Group Title: Tribune. (Nassau, Bahamas).
Title: The Tribune
ALL ISSUES CITATION THUMBNAILS ZOOMABLE PAGE IMAGE
Full Citation
STANDARD VIEW MARC VIEW
Permanent Link: http://ufdc.ufl.edu/UF00084249/00194
 Material Information
Title: The Tribune
Uniform Title: Tribune (Nassau, Bahamas)
Alternate Title: Nassau tribune
Physical Description: v. : ill. ; 58 cm.
Language: English
Publisher: Tribune
Place of Publication: Nassau Bahamas
Publication Date: August 30, 2005
Copyright Date: 2005
Frequency: daily, except sunday
daily
normalized irregular
 Subjects
Genre: newspaper   ( marcgt )
Spatial Coverage: Bahamas
 Notes
General Note: Description based on: Vol. 79, no. 210 (Aug. 3, 1983); title from caption.
 Record Information
Bibliographic ID: UF00084249
Volume ID: VID00194
Source Institution: University of Florida
Holding Location: University of Florida
Rights Management: All rights reserved by the source institution and holding location.
Resource Identifier: oclc - 09994850

Full Text






"START YOUR
MORNINGS WITH Jj
McGRIDDLES" invw, ,
HIGH 92F
LOW 78F

SUNNY SPlS,
SNOBE


The


Tribune


Volume: 101 No.228


"SDAY, AUGUST 30, 2005 PRICE 500


ARTHUR FOULKES

GETS TO THE POI
* SEE NEWS
SECTION PAGE TWO


BAHAMAS RU

ASSOCIATION
* SEE TRIBUNE
SPORTS SECTION


P Smith 'or rePd to rPesi'



Ousted COB president St Cecilia gets ready for new term

claims he was given ,

an ultimatum


* By KARAN MINNIS
and ADRIAN GIBSON
DR RODNEY SMITH, oust-
ed president of the College of
the Bahamas, said yesterday
that he was ordered by council
members to resign or be fired
over the plagiarism scandal.
At a closed meeting held in
the college's auditorium, Dr
Smith reportedly told college
staff that he was given the grim
choice by council chairman
Franklyn Wilson the man
who had hired him last year
with a pay package topping
$200,000.
Speaking to The Tribune yes-
terday, Mr Wilson described the
controversial meeting in COB's
auditorium as "unfortunate and
unbecoming".
"Dr Smith did not extend the
courtesy of discussing with the
council, through the chairman
or its secretary or the office of
the acting president, the possi-
bility of coming on campus for
any discussion and that is unfor-
tunate and unbecoming of
someone who held that office.
"We understand that copies
of the speech were handed to
the press but when persons
from the council asked for
copies of Dr Smith's remarks
they were told no and we don't
understand why he or his agents
would refuse to do that," said
the council chairman.
Mr Wilson did not want to
comment on any of the specific
accusations that he had heard
were contained in the speech,
but said that if what he was told


was actually in the speech it
would be "quite sad and frankly
my prayers go out to him."
Nevertheless, Dr Smith's rev-
elations could spark a college
revolt, with some senior acade-
mics threatening to call for Mr
Wilson's dismissal and a full
inquiry by Prime Minister Perry
Christie.
Dr Smith's resignation came
after it was revealed that he had
used portions of a speech writ-
ten by New York University
president John Sexton at the
COB's Honours Convocation
ceremonies without attributing
the quotes to Mr Sexton.
The past president told for-
mer colleagues that he was
forced to resign on August 4,
several weeks after the college
was rocked by his plagiarism
confession at a press confer-
ence.
After the meeting in COB's
auditorium, to which neither
students nor the press were
invited, staff members sworn to
secrecy denied Dr Smith's pres-
ence.
But, in a clandestine bath-
room meeting with. two promi-
nent staff members (who had
attended), and who feared
speaking openly, The Tribune
learned that Dr Smith had
revealed he was told to either
resign or be fired.
This was subsequently con-
firmed when The Tribune was
able to obtain a copy of Dr
Smith's speech late yesterday
evening from Dr Earl Johnson,
SEE page 11


CHILDREN of the St Cecilia constituency enjoy the last days of the summer holidays yesterday, thanks to Deputy Prime Min-
ister and Member of Parliament for the area Cynthia Pratt. Mrs Pratt presented the children with school supplies one week before
the new term begins. See page 12
(Photo: Felipe Major/Tribune staff)


Zhivargo
Laing plans to
retire from
active politics
By RUPERT MISSICK Jr
Chief Reporter
ZHIVARGO Laing, former
Cabinet Minister and MP for
Fort Charlotte, announced
yesterday that he plans to
retire from active politics.
While Mr Laing said that he
has no specific plans for the
future at this time, he will be
exploring all of his options but
will continue participating in
the process of community and
nation building, but "not from
a political platform."
"Over the past three years,
particularly the past several
months, I have given serious
consideration to the direction
I wished my life to take. There
SEE page 11


CC Sweeting
Junior school
teachers
stage sit-out
I'By PAUL G
TURNQUEST
Tribune Staff Reporter
THE pew school year may
already be' off to a rough start
as, according to reports, a num-
ber of schools still under repair
will not be completed in time
for the beginning of classes netf
week.
It has been reported that AF
Adderley has been condemned
and repairs to Carlton Francis
and CC Sweeting Junior will
not be finished in time for class-
es to start on Monday.
Minister of Education and
Attorney General Alfred Sears
was touring schools yesterday.
SEE page 11


Ministry

officials fear

even higher

fuel prices
By PAULG
TURNQUEST
Tribune Staff Reporter
AS A result of Hurricane
Katrina and uncertainty in the
US Stock market, the future
price of fuel at the pumps can
be higher than previously pro-
jected, ministry officials
announced yesterday.
On Sunday oil prices soared
to more than $70 a barrel with
gasoline futures trading up
more than six per cent in the
US.
Yesterday speaking with
The Tribune, the Trade and
Industry Minister Leslie Miller
said that local motorists can
SEE page 11


Teen in custody
over stabbing
A 13-YEAR-OLD resi-
dent of the Mud in Marsh
Harbour, Abaco is in police
custody today accused of
stabbing a youth to death.
The victim, Yvenader
Sainvil, 18, also of the Mud
was involved in an argu-
ment with a girl who
police say is a Haitian
national.
The altercation occurred
at about 9.30 am Sunday,
leaving Mr Sainvil with a
stab wound in the upper
right side of his chest.
Mr Sainvil was rushed to
the Marsh Harbour Gov-
ernment Clinic where he
died of his injuries at 10.30
pm.
The 13-year-old was tak-
en into custody by the
police. She is being ques-
tioned in connection with
this incident.
Police are continuing to
investigate this matter.


