PRIVATE ITEM
Digitization of this item is currently in progress.
The Tribune.
ALL ISSUES CITATION PDF VIEWER
Full Citation
STANDARD VIEW MARC VIEW
Permanent Link: http://ufdc.ufl.edu/UF00084249/01897
 Material Information
Title: The Tribune.
Uniform Title: Tribune. (Nassau, Bahamas).
Alternate Title: Nassau tribune
Physical Description: v. : ill. ; 58 cm.
Language: English
Publisher: Tribune
Publication Date: 06-14-2011
 Subjects
Spatial Coverage: Bahamas
 Notes
General Note: Description based on: Vol. 79, no. 210 (Aug. 3, 1983); title from caption.
 Record Information
Source Institution: University of Florida
Rights Management: All rights reserved by the source institution and holding location.
Resource Identifier: oclc - 09994850
oclc - 9994850
System ID: UF00084249:01897

Downloads

This item is only available as the following downloads:

( PDF )


Full Text

PAGE 1

N ASSA U AND BAHAMA ISLANDS LEADING NEWSPAPER Bran: is China financing FNM? Volume: 107 No.165TUESDAY, JUNE 14, 2009 PRICE 75 (Abaco and Grand Bahama $1.25 WEATHER PARTLY SUNNY HIGH 90F LOW 79F F E A T U R E S SEEWOMANSECTION S P O R T S Behind Her SEESECTIONE Shades Spartans beat the Raiders By TANEKA THOMPSON Deputy Chief Reporter tthompson@tribunemedia.net GOVERNMENT must dis close what deals were made to receive campaign financing from China, urged Democratic Alliance Leader Branville McCartney. Mr McCartney did not pro vide evidence that any funding was promised to the Free National Movement by the Chi nese. He said a visit from Chi nese government official Wang Lequan and a delegation to the FNM's headquarters last week part of a three-day tour of the Bahamas raised too many questions. FNM Chairman Carl Bethel released a statement yesterday calling the assertions untrue and cheap political shots. Mr Bethel stressed that there should be no suspicion about the visit from the Chinese delegation last week, explaining that successive governments have worked to maintain diplomatic ties with that country. However, Mr McCartney argued that with no account ability or regulations in place for election campaign funding, foreign governments or entities can "throw millions" behind the FNM and its re-election bid. The Bamboo Town MP outlined the investments China has made in the Bahamas over the last few years and reasoned that the country has a vested interest in t he FNM winning the next elec tion. "I find it very out of the ordinary that a member of the gov ernment in China would come and visit the headquarters of one of the (political country. They actually went to the headquarters and met with t he Chairman Carl Bethel, I saw the secretary-general there and other officials of the FNM party not the FNM government. "That has aroused our curiosity. There are two other parties here you know, there's the DNA and the PLP. "It has caused us concern and w e put to the FNM, pointedly, are you being financed directly or indirectly by the Chinese, the Chinese government or any other entity in China? "It's a matter of trust, we would like to know, yes or no?" he said at a press conference yesterday at his party's headquarters on Prince Charles Dri ve. Mr Bethel said the FNM has Govt says assertions are cheap, untrue TRY OUR McFLURRY SNICKERS The Tribune THEPEOPLESPAPER BIGGESTANDBEST LATESTNEWSONWWW.TRIBUNE242.COM www.fidelitygroup.comCall 356.7764today! Fall in love again with a Fidelity Fast Track car loan. FidelityBank FastTrack Loan BAHAMASBIGGEST CARSFORSALE, HELPWANTED ANDREALESTATE I N S I D E SEE page 13 SEVERELY burnt bodies of a man and woman believed to be Haitian were found inside a Golden Isles Home ravaged by fire on Sunday. Last night, residents of the area were still work ing to extinguish smolder ing embers that threatened to reignite the charred remnants. The six-room wooden structure was completely engulfed by flames, according to Fire Services, which responded to distress calls at Excellence Gardens off Golden Isles Road shortly before 2am. Firefighters discovered the victims during a search of the home after they had extinguished the flames. According to residents, the woman victim collectSEE page 13 TWO DEAD AFTER FIRE DESTROYS HOME TIM CLARKE/TRIBUNE STAFF By TANEKA THOMPSON Deputy Chief Reporter tthompson@tribunemedia.net BRANVILLE McCartney challenged Prime Minister Hubert Ingraham and Opposition Leader Perry Christie to run against him in Bamboo Town if they are secure of their party's support in the area. The heads of the country's two major parties have expressed confidence that their candidate will wrestle the constituency away from S EE page 12 DNALEADER CHALLENGES PM, CHRISTIETO RUN AGAINST HIM By PAUL G TURNQUEST Chief Reporter pturnquest@tribunemedia.net THE BATTLE for nominations in the Progressive Liberal Party continues to heat up as three Members of Parliament are reportedly set to face challenges from within their own party for the re-nominations of their current seats. Other than the well known race in South Andros where the set of PLP MP Picewell Forbes is being contested by former PLP MP Keod Smith, there are two other challenges within the party South Eleuthera, and Exuma. In South Eleuthera, the areas current Member of Parliament, the former Speaker of the House of Assembly Oswald Ingraham is reportedly set to face either Hank Johnson a local general council member, or attorney Damien Gomez. Exuma, party sources revealed, could be one of THREE PLP MPS SET F OR CHALLENGES FR OM WITHIN PARTY By AVA TURNQUEST Tribune Staff Reporter aturnquest@tribunemedia.net VENDORS at Potters Cay Dock criticised the lack of government regulation of their area after a police crackdown closed 11 stalls over the holiday weekend. Stall owners at the popular nightspot claim that their lack of autonomy from the govern ment, despite receiving no subventions, hinders growth. Matthew Rolle, president of the Potters Cay Dock Association (PCDA problem Potters Cay Dock has is that the government is not working with the vendors. The association has asked the government for autonomy but the government has refused. SEE page 13 SEE page 12 MATTHEW ROLLE vendor and president of the Potters Cay Dock Association POLICE CRACKDOWN ON POTTERS CAY DOCK FIRE SCENE: A resident of the area points to pockets of fire yesterday in the after math of a fatal house blaze off Golden Isles Road. DN A PLANS TOUGH STANCE ON CRIME SEEPAGETWO

PAGE 2

By TANEKA THOMPSON Deputy Chief Reporter tthompson@tribunemedia.net THE Democratic National Alliance will remove impediments to capital punishment and stop political interference in the police force as part of its "tough" stance on crime if elected to office, said party leader Branville McCartney. "We need to get serious on crime," the Bamboo Town MP said, flanked by his party's chairman Mark Humes and members of his party at DNA headquarters on Prince Charles Drive. Crime will be first the issue addressed by the DNA in series of town hall meetings that start June 20. "We will outline certain amendments that must be made to different laws, the enforcement of certain laws, sweating the small stuff, giving the police the ability to do their job without interference political interference or otherwise. We'll speak about a national youth programme, we will certainly talk about removing the obstructions to the death penalty so that it can be enforced in the Bahamas (and Citizens "We will be tough on crime, we will not have the citizens afraid of the criminals, we willget back to the point where t he criminally minded persons are afraid or respect the law," said the Bamboo Town MP, when asked to elaborate on the DNA's crime platform. The party will also address its vision for reforms in education, immigration policy, unemployment, the economy and other national issues during its town meeting series. The DNA will be launched in Grand Bahama in late June or early July when it will unveil three new candidates who will vie for seats in Grand Bahama along with a few others who will run in the Family Islands. "We anticipate in very short order we will come out with (a full slate ferent islands and you'll start seeing a progressive release of candidates," said Mr McCartney. Although he is the leader of a young party which was launched in May Mr McCartney believes the DNA will win voters' support because they are tired of status quo, politicians' unfulfilled promises and the government's lack of a national development plan. He chided the FNM for not having a long-term strategy for the country, only a 52-weeklong vision constrained in each new budget. "I left (the FNM s aw, and I said it, that the country was headed in the wrong direction. It's a 52-week vision." Mr McCartney, former state tourism minister and later state immigration minister, resigned from Cabinet in 2010. He then left the Free Nation al Movement in March and s aid the decision arose "out of the need to satisfy my conscience." LOCAL NEWS PAGE 2, TUESDAY, JUNE 14, 2011 THE TRIBUNE IRRWSULQWV IRRWSULQWV SRVLWLYH SRVLWLYH QHJDWLYH IDWKHUV IDWKHUV WRPRUURZ 9RaajRe YVc|dRj a a DNA plans tough stance on crime TOUGH STANCE ONCRIME: DNA leader Branville McCartney

PAGE 3

THE Progressive Liberal Party has called for the immediate re-establishment of school based policing in view of the escalating incidents of school violence seen throughout the capital. According to a statement issued by the official Opposition, over the past few days, at least two major fights have occurred involving at least 17 high school students and at least five students had to be taken to the Princess Margaret Hospital suffering from serious stab wounds. It is our understanding that more fights and altercations occurred over the last two weeks at a number of schools. However, the FNM government is sweeping these inci dents under the carpet because they are too embarrassed to face the reality thatt he PLPs school based policing served a meaningful purpose. Further, these matters no longer capture media attention to bring the gravity of the situation to the general public. The n egligent act of the FNM government not to take immediate a nd appropriate action places the entire school environment, including those involved in these incidents, at grave risk, the statement read. According to the party, the last PLP administration under t hen Prime Minister Perry Christie realised that the B ahamas, like its Caribbean counterparts, was experiencing serious problems in its school system and was headed for an explosion in school violence. In response, the PLP said they initiated research to iden tify the extent of the problem and possible challenges. This was a collaborative effort between all the respective agencies, including the Ministry of Education and the Ministry of National Security (more particularly, the Royal Bahamas Police Force). An impressive 83-page working document was produced to address the challenges associ ated with safety in our schools. It was and still is the position of the PLP that making our schools safer requires a comprehensive strategy that includes the following elements: Opportunities to acquire the knowledge, skills, and atti tudes necessary to maintain a school environment in which conflict and differences can be addressed in a manner characterized by respect and civility; Intervention and support for those who are at risk of, or already engaged in, violent or anti-social behaviour contrary to Ministry of Education stan dards and in violation of the laws of the Commonwealth of The Bahamas; A pro-active approach in identifying and preventing (where possible planned acts of violence in s chools; and An effective response to incidents when they occur one that respects the rights of victims and witnesses, as well as those of the alleged perpetra tors in accordance with the laws of The Bahamas. Due to the nature and extent o f the problem, the PLP said that the Christie administration formed the School Based Policing Unit that was headed by the Police and strategically placed them in the school environment. School violence, they said, dropped as the police in collaboration with school principals, administrative bodies, the Ministrys security teams and the wider public service pre vented, intercepted and detected more incidents that b reached school safety. All forms of weapons were confiscated before students could use such weapons to commit acts of violence. Unfortunately in 2007, when the FNM came to office, they stopped and cancelled the School Based Policing Programme. From 2007 to the present, at least three students were murdered and countless others have sustained life-threatening injuries. Additionally, students have attacked school administrators. In light of the escalating violence in schools, the PLP admonishes the FNM that it is generally accepted that schools must be safe places for learning and teaching. A safe school environment promotes respect, responsibility, and civility. Providing the best possible education for students in a safe school community is a shared responsibility, and it requires a commitment to collaboration, coop-e ration, and effective communication, not only among parents and teachers, or the Ministry of Education, but among all entities charged with the education and protection of the citizens of the Commonwealth of the Bahamas. The government itself must take charge and lead accordingly; return the School Based Policing Programme so that teachers feel safe enough to teach and students feel safe enough to learn. We also remind the Government that there are approximately sixty-five thousand (65,000 tional system. Given this large figure, the issues of crime, anti-social behaviour and violence that affect the educational system, combined with truancy and abuse must be given top priority by the Government. Implementation of the School Based Policing Initiative can be the catalyst that restores the element of safety to schools andp ermits students to focus on attaining their educational goals unimpeded by fear, the PLP said. LOCAL NEWS T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 3 POLICE have launched their probe into the stabbing of a Golden Gatesman as widespread special operations took into custody 11 men over the holiday weekend, accused of various offences. Investigators are also appealing to the public for any information that may assist their investigations into the discovery of an injured man found lying in the street off Soldier Road. The victim was discovered at Haven Subdivision shortly after 1am on Saturday after police received a call alerting them of an incident. Patrol officers at Horseshoe Drive found a 31year-old man with multiple stab wounds to the hand and arm shortly after midnight on Sunday. Circumstances surrounding the incident are still unclear, according Chrislyn Skippings, police press liaison officer, who confirmed that the Golden Gates resident was in stable condition in hospital. Meanwhile, Rapid Strike operations recovered two firearms and ammunition on Saturday.Officers discovered a shotgun with shotgun shells at the Five Star Bar parking lot whileon patrol in the St. James Road and Abraham Street area shortly after midnight. Later that evening, patrol officers arrested a 30-year-old Minnie Street man who was found with a handgun and ammunition. The arrest was made shortly after 11pm in the Peardale area. Sgt Skippings said: Officers proceeded to thearea where they heard the gunshots and observed a male in a blue pants and blue shirt with a handgun. Officers from the Southern Division, includ ing Southern and Grove police stations executed several search warrants on Thursday. Sgt Skippings said: As a result of the operation nine people were taken into custody for various offences such as possessionof dangerous drugs, unlaw ful possession, threats of death and housebreaking. Additionally, a male was arrested on an outstanding warrant of arrest and five people cited for various traffic infractions, said the sergeant. Persons with information that could assist investigations are asked to contact police at 911, CDU at 502-9991, or Crime Stop pers at 328-TIPS. P ROBE INTO S TABBING OF MAN FROM GOLDEN GATES CRIMENEWS PLP calls for return of school based policing THE PARTY said the last PLP administration under then Prime M inister Perry Christie (pictured realised that the Bahamas was experiencing serious problems in its school system. Party speaks out amid escalating student violence

PAGE 4

EDITOR, The Tribune. Today I actually feared for my life. As my son, who was driving my car, pulled over as close to the wall as possible on West Bay Street just before The Nassau Street traffic light all I could see were two very fast, very big menacing motor cycles moving at an outrageous and break neck speed bearing down on us, the one closest to my car missed us by mere inches (trust me I was in the passengers seat!). They were moving! The scary part of this story is that they were two motorcycle policementhis first very dangerous attack was followed by approximately 15 cars, all travelling way beyond any reasonable speed limit for the areatwo more motorcycles weaving in and out of traffic in the middle and another two at the back. This impressive motorcade consisted of several of the large black Chevy Tahoes that the special units drive, several TC plated cars and in the middle of it all, a car flying a Chinese flagI should think that the guest of honour must have been paralyzed with fear! Please tell me that all this menacing behaviour was not to take the Chinese Ambassador back to the airport. Instantly phoned 919, which took over 3 1 minutes to answer, (yes, I did time it commented to the person who answered that it was fortunate that my life had not depended on the speed that the phone was picked up. When I told the respondent o n the phone I was calling to report insane and dangerous driving on behalf of the Royal Bahamas Police Force he could n ot believe what I was saying and asked me several times to repeat myself. At the end of the call he assured me that he would have a word with those boys. It was interesting, if I call 919 to report a broken down car they ask me for my phone number, address and the colour of my house, this time I did not even have to give my phone number, nor was I asked my name, though I gave it! This entire performance with the police and the caval cade was accompanied by horns blaring and sirens screamingJust what do you think the tourists must have felt. It was like an absurd scene out of some inferior American cop movie.The sirens, and horns almost gave a feeling of unrest and revolt, the speed and aggression one of violence. I want to be a staunch supporter of the Royal Bahamas Police Force and I know many individual policemen who I do respect, but I have serious difficulty respecting these dangerous displays on the roads. Some of these young policemen drive their bikes like kids with a new toy that they have not learnt to handle properly; somebody is going to get badly hurt in the process. These officers are supposed to be protecting the Bahamian public not putting us in jeopardy whatever their mission. Far be it for me to tell the B ahamas Government what country should be their new Best Friend, but if they are so worried for their safety then please purchase a helicopter to move them from one place to another, there are less people to kill in the skies. I think it is a very sad reflect ion that today I feared for my life because of how a police officer was driving his vehicle. I beseech the Commissioner of Police to address this issue as soon as possible as I feel that it is important. K im Victoria Aranha Nassau, J une 10, 2011. EDITORIAL/LETTERS TO THE EDITOR PAGE 4, TUESDAY, JUNE 14, 2011 THE TRIBUNE The Tribune Limited NULLIUS ADDICTUS JURARE IN VERBA MAGISTRI Being Bound to Swear to The Dogmas of No Master LEON E. H. DUPUCH, Publisher/Editor 1903-1914 SIR ETIENNE DUPUCH, Kt., O.B.E., K.M., K.C.S.G., (Hon. Publisher/Editor 1919-1972 Contributing Editor 1972-1991 EILEEN DUPUCH CARRON, C.M.G., M.S., B.A., LL.B. Publisher/Editor 1972Published Daily Monday to Saturday Shirley Street, P.O. Box N-3207, Nassau, Bahamas I nsurance Management Building., P.O. F-485, Freeport, Grand Bahama TELEPHONES S witchboard (News, Circulation and Advertising) 322-1986 A dvertising Manager (242 W EBSITE w ww.tribune242.com updated daily at 2pm DALLAS Texas is close to enacting a law that would provide teachers with detailed information about the criminal histories of their students, opening juvenile files that have always been confidential and are unavailable in most states. The legislation, spurred by the fatal stabbing of a high school teacher in Tyler in 2009, is adding to a national debate over whether teacher safety should outweigh the rights of young offenders, who traditionally have moved through the juvenile justice system with their privacy protected. The new disclosure rules were passed by legislators with little public attention last month. A spokeswoman for Gov. Rick Perry said the governor is "thoughtfully" reviewing the measure before deciding whether to sign it. Many juvenile justice experts oppose the new disclosures, saying that they would undercut the purpose of youth corrections allowing young people to move beyond early mistakes to lead normal lives. But many educators insist that teachers are in too much danger. "The bottom line is protecting teachers," said Rep. Jerry Madden, a Republican from the Dallas suburb of Plano, who sponsored the legislation. Texas law already gives schools more background information on students than most states permit. The new law would sig nificantly expand the details released, including accounts of crimes committed. "This is a real departure from traditional juvenile court law," said Sue Burrell, an attorney with the Youth Law Centre, a San Fran cisco-based law firm that serves children in the justice system. More than 4,200 young offenders have been paroled from the state juvenile justice system to enter Texas public schools over the last five years, according to Texas Youth Commission data. About 300 were convicted of aggravated sexual assault or aggravated robbery. No statistics on incidents in schools involving former offenders are available. Under the new measure, law enforcement agencies must provide school superinten dents with "all pertinent details" of the offences committed by parolees, and superintendents must inform teachers. Teachers would also receive written notice of student arrests. Current law allows teachers to be told orally. Texas Youth Commission spokesman Jim Hurley said the agency is already providing more information to schools about paroleesas the result of a recent state attorney gen eral's opinion. Forty-six states require that schools be notified of criminal acts committed by students, although usually not until the student is formally judged delinquent, according to the National Centre for Juvenile Justice. Teachers too often must "see in the dark" when it comes to understanding potential problems posed by students, said Bernard James, a law professor at Pepperdine University who specializes in education issues. What Texas is considering "is a landmark piece of legislation," he said. However, the scope of the measure alarms some juvenile justice advocates. They worry that students who have committed crimes will be automatically placed in alter native education programmes or subjected to other prejudicial treatment. They also point out that the written arrest notifications could haunt students even if they are cleared. "A kid walks into a classroom where the teacher knows all the details of the offence, the teacher would have to be super-human to be open-minded," said Lawrence Wojcik, a Chicago attorney who chairs the American Bar Association's juvenile justice committee. Texas teacher groups strongly support the measure. "We feel like we can deal with things when we're in the know," said Grace Mueller, a middle school teacher in San Marcos and an officer with the Texas Classroom Teachers Association. "When you're blindsided, that's when you get fearful or put yourself or some one else in harm's way." The issue is particularly sensitive for teachers in Tyler, where special education teacher Todd Henry was stabbed to death in his classroom by a 16-year-old student who had been released by the youth commission. "All the teachers felt a little betrayed," said Barbara Davis-Staley, an elementary school teacher in the district. "We were wondering, how many more students do we have sitting in our classrooms that have been vio lent or have mental problems we don't know about?" The student who stabbed Henry had been released because he was suffering from schiz ophrenia and other psychological problems that couldn't be treated in custody. The district was told the boy, who had a criminal record as well as special needs, would be fine as long as he was "stabilized medically," said Tyler Superintendent Randy Reid. Reid said he is sceptical how much a school can do even if it knows more. "Certainly, the new guidelines would help us be more alert to what we're getting," he said. "But if these are children who are dangerous to be around, we're not really equipped to handle that." (This article was written by Danny Robbins of the Associated Press). Dangerous police driving made me fear for my life LETTERS l etters@tribunemedia.net Texas teachers and student criminal histories EDITOR, The Tribune. With your kind indulgence, I shall be grateful if you would allow me space in your valuable column to further articulate my thoughts on the continuing dilution of our access to land in New Providence and Paradise Island. You will note that over the last two decades total access on Paradise Island and New Providence has been eliminated. And I will seek to guess what percentage of land access has been elimi nated. Allow me to qualify my comments. Firstly, let us examine Paradise Island. To the east, there used to be an International airport, which was obviously accessible to the travelling public and otherwise. We all know that area was re-devel oped and converted to a gated community. A public area consist ing of public roads allowed by the department of Town Planning to be converted to a private area. Bahamians can no longer move freely on those roads. Secondly, Paradise Island Drive was either given to the developer and the rest is history i.e. the Convention Centre was built. Thirdly, to the east, free flowing access has been prevented and what used to be, I believe, public roads are now private roads. Then there is the luxury community Albany in the southwestern part of New Providence. We are all aware of what happened to Adelaide road and how it was eliminated and a new highway constructed. Again, a couple of miles of public road given to a private developer to enhance its development. Then there is the mega Baha Mar Resort development. And we are already witnessing the road realignment in progress. In a few months, one will no longer be able to move freely along West Bay Street because it will no longer exist. Instead, we will be moved further inland and forced to use an alternative route. Yes, again public roads closed off and given to private developers to enhance its development. The following comments are not based on any scientific research but I would guess that our access on Paradise Island has been depleted by about 40 per cent and our access on New Providence has been depleted by about 10 per cent. I believe that this elimi nation of access ought to be of utmost concern to Bahamians because we continue to witness a depletion of access granted to Bahamians to move freely throughout their own country! PAT STRACHAN Nassau, June 3, 2011. WE CONTINUE TO WITNESS A DEPLETION OF ACCESS GRANTED TO BAHAMIANS

