men Harlield and Turner continue Klnppmgtlieir product.

H. M. PERDUE first Monday in April will The celery crop of( the company i and robbed their store* at Julet las They-h ave made arrangements for Crank Egg Beater ;

'V.' acted. There will be no thin year is a success and shipments Wednesday night stid who held upa refrigeration' during the warm Shoe Brush

; WatclimalcBr. and Jeweler. first Monday in April. have begun. There i is no doubt that man near I ceiburg Friday. weathei., --

1. Watches and' Jewelrv "f.all kinds re- -L. D. Graham the. the crop will be marketed at a good The negroes when arrested were Mr.' F. \V. Hill is improving mid Shoe Blacking -

tir--'V ,paired. Prices Jleaaonable. man, always keeps'on hand price.On walking along the railroad track enlarging storeso a* to ..make '
-" I* Office at Leake' Drugstore. mount of tine lumber and Thursday. the Indies of the goirfgr towairds .Tampa, having' more room.for stock and customer, Fine LaunderedShirt* A

KISSIMMEE.. FLA. pared to fin order on sbor Christian church and some of Hheir spent theNiight in the wod on the Mr.. II, T. Duller has built an ,

.. Leave your fcrder' atvtlie friends will, at the store-room ,between outskirts of -Kliwimmee. Sheriff addition to' his residence whIch ,i

and Carson Grocery > Mr. John'' RoblnlOn'a and'St..ford'a Anderson had been keeping trackof make it, much more comfortable. With the aboy ; ) | :i
4; them I left
sine they Leesbvirghay .
:Miss Julia A..Lc'ake ; -. Racket tore, irom4 to '
k': .. store.The 11 o'clock 'p. tn. serve Ice Cream ing. been notified' from there A Jlare. _
.- .'. will'take pupils in ctocklipldera of and Strawberries and Cream.. A that they were headed this w.?-nd I have now'at W. B: Makinsonrtf '

nanl3uildlnL&'Lo.a cordial I ityi.tation-eatendedto all description of!them sent hirn lie 5fe aiinru tit" ftnmt. ,.
p
TNSTUI JENTAL; MUSIC of Knorvrile, Tenn.:, Tn notified Marshall McPliatter and Trees j ---- --- athf BlankJIooks : ; :

.!. V at her home. :.. Reasonable. county are hereby called to .McCabe & Young'a ..'DI.ckTrilbJ" they together took the early morning budded ever from offeredin the"celebrifnecT this State-t,. Indies' Trimmed ,
". the Kissimmee VALLEY held the. boards '
company train at this place and locatedthe Cloud orchards and off' '
Friday afternoon at I t the Opera House last night.A rtaturaseed.
: : 4 negroe.along the railroad track Sailors and ,.
o.f R. H.SEYMO J. .
tnembef* are urged to be fairly;good audience'were in attendance They gotofTlneffaTn at Lake Lock : VV IVEW.
'" 1ot II. C. and notwithstanding the Sledge Hammer I : ;;
N"; : 'tW1EZI. / come back on a pole car, meeting SNAKE STORY. : :

: .-' ,X.noiEIt,. Florida.. : Sec'y. Local coinpany was laboring under difficutties the negroes as stated above and. taking l4- V. : -