Nassau and Bahama Islands'Leading Newspaper


#1 PAPER IN CIRCULATION


lhe %Mami Aferatb
BAHAMAS EDITION








PAGE TUSDAYAUGUT 30,2005hL I NBUN


Assassination is not the





route to world peace


.0


P AT Robertson's statement call-
ing for the assassination of
Venezuelan President Hugo Chavez sent
shock waves around the world, :' "
Mr Robertson is one of the most pop-
ular television evangelists in America,
as well as a political activist who once P O IN T
sought the nomination of the Republican .... ',. i^.
Party to run for president of the United
States.
He is believed to be well-connected
to the present administration of Presi-
dent George W Bush and his neocon-
servative hawks who misled America
into an expensive and disastrous war in
Iraq.
So it was not surprising that his words
stirred up such a hornets' nest. Even
though he has made many outrageous
pronouncements in the past, it was still
shocking that this Christian leader could
openly advocate the murder of the
democratically elected leader of another
country.
In response to the torrent of condenm-
nation which followed his remarks, Mr
Robertson at first tried to blame the
media for misinterpreting his words, a
not unfamiliar tactic, Then he interpret-
ed his gangster parlance "take him out "R T H U R
to mean kidnapping. ,
But what he did in fact say was clear- F U L E S
ly heard and understood by millions inL K E S
his own country and around the world:
"..,If he thinks we're trying to assas-
sinate him, I think that we really ought to
go ahead and do it. It's a whole lot
cheaper than starting a war, and I don't
think any oil shipments will stop." dictator and that it is foolhardy to believe
The multi-millionaire some say bil- that western democracy can be rained
lionaire preacher would not be Con- down on an unwilling people from the
strained by his Master's command not to wings of stealth bombers.
kill but just might have second thoughts Instead he is plotting to inflict more
if murdering Mr Chavez would mean mayhem in another part of the world
that the oil would stop!
Clearly Mr Robertson was issuing a
fatwa against Mr Chavez to be executed
by his government or by some fanatical
follower. Even a back-
The tragedy about all of this is that
two thousand years after Jesus Christ, bencher of a gov-
when the world is still bleeding from so r h s
much. violence, a Christiarn.lePade.ArI f l 9 aP y i4a1'y
advocate even more violencesaseaiAi to be fi i w
tion to any perceived problem and *a way to be cv A'u l
to deal with a political opponent. y t he goes b'out try-
What can we in the West now say to . hie oes a.bo u ty-
the blood-thirsty murderers of a per- ing to upstage his
verted fundamentalist Islam who talk
about a compassionate and merciful God colleagues and
while preparing to blow up innocent chil-
dren along with themselves? score points at
Should we prove to them that we ,
believe in violence every bit as much as their expense.
they do and are even better at it? Should
we shock them by dropping bombs and
carrying out assassinations? Or should
we try to awe them with Christian love
and an invitation to come reason togeth- which is only now struggling to emerge
er? from lone years of violent interference


Mr Robertson should be among
those in the West who are
now painfully but so slowly coming
around to the realisation that it was
wrong to bomb tens of thousands of
Iraqis to bits in order to get rid of one


and bloody dictatorship.
Mr Robertson should recall the plain-
tive words of El Salvador's Archbishop
Oscar Romero to US President Jimmy
Carter before he was himself assassinat-
ed at the altar: -
"You say that you are Christian, If
you really are Christian, please stop


What can we in the West now say to
the blood-thirsty murderers of a
perverted fundamentalist Islam who
talk about a compassionate and
merciful God while preparing to blow
up innocent children along with
themselves?


sending military aid to the military here,
because they use it only to kill my peo-
ple."
Mr Robertson should also recall the
terror that was unleashed on the peo-
ple of Chile when their democratically
elected President Salvador Allende was
killed resisting a coup at least encour-
aged by agencies of the United States,
The Marxist Allende was succeeded by
the Fascist Augusto Pinochet, who killed
thousands of Chileans and imprisoned
and tortured many more thousands,
The international community should
insist on the observance of human rights
in Venezuela and everywhere else in the
world. But the Venezuelan people
should be left to decide for themselves
what kind of government they should
have.
If the socialism of Hugo Chavez suc-
ceeds, fine. If it fails then the Venezue-
lans should be trusted to try something
else.

After World War II came to an
end in Europe the British peo-
ple elected a socialist government head-
ed by Clement Attlee. It was a radical
regime which changed Britain forever.
When the British had enough of social-
ism they chose another kind of govern-
ment, Now, none of the three leading
parties in pBritain is ,socialist but some
of the institutionsand reforms put in
place by Mr Attleeitillstturvive.
The American government woqld be
wise not to listen to the likes of Pat
Robertson and repeat the bloody mis-
takes of the past. The administration
should engage Hugo Chavez, Fidel Cas-
tro and anyone else willing to sit and
reason together in an effort to bring
peace and stability to the hemisphere
and the world.


CABINET LESSON

M inister of Foreign Affairs
Fred Mitchell confirmed last
week that the PetroCaribe oil deal being
touted by his colleague Leslie Miller has
not yet come into operation,
In an interview with The Nassau
Guardian, Mr Mitchell acknowledged
that there is such a proposal "but the
analysis is not complete on that propos-


al and it can't be signed until the Cabinet
has looked at it."
It is reassuring to know that, but in
the meantime Mr Miller, the Trade and
Industry Minister, is due for another les-
son in cabinet government. He says the
controversial PetroCaribe proposal
would bring cheaper fuel and cheaper
electricity to the Bahamian public. "And
that's why I'm fighting for it because I
know it's the right thing to do."
Even a backbencher of a governing
party has to be careful how he goes
about trying to upstage his colleagues
and score points at their expense. A min-
ister in the government should not do it
at all,
It is easy to advocate a particular
course of action that would please the
public, even if it is not feasible, and then
turn around and say, "See, I tried but
those fellows Wouldn't let me do it."
This is exactly what Mr Miller is about,
and it is wrong. It is important that this
kind of ministerial conduct be stopped,
not just for the sake of the government
of the day but for the survival of orderly
government in the EBahamas.
It is easy to imagine what will happen
if every minister is allowed to put his
colleagues on the spot in this fashion
and, in effect, to reveal the position tak-
en by them in the process of arriving at a
collective decision,
Each minister is expected to accept
his share of responsibility for a cabinet
conclusion and ,o defend that cbnclu-
sion publicly. T~epnly way he can say he
did not agree -t'if he resigns over the
issue,
Former British Foreign Secretary
Robin Cook (who died a few weeks ago)
took just a position when he resigned
over his government's participation in
the Iraq war. Only then could he speak
out freely against the war.
It may seem a hard thing for minis-
ters but it is necessary to avoid disarray
in a government and to preserve good
order and discipline.
Mr Miller is obviously grandstanding
at the expense of his colleagues over the
high price of fuel, But he knows that the
causes of fluctuating oil prices are
beyond the power of the Bahamas gov-
ernment to control,
There are some things we can do inter-
nally to ease the shock, including reduc-
ing the tax on gasoline. But no minister
should publicly advocate even that with-
out the prior approval of the cabinet.


"Copyrighted Material
Syndicated Content
Available from Commercial News Providers"


S-


Backto Sh-o 6


With one week left before
most public schools
open, families every-
where are busy with
back to school pre-
parations, There is
naturally much excite-
ment in this for young
people. But for many
parents and guardians
back to school time
brings serious financial
stress, Shoes and
uniforms need buying,
School supplies, lunch
boxes, pencil cases,
pens, binders, rulers,
back packs and much
more are needed for each
child,
No where is this stress
felt more in our
community than in
special homes for
children. At the Bilney
Lane Children's Home'
Administrator Janet
Brown has 10 children in
her care, ranging from 12
to 15 years of age,


Mrs. Brown, and her
colleagues are very busy
these days getting all of
them ready for the new
school year. That's ten
sets of uniforms, shoes,
and lunch boxes. Ten sets
of pencils, pens, books
and school bags.

Mrs. Brown has a quiet
sense of confidence about
her as she describes the
children's needs. She
operates, successfully, on
one part community
support and three parts
faith.

