PRIVATE ITEM
Digitization of this item is currently in progress.
The Tribune.
ALL ISSUES CITATION PDF VIEWER
Full Citation
STANDARD VIEW MARC VIEW
Permanent Link: http://ufdc.ufl.edu/UF00084249/01861
 Material Information
Title: The Tribune.
Uniform Title: Tribune. (Nassau, Bahamas).
Alternate Title: Nassau tribune
Physical Description: v. : ill. ; 58 cm.
Language: English
Publisher: Tribune
Publication Date: 05-09-2011
 Subjects
Spatial Coverage: Bahamas
 Notes
General Note: Description based on: Vol. 79, no. 210 (Aug. 3, 1983); title from caption.
 Record Information
Source Institution: University of Florida
Rights Management: All rights reserved by the source institution and holding location.
Resource Identifier: oclc - 09994850
oclc - 9994850
System ID: UF00084249:01861

Downloads

This item is only available as the following downloads:

( PDF )


Full Text

PAGE 1

N ASSA U AND BAHAMA ISLANDS LEADING NEWSPAPER V olume: 107 No.137MONDAY, MAY 9, 2011 PRICE 75 (Abaco and Grand Bahama $1.25 W EATHER SUNSHINE HIGH 89F LOW 75F I N S I G H T INSIGHT: BIN LADEN RAID WAS LONGEST FORTY MINUTES OF MY LIFE SEEPAGE 16B By MEGAN REYNOLDS Tribune Staff Reporter mreynolds@tribunemedia.net A WOMAN tourist has died after suffering horrific injuries in a jet-ski accident. The 27-year-old from Florida was with an American man, also in his late 20s, when the jet-ski they were riding crashed into a boat near the entrance to Nassau Harbour at around 5pm, police say. Eyewitnesses said the colli sion was near The Narrows, between Paradise Island and Atol Island, off the Montagu Foreshore, and people gathered on the ramp watched as the couple were brought in by boat. An ambulance waited at the dock and paramedics boarded COOKIES & C REAM M cFLURRY The Tribune THEPEOPLESPAPER BIGGESTANDBEST L ATESTNEWSONWWW.TRIBUNE242.COM Woman killed in jet-ski hor r or Eyewitnesses tell of fatal collision BAHAMASBIGGEST CARSFORSALE, HELPWANTED ANDREALESTATE I N S I D E By AVA TURNQUEST Tribune Staff Reporter aturnquest@tribunemedia.net FAMILY members of a missing young mother continued their appeal for her safe return home as her two daughters spent their first Mothers Day without her. Every Saturday, the loved ones of 21year-old Krishanna Shanna Higgs who disappeared in January after travelling to Grand Bahama from New Providence SEE page 10 SEE page 10 FAMILY MAKES MOTHERS DAY APPEAL FOR MISSING WOMAN MISSING: Krishanna Shanna Higgs DELAYS experienced by British Airways passengers travelling from London to Nassau on Friday were put down to technical issues by an airline spokeswoman. According to unconfirmed reports, fumes were detected in the cockpit on flight BA235 two and a half hours after it took off from Heathrow. T he flight, which originally took off at 10.30am, returned to the airport in order for the aircraft to be checked by engineers. After a detailed inspection, and a decision to use a substitute aircraft, passengers eventually took off at 9pm and arrived in Nassau at 1am on Saturday. A passenger who was on the troubled flight told The Tribune : SEE page 11 FUMES REPOR TEDLY DETECTED ON LONDON TO NASSAU FLIGHT A NEWLOOKATRE-BRANDINGEVENT F ELIPE MAJOR / TRIBUNE STAFF THE Progressive Liberal Party called on Prime Minister Hubert Ingraham yesterday to apologise to the Bahamian people for appointing Usman Saadat the former chief of the Utilities Regulation and Competition Authority (URCA resigned from his post last week. Citing personal attacks on him and his family, Mr Saadat submitted his resignation to the Board on May 2. Pointing out they had been at odds with Mr Saadats appointment from the very beginning, the PLP said his resignation underscores the importance of a formal public inquiry into the circumstances surrounding the sale of BTC to CWC. This inquiry, the PLP promised, will come should they form the next government of the Bahamas at which time they said they hope Mr Saadat will make himself available for questioning. There existed a conflict between Mr Saadats duty to protect the public interest and his loyalty to Cable and Wire less, his former employer. The employment of Marsha Lewis, another former Cable and INCREASED police patrols led to a number of people being arrested on gun possession and drugs charges over the weekend. On Saturday, Fox Hill police detained a 21-year-old man at St Augustines College annual fair. While at SACORAMA, the man was seen throwing an object into bushes shortly before 11pm. Officers arrested the Kemp Road resident after a search of the area recovered a handgun with ammunition. Earlier that day, mobile patrol officers arrested two men who were found in pos session of a quantity of mari juana. In separate cases, police apprehended a 31-year-old man of Commonwealth Boulevard, Elizabeth Estates, and a 21-year-old man of Ethel Street, Montel Heights. Investigators are also appealing for witnesses to an armed FACEPAINTING: A youngster gets her face painted yesterday at a special Cable Bahamas event on Saturday. The company celebrated its rebranding and product upgrades at its main office on Robinson Road with entertainment, food and drink, fireworks and junkanoo. SEEPAGETWO PLP C ALL S F OR PM APOLOGY FOR URCA CHIEF APPOINTMENT SEE page 11 SEE page 10 POLICE S TEP UP PATROLS, MAKE MULTIPLE WEEKEND ARRESTS REPORTS reached The Tri bune late last night of a shoot ing at Harrold Road near Burger King. Up to press time, the male victim was said to be in serious condition. Police investigations continue. SHOOTINGREPORTS

PAGE 2

L OCAL NEWS PAGE 2, MONDAY, MAY 9, 2011 THE TRIBUNE TO CELEBRATE its re-branding and product upgrades, Cable Bahamas h eld a street party on Saturday at its main office offering free food and d rink, entertainment, fireworks and junkanoo. CABLEBAHAMASCELEBRATESRE-BRANDING FELIPEMAJOR /TRIBUNESTAFF

PAGE 3

EDITOR, The Tribune. Im rolling on the floor laughing now! I hear they finally man aged to tip one of the prison b uses over just now on B ernard Road and some fifty of the Bahamas finest are now out free without bail. Does anyone in Govern ment know who is in the two black SUVs that race upE ast Bay Street and Eastern Road at about 6pm every day? Completely unmarked (civilian plates B lack SUVs with fully tinted windows, blaring sirens and telling specific cars to moodayass. If the Pakis didnt know Bin Laden was on their capitals doorstep maybe our government has no idea who these vehicles belong to either. Must be some pretty impotent personages though as even our Governor Gen eral dont have to race a round the country with a s iren going. Maybe its the numbers people taking the cash somewhere? What a marvelous little country we have become. BRUCE G RAINE Nassau, May 5, 2011. ( As everyone knows by n ow, no prisoners escaped from the collision of the prison buses. Ed). EDITOR, The Tribune. I t is expensive when trying t o call Cuba. This becomes even more expensiveb ecause when someone p hones, many times one d oes not make contact but they still have to pay. S ometimes if you wait a couple of minutes, it will ring. So one waits and isc harged for one to two minutes. I have paid hundreds of dollars this past year alone for calls that did not get t hrough. Occasionally a recording c omes on and says it is busy. I spoke to Mrs Toni Lewis at BTC and she said that I have to pay even though the c all did not go through. This i s the same with other coun t ries. A fter I left I thought a bout it and remembered w hen I am in the US and dont contact my party, or the phone is busy, my mon ey is refunded. Also I dont know anywhere that is bad like Cuba. This happens too often. S ome people are lazy, some are not interested. It is my understanding t hat BTC shares this mone y with Cuba, which is a lot. N o one is interested in correcting this, so in the mean-t ime they are sharing a lot of m oney. People call here f rom Cuba and allow the phone to ring long enough, s o that one can see the number, so that they can call them back. They dont havet o pay, because no one answers. S omething should be done about this, because this happens too often and people a re paying a lot of money. E DNOLD THOMPSON Nassau, May 5, 2011. E DITORIAL/LETTERS TO THE EDITOR P AGE 4, MONDAY, MAY 9, 2011 THE TRIBUNE The Tribune Limited NULLIUS ADDICTUS JURARE IN VERBA MAGISTRI Being Bound to Swear to The Dogmas of No Master LEON E. H. DUPUCH, Publisher/Editor 1903-1914 SIR ETIENNE DUPUCH, Kt., O.B.E., K.M., K.C.S.G., (Hon. Publisher/Editor 1919-1972 Contributing Editor 1972-1991 EILEEN DUPUCH CARRON, C.M.G., M.S., B.A., LL.B. Publisher/Editor 1972Published Daily Monday to Saturday Shirley Street, P.O. Box N-3207, Nassau, Bahamas Insurance Management Building., P.O. F-485, Freeport, Grand Bahama T ELEPHONES Switchboard (News, Circulation and Advertising) 322-1986 Advertising Manager (242 W EBSITE w ww.tribune242.com updated daily at 2pm IT IS good that young Bahamians are starting to take an interest in politics. However, it is dangerous when they believe that without political experience and knowing how the system works they can promise voters allthe world and more besides if elected. We do not doubt that Renaldo Curry, the newest face on the political canvass, whose ambition is to overthrow the Prime Minister in his North Abaco constituency, is all that he says he is a part of a new youthful, energetic, and progressive breed of PLPs, who are a very powerful force to reckon with. He believes that his experience in his community and his work with the church has prepared him for the challenge of becoming thenext MP for North Abaco. We dont denounce any young person who believes in his own abilities, but we do take issue with this young man in the promises he is already making to his constituents promises he will not be able to keep because what he, and many others dont seem to understand is that old Mother Hubbards cupboard is bare. He says that among North Abacos press ing issues many of them long overdue are healthcare upgrades, including a mini hospital, reliable and affordable electricity, better education and housing, a modern terminal for the Marsh Harbour airport, new sporting facilities, and better support for local busi nesses. These happen to be the needs of all of the 30 inhabited islands of this nations 700island archipelago. What is not fully appreciated by most Bahamians is that an archipelagic nation is very expensive to administer because there is so much duplication of ser vices. Every island needs a mini hospital, a school and teachers, an airport, water and sewerage facilities, electricity, telecommuni cations, good roads, a support staff and the list goes on. An archipelagic nation is far more expensive to administer than a single land mass. In the same issue of The Tribune in fact on the same front page that Mr Curryannounced his candidacy and listed the needs of his constituents, Health Minister Dr Hubert Minnis announced that government did not have the funds to build a new hospital in New Providence a hospital that services patients from New Providence, as well as the Family Islands. Before the international financial crash, which took all nations down, including the Bahamas, Prime Minister Ingraham had hoped to replace the time-worn Princess Margaret Hospital with funds from the sale of BTC. However, after the economic crash, and even before the BTC sale had been completed, he announced that these funds would now have to be diverted from the hospital to pay down the national debt. And so Dr Minnis announcement was just official confirmation of an old reality. Politicians must also understand that in future it will not be so easy for the Bahamas to get loans from such international institutions as the IDB. Compared with poorer countries and despite the arguments put up by the Bahamas that it should qualify for loans it is felt that the Bahamas high percapita income takes it from the ranks of a poor and needy country. In March Prime Minister Ingraham warned that the day was coming when the Bahamas might no longer be able to tap the IDB for funding. He said that for some countries loans from institutions like the IDB are the primary source of their income. He said, for example, countries like the US believe that places like the Bahamas can get funding from the commercial international financial market and as a result the IDB ought to limit whatever funds it grants them. Already, said Mr Ingraham, the Bahamas has been graduated from being eligible to get loans from the World Bank. He now fears the day will come when the IDB might also graduate it from its books. When that day comes and if the EU loans also go then the loan market on favourable terms will dry up for the Bahamas. Maybe some of these young Turks should figure out how to increase business and rev enue so that some of the promises they are bound to make to the electorate can be fulfilled. Meanwhile, the electorate should take these promises with a grain of salt and under stand why many of them cannot be fulfilled. Mr Ingraham pointed out that many coun tries in the Caribbean are elated that they can now get loans from the Chinese. This is a situation that has to be closely watched by the Ingraham government to make certain that all Chinese labour brought to this country on work permits for the Baha Mar project and the various other projects now underway are returned to China on completion of their contract. Otherwise, we shall be building a problem for future generations similar to the problem now faced by many parts of Africa where the Chinese have gone to work, then settled and have so smoth ered Africans with their presence that they are no longer welcome. LETTERS l etters@tribunemedia.net Beware of promises that cant be fulfilled The high price of phone calls that dont get through Does anyone in Govt know who is in these racing SUVs? Share your news The Tribune wants to hear fr om people who are making news in their neighbourhoods. Perhaps you are raising funds for a good cause, campaigning for impr ovements in the ar ea or have won an award. If so, call us on 322-1986 and share your story.

PAGE 4

THE Progressive Liberal Party has called on Prime M inister Hubert Ingraham t o fire Minister of National S ecurity Tommy Turnquest, who they described as being laughably incompetent in his attempts to tackle the countrys escalating crime. Taking aim at the Ministers most recent comments t hat the government has n ot failed on crime, the PLP said they were shocked Mr Turnquestc ould be so brazen to make such a statement. Characteristics of a failing state include a central g overnment so weak or ineffective that it has little control or no control over w idespread criminality, t he party said. The crime statistics which highlight the increas-i ng murder rate during the p ast four years, speak for themselves. The Bahamas murder rate per capita exceeds that of the United States of America. The murder rate for the first quarter of 2011 is substantially higher than for thes ame period of 2010. The murder rate so far in 2011 is already on target to exceed 2010s record. 2 010s record exceeded the 2009 record. The Supreme Court has b een broken into and the perpetrators of this attack on the seat of justice have yet to be brought to trial. Witnesses in trials are being gunned down. Persons out on bail are comm itting murders and being m urdered. The foreign Director of Public Prosecution (DPP brought to the Bahamas to expedite criminal trials, streamline the system and assure convictions has failed hopelessly! The press has reported that for the t hird time in less than two w eeks, a murder case has been thrown out of court. Experienced observers p oint out that the FNM has set another record, three murder cases thrown out of court in less than two w eeks, the PLP said. The Opposition said that whatever yardstick is used, t he FNM has been an abysmal failure in a ddressing crime and the fear of crime. No logical thinking B ahamian from any sector of the political divide would agree that the FNM Government has been successful since 2007 in its efforts to stem the relentless and unremitting tide o f crime in the Bahamas. Bahamians are suffering gravely from record l evels of crime and the fear o f crime. Bahamians know that the FNMs stop, review and cancel policy visited upon the award winning and successful Urban Renewal Project and thes uccessful Swift Justice p rogramme have had a direct impact upon the increase in crime. The PLP will re-implement bothp rogrammes. The PLP again calls upon the Prime Minister to fire Tommy Turnquestw ho as well as being laughably incompetent has now taken to extraordinarya ttempts to mislead B ahamians and the world, the party said. LOCAL NEWS T HE TRIBUNE MONDAY, MAY 9, 2011, PAGE 5 RG 5HYHDOVHEXFKDGQH]]DUV'UHDP PLP wants Minister of National Security fired THEPLP criticised FNM M inister Tommy Turnquest

PAGE 5

By MEGAN REYNOLDS Tribune Staff Reporter mreynolds@tribunemedia.net A COMMUNITY cleanu p project in Nassau Harbour removed 18 sunken boats and truckloads of debris from the city coastline this weekend. V olunteers working with the National Coastal Awareness Committee (NCAC g roup of stakeholders from the private and public sectors focused their energya nd their efforts on Nassau H arbour this week working from Thursday to Saturday in the area between Malcolm P ark, west of the bridge to Paradise Island, and Williams Street across from the NassauY acht Haven. C ommittee chairman Earlston McPhee said the team of around 30 volunteers working on Thursday and Friday removed up to 14 submerged vessels, and they con t inued with the renewed energy of fresh volunteers on Saturday to bring that number up to 18. The teams of volunteers i ncluded employees of the N assau Airport Developm ent company (NAD Water and Sewerage Corporation, the LearningR esource Centre, and G GYA. Heavy equipment was donated to the cause free of c harge, and divers from Stua rt Coves Dive Centre, Kerzner International and Dolphin Encounters helpedt o identify and remove more waste from the ocean floor. Although the government M inistry for the Environment i s working with the NCAC to clean up Nassau Harbour, Mr McPhee said most of the w ork is being done by people who have donated their time and their equipment for free. M any of those volunteers, i ncluding sub-chairman Stuart Cove, deserve awards for their work, Mr McPhee said. We have some Bahami ans who love this country and who are putting action where t heir mouth is. If we can get f ive or six more individuals like that the we will be well on our way, he said. For persons to give their equipment so we dont have to buy manpower, we really need to recognise people w ho are giving back to their communities and we need to encourage them. H owever dumping in the harbour needs to be pre v ented in order for its new cleaner space to be maintained, and Mr McPhee trusts the new director of ports Patrick McNeil will ensure the laws are enforced. We hope there will be strict enforcement to ensure people dont come back with those derelict boats, Mr M cPhee said. We have to really take some strict measures toe nsure that the law is enforced. We have citizens giving t heir time for free, also their e quipment, so we have to ensure once we make those commitments and encourage others to do the same. The NCAC was established four years ago with am otive to maintain the integrity of coastal areas in the Bahamas. Last week a team of 30 to 4 0 people, including pupils from Lyford Cay School, flew to Crooked Island, courtesyo f Pineapple Air, and worked with locals to clean up the coastline, collecting over 300l arge garbage bags of waste o ver two days. That was just weeks after they had visited Cat Island to clean up the northern beaches where waste dumped at sea washes up ont he otherwise pristine sandy beaches with help from students at Kingsway Academy. Mr McPhee said the N CAC works closely with locals and local schoolchildren by establishing BahamasN ational Trust (BNT covery Clubs on the islands to raise awareness among thef uture generations. L OCAL NEWS PAGE 6, MONDAY, MAY 9, 2011 THE TRIBUNE Community clean-up targets Nassau Harbour PRESIDENT AND CEO OF NAD Steward Steeves and his son participating in the cleanup. STUART COVE DIVERS with other divers from Kerzner International and Dolphin Encounters coll ect debris from the ocean floor.