,." ,, r 40 WJ. practice ,.e desired, S> A dangerous malady shouU) a very creditable perform. them into custody The Citiien'a-Mianii correspondent ., New'. Goods. ;;; no I : ,:. ;: :
.nyw pectt I promptly and vigorously' : was rendered. This show is a They answer the boldly asserts that the. huge I
IaIattention given to the collection of description Call and be / ; :
1" \ eo 1
'iu' -f'' ''cUlms.if "- VV VrT' Fever undermine the departure, all'_tlie artists male sent o u t by the sheriff of Marion boa constrictor, previously-announced i ,
debilitate
and the
en body. i l ,
been
female, being colored. as having for moif
"' VV VVVV ( t. oet chill Toulc with Iron) county of the Barfle Id-Turner mur year to pay eash 'IR an
'r .cixaThznVQualuV II .Th.4oaIeau4.Netrfdv..t-I.of_,Hy.pophoaphltes dererandwLeiL.captured. arch of all it sucvcyed on* No Name. ff -'-.-- --- -
ti V ., .: V ."AdnrinlstratrarVNotici. !: blned with Inin ai a Tonic and. of oda sad lima In the ay.. give ho satisfactory account of their ly.1f the; east coast, has been Money.H .
1Zi All poraons Staving ebilms acalnat' the estate .rlfier i* superior to-other' ,will b* readily observed after u.lng| action and doings. being captured by_Ben Lawson, an anima ;
.. 1" ,:r.-.I H.C.r.O..l de e..ed, l I.W l of Ibo mount/ dies. Exceedingly palataMe. few bottle of llart' trnulnlon of Cod They nre I t
trainer,
n'<_ .of Florida, notl- Orlando 'Y
J .. .... are hereby bottle. No held in awaiting ad rf C. o
for
dtFF: ..! a. to vrenent.Ihs same to me properly atle>loUhlH > cure no pay* Oil with HTpophosphltea. Our It i i. said that '
ed Ih* ll.se preaorlb..l br law or UieTl J. C, Lea. eminent ph.rcitln.re It vice from Marion, county,end .ifl many year ago
,: '.will l b* iMtrad cud all Indebted said : .. along in th. .
: pomoni I "*'The for Hart's Emulsion. For Sale by they do not' pfova 'to be the men 40-* ve cr carrying:
"1 et u will make prompt mulemenrollli sam aen o for ;
I V : V I with w. 14 O.-; ft" u'aAM, and oilier C''Leake.The wanted there.Sheriff Anderson is a circus and menagerie wa wrecked Call'FD
: : turkey game .
: A.IIulnlsuakeV.LVLPILj4Y.LD in thttt
neighborhood, and the
'V ., -Monday,, nn'd hunt ing-. _. orange grove*_ in and yeVcttLreAVgoociVVpflVIVnQlia cagejeohfaTntng Bid will be received
(BTs-reptile. Which bv
ti'7 order. Kissimmee are in fine con they are"criminal* t>f the j Will '
ioppecLIn that $ Commissioner their :
I then only ten feet :
long broken
was
and ore doing bet worst fleeing from andre ;
justice
perhaps
: be plentiful 1ft 'S ailon. it t type .. be held March seth 1897, at
'' .. VV iiiiiii .iA: protected' out ot season, than ;in any section of the state w wanted'somewhere". t>ytheavesadcLhIs..anskeahIpswam | mrto batld-a bridge" over' :; j
R."TrfROflT. by the freeze, They ,are to tire key' where he has since according to plans and .
:E : } CHEST ANDS RGERY..' good citizens will not only OUt abun- Yo1i1)uty.! held undisputed fatteningand HU. 18 J. M, Lee''* office. t
:. ; from of' in profusive sway "
1 ,Office next door to Zeakearz' will bunting all violation out and a fair eroo ia exuected If m 'diclne i Is to cure a disease, growing until-now It is tb.irtye s V. I ; ,
!V'- .." report it must oe good medicine-the.belt ghjteet JOI1 and as thick througlai ,
If
.j.SlortJ you are looking fpr a '
'v ., _,. : ;? JV ci'un'e under Uieir 1cnowledee.Reed year.
,
-- ;
'1 "to-live contentedly grow only igoodenoughYourduty barrel L Jatotlts are': told of.its Attachment N !

Reiidence. lAke House.DU. I Me' Lain, the bI keep your eyes on Osceola to yourself and -to your,doctor i i. to I awallowi seven young Indian ) ;

- n.<' >" :--.1 man, ha* closed down his She I la bound to becoitoe go to the very best'druggist 'you buckr,'and for that reasbn the Semiifole I'f'. <