The Father Pat Fund is
pleased to donate $2,000
to the Bilney Lane
Children's Home for their
back to school needs.
Throughout our com-
munity special homes are
feeling back to school
financial pressures. The
need exists in many
places, with many kids.
Can you help?


, YOUR DECORATING


*E-Z CREDIT TERMS
AVAILABLE


"Lowest Prices
On The Island"

FREE DELIVERY
ANYWHERE IN NASSAU
AND TO THE MAIL BOAT


Donald's Furniture


STORE HOURS


AndAppliance Centre


MONDAY THURSDAY 8:30AM 5:30PM
FRIDAY SATURDAY 8:30AM 6PM


SIXTH TERRACE CENTREVILLE TEL: 322-1731 OR 322-3875


I ____~ C 1~_~ _7 ____~______ ___~~__~_ ~_ I


_ ____ _I


PAGE 2, TUESDAY, AUGUST 30, 2005


iHE RI IBUNE









THETRIBUNETUESDAYAUGUSTLOCALNEW


'No plans' to remove




vendors from Cay


* By PAUL G TURNQUEST
Tribune Staff Reporter
POTTER'S Cay vendors have been
assured by government that there are no
plans to evict them from the dock.
Vendors have complained for some
time about excessive police presence
and raids for liquor licences and inspec-
tions by health ministries, all of which
they feel are a part of a bigger plan to
push them out of business allegedly at
the request of Atlantis.
But the Department of Health has
rejected the rumours, and says that the
current re-beautification programme in
the area is intended to attract the poten-
tial business at the Atlantis resort, just
over the Paradise Island bridge
Last week vendors were issued let-
ters by the Department of Environ-
mental Health Services (DEHS) advis-
ing them that they can no longer sell
cooked foods at the dock. According
to the document, if a vendor was caught
in breach of this instruction, "legal
action" would be taken against them.
However, parliamentary secretary in
the Department of Environmental


Health Services (DEHS) Ron Pinder
said that this letter was prematurely
released and has since been rescinded
Mr Pinder said that at the end of this
clean up programme, scheduled for
completion for the Discovery Day
weekend (October 12), vendors will be
able to sell cooked and uncooked foods,
and even alcoholic beverages, once they
meet the desired requirements.
He said: "The letter that was issued
to the vendors at the Potter's Cay market
on the August 16 by the DEHS was a
premature letter and that letter has been
subsequently rescinded. What is now
happening is that the stalls are being
individually inspected by the Ministry of
Works, the Fire Brigade, Water and Sew-
erage and the DEHS, with a view to giv-
ing specific recommendations and
requirements that will cause each vendor
to meet the minimum standards of these
agencies to cause them to be eligible to
apply for the liquor and business licences.
"So they will be getting specific
instructions that need to take place at
their individual stalls at the Potter's Cay
market area. For example, some of the
recommendations are that their stalls


should be painted light colours, have
an exhaust fan for the stoves, and that
cooked food should be at a particular
temperature. Some may be at this level,
some may not. When they see these
requirements then they will govern
themselves accordingly," he said.
Mr Pinder assured the vendors that
despite the rumours they may have
heard about them being pushed out by
Atlantis, that such a move is not in place
"There is no government plan or pol-
icy to push them out. The strategy is to
significantly improve the Potter's Cay
area and cause it to be an attractive
down home fish fry business mecca. This
plan is to put them in a position to ben-
efit from the significant amount of per-
sons that stay at the Atlantis resort.
"People are looking for places that
are native, clean, with good service, and
that has good food. They are in a prime
location but at the present the standard
of the product is not at what it should be
so this is simply an attempt to enhance
their product," he said.
An Atlantis spokesman said: "The
company has made no indication to any-
one tha Potter's Cay should be closed."


Rigby demands an


apology for article


* By RUPERT MISSICK Jr
Chief Reporter
PLP chairman Raynard Rigby is
demanding an apology for what he
describes as a "tacky" reading of his
comments about Prime Minister Per-
ry Christie's health.
According to Mr Rigby, it was
"wicked" for a local daily to portray
his words about Mr Christie's health
as suggesting that the prime minister
might be unable to lead the party in
the next general election.
Calling yesterday's Nassau
Guardian headline a "craven and
calculated attempt to sell newspa-
pers at the expense of the truth",
the chairman assured the public that
Mr Christie will be the man leading
the PLP into the next election.
The headline referred to com-
ments made by Mr Rigby when he
appeared on Island FM's Parliament
Street radio show on Sunday.
"This too often occurs in this
country and I trust that the publish-
ers of all of the news media will
ensure that their reporters appreci-
ate and adhere to the principles of
integrity and truth," he said.
"I was baffled and shocked this
morning at the captioned headline in
this morning's Nassau Guardian,


"Fears over PM's health: PLP Chair-
man is concerned about Christie.
Mr Rigby said that while on the
show, he stated very clearly that all
indications from the prime minis-
ter's team of physicians and from
Mr Christie himself suggest that he
has fully recovered and was given a
good bill of health..
The party chairman said that when
he was asked whether or not he was
concerned about the prime minis-
ter's heath he said 'yes' because
there was general concern and noth-
ing rhore.
"Everyone is generally concerned
about his well being but not espe-
cially concerned about his stroke
because he is fully recovered and
back to his normal self doing all that
he is supposed to do," said Mr Rig-
by.
' Mr Rigby said it was "patently
misleading, false and wicked for The
Nassau Guardian to spread such a
malicious untruth and to attribute
the headline to statements purport-
edly made by me on Parliament
Street".
"In fact, the body of the story does
not support the headline and it again
is a clear indication of a press that
fails to understand its responsibility
to our democracy," said Mr Rigby.


Society calls on government E



for immigration action plan 1


* By KARAN MINNIS
The government has been
challenged to publicise an illegal
immigration action plan within
38 days.
Civil Society Bahamas (CSB)
has called on the authorities to
"deal decisively with persons
and companies who hire illegal
immigrants" and to "stop the
illegal use of Crown Land by
removing all shanty towns and
refuse to provide utilities to
their illegal structures"
Yesterday the group released
its findings from a town meeting
on illegal immigration in July.
The town meeting, which was
held at the College of the
Bahamas, was well attended by
numerous Bahamians and resi-
dents, according to CSB presi-
dent ad-interim Frederick
Munnings.
The meeting's panel included
former minister of immigration
Loftus Roker, attorney Mau-
rice Glinton, former politician
and social activist Dr Elwood
Donaldson, Reverend Cedric
Moss, Senator Tommy Turn-
quest and Minister of Immigra-
tion Vincent Peet.
Copies of the various recom-
mendations made at the meet-
ing have been forwarded to Mr
Peet, Prime Minister Perry
Christie and Deputy Prime
Minster Cynthia Pratt.

Policy

The government has also
been urged to, "institute a poli-
cy of zero tolerance on illegal
immigrants by deporting all
immigrants and refusing work


TRPIAL


-' S .INT


I INDEX Ii


* THE Mud and Pigeon Pea in Abaco, a Haitian settlement


(Photo: Felipi Major/Tribune staff)


permits unless it has been estab-
lished that no Bahamians are
available to fill job vacancies."
Speaking to the press yester-
day, Mr Munnings said that this
is not an attack on the Haitian
community.
"We are talking about illegal
immigration," he said. "All sec-
tors, all ethic groups, and there
are many the Chinese, the
Asian, the Haitians, the Cau-
casian, the American, the Euro-


pean, and all others any illegal
immigrant in this country needs
to be addressed."
The CSB report asks the gov-
ernment to put a moratorium
on repatriation and agree to a
period for illegal immigrants to
come forward and be registered.
It has also asked for illegal
immigrants who have been in
the Bahamas from a certain
fixed date to be regularised. The
report did not, however, sug-


gest a particular date.
CSB has also asked govern-
ment to be careful about grant-
ing citizenship to persons pre-
viously on work permits, as this
may prevent Bahamians who
have spent thousands of dollars
becoming qualified for those
positions from getting them.
CSB has also stated that it is
willing to assist government in
dealing with the matter in any
way it can.