PAGE 5

THE Free National Movement was branded a government asleep at the wheelby the PLP yesterday for failing to continue with their p lans to discontinue the b arging of water from Andros by the end of 2007. With the current government now stating that they intend to go ahead with thisp lan to discontinue the serv ice by the end of this year, 2 011, the PLP said that the FNM has squandered possib ly some $16 million in savings that could have been a ccrued from 2007 till now. This cost savings could have been utilized to under-w rite badly needed potable water to many communitiesi n the Family Island, including S outh Andros, extension of w ater mains on Long Island, San Salvador, Exuma, East & West Grand Bahama etc. This is a clear example of a government asleep at the wheel when it comes to thep rovision of vital services to impoverished areas and clearly supports the characterization of a non-visionary government that doesnt put the crucial interests of Bahamia ns first, the party said. T he PLP added that they are absolutely amazed at the timing of the recent state-m ents by the Prime Minister and the Minister of State fort he Environment, Phenton Neymour, with regards to the f ate of the North Andros barging programme. The PLP wishes to remind t he FNM of the plans left in place to discontinue water barging by 2007 and proactively address the water and waste-water demands of residents of New Providence, Baha Mar and other pending projects. If this administration, u nder the watch of the Minist er of the Environment and the Prime Minister, had followed through with the plans, the Water & Sewerage Corporation would have accrueda minimum of $16 million in s avings from 2007 to now, t he PLP said. LOCAL NEWS T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 5 4XDOLILFDWLRQVRI'HDFRQV POLICE are investigating the drowning of a man believed to be in his late sixties. The victim was reported to have been swimming with family members at South Beach shortly after 4.30pm on Friday when the incident occurred. The man was pronounced dead at hospital by emergency medical services. POLICE are questioning a 28-year-old man who turned himself in in connection with a shooting incident last week. The man, a resident of Toote Shop Corner, was arrested shortly before 11am on Thursday at the Southern Police Station. According to police, the incident took place at a home on Fritz Lane off East Street early Monday morning. The woman victim was reported to be in stable condition at hospital. MAN DROWNS IN WATERS OFF SOUTH BEACH PLP:FNM asleep at the wheel over barging of water from Andros THE PLP said they are absolutely amazed at the timing of the recent statements by the Prime Minister and the Minister of State for the Environment, Phenton Neymour (pictured Party claims govt has possibly squandered some $16m in savings

PAGE 6

SANDALS Resorts International expressed deep concern at the approach being taken by the Bahamas Hotel Maintenance and Allied Workers Union in relation to Sandals Royal Bahamian Hotel. The attempt by the union to use the recent ruling of the Privy Council, which merely validated the registration of the Bahamas Hotel Maintenance and Allied Workers Union (BHMAWU exert pressure on the Ministry of Labour to reinstate workers who are no longer employed by the hotel, clearly oversteps the boundaries of the Privy Council decision, according to Patrick Drake, the General Manager, Sandals Royal Bahamian. The Privy Councils decision concerned the Registrars failure to Gazette the intended name of BHMAWU at the time of its registration, and afford the Bahamas Hotel Catering and Allied Workers Union an opportunity to object to the similarity of the name. The Privy Council ruling has no connection to the workers who were separated from Sandals in 2008 and 2009. Further, there is no record of a dispute at the Ministry of Labour with regard to these workers. The fact is that the employees in question were made redundant as a result of the sharp decline in the hotel business which forced a number of hotels to downsize and cut s taff, one hotel by as much as 800 employees. It is instructive to note that while the BHMAWU has been trying to pressure the Ministry of Labour, to try to reinstate persons who are no longer employed by Sandals, the union has been dragging its feet on providing the necessary information it promised to address the claims of the existing workers of Sandals going forward. At a preliminary meeting on March 24, 2011, the BHMAWU promised to submit information on wage and other issues to enable the management of Sandals to assess the demands and to respond accordingly. However, quite incredibly, a lack of agreement on a venue has delayed a follow-up meeting taking place, he said. This situation, Mr Drake said, prompted Sandals to write to the union on Monday of last week with respect to an agreement on a meeting place and for the union to submit the outstanding documentation with respect to its claims and wage package. It was not until Wednesday of last week, he said that the BHMAWU informed them of the availability of a proposed venue for the meeting. However, up to until yesterday he said, the union still had not submitted all the required documentation. In the meantime the BHMAWU has been attempting to paint a false picture of the situation to the public and it has raised doubts as to whether the workers who were separated from Sandals in 2008 and 2009 received their due compensation. I would, therefore, like to make it clear that Sandals has always respected and adhered to the legal requirements and provisions for our employees. We, therefore, continue to await the information from the BHMAWU to properly address the relevant issues. In the meantime, we will not be intimidated by efforts to force any action that has no legal standing. We strongly believe that the adverse economic climate facing The Bahamas and indeed the entire world requires a paradigm shift, from old style industrial relations politics of blind oneupmanship, to a more enlightened approach that is fully cognizant of the realities of a fragile and unstable global economy. Ultimately, only such an approach will ensure the protection of the interests of all concerned. It should be clearly understood that at all times, the primary concern of Sandals is the welfare of our employees and we will not allow anything to jeopardise their future, he said. LOCAL NEWS PAGE 6, TUESDAY, JUNE 14, 2011 THE TRIBUNE O O O O O Sandals voices concern over union approach Attempt to exert pressure to reinstate workers oversteps the boundaries of Privy Council decision

PAGE 7

LOCAL NEWS T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 7 GRADUATES The 2011 graduating class of Centreville Primary School makes courtesy call on Gove rnor-General Sir Arthur Foulkes and Joan Lady Foulkes on Wednesday, June 8, at Government H ouse. Seated from left are: Samuel Johnson, school board member; Bella Mae Stubbs, principal; S ir Arthur; Lady Joan; and Luther Nottage, vice principal. Standing far left: Devonnia Brown-Armaly, grade 6P teacher; and Dorelle Newbold, guidance counsellor. Standing far right is Remelda Thompson, grade 6C teacher. Raymond A. Bethel /BIS C ENTREVILLEPRIMARYSCHOOLGRADUATESVISITGOVERNORGENERAL

PAGE 8

BAHAMIAN national security and law enforcement officials are well-trained and up to the challenge of dealing with transnational crimes such as drugs, firearm and human smuggling, Minister of National Security Tommy Turnquest told a visiting delegation from the Peoples Republic of China. Transnational crimes are said to be among some of the more fundamental issues driving crime and violence particularly violent offenses such as murder and armed robbery not only within the Bahamas, but the region. Mr Turnquest said a prearranged dialogue on national security and law enforcement matters between Bahamian law enforcement and national security officials and their Chinese counterparts, was essential to future Bahamian/Chinese relations as the two countries share very similar national security concerns in a number of areas. The dialogue followed a recent stint in the Peoples Republic of China by two officers of the Royal Bahamas Defence Force, which officials say will lead to additional collaboration and cooperation between Bahamian national security and law enforcement officials and their counterparts in China and vice-versa. Mr Turnquests comments came during a courtesy call by Wang LeQuan of the Peoples Republic of China at Police Headquarters, East Street. Deputy Prime Minister and Acting Attorney-General Brent Symonette was there as well. Mr Wang is a member of the Political Bureau of the Communist Party of China (CPC the deputy secretary of the Polit ical and Legal Affairs Commission of the CPC. Mr Wang began a three-day visit to the Bahamas Thursday. He was accompanied by national security and law enforcement officials from the PRC. Bahamian and Chinese national security and law enforcement officials are expected to exchange best practices on national security and law enforcement matters. The Bahamas and the Peoples Republic of China share similar issues primarily because of the wide geographical make-up of our country whose islands are spread out over 100,000 square miles of water, Mr Turnquest said. One such issue which remains a challenge not just for Bahamian national security and law enforcement officials, but law enforcement officials globally, is that of illegal drug and firearms trafficking, in addition to poaching of our maritime borders, he added. Mr Turnquest said the country has seen some successes in interdicting substantial quantities of illicit drugs and firearms, but that there are many more wars to be won on that front. He said the government remains committed to fighting transnational and other crime within its territory and has implemented, and will implement, addi tional strategies that include the use of updated technology and proven methods. He added that government continues to commit financial and other resources to the upgrade of its law enforcement and national security agen cies, in an attempt to provide them with the technical and human resources, and training, to effectively deal with transna tional crime and the fall-out from it. Mr Turnquest applauded the efforts of the Royal Bahamas Police Force and the RBDF, and the countrys other national secu rity and law enforcement agen cies, for the work they have done in the war on transnational crime. Our police force and defence force are well-trained, along with our other national security and law enforcement agencies, and so I have every confidence that they are up to the challenge, and will continue to be up to the challenge, of dealing with these issues. I welcome the dialogue we will continue to have on both legal and national security mat ters, Mr Turnquest added. LOCAL NEWS PAGE 8, TUESDAY, JUNE 14, 2011 THE TRIBUNE www.rbcroyalbank.com/caribbean Trademarks of Royal Bank of Canada. Used under licence. NOTICERBC Royal Bank (Bahamas) Ltd. INVITES TENDERSRBC Royal Bank (Bahamas) Ltd. invites tenders for the purchase of the following: AllTHAT piece parcel or lot of land being Lot No. 112 situate in Westridge Estates Subdivision situate in the Western district of the Island of New Providence one of the islands of the Commonwealth of the Bahamas. PropertySize: 22,000 sq. ft. Building Size: N/A This property is being sold under Power ofSale contained in a Mortgage to RBC Royal Bank (Bahamas) Ltd. All offers should be forwarded in writing in sealed envelope, addressed to the Manager, Royal Bank Commercial FinancialServices, P.O. Box N-7549, Nassau, Bahamas and markedTender 7939. All offers must be received by the close of business 4:00 p.m., 17th June, 2011. Cable BahamasLtd. NassauBahamas RobinsonRd.at Marathon JOBVACANCYThe position of Headend Digital Engineer requires an engineer experienced in both the CATV and IP network industries. The successful candidate would be responsible for the support of various aspects of the companys video product. The candidate must have extensive experience with the installation, operation, and troubleshooting of the Motorola DAC6000 Digital video platform including peripherals such as RADDs, SEMs, OM1000s and RPDs. Other core responsibilities include b ut are not limited to the following: troubleshooting of statistical multiplexers such as Big Band BMR1200. troubleshooting of NVOD and Ad Insertion servers such as Seachange. t roubleshooting of various models of Cisco and Extreme routers and switches. signal level measuring equipment including but not limited to spectrum analyzers, volt-ohm meters, wave form monitors, optical power meters, laser sources, VITs generators, ASI analyzers, and Mpeg Analyzers. b ut not limited to coax and optical cable transmission line theory, receivers, modulators, demodulators, encoders, multiplexers, edge QAM d evices, ampliers, video/audio servers, switches, and passive equipment. measurement techniques, network transport methods (SONET, T1, DS3), network management concepts and digital advertisement insertion. Headend experience at a cable company would be a big plus. Cable Bahamas Ltd.s strategy is to hire experienced sta to work in-house, side by side with local work force to ensure the transfer of knowledge d uring the design, construction and implementation of a world-class telecom facility. Resumes should be sent electronically to richard.adderley@cablebahamas.com by June 13, 2011.Headend Digital Engineer WANG LEQUAN (third left Republic of China (PRC calls on Deputy Prime Minister and Acting Attorney-General Brent Symonette and M inister of National Security Tommy Turnquest on Friday morning as part of his official visit to the country. Also pictured (from left son Greenslade; Brent Symonette; Wang LeQuan; Tommy Turnquest; Archie Nairn, permanent secretary, Office of the Attorney-General and Carl Smith, permanent secretary, Ministry of National Security. WANG LEQUAN of the Peoples Republic of China (far right Greenslade following a courtesy call on Deputy Prime Minister Brent Symonette and Minister of National Security Tommy Turnquest at the Paul H Farquharson Conference Centre. Mr Turnquest is shown first left. (BIS Local officials up to the challenge of dealing with transnational crime M inister speaks to delegation from Peoples Republic of China

PAGE 9

THE proposed restoration of Saunders Beach will expand the area from 1.5 acres to five acres, increasing the sanded beach capacity six-fold to accommodate at least 6,000 beach-goers from the western end. 'The public is aware that the western end of the beach appears to be enjoying a significant increase following the years usual winter storm erosion. Accordingly, the proposed expansion will add additional beach area at high tide of approximately three and a half acres, Minister of the Environment Earl Deveaux told a recent town meeting at the Sheraton Nassau Resort. Mr Deveaux gave insight into the governments vision of the future for Saunders Beach, as it ties into the Downtown Redevelopment Project. Government is planting more native shade trees along the length of the dune, to provide an escape from the sun for beach guests. A sand fence will be installed to collect the normal drift. Mr Deveaux also cknowledged the expertise of the BEST Commission's environmental engineers for their workon the project. Saunders Beach restoration and expansion will have negligible adverse environmental impact on the marine environment and will greatly enhance and complement the upland environment. In fact, the storm surge usually experienced will be mitigated, the drainage systems enhanced, and is likely that more attractive snorkeling will result from the protec-tion of the boulders used to create the whale tales, he said. We anticipate more vehicular traffic as a result of this restoration on the eastern end. And I urge motorists to exercise caution as beach-goers cross the street. Mr Deveaux reflected on his memories of Saunders Beach and Western Esplanade, as a place where he and his brother bonded doing track and field wind sprints, where he camped overnight with friends and roasted marshmallows and hot-dogs, and spent quiet moments of relaxation by the sea. He believes all Bahamians should experience the peacefulness of the coastal areas of New Providence. Through this government, I am very pleased to be able to assist in passing on to this group of Bahamians an enhanced, unique beach experience. Restoring and improving these outdoor areas is a natural and logical sequence to our growth and development and I commend it to you, said Mr Deveaux. He expressed concerns about the increase of environmental health issues as beach-goers buy, sell, and carry food and liquor to Saunders Beach. He said the increase of littering in beach areas would attract rodents and flies and invite community health issues. He said Saunders Beach residents should welcome community policing to ensure the beach maintains its family friendly environment with no cursing, drinking and fighting. LOCAL NEWS T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 9 The Mercedes-Benz C-ClassYour most enjoyable drive ever.The Mercedes-Benz C-Class is a pleasure tobehold offering a new interpretation of d riving pleasure. Its taut lines lend it an a ir of effortless superiority while the wide radiator grille and distinctive rear section announce a vehicle with a real presence and dynamic personality. Few cars can compete with its ability to adjust so many facets of its character from the interior to the drive technology so quickly and precisely in response toexternal conditions and your own p articular needs. The key to this flexible r esponse is the standard-fit Agility C ontrol Package which includes selective damping. The interior offers noticeably more space and a more distinctive atmosphere tosuit your taste. As you will see, the C-Class is the perfect embodiment of the Mercedes-Benz philosophy.Tyreflex Star MotorsWulff Road, P. O. Box N 9123, Nassau, The Bahamas, Tel 242.325.4961 Fax 242.323.4667OUR PARTS DEPARTMENT IS FULLY STOCKED WITH EVERY COMPONENT NECESSARY TO ENSURE THAT YOUR MERCEDES RUNS TROUBLE FREE. TRAINED TECHNICIANS ON DUTY. SAUNDERS BEACH EXPANSION WOULD INCREASE THE AREA FROM 1.5 TO 5 ACRES EARL DEVEAUX Minister of the Environment, spoke about the governments vision for the future o f Saunders Beach and how it ties into the Downtown Redevelopment Project. (BIS

PAGE 10

UNDER the theme, Pressing Towards Our Future, the Gerald Cash Primary Schoolh eld its annual prize-giving ceremony for over one hundred s tudents who are moving to the Junior High School level on Fri day 10th June, 2011 at the Golden Gates World Outreach Ministries Church located on Carmichael Road. In attendance were the Min i ster of Education Hon. Desmond Bannister, the Dis trict Superintendent Mrs. Olga Richards, the school's principal Mr. Albert Clarke, faculty members, along with scores of parents, family members and friends. The keynote speaker at the event was Superintendent Stephen Dean, the Director of the Royal Bahamas Police Force, National Crime Preven tion Office. Supt. Dean in his address e ncouraged the students to strive for excellence in order to be the leaders of our Country in years to come. Not be afraid to make mistakes, for mistakes you will make, be honest as students, and be true to your t eachers, true to your neighbor and true to your God. Supt. Dean encouraged the students to control their minds to enable them to make the right choices. According to Supt. Dean A goodly number of crimes that are being com mitted today are done by youngp eople and they make a considerable contribution towards the statistics at the Fox Hill Prisons. These young persons, some not all, were able to makea choice. Additionally, Supt. Dean told the students, the road to success is all yours. It will not bey ours if you begin to smoke drugs or use cocaine. It will not be yours if you get arrested or pregnant before you have com pleted your education. It will not be yours if you drop out of school. The success of students in life can be traced back to what they did at home, ins chool and in Church. In closing Supt. Dean com mended the Principal Albert C larke and Faculty members for the outstanding investment they have made in the life of the students. Parents were also commended for their support over the years and urged to be consistent in the involvement o f their child's education. And finally he implore stu dents to continue to work and develop positive study habits, seek God, make him the center in life so at the end of the day everybody will be proud of their achievements. Principal Mr. Albert Clarke i n his remarks thank the Education Minister District Super intendent, faculty members for their overwhelming support of the school over the years and lay claim that Gerald Cash Pri mary School is a place where they set the standard of excellence. E ducation Minister Hon. Desmond Bannister com mended the principle, faculty members and students for the standard of excellence they continue to set year after year. Minister Bannister in the spirit of generosity presented a laptop computer to the most out-s tanding student Grenique Brown. LOCAL NEWS PAGE 10, TUESDAY, JUNE 14, 2011 THE TRIBUNE 5(48,5(0(176 4 0F'RQDOGVRIIHUVH[FHOOHQWEHQHWV NATIONAL CRIME PREVENTION OFFICE DIRECTOR ADDRESSES PRIMARY STUDENTS Gerald Cash Schools annual prize-giving ceremony SUPERINTENDENT Stephen Dean, the Director of the Royal Bahamas Police Force, National Crime Prevention Office, speaks at the ceremony.

PAGE 11

By CONSTABLE 3011 MAKELLE PINDER ITS SUMMER TIME again and swimming is an activity that both kids and adults enjoy, during this time of the year. Watching other people swim looks very easy; but, swimming whether done in ones leisure time or competitively, is an activity that requires skill and training. Tragic water accidents occur because people lack knowledge and training and engage in activity far above their experience level. Having the appropriate knowledge and training can make swimming safer and more enjoyable. Practice the following swimming tips: Learn how to swim and do not allow children who have no knowledge of swimming in or around the pool. N ever allow children to swim alone without an adult supervision. Enclose your pool with high fences, which can be locked. Never swim alone and, at get-togethers, designate someone as the pool watch guard. Adults can rotate this duty. If you have a backyard pool, install an alarm on doors that lead to the pool area. Don't dive into unknown water or into shallow breaking waves. I f you are unable to swim out of a strong current, signal for help. Rely on your swimming ability rather than a flotation device. Look for, read and obey all beach safety signs and symbols. If caught in a rip current, swim sideways until free, don't swim against the current's pull. Alcohol and swimming don't mix. Protect your head, neck, and spine don't dive into unfamiliar waters feet first, first time. Follow regulations and lifeguard directions. Swim parallel to shore if you wish to swim long distances. If in doubt, just stay out! Remember: Safety is everyones concern. Be safe Bahamas and enjoy your summer! T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 11 Royal Bahamas Police Force National Crime Prevention Office swimming safety tips CONSTABLE 3011 Makelle Pinder

PAGE 12

The association, he said, would be responsible (witha utonomy) for all the stalls, all the licensing and inspection could come under one umbrella. The way things are now there is no way to effecta ny serious change. Most v endors are not making enough to be able to do it on their own. In addition to the 11 unlicensed stalls, Central Division officers also arrestedt wo people who had oust anding warrants of arrest pending. In an operation that lasted some six hours on Sunday, officers cited drivers and hauled vehicles and motorc ycles from the area for vari ous traffic infractions, said Chrislyn Skippings, police press liaison officer. Sgt Skippings added: Officers of the CentralD ivision sent a strong message to stall operators,p atrons and visitors going o nto Potters Cay Dock yesterday, that you will obey the law or face the conse-q uences. The PCDA represents a total of 54 vendor stalls that line the two sides of the area and include produce vendors who occupy the middle sect ion. I n order to obtain a licence, a potential vendor must provide authorization l etters from the Ministry of A griculture, National Insura nce Board, department of Environmental Health, police and the PCDA. According to Mr Rolle, licensing issues centreda round the procurement of a ll the necessary permits to complete the application. Most of the vendors are in a lot of debt due to the economic recession, said Mr Rolle, and were late ont heir renewal because of outs tanding bills from the government. As of now, all of the vendors are straight with National Insurance. At the dock yesterday, vendors agreed that stalls should not be allowed too perate without proper licensing; however, they also insisted that their circumstances should be also takeni nto consideration. R oland Bell, 72-year-old owner of Hot Spot, said: I told them, I said youre supp osed to do this in the right way. They (vendors the licence wouldnt haveb een ready until (today they know that the police know. But you have to take it under consideration, when you take bread out the peop le mouth you asking for w ar. M r Bell, who claims to be the oldest vendor at Potters Cat Dock, said: They need to change a lot of this, but the only way they can get itt ogether is if the government c omes together with the people. If they renovate the place nice, tourists will come but if you dont do it right, they aint coming. All the people stall (fruit a nd vegetable vendors) rott ing down, they (government) have the place all dig up, Mr Bell added. Fix up the place, if you (government) dont fix up the place nothing would happen. Rodney Heastie, another s enior vendor, said: Where are the civil servants who are supposed to regulate this? These licences expired sixm onths ago, if you lock a c hild up in the house for six months and come back, what do you think would happ en? The association has planned to meet with theL icensing Department this week to address the out standing renewal applications. LOCAL NEWS PAGE 12, TUESDAY, JUNE 14, 2011 THE TRIBUNE O O O O O O O O O O O O O Mr McCartney in the next general election. "Both Mr Ingraham and Mr Christie said it's FNM and it's PLP I challenge them to run against me in Bamboo Town. Leaders running in one area, leaders against leaders. (They say Town is their town let's go for it and see whose town it is." Mr McCartney, leader of the newly formed Democratic National Alliance, also dared the Boundaries Commission to leave the borders of Bamboo Town untouched to ensure a fair fight. "Leave the boundaries the way they are if we see a change in the boundaries well they certainly can't say that's Bamboo Town anymore." After Mr McCartney resigned from the FNM earlier this year, Mr Ingraham with a few of his Cabinet ministers held a meeting in the area and apologised for sending a man who "quit" on them. "I thought he (Mr Ingraham since he came to Bamboo Town to apologise and said that Bamboo Town was FNM," Mr McCartney quipped. He also challenged members of the two major parties to compare their records as MPs to his own. "Those who came in my constituency to apologise and they've not done hardly anything in their own constituency. My God, shame on you." Mr McCartney said his party attracted more than 1,000 members in the 24 hours after its May launch and now has "thousands" more of supporters siphoned from both the PLP and the FNM. "Our membership shows that persons coming aboard are both PLPs and FNMs, stalwart councillors and Meritorious Council Members, independents and otherwise," said Mr McCartney at a press conference at DNA headquarters on Prince Charles Road. He told The Tribune he has no plans to abandon his party and go back into the FNM's fold if the DNA has a dismal showing at the polls. Instead he said the party will decide whether or not to elect a new leader who can head a successful election campaign. "I am not a career politician. I got into politics when I was 40years-old, I will not go back to the FNM and I will not join the PLP. If, God forbid, we are not successful the party will determine (what's next we got a number of other persons here who can move forward. "I would remain with the party either in the background or as an MP, but certainly they can vote on who they wish to take over." SEEPAGETWO F ROM page one DNALEADER CHALLENGES PM, CHRISTIETO RUN AGAINST HIM FROM page one POLICE CRACKDOWN ON POTTERS CAY DOCK