- V. r A. B..S.TEVENS", Shingle"creek and wjll. banner county of (the .tat ;
_ tJ :' ". 4-' i'i"Ngncceeeog weeks remove it tip In tl;_, -." filled; without --letting I To W.C. PROTT:". '.
HowAnA to ; ,
\0"8 RbeallJatllUAo. You .11
"KiaaboTirforty miles : dollar and distance itsndin and other peiMMs
above. YOUI'Jt. ,
n.w. brvt' 'iiti6.4 -
to tMe-rtnrfMo
Pro E.v \
'- _.t J aonvtite,-<,-Mr...-Mcl auo.. -Winter tourist are_beginning.' frav... -__ ,,L .J t*>,- -Cooe Co-.r OnKooirov' be.. i.su.d eat of sa2dVnuI '
: rAbwtutely% IHInless Extraction %lth Vr Nl- taiDJIy left Monday for turn, toward'lla. where the N ; driSg.. r-yiah to InforO 7irp..peIty.etteohed-K ;
Pt l A.F
? 4 ,. troua Oxide Gas.! Administered *:es..still Hngar.and th.' flower V'\ The Dr. of the' Doll.ri B.ll. aounUng Mi_the
where tb-- }/make their : t' "aty. you great good rChnmbei I (Il..CIIItr'Io'l iiii
f* $Successfully the |>ast eleht esri. I ,WIne.amid C ..(O..IllS da
Mrs.McL.ane and;-her two not, nor the'bird ilnge'th rlle-ihould till prescription pre- Iain'* Pain Balmha done my wife., .IWT the same being a late d..

'c ': 'OfBc'Hourn8:30..tOs"'f :.'- ,,: ;t3q: Po !"..:;'3o., ioJo;. lug daughter vIU' he'very or. two yet.: Better -ciseJy:a* it i II wntten.- He should She'ha .been .troubled .witn'rheumatism.of 1 end tii.rI|4a4* aUd.sosweroreeaiHper jidf PMM wilt ;
missed K'.Miiimee' ': a wee" and be content 1n not t deviate a hairbreadth either in the.. arms and hands for .&_:_ and tour protwtjr '
;; HOTWALL BLOCJCOrange Avenue.lfp land' of ,flower, red-bug and 'six month and has '!. DaM. Ibis. llan h>l A.
"V''T"' ,, ""*,? -- .. --, f*'. indeed el tlr. family 1. a quantity.or kind. IIU'drugand: tried many rena. A-.f. ,JJtu
; ;"'t Oz. kiuimmeetJret will be. *, lest on your return youjnre, medicine* should obe the purest and edies prescribed that'complaint. :: ''! ;
tif
j'i'* ., : f1- _, (' f V and Bcarccly.. < ;"*' -, .&" -. d go up like best lie should shut hieye to but found no'relief until she used \* -.\ : ]
r : ."...; ;"_ Tr1: "V-u.. the .end Of V tourist' this' r.ln.B.lm
".It":. ,ji'Iij, .n' coriittiuarty wilt wish ,theiii7 catJistuon anything but the very best. He ; one bottle of LAKE, H 1 ?
;
'- '" '.'.I'T'I'TOVn', fleas( in.-theirnew homes and kle. : jti__ V .: should avoid the) handling Of Infe-,.which baicompletelycurgd her,' -I ; I (

'W- Ir c1o acber.t. in all thelr-uiidertakings.. '7"all 'CickPeople.-Just sick i roe drug a* he would ny other take pleasure recommending It ". .Moat. conveniently ''I 1 : ;

.. .- ...'V ;m' .. .' ...71 ': "The F"rt 'Mail' ;fo feel ll lay-and' listless, to criminal act. When he l l's. done fot that trouble. Yoqr: truly C. rable/ hotel property | : : '
4 i almmee. Good
Oppoaate .Pootofir-f',' all this .be. has A. .' and V :
,..1.j".t': JIt" V. """;,.,." ".,,'.r--..', V f .ho'wed to'a' delighted' no appetite to Ieep badly, I simply'dgoe' his bottle J3ut-t-ORD.tor 50 cent 'I.. .In* thoroughly ,' Ij ; j <
-have like 1 1I dutyr-no more. J. tLz.s.;:: *ae by W J. Sea..
.whatofflJ eat feel l lad already
$lt ; "...\0. Jldr tattlng 'h ,.al ,f the:.'latest l I ho opera ,hoate.'lasf" : .,, patronage' ;
HI ), ."Iea Rasor.'!al way* a1J.rp"and" i night; and seldom 4it;; jthe I your at.omach. not sick 'enough' 'WJ,. Seafi'deiirern publishthe V '. -,- li : '" :P-t 10 .t ) I : ;