Ministry monitoring



effects of Katrina


THE Ministry of Foreign
Affairs is monitoring hurricane
Katrina and its possible effects
on Bahamians and Bahamian
interests in the southern United
States.
Members of the public who
know of any specific instances
that may require the assistance
of the ministry after the pas-
sage of the storm are being


asked to contact Acting For-
eign Affairs Permanent Secre-
tary Marilyn Zonicle at the
Ministry of Foreign Affairs in
Nassau.
In the United states, the min-
istry can be contacted through
Alma Adams, Consul General
in Miami with responsibility for
the states of Louisiana, Missis-
sippi and Alabama.


Established in 1956 by an old Bahamian family
Parliament Street (near Bay St.) Tel: 322-8393 or 328-7157
Fax: 326-9953
Bay Street (next to Athena Cafe) Tel: 323-8240
Crystal Court at Atlantis, Paradise Island Tel: 363-4161/2
Lyford Cay (next to Lyford Cay Real Estate in
Harbour Green House) Tel: 362-5235
email:www.colesofnassau.com P.O. Box N-121


H


CARPET, FURNITURE, MARBLE & TILE CARE
THE MOST THOROUGH RESTORATION & CLEANING EVER, OR THE JOB IS FREE!
NASSAU'S ONLY PROFESSIONAL, CERTIFIED STONE CARPET & UPHOLSTERY CARE SYSTEMS.
Carpet, Upholstery, Stone and Marble Cleaning &
Restoration Specialist.
Prochem Cleaning Systems removes Deep & Heavy
Soil, Bacteria, Grease, Watermarks and Stains from
Carpeting & Furniture, restoring them to like new
at a fraction of replacement cost.
Carpet, Sofa's, Loveseats, Chairs, Dining Chairs, Cars,
Boats, Grout, Tiles, Marble & Stone
Persian, Wool & Silk Carpet Cleaning Specialist
Restoration & Care

Authorized StoneTech Professional Contractor
CALL PM BAHAMA S OUR LOCAL MEWER OF THE.
CALL PROCHEM BAHAMAS PROHEM SYSTEM (sm)
PHONE: 323-8083 or 323-1594
ONLY WE CAN DO IT RIGHT!
www.prochemsystem.com www.stonetechlpro.com www.iicrc.org
psp@coralwave.com


THE TRIBUNE


TUESDAY, AUGUST 3U, ,








IJLT ORIAUUGUSE30,2005HHEEDITOR


The Tribune Limited
NULLIUS ADDICTUS JURARE IN VERBA MAGISTRI
Being Bound to Swear to The Dogmas of No Master

LEON E. H. DUPUCH, Publisher/Editor 1903-1914

SIR ETIENNE DUPUCH, Kt., O.B.E., K.M., KC.S.G.,
(Hon.) LL.D., D.Litt.

Publisher/Editor 1919-1972
Contributing Editor 1972-1991

EILEEN DUPUCH CARRON, C.M.G., M.S., B.A., LL.B.
Publisher/Editor 1972-

Published Daily Monday to Saturday

Shirley Street, P.O. Box N-3207, Nassau, Bahamas
Insurance Management Building., P.O. F-485, Freeport, Grand Bahama


Bad effects of marijuana


MARIJUANA was recently featured on an
American television programme. We didn't see
the programme, but it provoked a conversa-
tion, which we did hear.
The gist of the conversation was that as mar-
ijuana is a popular recreational drug preva-
lent at every level of society, not only in the
United States, but also in the Bahamas, and
probably in every country of the world it
should be legalised.
At least, so the argument goes, it would
eliminate the back-street drug traders, and
remove the social stigma and legal consequences
attached to its use. Like alcohol it would
become a legal over-the-counter drug, vouch-
safed for its purity of content and sold at a rea-
sonable price.
This was the same argument used when alco-
hol, a drug that in its abuse can do as much
damage as marijuana, was legalised. The only
difference between the two drugs is that one is
legal, the other illegal.
An educational programme was supposed to
accompany the legalisation of alcohol so that
users would understand that because it was
legal did not mean that it was medically safe.
Having the experience of what happened in
the case of alcohol, and the fight now going on
to get cigarettes from between people's lips
and its smoke from out of their lungs, there is
much understandable resistance to the legali-
sation of marijuana. It is feared that young
people especially will close their ears to the
warnings and seek comfort in the false notion
that legality means safety.
Dr Frederick Lundell, a senior psychiatrist
and director of the Adolescent Clinic at The
Montreal General Hospital, in an article enti-
tled: "Marijuana, the enemy of Youth" has this
to say:
"Working with marijuana users is frustrat-
ing at the very best of times, heartbreaking at
the worst. Even with intensive treatment, nei-
ther I nor any other therapist can pull some of
these youngsters out of a habit encouraged by
their friends and condoned by society..."
Urging that any change in legislation should
reflect "a clear policy of deterrence of mari-
juana use", he believes that "we aren't being fair
if we don't make it overwhelmingly clear to
them (marijuana users) that smoking marijuana
jeopardizes, their mental and physical health".
In another article "Marijuana Alert: Brain
and sex damage" Janice Tyrwhitt writes:
"Marijuana is not harmless. Researchers have
confirmed the observations of practising physi-
cians. Study after study demonstrates the inju-
rious effects of marijuana most alarmingly on
the brain, lungs, reproductive system and cel-
lular metabolism. Today, ironically, as the Cana-
dian government considers more liberal mari-
juana laws, the scientific evidence is too strong
to be ignored."
Both of those articles were published in
Novc.eber 1980. In the succeeding 25 years the
medical evidence on the dangers of marijuana
has continued to grow it is dangerous, not
or. to the addict, but it also takes a heavy toll
c the casual user.