PAGE 13

A MEMORIAL service will be held for Rotarian Harold Tony Hing-Cheong at 6pm tomorrow at St Matthews Anglican Church. Mr Hing-Cheong, who joined East Nassau Rotary in May 1964, was described by LOCAL NEWS T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 13 ed food and clothing which she sent to Haiti. Singed piles of cloth ing and melted buckets, said to contain meat, littered the area. Up to press time, the bodies had not yet been identified. T he police appealed to the public to establish a fire safety plan as investigations continue into the third fatal blaze in less than two months the second to hit the Golden Isles constituency. Persons were advised to unplug unused appliances each night before going to sleep. Chrislyn Skippings, police press liaison officer, said: Unplug any appliance that is not in use, i.e. TVs, computers, stereos andensure that all candles are extinguished. An early morning blaze claimed the life of a three-year-old girl o n May 24. The young victim died at hospital where she was listed in critical condition following the fire in a Haitian Village off Golden Isles Road. Two weeks earlier, four of seven children were killed in a trag ic blaze at their Sandilands Village Road home on May 11. The three surviving children, treated for severe smoke inhalation and burns to the body, remain in serious condition at hospital after they were found in an "unresponsive state", huddled togeth er in an eastern bedroom of the apartment on Sandilands VillageR oad. According to police, the children were left alone in the house by their father, an electronics repairman who operated his business out of the family's home. At the time, investigators suspected the fire was caused by a mal functioning computer; however, it was unclear up to press time whether or not police have concluded their probe. FROM page one TWO DEAD AFTER FIRE not requested any campaign money from China nor was any funding offered to the governing party. "The FNM party has neither asked for, nor received, or received any offer of financial assistance from the governing party of China nor would or could any such assistance or offer be accepted if it were to be made, which it has not," said Mr Bethel. Both the FNM and the PLP have spoken of the need for campaign finance reform but have not put the machinery and legislation in place to regulate the area, said Mr McCartney. He demanded that both major parties unveil their campaign financing sources. He said the DNA party will follow suit once the government leads the way. "We have an election coming up and we would like for them not to speak about it, we want them to live it and show it. If they are so interested in doing it, start it now, be transparent. Let all parties do it. We are willing to do it and we would like for them as the governing party to take the lead." The Bamboo Town MP said his new organisation has not received contributions from foreigners. "No foreign entity has donated to the campaign," he told The Tribune. Mr Wang and his delegation made courtesy calls on Governor General Sir Arthur Foulkes, Deputy Prime Minister and Minister of Foreign Affairs Brent Symonette, National Security Minister Tommy Turnquest, Police Commissioner Ellison Greenslade, President of the Senate Lynn Holowesko and visited the Free National Movement headquarters. The delegation toured the national stadium, whose construction was paid for through a gift from China, and the Clifton Heritage site before leaving the country. SEEPAGETWO the most hotly contested nominations as MP Anthony Moss could be facing a challenge from at least three other party supporters Dwight Hart, Dan ny Strachan, and Randy Curt is. The areas former Member of Parliament George Smith, is also reportedly being pushedby some within the community to once again put his name forward as a candidate citing thepoor performance they claim is currently being put forwardby Mr Moss in the House of A ssembly. While some within the PLP look on these challenges as proof that democracy is alive and well within the PLP, other party faithful believe that it shows a level of disrespect to the current MPs who have sacr ificed much to represent their constituents. A lot of PLPs were out there bad mouthing Keod Smith for instance for saying that he was interested in running in South Andros. But what these other contests prove is that it should not be that b ecause you are the areas MP you should automatically get the re-nomination. The people of these constituencies should get the best representation, the source explained. FROM page one THREE PLP MPS SET FOR CHALLENGES his club as "Mr. East Nassau Rotarian cum laude." No Rotarian, said the club, has volunteered for more jobs no task was too small and no job too difficult for him to tackle willingly and enthusiastically. Not one for seeking the limelight, it took many years to persuade Tony to accept the Presidency... but he was President 1982/83 and enjoyed a very successful year, said club president Joanne Smith. He became a Paul Harris Fellow in 1979 and received the Ambassador Award in 1991. Born in Georgetown, British Guiana (now Guyana), Mr Hing-Cheong came to the Bahamas in 1945 on a Colonial Service transfer to the then Crown Lands Office as Surveyor and Deputy to the Crown Lands Officer. In 1972 he was appointed Director of Lands and Surveys and was made Surveyor General in 1975. He retired in 1984 from the Bahamas Government Service after 42 years of continuous public service. He continued to work for the welfare of the Bahamas and was well known in several local charitable organizations, especially The Bahamas Girl Guides Association. Pre-deceased by his wife Estelle, their union produced two children. FROM page one B RAN: IS CHINA FINANCING FNM? MEMORIAL SERVICE FOR HAROLD TONY HING-CHEONG

PAGE 14

INTERNATIONAL NEWS PAGE 14, TUESDAY, JUNE 14, 2011 THE TRIBUNE GUVECCI, Turkey Associated Press SYRIANS STREAMED across the border Monday into neighboring Turkey, finding sanctuary in refugee camps ringed by barbed wire and offering a frightening picture of life back home where a deadly crackdown on dissent is fueling a popular revolt. Turkey's prime minister has accused Syrian President Bashar Assad's regime of "savagery," but also said he would reach out to the Syrian leader to help solve the crisis. Still, many of the nearly 7,000 refugees in Turkey say they expect their government to inflict only more violence and pain. Refugees were pouring across the border to flee a c rackdown Sunday that sent elite forces backed by helicopters and tanks into Jisr alShughour, a northern town that spun out of government control for a week. Troops led by Assad's brother regained control of Jisr al-Shughour on Sund ay, and residents ran for their lives. In Guvecci, two Syrians gave a bleak picture of life across the frontier. "There are 7,000 people across the border, more and more women and children are coming toward the barbed w ires," said Abu Ali, who left Jisr al-Shughour. "Jisr is finished, it is razed." Turkey and Syria once nearly went to war, but the two countries have cultivated warm relations in recent years, lifting travel visa requirements for their citizens and promotingb usiness ties. Turkey and Syria share a 520-mile (850 kilometer der, which includes several Syr ian provinces. Refugees and rel atives on both sides appeared to be crossing unimpeded around the village of Guvecci. Syrian refugees staged opena ir noon prayers behind wire fences Monday at the Boynuyogun refugee camp inside Turkey. At another camp in the town of Altinozu, refugee fam ilies flashed V for victory signs as police guarded their com pound. Turkish authorities have b locked the media from enter ing the camps. Turkey appears to be trying to limit the public ity of the crisis even as Prime Minister Recep Tayyip Erdogan, who won a landslide victory in Sunday's general elections, says he will speak to Assad soon. Support Despite their support of NATO intervention in Libya, Arab governments have not responded to Syria's crackdown, fearing the chaos that could fol low Assad's fall. The country has a potentially explosive sectarian mix and is seen as a regional powerhouse with influ ence on events in neighboring Israel, Lebanon and Iraq. A reported mutiny in Jisr alShughour posed one of the most serious threats to the Assad regime since protests against his rule began in midMarch. Assad has made some concessions, but thousands of people demonstrating weekly inspired by protests in Tunisia, Egypt and elsewhere say they will not stop until he leaves power. The Local Coordination Committees, a group that documents the protests, said government snipers have killed at least 10 people in the nearby v illage of Ariha in the past two days. Syria's government has said 500 members of the security forces have died, including 120 last week in Jisr al-Shughour, although it has denied a mutiny. More than 1,400 Syrians have died and some 10,000 have beend etained in the government crackdown since mid-March, activists say. The Obama administration condemned the Syrian crack down. "We understand the Syrian government is instructing its security forces to use tanks andh elicopter gunships against Syrian people," State Department spokesman Mark Toner told reporters in Washington. "What continues to occur is absolutely revolting, and we condemn these barbaric acts in the strongest possible terms." Two of the refugees in Turkey said the military is killing soldiers who refuse orders to fire on protesters. Military "Assad's men are killing any one within the military, police or others who don't obey their orders blindly," said a man who gave his name as Abu Ali. "They are killing those who want freedom." Another Syrian, who gave his name as Ammar, had a similar allegation, though neither man offered any specifics. On Monday, Syria imposed a travel ban on one of the pres ident's cousins, a move that appeared to be an attempt to show Assad is serious about investigating the bloodshed. State-run SANA news agency says the ban was imposed on Brig. Gen. Atef Najib, who ran the security department in the southern province of Daraa. The uprising erupted there in mid-March after the arrest of 15 teenagers who scrawled anti-government g raffiti. Judge Mohammed Deeb alMuqatran of the Special Judicial Committee said the travel ban is precautionary in order for Najib to be available for questioning. Al-Muqatran was quoted as saying on Monday that "no oneh as immunity, whoever he is." In an apparent anticipation of more refugees, workers of the Turkish Red Crescent, the equivalent of the Red Cross, began building a fourth tent camp Monday near the border. On Monday, women in the camp, many of them wearingc olorful robes and head scarves, tended to children as refugees tried to dry laundry under a cloudy sky. BEHIND BARBED WIRE, SYRIANS FINDING REFUGE IN TURKEY A SYRIAN REFUGEE walks in the tent compound in Boynuyogun, Turkey, near the Syrian border, Monday. According toTurkey's Foreign Mini stry the number of Syrians that fled their country seeking refuge in Turkey climbed to nearly 6.000, prompting Turkish authorities to start building a the fourth tent compound in the border area. (AP ADDIS ABABA, Ethiopia Associated Press SECRETARY OF STATE Hillary Rodham Clinton pressed some of the world's last remaining friends of Moam mar Gadhafi to abandon Libya's strong man and join the growing international demand for him to cede power. She told African nations that their solidarity with the Libyan people could make the difference for a peaceful future. Culminating a volcano-shortened trip to the Gulf and three African nations, Clinton told diplomats at the African Union headquarters in Ethiopia's capital that they needed to recognise that Gadhafi forfeited his legitimacy to rule by attacking his own citizens. It represented a difficult call for uni ty. Gadhafi still has many friends in Africa after providing decades of military training and patronage for groups fighting apartheid and colonialism. "Your words and actions could make the difference in bringing this situation to a close and allowing the people of Libya to get to work rebuilding their country," Clinton told African officials in Addis Ababa. She said the world needed African leadership to end the standoff between opposition forces and Gadhafi's troops. For Clinton, the emphasis on the Libyan leader provided a full circle for a one-week voyage that began in the United Arab Emirates, where she prod ded NATO countries and Arab governments participating in the U.N.-mandated military mission against Gadhafi to increase the pressure on him to leave power and increase their contacts with the Transitional National Council. After stops in Zambia and Tanzania, she was to have spent Monday night in Addis Ababa. But she was forced to leave the Ethiopian capital a day ahead of schedule when a volcano eruption in nearby Eritrea sent an ash cloud over parts of East Africa. Officials said the airport in Ethiopia's capital was to be closed, and Clinton faced being strand ed if she had proceeded with her planned events. Clinton, however, isn't expected to return to Washington significantly ahead of her originally planned land ing early Wednesday morning. The timing of Clinton's return is being closely watched because her traveling party includes senior aide Huma Abedin. Abedin is the wife of embattled New York Rep. Anthony Weiner, who is facing calls to resign because of sexually-charged messages and photos he sent to several women online. Weiner reportedly wants to speak with his wife before making a decision on stepping down. In Ethiopia, Clinton acknowledged that Gadhafi's "major role in provid ing financial support for many African nations and institutions, including the African Union." But she said it has become clear in light of his abuses that he cannot remain in power. All African leaders should demand that Gadhafi accept a ceasefire and then leave Libya, she said. They should expel pro-Gadhafi Libyan diplomats from their countries, suspend the operations of Libyan embassies and work with the Libyan opposition. Since seizing power in Libya in 1969, Gadhafi has offered training, funding and other support for African rebel groups, including the African National Congress as it fought white minority rule in South Africa. Buoyed by oil money, he also paid the membership dues of many smaller, poorer countries at the United Nations, African Union and other international bodies winning himself a cast of supporters even as he fancied himself the continent's "king of kings." While the Arab Leagues suspended Libya's membership in the midst of the crisis, Gadhafi is still seen as a hero by many African leaders. His government remains a member in good standing in the African Union. Among the scenarios that Western nations have debated to resolve the situation include Gadhafi's possible exile to a friendly African country. The revolt against Gadhafi in Libya is just one among many in the Middle East and North Africa. The longtime leaders of Tunisia and Egypt have been ousted and anti-government protests have faced severe crackdowns in Bahrain, Syria and Yemen. Clinton said that repressive gover nance is no longer accepted in the world. She said discontent, mainly among exploding youth populations in Africa, the Middle East and elsewhere cannot be suppressed in the era of the internet and social media. "Too many people in Africa still live under long-standing rulers men who care too much about the longevity of their reign and too little about the legacy that should be built for their coun tries' future. Some even claim to believe in democracy defined as one election, one time," she said to laughter. Clinton said that approach has been soundly rejected, noting the Arab uprisings. "After years of living under dictator ships, people have demanded new lead ership in places where their voices have long been silenced," she said. "They are exercising their right to speak at the top of their lungs." African governments, too, must enact broad social, economic and political reforms or they will face similar revolts, Clinton said. In Addis Ababa, Clinton also met separately with officials from Sudan's northern and southern governments and helped advance the U.S. goal of an Ethiopian peacekeeping force being sent to the disputed, oil-rich region of Abyei. The two sides agreed in principle Monday to demilitarize the region, after two days of talks between Southern Sudan President Salva Kiir and Sudan President Omar al-Bashir aimed at defusing threats of a renewed military conflict. Both sides claim Abyei, but the north sent troops into the region last month. Tens of thousands of residents fled to the south, which will become the world's newest independent country on July 9. The north and the south fought a debilitating two-decade civil war that end ed in 2005. "I was hoping to spend a long time talking to you but I am being chased by a volcano," Clinton told Kiir. Clinton's travels have often been dogged by natural disasters. She arrived in Tanzania on Saturday, a day after the capital Dar es Salaam was shaken by a small quake. S ECRETARY OF STATE HILLARY RODH AM CLINTON a ddresses the African Union at the African Union Commission, after the power went out in the auditorium, headquarters in Addis Ababa, Ethiopia, Monday, June 13, 2011. (AP CLINT ON PRESSES AFRIC A TO SEVER TIES WITH GADHAFI JAKARTA, Indonesia Associated Press SIXTEENpeople arrested in Indonesia are suspected of plotting to kill p olice with cyanide and pen g uns, authorities said Monday. Extremists in Indonesia have increasingly targeted police in the past year or soa s an ongoing security crackdown has disruptedt errorists' ability to launch large-scale attacks. The 16 suspects were arrested over the past three days in the capital, Jakarta,a nd other locations based on confessions from people captured in Central Sulawesi after two police officers were slain last month, said Col. Boy Rafli Amar, an ational police spokesman. "There is suspicion that they have plotted to attackp olicemen, but in a different ways, including by using c yanide," Amar told r eporters. A mar said the group p lanned to spread cyanide in police dormitories and c anteens. Bottled water was also to be used as a delivery method, he said. I n a live television interview, Amar said police also confiscated pen guns along with cyanide in a raid in the capital. An investigation is under w ay to find out whether the p en guns are their own innovation or being sup plied by other parties, A mar said. Police have been at the forefront of Indonesia's c ampaign against terrorism s ince the al-Qaida-linked n ightclub bombings on the resort island of Bali in 2002. A ttacks in recent months have targeted police themselves. I n September last year, a militant tried to blow up a police post near Jakartaw ith a homemade bomb strapped to his bicycle. The man, who carried a note saying he wanted toa venge the arrests and killings of Muslim fighters, was injured when the explos ive detonated prematurely. In April, a suicide bomber blew himself up ina mosque in West Java w here police were preparing for Friday prayers, wounding 30 people, most l y policemen. INDONESIAN SUSPECTS ARE ACCUSED OF POLICE POISON PLOT MILAN Associated Press ITALIANvoters turned out in large numbers to deal Premier Silvio Berlusconi his latest blow at the ballot box Monday, overturning laws passed by his government to revive nuclear ener gy, privatise the water sup ply and help him avoid prosecution. The defeat on four referendums on the ballot Sun day and Monday was Berlusconi's second in as many weeks, after his candidates lost mayoral races in his stronghold Milan and trash-choked Naples in a vote the billionaire media mogul himself had billed as a referendum on his govern ment. Center-left opposition leader Pier Luigi Bersani said referendum results were tantamount to "a divorce between the government and the country." Activists for the "yes" vote on four referendums erupted in cheers in the capital Rome when it became clear that voter turnout, topping 57 percent, had surpassed the quorum needed to validate the vote. It was the first time since 1995 that the quorum of more than 50 percent was reached. Final results showed clear overwhelming majorities of those casting ballots chose to throw out two laws to pri vatize the water supply, killa law reviving nuclear energy and undo the so-called "legitimate impediment" law offering the Italian leader a partial legal shield in criminal prosecutions. Each referendum passed with around 95 per cent. V OTERS DEAL BERLUSCONI LATEST BLOW IN REFERENDUMS

PAGE 15

B UENOS AIRES, Argentina Associated Press THE d rifting plume of ash from Chile's erupting volcanof orced new cancelations of d ozens of flights on Monday in Argentina, Uruguay and other South American coun t ries, even as airlines in Australia began trying to move a backlog of volcano-strandedp assengers. Buenos Aires' two main airports halted flights due to the cloud of fine grit, which c an damage airplane engines. The cloud also has drifted across the Pacific Ocean, and most flights between Aus tralia and New Zealand remained grounded. In Argentina, U.N. Secre t ary General Ban Ki-moon was among those inconvenienced by the closings ofB uenos Aires' airports. He was forced to fly instead into the city of Cordoba and travel on by car to visit President Cristina Fernandez in the cap ital. All flights were canceled at the international airport in Montevideo, Uruguay, and some were grounded in Chile, Paraguay and Brazil. Airlines in Australia started flying a backlog of thousands of stranded passengers to and from the city of Melbourne on Monday as ash cleared somewhat after forcing hun dreds of cancelations. Aus tralia's Bureau of Meteorology said the ash cloud was large enough, however, to disrupt more flights later in the week. Chile's Cordon Caulle volcano began erupting on June4. Since then, about 4,000 Chileans have been evacuatedfrom the area. Last week, the ash cloud grounded hundreds of flights in parts of South America. Aerolineas Argentinas rerouted incoming flights from Europe on Monday away from Buenos Aires and instead to Cordoba, about 430 miles (700 kilometers northwest. Other regional airports in southern Argentina have been closed since last week. Brazilian airlines Gol and TAM informed passengers that flights to Argentina and Uruguay were called off Monday until further notice because of unsafe conditions caused by the shifting ashes. In Chile, the airline LAN on Sunday and Monday halt-ed some flights between San tiago and various cities in South America, as well as to Australia and New Zealand. In Colombia, Avianca sus-p ended flights between Bogota and Buenos Aires on Sunday and Monday. T he Chilean volcano wasn't the only one causing problems for airlines and travel ers. U.S. Secretary of State H illary Rodham Clinton was also cutting short a threenation tour of Africa due to a v olcanic eruption that has created an ash cloud over parts of East Africa. LOCAL NEWS T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 15 VOLCANIC ASH FROM CHILE GROUNDS MORE FLIGHTS P OLICE Commissioner Ellison E. G reenslade received an honorary Doctor o f Humane Letters degree from Sojourner-Douglas College, Baltimore, Maryland, during the Colleges 31st annual com mencement ceremony held at the British Colonial Hilton Hotel on Sunday. Family and friends of the 40 graduates attended the ceremony. C ommissioner Greenslade delivered the commencement address after which the Doctor of Humane Letters degree was conf erred on him by Dr. Charles W. Simmons, P resident of Sojourner-Douglas College for h is exemplary work in law enforcement and f or his leadership in Bahamian communities o ver the course of his working life. T he keynote speaker for the graduation, Commissioner Greenslade reminded the graduates that we are at a crossroads in our history and development and where we go from here will be determined by the positive influences of leaders such as them selves. H e encouraged the graduates to keep the flame of hope, love, generosity, hospitali ty, and community alive and asked them tob e beacons of hope for those among us who a re still in the shadows of darkness struggling t o find the light. D R. CHARLES W. SIMMONS President of Sojourner-Douglas College, with Police Commissioner E llison E. Greenslade Honorary Doctor of Humane Letters degree for Commissioner Greenslade I NTERNATIONALNEWS