PAGE 6

LOCAL NEWS T HE TRIBUNE MONDAY, MAY 9, 2011, PAGE 7 By MEGAN REYNOLDS Tribune Staff Reporter mreynolds@tribunemedia.net A LUCKY couple will take their honeymoon one year after their wedding courtesy of Tribune Trivia after they each won The Tribunes daily online game. Shelton and Justina Miller, of Pinewood Gardens, could not afford a honeymoon after they splashed out on their wedding in April last year, and although Mr Miller said it was $18,000 well spent for him, and his wife, to have a special day, the couple would have liked to have sometime alone together. Mr Miller, a professional fisherman, and his wife, a security officer at Clifton Pier, have four children and little time alone together. So when Mrs Miller, 30, won the monthly Tribune Trivia prize in February a return flight to Miami, one night in a hotel and a free car rental the couple heldout to try to win a vacation t ogether. Mr Miller, 36, played Tribune Trivia daily throughout the month of March, diligentlya nswering each question posted on Facebook by Tribune News Network at 3pm, and emailing his answer in by 12pm the following day. His correct answers were randomly selected enough times to win him and one other player the most amount of points by the end of the month, but sadly, Mr Miller was knocked out in a tie-breaker by March winner Tangy Cartwright The dutiful husband kept playing, however, and continued to answer the trivia questions correctly throughout the month of April. Yet again he accumulated the most amount of points and yet again, another player did too. But this time Mr Miller got lucky. When I saw there was a pri v ate number calling my phone I started screaming, he said, as he recalled the moment The Tribune called on Tuesday to inform him he had won Aprils Tribune Trivia. The last time he went to Miami was in December, when he went on a Christmas shopping tripa lone to buy presents for his wife and their four kinds. This time, the children will stay at home with their grandmother, and leave the still-quite-new lyweds to enjoy a holiday alone together. When we got married we paid for our wedding out of our own pockets and it cost us close to $18,000 so it just wasnt possible to go on a honeymoon at the time, Mr Miller said. Now they will fly to Miami courtesy of Bahamasair, enjoy a free night in a hotel, and each are entitled to a free days car rental courtesy of Dollar Rent-a-car. I just want to go to Red Lobster, Mrs Miller said. To play Tribune Trivia join The Tribune News Network on social networking website Face b ook and email your answer to tribunetrivia@tribunemedia.net including your full name and phone number. Answers to all questions can be found in that day's Tribune or on www.Tribune242.com GRAND BAHAMA DISTRICT The Assistant Commissioner of Police for the Grand Bahama DistrictQuinn McCartney and his senior officers this morning visit the Police College for inspection of the new recruits in their uniforms for the first time. Assistant Commissioner McCartney is seen inspecting 3497 Theo Strachan as his senior officers at the college look on. Vandyke Hepburn /BIS ASSISTANTCOMMISSIONERVISITSNEWRECRUITS S HELTON AND JUSTINA MILLER w ill finally take their honeymoon thanks to Tribune Trivia! Tribune Trivia winners set for their honeymoon at last

PAGE 7

PAGE 8, MONDAY, MAY 9, 2011 THE TRIBUNE BySIR RONALD SANDERS (The writer is a Consultant a nd former Caribbean diplomat) OF THE249 places in the world in which human beings live and work, the small Caribbean island of Dominica ( 751 sq km) ranks at 187 in size. Even so, it is bigger than well-known Caribbean tourism destinations such asSt Lucia, Antigua and Barbuda, Barbados, Grenada, Caym an Islands, St Kitts-Nevis, B ritish Virgin Islands, Bermuda, and St Marten. Two reasons account for Dominica being left behindb y neighbouring Caribbean islands in the development of t ourism. The first is that it has no white, sandy beaches the i conic symbol of Caribbean tourism; and, second, it doesnt have an international air-p ort. It is served by small aircraft operated by American Eagle from Puerto Rico, and LIAT for inter-island transportation. Nonetheless, the island is a v eritable garden of trees, p lants, and colourful flowers. M uch of it is luxuriant rain forest, majestic in its spread o ver mountain ranges and into lush valleys. The entire terrain is adorned by gushingw aterfalls; narrow, flowing r ivers and hot sulphur springs. N ot surprisingly, it is home to hundreds of species of birds. Private operators in Dominica have also developed a vibrant whale-watching indus-t ry, taking advantage of the countrys marine life, and providing an added attraction for i ts visitors. The island, therefore, is as an eco-tourism par adise. I n an effort to expand the t ourism plant on the island, the government has consid ered borrowing US$60 mil lion from the Export-Import Bank of China. The loan would amount to 16 per cent of GDP and, if it is consummated, Dominica would nota chieve the debt to GDP ratio of 60 per cent which the IMF considers desirable. For the time being, this potential borrowing from China is on hold unless a private sector partner can be identified. B ut, millions of dollars have already been ploughed i nto spectacularly natural ecotourism resorts in Dominica b y dedicated private investors, a nd there could be even more f inanciers if the countrys f uture as a desirable ecotourism destination had a g reater level of confidence than now exists. Market D ominica is agriculturally w ell-endowed. But that endowment is in the ground and doesnt translate itself i nto income and employment. The islands last viable agricultural product, bananas, wasd ealt a mortal blow by a comb ined US-Latin America challenge at the World Trade Organization to its traditional preferential market in the European Union. A once vibrant small farmer commu n ity of some 9,000 persons has been reduced to about 500. Still, Dominica has the capacity to supply neighbour i ng Caribbean islands with fresh fruit and vegetables in abundance if it can overcome t wo constraints: no regular and scheduled refrigeratedtransportation; and high quality packaging that satisfies the requirements of the tourist markets in these islands. Both are a tall order, and beyond the resources of the Dominicag overnment alone. Therefore, eco-tourism is the star that shines brightly in Dominicas economic sky. It could guide the country to a prosperous future, but this will depend substantially on t he ecological policies that any government of the count ry pursues. Among those policies s hould be a serious and u nshakeable commitment to m aintaining Dominica as an e nvironmentally friendly island. This means any gove rnment there will have to adopt and maintain international best practices withr egard to the islands mari time and land resources, crea ting both as sanctuaries. I t will also have to instil in its young people, from kindergarten to tertiary education, t hat a foremost value of D ominican society and culture must be the protection and preservation of the envi-r onment. Already the International Fund for Animal Welfare ( IFAW) an influential cons ervation organisation with a g lobal outreach is working with the Ministry of Educat ion in a very popular Float ing Classroom project in which fifth graders study theo cean as an integrated part of their school curriculum. The project combines cross disci p linary classroom study, hands-on learning during an ocean excursion, and a student-led conservation initia tive. Children who undertake t he programme have become the custodians of their heritage in the sea, and are stronga dvocates of conservation, s howing their elders the benefits of protecting and preserving their natural environm ent. Support It is also in Dominicas n ational interest for the gove rnment to assert itself as a Champion of the environment in the international c ommunity. In return, Dominica would earn the respect of the worlds envi-r onmental and conservation organizations, and the support of their millions of members worldwide. As an example, after the Prime Minister, Roosevelt Skerrit, moved his govern m ent away from supporting Japans continuing determination to overturn rules at the International Whaling Com m ission so as to legitimize killing of hundreds of whales, including endangered species, Greenpeace another major i nternational conservation organization with regional offices in 48 countries toldi ts millions of supporters: If y ou are going to spend your hard-earned cash on a vacation to a Caribbean island, w hy not make it to one that has made the commitment toe nding whaling. T hat is a mighty message, o ne that has already brought many new Eco-tourists to Dominica and could bring t housands more every year, particularly if the call is repeated by every major con-s ervation organisation in the w orld. Such support is possible if Dominica demonstrates that in all aspects of conservation it will be amongst the first countries to stand-up. Undoubtedly there would bea coalition of international groups ready to reward the Dominican people by putting their millions of members b ehind them. If only a small percentage of the worldwide supporters o f conservation and environ mental groups said Yes to Dominica for their vacations, i ts tourism would boom and contribute substantially to the countrys GDP and toe mployment and foreign e xchange earnings. The demand for seats into Dominica would encourage l arge airlines to allocate much more space to the island ont heir flights into Caribbean h ubs such as Antigua, Barbad os, Guadeloupe and Martinique. In light of the money that c ould be made, feeder carri ers, such as LIAT, might then be ready to schedule pick-upf ights from the hubs into D ominica. The potential for sustainable economic growth, led by eco-tourism, is great. Dominica could become the worlds leading eco-tourism destina t ion. Sustainable environmental policies by its government and strategic alliances with global environmental b odies could take it there. Responses and previous c ommentaries at: www.sirronaldsanders.com Dominica: The worlds leading eco-tourism destination? WORLDVIEW

PAGE 8

LOCAL NEWS T HE TRIBUNE MONDAY, MAY 9, 2011, PAGE 9 The Mercedes-Benz C-ClassYour most enjoyable drive ever.The Mercedes-Benz C-Class is a pleasure t obehold offering a new interpretation of driving pleasure. Its taut lines lend it an air of effortless superiority while the wide radiator grille and distinctive rear section announce a vehicle with a real presence and dynamic personality. Few cars can compete with its ability to adjust so many facets of its character from the interior to the drive technology so quickly and precisely in response toexternal conditions and your own p articular needs. The key to this flexible response is the standard-fit Agility Control Package which includes selective damping. The interior offers noticeably more space and a more distinctive atmosphere tosuit your taste. As you will see, the C-Class is the perfect embodiment of the Mercedes-Benz philosophy.Tyreflex Star MotorsWulff Road, P. O. Box N 9123, Nassau, The Bahamas, Tel 242.325.4961 Fax 242.323.4667OUR PARTS DEPARTMENT IS FULLY STOCKED WITH EVERY COMPONENT NECESSARY TO ENSURE THAT YOUR MERCEDES RUNS TROUBLE FREE. TRAINED TECHNICIANS ON DUTY. VETERAN nurse Kaylor Douglas ran into Jamz waving a dollar bill on Friday as if summoned to a medical emergency ... and soon exchanged thatmagic dollar for $1,900. Prompted by a premonition based on the old adage, Kaylor knew her consistently itching hand would yield her somebig bucks, and since pay day had passed, she was on the lookout for an alternative source of income. Kaylor received the magic dollar as part of her change during a recent visit to the Beauty Shack for a bar of soap and some eye shadow. An avid Jamz listener, she listened to Jamz during a break in one of her classes at the nursing school believing out loud she would win in spite of the naysayers who surrounded her. Kaylor needed the money to help pay her daughters COB tuition, so she kept the faith. Indeed, the dollar she had, matched the serial number Jamz personality Empress announced, so she rushed over to Jamz on Shirley Street, gasp ing for breath. Yesterday Kaylor and her daughters celebrated by diningout on Mothers Day. The Beauty Shack Be-Dazzled Ultra Double Platinum Collection Magic Money Promotion, which began on Mon day, April 18, on 100 Jamz, encourages listeners to retain their dollar bills and listen to 100 Jamz daily for serial num bers. Once a serial number is called, anyone with the corre sponding dollar has 100 minutes to present that dollar to the station and claim his/her cash prize. A new serial number is called during each shift on 100 Jamz beginning with C-Note in the mornings and ending with Real ity at nights. The jackpot starts at $100, increasing by one hundred with each failure to present a winning dollar in the time allotted. It returns to $100 with every win. The promotion continues weekdays on 100 Jamz and involves Bahamian currency only, while dollar bills are publicly circulated, they are ini tially generated as change from purchases at the Beauty Shack. Kaylor joins Rhonda Ranger who presented a magic dollar to 100 Jamz on April 29 and received $3,100 in return; she too was overwhelmed with excitement. SPECIAL K, JAMZ on-air personality with Rhonda Ranger, $3,100 cash winner. 100 Jamz listeners spend a little, win a lot By CONSTABLE 3011 MAKELLE PINDER THE ROYAL BAHAMAS POLICE F ORCE would like to offer some advice to our commercial business community with regards to preventing employee theft. It is estimated that approximately 75%80% of all inventory loss is a result of employee theft. The rest of the loss can be attributed to shoplifting. Therefore listed below are a few tips that can help to minimise employee theft. D evelop policies that specify how an employee may return items. Employees should not be allowed to process their own p ersonal transactions. P rovide lockers for employees and indic ate through policies that purses, gym bags, b ackpacks, briefcases, etc. are not to be b rought into merchandise area. S upplement surveillance of the premises with CCTV, digital systems are preferred. Develop a policy for trash removal. Spot check trash containers and flatten boxes. U se transparent trash bags. Returned items should be inspected by s omeone other than the person who conducted the sale. D evelop strict security policies related to a udits and inventory. Persons responsible for payroll should n ot be directly involved in its distribution. Management should conduct spot i nspections of areas suspected of being used as a cache, delivery trucks, etc. Background checks should be conducted o n all employees PRIOR to Point Of Hire and anytime employees are suspected of t heft unless termination is in order. Sometimes employees have legal issues after they have been hired. L imit the amount of cash allowed to accumulate in the registers. M andate immediate "over ring" notification with receipts to be signed by a manager. D evelop policies/procedures for key con trol and access management that includes key audits. Electronic access and key control should only be granted to those who N EED it for job performance. Ensure key/ a ccess control return by using a policy for retrieval (holding onto the last paycheck is one method). Conduct audits by outside auditing agencies. Mandate that employees take their vacations-this may reveal a trend when t heft stops during these times. A ll shortages should be immediately and aggressively followed up on. S hould you need more information on Employee Theft or if you have information pertaining to any crime, please do not hesitate to contact the police at or CrimeS toppers at 328-tips (New Providence 300-8476 (Family Island P lease Help Us Help You and Report Employee Theft Royal Bahamas Police Force National Crime Prevention Office: Employee theft prevention tips C ONSTABLE 3011 M akelle Pinder E MPRESS Jamz on-air personality with Kaylor Douglas, $1,900 cash winner.