In an article on the Internet by Jim Parker on
the health effects of marijuana, he explains:
"Marijuana isn't a single molecule, like alcohol
or cocaine, but a mix of more that 420 different
chemical components. They're so differeht,'in
fact, that 61 of them are unique to marijua-
na..."
One of them, THC for short, is the "chemical
that triggers marijuana's main drug actions and
effects in the body and brain." It breaks up
into at least 80 different byproducts before it's
eliminated from the body, which can take some
time.
"The process starts as soon as THC enters the
bloodstream, and begins zeroing in on cannabi-
noid receptors in the brain and central nervous
system.
"Once it checks into the brain," writes Park-
er. "THC takes its own sweet time in checking
out. Unlike many other drugs, which are excret-
ed from the body within hours, THC metabo-
lites stick around stored in fatty tissue, most-
ly for 3-5 days, even weeks, in heavy users."
Another report says that the mood change
from smoking marijuana can take a few minutes
and last up to five hours. The drug can stay in
the body for up to six weeks.
"What THC metabolites do, if anything, dur-
ing this time is still mostly unknown. But it's this
buildup of metabolites, and the duration of
their hangtime in the body, that raises the most
concern about possible long-term risks".
And in a report by the National Institute of
Drug Abuse one of their studies indicates that
a "user's risk of heart attack more than quadru-
ples in the first hour after smoking marijuana."
It has also been discovered that smoking
marijuana "increases the likelihood of devel-
oping cancer of the head or neck." It also has
the "potential to promote cancer of the lungs
and other parts of the respiratory tract."' It is
believed that some of marijuana's adverse
health effects "may occur because THC impairs
the immune system's ability to fight off infec-
tious diseases and cancer."
The report also found that "depression, anx-
iety, and personality disturbances have been
associated with marijuana use. Research clear-
ly demonstrates that marijuana has the potential
to cause problems in daily life or make a per-
son's existing problems worse."
Recommended as an inexpensive and
healthy substitute for that mind-destroying mar-
ijuana high is to get up and getting moving go
for a run, a cycle, a swim, anything that will
clear the head, and send the blood coursing
through the veins.
Also stay off junk food and break away
from caffeine and sugar learn to relax.
These are only highlights of many articles
that are within easy reach for anyone who is
interested and knows their way around the
Internet. It is important to do your own inves-
tigation.
Anyone who cannot enjoy a party without
running to the bathroom for a quick fix, should
stop, take a look in the mirror and make a deci-
sion. Are you the master of your destiny, or is it
the marijuana joint?


Respect for





resignation





of Dr Smith


EDITOR, The Tribune
DR Rodney Smith, president
of the College of the Bahamas,
must be congratulated for being
a man of honour and principles.
His decision to resign his post
was indeed a wise one and most
appropriate under the circum-
stances.
This kind of courageous and
unselfish act where the benefits
of society is placed above one's
personal interest or agenda is
extremely rare in the Bahamas.
By his actions, Dr Smith has set
a new standard of behaviour for
the rest of the Bahamas to fol-
low.
In any situation where one
has to make a choice, there are
consequences. Some choices are
just simply mistakes or actions
that were not planned. Other
choices are just bad judgment
where the perpetrator was fully
aware of the consequences but
ignored his responsibility of rea-
sonableness by being reckless.
The third category of bad
choices are the ones that are
the most damaging as they have
a mental element. In other
words, they were planned and
calculated to produce a desired
effect. This category is accom-
panied by a degree of criminal
intent or culpability on the part
of the individual.
Dr Smith admittedly made
the "mistake" of not acknowl-
edging the true source of his
graduation speech earlier this
year at the College of the
Bahamas. Most appropriately,
he immediately apologised for
the omission and indicated that
any oversight on his part was
completely innocent. Ordinari-
ly this response would have
been sufficient and for the
Bahamas, it was far in excess of
what the public could have
expected.
However, as an individual
who is highly involved in the
world of academia at some of
the most prestigious universi-
ties in the United States, cer-
tainly he is aware of intellectu-
al procedures. Consequently,
some felt that because of this,
Dr Smith was most negligent,
as his academic experiences
should have taught him proper
procedures.
To make matters worse was
the selection of the topic of Dr
Smith's speech that centred
around ethics and integrity. This
plagiarism was therefore unfor-
givable. Even though the vast
majority of the students and
staff at COB rallied behind Dr
Smith, the handwriting was on
the wall. The media took an
interest in this issue until it


became within the best interest
of the COB that either Dr
Smith resign or be fired.
By resigning, Dr Smith
assumed full responsibility and
accepted the consequences of
his actions. This is important
because it was a clear message
to the 2,500 students and staff at
COB to always do the right
thing. If any of them unfortu-
nately find themselves in Dr
Smith's position, hopefully they
would remember Dr Smith and
do the right thing by following
his example.
To demonstrate the signifi-
cance of Dr Smith's actions, one
must look at other situations in
the Bahamas where those in
public office and administration
were faced with similar chal-
lenges and how they chose to
resolve the matter. When the
act committed by Dr Smith is
compared to the acts committed
by others, Dr Smith's mistake is
just a ripple in a blue hole.
The problem in the Bahamas
is that there are so few people
credible enough to be good
examples or for people (espe-
cially the young) to look up to.
As a direct result, the social
structure has all but collapsed
and instead of a nation with
ethics and integrity, we are told
that "principles" don't pay bills.
. We are quick to blame the
youth for the problems of the
day without acknowledging the
fact that many of those that we
look up to conduct themselves
in a most disgraceful manner. .
In the 1984 Commission of
Inquiry, corruption and drug
smuggling in the Bahamas was
investigated. Despite over-
whelming evidence against a
number of high ranking
Bahamian officials, administra-
tors, civil servants and even
Cabinet ministers, not a single
one resigned.
Evidence ranged anywhere
from being involved with drug
smugglers, accepting bribes or
somehow compromising the
integrity of their office or pro-
fession. At least one was
believed to be fronting "wit-
tingly or unwittingly" for the
Mafia.
Instead of an outraged
Bahamian public marching on
Parliament demanding nothing
less than the heads of some of
its members on a platter, the
world was shocked to see that
some of those in question were
re-elected. When Prime Minis-
ter Sir Lynden Pindling was
questioned about this, his reply
was that Bahamians have a right
to choose whoever they wish to
represent them (even if that
individual is compromised).
In a supposedly Christian
nation where there is supposed


to be the fear of God, there was.
not a single prosecution.
The 1994 Commission of
Inquiry investigating waste and
mismanagement in certain gov-
ernment corporations once
again was a lesson in despair.
With millions of the taxpayer's
money doing "walkabout" in
outright theft or kickbacks, no
one was again prosecuted or
punished. So much for the story
of ethics and integrity in the
Bahamas. By now, most
Bahamians have concluded that
they are non-existent in the
Bahamas.
With the PLP victory at the
polls in 2002, Prime Minister
Perry Christie vowed to run a
government where ethics and
integrity would dictate the con-
duct and behaviour of members
of his government. He intro-
duced his Codes of Ethics,
which with regrets and respect is
not worth the piece of paper
that it is written on.
Under the Westminster sys-
tem of government, had Prime
Minister Perry Christie imple-
mented the provisions of his
Codes of Ethics, several mem-
bers of his government would
have been by now obligated to
resign forthwith. Just look at
the Sidney Stubbs case. It is my.
opinion that this man should
have been thrown out of the
upstairs window of the House of
Parliament like the Mace after
the Korean boat incident.
Instead, he is congratulated and
given "hi-fives" by his col-
leagues upon his return to Par-
liament without a single objec-
tion by anyone in the PLP.
Conflict of interest, breach of
trust, bad judgment and violat-
ing the laws of the Bahamas are
all reasons to invoke the Code
of Ethics aiid demand a resig-
nation. Apparently, 'not so in
the Bahamas. The bad exam-
ples and those selfish individuals
are the ones rewarded in our
society. Those who stand up for
truth, justice and integrity are
crucified.
I certainly hope that Dr:
Smith's resignation is the cata-
lyst that tries to re-establish
some kind of ethical standards
in the Bahamas.
The words of former Deputy
Prime Minister Arthur Hanna
still haunts the Bahamas when
under controversial circum-
stances he demanded of Prime
Minister Lynden Pindling that
"in the name of common decen-
cy, we should both resign!" Sad-
ly, there was no resignation and
the Bahamas continued to
achieve an even lower level of
indecency.
Now we sit and scratch our
heads wondering what on earth
our beloved Bahamas is com-
ing to!