PAGE 16

By ALISON LOWE B usiness Reporter a lowe@tribunemedia.net Two Nassau/Paradise I sland hotels are to be sold to a Canadian company by the end of the month, Tribune Business has confirmed. The 183-room Nassau Palm Resort, on West Bay Street, and the all-inclusive 246-room Paradise Island Harbour Resort, located on the southern shore of Paradise Island, are to be sold to the same buyer for an asyet unconfirmed price. The latter has some 200 employ ees. This was confirmed by attorney Valentine Grimes, who represents the sellers of the Paradise Island Har bour Resort, Genwood Paradise Ltd. Genwood Paradise is an investment vehicle thought t o be owned by Driftwood, t he former operator of Freeports still-closed Royal Oasis resort. Driftwood is t hought to own the Nassau P alm Resort through a sep arate investment vehicle. Driftwood has been on an initiative to liquidate all its B ahamas-based resort and t ourism investments for some time. Apart from sell ing the Royal Oasis for $33 $4. 68 $4. 51 $4. 69The information contained is from a third party and The Tribune can not be held responsible for errors and/or omission f rom the daily report.$ $5.59 $5.54 $5.67 T HETRIBUNE SECTIONB business@tribunemedia.netMONDAY, MAY 9, 2011 [Learn more at royaldelity.com] BAHAMASNassau:242.356.9801 Freeport:242.351.3010BARBADOSSt.Michael:246.435.1955 fn "# # # # n!nrrr# rfn By NEIL HARTNELL Tribune Business Editor Caribbean Bottling Company will pretty much double production capacity when it moves into its new Carmichael Road/Sir Milo Butler Highway headquarters by mid-July, its principal telling Tribune Busin ess that the companys sales had increased by roughly 50p er cent since the new owners took control five years ago. Walter Wells, principal of the Coca-Cola, Fanta and Schweppes producer/distributor, said the multi-million dollar office and production facility would enable the company to expand into new drinks product lines, having outgrown its existing site on Thompson Boulevard. We anticipate being fully operational there by mid-July, he told Tribune Business of the new facility. We started con s truction in August 2009 with the building, and we also had to o rder new lines, and have got them substantially in place. Declining to specify Caribbean Bottling set to double production Multi-million dollar plant to start in July, with capacity for 100,000 cases per week Move essential because current site bursting at seams Sales up roughly 50% since new owners took control Staff levels also expanded 50% T i m C l a r k e / T r i b u n e s t a f f DRINKTOTHIS: Caribbean Bottling Company moves into its new Carmichael Road/Sir Milo Butler Highway headquarters by mid-July. SEE page 5B By NEIL HARTNELL Tribune Business Editor RoyalFidelity Merchant Bank & Trust is offering Bahamian investors a guaranteed minimum annual return of 2 per cent with its latest international investment fund, seeking a minimum $1.5 million in invested capital when it launches on June 20. Joseph Euteneuer, RoyalFidelity's mutual fund manager, confirmed to Tribune Business that the TIGRS 5 funds investments will be split between an equity basket weighted 60/40 between the global agribusiness and energy indices. Apart from the 100 per cent principal protection, a nowstandard feature for RoyalFidelitys TIGRS international investment funds, the latest version will only give investors 60 per cent participation in the funds upside something designed to balance the guarRoyalFidelity fund in 2% annual return guarantee L atest offering targeting global energy/agribusiness sectors structured with 60% upside participation SEE page 4B TWO NASSAU RESORTS SOLD BY MONTHS END Canadian buyer to purchase Nassau Palm Resort and Paradise Island Harbour Resort SEE page 6B B y ALISON LOWE B usiness Reporter alowe@tribunemedia.net The Bahamas Real Estate Associations (BREA ident plans to write to the Government formally e xpressing industry concerns over changes in how Stamp Duty levied on property transactions is beinga ssessed a change she claims has the capacity to kill sales and cause trou ble in a market that already h as trouble. Patty Birch, who is presently out of the coun-t ry, said she hopes to make t he approach upon her return after June 27, having received many calls from concerned realtors over the past two to three months. They, along with their buyers and sellers, haveb een surprised to find the Treasury is calculating Stamp Duty due based on past real property tax valua BREA CHIEF SET TO SEEK STAMP DUTY CLARITY Fears current confusion may kill sales and cause trouble in already difficult market SEE page 7B By NEIL HARTNELL Tribune Business Editor A sustainable supply of high school graduates equipped with the technical skills required by Grand Bahamas industrialbased economy has been iden-tified as that islands most pressing need, its Chamber of Commerce president telling Tribune Business they now had to put meat on the bones of their sustainable development plan. K P Turnquest, reflecting on last weeks Economic Devel opment Summit for Grand EDUCATION REFORM URGENCY NEEDED Lack of technicallyskilled workforce number one issue for Grand Bahama economy* Chamber chief says next plan phase to put meat on the bones* Aim to get island firing on all cylinders, all engines K P TURNQUEST SEE page 8B

PAGE 17

By ROYALFIDELITY C APITAL MARKETS I t was a slow week of trading in the Bahamia n stock market. Investors traded four out of the 24 listed securities, with two decliners E QUITY MARKET A total of 65,130 shares changed hands, representing an increase of 39,316 shares com-p ared to the previous week's trading volume of 25,814. Commonwealth Bank (CBL i ng the week, trading a volume of 55,866 shares to see its stock price fall by $0.11 and close $6.87. Cable Bahamas (CAB er for the week, trading a volume of 1,400 shares to see its share price fall by $0.26, closi ng at a new 52-week low of $8.48. Abaco Markets (AML 7,764 shares, remaining unchanged at $1.18. Finance Corporation of the Bahamas (FIN traded a volume of 100 shares, remaining unchanged at $6. BOND MARKET No bonds traded last week. COMPANY NEWS Earnings Releases: There were no financial releases last week. D ividend Notes: C ommonwealth Bank (CBL dividend of $0.06 per share, payable on June 30, 2011, to all ordinary shareholders of record date June 15, 2011. Bank of the Bahamas (BOB dividend of $0.05 per share, payable on June 14, 2011, to all ordinary shareholders of record date June 7, 2011. Cable Bahamas (BOB dend of $0.08 per share, payable on June 30, 2011, to all ordinary shareholders of record date June 17, 2011. AGM Notices: Cable Bahamas (CAB AGM will be held in Governors Room One at the British Colonial Hilton Hotel on June 30, 2011, at 6pm. Abaco Markets (AML AGM will be held at the British Colonial Hilton Hotel on July 13, 2011, at 10am. J. S. Johnson & Company (JSJ announced its AGM will be held in the Governors C Room at the British Colonial Hilton H otel on June 20, 2011, at 6pm. D octors Hospital Health Systems (DHS h as announced its AGM will be held at Doctors Hospital's Conference Room, DowdeswellS treet, on June 23, 2011, at 5.30 pm. BUSINESS PAGE 2B, TUESDAY, JUNE 14, 2011 THE TRIBUNE Lower premiums,low deductibles,generous benefits and a fast claims service for home and motor cover.Pick up the phone and ask NIBA for a great insurance deal.Tel.Nassau 677-6422/Freeport 352-6422 or visit www.nibaquote.com Open Saturdays1 0.00am2.00pm NASSAU INSURANCE BROKERS AND AGENTS LIMITED Atlantic House,2nd Terrace & Collins Avenue P.O.Box N-7764 Nassau Suite 6,Jasmine Corporate Center,East Sunrise Highway P.O.Box F-42655,Freeport Tel.Nassau 677-6422 Freeport 352-6422 www.nibaquote.com RoyalFidelity Market Wrap EQUITY MARKET TRADING STATISTICS Week ending 10.06.11 BISX SYMBOLCLOSING PRICEWKLY PRICE CHANGE VOLUMEYTD PRICE CHANGE AML$ 1.18$-7,76421.65% BBL$ 0.18$-00.00% BOB$ 6.85$-039.80% BPF$ 10.63$-00.00% BSLN/A$-00.00% BWL$ 2.70$-00.00% C AB$ 8.48$-0.261,400-18.93% CBB$ 8.33$-00.00% CBL$ 6.87$-0.1155,866-1.86% CHL$ 2.80$-016.67% CIB$ 8.60$-0-8.41% CWCB$ 1.75$-0.070-6.42% DHS$ 1.38$-0-13.75% FAM$ 5.40$-0-11.04% FBB$ 1.77$-0-18.43%F CL$ 5.50$-00.73% FCLB$ 1.00$-00.00% FIN$ 6.00$-100-17.01% ICD$ 7.30$-030.59% JSJ$ 9.82$-00.00% PRE$ 10.00$-00.00% BOND MARKET TRADING STATISTICS B ISX SYMBOLDESCRIPTIONVOLUMEPAR VALUE FBB13FBB Series C0$1,000 N otes Due 2013 FBB15FBB Series D0$1,000 Notes Due 2015 FBB17FBB Series A 0$1,000 Notes Due 2017 FBB22FBB Series B0$1,000 N otes Due 2022 I NTERNATIONAL STOCK MARKET INDEXES IndexWeekly% Change DJIA11,951.91-2.42 S &P 5001,270.98-3.20 N ASDAQ2,643.73-4.67 Nikkei 9,514.44 0.42 I NTERNATIONAL MARKETS FOREX Rates W eekly % Change Currency CAD 1.0217-0.43 GBP 1.6231 0.89 E UR 1.4343-1.05 Commodities Weekly%Change C ommodity Crude Oil 1 18.552.53 Gold1,529.25-0.67 Share your news The Tribune wants to hear from people who are making news in their neighbourhoods. Perhaps you are raising funds for a good cause, campaigning for improvements in the area or have won an award. If so, call us on 322-1986 and share your story.

PAGE 18

By ALISON LOWE Business Reporter alowe@tribunemedia.net The Government and Central Bank of the B ahamas are wimpy and pathetic when it comes to protecting consumers, a former Chamber of Commerce president has charged, sug-g esting there may be an effort on the part of comm ercial banks to hide loan terms that, in some cases, leave people paying back more than double what they borrow. Superwash president, Dionisio DAguilar, made this comment as he urged the Government to do more t o provide incentives to banks to go towards mort-g ages and commercial loans, which support the productive sectors of thee conomy, rather than leani ng towards expanding their more profitable consumer loan portfolio. Mr DAguilar suggested he supports the position thatw as put forward by Franklyn Wilson, chairmano f Arawak Homes and the S unshine Group of Companies, last week, in which he charged that the explosiono f consumer debt limited many Bahamians ability to access the mortgage market and buy their own Piece oft he Rock. Mr DAguilar went furt her, stating that more s hould also be done to ensure commercial banksm ake clear to consumers the f inancial burden they are taking on with a consumer loan. We should have truth in lending, so people can know what they are getting into. You can charge me 18 per cent on a loan. dont have a problem w ith that, but it has to be laid out in a way that I can see it. I want to know how m uch I am going to be payi ng. The principal, the term of the loan, the interest on a nice piece of paper, in Engl ish, Mr DAguilar said. Hide I think theres an effort to hide it. A lot of my employees when they take out loans have no idea the r ate of interest on the loan. They just know they have to pay X amount on a certain day. M r DAguilar said he was disturbed to discover, on b ehalf of one staff member at his Superwash chain, who shared with him bank litera ture relating to her consumer loan, that she would b e paying back around $7,500 in total after taking out a $3,000 loan. The Government is extremely wimpy, and the C entral Bank is pathetic, when it comes to protecting Bahamian consumers, said Mr DAguilar. BUSINESS T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 3B 38%/,&+263,7$/6$87+25,7< $'9(57,6(0(17 9$ &$1&< ),1 $1&,$/&21752//(5 35,1&(66$5*$5(7+263,7$/ 7 KH 3XEOLF+RVSLWDOV$XWKRULW\LQYLWHVDSSOLFDWLRQVIURPVXLWDEO\ TXDOLHGHPSOR\HHVIRUWKHSRVWRI)LQDQFLDO&RQWUROOHU3ULQFHVV0DUJDUHW +RVSLWDO $SSOLFDQWVPXVWSRVVHVVWKHIROORZLQJTXDOLFDWLRQV 3URIHVVLRQDOTXDOLFDWLRQIURPDUHFRJQL]HGDFFRXQWLQJERG\QDPHO\ $PHULFDQ,QVWLWXWHRI&HUWLHGXEOLF$FFRXQWDQWV$,&3$fGHVLJQDWLRQ &3$VVRFLDWLRQRI&KDUWHUHG&HUWLHG$FFRXQWV$&&$fGHVLJQDWLRQ &$RU&DQDGLDQ,QVWLWXWHRI&KDUWHUHG$FFRXQWDQWV&,&$fGHVLJQDWLRQ &$RU&HUWLHG*HQHUDO$FFRXQWDQWV$VVRFLDWLRQRI&DQDGD&*$f GHVLJQDWLRQ&*$DQGDWOHDVWWKUHHf\HDUVH[SHULHQFHDVD)LQDQFLDO &RQWUROOHULQDVLPLODUVL]HLQVWLWXWLRQSURIHVVLRQDOXDOLFDWLRQ & 3RU&*$DQGWKUHHf\HDUVH[SHULHQFHDVDDQDJHUZLWKD S XEOLFDFFRXQWLQJUP ([FHOOHQWOHDGHUVKLSDQGRUJDQL]DWLRQDOVNLOOV ([FHOOHQWFRPPXQLFDWLRQVNLOOVRUDODQGZULWWHQfDQDO\WLFDODQG FRQFHSWXDOL]HGWKLQNLQJVNLOOVFRPSXWHUVNLOOVH[FHOOHQWLQWHUSHUVRQDODQG OHDGHUVKLSVNLOOV 7KH)LQDQFLDO&RQWUROOHUZLOOUHSRUWGLUHFWO\WRWKH'LUHFWRURI)LQDQFHRIWKH 3XEOLF+RVSLWDOV$XWKRULW\&RUSRUDWHIFH -2%$5< 3DUWLFLSDWHVIXOO\LQWKHPDQDJHPHQWDQGJRYHUQDQFHRI7KHULQFHVV 0DUJDUHW+RVSLWDODQGVXSSRUWHQLRUDQDJHPHQWDQGWKH%RDUGZLWK QDQFLDODQGRWKHUEXVLQHVVDGYLFHWRSHUPLWGLVFKDUJHRIUHVSRQVLELOLWLHV IRUSXEOLFDFFRXQWDELOLW\RSHUDWLRQRIHIIHFWLYHV\VWHPVRIQDQFLDO FRQWUROFRUSRUDWHJRYHUQDQFHDQGHQVXUHWKDWQDQFLDOWDUJHWVIRUWKH\HDU DUHPHWLQDPDQQHUWKDWPDLQWDLQVQDQFLDOVWDELOLW\ /HDGVPDQDJHPHQWUROHIRUWKH$XGLW&RPPLWWHHZRUNSODQDQGIRU GHOLYHU\RIWKH$XWKRULW\VYHf\HDUQDQFLDOSODQDQGLQ\HDUUHYHQXH EXGJHWHQVXULQJVRXQGV\VWHPVRILQWHUQDOFRQWUROVDQGJRRGQDQFLDO PDQDJHPHQWDUHLQSODFHURYLGHVKLJKOHYHOQDQFLDODGYLFHDQG VXSSRUWWRWKH+RVSLWDO$GPLQLVWUDWRU'LUHFWRURI)LQDQFHRWKHU'LUHFWRUV DQG'LYLVLRQDOEXGJHWKROGHUV (QVXUHVDFFRXQWDELOLW\E\DOOSHUVRQVFKDUJHGZLWKWKHXVHRIWKH $XWKRULW\VIXQGV 'ULYHVWKHSHRSOHVWUDWHJ\RIWKHRUJDQL]DWLRQWRHQVXUHWKDWWKH $XWKRULW\VUHVRXUFHVSURYLGHWKHRYHUDOOEXVLQHVVSHUIRUPDQFHQHHGHGWR DFKLHYHLWVVWUDWHJLFDLPVDQGREMHFWLYHV '87,(6 3URYLGHVKLJKOHYHOH[SHUWLVHLQWKHDUHDVRIQDQFLDOPDQDJHPHQWDQG FRUSRUDWHJRYHUQDQFHWRWKH%RDUGDQGVHQLRUPDQDJHPHQWWKDWHQVXUHV QDQFLDOVWUDWHJLHVDUHHIIHFWLYHO\LQWHJUDWHGDQGDOLJQHGZLWKLQWKH FRUSRUDWHPDQDJHPHQWSURFHVV 3ODQVFRQWUROVDQGPRQLWRUVWKHRZRIWKH$XWKRULW\VIXQGVWR HQVXUHH[SHQGLWXUHLVFRQWDLQHGZLWKLQEXGJHWURGXFHVQDQFLDO UHSRUWVDVUHTXLUHGE\WKH%RDUGWKHDQDJLQJ'LUHFWRUDQGDOOLWVOHYHOV RIPDQDJHPHQWDVZHOODVIRUVWDWXWRU\SXUSRVHVWKDWDUHWLPHO\UHOHYDQW DQGSURDFWLYH $VVLVWVLQWKHGHYHORSPHQWDQGLPSOHPHQWDWLRQRIWKH$XWKRULW\QDQFLDO VWUDWHJ\DQGSODQV(QVXUHVWKDWWKHDSSURSULDWHOHYHOVRIH[SHUWLVHDUHLQ SODFHIRUHIIHFWLYHGHOLYHU\RIQDQFLDODQGPDQDJHPHQWDFFRXQWLQJ VHUYLFHVDQGWKDWDOOVWDWXWRU\DQGUHJXODWRU\UHTXLUHPHQWVDUHPHWUHODWLQJ WRWKHULQFHVVDUJDUHW+RVSLWDOVDFFRXQWVLQFOXGLQJWKHVXEPLVVLRQRI DXGLWHGDFFRXQWVWRVWULFWGHDGOLQH 5HYLHZVDQGVXSHUYLVHVWKHLPSOHPHQWDWLRQRIQDQFLDOSROLFLHVDQG VXSHUYLVHVDSSURYHGV\VWHPVRIQDQFLDOFRQWUROWRHQVXUHWKHHIIHFWLYH XVHRIUHVRXUFHVDQGFRPSOLDQFHZLWK+$VQDQFLDOSROLFLHVDFFRXQWLQJ VWDQGDUGVOLDLVHVZLWKDXGLWERWKLQWHUQDODQGH[WHUQDOWRHQVXUHV\VWHPV RIFRQWURODUHDGHTXDWHDQGVHFXUHSURPRWHVRSWLPXPVWDQGDUGVRI SURIHVVLRQDOLVPZLWKLQQDQFLDOIXQFWLRQVWRHQVXUHFRPSOLDQFHZLWKEHVW DFFRXQWLQJVWDQGDUGVDQGSUDFWLFHV &RRUGLQDWHVLQWHJUDWHGDFWLYLWLHVDFURVVWKH$XWKRULW\DQGLWVLQVWLWXWLRQV HQVXULQJWKH%RDUGDQDJLQJ'LUHFWRU+RVSLWDO$GPLQLVWUDWRUDQGDOO OHYHOVRIPDQDJHPHQWKDYHWKHDSSURSULDWHVNLOOVDQGWRROVWRPD[LPL]H VFDUFHUHVRXUFHVVRDVWRGHOLYHUVXVWDLQDEOHLPSURYHPHQWVWRSDWLHQWFDUH (QVXUHVWKDWWKHUHLVHIIHFWLYHFRRUGLQDWLRQDFURVVDOOHOHPHQWVRIWKH QDQFHIXQFWLRQVRIWKHULQFHVVDUJDUHW+RVSLWDOFRQWULEXWHVIXOO\WR WKHEXVLQHVVSODQQLQJF\FOHRIWKHULQFHVVDUJDUHW+RVSLWDOOLDLVHVZLWK WKHUHOHYDQWNH\PDQDJHUVDQGFOLQLFLDQVWRHQFRXUDJHWKHLUSDUWLFLSDWLRQ LQWKHSURFHVV /HDGVPRWLYDWHVGHYHORSVDQGWUDLQVVWDIZLWKLQWKHGHSDUWPHQWWRHQVXUH WKDWWKH\KDYHWKHQHFHVVDU\VNLOOVWRDFKLHYHUHTXLUHGREMHFWLYHVDQGWR HQFRXUDJHWKHGHYHORSPHQWRILQQRYDWLYHFUHDWLYHWKLQNLQJDQGWHDP ZRUNDFURVVWKHGHSDUWPHQWV 'HYHORSVDIWHUFRQVXOWDWLRQZLWKUHOHYDQWVWDNHKROGHUVDQ$QQXDO 3ODQIRUWKHPDQDJHPHQWRIUHVRXUFHV7KHSODQPXVWEHVXEPLWWHGWRWKH 'LUHFWRURI)LQDQFHIRUUHYLHZDQGDSSURYDO /HWWHUVRIDSSOLFDWLRQDQGFXUULFXOXPYLWDHVKRXOGEHVXEPLW WHGWKURXJK \RXU+HDGRI'HSDUWPHQWWRWKH'LUHFWRURI+XPDQHVRXUFHV &RUSRUDWHIFHXEOLF+RVSLWDOV$XWKRULW\7KLUGDQG:HVW7HUUDFHV &HQWUHYLOOHRU QRODWHUWKDQ WK WK Govt, Central Bank wimpy over consumer protection E X -C H AMBERCHIEFCALLSFOR T RUTHINLENDING D IONISIO DAGUILAR We should have t ruth in lending, so p eople can know w hat they are gett ing into. You can c harge me 18 per c ent on a loan. I d ont have a problem with that, but it h as to be laid out in a way that I can see it... DIONISIO DAGUILAR