PAGE 9

L OCAL NEWS PAGE 10, MONDAY, MAY 9, 2011 THE TRIBUNE the boat, put the woman on a stretcher, and carried her into the ambulance. The man, who sustained serious head injuries in the collision, walked to the ambul ance with help from paramedics, witnesses said. According to police, the woman died soon after she arrived at hospital. The man was detained in serious condition. Police press liaison officer Sgt Chrislyn Skippings said investigations are still under way, and police are working to determine who was driving the jet-ski, where the tourists had acquired it, and other details of the circumstances leading up to the fatal accident. S he also warned visitors and residents to take care on the water. We always try to encourage people when you come here to enjoy our seas, but wear a life vest, Sgt Skippings said. While you enjoy yourself, take the necessary precautions. Concerns over the dangers of the jet-skis have been repeatedly raised as tourists and residents have suffered f atal and life-changing accidents. Legislation governing the use of jet-skis was revised in the Commercial Recreational Watercraft Regulations Act 2006. Operators must be licensed, trained in rescue procedures, First Aid, rules of the road, and vessel maintenance. They must also have a safety inspection certificate for their watercraft issued by the Port Department. And according to the law, an owner or operator of a jet-ski should provide a 15-minute orientation training session with anyone who hires the watercraft, guiding them in operation and safety instruction, before letting them drive it alone. An owner or operator who contravenes or fails to comply with this regulation is liable on summary conviction to a penalty of up to $5,000, two years imprisonment, or both. Reno Deveaux, of Reno Water Sports, criticised authorities for failing to adequately regulate watersports on Bahamian waters and argues jet-ski operators should be required to use machines with four-stroke engines rather than the two-stroke engines used in Nassau and Paradise Island, as he said they are safer. Mr Deveaux has said that unlike the two-stroke jet skis, the four-stroke allows for turning while slowing down. The two-stroke had design faults since the seven ties," said Mr Deveaux. They upgraded that in the four-stroke by putting in a sensor, where once the gas is let go there is still turning ability, but in the two-stroke if you're doing full speed and coming up to an object and you need to slow down and turn, you have to be giving it gas in order to turn. That is the reason most of the accidents happened on Paradise Island. Police have not confirmed the type of jet-ski involved in Fridays fatal collision. conduct a walkabout to raise awareness and expand their search. The family plans to extend their efforts into New Providence and the Family Islands as they continue their probe into her disappearance. Shannas two girls, aged three and two, have different fathers, and due to the ongoing investigation, have been living separately for nearly four months. Marina Bethel, Shannas grandmother, said: Right now its a nightmare I hope will end soon. This is an extremely sad time. Thinking about the times we spent since she became a mother, and how we spent the first Moth ers Day together it was such a great day. Ms Bethel added: Just thinking about her life, it just doesn't make any sense this whole ordeal were going through right now. I appeal to anyone who can tell us anything right now. Its so sad, two little girls who are always with their mom on Mothers Day. According to relatives, Shanna moved to Nassau last year in search of a job and was staying with her mother, Krista Fox. The young woman travelled to Grand Bahama on January 12, and was reportedly last seen in a blue-coloured Chevy Suburban. Shanna was wearing a black fitted top with a gold design, dark blue jeans and gold heeled sandals. Since Shannas disappearance, her family has received a number of text messages from her cell phone; however, relatives believe they were not sent by the young mother. Ms Fox filed a missing persons report on March 29. Rowena Poitier, an aunt, said: They [Krishannas daughters] ask for her every day. They cry for her every day. It's hard. After Krishannas disappearance, Ms Poitier returned to Freeport from Los Angeles to assist in the search for her niece. In addition to internet search efforts, Ms Poitier also coordinates the community walkabouts on Grand Bahama. Ms Poitier said: People have been really supportive, we haven't gotten any more information about her on that day at all and that is just really curious. While [Grand Bahama] is large, it feels like its a small community and we're appealing for anyone who knows anything to come forward. Police have issued an allpoints bulletin for Ellies father, 25-year-old Charles Tony Fitzger ald, whom they want to question concerning the matter. Fitzgerald, also known as Gary Coop er, is described as brown-skinned with dark brown eyes, about 5ft 10ins tall, of average build and weighs 170 to 180 pounds. Anyone with information which might assist police investigations is asked to contact the Central Detective Unit at 3503106 to 9, or 3529774/ 5 in Grand Bahama. Police control rooms in Grand Bahama or Nas sau can be reached at 911. Persons can also contact Crime Stoppers anonymously at 328-8477. We're determined to find her and we're going to, Ms Bethel added. I know its going to be soon, we're not going to give up and we will never give up. Im clinging to that hope that someone will be able to shed some light on this. Im not giving up even, if it takes our last breath we are going to keep on search ing for her. The family can be reached via email at helpusfindshanna@gmail.com or on the Facebook community page Find Shanna and Ellie. robbery at a bank parking lot. The woman victim was approached by a silver Honda car, occupied by a man and a woman, while at First Caribbean Bank, Madeira Street, on Friday morning. According to police, the pair demanded cash as the woman was walking to her car and one person was armed with a handgun. The culprits fled the area in an unknown direction after taking an undetermined amount of cash. Several hours later, Southeastern Division officers arrested two women, aged 54 and 18, and two men, aged 27 and 24, in connection to firearms, ammunition, and suspected drugs. The arrests were made at around 5.30pm at a building on Buttonwood Street, Pinewood Gardens. Later that day, Central Detective Unit officers recovered a handgun after a search of Fox Hill Park, Fox Hill Road. The officers were on routine patrol sometime around 9pm when they discovered the weapon. Meanwhile, CDU officers also on Fox Hill Road arrested three men, aged 27, 26, and 18, after a search recovered a quantity of suspected marijuana. In addition to the widespread arrests, police are also questioning a man believed to be involved in a shooting incident at Brougham Street on April 30. Ahmad Babbs, a 24-year-old Yellow Elder Gardens resident was arrested sometime on Friday. Persons with any information that may assist police with ongoing investigations, or who may have information on illegal firearms, are asked to call police at 919, 911, 322-3333, CDU 502-9991, 502-9910, Crime stoppers at 328TIPS. Woman killed in jet-ski horror F ROM page one Police step up patrols, make multiple weekend arrests FROM page one FROM page one Family makes Mothers Day appeal for missing woman

PAGE 10

LOCAL NEWS T HE TRIBUNE MONDAY, MAY 9, 2011, PAGE 11 THEFree National Movement held a Torchbearers Youth Conclave on Saturday at the Kem En Het HeritageC entre Fox Hill Under the t heme Fired Up and Ready to Vote!. Over 200 delegates from from New Providence, Grand Bahama, Eleuthera and Abaco were in attendance. Speakers included Minister Loretta Butler Turner, Minis-t er Tommy Turnquest, Party C hairman Carl Bethel, Deputy Prime Minister Brent Symonette and a cadre of youth speakers. Wireless employee, by Mr Saadat to head Human Resource not only violated Bahamian law, but it further compounded the conflicts of interest at U RCA. The blame for this sordid affair at URCA rests squarely at the feet of the Prime Minister who is the substantive min ister responsible. The Prime Minister demonstrated incredibly poor judgment in not only approving this appointment, b ut in failing to act in the pub lic interest when legitimate questions were raised in the public domain about possible conflict of interest connected with this appointment, the PLP said. In keeping with their promise of putting Bahami a ns first, the PLP said that at t he very least the Prime Minister should apologise to the Bahamian people and right this wrong by ensuring that suitably-qualified Bahamians are given a fair opportunity to fill this important positiona ccording to Bahamian law. In compliance with the terms o f his contract, and in order to facilitate the transition to a successor, Mr Saadat will stay on in his post until August 31. In a statement to the media, Mr Saadat said he has enjoyed the challenge of leading variousa spects of change both external and internal over the last two years. At the time I was appoint ed as DPR, I then understood my broad mandate as helping to transform the legacy regula tor (PUC regulatory regime, effectively regulate under the new frame work, local capacity building, a nd providing the certainty and predictability in the regulatory regime that is conducive to investment through new operators and via privatisation. I feel satisfied that I have fulfilled a large part of thatm andate. I want to express my sinc ere thanks to the Board, who have backed me through some challenging times recently. Finally, I want to thank my colleagues at URCA who have endured major changes but delivered the necessary outputsa nd outcomes under demanding circumstances, he said. Mr Saadat was hired in April 2009 after an international search for a director of policy and regulation. He was subsequently appointed CEO, following another competitive selection process in October 2010. F ROM page one PLP calls for PM apology for URCA chief appointment We had been flying for two and a half hours when it was announced there were fumes in the cockpit. The passengers were told it was nothing to get alarmed about, but the pilots had decided to return to London. The fire engines were waiting for us at Heathrow on our arrival. We were told to disembark and go through security again while the aircraft was being checked. Staff told us it should be ready for a 4pm takeoff. Eventually it was decided a substitute aircraft had to be used and we boarded the second aircraft at 7.30pm. We had to sit on the runway until about 9pm when the aircraft was cleared for take off. There was no panic among passengers. Michele Kropf, the airlines duty press officer, refused to release details of the mid-air drama. She said: We are very sorry for the delay. We always prioritise the health and safety of our customers and crew. F ROM page one FUMES REPORTEDLY DETECTED ON LONDON T O NASSAU FLIGHT DAVID PORTER, Associated Press HOBOKEN, N.J. A commuter train from New York pulling into a station for its final stop crashed into the bumpers at the end of the tracks Sunday morning, injuring 34 people, shutting down service and putting Monday morning's commute in jeopardy. None of the injuries in the PATH train's 8:30 a.m. crash was considered life-threatening, though several victims were taken away on stretchers or put in neck braces as a precaution, Hoboken Mayor Dawn Zimmer said. The injured, who mostly sustained cuts and bruise s, were taken to three area hospitals for treatment, and most, if not all, were expected to be released later in the day. The cause of the crash remained under investigation, but city police said it appeared t hat a mechanical failure was to blame. The National Transportation Safety Board and the Port Authority of New York and New Jersey were investigating, and officials said train service would remain suspended until the NTSB completed its initial review, which was ongoing late Sunday afternoon as crews worked feverishly to repair damaged tracks. Port Authority and city offi c ials said crews would be work ing through the night to make repairs at the station in Hoboken, just across the Hudson River from New York City. It was hoped that one of the three tracks would be reopened by Sunday night and that a second would be ready for the Monday morning commute, but it was unknown when the remaining track might reopen. To help deal with the potential travel woes on Monday, transit offi cials said additional bus and ferry service would be provided, and most agencies planned to honor each other's tickets. T he PATH, or Port Authority Trans-Hudson, system is the main transit link between Manhattan and neighboring New Jersey urban communities and suburban commuter railroads. It handles nearly 250,000 passenger trips each weekday, few er on weekends. Officials said the motorman on Sunday's train would be test ed for drugs and alcohol, which is standard policy in such crash es. They said there was no reason or evidence to suggest that the motorman had been impaired at the time of the crash. Passengers on the train, which had departed earlier in the morning from New York City, said it had been a routine trip until they suddenly were knocked around by the impact. "People were stunned, but nobody was really going crazy or anything," said Tom Gordon, of Jersey City, who was riding in the train's front car with about 15 other people. "I didn't know what had happened at first." Gordon, who was headed home from his security job at a New York City apartment building, said he was half-asleepas the train pulled into the sta tion on track No. 2. But he was quickly awakened and jolted from his seat by the crash. He was taken to Hoboken University Medical Center for treatment of minor arm and rib injuries and left the hospital Sunday afternoon with his arm in a sling. "I just want to get home," he said while waiting for his wife to pick him up. Witnesses described the scene as the station as "controlled chaos," saying people were mostly calm but very concerned for the injured. Zimmer praised the efforts of emer gency responders from Hoboken and surrounding commu nities who answered their call for assistance. TRAIN CRASHES PULLING INTO NJ STATION, HURTING 34 CASUALTY: An unidentified man, who was injured during a PATH train crash at the Hoboken Terminal, is seen on a stretcher as medical officials prepared to take him to t he hospital, Sunday, May 8, 2011, in Hoboken, N.J. FNM HOLDS TORCHBEARERS YOUTH CONCLAVE

PAGE 11

B y ALISON LOWE Business Reporter alowe@tribunemedia.net The Bahamas Maritime Authoritys (BMAi n growing this nations ship p ing registry, and paying dividends to the Government, should be viewed as an incen t ive for other public corporations/agencies to be given the same semi-autonomous sta tus, its chairman has argued. Ian Fair said that as a statutory corporation the BMA is a very effective model for h ow other government entities could be operated, having returned dividends to theG overnment in excess of $50 million (in 16 years with a staff of 75. The Government wanted the BMA to operate as a private sector entity, and the model has worked very effec tively. I would submit it is an excellent example for other entities. It had sat under the Ministry of Transport for many years until it was formalised in 1995, and its just been a huge success. Weve returned a lot of money to the Government in dividends, but we are also able to use our own resources for the good of the Bahamas as well in various aspects. We dont have to worry about going cap in hand to the Gov ernment to raise money, said Mr Fair, adding that he believes the Government should not be in the business of doing business. He was addressing the Rotary Club of East Nassau on Friday at the Nassau Yacht Club. Mr Fair said that today the Bahamas is a significant player in the open register business, which allows own ers whose principal place of business is not in a particular country to register their vessel here. Open -egister registration is growing in popularity, sug gested Mr Fair, noting that the number of vessels attached to open registers has grown in 10 years from 30 per cent to over 50 per cent. As the third largest ship registry in the world, thisn ation presently has some 1,650 vessels on its register SECTIONB business@tribunemedia.net MONDAY, MAY 9, 2011 THETRIBUNE $4. 68 $4. 51 $4. 69T he information contained is from a third party and The Tribune can not be held r esponsible for errors and/or omission from the daily report.$ $5.69 $5.62 $5.73 By NEIL HARTNELL Tribune Business Editor The Bahamas Oil Refini ng Companys (BORCO new owner has unveiled plans to launch a phased $ 350-$400 million expansion o f its tank capacity this quart er, adding that it still expects the Grand Bahamabased facility to generateb etween $130-$140 million in annual operating income once various projects are completed. Addressing a conference call to discuss Buckeye Partners 2011 first quarter results with Wall Street analysts, Forrest E. Wylie, the companys chairman and c hief executive, described the 7.9 million barrel capacity expansion at BORCO as our biggest actual capital g rowth project. H aving reevaluated the expansion plans left in place by the previous FirstR eserve Corporation/Vopak ownership, Mr Wylie said Buckeye Partners had decided to structure the project in various phases, with the first phase involving a 3.5 million barrel capacity expansion to start in the 2011 second quarter and be operational by end2 012. The extra capacity will be used for additional clean p roducts and fuel storage, M r Wylie explained, with t he second expansion phase involving a 3.4-3.5 million barrel capacity expansion.H e added that the total expansion will encompass 7.9 million barrels of stor$400m expansion kick-off at BORCO n New owner approves two-phase, 7.9m barrel capacity addition to start this quarter n Expansion projected to boost annual operating income at Grand Bahama storage facility to $70-$80m n Annual income could hit $130-$140m when BORCO reaches full capacity potential By ALISON LOWE Business Reporter alowe@tribunemedia.net The Ministry of F inance is reasonably satisfied with progress being made at the Busi-n ess License Unit, although admitting that a three-week backlog of around 300 applications currently remains. M inister of State for Finance, Zhivargo Laing, s aid late last week that the unit has processed and completed about 10,000 applications for business licenses since January 2011. He said that of those outstanding applications received b y the department, some of them have to do with people who have not submitted all of the information they w ere required to, but most of them have to do with volBusiness Licence backlog sorted within the week 10,000 licence applications processed since January, but 300-strong two-week backlog remains SEE page 8B Z hivargo Laing By NEIL HARTNELL T ribune Business Editor The Bahamas Telecomm unications Company (BTC t ors to ensure it does not under-recover costs associated with providing interc onnection joining services for rival carriers, noting t hat it has employed $101 million in capital on this to date. R esponding to the Utilities Regulation & Compet ition Authoritys (URCA consultation on its proposed charges for interconnection joining services, the newly-privatised carri e r said its separated accounts showed it spent a total $63 million on provid ing interconnection joining c ircuits during its 2009 financial year. Splitting that figure into $30 million of mainte n ance, network operations and support costs, and $33 million in common costs, BTC added that total net w ork capital costs amounted to $37.1 million taking its total interconnectionj oining services outlay to b etween $100-$101 million. The total capital employed in the accounts relating to joining circuitsa mounts to $101 million, so BTC demands no under-recovery on connect costs Carrier says total capital deployed on joining services is $101m Regulators mark-ups a factor five higher than its own* URCAs monthly operating cost benchmarks between 73-150% higher than BTCs By NEIL HARTNELL Tribune Business Editor A leading Freeport wholesaler has been grant-ed leave to appeal a Supreme Court ruling that dismissed its Judicial Review application over Customs demands for a monthly bonded goods sales report, with the latters undertaking that it would not take action against the company also remaining in place. Fred Smith QC, the Cal lenders & Co attorney and partner who acts for Kellys (Freeport Appeal Justice John during an in-chambers hearing granted the company leave to appeal a ruling by Justice Hartman Longley, who dismissed its Judicial Review application on the grounds that it had failed to file a mandatory Notice of Motion within the required timeframe for no good reason. The result is that we were given leave to appeal Justice Longleys dismissal of Kellys action, and the Appeal Justice also stayed his ruling, so Customs undertaking remains in place. Nothing changes until the determination of the appeal, Mr Smith told Tribune Business. He added that Appeal Justice Johns decision has Kellys in Customs appeal victory SEE page 8B SEE page 8B MARITIME AUTHORITY A GOV T AGENCY MODEL Paid over $50m in dividends to government over 16 years SEE page 7B By NEIL HARTNELL T ribune Business Editor Cable Bahamas has urged sector regulators to ensuret hat the Bahamas Telecom munications Company (BTC nection agreements with it w ithin one month of approving the latters Reference Access and InterconnectionO ffer (RAIO t hat no delay in introducing fixed-line voice competition be tolerated. The BISX-listed commun ications operator, in its response to the Utilities Regulation & CompetitionA uthoritys (URCA CABLE URGES ONE MONTH TARGET FOR BTC INTERCONNECT Calls on URCA not to tolerate any competition stalling tactics by incumbent SEE page 6B IAN FAIR SEE page 6B