DR LEATENDORE
PERCENTIE, DDS
Boston, Massachusetts
August 10 2005


Hoping for recognition


Back to School

Complete pair of glasses and

examinationfor $99
Includes eye examination, frames and lenses
or BRING IN
YOUR OWN PRESCRIPTION
and it's $zo/$2o (lenses-$2o & frame-$zo)







IMPERIAL/ TICAL
Co. (Nassau) Ltd
322.2089 :: 326.7142 Rosetta Street
393.5959 Mall-at-Marathon

with the purchase of scratch rsistant lenses
Sale ends September 17' 2005 or while supplies last.
Valid for selected frames and lenses.


EDITOR, The Tribune
I feel that there isn't one per-
son on earth who loves to see
people advance or accomplish
better in life more than me,
therefore, I congratulate all offi-
cers promoted.
As the promotion list of
senior officers for the Royal
Bahamas Police Force has not
been published, I hope that
good officers such as Assistant
Superintendent of Police Sidney
McPhee and Matthew Davis,
also Inspector Clarence Fin-


I o A
Q UAmITY sa
LIMITED
#1 AUTO DEALER IN THE BAHAMAS
EAST SHIRLEY STREET 322-3775 325-3079
V1l owu sEowroom at Quawl Auto SlesOrepo) Ld t lo r d 8o ue. n's HIgway 35- 122


*yson are not bypassed again.
After over 35 years on the
job with good record and hold-
ing many offices of responsibil-
ity, if they are overlooked I may
have to consult NASA to find
out what type of advance for-
mula contact glue they must be
standing on, while others con-
tinue to fly past them.
Looking forward to positive
results.

I MAXWELL STORR JR
Nassau
August 17 2005

lION COURSES I


When you are ready to venture over the horizon make
sure that you are prepared for the challenge. On Monday,
September 5th take the time to attend the free first
class of the TERRESTRIAL NAVIGATION
COURSE offered by The Bahamas School of Marine
Navigation at 7p.m. at BASRA Headquarters on East
Bay Street then consider enrolling in the 3-month
course designed to impart essential theoretical and
practical navigational skills. Other courses available
are Celestial Navigation and Marine Safety/
Seamanship.

Telephone: 364-5987, fax 364-5988
or
e-mail pgk434@netscape.net


G,'AbiE 4. '',..S;L)AY, AUGUST 30, 2005


THE TRIBUNE







I r- i I lID U lI r'-- .., .. .





'Crack rock' reference was




not about drugs, says lawyer


* By FELICITY INGRAHAM
Tribune Staff Reporter


REFERENCES by Keva
Major to "crack rock" referred
to land developments and not to
- drugs, according a court affi-
davit
Police-recorded telephone
conversations with Dwight and
Keva Major were read in court
by attorney Michael Kemp yes-
terday.
"Copyrighted Material Edward Godfrey Minnis,
Syndicated Content alias "Gully", was called a
ailable from Commercial News Providers" "thief" by Keva Major in one
of the intersepted conversations.
According to police, Keva
- Major did not want Gully to
"dump the crack rock" because
he was a thief.
Police interpreted these
- words as being drug-related,
however the affidavit said that
the meaning of the words was
- - misconstrued.
Gully's affidavit states that
he is a heavy equipment opera-
tor worked for the Majors at
their company, Sider Brown
Construction, between July
2002 and January 2003.
The affidavit states, in part:
"During this period we had four
trucks running crack rock from
* Arawak Cay to New Provi-
-- dence concrete on Soldier Road
and also (quarry) fill from Bowe
- investments. I recommended a
man I know as Stephen Miller
as a truck driver to Mrs Keva
Major at the time.
- "Sometimes Mr Miller took
it upon himself to dump loads


of this crack rock to other
places which he sold for monies.
"Mrs Major found out and
cuss me out saying we were
thieves. Mrs Major made me
accompany Stephen back to the
place where he had dumped the
load of rock and I picked the
load up with the pay-loader and
delivered it to New Providence
Concrete."
The affidavit also talked
about a low-lying, seaside lot in
South Beach.
It said the edge of the lot was
so low, that fill and what was
referred to as "crack rock" had
to be dumped into the sea and
built up two feet towards the
road.
The affidavit said this project
would have been discussed over
cellular phones, hand-held
radios and land-lines numerous
times daily between Keva
Major and the contractors.
Said Mr Minnis in the affi-
davit: "I verily believe that these
are the conversations that DEU
would have heard and miscon-
strued them to their liking to
frame Mr and Mrs Major."
Mr Kemp used the affidavit
in his argument that the words
used in the recorded conversa-
tions must be viewed in light of
the circumstances in which they
were used.
Mr Kemp produced the busi-
ness licence for Sider Brown
which describes the company's
activities as "mining and landfill
transportation."
The transportation of sub-


stances referred to as "crack",
"rock" and "fill", he explained,
is practised daily his client's
company, as is the case with any
construction company.
In looking at the telephone
interceptions themselves, Mr
Kemp said the tracking took
place at times contrary to the
time the Commissioner of
Police allowed them to happen.
The authorisation, he said,
covers 14 days between Decem-
ber 2002 and January 2003.
However, the evidence pro-
duced by police about the inter-'
ceptions "deal with events
which took place from January
14, 2002".
He said 3,646 calls were moni-
tored by police in "Operation
Sider Brown", in which PC
Clarke, in a sworn affidavit to the
court, said he monitored. How-
ever, Mr Kemp said he learned
that the calls were monitored by
PCs Major and Thurston.
In conclusion, he called for
the release of his clients based
on several inconsistencies he
pointed out during the trial.
Mr Kemp held up "a myste-
rious CD, that he claimed was
handed to him by an unidenti-
fied man just yesterday morning
as he was entering the court
house.
He said that if the disc is what
he thinks it is, it "goes to show"
what he has said in court about
"disclosure and collusion" hav-
ing taken place in the case.
Justice Isaacs has decided not
to make his judgment just yet.


TUESDAY
AUGUST 30
2:00am Community Page/1540AM,
'10:00 Colombia Trade Show 2005
11:00 Immediate Response
12noon ZNS News Update Live
12:03 Caribbean Today News
Update
12:05 Immediate Response Cont'd
1:00 Ethnic Health America
1:30 Spiritual Impact
2:00 Mr. Ballooney B.
2,:30 Treasure Attic
3:00 Frank Reid III
3:30 Paul S. Morton
4:00 Video Gospel
4:30 Gospel Grooves
4:58 ZNS News Update
5:00 Caribbean Newsline
5:30 Cybernet
6:00 Bahamian Things
6:30 News Night 13
7:00 Bahamas Tonight
8:00 Kerzner Today
A:15 Good News-Bahamas
8:30 Ethics & Excellence
-9:00 Island Hopping: Cat Island
`10:00 Spoken
10:30 News Night 13
11:00 Bahamas Tonight
11:30 Colombia Trade Show 2005
12:30 Community Page 1540 AM
N .1r v
therihttomak fstmiut


Sir Burton's



hopes for



tribunal post


* By RUPERT MISSICK Jr
Chief Reporter
Sir Burton told The Tribune
yesterday that he hopes to
make his country proud when
he is called to serve at the Inter-
national Criminal Tribunal for
the prosecution of serious
crimes committed against
humanity in former Yugoslavia
Expressing his gratitude for
his election as an ad litem
judge, Sir Burton said: "I view it
as a recognition for the
Bahamas over and beyond any
identification of me as an indi-
vidual and I expect to rise to
the occasion and serve when
called to do so and do the
Bahamas proud."
Sir Burton has served previ-
ously at the international level,
so is not intimidated at the
prospect of participating in
what has been called~one of the
biggest war crime tribunals held
since World War II.
"Bahamians in many other
areas have been known to hold


their own in other areas and
are capable of doing so, so I
don't feel overwhelmed," he
said.
Of the 189 members of the
United Nations voting, Sir Bur-
ton received 167 votes, the sixth
highest of all the candidates.
Attorney General Alfred
Sears said that the election of
Sir Burton as an ad litem judge
was a credit to the Bahamas.
"I think it is a significant
recognition of the quality of the
judiciary in our jurisdiction and
it is a personal compliment to
Sir Burton," said Mr Sears.
The tribunal's objectives are
to bring to justice persons
allegedly responsible for seri-
ous violations of international
humanitarian law; to render jus-
tice to the victims; to deter fur-
ther crimes; and to contribute
to the restoration of peace by
promoting reconciliation in the
former Yugoslavia.
However, Sir Burton at this
time does not know what trials
he will be presiding over.