PAGE 19

anteed return. Expressing hope that the 2 per cent minimum per annum return would look attractive to Bahamian institutional and retail investors following last weeks 0.75 percentage point cut in the Central Banks Discount Rate, which has reduced returns on bank deposits and o ther fixed income securities linked to Prime, Mr Euteneuer confirmed: Thats what were going to go with. A 60 per cent upside participation rate, and a 60/40 split between global agribusiness and global energy. Investors will get that mix of growing sect ors, often interlinked with one another, a floor of a minimum 2 per cent per annum return, and 100 per cent principal protection over five years. The TIGRS 5 fund is set to launch next week Monday on June 20, with a July 1, 2011, closing. RoyalFidelity is hopi ng it will prove attractive enough to capture much of the $10 million in investor principal that is maturing at end-June with its first international investment fund, the TIGRS 1. I think, especially given the recent drop in the Discount Rate announced by the Cent ral Bank, a 2 per cent floor is pretty good, Mr Euteneuer told Tribune Business. A 2 per cent return on equity with 100 per cent principal protection looks pretty attractive. Of course wed love to capture everybody [in TIGRS 1]. That was $10 million, and thats not going to happen, but the minimum is $1.5 million. I hope its attractive for everyone.......... I wont make any predictions, but for the next five years, especially with a minimum 2 per cent return on investment like this, the exposure for Bahamian investors to such a wide selection of global sectors, its a very attractive offer. But well see. Michael Anderson, RoyalFidelitys president, confirmed to Tribune Business that largely what [we are] trying to do is make sure those investors [in TIGRS1] have alternative investments to put their money into. He reiterated his hope that the cuts in the Discount and Prime interest rates would encourage Bahamian investors to switch from bank deposits, government-registered stock and other fixed income securities, because the opportunity cost of relinquishing such investments had decreased. M r Euteneuer, meanwhile, said all the available evidence seemed to point to a long-term run of increased food prices. With an ever-increasing world population set to put intense demand-side pressure on the food industry, he suggested the solutions were to either grow more food or do so more efficiently producing more food from the same land. This, in turn, would lead to increased business for both thea gribusiness and energy sectors, the same two industries in which the TIGRS 5 fund is invested. Some 60 per cent of TIGRS 5 will be invested in the DAXglobal Agribusiness Index and the remaining 40 per cent in the Energy Select Sector Index. The DAXglobal Agribusiness Index is composed of 46 agricultural chemical invest-m ents; 31 per cent agriproduct operations; 12 per cent agricultural equipment; 8 per cent livestock operations; and 2/5 per cent ethanol/biodiesel. As for the Energy Select Sector Index, this features oil and gas service providers and pipeline companies. Some 78 per cent of this is composed from oil and gas providers, the remaining 22 per cent from energy equipment and services. Among the companies included in these indices are Exxon Mobil, Halliburton, Monsanto, Deere & Co andA rcher Daniels Midlan. All agribusinesses rely to some extent on fuel to produce food. BUSINESS PAGE 4B, TUESDAY, JUNE 14, 2011 THE TRIBUNE 52wk-Hi52wk-LowSecurit y Previous CloseToday's CloseChangeDaily Vol.EPS $Div $P/EYield 1.190.95AML Foods Limited1.181.180.000.1550.0807.66.78% 10.639.05Bahamas Property Fund10.6310.630.00-0.6400.200-16.6 1.88% 7.504.40Bank of Bahamas6.856.850.000.2130.10032.21.46% 0.530.17Benchmark0.180.180.00-0.0480.000N/M0.00% 2.842.70Bahamas Waste2.702.700.000.0470.09057.43.33% 1.961.77Fidelity Bank1.771.770.000.0970.04018.22.26% 11.968.48Cable Bahamas8.488.480.001.0580.3108.03.66% 2.852.35Colina Holdings2.802.800.000.4380.0406.41.43% 8.338.33Commonwealth Brewery8.338.330.000.0000.0000.00.00% 7.005.80Commonwealth Bank (S1)6.876.870.000.4960.26013.93.78% 2.191.90Consolidated Water BDRs1.771.770.000.1110.04515.92.54% 2.541.31Doctor's Hospital1.381.380.000.1070.11012.97.97% 5.994.75Famguard5.405.400.000.4460.24012.14.44% 9.005.65Finco6.006.000.000.7570.0007.90.00% 9.858.25FirstCaribbean Bank8.608.600.000.4940.35017.44.07% 6.004.57Focol (S)5.505.500.000.4350.16012.62.91% 1.001.00Focol Class B Preference1.001.000.000.0000.000N/M0.00% 7.305.50ICD Utilities7.307.300.00-0.1220.240-59.8 3.29% 10.809.80J. S. Johnson9.829.820.000.8800.64011.26.52% 10.0010.00Premier Real Estate10.0010.000.001.2070.2008.32.00% 52wk-Hi52wk-LowSecuritySymbolLast SaleChangeDaily Vol. 99.4699.46Bahamas Note 6.95 (2029BAH2999.460.00 1 00.00100.00Fidelity Bank Note 17 (Series A) +FBB17100.000.00 1 00.00100.00Fidelity Bank Note 22 (Series B) +FBB22100.000.00 1 00.00100.00Fidelity Bank Note 13 (Series C) +FBB13100.000.00 100.00100.00Fidelity Bank Note 15 (Series D) +FBB15100.000.00BISX LISTED & TRADED SECURITIES AS OF:7% Interest 7% RoyalFidelityMerchantBank&TrustLtd(Over-The-CounterSecurities) 29 May 2015 W WW.BISXBAHAMAS.COM | TELEPHONE: 242-677-BISX (2479) | FACSIMILE: 242-323-232019 October 2022 Prime + 1.75% Prime + 1.75% 6.95%20 November 2029T HURSDAY, 9 JUNE 2011BISX ALL SHARE INDEX: CLOSE 1,418.90 | CHG 0.00 | %CHG 0.00 | YTD -80.61 | YTD % -5.38BISX LISTED DEBT SECURITIES (Bonds trade on a Percentage Pricing basis)Maturity 19 October 2017F INDEX: YEAR END 2008 -12.31%30 May 2013 52wk-Hi52wk-LowSymbolBid $ A sk $Last PriceDaily Vol.EPS $Div $P/EYield 10.065.01Bahamas SupermarketsN/AN/A14.00-2.9450.000N/M0.00% 0.550.40RND Holdings0.350.400.550.0010.000256.60.00% 41.0029.00ABDAB30.1331.5929.004.5400.0009.030.00% 0.550.40RND Holdings0.650.750.400.0290.00024.130.00% 52wk-Hi52wk-LowFund NameNAVYTD%L ast 12 Months %NAV 3MTH 1.55731.4674CFAL Bond Fund1.55732.04%6.13%1.535365 3.01852.9020CFAL MSI Preferred Fund3.01852.41%4.01%2.952663 1.59761.5289CFAL Money Market Fund1.59761.50%4.50%1.580804 3.20252.6384Royal Fidelity Bahamas G & I Fund2.5997-4.43%-16.29% 13.638813.0484Royal Fidelity Prime Income Fund13.50161.08%0.02% 116.5808103.9837CFAL Global Bond Fund116.58080.71%8.38%115.762221 114.1289101.7254CFAL Global Equity Fund114.12892.39%7.89%111.469744 1.16081.0000FG Financial Preferred Income Fund1.16551.66%5.19% 1.12141.0000FG Financial Growth Fund1.12640.71%6.11% 1.16201.0000FG Financial Diversified Fund1.16681.54%5.59% 9.99529.5078Royal Fidelity Bah Int'l Investment Fund Principal Protected TIGRS, Series 19.94330.98%4.58% 11.217310.0000Royal Fidelity Bah Int'l Investment Fund Principal Protected TIGRS, Series 211.28102.07%9.80% 10.42889.1708Royal Fidelity Bah Int'l Investment Fund Principal Protected TIGRS, Series 310.40873.83%11.49% 8.45104.8105Royal Fidelity Int'l Fund Equities Sub Fund8.78964.66%16.69% BISX ALL SHARE INDEX 19 Dec 02 = 1,000.00YIELD last 12 month dividends divided by closing price 52wk-Hi Highest closing price in last 52 weeksBid $ Buying price of Colina and Fidelity 52wk-Low Lowest closing price in last 52 weeksAsk $ Selling price of Colina and fidelity Previous Close Previous day's weighted price for daily volumeLast Price Last traded over-the-counter price Today's Close Current day's weighted price for daily volumeWeekly Vol. Trading volume of the prior week Change Change in closing price from day to dayEPS $ A company's reported earnings per share for the last 12 mths Daily Vol. Number of total shares traded todayNAV Net Asset Value DIV $ Dividends per share paid in the last 12 monthsN/MNot Meaningful P/E Closing price divided by the last 12 month earningsFINDEX The Fidelity Bahamas Stock Index. January 1, 1994 = 100 (S) 4-for-1 Stock Split Effective Date 8/8/2007 (S1) 3-for-1 Stock Split Effective Date 7/11/200731-May-11BISX Listed Mutual FundsNAV Date 31-May-11 30-Apr-11 31-Mar-11 RoyalFidelity Merchant Bank & Trust Ltd (Over-The-Counter Securities) CFAL Securities Ltd. (Over-The-Counter Securities)TO TRADE CALL: CFAL 242-502-7010 | ROYALFIDELITY 242-356-7764 | FG CAPITAL MARKETS 242-396-4000 | COLONIAL 242-502-752530-Apr-11 31-Mar-11 30-Apr-11 29-Apr-11 31-May-11MARKET TERMS30-Apr-11 NAV 6MTH 1.512246 2.907492 1.561030 114.368369 106.552835 31-Mar-11 30-Apr-11 31-May-11 30-Apr-11 127,&( (67$7(7+(/$7( ',$1(%2895(77( 1RWLFHLVKHUHE\JLYHQWKDWDOOSHUVRQV KDYLQJDQ\FODLPVRUGHPDQGVDJDLQVWWKHDERYH QDPHG(VWDWHDUHUHTXHVWHGWRVHQGWKHVDPHGXO\F HUWLHGWRWKHXQGHUVLJQHGRQRUEHIRUHWKHWKG RI -XO\ $1'1RWLFHLVKHUHE\DOVRJLYHQWKDWDIWHU WKHH[SLUDWLRQRIWKHWLPHDERYHPHQWLRQHGWKH DVVHWVRIWKHGHFHDVHGZLOOEHGLVWULEXWHGDPRQJWKH SHUVRQVHQWLWOHGWKHUHWRKDYLQJUHJDUGRQO\WRWKH FODLPVRIZKLFKWKH$GPLQLVWUDWRUVVKDOOWKHQKDYH KDGQRWLFH /(112;$721 $WWRUQH\VIRUWKH(VWDWH ,1 7+((67$2):LOOLDP6LPRQ 'HOHYHDX[ ODWHRI(DVW6WUHHW1HZ3URYLGHQFH %DKDPDV 1 27,&( LVKHUHE\JLYHQWKDWDOOSHUVRQVKDYLQJ DQ\FODLPRUGHPDQGDJDLQVWWKHDERYH(VWDWH DUHUHTXLUHGWRVHQGWKHVDPHGXO\FHUWLHGLQ ZULWLQJWRWKHXQGHUVLJQHGRQRUEHIRUHWKH WK GD\RI-XO\DIWHUZKLFKGDWHWKH ([HFXWRUVZLOOSURFHHGWRGLVWULEXWHWKHDVVHWV KDYLQJUHJDUGRQO\WRWKHFODLPVRIZKLFKWKH\ VKDOOWKHQKDYHKDGQRWLFH $1'127,&( LVKHUHE\JLYHQWKDWDOOSHUVRQV LQGHEWHGWRWKHVDLG(VWDWHRI :LOOLDP6LPRQ I 'HOHYHDX[ DUHUHTXHVWHGWRPDNHIXOOVHWWOHPHQW RQRUEHIRUHWKHGDWHKHUHLQEHIRUHPHQWLRQHG 1$',$:5,*+7 $WWRUQH\IRUWKH([HFXWRUV &KDQFHOORUV&KDPEHUV 3 1DVVDX%DKDPDV RoyalFidelity fund in 2% annual return guarantee FROM page 1B

PAGE 20

Caribbean Bottlings total investment in the 20-acre site and new plant, although confirming it was well into the seven figures, Mr Wells said the company could move into its new offices tomorrow if needed. Its new reverse osmosis facility was operational, and the production and packaging lines were currently undergoing testing prior to opening. It will pretty much double our production capacity, Mr Wells told Tribune Business. It will give us the ability, if we want, to extend shifts to produce 100,000 cases a week if we have to. Obviously, the market here will not sustain that production, so it allows us to expand the products we offer. We will be looking at an expansion move into water, energy drinks and citrus products, which will be available at the end of this year. Caribbean Bottling, he explained, was currently restricted by capacity constraints, particularly the size of its existing Thompson Boulevard location, from taking on new drinks lines for distribution or production. Everything will be located in one spot, Mr Wells said of the new site. Were bursting at the seams because there is no room to expand on this site. Were tenants here, rather than owners, and dont want to be tenants for ever, so its an opportune time to secure our own premises, which we have been able to do, and put us on a sounder financial footing going forward. Caribbean Bottling will transfer its can filler and a few pieces of associated equipment from its existing Thompson Boulevard location to the new s ite over the next three-four weeks, but Mr Wells said: For the most part weve gotten substantially new production lines there. The can line is substantially a new line, and the bottle line is a new line. Outlining the efficiency and production gains that the new plant will bring, Mr Wells added: Its substantially automated versus what we have today, which is very manual....... Its very little human interaction. While the automated nature of the production lines would not require Caribbean Bottling to immediately hire additional staff for its new Carmichael Road/Sir Milo Butler Highway site, Mr Wells said the company had increased headcount by 50 per cent over the last four years to its current 150-strongw orkforce. However, if the expansion and new product lines performed well, Mr Wells said the company may require a larger sales team, but thats six-12 months down the road based on the success of these products. Praising the great team assembled at Caribbean Bottling since he and his fellow investors, Bahamians and Barbados-based Banks Breweries (which holds 30 per cent of the equity) took control, Mr Wells said customers should see i mproved packaging quality as a result of everything being shrink-wrapped. Outlining the companys strategy, the Caribbean Bottling principal said it sought to initially import and distribute new drinks lines, building them up to the point where it was financially viable for the firm to start producing and bottling them in the Bahamas. Our goal is to really build a market to sustainability, and then when the investment is justified, branch into production once the numbers make sense, Mr Wells said. Once we run the volumes here, we will look at producing locally and make the investment in equipment to do so. Telling Tribune Business that Caribbean Bottling had come a long way since its currento wners took control in 20062007, Mr Wells added: Its grown very nicely. Of course, the economic conditions the world and ourselves are experiencing today has slowed our growth, but we have fared pretty well. Despite the recession, we have held our own, and Im certainly satisfied with how the business is performing. Our sales have increased roughly 50 per cent since we took control. Apart from the various CocaCola and Sprite products, Caribbean Bottling also produces the Schweppes and Fanta flavours. It also produces and distributes Desani Water, and imports the V-8 Juices, along with Vitamin Water and Minute Maid products. BUSINESS T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 5B FROM page 1B Caribbean Bottling set to double production

PAGE 21

BUSINESS PAGE 6B, TUESDAY, JUNE 14, 2011 THE TRIBUNE ABOUT URCA: The Utilities Regulation and Competition Authority (URCA the converged regulator for Electronic Communications Services (ECS) (covering broadcasting, radio spectrum and electronic communications) in the Commonwealth of The Bahamas. 85&$LVVHHNLQJWRHPSOR\VXLWDEO\TXDOLHGLQGLYLGXDOWR WKHSRVWRI&KLHI([HFXWLYH2IFHU7KLVSRVLWLRQZLOOEHEDVHGLQ Nassau, The Bahamas and will report to the Board of URCA. CORE DUTIES: The successful candidate will be required to: L ead and promote the development of URCA as set out in the URCA and Communications Acts Take total ownership and overall responsibility for leading URCA through post liberalisation reform, policy developm ent, priority mapping and stakeholder management. Ownership includes, but is not limited to, leadership and human capital development, prioritizing of strategic initiatives and use of scarce resources, monitoring, implementation and reporting same to the Board /HDGWKHVWUDWHJLFSODQQLQJDQGUHODWHGVFDOREMHFWLYH setting for URCA in accordance with the Boards policies and consistent with its statutory obligations Lead the implementation of policy determined by the Board Ensure that URCAs capacity to absorb organizational change is properly assessed and managed through the normal organizational structures and management and identify support where required Ensure timely and appropriate transfer of responsibility from consultants and other advisors to the organization Attract, excite and retain colleagues within URCA toward WKHDWWDLQPHQWRIVWUDWHJLFREMHFWLYHV QUALIFICATIONS & EXPERIENCE: Candidates must: hold a university degree, preferably at the post graduate l evel in the area of law, economics, engineering, accounting or business management or a professional designation that is equivalent, to be able to meet the intellectual dePDQGVRIWKHMREDQGRUHTXLYDOHQWH[SHULHQFH have workedin, consulted in or regulated in comparative sectors for over ten years and ideally have both regulatory and industry experience have proven experience in areas of regulation, i.e. communications, broadcasting, electricity, or water at a senior level in a leadership role have proven experience in managing post liberalization regulatory issues Five to seven years experience working at senior/ executive OHYHOLQRWKHMXULVGLFWLRQVLQWKHUHJXODWRU\RULQGXVWU\HQYLURQ ment will be an asset COMPETENCIES & OTHER KEY REQUIREMENTS: Demonstrable track record of successful delivery of organizational transformation and change management on a QXPEHURIYHU\ODUJHVFDOHKLJKSUVWUDWHJLFFKDQJH SURMHFWVRUSURJUDPPHVSHFLFWRSRVWOLEHUDOL]HGPDU ket Ability to motivate and manage internal and external stakeholders Must have a high degree of organizational awareness and political sensitivity Strategic outlook and capable of conceptual thinking and decisive decision making Ability to absorb new facts, data and information rapidly Demonstrable sensitivity to balancing stakeholder interests as well as the regulatory imperatives of transparency, consistency and fairness Capable of modifying strong views in the face of new inIRUPDWLRQPDUNHWUHDOLWLHVDQGFRPSHOOLQJDQGLV humble enough to ask questions to ensure an understanding of the situation Strong bias for action and capable of translating the strategic agenda into actionable, quantitative plans, convey a sense of urgency and drive to closure &DSDEOHRIPDQDJLQJSURMHFWVIURPLQFHSWLRQZLWKLQWLPH frames and approved budgets. Good communication and inter-personal skills,and the right attitude to drive a high performance team Demonstrable track record of managing relationships with the media REMUNERATION & BENEFITS: URCA is a performance driven organisation and offers a comSHWLWLYHDQGDWWUDFWLYHUHPXQHUDWLRQDQGEHQHWSDFNDJHDV well as opportunities for career enrichment. Further information about URCA can be obtained from the website: www. urcabahamas.bs CONTACT: Interested applicants should email their resume to info@orgsoul.com.Applications should be received on or before July 8, 2011. Only candidates with the credentials and experience required for the role will be contacted. Thank you for your interest. Executive SearchCHIEF EXECUTIVE OFFICER U TILITIES REGULATION AND COMPETITION AUTHORITY (URCA 3 8%/,&+263,7$/6$87+25,7< $'9(57,6(0(17 9 $ & $1&< ),1 $1&,$/&21752//(5 *5$1'%$+$0$+($/7+(59,&(6 7KH3XEOLF+RVSLWDOV$XWKRULW\LQYLWHVDSSOLFDWLRQVIURPVXLWDEO\ T XDOLHGSHUVRQVIRUWKHSRVWRI)LQDQFLDO&RQWUROOHU*UDQG%DKDPD + HDOWKHUYLFHV $ SSOLFDQWVPXVWSRVVHVVWKHIROORZLQJTXDOLFDWLRQV 3URIHVVLRQDOTXDOLFDWLRQIURPDUHFRJQL]HGDFFRXQWLQJERG\QDPHO\ $PHULFDQ,QVWLWXWHRI&HUWLHGXEOLF$FFRXQWDQWV$,&3$fGHVLJQDWLRQ &3$VVRFLDWLRQRI&KDUWHUHG&HUWLHG$FFRXQWV$&&$fGHVLJQDWLRQ & $ RU &DQDGLDQ,QVWLWXWHRI&KDUWHUHG$FFRXQWDQWV&,&$fGHVLJQDWLRQ&$ RU &HUWLHG*HQHUDO$FFRXQWDQWV$VVRFLDWLRQRI&DQDGD&*$fGHVLJQDWLRQ &*$DQGDWOHDVWWKUHHf\HDUVH[SHULHQFHDVD)LQDQFLDO&RQWUROOHULQD VLPLODUVL]HLQVWLWXWLRQSURIHVVLRQDOXDOLFDWLRQ&3RU&*$ DQGWKUHHf\HDUVH[SHULHQFHDVDDQDJHUZLWKDSXEOLFDFFRXQWLQJUP ([FHOOHQWOHDGHUVKLSDQGRUJDQL]DWLRQDOVNLOOV ([FHOOHQWFRPPXQLFDWLRQVNLOOVRUDODQGZULWWHQfDQDO\WLFDODQG F RQFHSWXDOL]HGWKLQNLQJVNLOOVFRPSXWHUVNLOOVH[FHOOHQW LQWHUSHUVRQDODQGOHDGHUVKLSVNLOOV 7KH)LQDQFLDO&RQWUROOHUZLOOUHSRUWGLUHFWO\WRWKH)LQDQFH'LUHFWRURIWKH 3XEOLF+RVSLWDOV$XWKRULW\&RUSRUDWHIFH -2%$5< 3DUWLFLSDWHVIXOO\LQWKHPDQDJHPHQWDQGJRYHUQDQFHRI*UDQG%DKDPD +HDOWKHUYLFHVDQGVXSSRUWHQLRUDQDJHPHQWDQGWKH%RDUGZLWK QDQFLDODQGRWKHUEXVLQHVVDGYLFHWRSHUPLWGLVFKDUJHRIUHVSRQVLELOLWLHV I RU SXEOLFDFFRXQWDELOLW\RSHUDWLRQRIHIIHFWLYHV\VWHPVRIQDQFLDOFRQWURO FRUSRUDWHJRYHUQDQFHDQGHQVXUHWKDWQDQFLDOWDUJHWVIRUWKH\HDUDUHPHW LQDPDQQHUWKDWPDLQWDLQVQDQFLDOVWDELOLW\ /HDGVPDQDJHPHQWUROHIRUWKH$XGLW&RPPLWWHHZRUNSODQDQGIRUGHOLYHU\ R I WKH$XWKRULW\VYHf\HDUQDQFLDOSODQDQGLQ\HDUUHYHQXHEXGJHW H QVXULQJVRXQGV\VWHPVRILQWHUQDOFRQWUROVDQGJRRGQDQFLDOPDQDJHPHQW DUHLQSODFH7KHSRVWKROGHUZLOOSURYLGHKLJKOHYHOQDQFLDODGYLFHDQG V XSSRUWWRWKH+RVSLWDO$GPLQLVWUDWRU'LUHFWRURI)LQDQFHRWKHU'LUHFWRUV D QG 'LYLVLRQDOEXGJHWKROGHUV (QVXUHVDFFRXQWDELOLW\E\DOOSHUVRQVFKDUJHGZLWKWKHXVHRIWKH $XWKRULW\VIXQGV 'ULYHVWKHSHRSOHVWUDWHJ\RIWKHRUJDQL]DWLRQWRHQVXUHWKDWWKH $XWKRULW\VUHVRXUFHVSURYLGHWKHRYHUDOOEXVLQHVVSHUIRUPDQFHQHHGHGWR DFKLHYHLWVVWUDWHJLFDLPVDQGREMHFWLYHV '87,(6 3URYLGHVKLJKOHYHOH[SHUWLVHLQWKHDUHDVRIQDQFLDOPDQDJHPHQW DQGFRUSRUDWHJRYHUQDQFHWRWKH%RDUGDQGVHQLRUPDQDJHPHQWWKDWHQVXUH QDQFLDOVWUDWHJLHVDUHHIIHFWLYHO\LQWHJUDWHGDQGDOLJQHGZLWKLQWKH FRUSRUDWHPDQDJHPHQWSURFHVV 3ODQVFRQWUROVDQGPRQLWRUVWKHRZRIWKH$XWKRULW\VIXQGVWRHQVXUH H[SHQGLWXUHLVFRQWDLQHGZLWKLQEXGJHWURGXFHVQDQFLDOUHSRUWVDV UHTXLUHGE\WKH%RDUGWKHDQDJLQJ'LUHFWRUDQGDOOLWVOHYHOVRI PDQDJHPHQWDVZHOODVIRUVWDWXWRU\SXUSRVHVWKDWDUHWLPHO\UHOHYDQW DQGSURDFWLYH $VVLVWVLQWKHGHYHORSPHQWDQGLPSOHPHQWDWLRQRIWKH$XWKRULW\ QDQFLDOVWUDWHJ\DQGSODQV(QVXULQJWKHDSSURSULDWHOHYHOVRIH[SHUWLVH DUHLQSODFHIRUHIIHFWLYHGHOLYHU\RIQDQFLDODQGPDQDJHPHQWDFFRXQWLQJ VHUYLFHVDQGWKDWDOOVWDWXWRU\DQGUHJXODWRU\UHTXLUHPHQWVDUHPHWUHODWLQJ WR*UDQG%DKDPD+HDOWKHUYLFHVDFFRXQWVLQFOXGLQJWKHVXEPLVVLRQRI DXGLWHGDFFRXQWVWRVWULFWGHDGOLQH 5HYLHZVDQGVXSHUYLVHVWKHLPSOHPHQWDWLRQRIQDQFLDOSROLFLHVDQG VXSHUYLVHVDSSURYHGV\VWHPVRIQDQFLDOFRQWUROWRHQVXUHWKHHIIHFWLYHXVH RI UHVRXUFHVDQGFRPSOLDQFHZLWK+$VQDQFLDOSROLFLHVDFFRXQWLQJ VWDQGDUGVOLDLVHVZLWKDXGLWERWKLQWHUQDODQGH[WHUQDOWRHQVXUH V\VWHPVRIFRQWURODUHDGHTXDWHDQGVHFXUHSURPRWHVRSWLPXPVWDQGDUGV RI SURIHVVLRQDOLVPZLWKLQQDQFLDOIXQFWLRQVWRHQVXUHFRPSOLDQFHZLWK EHVWDFFRXQWLQJVWDQGDUGVDQGSUDFWLFHV &RRUGLQDWHVLQWHJUDWHGDFWLYLWLHVDFURVVWKH$XWKRULW\DQGLWVLQVWLWXWLRQV HQVXULQJWKH%RDUGDQDJLQJ'LUHFWRU+RVSLWDO$GPLQLVWUDWRUDQGDOO OHYHOVRIPDQDJHPHQWKDYHWKHDSSURSULDWHVNLOOVDQGWRROVWRPD[LPL]H VFDUFHUHVRXUFHVVRDVWRGHOLYHUVXVWDLQDEOHLPSURYHPHQWVWRSDWLHQWFDUH (QVXUHVWKDWWKHUHLVHIIHFWLYHFRRUGLQDWLRQDFURVVDOOHOHPHQWVRIWKH QDQFHIXQFWLRQVRI*UDQG%DKDPD+HDOWKHUYLFHVFRQWULEXWHVIXOO\WRWKH EXVLQHVVSODQQLQJF\FOHRI*UDQG%DKDPD+HDOWKHUYLFHVOLDLVHVZLWKWKH UHOHYDQWNH\PDQDJHUVDQGFOLQLFLDQVWRHQFRXUDJHWKHLUSDUWLFLSDWLRQLQWKH SURFHVV /HDGVPRWLYDWHVGHYHORSVDQGWUDLQVVWDIIZLWKLQWKHGHSDUWPHQWWRHQVXUH WKDWWKH\KDYHWKHQHFHVVDU\VNLOOVWRDFKLHYHUHTXLUHGREMHFWLYHVDQGWR HQFRXUDJHWKHGHYHORSPHQWRILQQRYDWLYHFUHDWLYHWKLQNLQJDQGWHDPZRUN DFURVVWKHGHSDUWPHQWV 'HYHORSVDIWHUFRQVXOWDWLRQZLWKUHOHYDQWVWDNHKROGHUVDQ$QQXDOODQIRUWKH PDQDJHPHQWRIUHVRXUFHV7KHSODQPXVWEHVXEPLWWHGWRWKH'LUHFWRURI)LQDQFH IRUUHYLHZDQGDSSURYDO /HWWHUVRIDSSOLFDWLRQDQGFXUULFXOXPYLWDHVKRXOGEHVXEPLWWHGWRWKH'LUHFWRURI +XPDQ5HVRXUFHV&RUSRUDWH3XEOLF+RVSLWDOV$XWKRULW\7KLUGDQG:HVW 7HUUDFHV&HQWUHYLOOHRU3%R[1DVVDX%DKDPDV QRODWHUWKDQ WK -XQH m illion to Irish-based developer, Harcourt Developments, it also sold the Hurricane Hole Marina and sur-r ounding timeshare facilities to Kerzner International. Driftwoods last remaining Bahamian interests arei ts two Nassau/Paradise Island resorts. Its investments in this nation were financed by the private equity arm of now-bankrupt Lehmann Brothers. Mr Grimes would not comment on plans the prospective buyer may have for the properties, directing this newspaper to its attorney, who was unavailable up to press time. I t had been suggested that employees at the Paradise Island Harbour Resort werei nformed in an April 12, 2011, by Scott Cornelius, the c ompany's regional director and general manger, that the resort would be sold by May1 2 to an entity called Benisasia Investment and Properties Ltd. Mr Cornelius was said to have informed employees that Genwood would cease doing business once the sale w as completed, and as a result employees with the company would also come to the end of their service. Sources close to the transaction at the weekendc laimed this would not be t he case, and staff would not be affected as the resort w ould remain operational after the sale. Messages left for B ahamas Hotel, Catering and Allied Workers Union executives on the matter were not returned up to press time. TWO NASSAU RESORTS SOLD BY MONTHS END FROM page 1B