PAGE 12

By ROYALFIDELITY CAPITAL MARKETS It was moderate week of trading in the Bahamian stock market. Investors traded in eight out of the 24 listed securities, with two advancers and three decliners. EQUITY MARKET A total of 43,745 shares changed hands, representing a decrease of 76,972 shares compared to the previous week's trading volume of 120,717. Famguard Corporation (FAM trading a volume of 14,110 shares to see its stock price climb $0.20 to close at $5.40. Bank of the Bahamas (BOB traded a volume of 5,150 shares, i ts share price increasing by $0.01 to close at $6.89. FirstCaribbean International Bank (BahamasCIB the volume leader, trading a volume of 14,467 shares, its stock price decreasing by $0.15 to close at $8.60. Finance Corporation of the Bahamas (FIN d ecliner, trading a volume of 1,000 shares to see its stock price fall by $0.50 to close at $6. Doctors Hospital Health Systems (DHS of 5,200 shares, its stock falling by $0.04 to close at $1.31. Focol Holdings (FCL a volume of 2,000 shares to c lose unchanged at $6. Cable Bahamas (CAB ed a volume of 1,000 shares to close unchanged at $8.74. Colina Holdings (CHL ed a volume of 818 shares to close unchanged at $2.55. BOND MARKET N o notes traded during last week. COMPANY NEWS Earnings Releases: Bahamas Supermarkets (BSL results for the quarter ended March 9, 2011. BSL reported a n et profit for the quarter of $3.9 million after extraordinary income of $15.5 million. It was noted that before the extraordinary income was declared there was a loss of $11.5 million. Net sales stood at $43.7 million, while cost of goods sold was $34.2 million. Gross profit was $9.4 million compared to $23.9 million in the prior year. BSLs operating and administrative expenses were $20.1 million, while interest expense/finance charges s tood at $793,000. Total assets and liabilities at March 9, 2011, were $12.9 million and $10.7 million, respectively, compared to $15.1 million and $16.6 million at the previous year-end, January 30, 2010. C ommonwealth Bank (CBL released its unaudited financial results for the quarter ended March 31 2011, reporting a total comprehensive income available to common shareholders of $12.9 million. That was an increase of $927,000 from the $12 million reported in the s ame quarter in the previous year. Net interest income of $28.1 million increased by $1 million, from $27.1 million in the comparative quarter, while loan impairment expense fell by $0.7 million from $5.8 million to $5 million. CBL's non-interest expense of $13.1 million increased by $0.6 million yearover-year, due primarily to higher general and administrative expenses. Earnings per share for the quarter were $0.12, compared to $0.11 in the 2010 first quarter, an increase of $0.01. CBLs total assets and liabilities at September 30, 2010, were $1.43 billion and $1.18 billion, respectively, compared to $1.41 billion and $1.16 billion at year-end December 31, 2010. Dividend Notes: AML Foods (AML declared a dividend of $0.04 per share, payable on May 6, 2011, to all ordinary shareholders of record date April 29, 2011. AGM Notice: Colina Holdings (CHL announced its AGM will be held at the J.W. Pinder Building on Collins Avenue on May 12, 2011, at 5.30 p.m. Bahamas Waste (BWL announced its AGM will be held at the National Tennis Centre on May 18, 2011, at 6pm. Commonwealth Bank (CBL has announced its AGM will be held at SuperClubs Breezes on May 18, 2011, at 5pm. B USINESS PAGE 2B, MONDAY, MAY 9, 2011 THE TRIBUNE RoyalFidelity Market Wrap EQUITY MARKET TRADING STATISTICS Week ending 06.05.11 BISX CLOSING WKLYPRICE VOLUME YTDPRICE SYMBOLPRICECHANGECHANGE AML$ 1.18$-021.65% BBL$ 0.18$-00.00% BOB$ 6.89$0.015,15040.61% BPF$ 10.63$-00.00% BSLN/A$-00.00% BWL$ 2.70$-00.00% CAB$ 8.74$-1,000-16.44% CBL$ 6.98$-0-0.29% CHL$ 2.55$-8186.25% CIB$ 8.60$-0.1514,467-8.41% CWCB$ 1.86$-0.1001.64% DHS$ 1.31$-0.045,200-18.13% FAM$ 5.40$0.2014,110-11.04% FBB$ 1.96$-0-9.68% FCL $ 6.00 $2,0009.89% FCLB $ 1.00 $-00.00% FIN $ 6.00$-0.501,000-17.01% ICD$ 7.30$-0-1.35% JSJ$ 9.82$-00.00% PRE$ 10.00$-00.00% n C ONTINUED ONPAGETHREE

PAGE 13

By ALISON LOWE Business Reporter alowe@tribunemedia.net The Bahamas Maritime Authoritys (BMA has called for greater harmonisation in the sector, suggesting that this could lead to future growth and innovation for both the industry and econo-my overall. Ian Fair said the BMA considers Denmark an excellent model for how this nation could form a cluster of maritimerelated government and private sector entities. To be clear, I am not proposing any form of mass consolidation, as many parts need to retain their own identity. What I am saying is that, in line with the Danish model, we have the various elements work much more closely together so that the sum of the whole is greater than the parts, he explained. Mr Fair, also deputy chairman of Butterfield Bank (Bahamas many segments of the maritime industry as including: the BMA and the ship registry, interisland and overseas shipping, general maritime services, resident shipping companies, oversaes shipping companies based here, the Freeport Container Port, the shipyard in Freeport, the various yacht services centres especially in Freeport and Abaco, other ports and marinas, the Port Department, the RBDF, the fishing industry, the maritime leisure and sportfishing business, suppliers, sub-contractors and professional advisers. Underlining the incentives for such harmonisation, Mr Fair noted that while many people speak of the need for diversification away from tourism and financial services as pillars of the economy, he sees such a third leg already existing in the form of the maritime industry. However, its fragmentation means that it has traditionally not received the recognition or been marketed as extensively as it deserves. Taken as a whole the maritime industry is the third largest contributor to our economy, and rivals the financial services industry in size. In my view this is one of our lesser known stories and needs to be promoted to a much larger extent, said Mr Fair. He was speaking on the role of the BMA and the maritime indus try in the Bahamas to the Rotary Club of East Nassau on Friday. He believes his harmonisation proposal would, if imple mented, raise the profile of the maritime industry and [ensure that it] contributes even more to our economy. I believe the sum of the parts will be greatly enhanced if they were put together in a more integrated manner. Let us grasp the moment and make an even greater contribution to our economy in the years to come, charged Mr Fair. Mariners He also made the case for greater emphasis on creating conditions that would allow more young Bahamians to enter into careers in the maritime industry, as mariners on board vessels sailing the world. Although the Bahamas is the third largest ship registry in the world (1650 vessels Bahamians sail onboard Bahamian-flagged vessels. While there is significant potential for meaningful marine careers for trained and certified Bahamians, there is no maritime training institution in the Bahamas that can offer the required international certifications. Many Bahamians who have an interest in the field can not afford the tuition and other costs associated with studying abroad. Mr Fair reflected upon one of the best days of his life in recent years having been the day that he presented graduation certificates to graduates of the Bahamas Maritime Cadet Corps, recalling the unparalleled energy and enthusiasm of the kids and their parents present. One of the challenges weve had is that the kids go away to a summer course at Holland College on Prince Edward Island, but they havent got the money to go away and get their fouryear degrees, so we havent got as many Bahamians going away and getting their degrees and going away to sea, Mr Fair said. Thats the reason why we are now pushing a maritime school at the College of the Bahamas. That will give a huge opportunity to more Bahamians to at least get those two years, and possibly their full four-year degrees, so basically we can get way more Bahamians becoming fully qualified mariners. People can go to sea from anywhere from one to ten years, and when they come to shore theyre an expert mariner. The maritime industry is so vast, so there are huge numbers of job opportunities theyve got a career. Theres great opportunities, said Mr Fair, adding that in his opinion the Bahamas could sell itself as a place to study for a maritime career not only for Bahamians but globally. Why shouldnt we become known in a few years time as one of the maritime schools of the world?, he said. BUSINESS T HE TRIBUNE MONDAY, MAY 9, 2011, PAGE 3B 08/7,1$7,21$/+$50$&(87,&$/&203$1< ,VORRNLQJIRUDSRWHQWLDOFDQGLGDWHVWR OOWKHSRVLWLRQRI 0HGLFDODOHVHSUHVHQWDWLYH %DKDPDV 5HVSRQVLEOHWRJXDUDQWHHWKHIXOOOPHQWRIWKH VDOHVJRDOVDQGPDUNHWSDUWLFLSDWLRQJURZWKRIWKH DVVLJQHGSURGXFWV 5HTXLUHPHQWV $EDFKHORUVGHJUHOGUHODWHGWR PHGLFLQHRUSKDUPDFRORJ\VXFKDVELRORJ\ FKHPLVWU\RUSK\VLRORJ\LVKLJKO\GHVLUDEOH ([SHULHQFHRI\HDUVPLQLPXPLQVLPLODUSRVLWLRQ LQPXOWLQDWLRQDOKHDOWKFRPSDQLHV +LJKOHYHORIFXVWRPHUIRFXVUHVXOWVRULHQWDWLRQ ([FHOOHQWFRPPXQLFDWLRQDQGSUHVHQWDWLRQVNLOOV ([FHOOHQWLQWHUSHUVRQDOVNLOOV HDPSOD\HU :HRI &RPSHWLWLYHFRPSHQVDWLRQDQGEHQHWVSDFNDJH ZLWKLQWKHPDUNHWRIPXOWLQDWLRQDOFRPSDQLHV $WWUDFWLYHZRUNLQJHQYLURQPHQWKLJKO\HPSRZHUHG WRFUHDWHLQQRYDWLYHVROXWLRQV,QWHUQDWLRQDOFDUHHU RSSRUWXQLWLHV 3OHDVHVHQG\RXUHVXPHWRWKHIROORZLQJHPDLO PHGLFDOUHSUHVHQWDWLYHFDUHHUV#JPDLOFRP B OND MARKET TRADING STATISTICS BISX SYMBOL D ESCRIPTIONVOLUMEPAR VALUE F BB13FBB Series C0$1,000 Notes Due 2013 FBB15 FBB Series 0$1,000 D Notes Due 2015 FBB17 FBB Series 0 $1,000 A Notes Due 2017 FBB22FBB Series0$1,000 B Notes Due 2022 INTERNATIONAL MARKETS FOREX Rates CurrencyWeekly% Change CAD 1.0346 -2.17 GBP 1.6404 -1.84 EUR1.4358-3.10 Commodities CommodityWeekly% Change Crude Oil 109.77 -12.81 Gold 1,487.00 -3.16 I nternational Stock Market Indexes IndexWeekly% Change DJIA12,638.81-1.34 S&P 5001,340.20-1.72 NASDAQ2,827.56-1.60 Nikkei9,859.200.10 Maritime chief calls for better sector integration RoyalFidelity Market Wrap continued from Page Two

PAGE 14

B y ALISON LOWE B usiness Reporter Alowe@tribunemedia.net The attorney representing w orkers at Morton Salt ( Bahamas) has accused the c ompany of union busting, and said the union has noo ption but to go to court a fter it announced plans to unilaterally apply new c onditions of employment before a deal on an indus-t rial agreement had been reached. O bie Ferguson, legal a dviser to the Bahamas I ndustrial, Manufacturing and Allied Workers Union( BIMAWU), alleged that M orton Salts move, a nnounced in a statement i ssued to the press on Thursday, was not lawful. M orton Salt (Bahamas said the decision, the legalit y of which it defended on t he basis that the deal being o ffered to employees was more favourable to work-e rs, came after an impasse h ad been reached following more than a year of negotiations with the BIMAWU. The BIMAWU president, Ronald Roker, denied the impasse and called for the company to again sit down a t the negotiating table. Concerned In an interview with Trib une Business late Friday, Mr Ferguson said he and the u nion were particularly conc erned about the fact that the company is asking the w orkers to increase their contribution to their healthcare insurance costs. He said he would be seeking an injunction as soon as p ossible to prevent Morton S alt implementing the proposed changes to the work-e rs terms, as this would negatively impact them, i ncluding the healthcare c ontribution increase. T he company stated that it intended the changes toc ome into effect on June 1, 2 011. It cited the rising cost of health insurance as the motivation behind the increase, adding that with the increase the total contribution would be in line or below that required by o ther employers in the r egion, while to 90 per c ent of the increase would b e covered by the company. M r Ferguson said: What t hey are trying to do is against the law. The union isa bargaining agent. The relationship between the employer and those employees have been abrogated. The union is the agent, a nd so they cannot without the consent of the worker enter with a view to d ecrease their salaries. The e ffect of the increase to take e ffect on March 1 would be to decrease their salaries ,and it would be a unilateralv ariation of their contract." The last industrial agree ment between the BIMAWU and Morton Salte xpired in April 2010. The company and the union have been negotiating since January 2010 for a new deal.T he company accused the union of not having negoti ated in good faith accepti ng and then rejecting offers and not living up to com mitments made. It said it needed to impose the new terms in order top rovide certainty both for workers and for its own business. M r Ferguson denied that the union had not been negotiating in good faith. He said the old industrial agree m ent would continue to a pply until a new one was reached. B USINESS PAGE 4B, MONDAY, MAY 9, 2011 THE TRIBUNE 52wk-Hi52wk-LowSecurit y Previous CloseToday's CloseChangeDaily Vol.EPS $Div $P/EYield 1.190.95AML Foods Limited1.181.180.000.1550.0807.66.78% 10.639.05Bahamas Property Fund10.6310.630.000.0130.200817.71.88% 7.004.40Bank of Bahamas6.896.890.000.2130.10032.31.45% 0.530.17Benchmark0.180.180.00-0.8770.000N/M0.00% 2.842.70Bahamas Waste2.702.700.000.0470.09057.43.33% 2.201.96Fidelity Bank1.961.960.000.0160.040122.52.04% 12.008.69Cable Bahamas8.748.740.001,0001.0500.3108.33.55% 2.852.35Colina Holdings2.552.550.000.4590.0405.61.57% 7.005.80Commonwealth Bank (S1)6.986.980.000.4960.26014.13.72% 2.531.86Consolidated Water BDRs1.881.86-0.020.1110.04516.82.42% 2.541.31Doctor's Hospital1.311.310.000.1070.11012.28.40% 5.994.75Famguard5.405.400.002,0000.3570.24015.14.44% 9.005.65Finco6.506.00-0.501,0000.6820.0008.80.00% 9.858.60FirstCaribbean Bank8.608.600.001,0000.4940.35017.44.07% 6 .004.57Focol (S)6.006.000.000.4350.16013.82.67% 1.001.00Focol Class B Preference1.001.000.000.0000.000N/M0.00% 7.305.50ICD Utilities7.307.300.000.0120.240608.33.29% 10.509.80J. S. Johnson9.829.820.000.8590.64011.46.52% 10.0010.00Premier Real Estate10.0010.000.001.2070.2008.32.00% 52wk-Hi52wk-LowSecuritySymbolLast SaleChangeDaily Vol. 99.4699.46Bahamas Note 6.95 (2029BAH2999.460.00 100.00100.00Fidelity Bank Note 17 (Series A) +FBB17100.000.00 100.00100.00Fidelity Bank Note 22 (Series B) +FBB22100.000.00 100.00100.00Fidelity Bank Note 13 (Series C) +FBB13100.000.00 100.00100.00Fidelity Bank Note 15 (Series D) +FBB15100.000.00 52wkHi 52wkLow Symbol Bid$ Ask$ LastPrice DailyVol EPS$ Div$ P/E Yield F INDEX: YEAR END 2008 -12.31%30 May 2013 20 November 2029FRIDAY, 6 MAY 2011B ISX ALL SHARE INDEX: CLOSE 1,435.03 | CHG -6.92 | %CHG -0.48 | YTD -64.48 | YTD % -4.30BISX LISTED DEBT SECURITIES (Bonds trade on a Percentage Pricing basis)Maturity 19 October 2017 7%RoyalFidelity Merchant Bank & Trust Ltd. (Over-The-Counter Securities)29 May 2015 W W W.BISXBAHAMAS.COM | TELEPHONE: 242-677-BISX (2479) | FACSIMILE: 242-323-232019 October 2022 Prime + 1.75% Prime + 1.75% 6.95%BISX LISTED & TRADED SECURITIES AS OF:7% Interest 52wk Hi 52wk Low Symbol Bid $ Ask $ Last Price Daily Vol EPS $ Div $ P/E Yield 10.065.01Bahamas SupermarketsN/AN/A14.00-2.9450.000N/M0.00% 0.550.40RND Holdings0.350.400.550.0010.000256.60.00% 41.0029.00ABDAB30.1331.5929.004.5400.0009.030.00% 0.550.40RND Holdings0.450.550.550.0020.000261.900.00% 52wk-Hi52wk-LowFund NameNAVYTD%Last 12 Months %NAV 3MTH 1.54871.4525CFAL Bond Fund1.54871.48%6.06%1.526164 2.98142.8300CFAL MSI Preferred Fund2.98141.15%2.40%2.947425 1.59201.5141CFAL Money Market Fund1.59201.14%4.53%1.574964 3.20252.8522Royal Fidelity Bahamas G & I Fund2.7049-0.56%-15.54% 13.638813.0484Royal Fidelity Prime Income Fund13.50161.08%0.02% 115.7622101.6693CFAL Global Bond Fund115.76229.58%9.58%114.368369 111.469799.4177CFAL Global Equity Fund111.469711.32%11.32%106.552835 1.16081.0000FG Financial Preferred Income Fund1.16081.25%5.20% 1.12141.0000FG Financial Growth Fund1.12140.26%4.18% 1.16201.0000FG Financial Diversified Fund1.16201.12%5.24% 9.99529.5078Royal Fidelity Bah Int'l Investment Fund Principal Protected TIGRS, Series 19.99521.51%6.08% 11.217310.0000Royal Fidelity Bah Int'l Investment Fund Principal Protected TIGRS, Series 211.21731.50%6.41% 10.42889.1708Royal Fidelity Bah Int'l Investment Fund Principal Protected TIGRS, Series 310.42884.03%4.29% 8.45104.8105Royal Fidelity Int'l Fund Equities Sub Fund8.55591.88%8.41% BISX ALL SHARE INDEX 19 Dec 02 = 1,000.00YIELD last 12 month dividends divided by closing price 52wk-Hi Highest closing price in last 52 weeksBid $ Buying price of Colina and Fidelity 52wk-Low Lowest closing price in last 52 weeksAsk $ Selling price of Colina and fidelity Previous Close Previous day's weighted price for daily volumeLast Price Last traded over-the-counter price Today's Close Current day's weighted price for daily volumeWeekly Vol. Trading volume of the prior week Change Change in closing price from day to dayEPS $ A company's reported earnings per share for the last 12 mths Daily Vol. Number of total shares traded todayNAV Net Asset Value DIV $ Dividends per share paid in the last 12 monthsN/MNot Meaningful P/E Closing price divided by the last 12 month earningsFINDEX The Fidelity Bahamas Stock Index. January 1, 1994 = 100 (S) 4-for-1 Stock Split Effective Date 8/8/2007 (S1) 3-for-1 Stock Split Effective Date 7/11/200731-Mar-11 31-Mar-11 109.392860 100.183340 31-Dec-10 31-Mar-11 NAV 6MTH 1.505557 2.918697 1.555464TO TRADE CALL: CFAL 242-502-7010 | ROYALFIDELITY 242-356-7764 | FG CAPITAL MARKETS 242-396-4000 | COLONIAL 242-502-752531-Mar-11 31-Dec-10 31-Mar-11 1-Apr-11 31-Jan-11MARKET TERMS31-Mar-11 31-Mar-11CFAL Securities Ltd. (Over-The-Counter Securities)31-Mar-11BISX Listed Mutual FundsNAV Date 31-Mar-11 31-Mar-11 Morton Salt union eyes court action Grand Bahamas tourism industry and wider economy h as suffered a potential blow after Discovery Cruise L ine, the largest tour operator to the island, announced that from September 7, 2011, it will suspend for an indefinite period, the service of its ship, the Discovery Sun. Hanns J. Hahn, its vice-president and general manager, said: "While the ship is in safe operational order and complies with all United States Coast Guard and SOLAS requirements, it requires extensive dry docking and refurbishment. A timetable for its return will be announced after further inspections are completed." Discovery dry dock blow for Freeport INSIGHT For the stories behind the news, read Insight on Mondays