Couple's attorney ends


submissions for their


release from prison


* By'FELICITY INGRAHAM tHbthe y,"'he said.
Tribune Staff Reporter "The position on behalf of
the requesting state holds no
LAWYER Michael Kemp water," said Mr Kemp, and he
concluded his rebuttal state- then cited several cases which
ments before Justice Jon Isaacs he considered to be beneficial to
yesterday, ending his submis- his case.
sions in Dwight and Keva "The Superinendent of Pris-
Major's attempt to secure their ons has no lawful authority
release from prison, whatsoever to detain Keva
Mr Kemp. said that Garvin Major any further pursuant to
Gaskins, attorney for the US this warrant of committal," said
government and the Bahamas Mr Kemp.


superintendent of Prisons, has
admitted that the committal
against Keva Major is in part
defective but he wants the
court to make the correction
rather than throwing out the
case.
"My learned friend has
admitted that the warrant is
partly good and partly bad. We
are not playing a game of poker.
It must be fully good and no


Statute

Mr Kemp also argued that
Mr Gaskins never pointed to a
particular statute with regard
to the fact that the warrant
against Dwight Major stated
that he was in "Broward Coun-
ty and elsewhere" when, in fact,
he was at her Majesty's Prison.


Said' Mr Kemp: "His
(Major's) location makes it vir-
tually impossible for him to be
convicted of (attempt to import
drugs) in this country under
these circumstances."
He said that if Justice Isaacs
did not rule in his favour on the
issue of disclosure, he would be
"backtracking" as he, Justice
Lyons,, and other judges have
ruled in favour of "the duty to
disclose".
Discovery or disclosure with-
out access to the material is
"nonsensical", he added.
He concluded by stating that
the detainment of his clients was
a "joint exercise" where execu-
tives of the Bahamas and the
US were working "hand in
hand". He said the joint exer-
cise is a violation of both the
Majors' constitutional rights and
the Extradition Act.


The Bahamas Telecommunications Company Ltd.

wishes to advise the general public that the deadline

for its 2006 Directory Canvas is Wednesday, August

31, 2005.




Subscribers who have not finalized their directory

contracts are asked to contact BTC's Directory

Publications Department in New Providence at

322-9183-6 in Grand Bahama at 242-352-2336.

Subscribers on the Family Islands may call toll

free at 242-300-1997 or contact their local BTC

office.


Ava


i KEVA Major


Funeral held for Lemuel Sawyer

FUNERAL services for Mr
Lemuel Sawyer, 87, who died
at his home in Spanish Wells
on August 26, were held at the
Gospel Chapel in Spanish
Wells on Sunday, August 28.
Mr Sawyer, who was born
in Spanish Wells on January
.24, 1918, came to Nassau wi4t h
his family when he was two
years old.
SHe attended Queen's Col-
lege and upon leaving school
he went to work in the family
business, EL Sawyer Grocery
on Bay Street. He later opened
Fashionette Ltd, a popular
men's clothing store.
In 1960 he started Sawyer
Marina in Spanish Wells which
he managed until his retire-
ment in 1983. In recent years
he has been in failing health.
He is survived by his wife,
.Jane, three nephews and their
wives, Terry and Kathy Rus-
sell, Don and Joan Russell and
,Tommy.Russell; one niece
Collen and Don Springle; two
brothers-in-law, Keddy and
Dona Pinder and Morgan and
Rosemarie Pinder; his faithful
caregiver of 16 years Fontane
(Johnny) Saint Ilius; three
great-grandnephews and five
great-grandnieces; five great-
great-grandnephews and three
great-great-grandnieces.


4


oo


ia:








PAGE TUSDAYAUGUT 30,2005THE TIBUN


New tourism

appointments

made 'to

focus on the

growing

demands of

industry'

E By ADRIAN GIBSON
TOURISM Minister Obie Wilch-
combe has made key appointments with-
in the ministry in an effort to highlight
the new tourism thrust.
The Tribune was told that the recent
promotions and appointments are an
effort to focus on product improvement,
develop new markets for expansion and
highlight staff training.
These appointments are described as"
bid to capture an increased share of the
lucrative niche markets inclusive of
groups, conventions, weddings, sports,
heritage and culture".
Newly appointed directors are Kayla
Ward, information technology; Carla Stu-
art, cruise development; Paul Strachan,
Canada; Karen Seymour, Europe;
Valerie Brown-Alce, tour and travel;
Janet Johnson, special projects and
events; and Charity Armbrister, Exuma.
Further appointments include senior
director Angela Cleare who has been
given responsibility for Product Devel-
opment and Family Islands, senior direc-
tor Samuel Gardiner, training and devel-
opment and James Malcolm who was
appointed as director of groups travel.
Ms Vernice Walkine's recent promo-
tion to director-general has resulted in
Elliston "Tommy" Thompson's promo-
tion from director Europe, based in Lon-
don, to deputy director-general.
"This restructuring is about the min-
istry becoming more effective and
responsive to the needs of the tourism
industry," said Mr Wilchcome. "We must
be able to explore all opportunities avail-
able to us and flexible enough to take
advantage of changing trends to the ben-
efit of all Bahamians."
"The shift in tourist interests towards
more personalised activities, require that
we incorporate more of the country's
culture and heritage in our tourism prod-
uct. We are much more than sun, sand
and sea," he said.
Former Minister of Tourism Tommy
Turnquest recently questioned the pro-
motions. "Many perso,Qns,.are b.eing
moved around and brought from ZNS
to the ministry. There needs to be more
focus on getting the job done. Why is
there so many positions being created
for a vertical market as tourism?"
"There is no need for all these direc-
tors for each sector of a vertical market,
all we need is someone in charge of a
vertical market, who will assign persons.
They need to focus on the objectives,
such as improving upon dxit surveys that
still aren't meeting the criteria. They
need to get the job done,' he said.
But Mr Wilchcombe said: "These posi-
tions were always in place. This ain't
nothing new and there are adjustments
being made to meet the growing
demands of tourism. For example, right
now our director of information tech-
nology is establishing call centres in the
Bahamas. The former government paid
millions of dollars for call centres in the
US, but what for? That's what Tommy
did, he should answer that."
The appointments became effective
on July 1 2005.