PAGE 22

BUSINESS T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 7B tions, not the current market price. Given the current state of t he real estate market, which has seen property values slide over the last several y ears due to the financial crisis and global recession, t his has in many cases resulted in the payable Stamp Duty being higher than it w ould be if calculated based on current market value/selling price of the property. T his shift from the previous approach, which saw Stamp Duty based on the sale price shown on the con-v eyancing document, has l eft some buyers scrambling t o come up with the extra c ash thousands of dollars in some cases and both realtors and attorneys in the uncomfortable position of having found the advice they gave to clients on how much they should expect to payt urning out to be wrong. M rs Birch provided her c omments on the situation after Andrew OBrien, partner with the Glinton, Sweeti ng and OBrien law firm, a nd head of the Bar Associations real estate section, told Tribune Business last week that the issue has the potential to really wreak havoc on the Bahamian real estate market if it is not addressed, since it would c hange the rules of the game. Like Mrs Birch, he said t he trend had started over the last three months and h as disturbed the continuity and predictability of the B ahamian real estate market, replacing these key conditions for stability with uncertainty as parties do notk now what their transac t ion costs will be. Mr OBrien said there is no legal basis for calculati ng Stamp Duty based on R eal Property Tax valuations from years prior. He described how probl ems arise in instances such a s when property, which may have previously been valued at over $200,000 by the Real Property Tax Department, later sells for a lower price, of say, $100,000. If the buyer ands eller then pay the Stamp D uty on the property based on a $200,000 valuation, they would be subject to a 10 per cent Stamp Duty rate as opposed to an 8 per cent r ate that would apply if the p roperty was valued on the s elling or market price. This w ould increase the amount of Stamp Duty paid by $ 12,000. Mrs Birch said the Gove rnment needs to clarify what it is doing when it c omes to calculating Stamp D uty payable on real estate t ransactions, and suggested t hat if the change does not have a basis in law, it must r evert to the former procedure. She added that it seems a s if the Treasury may be being inconsistent in how it i s calculating the tax owed. Sometimes they are charging it based on the m arket value, on what it s ays on the agreement for sale; sometimes it is based on the real property tax value; and in some cases it is being based on an appraisal, she said. B REAs position, she affirmed, is that Stamp Tax s hould be paid on the market value, which is the curr ent value of the property. The market value is d efined as the amount of money thats paid by a willing buyer to a willing seller. That's the definition of mark et value, and whatever h appens three or two years ago, one years ago or five months ago, is not what'sg oing to happen today, said M rs Birch, adding: Some properties that would have sold for $600,000 are now selling for $450,000, because people just want to move on." The BREA president sugg ested that perhaps the T reasury has been inspired to base its Stamp Duty valuations on Real Property Tax valuations from years prior in order to make up f or shortfalls in revenue coll ected from real property tax i n the last Budget. In the m id-year Budget, $43 million less was said to have b een collected in the first six months of the 2010-2011 fisc al year than had been antici pated by Government. They were out. Now a lot o f properties are not selling, o r are selling at a lower valu e than before, so perhaps they determined they would c hange it to base it on the higher value because they want to get as much as theyc an, said Mrs Birch. However, she charged t hat this will be counterprod uctive, as when people discover their Stamp Duty is h igher than they anticipate d, or not based on the mar ket value of the property, they may back out of purchases altogether. This would leave the Govern ment deriving zero Stamp D uty. It will kill sales, said M rs Birch, noting that while some may be able to make u p the extra cash at the last minute, others cannot, ands ome will simply find the idea unpalatable. BREA chief to seek Stamp Duty clarity FROM page 1B

PAGE 23

BUSINESS PAGE 8B, TUESDAY, JUNE 14, 2011 THE TRIBUNE Bahama, said the private and public sectors needed to focus on the education system with definite urgency, and ensure it provided a workforce with the skills required not just by tourism and other existing sectors, but other industries the island was now targeting. It went very well, said Mr Turnquest of the forum, which was attended by 120 persons, mostly from the private sector. We were able to discuss a few of the factors affecting, impeding our economic growth. We had indications of possible solutions to some of them. Education was determined to be the number one issue, not necessarily at the professional level but at the technical skills level. That was the big issue. There was talk about the bridge to Abaco again, that being a possibility, and the power rates, the utility rates, were also an issue. Mr Turnquest said the Summit was addressed by Grand Bahama Power Companys new president and chief executive, who emphasised the $72 million investment it was making in its new power plant, plus a willingness to work with the islands business and residential community. However, on the education front, Mr Turnquest said the high school and wider system was failing to produce graduates, in sufficient quantities, who had the necessary technical, practical and vocational skills required by Grand Bahamas industrial employers, such as the Shipyard, Polymers International and BORCO. They all need technical skills, the Chamber president told Tribune Business. Kids today come out with general knowledge, but they dont have the practical skills, the welding and the technical. That is the need of our employers at the moment, so kids are coming out ill-equipped to enter these markets. The general knowledge they come out with is also not adequate, the maths and English standards still need improvement. The consensus was that we need to start focusing on the education system with definite urgency.... training for the jobs that exist, as well as those industries that we intend to target. Tourism is certainly still a part of it. As to where the Chamber and private sector will now go with their Sustainable Economic Development plan for Grand Bahama, Mr Turnquest said: The next step from here is to develop the strategic plan, now we have an idea of what the issues are and what we should be focusing on. And, once it is developed, come back to the community again, flesh it out, and make sure we have the focus the community wants us to have. We will bring in advisers, consultants to help with that. Right now, weve got the bones, and want to put meat on the bones. Once weve done that, we will come back to the community again to test the waters. Mr Turnquest said that once the Sustainable Economic Development plan for Grand Bahama was formulated, its implementation would be handed over to the Grand Bahama Development Board, the newly-established organisation featuring representatives from the Chamber/private sector, Grand Bahama Port Authority and the Government. Invitations have already gone out to the first round of Development Board/committee members, with responses awaited. Asked about the plans goals, Mr Turnquest told Tribune Business: What we hope it will achieve is a strategic vision for Grand B ahama, one that long-term survives any changes in politics and in party, and that it will be able to achieve buy-in from everyone that this is the desired future for Grand Bahama. We will start to gear all systems from the education system to the branding of the island to achieve that vision. What we hope to achieve at the end of the day is that this economy is firing on all cylinders, all engines for the benefit of Grand Bahama and the Bahamas, eventually everyone pulling in the same direction as one. Thats sustainable economic development. Education reform urgency needed FROM page 1B T rusts and SMART funds will be two areas of discussion at the Nassau Conference, which takes place tomorrow at the British Colonial Hilton. Simon Beck, partner in the Miami office of Baker & McKenzie, will disc uss settlor-directed trusts. His pract ice focuses on the international wealth m anagement industry and its clients, a nd he specialises in international tax a nd trust planning, as well as US fede ral and international securities and b anking regulations. A panel discussion on the use of SMART funds in trusts and corporate structures is also scheduled for the afternoon, featuring three Bahamian legal specialists. Samantha Knowles-Pratt, senior associate and attorney at Halsbury C hambers, specialises in the areas of s ecurities, investment funds, corporate and commercial law, banking law, t rusts, foundations, real estate and m ortgages. T imothy J. Colclough, vice-president, The Winterbotham Trust Company, specialises in trust and estate planning f or single and multi-generational high net worth and ultra high net worth i ndividuals and families. Pamela Klonaris, partner in Klonaris & Company, specialises in corporate a nd commercial law. A practicing attorney since 1989, she joined Klonaris & Co in 2001 after spending seven years and becoming a partner at a nother major law firm in the Bahamas. Prior to that she was inhouse counsel for Ansbacher ( Bahamas). The registration fee for the Confere nce is $500. Persons can register o nline at www.nassauconference.com or by calling AIBT at 356-3898. Conference attendance by BACO, BICA and STEP members providesC PD/CDE recognition. The Nassau Conference sponsors include the Bahamas Telecommunica tions Company; Credit Suisse AG, N assau Branch; EFG Bank & Trust (Bahamas (Bahamas and Trust; Santander Bank and Trust; Societe Generale Private Banking ( Bahamas); Stenham Advisors Plc; The Bank of Nova Scotia Trust Company (Bahamas Company; and UBS (Bahamas Conference to feature trusts and SMART funds S IMON BECK SAMANTHAKNOWLES-PRATT TIMOTHYJ. COLCLOUGH P AMELA K LONARIS

PAGE 24

T HETRIBUNE SECTIONCTUESDAY, JUNE 14, 2011 By ALESHA CADET Tribune Features Reporter L I KE JASMINE Poiter, we all have choices to make in life, whether its education, fame, o r love. In order to make that right decision, Jasmine is forced to walk down memory lane i n a new play entitled "Behind Her Shades" The show premiered last Friday at the College of the Bahamas Center for Performing Arts in the form of a drama and musical stage play that outlined the matters that affect Bahamians ociety daily. True friendship, relationship issues, and infidelity are all acted out in dramaa nd song. The musical was filled with comedy, drama, r omance and suspense. Viewers got the chance to watch the story unfold of a strong black f emale who is on the brink of success but is presented with her past and present situations. The production was filled with classic songs and phenomenal dance concepts. The production also features a sound t rack of hits from Adele, Whitney Houston, Beyonc and JoJo. It p romises to be both enjoyable and inspirational. I n a statement, director Jonathan Miller of S tarLight Productions, t old T ribune Woman that the story line from "Behind Her Shades" w as created to focus on issues that people face on a daily basis. Situations dealing with past exes, friends a nnoying you and involving themselves in sit uations they ought not to be, along with thep ressures of trying to pursue your dreams and sustain an educational life style by obtaining a degree. The basis of the production focuses really on trusting in the Lord and leaning not onto your own understanding. As well as it provides the audience with lessons on how to handle situations or rise to the occasion when called The concept of 'Behind Her Shades' was created because it is exactly what the name says. It's Life from Behind 'Jasmines shades (one of the lead characters eyes. from her perspective of having a confrontational best friend by the name of Indira, a boy friend who believes in her dreams but don't support, and he goes by the name of Brandon and an ex boy friend who holds the keys to her future but won't give them unless she gets back with him. His name is Andrew, Andrew Foxx." He explains the thing that made the production so spectacular is that he included classic songs from Whitney Houston, Adele and Jasmine Sullivan, t rew the audience in and enticed them into getting into SEE page 2C BARISHA PINDER AS INDIRA FRANK, the confrontational best f riend of Jasmine in Behind Her Shades.

PAGE 25

WOMAN PAGE 2C, TUESDAY, JUNE 14, 2011 THE TRIBUNE ATLANTIC MEDICAL INSURANCE CO.LTD. Atlantic House,2nd Terrace & Collins Avenue,P.O.Box SS-5915,Nassau Tel.326-8191 Suite 5,Jasmine Corporate Center,East Sunrise Highway,P.O.Box F-42655,Freeport Tel.351-3960A member of Colonial Group International:Insurance,Health,Pensions,LifeA health plan with Atlantic Medical protects you from large out-of-pocket bills.Atlantic Medical offers the richest benefits package for your money and a fast claims service.It is appreciated by members and providers.So why choose a health plan where benefits and choice have been reduced to maintain the price? After all, isnt health care all about choice,value and service? With Atlantic Medical,you receive protection from potentially huge bills: Stop loss protection (including out of network charges) Low deductibles and no hidden deductibles Direct billing,dedicated in-house claims department Widespread I.D.card acceptanceCall 326-8191(Nassau) or 351-3960 (Freeport) or visit www.cgigroup.bm Colonial Group International is rated A-(Excellentby AM Best. Premier HealthWhy pay your health premium and risk large bills too? Your wealth is protected with Atlantic Medical. t hat drew the audience in and enticed them into getting into the s tory line. This production serves as a triple threat mainly because it has acting, singing and dancing in i t. So it promises to deliver excellence," he said. Jasmine is a college student with an incredible singing voice. She wants to be focused on here ducation, yet she always comes across some sort of distraction. O ne of them is her loud and comical best friend Indira Frank. She continues to push Jasmine to pur s ue her talents. Usually, they would go to Open Mic at a local restaurant. H owever, this one particular night a well-known music executive walks in on Jasmine singing andh es captivated by her voice. Andrew Foxx seeks out and g ets Jasmine a lifetime opportunity to meet with his executive team to possibly sign a record d eal. Even though Indira is highly supportive of Jasmine becoming a star, she just doesnt trust Andrew and sees that hes up to no good. Indira isnt the only one who doesnt trust Andrew Foxx. Brandon, Jasmines boyfriend feels as ifs he should stay focused in school, because a singing career is not a lways promising especially how they are located in the Caribbean region. This puts Jasmine under a lot of pressure because along with dealing with these choices given, she too has to avoid her past to being unveiled that may catch up w ith her present. If it does, it may ruin her future." The cast was composed of y oung Bahamian actors and singers. S ome of the cast was featured previously in the musical and stage play of Starlight Productions, It B eats Me." The production wanted to give its viewers the message of making right choices. Cast Members included: Uri J. B utler as Andrew Foxx, Alfred Culmer as Brandon Johnson, Barisha Pinder as Indira Frank, SelahP oitier as Jasmine Poitier, Brian J Fernander as Mr Robert Bethel, R asDinero Thompson as George Lucas, Brianne Gibson as Jenn Cunningham, Cheraine Jackson a s Michelle Adams, Pem Rolle as Sandra Ferguson, FitzGerald Burrows as Devon Mcphee and Valarie Barr as Alicia. Behind Her Shades FROM page one BELOW: People got to witness Brandon and Indira live on stage last Friday. R IGHT: T wo of the Execu tives from 'Atlantic Record Company', the people who hold the keys to 'Jasmines' future. [L] Robert Bethel [R] Jenn Cunningham.