? A. i''j'; *'. '"everything, In the tonabrUU lin:will J ege "ilinwee''p ?<>pje) '( go to bed or eall-a doctor, but following extrnct from a Utter : Notto: Iwnby, ..thM"; at the ':_. ., BOUGHTAT{ | ; $

',. )) Ibe.don.with I eatness and,.dispatch. If" '':1iJ.l..a/5; performajjce! st.fti,k.' rough( ; tq nOtkno-wjwhat of Chas. !. utfi.Id"" 'ofJbedJey: (4he LeiHiiiuar*ul(lb. m"i. of riorMe neat a bill Ins Ye r 5iIZtICaI5r5 PIJ.'i I ; ;
: dji _Take tonlc-ttl..tt. what will be Intrartneed In th. ., ,
IIonM <
t,3t.i' VV' ..' ac.nII'ell' wa'.;.ID. ] Fresndi O 4Cai.: asjbie-bandla the e Konruxmlw ; : 1 '
'. i 1'.u.> l w > tires,Mltlnc for.>peel.1 l loral ent ol Lrl.i.1 -, ," --
( 1I. _,,10\.11) 01.1.893-1011.0( Nt som
t'T.4 -' .A,..>MtFarlaod.prominent;; ; presented w.tthi.telliDa: .-lusicvwiir- *nnijvii JPUUS-puuv* lUto.men.t01tnow wTVaTj* ipleiidid ,. -.V ':1,W.W&TIOtr. "M A .;,,:';, : -:7iV : : 1

,r..r">" ,' .,' $' OT| Live Oak,.putter Co., fect, among whlc1rwera.' and put new life In .you,!f You' medicineItV\ ) > -4'- .* : V 1I.IOUt.. ". V.". .- t'I, : \

Cal..wa.tskenwltl: sveIy' hey boat ,e.ptoelon.-anl/ ',engi ; get )Just IudI', toqtc at .jLeke. ,* f "If1 t i. wjtb'iure- t ;
( ; : JI ,. ,.i' ) v-J lt you
Ii\.}.. cold.Ihe paine lnVbi. 1icst'were freight/trairy,"nd' ru t o e\iiiJJ 4.T&i..< I.:") .1', i that by"oo day'a oe obambwhilts : )t.y. ,1 ''irap Y l lI. 1.'PIl: : ;

1ft!: thirltetI4ptim. b Crossing the pmge'altt fI r.t t"WilllO; .)...b .. ut 'we-' ll t tC tigb remedy I wa relieved caraflrbdr v' : '

i 44Wctbf.atcao41,4w1th":poellmon'-. mllea an hour' The scene fromjJ JN.w-York Life In. of a.'Y"ry'.r"'cold'Myh..cIw.. ."..', ,i'V.. ",,.'Lay. JMi wi', .doorto' "-."e ... ,.L' ': 11n. \ ;\
.U. father ,"bn.evral large; agara-Falls very; : '.'n ,Co.. -a onportrait :;pf :"completely*t ppett up'attd I-.could '" 1.'. .. .. ,_.' U'; ... : : \ 1

., ; '''do.e."of; ChaflibOr4&ItI'ICOt1gb; brought forth, 'burst.ro: I u'A* McCall, -.presldont of .noti.t.gbtLccan"recuin w, ,;"l rRIOILlSi"1'i':1"'" l" : : !

g' _' lemoaJiw1aId1broke'up tbereougb .InUr.wovenv witb the.; Cot,.V MrMeCalLf*.onT>f the :'mend this"remedy.l*; cold'nesjjyalw.ay III1ltf.DfMeIn cxmwaam.- .: __..Law ass_?. .; Tfte *

di: aisd.cur4- I1laa.''.Mr.MFar1aed! a,',plaVfost itirfihing. ; 'Mtoricd officer cf the,\Juited i \stan&imFtbbed and after* '-, ''.'01.1"11': ..i". lOa 10 tlf..t.1 I'ifi. "