PAGE 15

BUSINESS T HE TRIBUNE MONDAY, MAY 9, 2011, PAGE 5B STATOILSOUTH RIDING POINT, LLCEMPLOYMENTOPPORTUNITYTECHNICAL ENGINEER The successful candidate main responsibilities are as follows: Implement Statoil Technical Information System (computerized documentation system Update and perform planning and scheduling for maintenance and modification department Update and follow-up progress in existing computerized maintenance system Participate in implementing Statoils maintenance system (SAP Assist in technical questions raised by the organization and support with technical documentation and engineering competence Perform task within the SAPsystem EDUCA TION REQUIREMENTS Preferrably a dual major in Mechanical and Electrical Engineering from a recognized tertiary university Three (35 BENEFITS include Medical, Dental and Vision Insurance including Life Insurance and Pension Savings Salary will be compensated with education and qualification Interested individuals should forward orfax rsums to: The Human Resources Administrator P.O. Box F-42530 Freeport, Grand Bahama Bahamas FACSIMILE NUMBER 1-242-353-4573 NO TELEPHONE SOLICITATION PLEASE! Rsums should be received by May 6th, 2011Our values are to be courageous, open, hands-on and caring. We believe in these qualities, which are essential for building an even stronger Statoil. If you can identify with them, you could be the one to strengthen our team.Statoil B y NEIL HARTNELL Tribune Business Editor A leading Bahamian communications player has expressed concern that the resignation of the Utilities Regulation & Competition Authoritys (URCA chief executive could undermine continuity and leadership at the regulator during a crucial period in its development and that of the overall market. Describing Usman Saadats imminent departure as unfortunate, Anthony Butler, president and chief executive of BISX-listed Cable Bahamas,i ndicated to Tribune Business his concern that the resignation might derail or hinder URCAs current work, which includes several consultations vital to creating the framework for sustainable competition in the Bahamian communications industry. O f particular concern to Cable Bahamas, given last weeks re-branding and its launch into the fixed-line voice telephone market via its $10 million Systems Resource Group (SRG number portability consultation, currently out in the market for consultation. Number portability is viewed as critical to creating sustainable competition in the Bahamian fixed-line voice market as it allows customers to keep the same number when they switch carriers, thus making it more attractive for people to move from the incumbent Bahamas Telecommunications Company (BTC Go Networks. Its very unfortunate, Mr Butler said of Mr Saadats resignation, because URCA really now has 24 months under its belt and this will be the second chief executive in such a short period of time. You need to have continuity and leadership at the regulator at this early stage in its, and the markets, life. Focusing on the practical issues stemming from Mr Saa dats departure, Mr Butler told this newspaper: I hope it does nt derail or hinder the current plans for the number portability consultation that is currently outf or discussion and comment. We believe that is one area that is necessary for true competition in the voice market, and the Bahamian consumer expects it. It has been demonstrated in all a reas where competition has been created. Paying tribute to Mr Saadats time at URCA, where he was initially director of policy and regulation before rising to the top post, the Cable Bahamas chief added: If you look at the period from the summer of 2009 t o this summer, URCA has completed a significant amount of work on the new legislation and the consultations. Theyve done the two under his stewardship, met their obligations and commitments to the sector, and obviously some credit has to be given under his leade rship. The URCA release announcing Mr Saadats resignation said it was a personal decision, citing personal attacks on him and his family. Mr Saadat became a focus for those opposed to the BTC privatisat ion, the opposition Progressive Liberal Party (PLP posed conflict of interest created by his former career as a Cable & Wireless Communications (CWC Caribbean region, despite the fact he had left this post several years before joining URCA. A nother angle of attack was the link between Mr Saadat and Marsha Lewis, another former CWC executive who was subsequently hired as a human resources consultant to URCA. Again, unproven conflict of interest claims were raised when it was learnt that Ms Lewis would have vetted Mr Saadats application for the chief execu tive post, despite the final decision resting with the Board. Once URCAs role in approving CWCs majority pur chase of BTC became known, it was targeted by demonstrators and for public attack. URCA initially appeared intim idated by what many in the com munications industry believe was a campaign to do just that, the ultimate goal being to block and disrupt the privatisation approval process. URCA has reluctantly accepted Mr Saadats resignat ion, and its chairman, Wayne Aranha, said: The Board would have wished Mr Saadat to stay for the length of his tenure, until 2013, given that it has full confidence in the ability, integrity, and leadership of its chief executive. However, noting that this is a personal decision, which has been directly influenced by the recent unfortunate and unwarranted personal attacks on him and his family in different media, the Board has reluctantly accepted his resignation. He has contributed significantly to the development of U RCA and the advancement of the regulation of the communications sector in the Bahamas. He will be leaving URCA at a critical juncture as it seeks to ensure that the full benefits to be derived from the newly liberalised sector accrue to all B ahamians. Mr Saadat added: I have enjoyed the challenge of leading various aspects of change external and internal over the last two years. At the time I was appointed as director of policy and regulation, I then understood my broad mandate as h elping to transform the legacy regulator (PUC new regulatory regime, effectively regulate under the new framework, local capacity building, and providing the certainty and predictability in the regulatory regime that is conducive to investment through new operators and via privatisation. I feel satisfied that I have fulfilled a large part of that mandate. I want to express my sincere thanks to the Board, who have backed me through some challenging times recently. Finally, I want to thank my colleagues at URCA who have endured major changes but delivered the necessary outputs and outcomes under demanding circum stances. Stability concern over departure of URCAs top man

PAGE 16

s ultation on BTCs proposed c harges for interconnection joining services, also called upon the regulator to ensure BTC began construction of r equested joining paths as s oon as possible after the latters RAIO was approved. In its May 4 submission, J udith Smith, Cable B ahamas in-house legal c ounsel, wrote: Given the l ong period of time that has elapsed since BTC first pro posed its RAIO, Cable Bahamas calls upon URCA t o ensure that BTC adheres to a strict timetable (no more than one month foll owing approval of the final RAIO) to finalise its cont ractual arrangements with Cable Bahamas. Furthermore, URCA should take whatever steps are necessary to ensure that B TC moves forward with the construction of request ed joining paths as soon as p ossible following URCAs approval of the final RAIO. A rguing that there was no justification for any d elay, Ms Smith said BTC should not even be allowed to use the excuse that no agreement had beenr eached for the termination of its traffic on Cable Bahamas network or thato f another carrier. If BTC understands that it can delay a competitorsp rovision of voice services simply by prolonging the n egotiations, it will have every incentive to delay reaching an agreement ad infinitum, Ms Smith said. If the parties cannot agree on all of the terms and conditions that will apply to t he termination of BTCs t raffic, an interim solution c an and should be put into p lace at URCAs direction p ending final resolution. URCA should make clear in its final decision that it will not tolerate further delay by BTC in introducing voice competition to the B ahamas. Competition Cable Bahamas interest in the issue is obvious, given that interconnection is key to facilitating fixed-line v oice telecoms competition in any market. This allows traffic origi nating on one carriers network to terminate on that of a rival, thereby allowing customers of two different carriers to talk to one another. Cable Bahamas is espe cially keen for interconnection, and competition, to occur as quickly as possible, given last weeks re-brand ing and its entry into the fixed-line voice market with the $10 million acquisition of Systems Resource Group/IndiGo Networks. Elsewhere in its response to URCAs consultation, Cable Bahamas urged ther egulator to monitor how B TC implemented inter connection joining circuit charges in practice, calling upon it to intervene if com p etition was impacted. Backing URCAs proposal on how joining circuitss hould be measured and charged, Cable Bahamas said spreading installa tion/maintenance costs for p orts and terminating cards o ver five years was consid ered best practice in Europe. Cable Bahamas also questions whether it is appropriate for BTC to impose a relatively high recurring monthly charge for footway boxes of $38, the company said. It is Cable Bahamas understanding that in Jamaica, the RAIO includes a one-time charge of $38 per box up-front, and a significantly lower recur ring monthly charge of around $9. When it came to duct charges for interconnection joining paths, Cable Bahamas said these should be determined on a caseby-case basis, as such costs were likely to be higher in New Providence and Grand Bahama than islands such as Abaco. age capacity, and cost between $350 million to $400 million. B ORCO was in Bucke yes portfolio for less than t he entire 2011 first quarter, the company having acquired First Reserves 80 per cent stake on January 18, and only completing the purchase of Vopaks 20 per c ent equity holding in Febr uary. Together with Buckeyes terminal in Yabucoa, Puerto Rico, BORCO has been placed in the companys newly-created internationalo perations segment one of five business segments. Keith StClair, Buckeyes chief financial officer, said that despite not having 100 p er cent BORCO ownership for a full quarter, the international operations segment had generated $25.5 million in adjusted first quarter o perating income a large amount of the overall increase in the companys a djusted operational i ncome. This rose by 36.6 p er cent year-over-year, g rowing from $89.5 million t o $122.2 million. Our annual expectations for BORCO were between $130-$140 million of adjusted EBITDA [operating income], and thats still the level we would expect them to perform at on an annual b asis, Mr StClair said of p rojections for the Grand Bahama-based petroleum p roducts facility once all e xpansion initiatives are c ompleted. The 7.9 million barrels of additional capacity are merely the first stage in what could ultimately be an almost-doubling of its existi ng 21.6 million barrel capacity. Mr StClair said Buckeye had reached commercial t erms for the majority of t he first phase 3.5 million b arrel expansion with vario us oil and petroleum comp anies. He indicated that B ORCOs adjusted operating income would reach $70$80 million on an annual basis when we have the full [7.9 million barrel] expansion up and running. Clark Smith, Buckeyes p resident and chief operati ng officer, told Wall Street analysts that the capacity e xpansion was being struct ured in phases to ensure t hat BORCO did not get ahead of market demand. Adding that Buckeye expected the first 3.5 million barrels to be operational by the close of 2012, Mr S mith said the installation of a new offshore jetty at BORCO was expected to be c ompleted and operational b y the 2011 fourth quarter. M r Smith said this would g ive BORCO three offshore j etties with six berths, while a new inland dock was expected to become operational this quarter. The latter move, Mr Smith said, would provide the Grand Bahama-based storage facility with two s heltered berths in an inlet n ear its storage facilities, capable of handling Panam ax vessels. D escribing BORCOs i ntegration into Buckeyes operations as having gone very smoothly, and prais ing the talented team of p eople at the Grand Bahama facility, Mr Smith added: We are moving forward on the major expansion projects. Our newlyformed international operations segment has expans ion and operational i mprovement opportunit ies. He noted that BORCO recently completed one million man hours without an operational loss of time incident. We expect to see additional growth in this segment as we bring on additional storage capacity in the next few years and achieve operational efficiencies, Mr StClair added of the international operations category, which includes BORCO. Mr Wylie said Buckeye w ould also seek to introduce best practices into this category. B ORCOs importance to B uckeye cannot be overs tated, the companys 2011 first quarter press release describing it as its largest acquisition to date and a premier marine terminal. Buckeyes flagship m arine terminal in the Bahamas, BORCO, is one of the largest oil and petroleum products storage facilities in the world, serving the i nternational markets as a p remier global logistics hub, Buckeye said. B USINESS P AGE 6B, MONDAY, MAY 9, 2011 THE TRIBUNE .,1*6:$<$&$'(0<7HDFKHU9DFDQFLHVIRUHSWHPEHU.LQJVZD\$FDGHP\LQYLWHVDSSOLFDQWVIURPTXDOLHGDQG H[SHULHQFHGFDQGLGDWHVIRUWHDFKLQJSRVLWLRQVDWWKH(OHPHQWDU\FKRRO 3K\VLFDO(GXFDWLRQ+LJKFKRRO(QJOLVK/DQJXDJHDQG/LWHUDWXUH6SDQLVK&KULVWLDQ(GXFDWLRQ3K\VLFDO(GXFDWLRQ3K\VLFVDQG&KHPLVWU\$GYDQFHGODFHPHQWf&DUSHQWU\DQG-RLQHU\0XVLF2IILFHURFHGXUHV,QIRUPDWLRQHFKQRORJ\0HGLD&HQWUHDQDJHU7KHVXFFHVVIXOFDQGLGDWHVVKRXOGKDYHWKHIROORZLQJ$QDFDGHPLFGHJUHHLQWKHDUHDRIVSHFLDOL]DWLRQ$ WHDFKLQJFHUWLFDWH([FHOOHQWFRPPXQLFDWLRQVNLOOV$ ORYHIRUFKLOGUHQDQGOHDUQLQJ+LJKVWDQGDUGVRIPRUDOLW\%HDERUQDJDLQ&KULVWLDQ$ FRPSOHWHDSSOLFDWLRQSDFNDJHFRQVLVWVRI FRPSOHWHG DQGVLJQHG .LQJVZD\$FDGHP\DSSOLFDWLRQIRUP DYDLODEOHDWWKHVFKRRO$GPLQLVWUDWLRQEXLOGLQJRURQWKHZHEVLWH ZZZNLQJVZD\DFDGHP\FRP HH'RFXPHQW'RZQORDGVf GHWDLOHGUHVXPHZLWKFRYHUOHWWHUFRSLHVRIGHJUHHVFHUWLILFDWHV UHFHQWSKRWRJUDSKSROLFHUHFRUGKHDOWKFHUWLILFDWHWKUHH fUHIHUHQFHOHWWHUVRQHfEHLQJIURP\RXUFKXUFKVPLQLVWHU KfOHJLEOHHPDLODGGUHVVDQGZRUNLQJWHOHSKRQHFRQWDFWV1RWH $OOGRFXPHQWVVKRXOGEHVXEPLWWHGDWWKHVDPHWLPH3OHDVHIRUZDUGWR.LQJVZD\$FDGHP\(PSOR\PHQW$SSOLFDWLRQ .LQJVZD\$FDGHP\ 1DVVDXKH%DKDPDV HPDLONLQJVZD\HPSOR\PHQW#\DKRRFRP' HDGOLQH 7RHQVXUHFRQVLGHUDWLRQFRPSOHWH DSSOLFDWLRQ PDWHULDOV PXVWEHUHFHLYHGE\RQGD\WK t t b $400m expansion kick-off at BORCO SEE page 1B FROM page 1B CABLE URGES ONE MONTH TARGET FOR BTC INTERCONNECT