PAGE 26

(ARA bly never lose its place in a wedding, but a growing num ber of brides are turning to col or to help personalise their special day. From a pop of colouron a white or ivory wedding gown, to entire themes that carry throughout the flowers, decor, favours and accessories, you can use colour to set the mood for guests or make a statement about your personal style. "Brides are embracing colour as another way to customise their weddings," says Ray Miller of My Wedding Reception Ideas.com, a leading online resource for brides seeking unique wedding favors, wedding decorations and wedding supplies. "Customising with colour offers brides such a range of creativity. They can choose colours that honour their heritage, evoke the atmosphere of a specific place, or cel ebrate a memory or experience that is special to the wedding couple." If you'll be saying your "I do's" in 2011, Miller offers some advice for using colour to help create the wedding of your dreams. Tips for choosing a colour "When it comes to choosing colours for your wedding whether it's for accessories, table linens, bridesmaid gowns or even a wedding gown accent the only unbreakable rule should be that you must love the colours you choose," Miller says. Keep in mind, however, that different colours will create different moods and not all colours will feel like a good fit for your wedding depending upon where and when you have it. For example, if your goal is to create a wedding that captures the fresh, innocent aura of spring, vibrant red table linens and ice-blue bridesmaids' gowns will be in conflict with that atmosphere. "Certain colours are traditionally asso ciated with each season," Miller notes. "If you're emphasising a seasonal effect, keep in mind the colours that the natural world wears during that season." Colours that will be popular this spring and summer include hot pink, apple green, celadon, pine green, clementine orange and yellow. Heading into fall, look for amber, chestnut, dark tangerine and brick red. Winter weddings will sport colours ranging from Santa's suit red and Christmas tree green to oyster gray, ice blue and pale purple. Carrying it through Once you've chosen your wedding colours, you'll need to think about how you'll use them in both the ceremony and reception. Your creativity will serve you well here. Your wedding colours can be used in virtually every aspect of your big day, from the bridal bouquet and decor in the ceremony location, to table linens and accessories for the reception. Accessory collections are an easy way to carry your chosen colour throughout the wedding. For example, at My Wedding Reception Ideas.com, you'll find accessory collections cataloged by colour. These collections allow you to continue your colour theme whether it's a traditional shell pink, a rich royal purple or even cam ouflage with color-specific accessories such as flower girl baskets, ring bearer pillows, guestbooks and garters. What's more, you can customise table linens and even guest favors using your chosen colours. Wedding gowns and colour For decades in America, white and ivory have reigned when it comes to wedding gowns. However, the colour trend that began last year with pops of colour appearing on bridal fashion runways has con tinued in 2011. This year, brides have more options than ever if they're looking to use colour to make a personal statement with their wedding gown. From gowns that feature beading and crystals in sparkling hues, to floral accents that capture a season's signa ture colours, and even bodices or skirts in contrasting colours, bridal gowns in 2011 are going colorful. If you've already chosen a traditional white or ivory gown, you can still dress it up with your wedding colour. A simple sash or floral accent that matches your color theme will look great against the pure, fresh background of white. And if you haven't yet chosen a gown, you may just discover one with a touch of colour that can become the colour theme for your entire wedding. WOMAN T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 3C (ARA plenty of focus on making changes to your wardrobe. But as you switch out your winter for summer clothes, consider updating more than just your wardrobe this sea-s on. Changing your hair to reflect the hottest runway trends is easier than you might think and can add ane xtra element of style to your look. While you might think of high-fashion runway hairstyles as too outlandish to wear to work or even on your weekend outings, you can take inspiration fromt hem, rather than copying them verbatim. World-renowned stylist and Redken Creative Consultant Guido Palau is a fixture at the fashion industry'st op shows each season, including the spring/summer 2011 shows. He offers the following tips for translating the best hairstyles of the runway into hairstyles that y ou can wear every day. The style: Lacquer look Seen at: Prada G lossy, almost mirror-like shine was on display on Prada and other major runways. "Shine for spring/summer 2011 is bold and almost wet-looking, like it's painte d on," Palau says. "This lacquered effect makes it i mpactful on the runway, but it can also work for every day." Using smoothing serums, strong sculpting gels, mousses and firm-hold hairsprays often together g ives you the glossy tresses needed for this dramatic look. "Three key products I recommend to complete this look are: Redken pure force 16 non-aerosol fixing spray,h ardwear 16 super strong sculpting gel and glass 01 s moothing serum," Palau adds. The style: Close up Seen at: Louis Vuitton This idea is versatile, but has one defining feature: Wearing hair close to the head. These styles are ideal for making your face the center of attention they're sedate enough to be worn every day but still add extra style. Try the newly revived "milkmaid" braids, worn across the crown of your head or a shaggy chignon knotted close att he back of the head. "The braids call for sleeker styling with a smoothing serum product, while the more tex-t ured strands of the chignon require a product like Redken aerate 08 bodifying cream-mousse," Palau notes. "I like to finish this style with Redken quick dry 18 instant finishing spray." The style: Bigger is better Seen at: Marc by Marc Jacobs I nspired by style icons like Diana Ross, this voluminous look is sure to get you noticed. Playful approaches to texture were all over the runways, but you can m ake it a more everyday look by simply going for extra v olume. Use a thickening lotion like Redken thickening lotion 06 body builder and blow dry with a round brush to create loose, airy texture and for even more volume,d on't be afraid to do a little back-combing. The style: Pony tales S een at: Calvin Klein T his is a classic look, but one that can be played with more than you might imagine. On the runways, the emphasis was on clean lines, sleek texture and extende d lengths. At Calvin Klein, ponytails were worn at the nape of the neck, but re-invented by swooping the side strands over, rather than behind the ears. It's a mini m alist look that will look chic all season long. To get this look I blow-dry hair straight with Redken blown away 09 and go over hair with a flat iron and Redken iron silk 07 ultra straightening spray," Palau says. For more information about these trends, please visit Redken.com, become a fan of Redken on Facebook and follow Redken on Twitter (@Redken5thAve FROM CATWALK TO SIDEWALK How to create wearable spring and summer hairstyles The colour of love: Customising y our w edding with colour

PAGE 27

(ARA I f you're building a new home, you will likely spend thousands of dollars in upgrades designed to make your home more beautiful. Carpet, cabinet and lighting upgrades can easily drive up the total cost of the home significantly. But how much are you willing to spend to make your home safer for you and your family? The reality is that for the same amount of money it would cost to upgrade your carpet or cabinets, you could i nstall a life-saving fire sprin kler system. On average, the cost to install a fire sprinkler system in a new home is 1 to 1.5 per cent of the total building cost. It has been proven that smoke detectors alone are not enough. They merely provide a warning but do nothing to extinguish deadly flames. Fire sprinkler systems, on the other hand, are designed to provide occupants with added time to s afely escape. Industry statistics show that when a smoke detector is used in combination with a fire sprinkler system, it can reduce the loss of life up to 98.5 percent an increase of 48.5 percent over what smoke detectors alone can do. "Residential fire sprinkler systems more than pay for themselves in the form of peace of mind," says Matthew Kuwatch, global business director for BlazeMaster Fire Sprinkler Systems, the most speci fied nonmetallic fire sprinkler systems in the world. "The deci sion to install a residential fire sprinkler system is a smart one, but is especially beneficial for families with young children, elderly adults or disabled indi viduals, because their chances of dying in a fire are more than twice as high as they are for young and middle-aged adults. Fire sprinkler systems work to help delay a fire and, in some cases, completely extinguish it." Cost I f you're still concerned about cost, be aware that there are newer technologies on the market that have proven to be more cost-effective, as well as more reliable, than traditional steel fire sprinkler systems. BlazeMaster fire sprinkler sys t ems, for example, are made from a revolutionary, high-temperature specialty material that has effectively been used in lifesafety applications for nearly 30 years. Lightweight, corrosion-resistant and easy-toinstall, BlazeMaster fire sprinkler systems offer significant cost savings in the form of reduced material and labour costs. They additionally offer superior flame and smoke characteristics over some other non metallic piping materials. Beyond the obvious safety benefits, the installation of a residential fire sprinkler system can also result in reduced insur ance premiums because of its ability to limit property damage. Automatic fire sprinklers are individually heat-activated to spray water only in the immediate area of the fire often with only one sprinkler operating. The amount of water discharged from a sprinkler head is one-tenth to one-hundreth of the amount of water typically disbursed if the local fire department is called in. In some regions of the coun try, fire sprinkler systems aren't just a smart investment, they are required by code. Recent changes to the International Residential Code (IRC date that new single-family homes be built with sprinklers beginning this year, although it is at the discretion of individual states to decide when the new code changes will be implemented. Such changes in legislation reflect increased educa tion and growing awareness regarding the effectiveness of and need for home fire sprinkler systems. According to the National Fire Protection Asso ciation (NFPA 500,000 household fires occur in this country alone each year, resulting in 5,000 deaths an average of 14 per day. Make sure your family is adequately protected wherever you live. To learn more about the benefits of residential fire sprinkler systems, visit www.blazemaster.com or the Home Fire Sprinkler Coalition at www.hfsc.com. WOMAN PAGE 4C, TUESDAY, JUNE 14, 2011 THE TRIBUNE Bringing SEXYBackThe All-New SONATANew Sonata GLS features: push button start 6-speed automatic transmission advanced airbag system anti-lock break system 18 inch alloy wheels USB & iPod connectivity power drivers seat remote audio steering wheel control and much more #1 AUTO DEALER IN THE BAHAMAS Part of the Automall groupEAST SHIRLEY STREET 322-3775 325-3079Visit our showroom at Quality Auto Sales (Freeport or Abaco Motor Mall, Don MacKay Blvd, 367-2916 www.automallbahamas.com W I N N E R o f t h e I n t e r n a t i o n a l C a r o f t h e Y e a r A w a r d Push Button StartLuxury interior 0$;(1(6$,17*(5$5'RI 0 $56++$5%285$%$&2%$+$0$6 6$,17-8/,67$1,6RI-$0(6 &,67(51(/(87+(5$%$+$0$6 NOTICE is hereby given that DAVID PRINGLE McNAUGHTAN ofNutmeg House, Shamrock Street, P.O. BOX N-3229, NASSAU, BAHAMAS, is applying to the Minister responsible for Nationality and Citizenship, f or registration/naturalization as a citizen of The Bahamas, and that any person who knows any reason why registration/ naturalization should not be granted, should send a written and signed statement of the facts within twenty-eight days from the 14th dayof JUNE, 2011to the Minister responsible for nationality and Citizenship, P.O. Box N-7147, Nassau, Bahamas.NOTICE (17215$'(0$5,RI %/8(+,//52$'3%2;1$66$8 %$+$0$6 health T h e T r i b u n e BODYANDMIND Home fire sprinkler systems a practical investment EASEYOURWORRY: Home fire sprinkler systems provide peace of mind, especially for families with young children, disabled individuals and elderly adults who may need added time to escape.

PAGE 28

WOMAN T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 5C (ARA F or many men, starting a weight loss regimen may seem unnecessary and cumbersome. If you're like a lot of guys, you may be thinking that losing weight is a matter of staying active, and watching what you eat is more work than it's worth. While men might think that weight loss plans are something better suited for women, the statistics show men are more likely to be overweight than their female counterparts. Where 72 per cent of American males are overweight, 64 per cent of women can be considered overweight, according to the most recent prevalence and trends report on obesity published in a 2010 issue of the Journal of the American Medical Association. Seeing the need to provide men with a no-nonsense approach to losing weight, Weight Watchers recently launched its first national advertising campaign targeted directly at men. If you're a man who would like to shed a few pounds, but has previously been averse to trying a weight loss plan, it may not be as bad as you might think. Here are a few myths about male weight loss that may cause men to avoid eating healthier and the truth behind them. Myth: Men only need to exercise to lose weight. Reality: Unless you are working out for hours each day, simply working out and not worrying how many calories you consume is not a good plan for shedding pounds. The fact is, burning calories through exercise takes a lot longer than it does to consume them. A 200-pound man will burn about 450 calories during a three-mile run, according to Runner's World. An average hamburger or piece of cake contains about the same amount of calories. Myth 2: Low-fat or low-carb automatically means healthier. Reality: While overloading on fats and carbohydrates will likely lead to weight gain, both play an important role in healthy eating. Fats and carbohydrates are also not created equal for instance, trans and saturated fats can increase your cholesterol while unsaturated fats can have the opposite effect. The key to healthy eating is getting the right balance of both. Myth 3: Losing weight means you have to eliminate alcohol. Reality: It's true that consuming too many alcoholic beverages can lead to weight gain, but consuming in moderation can be part of a healthy diet, as long as you count those calories along with what you are eating. M yth 4: Watching what you eat means you have to give up red meat. R eality: Some cuts of meat may contain a lot of fat, but there are also a lot of lean red meat options, which contain beneficial protein, iron, zinc and vitamins. Myth 5: Weight loss works the same for everyone. R eality: Your ability to lose weight depends on many factors, and every person's metabolism is u nique. Men generally tend to lose weight faster than women due to their body composition and men also tend to be more physically active, therefore burning more calories. While you might think that following a weight loss plan is a lot of work, it's never been easier, asa plan like Weight Watchers Online For Men allows men to follow the Weight Watchers P ointsPlus program entirely online and offers mobile applications that can help you keep track of what you are eating when you are on the go. To learn more about the men's plan, visit www.weightwatchers.com/men. Losing weight doesn't have to mean giving up the foods you like for the latest fad diet, but simply being more aware of what you are putting into your body. Finding a plan that can more e asily help you track your progress can make your weight loss goals achievable. Five male weight loss MYTHS F AMILYFARE: F ather serving food to family from grill.

PAGE 29

WOMAN PAGE 6C, TUESDAY, JUNE 14, 2011 THE TRIBUNE Office Of The Prime Minister G N-1241 I t is quite common for individuals who have heart valve disease; heart attacks; deep vein clotting tendencies; strokes; heart valve replacements and kid-ney dialysis to be on anticoagulation (blood thinning medication. T wo of the commonly used anticoagulants are: (i warfarin for long term t reatment; and (ii for short term treatment. Warfarin is the more comm only used anticoagulant and is taken by mouth. T reatment with warfarin impairs clotting (when blood cells come together to stop bleeding). Therefore after a lacerat ion (cut taking warfarin, will take l onger than normal to stop b leeding. The warfarins effect usually takes 8-12 h ours to begin and persists for 3 days. Bleeding in the mouth can b e excessive, even in nonanticoagulated patients.C onsequently, dental p atients on warfarin have an i ncreased risk of bleeding during surgical procedures and as such, if a surgical procedure is required, the dental healthcare professional a Will assess the effect of the warfarin on the blood b y using a laboratory test called the International Normalized Ratio (INR who is not on warfarin, has an INR of 1. The number climbs depending on the amount of warfarin a person is using and the effect it has on the b odys ability to stop bleedi ng. The larger the number, t he more likely the individu al is to keep bleeding after a cut, when compared to the a verage person; b. Be cognizant of the reason why the individual is taking the anticoagulant; and c. Consider the type of dental procedure to be perf ormed. Surgery is the main oral healthcare hazard to a patient on warfarin and t herefore options such as r oot canal therapy should a lways be considered. Dental preventative care should be emphasised, in order tor educe the possible need for dental surgery (i.e. an extraction) because of a decayed tooth. For any elective dental surgery, it is imperative for the dental patient to understand the p otential for excessive b leeding during and after the surgery. I n addition, it is worth noting that there are certains ystemic conditions that can i ncrease the risk of excess ive bleeding especially in patients taking warfarin such a s, (iii malignancies; and (iii infection. All well trained dental healthcare professionals, will be aware of and take great care in choosing the most a ppropriate medications to be used during any dentalt reatment, for a patient taking warfarin. C are will also be taken in c hoosing any medications to be prescribed after any dental treatment. This type of protocol is followed, in order to reduce any possibility of excessive bleeding during or after the dental treatment. Caution is taken not only in choosing and prescribing medication, but a prudent d entist will also use procedural techniques that reducee xcessive bleeding during and after dental treatment.I n addition, the INR value is u sed as an indicator of the t endency of a patient to bleed excessively during a d ental surgery. The INR is a guideline to care and is checked on the day of the surgical procedure or 24 hours prior to the surgery. It is crucial that a patient taking anticoagulat ion medication has all excessive bleeding analyzed. D espite all of the above, it is not usually necessary toa sk patients to stop taking t heir warfarin medication for any period of time before a primary care dental surgical procedure. The American Heart Association (AHA suggests that patients take no wafarin for a short time before major surgeries. The American Dental Association Council on Scientific Affairs (ADA/SCA h as determined that the AHA guidelines for patients undergoing major surgerya re not applicable for patients having dentoalveol ar surgery (e.g. extractions It is therefore acceptable to allow persons having minor surgeries to continue t o take their warfarin medi cation and to be closely m onitored during the procedure. F urthermore, the A DA/SCA, the British Dent al Association and the Haemostasis and Thrombosis Task Force of the British Committee for Standards in Hematology have reviewed scientific literature and have c oncluded that warfarin t herapy should NOT be stopped for patients having routine dentoalveolar s urgery if the INR is less than or equal to 4. There are no scientific studies regarding non routine, more extensive surg-e ries (e.g. more than 6 e xtractions at one visit; r emoval of impacted teeth a nd tori (normal bone excess ive growth) removal). The dental healthcare professional will make a final decision concerning w hat is best for the patient and will adhere to all current protocols to ensure patient safety. If you are taking the blood thinnerw arfarin, please remember to tell your oral healthcare professional. T he professional will use the information, to ensure that special precaution is t aken when managing your mouth health and if necessary; your medical doctor w ill be consulted. This is to ensure the safest experience for you. Full disclosure of the medications you use is crucial and may be life sav-i ng. This article is for informational purposes only. It is not intended and may not be treate d as, a substitute for professional medical/dental advice, d iagnosis, or treatment. Always s eek the advice of a physician or dental professional with any q uestions you may have regarding a medical/dental condition. Never disregard profess ional medical/dental advice or delay in seeking it because of a p urely informational publicat ion." Copyright 2011 by Dr. Andre R. Clarke. All rights reserved. Reproduction of this article, in whole or in part, is prohibited without written perm ission. If you have questions, please send email to dr_andreclarke@hotmail.com. Dr Andr R. Clarke, DDS, MBBS Special Care Dentistry The blood thinner Warfarin and oral healthcare KEEPINGYOUR MOUTH ALIVE By Dr. Andr Clarke Caution is taken not only in choosing and prescribing medication, but a pru-d ent dentist will also use procedural techniques that reduce excessive bleedi ng during and after dental treatment.

PAGE 30

WOMAN T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 7C SUPREME COURTGN-1237 T hey say that the journey of a thousand miles begins with one step. Well, for the National Insurance Board's Get Well Bahamas Challengers, the journey of five miles began with twelve weeks of fitness and personal fitness training and wellness coaching. As their final fitness challenge, participants walked from Fort Charlotte to Goodmans Bay and back, in an exciting event dubbed, the Great Pedometer Stepoff Janette Martin-Isaacs, president of Jemi Health & Wellness, one of the facilitators for Get Well Bahamas, noted that all of the Chal lengers even those who had significant health hurdles to overcome gave their personal best. Everybody did exceptionally well. We were looking for their personal best and everybody gave their personal best. One of the final persons to finish the walk actually has some chal lenges with his legs, one leg being shorter than the other, and he has some venous insufficiency, but he wanted to bring this in to the end. I'm so proud of him. Another one of our ladies, who came in at the end, could only walk 25 yards initially. But by the end of last week she was up to the half way point which is 2 and a half miles. This is a five mile walk, and by yesterday she was up to five miles. She completed the walk this morning. So I am very, very proud, said Mrs Isaacs. Two weeks leading up to the walk, Challengers were busy training in true marathonstyle. They would practice by walking along the actual route to build up their endurance. Previous weeks of eating healthy foods, exercising at Body Zone Fitness, and receiving wellness coaching at Jemi Health & Wellness, bolstered their ability to finish the five-mile walk. Dinah Knowles, who went on to be the top overall finisher in the Get Well Bahamas programme, losing 49 pounds, described the five mile walk as exhilarating. Ten years ago, she was an avid walker, but her walking slowed down once she gave up on exercise. However, she credits a renewed love of exercise with improving her endurance to be able to complete the five-mile walk. Bernice Munnings, third place overall finisher said that walking is awesome, though challenging. It was a little torturous, but we had practiced for this. If it wasnt for my weight loss thus far, or my eating healthier, I couldnt have done it. But I did it. I didnt come first, but this walk wasnt for competition. It was something that I set my mind to in order to see if I could do it. And I did it. And I feel great, said Ms Munnings. Darron Mortimer may have been the first to cross the finish line, but he was more con cerned with helping his team members than gloating over his victory. At the end of the day I came in first, but it was not all about winning, he said. After completing his walk, Mr Mortimer went back on the route and helped fellow teammate, Shanrec Cleare, finish her walk. I got on the bicycle that one of the trainers had and I came back with [Shanrec], encour aging her along the way. People her size nor mally would give up, but she stuck with it and she came in to the end. I felt proud of my group...., Mr Mortimer added. Mr Mortimer had also encouraged fellow teammate, Gerard Davis, to complete his walk. Mr Davis said that the five-mile walk was the longest distance that he had ever completed in his life. This is a spectacular feat for Mr Davis, who has poor circulation in his legs, and a swollen spinal cord. He had also suffered a stroke. Yet, Mr Davis was determined to complete the race. And he encourages others to begin a wellness journey of their own. I see people out there so relaxed with their weight. They can walk. They have two good legs. I say to people out there, get up and start exercising before its too late, before you reach my condition of obesity. Just do something, every day. For half an hour after you eat, walk around the house, just do something so that you keep your blood circulating and your heart pumping properly, then youll be like me, about a year from now, slim and trim, said Mr Davis. Get well BAHAMAS SPECIALTOTHETRIBUNE W ALK IT OUT National Insurance Boards Get Well Bahamas Challengers are off to a good start during the Great Pedometer Stepoff, a five-mile walk from Fort Charlotte to Goodmans Bay and back. G WB WALKATHON WINNER: STEP-BY-STEP Darron Mortimer, Get Well Bahamas Challenger, walks during the Great Pedometer Stepoff, a five-mile walk from Fort Charlotte to Goodmans Bay a nd back. The event was the final fitness challenge for phase 1 of NIBs Get Well Bahamas programme. W ALKINGFORWELLNESS

PAGE 31

By JEFFARAH GIBSON T ribune Features Writer I TS easy to frown at the idea of inserting a cup into the vagina during menstruation before actually weighing the possibilities of a new innovative viable alternative t o pads and tampons. T he menstrual cup d ubbed the divacup, mooncup, lunette, miacup have all made their comeback in recent times, slowly emergi ng as a new trend in wome ns health. Women all a round the world are warmi ng up to the idea of using a c up that stays put for the d uration of menstruation. While there are an array of cups available, the divac up is the latest and is becoming very popular amongst women all around the world. T he diva cup is not the first of its kind. Menstrual cups were first developed in t he 1930s. It was made from rubber latex (an allergen for m any). The bell-shaped cup and the soft, flexible, disposable cups are the only t ypes. The bell-shaped cup is reusable and designed to last f or up to 10 years. Some brands recommend replacement each year, 5 years o r state that women who have been comfortable using t hem up to 10 years. These bell-shaped silicone or rubber cups must be removedb efore penetrative vaginal sex. I nsertion is relatively easy as well. The divacup is inserted by pressing sides of the cup together and fold-i ng it in half. You can also do the push down fold by placing a finger on the topr im of the cup and pressing i t down into the center of the inside base to form a tria ngle. If it is necessary moistening the rim of the divacup with water can also allow for easy entry. M any women wonder a bout leakage and the length of time the cups can be left in the vagina. Depending on each individ u als specific needs the cup s hould only be left in no longer than 12 hours. For women who have heavier periods the cups can ber emoved as frequently as n ecessary. After removal it should be emptied, rinsedo r washed and then reins erted. The cups are also said to be environmentally friendly by mother and daughtero wners of the divacup. Not every woman can afford a hybrid car nor easi ly convert their home to solar power. Yet, by choosing to use a menstrual cup instead of disposable tam p ons and pads, any woman i s able to make an environ m entally responsible choice each month. This is no small matter. In the US alone, billions of tampons and pads are dumped into landfills and the environment each year, said Carinne Cham bers. Francince Chambers had this to say: With all the state-of-the-art conveniences western society has developed, it baffles us why outdated feminine products are still being used. We believe that reusable menstrual cups are the next gene ration of feminine hygiene because they are the most environmentally responsible choice. They are also them ost convenient and relia ble option available and are not linked to ToxicS hock Syndrome. T hough the cups are environmentally friendly, health ier, less expensive than pads and tampons, and more con v enient there are a few dis advantages. The cup only comes in two sizes that is model 1 which is for women under 30 years old who have never delivered vaginally or by caesarian section andm odel 2 which is for women o ver 30 years old and/or for w omen who have delivered vaginally or by caesarian section. Another disadvantage if you are squeamish about blood or not comfortable with your genitals, then cups may not be an alterna tive for you. Here is what some women have to say about menstrual cups. Ive been using a divacup for maybe 5 cycles or so, but usually I take it out b efore using the bathroom because it just feels more difficult. Since my cycle started and Ive been leavingt he cup in all day, taking it o ut, cleaning and inserting before I go to bed. I haven oticed that urinating is a l ittle strange, it must be pressing against my bladder because peeing takes longer. A nother lady said: I am just about at the end of my rope. Without fail, every month, my Diva cup leaks for the first two days of my period. Yes, those are my heaviest days, but it doesn'tm atter how often I empty it. I check the holes, I can spin i t, when I tug gently on it feels like a suction. It is good, but it still leaks. I wont be going back to my old ways. The Diva Cup is just so much better, so much more comfortable, and you can use it over and over again, said Shela Stubbs*. not their real names WOMAN PAGE 8C, TUESDAY, JUNE 14, 2011 THE TRIBUNE THEDIVACUP: A NEW TREND DIVA CUPS are viable alternatives to pads and tampons.