''f 1 ,;. .wbeJlorir-Jd. bUd bk *, whkh. ;t04.b .; drawajtbaliomforubl* r Wnrd*.;'extend*;.to."'tb&throat:n
.: i i1 .ICroQ.( ; be Ih.ariabljh glees i b-.n ten -*corps of actor*.a* I bm Of$5.,ooqr'.'.v a";'v.Th*' por.raI" lung. By" using th!.rem 1j'.f frteJya ,whl&eP'ro. v_.__BIn.Uc.' .' iii _..,.... .. .' ." ', : I
/. .,"f .a :lt .,Cbllnborl.t,'.Cough.Remedy'aq4i the, ,joadi,*f T ken:: < I ',were,tonly ceu,to Jhoe) afaant* *oOn'
t. ,og I, alwayu...the ,..JJ.eon.te1en .pat Mlrori : ;. I oln ; a required; o-ot.'bUi- tr cte4 It will cur; the'eord; at once Wa.I: ii4.US "IWItI W.' f"is ssi twm \ :
.. 1r 5.i. ;
&5tNbeat COIIgb., m : jAtb,, Qwt on the roadT,"and ..! foX,.JFebUarV, .Ana'I.Iulmm.e 1d.prevent t It' .fl'i.& It"lIdlnl'f'tofMt w-.,,:- .i1 ,.:. ..t; '-. '.,'

-\.' .jM%. 4afki #,-< .. "If D'fw'I4'. ., Surf, '.. .. .rothIIf775I.wbtist4: ( i 2rJiU of,.J I Jartses.' tIgepcIs!. ( lU"II';, "-"; ''tt: ': 01' Worta.IUIU C.,.La ,. .'.0 t'"' 0.I _. ._..' 1..i., .J. : 1' 5
1 /t .'4 : ; .' .=/li' I ; "' ., .. !
.
.ft 'i : r Ht \ 1I 'WiI o"\ '' "t .
1t > r C 'tt.7' \
( ; '" .
"lf\i
1 i"1,( .i' ; .JJ "". '' J" ;'. ; '- ;: .; \ I J, ., 'I-
; H .
: '
) : I. : ; : 'rg'. $ '
\ 'il"y rx ,.... 'I/. < I 'ir..c v4. 1 ':1 .., o\ 1rf' .. .. :. \ :1 '' iIi"J .
'K k'ooi .
.,. .'.'IIj .iL 1.. ,:i' \_ ., .'." b'"Ioo'j'. .d ? oo''" 10.. .l- ; ,;Af' (, ( .,{ \ ., -.I ''f'I '.. ". ) "" ill.r\i. 1 :
l'II
I tt '- ", ,, .
f. i '
< \ 1 1I
t' I ii" } ; '
,
It' ; '
t. i 'N i. ; : rc
> q'1' .J 1 ; m .jh.Mi:': .- ,v 1"fJ'j"i..:, Jk ": ".: ,, S'll .'M f.e'.{$, i : '' ::?JL :; ,, il11i. J I \" l !' ti .,-.fi, .' ., "I ,7' t ::,
., J"" ." t kh kh4'i r' "Ff : : J ; 1ji1i. _,.' .,
:7r :. :. 'If f t'.I ; 1f .t ,,l 1.'tI \,
''i ,. \ ,.".,tI['.,; <. 'J(1t-J( t.J'.r' ... r'.J' IdiW & I 1 \o ..i: tN' .i','. "'j -!... r-ffit" \ K ;" ":fU! :;. ", "". ,;',,, tI.ri

1 ':,.(.''., 'i ..J.'.t[..J..f.:' ::;:., / :'C':.I' .'.'. '..H, 'ii''. :, ;. 9i .,..,:1..rt'' 'r,.1 sl': /,!' '. !.. '.j 1I..t". I. .. ,'h 1"gi'r'i'r' .!f111ii j ,' .\ f "'j; ... f f.1r".f' ,;,. W't1J": l' t1 'j I=, _

-. .4
; :
". .
f,''' I 4 I 1 \ I "