PAGE 17

with a gross tonnage of more than 53 million tons. The Bahamas has the largest num-ber of cruise ships on its register of any country, although t hese in fact only make up 11 p er cent of its overall numbers. Because contributions to the International Maritime Organization (IMOb ased on the tonnage attached to ones register, theB ahamas makes a greater contribution than much larger and more developed countries, such as the US or the UK, at $1.1 million a year,n oted the chairman. Mr Fair, who summarised t he BMAs role as to register vessels, enforce ship safety requirements and constantly monitor and improve standards in sector, told the Rotary group that he could tell you with some pride thatw e punch well above our weight in global shipping fora. We have a powerful voice i n world shipping and have the abiliy to influence the development of policies and legislation both nationally ando n the international stage, he added. M r Fair said the BMA is constantly looking for ways to grow its business and seek new revenue streams for the Bahamas in the maritime industry. I n this regard, the Bahamas yacht registry is now up and running, with regulations having been established allowing it to be opened to the public within the last month, said Mr Fair. T he yacht registry complements our overall offering and enhances the profile of our nation, he suggested. From a concentration on t he large ship sector, we now r ealise our wealthy financial services clients might want to h ave a one-stop shop for t heir financial assets and their leisure assets. We are continually looking at ways to further develop our businessm odel, not only to service our existing customers but also to a ttract new business. Were not expecting a flood of registrants in the first year but it had to be one of the offerings we gave. Meanwhile, having opened a BMA office in Hong Kong last year, Mr Fair said the office which has three staff and a Bahamian registrar has been bearing fruit. Mr Fair said he expects the Hong Kong office will also be ano utlet for other Bahamas offerings. The BMA is now hoping to establish the conditions which would enable the Hong Kong o ffice to go out and seek to do b usiness with China. Weve got our staff (in H ong Kong) and they are out k nocking on doors. Our Bahamian registrar is there doing business already; shes already done some closingsa nd were very happy, said Mr Fair. Were going to be in Beijing and Hong Kong in June. Having established an office in Hong Kong, we cant actually start marketing in China until such time as we presento ur credentials to the government, so its a formal visit to the ministries and, hopefully, because of the relationship the Bahamas has with China they may open a few doors for us. T he BMA is also looking to expand its reach further into Europe by establishing a long overdue full office in Greece later this year in an e ffort to capture more busin ess. Forty per cent of ship owners on the Bahamian registry are from Greece, Norway and the UK. They (the Greeks largest ship owning group by f ar. Its a major maritime nation, and the Bahamas has such close ties to Greece already. Weve got a Greek diaspora in the Bahamas; we can build on that, said MrF air. He also heaped praise on present director of the BMA, former defence force commander, Davy Rolle. A great success during his time as chairman was the appoint-m ent of a Bahamian director, after years in which the post was held by British nationals who were not greatly exposed to the Bahamas a nd, while diligent, saw the p ost as a job. Having a Bahamian, Davy Rolle, has been a huge step forward. The level of dili-g ence and commitment hes given to this organisation, I c ant begin to tell you. He called me at 12.45am the other day from his office because he was putting together stuff for our next Board meeting. And this is not a young man;h es a former commander of the Defence Force. Hes doing a great job, said Mr Fair. Given that shipping is the primary facilitator of world trade, it is by and largea stable industry with numero us opportunities for growth. Short of a massive economic contraction, Mr Fair said the primary threat to the continued growth of the mari time industry was piracy, s uch as that which is currentBUSINESS T HE TRIBUNE MONDAY, MAY 9, 2011, PAGE 7B L ower premiums,low deductibles,generous benefits and a fast claims s ervice for home and motor cover.Pick up the phone and ask NIBA for a g reat insurance deal.Tel.Nassau 677-6422/Freeport 352-6422 or visit www.nibaquote.com O pen Saturdays10.00am2.00pm NASSAU INSURANCE BROKERS AND AGENTS LIMITED Atlantic House,2nd Terrace & Collins Avenue P.O.Box N-7764 Nassau Suite 6,Jasmine Corporate Center,East Sunrise Highway P.O.Box F-42655,Freeport Tel.Nassau 677-6422 Freeport 352-6422 www.nibaquote.com FROM page 1B MARITIME AUTHORITY A GOVT AGENCY MODEL

PAGE 18

B USINESS P AGE 8B, MONDAY, MAY 9, 2011 THE TRIBUNE (67$7(7+(/$7( $11($5,(-$9$/ DND $11($5,(+,/,33( 1RWLFHLVKHUHE\JLYHQWKDWDOOSHUVRQVKDYLQJ DQ\FODLPVRUGHPDQGVDJDLQVWWKHDERYHQDPHG(VWDWH DUHUHTXHVWHGWRVHQGWKHVDPHGXO\FHUWLHGWRWKH XQGHUVLJQHGRQRUEHIRUHWKH WK GD\RI-XO\ $1'1RWLFHLVKHUHE\DOVRJLYHQWKDWDIWHUWKH H[SLUDWLRQRIWKHWLPHDERYHPHQWLRQHGWKHDVVHWVRIWKH GHFHDVHGZLOOEHGLVWULEXWHGDPRQJWKHSHUVRQVHQWLWOHG WKHUHWRKDYLQJUHJDUGRQO\WRWKHFODLPVRIZKLFKWKH $GPLQLVWUDWRUVVKDOOWKHQKDYHKDGQRWLFH /(112;$721 $WWRUQH\VIRUWKH(VWDWH (67$7(7+(/$7( 3,(55(+,/,33( 1RWLFHLVKHUHE\JLYHQWKDWDOOSHUVRQVKDYLQJ DQ\FODLPVRUGHPDQGVDJDLQVWWKHDERYHQDPHG(VWDWH DUHUHTXHVWHGWRVHQGWKHVDPHGXO\FHUWLHGWRWKH XQGHUVLJQHGRQRUEHIRUHWKH WK GD\RI-XO\ $1'1RWLFHLVKHUHE\DOVRJLYHQWKDWDIWHUWKH H[SLUDWLRQRIWKHWLPHDERYHPHQWLRQHGWKHDVVHWVRIWKH GHFHDVHGZLOOEHGLVWULEXWHGDPRQJWKHSHUVRQVHQWLWOHG WKHUHWRKDYLQJUHJDUGRQO\WRWKHFODLPVRIZKLFKWKH $GPLQLVWUDWRUVVKDOOWKHQKDYHKDGQRWLFH /(112;$721 $WWRUQH\VIRUWKH(VWDWH a t an assumed weighted average cost of capital (WACC 1 0 per cent, ROCE (return on capital employed services amounts to around $10 million in 2009, BTC told URCA. From the accounts we can also obtain a total depreciation amount for relevant assets of $27 million, giving total capital costs of around $37 million. Treating both common costs and indirect network costs as mark-up capital costs gave percentages of 88.95 per cent and 8 0.86 per cent, BTC said, making for a cumulative 169.81 per c ent. The carrier, now majority-owned by Cable & Wireless Communications (CWC a factor five higher than the ones it had originally proposed. C omparing its proposed monthly joining services operati ng costs with those suggested by URCA, which had used a different benchmark, BTC said the regulators were between 7 2.58 per cent to 140 per cent higher than its own. BTC has provided operational expenditure estimates that are significantly below the benchmark that URCA d eems reasonable for services of this type, BTC said. Concern This suggests that the principal area of concern for URCA should be to ensure that BTC does not under-recover against incurred costs for the service. URCAs comments suggest that the real risk associated with BTCs tariff proposals is that they are below the reasonable cost levels observed in other markets. T his table and the [UK] benchmark suggest that the m ark-ups proposed are too conservative, so BTCs suggest ion would be to use URCAs suggested benchmark to set t he final rates for the time being. D ecrying URCAs use of the UK as a comparison on h ow interconnection services are provided, BTC questioned how the regulator would treat under-used interconnection capacity, since this was still likely to be included in its service tariffs. All operators are likely to require interconnection capacity from BTC, while not all operators will require inter connection with each other, perhaps preferring to use BTCa s a transit operator, BTC added. BTC is therefore likely to require a higher degree of spare capacity in order to prevent shortages. It is also clear that these costs are incurred by BTC because of the provi-s ion of interconnection joining services, and they should t herefore be recovered from tariffs for joining services. However, acknowledging that rival licensed carriers might pay for unnecessarily high spare capacity if tariffs were notl imited, BTC said it proposed to include a 25 per cent spare capacity mark-up in the equipment calculations to ensure it recovers legitimate costs. Proposing to review joining services tariffs after a reas onable number of rival carriers have made separate pro posals, BTC said that not charging mark-ups on indirect and common costs would result in inefficient allocation out comes and, in the long run, undermine the financial viabili ty of a regulated firm like BTC. BTC demands no under-recovery on connect costs FROM page 1B t he result of maintaining the p osition as it was before his r uling. Effectively, Customs undertaking has been reinstated. Were looking forward to the hearing of the appeal, and hopefully that will occur i n the near future. I n his submissions to the Court of Appeal, Mr Smith argued that the JudicialR eview was in the public i nterest, adding: All GBPA ( Grand Bahama Port A uthority) licensees are affected by Customs first decision, to demand additional paperwork in respect of goods sold over the counter. All GBPA licensees are a lso affected by the manner a nd legality of the enforcement mechanisms which C ustoms chooses to deploy t o enforce its demands. Sign ificant numbers of persons and corporations are therefore potentially affected byt he outcome of these proceedings. Thirdly, while the first decision may be subject to nice arguments of law, the second decision relating to Customs enforcement a ction is a manifest abuse o f power by Customs which i t has not sought to explain or attempt to justify in evidence. The allegation is serious and should be determ ined. A nd he further alleged: Customs arbitrary decis ions to seize goods and r efuse paperwork has led to u ncertainty and extra costs, and damaged the applicants (Kellys Freeports ness. This will lead to loss of profit, not to mention damage to goodwill and future l oss of business if and when it is unable to fulfil existing contracts and/or customersg o elsewhere. The applicant is fearful, and for good cause, thatt hese arbitrary seizures and fits of non co-operation will continue. The current uncertainty affects many licensees in Freeport to the general detriment of the construct ion and other industries w hich rely on businesses s uch as the applicants for their supplies. On the basis of Customs past behaviour, as set out in t he Application for Leave, t here is every reason to b elieve that, unless restrained, the respondent will seek to continue its pat-t ern of oppressive and prejudicial conduct by seeking to arbitrarily detain goods, or refuse to process imported goods for entry in the usual way, or refuse to accept returns for duty paid s ales, or otherwise take e nforcement action against t he applicant or other Grand Bahama Port Authority licensees, on the basis of non-receipt of duty exempt b onded sales reports or on a ny other basis not sanct ioned by law. Kellys in Customs appeal victory F ROM page 1B ume (of applications His comments came as Tribune Business continues to receive calls from concerned business owners, who said they had been unable to obtain their Business License since applying, completing the procedures and paying for the d ocument prior to the March 31 deadline. They said they couldnt do anything for us and we should c ome back next week, said one businessman. Mr Laing said: We are reasonably satisfied with the progress being made, considering there were 10,000-plus a pplicants. We hired 12 additional people to assist with this, who came on a month-and-a-half ago. There are some ( applicants) who have been waiting around three weeks now. We are processing the applications and we have people working overtime, working weekends. The backlog of applications should be sorted out within the next week. T he backlog at the Business License Unit appears to have taken longer than the unit anticipated to resolve. Three weeks ago, in response to complaints about delays i n receiving Business Licences after applications were made, Athena Marche, deputy controller of inland revenue with responsibility for the Business License/Valuation Unit, said the issue had been largely resolved with just a small num b er of applications still waiting to be processed. M s Marche suggested the remaining applicants could expect to be called to pick up their licenses by the end of that week. T he official attributed the delay in processing some appli cations to the fact that many business operators left it until within a week of the deadline to apply, while others who had not been in compliance for "many years" finally felt com p elled to register. Ms Marche suggested the fact that the deadline for applications under the new Business License Act is now the end of March, whereas the former Act stipulated an end-of-A pril deadline, caught some people off guard, despite the Ministry of Finance's publication of the deadline for sever al months in the media. The crowd that came in was not the normal crowd. E veryone rushed at the end of period. They don't normally do that. You had persons who did not apply for up to a decade coming in to apply," said Ms Marche. Business Licence backlog sorted within the week FROM page 1B

PAGE 19

BERNARD CONDON, AP Business Writer NEW YORK Here's a markets riddle for you: What has jumped in value more than its biggest fans expected and withstood worries like slowing U.S. growth, European debt woes and even the specter of the U.S. losing its top credit rating? No, it's not the stock market. Stumped? It's junk bonds, a sort of IOU from risky companies thought most likely to not pay back their debt. Junk has gained 55 percent the past two years, 5 percentage points more than stocks. That's good for the many brave investors who've bought junk bonds. And good for the econo-my, too. The hot market for junk means companies that once seemed close to bankruptcy can sell these bonds with ease and use the proceeds to run their businesses. "Companies struggling during the recession have been able to borrow, and that's given them t ime and that's good," says George Cipolloni, co-manager of Berwyn Income, a mutual fund that holds junk. The latest sign of this economic elixir at work came Wednesday. While stocks were in a twoday decline, research firm Dealogic published a reports howing a record amount of junk bonds has been sold so far this year $158 billion, nearly dou ble what was sold during the same period in 2007, when the economy was still booming. But this rally is not without its critics. Junk is up partly because companies are more likely to payb ack their bonds and other debts now that the Great Recession is over. But Federal Reserve Chairman Ben Bernanke has also played a role in rising junk prices. That worries investors who think the Fed has a habit of inflating bubbles. T he Fed's policy of setting benchmark interest rates at zero and buying government securities has frustrated investors who are getting miserly interest payments on those and other conservative assets. That led many to rush into risky investments. To some extent, that's exactly what the Fed wanted. The hoped-for result is that money will flow more freely to companies and that investors will feel richer and that both will spend more. Bernanke's efforts were mostly designed to push investors into stocks after many pulled money out of stocks during the financial crisis. They've fled into all sorts of assets including tradable bank loans, heating oil futures, carbonemission credits and, yes, junk bonds. A revived economy may justify the higher assets prices on junk that Fed policy has facilitated. But critics of the Fed note that such easy-money policies have helped lead to two stock bubbles in a decade, a credit market bubble and a housing bubble all of which burst, socking investors with hundreds of billions in dollars in losses. When junk bonds imploded in 2008, for example, investors in mutual funds holding them lost 26 percent, according to Morningstar. Buyers were so scared that bond yields, which move in the opposite direction from their price, spiked to over 20 percent. The big appeal of junk now is that safer assets are so unappealing. Holders of five-year Treasurys get 2 percent annually for their money now. Put cash in five-year certificates of deposits instead and you might get 2.6 percent. Junk bonds? They'll give you 6.7 percent, according to Barclays Capital. That sounds great, but in reality, junk bond yields are near record lows and they're down 1.75 percentage points in just a year. "Companies are more healthy now, but I'm not getting paid as much," says Andrew Smock, cochief investment officer at Merganser Capital, a money manager that has been selling junk for several months as investors have piled into the market. "It's junk, it's risky. I can't get excited." BUSINESS T HE TRIBUNE MONDAY, MAY 9, 2011, PAGE 9B t t b Why junk bond rally should be cheered and feared INTERNATIONAL BUSINESS

PAGE 20

I NSIGHT PAGE 14B, MONDAY, MAY 9, 2011 THE TRIBUNE C AIRO A ssociated Press R ELATIONSbetween Egypt's Muslims and Chris-t ians degenerated to a new l ow Sunday after riots overnight left 12 people d ead and a church burned, adding to the disorder of the country's post-revolutiont ransition to democracy. The attack on the church w as the latest sign of assertiveness by an extreme, ultraconservative movement o f Muslims known as Salafis, whose increasing h ostility toward Egypt's Coptic Christians over the past few months has metw ith little interference from the country's military rulers. Salafis have been blamed for other recent attacks on Christians and others they don't approve of. In one attack, a Christian man had a n ear cut off for renting an a partment to a Muslim woman suspected of involvement in prostitution. Violence The latest violence, which erupted in fresh clashes Sunday between Muslimsa nd Christians who pelted each other with stones in another part of Cairo, alsop ointed to what many see a s reluctance of the armed forces council to act. The council took temporary con trol of the country after P resident Hosni Mubarak was deposed on Feb. 11. After the overnight clash e s in the slum of Imbaba, r esidents turned their anger toward the military. Some said they and the police did a lmost nothing to intervene i n the five-hour frenzy of violence. Analysts warned of signs of Coptic violence, especially with reports that some Christians have opened fire at Muslims. "The Coptic volcano is exploding," Coptic expert Youssef Sedhom said. "How would Copts respond if they find their back to the wall facing guns? They w ould have no option but s elf defence," adding, "don't blame Copts for what they do." Six Muslims were among the dead, according to Egypt's state-run news agency. T he bloodshed began Satu rday around sundown w hen word spread around t he neighborhood that a C hristian woman who mar r ied a Muslim had been abducted and was being kept in the Virgin Mary Church against her will. Islamic extremists declared the crowded dis trict a state within a state in1 990s, calling it "the Islamic Republic of Imbaba," one of the country's hottest s pots of Islamic militancy. T he report of the kidnap p ing, which was never confirmed by local religious figures, sent a large mob ofM uslims toward the church. Christians created a human barricade around the build-i ng and clashes erupted. Gunfire sounded across the neighborhood, and witnesses said people on rooftopsw ere firing into the crowd. T he two sides accused each other of firing first. Crowds of hundreds of M uslims from the neigh borhood lobbed firebombs at homes, shops and the church. Residents say Chris t ians were hiding inside. Muslims chanted: "With our blood and soul, we defend you, Islam." R imon Girgis, a 24-yearold with a tattoo of a Coptic saint on his arm, was amongt he Christians who formed a h uman shield around the c hurch. "They were around 40 bearded men chanting slogans like 'There is no God but Allah.' After rallying Muslim residents, they opened fire," he said. "We Copts had to respond, so we hurled stones and pieces of broken marble." Some of the wounded were carried to the nearby St. Menas Church, where floors were still stained with blood hours later. Every five minutes, an i njured person was rushed into the church," said a Father Arshedis. "We couldn't reach ambulances by phone. We called and no one answered. We tried to treat the injured. We used t he girls' hair clips to extract t he bullets." The army is responsible b ecause they took no a ction," he said. L ater the same night, the Muslim crowd moved to a Christian-owned apartment building nearby and set it on fire. Piles of charred furniture, garbage and wood were mixed with remains of c lothes, food and shoes. Shops on the ground floor of the buildings were d estroyed. Soldiers Some soldiers and police did fire tear gas, but failedt o clear the streets for h ours. By daybreak, the military had deployed armored vehicles and dozens of troopc arriers to cordon off a main street leading to the area. They stopped traffic andt urned away pedestrians. Men, women and children watching from balconies took photos with mobilep hones and cheered the t roops. Across the Nile river, in downtown Cairo, clashesb roke out on Sunday afternoon. Muslim youths attacked Coptic Christian protesters, said Christiana ctivist Bishoy Tamri. TV images showed both sides furiously throwing stones, including one Chris t ian who held a large wooden cross in one hand while flinging rocks with the other. Scores were injured, but an army unit securing the TV building did nothing to stop the violence, Tamri said. Late Sunday thousands of Copts decided to camp out in front of the TV building overnight to press demands to bring the arsonists to just ice and to make religious instigation a criminal offense. Islamic clerics denounced t he violence, sounding alarm bells at the escalating tension during the transitional period followingM ubarak's Feb. 11 ouster by a popular uprising. "These events do not bene fit either Muslim or C opts," Ahmed al-Tayyeb, the sheik of al-Azhar, told the daily Al-Ahram. Spirit During the 18-day upris ing that ousted Mubarak, there was a rare spirit of brotherhood between Muslims and Christians. Each group protected the other during prayer sessions in Cairo's Tahrir Square, the epicenter of the revolution. But in the months that f ollowed, there has been a sharp rise in sectarian tensions, as the once quiescent Salafis have become moref orceful in trying to spread their version of an Islamic way of life. In particular, they have focused theirw rath on Egypt's Christians, who make up 10 percent of the country's 80 million peo-p le. O n Friday, a few hundred Salafis marched through Cairo to praise al-Qaida l eader Osama bin Laden and condemning the U.S. operation that killed him. Critics say Egyptian mili tary authorities have done too little to stem the religious violence. But authorities arrested 190 people after the church attack, sending them to military prosecutions and threaten ing the maximum penalty against anyone attacking h ouses of worship. Copts complain of widespread discrimination, including tight restrictionso n building or repairing churches, while Muslim places of worship do not face such limits. I n one of the worst attacks against them, a sui cide bomber killed 21 peop le outside a church in the p ort city of Alexandria on Jan. 1, setting off days of protests. Egypt made some a rrests but never charged anyone with the attack. Tensions have been building for the past year as Salafis protested the alleged abduction by the Coptic Church of a priest's wife, Camilla Shehata. The Salafis claim she converted to Islam to escape an unhappy marriage a phe nomenon they maintain is common. Divorce Because divorce is banned in the Coptic Church, with rare excep tions such as conversion, some Christian women resort to conversion to Islam or another Christian denomination to get out of a marriage. Shehata's case was even used by Iraq's branch of alQaida as a justification for an attack on a Baghdad church that killed 68 people and other threats by the group against Christians. On Saturday just before the violence erupted in Imbaba, Shehata appeared with her husband and child on a Christian TV station broadcast from outside of Egypt and asserted that she was still a Christian and had never converted. "Let the protesters leave the Church alone and turn their attention to Egypt's future," she said from an undisclosed location. In the Egyptian Sinai desert, hundreds of Bedouins forced authorities to set free a prisoner after laying siege to the main courthouse, firing gunshots in the air and burning tires, witnesses said. CHURCH BURNING DEEPENS TUMULT OF EGYPT TRANSITION EGYPTIAN COPTS one holding a cross and a picture of Jesus Christ and Coptic Pope Shenouda III with writing in Arabic reading "Your salvation is in my hands, God is here", demonstrate against the overnight sectarian violence, in downtown Cairo, Egypt Sunday, May 8, 2011. Christians and Muslims throwing rocks c lashed in downtown Cairo on Sunday, hours after ultraconservative Muslim mobs set fire overnight to a church and a Christian-owned apartment building in a frenzy of violence that killed 12 people and injured more than 200. (AP EGYPTIAN COPTS one holding a banner with a picture of Jesus Christ and writing in Arabic reading "Christ, Our God, is alive", demonstrate against the overnight sectarian violence, in downtown Cairo, Egypt Sunday. (AP 12 dead after clashes between Muslims and Christians