PAGE 32

THETRIBUNE SECTIONETUESDAY, JUNE 14, 2011 INSIDE T T U U R R N N T T O O 3 3 E E . . . T T U U R R N N T T O O 3 3 E E . . . T T U U R R N N T T O O 4 4 & & 5 5 E E . . . B AAA A THLETE PROFILE UFC 131: Stout knocks out Edwards RA VENS TO FACE GO GREEN PREDATORS FOR TITLE CANADIANS went 3-1 on t he undercard at UFC 131 Saturday night, including light-w eight Sam Stouts knockout a gainst veteran Yves Edwards. Texas A&Ms dream of becoming the first school with three straight mens and wom ens team titles came down to the final two races of the NCAA championships. MULLINGS BEA TS GA Y IN 100 TEXAS A&M SWEEPS NCAA OUTDOORS MURRAY BEA TS TSONGA FOR HIS FIRST TITLE OF THE SEASON CHAMPION MA VS ARRIVE HOME IN DALLAS T T U U R R N N T T O O 2 2 E E . . . T T U U R R N N T T O O 2 2 E E . . . T T U U R R N N T T O O 7 7 E E . . . T T U U R R N N T T O O 8 8 E E . . . B y BRENT STUBBS Senior Sports Reporter bstubbs@tribunemedia.net M ark the date down: W ednesday, June 22, 2 011. Thats when The Peoples Republic of China will officially turn the new national stadium over to the Government of the Bahamas, signaling the completion of the regions m ost spectacular arena. O n August 14, 2006, the contract w as signed to build the $30 million, 1 5,000-seat track and field and football (soccer the name of legendary sports ambassador Thomas Augustus Robinson. Over the weekend, His Excellency Wang Lequan of The Peoples Republic of China, led a visiting del-e gation that got a close up and personal view of the stadium. They were joined by local government officials, headed by Minister of Youth, Sports and Culture Charles Maynard. From my perspective, they saw the stadium as a major undertaking b y their country, said Maynard, whose delegation included Robinson. I remarked to some of my senior officers that I dont know if this many high-ranking officials from China has visited the Bahamas evero r any other country in the region as much as weve seen them come over the last two years while the construction phase was going on. Maynard said the Chinese are very interested to know that the stad ium is being built by the highest quality and most of the modern t echnology are installed. That gives us a sense of comfort that they want this as a symbol of their friendship with our country, he said. But they also want it as a symbol of the technical skills and the ability of the people of China. W ith just some cosmetics work left to be done, Maynard said hes extremely pleased with the way the project has progressed so well. They are virtually complete, but we will take complete control of it Delegates tour new stadium By BRENT STUBBS Senior Sports Reporter bstubbs@tribunemedia.net AFTER placing sixth last year, Demetrius Pinder was hoping to close out his collegiate career for the Texas A&M Aggies on a bright note in the final of the mens 400 metres. However, on Friday, Pinder ended up in fourth place in 45.23 seconds in a race that he admitted got away from him at the 2011 NCAA Outdoor Championships in Des Moines, Iowa. The race was won by sophomore Kirani James of the University of Alabama in 45.10. It was a learning experience for me. Im way better than how I com peted in my individual event this weekend, Pinder stated. But in the relay, I put forth my best ability. In the open event, I went into the race ready to compete and I just didnt stick to the race plan. I got out pretty good, but after I picked him (James sat on his back and I had in my mind that I was going too fast. I lost the race because of me, not because he was better than me. Despite the disappointment in the quarter-mile, Pinder ran the second leg of the Aggies victorious 4 x 400 relay team that clocked 3:00.62 to hold off Louisiana State University (3:01.07 In the process, Texas A&M clinched another mens title and they joined their womens team as the Aggies made history by becoming the only school to win the dual national championship title for three consecutive years. Also on Friday, Pinder ran the second leg for the Aggies as they finished second in the 4 x 100 in 38.91 behind Florida State (38.77 In the womens 4 x 4 relay on Saturday, senior Cache Armbrister also completed her collegiate career at the University of Auburn by run ning the second leg as the Tigers ended up second in 3:26.46 behind the Aggies (3:26.31 Armbristers junior team-mate Nivea Smith of Grand Bahama competed in the womens 200 final where she was seventh in 22.94. The race was won by Kimberlyn Dun Pinder ends up fourth at NCAA Outdoors S EE page 2E SEE page 2E Spartans beat Raiders POWER PLAY: In the womens division of the Bahamas Flag Football League, the Spartans (green and black defeated the Raiders (black and white) in the semifinals at the Winton rugby pitch Sunday afternoon. T i m C l a r k e / T r i b u n e s t a f f

PAGE 33

B y LUKE MEREDITH AP Sports Writer DES MOINES, Iowa (AP Texas A&Ms dream of becoming the first school with three straight mens and wom-e ns team titles came down to the final two races of the NCAA championships. The Aggie men needed to take first in the 1,600-meter relay outright to claim a third straight crown. The womenn eeded to beat Oregon in the 1,600 and finish in the top three to overtake LSU. Texas A&M won both relays and the national titles in thrilling style Saturday, proving once again that the A ggies are the powerhouse programme in outdoor track and field. "You don't ever want it to come down to the relay, but it has for us for the last three years," said Texas A&Mc oach Pat Henry, who has won 33 national titles dating t o his time coaching at LSU. "It's a great, great feeling, especially when you knowy ou have a pretty good group when fixing the lineup." M en's anchor Tabarie Henry, no relation to the coach, held off LSU's Riker Hylton i n the 1,600 relay to clinch the v ictory in 3 minutes, 0.62 seconds. Jessica Beard anchored the women's foursome with a meet-record split of 49:14 seconds that gave the A&M women the win and the teamc rown over Oregon. T exas A&M's men won their third straight title with 55 points, one ahead of Florida State and two ahead of Florida. Coach "Before we came out, our coach (Pat Henry gave us our motivational speech as always. He told us it would come down to the r elay," Tabarie Henry said. He said 365 days, this is the day. We all knew what we had to do." The Aggie women claimed t heir third crown in a row with 49 points. The Ducks missed their first outdoor team title in 26 years, finishing four points behind A&M. LSU was third in the women's standings with 43.5p oints, as Kimberlyn Duncan won the women's 200 in a world-leading 22.24 seconds. B y RACHEL COHEN A P Sports Writer N EW YORK (AP S teve Mullings was still pressing his chest and grimacing long after clinching a second straight statement victory in the 100 meters. Cold conditions like Saturday's weather at the Adidas Grand Prix causes tightness in his chest because of mild asthma. The Jamaican needed oxygen after holding off train ing partner Tyson Gay to win in a photo finish. The conditions were far from perfect for the race, with a stiff headwind of 3.4 meters per second and three false starts that trimmed the fieldfrom nine to six. Mullings wasn't fazed. The 28-year-old suddenly has emerged as the latest Jamaican sprint star, running a personal-best 9.80 last week in Oregon, the second-fastest time in the world this year behind Gay. Still, there's no guarantee he'll even qualify for this summer's world championships, considering how deep his country is in his events. "I don't know what it feels like to be in a championship final in the 100," Mullings said. "That's what I'm working on." Mullings, who ran for Mississippi State, tested positive for the banned substance testosterone in 2004 and was suspended for two years. He denies ever doping. "I've always got to walk around with a big, black cloud over my head, that people say I'm dirty," Mullings said. "I can't let that bother me," he added. "If I sit around and think about what people say, I wouldn't have time to practice. I know I'm clean." Mullings won in 10.26 sec onds Saturday. Gay, who was slow out of the blocks, nearly ran him down. The American also posted a time of 10.26 ona chilly, rainy afternoon at Randall's Island, east of upper Manhattan. "I was just running a little bit sluggish for some reason," Gay said of his start. Three-time world champion Allyson Felix won the 200 in 22.92 seconds to lead an American sweep of the top four spots. "I feel like my training is coming along," Felix said. "I'm kind of where I want to be. Got a few things to work on. It's a long season, so just have to be patient and plans things out really well." Reigning Olympic and world 100-meter champion Shelly-Ann Fraser-Pryce of Jamaica struggled to last place in 23.52 while trying out the longer race she once hated. Bianca Knight was sec ond and Shalonda Solomon third. Felix plans to decide this weekend whether to run the 400 at the US championships later this month, which serve as qualifying for worlds. She said her coach was leaning against it. Fellow American Jeremy Wariner, the 2004 Olympic champ, figured the 45.13 he ran to win the 400 was the equivalent of a mid-44-second time if not for the cold and rain. So he'll take it as an encouraging result heading into nationals. "Under better conditions, it would have been a season's best," Wariner said. Double-amputee sprinter Oscar Pistorius was fifth in 45.69, just .08 off his personal best. He used to be uncomfortable racing in the rain, but he's gained confidence by making sure he trains outside every time the skies open up. The "Blade Runner" from South Africa must run a 45.25 to post the "A'' qualifying time for this year's world championships. Saturday's mark in bad weather is a good sign. "It shows I'm in the right frame of mind and have the right amount of confidence," Pistorius said, "and that this season will get better and bet ter." Javier Culson picked a good weekend to win at New York's Diamond League meet. Sunday is the city's Puerto Rican Day parade, and the first Puerto Rican to earn a medal at the world championships got the cele bration started a day early with a victory in the 400 hurdles. Two-time high jump world champion Blanka Vlasic of Croatia lost for the first time in 10 Diamond League meets. Emma Green Tregaro of Sweden jumped 6 feet, 4 inches to beat Vlasic's 6-2. The large Jamaican contin gent in the stands at Icahn Stadium saw a victory in a longer race, too. Kenia Sin clair won the women's 1,500, which honored nine-time New York City Marathon champ Grete Waitz, who died in April. Ethiopia's Dejen Gebremeskel held off Amer ican Bernard Lagat to win the 5,000, and Danielle Carruthers of the United States took first in the 100 hurdles. Pinder ends up f our th at NCAA Outdoors on June 22, both symbolically and literally, Maynard said. So the work then begins on our path. We have to make sure that we can properly maintain it, continue to promote it and make sure that it remains a first-class facility. In preparation for the hand over, Maynard noted that there will be a lot of work being done on the outside over the remaining days, including the equipment used by the Chinese removed to allow people to get a better view of the stadium when they drive pass. There are a lot of things that we are doing internally to make sure that once the hand over is complete, we can take possession of it, said Maynard, who added that the Chinese will have a skeleton crew on hand for the next 12 months to ensure a smooth transition. Its been a lot of behind the scenes work done, but we are very happy with the progress that has been made so far. Its now a reality and we are eagerly looking forward to the take over on June 22. Once all of the external works are completed, May nard said the government intends to have an official opening ceremony sometime in November. As for the stadium, Maynard said hes delighted that it will bear the name of Robinson, whom he feels is just as proud, having had the distinct pleasure of working on the project from scratch. Like I remarked in Parlia ment during the debate, hes the first person that I know about who has something named after them when hes had to work hard to help develop it, Maynard said. He headed the stadium committee from day one. So besides all of the things that he has done for the national development for sports, he was actually physically there helping to move the project forward. Once it is officially named after him, Maynard said Robinson will definitely havea sense of pride, not only for having such an honour, but for seeing that he helped to create it. As the work continues in and around the stadium, May nard said the government is presently getting ready to cre ate three roadways into the stadium. Designed Its going to be designed so that when we have 15,000 people in the stadium, they will be able to get in and out and not block the whole area, he said. So the work has began on those and there will be a grand entrance into the stadium that we are also working on. The Henry Crawford building will be demolished so they can start to shoot the point for the grand entrance. Maynard said in time, the government will completely transform the Queen Elizabeth Sports Center to show off the beauty and splendor of the new national stadium. TRACK & FIELD PAGE 2E, TUESDAY, JUNE 14, 2011 THE TRIBUNE LEGENDARY sports ambassador Tommy Robinson (far left of The Peoples Republic of China during the tour of the new staduim over the weekend. Looking on in the background is Minister of Youth, Sports and Culture Charles Maynard (wearing shades FROM page 1E FROM page 1E Delegates tour new stadium T i m C l a r k e / T r i b u n e s t a f f can in 22.24. On the field, two other seniors also finished their col legiate careers in their specialties. Lamar Delaney, competing for the University of Houston, was 18th in the mens triple jump with a best leap of 15.41 metres or 50-feet, 6 3/4-inches. Christian Taylor, a junior at the University of Florida, won with a leap of 17.80m or 58-4 3/4. And Jamal Wilson, com peting for the University of Texas, had to settle for a three-way tie for 16th placein the mens high jump with a height of 2.10m or 6-10 3/4. The winning jump was 2.29m or 7-6 by Erik Kynard,a sophomore from Kansas State. With the collegiate season complete, the focus of attention now switches to the Bahamas Association of Ath letic Associations BTC National Open Track and Field Championships next weekend in Grand Bahama. As a native of Grand Bahama, Pinder said hes looking forward to returning home and improving on what hes done all season long. I dont have no injuries, so I want to thank the Lord,he said. So Im healthy. Im ready to go. Im ready to com pete. The crowd and the home fans will be a plus. But I still have to go out there and do my job, which is to go into the race and stay focused and stick to the race plan. I just want to continue to run well and believe in myself. Texas A&M sweeps NCAA outdoor titles Mullings beats Gay in 100 at Adidas Grand Prix P HOTO FINISH: J amaicas Steve Mullings (right finishing with an identical time of 10.26 seconds at the Adidas Grand Prix track and field meet on Randalls I sland in New York Saturday. (AP Photo R ELAY VICTORY: T exas A&Ms Tabarie Henry (right door track and field championships Saturday at Drake Stadium in Des Moines, Iowa. (AP Photo

PAGE 34

W ith the Bahamas Association of Athletic Associat ions National Open Track and Field Championships scheduled for the Grand Bahama Sports Complex next weekend, public relations offi-cer Alpheus Hawk Finlayson will begin a series of profileso n some of the top athletes expected to compete in the meet. Today, the spotlight is on A A n n t t h h o o n n i i q q u u e e S S t t r r a a c c h h a a n n Anthonique Strachan was born in Nassau on November 24, 1993. Strachan attended TA Thompson Primary School a nd now attends St A ugustines College. I n 2011, she made the semi-final of the 200 at the IAAF World Junior Championships in Moncton, Canada. A member of Club Monic a, Strachan is coached by D ianne Woodside. A t the Scotiabank National High School Track and Field Championships in March, Strachan was selected Female Athlete of the championships.S he won the 100 and 200. I n the 200, she ran 23.17sec broke the 17-year-old record established by Debbie Ferguson-Mckenzie. This was the b est time in the world by a junior at that time. A t the BTC Carifta Trials, S trachan improved on her p ersonal best, clocking 23.06sec, the best time in the world for a junior at that time. At the Carifta Games in Montego Bay, Jamaica, Stra-c han tied Veronica CampbellB rowns Carifta record in the 2 00 of 22.93sec, the best time in the world for a junior. She also won the 100 in 11.38sec, a personal best. In the process, she won theA ustin Sealy Award for Most O utstanding Athlete of the Games. She was the first Bahamian to win the award since Debbie FergusonM cKenzie in 1995. UFC 131: Stout knocks out Edwards BAAA Athlete Profile S S W W I I M M M M I I N N G G B B S S F F S S R R O O Y Y A A L L B B A A N N K K O O F F C C A A N N A A D D A A N N A A T T I I O O N N A A L L S S THE Bahamas Swimming Federations 28th Annual Royal Bank of Canada (RBC ming Championships is shaping up to be a spectacular one at the Betty Kelly Ken ning Aquatic Center this weekend. The event is being sanctioned by the international governing body for the sport, FINA, and will serve as a qualifier for both the FINA World Championships July 16-31 in Shanghai, China, and the 2012 Olympic Games in London, England. More than 350-plus swimmers are expected to com pete in the championships. While all of the elite and collegiate swimmers are expected to be home to compete, a team from Venezuela and two from the United States are expected to participate. S S O O F F T T B B A A L L L L N N P P S S A A A A C C T T I I O O N N AFTER taking a break for the funeral service for the late Basil Hall and the holi day weekend, the New Prov idence Softball Association will be back in action at the Bankers Field, Baillou Hills Sporting Complex, tonight. A double header is scheduled for 7pm with Phoenix taking on the Proper Care Pool Lady Sharks. That will be followed by the mens feature contest at 8:30pm between the Dorsey Park Boys and the Dorin United Hitmen. Another double header is set for Thursday. In the womens opener at 7pm, the Pineapple Air Wildcats will play Phoenix and in the fea ture contest at 8:30pm, Dorsey Park Boys will take on New Breed. V V O O L L L L E E Y Y B B A A L L L L B B S S C C J J A A S S O O N N S S A A U U N N D D E E R R S S C C L L A A S S S S I I C C THE Baptist Sports Council has announced that its 2011 Jason Saunders Volley ball Classic will be held on Saturday (July 2 tion will be held in the men, women and 17-and-under divisions. There is an entry fee per team in each division. Awards will be presented to the champions and runnersup as well as the most valu able player in each division. There will also be a trophy for the winning church in each division. All teams interested in participating are urged to attend an important meeting 7pm Thursday at The Tri bune on Shirley Street. B B O O W W L L I I N N G G B B S S C C B B O O W W L L I I N N G G L L E E A A G G U U E E THE Baptist Sports Coun cil has announced that it intends to add a bowling league to its calendar of events. The bowling competition is scheduled to be staged at the Marios Bowling and Entertainment Center. Bowling Bowling is the newest event on the BSCs hectic yearly schedule that includes a road race, basketball, volleyball, cycling, softball and track and field. A meeting for all teams interested in participating in the league will be held 7pm Thursday at The Tribune on Shirley Street. C C Y Y C C L L I I N N G G B B S S C C J J E E F F F F B B U U R R N N S S I I D D E E C C L L A A S S S S I I C C THE Baptist Sports Council has announced that its 2011 Deacon Jeffery Burn side Cycling Classic will be held on Saturday (June 24 at the National One Mile Cycling Track. Competition will take place in the men and women masters, open, 19-and-under, 15-and-under, 10-and-under and 5-and-under divisions. Awards will be presented to the first three finishers in each category, the overall individual winners and the church with the most finishers. There is an entry fee per athlete, except for the 10and-under and 5-and-under divisions. A meeting is set for 7pm Thursday at The Tribune on Shirley Street. LOCAL SPORTS T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 3E CANADIANS went 3-1 on the under card at UFC 131 Saturday night, including lightweight Sam Stouts knockout against veteran Yves Edwards. Stout connected with a left hook in the f irst round and Edwards toppled backward. Stout (15-4-1 held back when he saw Edwards was motionless. Edwards (40-17-1 a stool to the applause of the crowd but needed a helping hand as he was led away. That is one of the nastiest KOs I have EVER seen!!!!" UFC president DanaW hite posted on his Twitter account. The 27-year-old Stout, who is from Lon don, Ontario, celebrated the victory with a backflip in the cage. SPORTS IN BRIEF I N THE SPOTLIGHT: A nthonique Strachan KNOCK OUT: Sam Stout knocks out Yves Edwards (left m artial arts bout at UFC 131 Saturday in Vancouver, British Columbia. (AP Photo

PAGE 35

FLAG FOOTBALL PAGE 4E, TUESDAY, JUNE 14, 2011 THE TRIBUNE A first time champion will be crowned in the third year of the BahamasF lag Football League when the season finale, just two weeks away, takes place. The Ravens and Go Green Predators are slatedt o square off to decide the league title 4pm Sunday (June 26 by pitch. Both teams pulled off upsets against higher seeded teams Sunday afternoon in the semifinals to advance to the championship contest. The Ravens dominated the leagues second ranked team with a 27-6 win over the Nautilus Warriors while the Predators unseated the league pennant winners,H eineken Spartans, 14-6. The Ravens scored on a 99-yard touchdown pass on their first offensive play from scrimmage and were n ever threatened for the r emainder of the game. They led 14-0 at the half a nd built a 20-0 lead before t he Warriors reached the scoreboard for the first time. The teams met in the opening week of the regular s eason when the Warriors scored a 24-8 win. However, eight games later saw ac omplete turnaround with two teams reversing roles. The Ravens path to the c hampionship opened with a dominant first half perform ance and stingy defensive effort for a 14-6 win over d efending champion RBC Lions. The Ravens finished the r egular season at 6-2, the Ravens to face Go Green S S E E E E n n e e x x t t p p a a g g e e

PAGE 36

FLAG FOOTBALL T HE TRIBUNE TUESDAY, JUNE 14, 2011, PAGE 5E Predators for the BFFL title leagues hottest team, currently riding an eight-game winning streak after starting the year at 0-2. T he Warriors finished the year at 6-2-1. The Predators pulled off the biggest win of the playoffs when they took down the top ranked Spartans whof inished the regular season at 7-1. I n the regular season matchup between the two teams in week nine, the Spartans clinched the top overall seed with a 20-7 wino ver the Predators. However, like in the first matchup, the teams experienced a role reversal in the playoffs. In the opening game of the playoffs, the Predators came from behind for an 18-12 win over the Green Parrot Hitmen. The Predators, who finished the year at 5-3, backpedalled into the play-o ffs with three consecutive losses after beginning the year at 5-0. The win against the Spartans was their first in the last four games but the timely win was enough for them toa dvance to the championship. The Ravens and Predators met in the sixth week of the BFFL regular season, and the Ravens came away with a 14-6 win. They led 14-0 at t he half before the Predators scored a late second half touchdown to prevent the shutout. F F R R O O M M p p a a g g e e 4 4 E E


University of Florida Home Page
© 2004 - 2011 University of Florida George A. Smathers Libraries.
All rights reserved.

Acceptable Use, Copyright, and Disclaimer Statement
Last updated May 24, 2011 - Version 3.0.0 - mvs