PAGE 21

istan, an inconstant ally in t he long struggle against t errorists. S en. John Kerry, DMass., chairman of the Senate Foreign Relations Committee, said: "Everybody has to understand that even in the getting of Osama binLaden, the Paki stanis were helpful. We h ave people on the ground in Pakistan because they allow us to have them. "We actually worked with them on certain parts o f the intelligence that h elped to lead to him, and they have been extraordin arily cooperative and at s ome political cost to them i n helping us to take out 16 of the top 20 al-Qaida leade rs with a drone prog ramme that we have in the western part of the country," he said. The senior Republican on the committee, Sen. Richard Lugar of Indiana, said: "Pakistan is a critical f actor in the war against t error, our war, the world's w ar against it, simply b ecause there are a lot of t errorists in Pakistan." He a lso noted that the nation possesses nuclear weapons, and said a cut-off in aid could weaken the United States' ability to make sure they do not fall into the hands of terrorists. K erry strongly defended the president's decision to order the raid, and the shooting death of binLaden. The administration has o ffered shifting accounts of t he events that unfolded in t he 40 minutes the Navy SEALs were inside binLaden's compound, most recently saying the terrorist mastermind was unarmed but appeared tob e reaching for a weapon when he was shot in the head and chest. "I think those SEALs did exactly what they should have done. And wen eed to shut up and move on about, you know, the realities of what happened in that building," Kerry s aid. National security adviser Tom Donilon said, "I've n ot seen evidence that w ould tell us that the politi cal, the military, or the i ntelligence leadership had f oreknowledge of of b inLaden" being in the country. He said the U.S. h as asked the Pakistani authorities for access to people whom the SEALs l eft behind in the compound, including three of b inLaden's wives. The U .S. also wants access to additional materials coll ected there, he said. O fficials have said the S EALs took voluminous computerised and paper records when they chop p ered out of binLaden's compound. Donilon likened the amount of information retrieved to the size of a small college library. Donilon also sidestepped when asked if waterboarding and other so-called e nhanced interrogation of detainees had produced information that led to the s uccessful raid against binLaden's compound. "No single piece of intelligence led to this," he said. The national security a dviser appeared on ABC, NBC, CNN and Fox. Lugar was on CNN, and Kerry s poke on CBS. INSIGHT T HE TRIBUNE MONDAY, MAY 9, 2011, PAGE 15B ISLAMABAD A ssociated Press THEUnited States wants access to Osama bin Laden's three widows and any intelligence material its commandos left behind at the al-Qaida leader's compound,a top American official said in comments broadcast Sunday that could add a fresh sticking point in already frayed ties with Pakistan. I nformation from the women, who remained in the house after the commandos killed bin Laden, might answer ques t ions about whether Pakistan harbored the al-Qaida chief as many American officials are speculating. It could also reveald etails about the day-to-day life of bin L aden, his actions since the invasion of Afghanistan in 2001 and the inner workings of al-Qaida. T he women, along with several children also picked up from the house, are believed to be in Pakistani army custody.A Pakistani army official declined to com ment Sunday on the request, which U.S. National Security Adviser Tom Donilon revealed on NBC's "Meet the Press." The CIA and Pakistan's spy agency, known by the acronym ISI, have worked uneasily together in the past on countert errorism, but the unilateral U.S. raid done without Pakistan's advance knowl edge has exposed the deep mistrust that scars a complicated if vital partnershipfor both nations. Pr essur e Even before the May 1 raid, the ISI said it was cutting cooperation with CIA to protest drone strikes close to the Afghan border, among other things. In the current environment, Pakistan could use the fact it has something Washington wants bin Laden's widows as lever age to reduce some of the pressure it is under. Bin Laden was found in a large house close to a military academy in the army town of Abbottabad where he had been living for up to six years. His location raised U.S. suspicions that he had help from some Pakistani authorities, possibly elements of the powerful army and intel ligence services. Donilon said Washington had seen no evidence that the Pakistani government had been colluding with bin Laden the public line taken by most U.S. officials since the raid, including President Barack Obama in comments also broadcast Sunday. "But they need to investigate that," Donilon said. "And they need to provide us with intelligence, by the way, from the compound that they've gathered, includ ing access to Osama bin Laden's three wives, whom they have in ... custody." Donilon also said Pakistani authorities had collected other evidence from the house which the United States wanted to "work with them on assessing." U.S. commandos managed to seize a large and valuable intelligence haul that included videos, telephone numbers and docu ments, along with the body of bin Laden, before flying back to Afghanistan, accord ing to U.S. officials. The Pakistani government has strongly denied it knew of bin Laden's where abouts, but Western governments have long regarded Islamabad with suspicion. Its armed forces have historical some say ongoing links with Islamist militants, which they used as proxies in Afghanistan and India. The allegations of Pakistani collusion pose an acute problem for the Obama administration because few can see any alternative but to continue engaging with the country. Unstable and nuclear-armed, it remains integral to the fight against alQaida as well as to American hopes for beginning to draw down troops in Afghanistan later this year. "We need to act in our national inter est," Donilon said. "We have had difficulty with Pakistan, as I said. But we've also had to work very closely with Pak istan in our counter-terror efforts." The American commandos killed bin Laden and up to four other people, including one of his sons, at the compound. Pakistani officials have given little information, some of it conflicting, about the identities of the women and children left behind, including exactly how many there are and what they allegedly have been saying. One of the wives is Yemeni, Pak istani officials have said. A copy of her passport, leaked to the local media, identifies her as Amal Ahmed Abdullfattah. She has allegedly told Pakistani investigators that she moved to the home in 2006 and never left the upper floors of the three-story compound, where bin Laden was living. She is from the southern Yemeni province of Ibb, about 120 miles (193 kilometers) south of the capital, Sanaa. A family member there has sought a meeting with Pakistan's ambassador to Yemen to ask about her fate and whether she is to return to Yemen. The relative, a cousin named Walid al-Sada, said the ambassador did not know and promised to get back to the family. Pakistan Foreign Ministry spokeswoman Tahmina Janjua said no countries have asked for the return of bin Laden's relatives. The Foreign Ministry in a state ment last week said they were being well looked after and will be returned to their countries of origin. Videos When the Navy SEALs raided bin Laden's compound, they collected com puter equipment and videos, including one that showed bin Laden huddled in a blanket and wearing a knit cap while seated on the floor watching television an image that contrasts with the bin Laden seen in propaganda videos released over the years, which depicted him as a charis matic religious figure unaffected by the world's scorn. But many Pakistanis, who are routinely misled by their government and live ina country where television and newspapers report conspiracy theories about the malign intentions of the United States uncritically, don't believe bin Laden has died. "I think Osama did not die," said Mohammad Khan at a newspaper kiosk in Rawalpindi city. "I don't believe even 1 percent that he was martyred in Abbottabad. The making of a video is not a big thing for America. They can do what they want because they have the latest technology. They can make impossible things seem possible." US S AYS IT WANTS ACCESS TO BIN LADEN WIDOWS PAKISTANI YOUTHS view the house, background, of former al-Qaida leader Osama bin Laden in Abbottabad, Pakistan on Sunday, May 8, 2011. Osama bin Laden was killed by a helicopter-borne U.S. military force on Monday, in a fortress-like compound on the outskirts of Pakistani city of Abbottabad. (AP IN THIS IMAGE released by the White House and digitally altered by the source to diffuse the paper in front of Secretary of State Hillary R odham Clinton, President Barack Obama and Vice President Joe Biden, along with with members of the national security team, receive a n update on the mission against Osama bin Laden in the Situation Room of the White House, Sunday, May 1, 2011, in Washington. T he White House, Pete Souza / AP Raid was the longest 40 minutes of my life F ROM page 16B

PAGE 22

W ASHINGTON PRESIDENTBarack Obama ordered the commando raid that killed ter rorist leader Osama bin Laden after deciding the risks were outweighed by the possibility "of us finally getting our man" following a decade of frustration, he said in a Sunday broadcast interview, according to Associated Press. The helicopter raid "was the longest 40 minutes of my life," Obama told CBS' 60 Minutes, with the possible exception of when his daughter Malia became sick with meningitis as an infant. Monitoring the commando raid operation in the White House Situation Room a week ago, Obama said he and top aides "had a sense of when gunfire and explosions took place" halfway around the world, and knew when one of the helicopters carrying Navy SEALs made an unplanned hard landing. "But we could n ot get information clearly a bout what was happening inside the compound," he said. Public opinion polls have shown a boost in Obama's support in the days since the raid, and his re-election campaign was eager to draw attention to the interview. Jim Messina, the president's campaign manager, emailed supporters encour aging them to watch the programme. The note included a link to a listing of all of the network's local affiliates around the coun try and another one requesting donations to Obama's re-election effort. In the interview, Obama said that as nervous as he was about the raid, he did n't lose sleep over the pos sibility that binLaden might be killed. Anyone who questions whether the terrorist mastermind didn't deserve his fate "needs to have their head examined," he said. O bama said binLaden h ad "some sort of support network" inside Pakistan to be able to live for years at a high-security compound in Abbottabad, a city that houses numerous military facilities. But he stopped short of accusing Pakistani officials of harbouring the man who planned the Sept. 11, 2001, terror attacks that killed nearly 3,000. "We don't know who or what that support network was. We don't know whether there might have been some people inside of government, people outside of government." He said the United States wanted to investigate further to learn the facts, "and more importantly, the Pakistani government has to investi gate." Some members of Congress have called for a cessation of U.S. aid to Pak istan, at least until it becomes clear what role, if any, the government played in binLaden's ability to a void detection for years. B ut Obama said that since the Sept. 11 attacks, "Pakistan has been a strong counter-terrorism partner with us" despite period dis agreements. The president was guarded in discussing any of the details of the raid, and offered no details that have not yet been made public. Discussing his own role, he said the decision to order the raid was very difficult, in part because there was no certainty that binLaden was at the compound, and also because of the risk to the SEALs. "But ultimately, I had so much confidence in the capacity of our guys to car ry out the mission that I felt that the risks were out weighed by the potential benefit of finally getting our man," he said. Two influential lawmak ers rebutted calls for a cutoff in American aid to PakI NSIGHT I NSIGHT THE STORIES BEHIND THE NEWSMONDAY, MAY 9, 2011 U S PRESIDENT BARACK OBAMA b oards Air Force One at Andrews Air Force Base, Md. last week before heading to New York City to visit Ground Zero and meet with first responders and family members of victims of the Sept. 11, 2001 attacks. (AP OSAMA BIN LADEN was killed by USforces last weekend. (AP Obama: Getting our man outweighed the risks SEE page 15B

PAGE 23

B y BRENT STUBBS S enior Sports Reporter bstubbs@tribunemedia.net I ts still early, but C hris Bay Brown f eels his 400m triumph at the J amaican Invitational will set the tone for bigger a nd better things for him this year. I n one of his defying m oments, Brown powered from behind and held off a s trong field to pull off the o ne-lap race in 45.37 to place h im eighth on the IAAF w orld list. The top Bahamian, however, is Texas A&Ms senior Demetrius Pinder of Grand B ahama at No.4 in 45.06. A lso at the meet on Saturday at the Jamaican National S tadium in Kingston, sprinter Debbie Ferguson-McKenzie had to settle for third in the womens 200 in 22.78. Jamaica finished with a 1-2 p unch with Shelly-Ann Fraser in 22.10, followed by compatriot Veronica Campbell-B rown in 22.37. For Brown, in an interview yesterday on his return home,h e said the meet was a pretty good one and he thanked God for allowing him to display his skills. It was my first one for the season and I wanted to get off to a good start, he said. I w asnt concerned about the time I was going to run. I just wanted to win, which wasm ost important. After getting out pretty good, Brown stayed in the pack on the back stretch, butc oming off the final curve, he exerted just enough energy to surge ahead of Trinidad & T obagos Renny Quow, who trailed in 45.43. Jamaican Jermaine Gonzales settled fort hird in 45.52. Im very pleased with the time and very pleased with my performance. To go toJ amaica and to come out with a victory is very huge, he said. The stadium was filled to c apacity and they were rooting for their home town favourites, but I had God on my side and I had some fans there cheering for me, so I just went out there and do battle because I know no weapons formed against me shall prosper. Brown, 32, will now head to Europe for two meets in Rome, Italy, on May 26 and in Ostrava, Czech Republic, on May 31 before he returns to the US to compete in New York and then he will head home for BAAA Nationals i n June. Ferguson-McKenzie, on the other hand, said her perfor-m ance was a start but she admitted that while she was disappointed in her start, t here were three different races within the half-lapper. She was gone, said Ferguson-McKenzie, referring to F raser, who bolted like a lightning from behind to surge ahead of the field off thec urve for an impressive win. She was gone. She was gone from the get go. It wasl ike there was three different races. Shelly-Ann was in a race be herself. Veronica was in a race by herself and I wasi n a different race. She was gone. She was gone, said Ferguson-McKenzie. S he said once she can get in some speed work and some more races between now and the World Championships, she will be ready to contest for another medal. Its still early, she said. So Im not too concerned. Ferguson-McKenzie, 35, will travel to Puerto Rico to compete in her next meet this w eekend. With the new national sta dium expected to be comp leted by June, FergusonMcKenzie said she longs fort he day when the Bahamas c an host an international m eet. A lot of the athletes went to Jamaica to compete, butt hey also enjoyed the food and the whole atmosphere of being on the island where itw as more laid back, she said. So I think it will be a good thing for us to follow in Jamaicas footsteps. Hopefull y, we can have one that is close enough so that when they finish in Jamaica theyc an come to the Bahamas. It w ould be awesome. Elsewhere over the week end, two Bahamian sprinters c ompeted at the Bob Pollick Spring Invitational at Clemson University where they w ent head-to-head in the mens 100. Jamial Rolle, competing unattached, got second in the s traight away race in 10.26 with Warren Fraser of Clemson coming in third in 10.28.A merican Travis Padgett won in 10.11. Rolle, 31, also contested the 2 00 where he posted a victory in 20.91 with Fraser ending up fourth in 21.24. Im happy with it, espe c ially with my training that Im doing right now, Rolle said. I was just happy that everything is coming alone, but I still have a lot of things to work on technically. Im capable of running a lot faster. Thats the technical flows that I have to work on before I get in peak form. But Im in shape right, so Im happy that its early May and Im running fast. So the sky is the limit. MONDAY, MAY 9, 2011 THETRIBUNE SECTIONE INSIDE International sports news Mavs sweep Lakers, into Western finals S ee page 8e By BRENT STUBBS Senior Sports Reporter bstubbs@tribunemedia.net IN principal, the Bahamas Association of Athletic Associations is set to stage its 2011 National Track and Field Championships at the Grand Bahama Sports Complex June 24-25. BAAA president Mike Sands con firmed the speculations circulating that the Nationals will be moved from Thomas A Robinson Track and Field Stadium to the nations sec-ond city. Weve agreed in principal that the nationals will be held in Grand Bahama, Sands stated in an inter view on Sunday. As an executive, we have agreed in principal and I have to stress that. But in order for the Nationals to return to Grand Bahama, Sands indicated that there are several logistics that have to be sorted out before a final decision is made. We have to make an assessment of the facilities, particular the equip ment needs, which is most critical, Sands said. Bear in mind that the Nationals is a qualifying meet for the World Championships, the Pan American Games and the CAC Championships. Once they complete their assessment this week, Sands said by the end of the month the BAAA would confirm whether or not they will eventually stage the Nationals there. We can not just say that the nationals will be there until we have all the ducks in the pond, Sands said. But we are satisfied that whatever needs will be done in time to have the nationals there. Sands said the BAAA has also approached the Ministry of Youth, Sports and Culture to assist in pulling off the meet, which he feels will be the biggest to hit Grand Bahama. And they are also looking forward to securing a principal sponsor, hopefully from Grand Bahama where the economic boost is far fetching, considering the fact that there are so many elite athletes that have not had the chance to compete at home in quite some time. Sands was referring to quartermilers such as Demetrius Pinder, Michael Mathieu, Andrea Williams and Latoy Williams, high jumper Donald Thomas and sprinter Nivea Smith, just to name a few. But he pointed out that the majority of the athletes, who are from New Providence and who are based in the United States, will just simply make arrangements to travel directly to Grand Bahama instead of coming here. There maybe some minimum inherent cost, such as accommoda tions, but again, we are working on making that as economically feasible as possible on their behalf, Sands said. Its a mandatory meet for all the athletes wishing to make any of the national teams, so were satisfied that the event will be fully subscribed and it will bring a level of excitement to Grand Bahama that they have never seen before in track and field, he said. Additionally, Sands said if time permits, the BAAA intends to put on a special 4 x 400 relay dubbed Grand Bahama versus the rest where the Grand Bahamian quarter-milers will team up to compete against a team made up of the other quartermilers, led by Chris Brown. In a bid to try and see if both the 4 x 4 and the womens 4 x 100 relay team get a chance to qualify for the World Championships, Sands said they intend to invite a couple of Caribbean nations to compete. To use it as a qualifier for the World Championships, you must have three countries compete, Sands said. Unfortunately, most of the region will be having their nationals as well, but we will invite any country who is looking for a meet to try and qualify their relay teams. When contacted, a couple of the athletes pointed out that a change in venue for the Nationals will be just what they need. Its okay. We were asking if the Nationals would be at the main stadium, which they told us wont hap pen, said sprinter Debbie Fergu son-McKenzie. So in a way, I think its kind of good that it will be in Grand Bahama. As much as we usually have more crowd in Nassau, I think we just want a change. Since its not the new stadium, lets just take it somewhere different. Sprinter Jamial Rolle weighed out the situation. Being from Nassau, I have a preference competing there, Rolle said. But its the Bahamas Nationals, not Nassau Nationals, so it is what it is. Be honest, I probably would want to compete in Nassau because its my home. But Grand Bahama has a nice track, so they deserve us coming there. Either way, its a track with eight lanes, so it is what it is. It doesnt matter. But if I had a preference, it would be Nassau. However, Chris Bay Brown has a little more at stake, competing against a host of Grand Bahamians in the mens 400 metres. I enjoy a different scenery every now and then. It makes it more exciting, Brown said. Its something different. The only thing is Ive never had a good race in Grand Bahama. Hopefully, this time would be different. Even though they have their home-town favourite, it would be nice to go there and upset the home-crowd favourite. I think its going to be a nice championships. If everybody comes home healthy, it should be a nice race. eve agreed in principal that Nationals will be held in Grand Bahama JAMIAL ROLLE competes in the 100m at the Bob Pollick Spring Invitational. Chris Brown wins 400 in JA Golden girl Debbie third in the 200m B IG WIN: C hris Bay Brown (file photo lap race in 45.37 at the Jamaican Invitational. He is ranked 8th of the IAAF world list. Debbie FergusonMcKenzie (file photo top right

PAGE 24

B y MICHAEL CASEY AP Sports Writer DOHA, Qatar (AP w as a tough night for Ameri can stars at the Diamond League opener Friday, with o nly triple world champion Allyson Felix and sprinter Walter Dix among the bign ames who won. F elix edged a hard-charg ing Amantle Montsho to win the 400 meters in 50.33 sec-o nds. The reigning three-time world champion in the 200 held on down the stretch tof inish 0.08 ahead of Botswana's Montsho. Patri cia Hall of Jamaica was third. I t was the American's 10th win in Qatar, including the world indoor gold last year as part of the United States' 4x400 relay. "It was decent," said Felix, who won the Diamond League title last year in the 200 and 400 and is considering running both events at the worlds in August. "I wasn't sure what to expect being it's my first race. Now I have a place to work from. "I felt like we went out slow in the (first windy and it really forced us to work home. I felt comfortable in this race and I can definitely push myself a lot more." Olympic bronze medallist Dix got his season going witha win in the 200, easily beating Femi Ogunode. Dix's time of 20.06 was the best this year and a meet record. "Walter Dix is reloaded," Dix said. "I didn't train in January and missed the indoor season, but now I feel very strong. Everyone is beatable and everyone is on my list." In the 100 hurdles, 2010 winner Lolo Jones came in third behind fellow Americans Kellie Wells and Danielle Carruthers. Wells won in 12.58, 0.11 seconds faster than Jones and the fastest time this year. Jones, who won the gold in the 60-meter hurdles at the 2010 world indoors, has struggled in recent months with a nerve injury and came into the meet on a three-race losing streak after being beatenlast week at the Drake Relays. She admitted the nerve pain "was a concern" aheadof the race, but felt she was improving and wasn't going to "beat herself up" over the race. "It was good. A lot of peo p le ask if I'm disappointed. Y ou know, not really because I'm coming off an injury," she said. "There is definitely huge room for improvements. In the third hurdle we were all kind of there. I was right int he mix. I got high over the fourth hurdle and everyone passed me so I had to play catch-up." C hristian Cantwell of the US couldn't defend his shot put title, finishing fifth behind D ylan Armstrong of Canada, who won with a toss of 70 feet, 1 inches. Americans Reese Hoffa and Ryan Whit-i ng were second and third. Cantwell won his third indoor title in Doha last year with a throw of 71-7 and only lost twice in the 2010 outdoor season. Louis Van Zyl won the 400 hurdles in 48.11 seconds, beating fellow South African Cor nel Fredericks by 0.32 sec onds. American Bershawn Jackson, last year's winner, placed third. Champion Jackson, a world champion in 2005, shrugged off the results, saying it was only his second race of the season. He is still aiming for gold at the worlds and eventually breaking 47 seconds. "I just started training in January. Them guys are sharp and ready," he said of the South Africans who beat him. "The reason I came here is to just see where I'm at. I feel good. I didn't expect too much. I was happy with my performance and I'll get a lot better as the season goes on." World indoor champion Teddy Tamgho of France wasn't at his best in the triple jump, but still easily won witha leap of 57-4. The 21-yearold Tamgho said he had want ed to jump farther but he "had problems with his runup." Tamgho, who has broken the indoor record three times in the past year, said he was on track for his goal of win ning gold at the worlds. "I expected a bit farther jump, but I achieved the win and that is the most important which is the first since the Diamond League final last year," he said. The opener lacked some of the fireworks of last year's inaugural event, with some top stars pulling out injured. Several top Jamaican and American athletes entered a Jamaican invitational this weekend. While there were 10 reigning world and Olympic cham pions competing for $480,000 in prize money, the 16-event field missed 100-meter stars Usain Bolt, Tyson Gay and Asafa Powell. The 100 was a non-Diamond League event and, in the end, was canceled. The men's 800 also lost some of its luster after world record-holder David Rudisha pulled out due to injury. L OCAL SPORTS P AGE 2E, MONDAY, MAY 9, 2011 TRIBUNE SPORTS O N Friday, triple jumper Leevan Superm an Sands and high jumper Donald Thomas got second and fourth respectively in their e vents at the Samsung Diamond League in Doha, Qatar. W ith softball player/pilot Byron Ferguson w atching in the stands, Sands popped a season's best of 17.09 metres or 56-feet, 1-inch o n his first of four jumps to trail Teddy Tamgho of France. T amgho produced a world leading mark of 1 7.49m or 57-4 3/4 on his second attempt to erase the meet record of 17.47m or 57-3 3/4 by C uban Alexis Copello last year. Copello had to settle for third with 17.05m or 55-11 1/4 on h is first attempt. Thomas, meanwhile, ended u p with a best of 2.29m or 7-6 for his fourth position. American Jesse Williams produced 2 .33m or 7-7 3/4 to surpass the meet record of 2.28m or 7-5 3/4 by Charles Austin in 1998. Superman soars for seasons best Felix wins the 400 in Diamond League meet ALLYSON FELIX of the US celebrates after winning the 400m at the IAAF Diamond League in Doha, Qatar. (AP Photo S HOWN ( l-r) are Donald Thomas, Byron Ferguson and Leevan Sands at the Qatar meet. SUPERMAN L eevan Sands chats with his coach after competing in the triple jump.

PAGE 25

By RENALDO DORSETT Sports Reporter rdorsett@tribunemedia.net WITH a pair of bouts on the horizon which places him in line to possibly capture the WBF Heavyweight Championship, the Bahamas leading professional fighter hopes touse these opportunities to promote the sports tourism aspect of the Bahamas. Sherman The Tank Williams, after fighting to ano contest with Evander Holyfield in January, now prepares himself to face Brazilian Raphael Zumbano and following that bout, a win could earn him a rematch with Holyfield with the WBF Heavyweight title on the line. Williams has noted that the pair of fights could pay great dividends to the sports tourism industry in the Bahamas. We can bring a world class show here to the Bahamas. Imagine having a heavyweight championship bout headlin ing an event and having a Bahamian featured in the fight. It can have a great social and economic impact on the Bahamas, especially if it is featured at a venue like the Atlantis which has become a great sports tourism destination," he said. In Las Vegas, they are not just fans of boxing, they are fans of the economic impact that prize fighting brings to the area and the boost it can give to the economy and what we have is an opportunity possibly for a two-fight deal, he said. Williams bought with Zumbano, scheduled for mid to late July, will be televised live on Telemundo and Fox Sports Television. Hopefully, we can have this fight picked up in the Bahamas. They are proposing Argentina, but I'm a bit skeptical about going to Argentina to fight the hometown boy. I would prefer to fight in a neutral situation like the United States or in the Bahamas. My people are going to contact the Ministry of Tourism and see if there is any interest there. This will be a televised fight on Telemundo and Fox Sports and I would hope that the Bahami an Government will have a keen interest in the fight, see ing that it will do so much to promote tourism and gaming.I am sure the entire Bahamas can use the publicity so I think it will be a plus if they show some interest in it. Williams has also devel oped a bond with the two most noteworthy heavyweights in professional boxing, the Klitschko brothers, who he regularly joins for training and sparring campsin Austria. Along with making him a better fighter, Williams has said his bond with the Klitschkos can also pay dividends for the Bahamas with the prospect of the champions staging a title bout on Bahamian soil. The training camp with the Klitschkos always puts me on edge and gets me prepared and its one of the reasons why I think I'm so successful being in there with Vitali and Wladimir, he said. It definitely gives me an edge going into training camp. Moving with a tall fighter is nothing new to me. I'm very familiar with it and obviously my confidence is up because, with Vitali, I was able to land punches at will and I was able to bob out of the way of the big right hands that follow when he tried to counter punch. Wladimir is the IBF, IBO, WBO and Ring Magazine champion. His older brother Vitali is the current WBC champion. Wladimir is the longest reigning heavyweight cham pion in history for the IBF, WBO & IBO Heavyweight titles, both in measurements of defenses and time. So I'm also doing my part to promote the Bahamas. We have a good relationship and hopefully in the very near future, I want to get a title shot at one of the brothers, Williams said. It's nothing personal. He and his agent understand. So I'm hoping everything falls in line and we could even possibly have that fight in the Bahamas as well." LOCAL SPORTS TRIBUNE SPORTS MONDAY, MAY 9, 2011, PAGE 3E THE New Providence Softball Association, which had to resort to using some replacement officials in the absence of the certified officials, continued its regular season with a double header on Saturday. In the womens opener, the Bommer George Collectors blasted the Black Scorpions 12-3. In the mens feature contest, the New Breed shut out the Johns Buccaneers 7-0. Desiree Coakley gave up four hits, walked as many batters and struck out three for the win. Mar-v ell Miller was tagged with the loss on 10 hits, three s trike outs and a walk. Nesessa Seymour went 2 -for-3 with two runs scored, Rebecca Moss was 2-for-3 with a run, Shavone Dames 1-for-3 with two runs and Lathera Brown was 1-for-3 with three RBI and a run scored in the win. Ingrid Rose was 2-for-3 with a run scored, both Renee Davis and Crystal Taylor scored a run and Miller and Ebony Evans were 1-for-3 in a losing effort. The NPSA hopes to have its full slate of certified officials on hand when they resume play Tuesday night. In the womens 7:15pm opener, the Wildcats are slated to take on Choppy Team. The mens nightcap at 8:45pm will be between the Millers Ram against the Dorin United Hitmen. And at 7pm Thursday, Choppy Team is scheduled to play the opener against the Sigma Brack ettes (women by New Breed against Dorsey Park Bommer G (men On Saturday, the Proper Care Pool Lady Sharks are all set to meet the Wildcats in the womens 7pm opener. The mens feature contest at 8:30pm will see the Island Luck Truckers against the Johns Buccaneers. Collectors blast the Scorpions 12-3 New Breed shut out Buccaneers THE Bahamas Sailing Association (BSA nical Course for Coaches', funded by Olympic Solidarity through the Bahamas Olympic Committee this week. The course was supported by the International Sailing Federation (ISAF nect to Sailing' project. ISAF trainer Tom Wilson and Maria Aaboe, BSA senior instructor, have been working with the coaches from Rock Sound and Governors Harbour, Eleuthera, Harbour Island, Long Island and New Providence. Eleven participants attended the course, representing their local sailing club or school, with the hope to take back some new skills and knowledge to help develop their sailing provision. "It has been really beneficial having such a variety of coaches from different islands as they have been able to share their experiences from the projects they run. Along with input from the ISAF 'Connect to Sailing Project and ISAF Learn to Sail Training Programme guide lines the group have a much greater appreciation of what it takes to run structured sailing sessions for all standards of sailor," said Wilson. The five-day course looked at how to introduce complete beginners into sailing, making their first experience safe, fun and memorable and then how to develop their skills so that the sailors are able to be independent on the water and have the knowledge to start racing. John Lawrence, of the BSA, explained why such a course was organised. The BSA hosted this technical course so that we could increase the coaching expertise that we have in the Bahamas. The BSA felt that it was an excellent opportunity to assist with expanding the junior sailing programmes throughout the Bahamas and into our existing OutIsland programmes," he said. "We have been rapidly adding new junior sailing fleets in the Bahamas to some of the smaller, less accessible locations and these programmes will of course all be dependent of competent qualified instructors. This technical course went a long way towards achiev ing these growth goals of the Bahamas," said Lawrence. Throughout the course, the group had some of the local young sailors from Nassau come along so the participants were able to have some real students to coach. "It has been fantastic to see the young local Bahamians have the opportunity to get on the water and have so much fun and we look forward to developing our relationships with the whole of the Caribbean Sailing Association and their members as the programme develops even further," Wilson said. The aim of the course was to educate those that are involved in the delivery of sailing throughout the Bahamas, along with support from the world governing body of sailing in developing the formal coaching and learn-to-sail programme with the Bahamas which is the next stage in the development so that the BSA gets more young children afloat that would not normally have the chance. The ISAF is thankful to Nassau Yacht Club, the hosts of the course, who allowed ISAF and BSA the use of the club facilities. Wellington Miller was present at the closing of the course to officially present the coaches with their certificates of attendance. "It was really positive to see so many new coaches equipped with the skills to help develop the learn-to-sail programme within the Bahamas," he said. Bahamas Sailing Association hosts its first Technical Course for Coaches BOC president Wellington Miller (left ank to face Zumbano Win could earn him rematch with Holyfield for WBF title SHERMAN The Tank Williams (left Holyfield in January. The bout was ruled a no contest.


University of Florida Home Page
© 2004 - 2011 University of Florida George A. Smathers Libraries.
All rights reserved.

Acceptable Use, Copyright, and Disclaimer Statement
Last updated May 24, 2011 - Version 3.0.0 - mvs