Sigmas fraternity take time



to help out young people



Members of Phi Beta
Sigma Fraternity were
busy this past weekend
as they split their efforts ..!il
working with an incom-
ing Family Island stu- .
dents, as well as those
coming to attend the uni- 4
versity of the West Indies
at the dormitories at
COB. They fraternity
members were helping
the young people move
in to their lodgings, and
move furniture
Other members tray-
elled to Freeport to men-
tor the children of the
Grand Bahama Chil-
dren's Home as members
tried to give back to soci-
ety.





0 MEMBERS of Phi
Beta Sigma Ferternity
out of Nassau visited
the children's home.
President Kareem
Hanna speaks to the
children in the Grand
Bahama children's
home on Saturday.


* BROTHERS of the Delta Epsilon Sigma Chapter and Beta Beta Lamda, the graduate and undergraduate chapters of Phi Beta Sigma Faternity, help
students from the family isalnds move into their COB dorms on Saturday


WASHERS & DRYERS
DEPENDABLE PRODUCTS FOR YOUR HOME!


Stack Washer/Dryer
Gas...................................$2,269
Electric................................. $2,360
Drying Rack................ ...$2,463


15% CASH
DISCOUNT
if you purchase a
Washer & Dryer together


We............i..saMseaanS Ca-5Dsotihrtcd .

TAYLOR1.1 IN1D1USTRIES
^iSHIRLEY iSTRE E:32-91 PE:MN-FI 730a~m -43 m-A :0a m 12 noon


* BROTHER Willy Dean, one
of the founders of the Delta
Epsilon Chapter of Phi Beta
Sigma Faternity, along with
Brother Kahreem Williams
helps students from the Family
Isalnds move into their COB
dorms on Saturday




(Photos: Felipe Major/
Tribune Staff)


Share ye
The Tribune wants to hear
from people who are
making news in their
neighbourhoods. Perhaps
you are raising funds for a
good cause, campaigning
for improvements in the
area or have won an.
award.
If so, call us on 322-1986
and share your story.


our news


#1 Preferred Brand, Consumer 15% CASH
15% CASH
Rated, Top of Line! DISCOUNT
Washer...................................$954 Wosepr&Drogete .
Dryer (Electric).........................$890


W-M9


PAGE 6, TUESDAY, AUGUST 30, 2005


THE TRIBUNE








THE TRIBUNE


TUESDAY, AUGUST 30, 2005, PAGE 7


LOCAL0NEWS


Warning to




businesses to




deposit money


By KARAN MINNIS

DUE to a rise in the number of pri-
vate businesses targeted by robbers, the
Royal Bahamas Police Force has issued
a public warning to all business owners.
Speaking to the press yesterday, liai-
son officer inspector Walter Evans said
that in recent months, police have seen
"a number of businesses reporting that
they have been robbed of large sums of
cash."
"These business establishments need
to have those moneys deposited on a
regular basis instead of having them in
the company for a long period of time,"
Inspector Evans said.

Staggering

He suggested that business owners
adopt a system whereby deposits are
made at staggered intervals during the
day by at least two people.
Inspector Evans added that the
deposits should not be made after dark
or to a location in an isolated area.
In other crime news,, a 36 year-old
Sunshine Park man was shot and


wounded while attempting to repair
his vehicle near Golden Gates Shop-
ping Center at 2am yesterday.-
The man reportedly noticed three
men approaching him and decided to
run.

Shot

He told police that he heard a shot
fired and was struck by a bullet in the
right leg.
The man was transported to hospital,
where his condition is not considered
life-threatening.
Responding to a call around 4.43
am, police went to the Robinson Road
Liquor Store and discovered two men
who had reportedly forced their way
into the building some time earlier.,
Upon seeing the police, the two men
reportedly began throwing missiles at
the officers.
One of the officers drew his weapon
and fired a shot, which reportedly hit
one of the men in the right leg.
The injured man was taken to the hos-
pital by ambulance to receive medical
treatment.


Back to school bonanza


FNM leader Tommy Turnquest
and the FNM Mount Moriah Con-
stituency Association hosted a
Back-to-School Kids' Fest on Sat-
urday on the grounds of the
Bahamas Union of Teachers Hall
on Bethell Avenue.
Hundreds of children and their
parents attended the event and took
part in the activities and received
school supplies.
The children were treated to hot
dogs, snowballs, sodas, and ice
cream; played on a bouncing castle
or danced to music.
Mr Turnquest told the students
to embrace education and to listen
to their teachers.
He also stressed the importance
of children heeding the words of
their parents.
Students received much appreci-
ated school supplies of books, pen-
cils, pens, rulers and sharpeners.


* HUNDREDS of eager children and their parents were in attendance to
receive much appreciated school supplies and to enjoy the many activities
and treats provided for them


wI &W 4 ah d


.Copyrighted Material -".

"- Syndicated Content a- --M-


Available from Commercial News Providers"


-- -
o-. &
qb m d--g


Q ~. ,


m.b dsafmt
. 4b
- -. -.* .


PROSPECTUS
THE GOVERNMENT OF THE COMMONWEALTH OF THE BAHAMAS


BAHAMAS REGISTER 5


ISSUE OF B$75.000000.000.00

Issued under The Bahamas Registered Stock Act, and authorized by Resolutions of the House of
Assembly, 20th June, 2005.

Applications will be received by The Banking Department beginning at 9:30 am on 24th August, 2005 and
will close at 3:00pm on 6th September, 2005. Allocations will commence at 9:30 a.m. on 7th September, 2005.

If the total subscriptions exceed the sum of B$75,000,000.00 (Nominal) partial allotment will be made to
subscribers, and a proportionate refund will be made as soon as possible after allotment. No interest will be
paid on amounts so refunded.


The date of this Pros 5


The Government of The Commonwealth of The Bahamas invites applications for Bahamas Registered
Stock totalling B$75,000,000.00. The Stock will be available in a range of maturity dates; the earliest being
repayable in 2021 and the latest in 2025. The total amount of Stock offered, the rate of interest and the issue
price are given below :-


Rate Of Interest

5/32% Above Prime Rate
3/16% Above Prime Rate
7/32% Above Prime Rate
1/4% Above Prime Rate
9/32% Above Prime Rate


Amount
B$


Bahamas Registered Stock 2021
Bahamas Registered Stock 2022
Bahamas Registered Stock 2023
Bahamas Registered Stock 2024
Bahamas Registered Stock 2025


15,000,000.00
15,000,000.00
15,000,000.00
15,000,000.00
15,000,000.00
.75,000,000.00


Issue
Price
B$
100.00
100.00
100.00
100.00
100.00


The Stock shall be repaid on 7th September, in the year appearing in the name of the Stock.

INTEREST
The Stock will bear interest from 7th September, 2005, at the rate shown against the name of the Stock as
the percent per annum over the Prime Rate (i.e. the prime commercial interest rate from time to time fixed by
the Clearing banks carrying on business in the Island of New Providence in The Bahamas. If there shall be any
difference between them, then that which is fixed by Royal Bank of Canada). Interest shall be payable half-
yearly commencing on 7th March, 2006 and thereafter on 7th September and 7th March in every year until the
Stock is repaid.

CHARGE UPON CONSOLIDATED FUND

The principal monies and interest represented by the Stock are charged upon and payable out of the
Consolidated Fund and assets of The Commonwealth of The Bahamas.

SUPPLEMENTARY PROVISIONS
Issue of Stock The Stock will be issued by the Registrar (The Central Bank of The Bahamas).
Applications will be received by The Banking Department beginning at 9:30 am on 24th
August, 2005 and will close at 3:00 pm on 6th September, 2005, allocations will
commence at 9:30 a.m. on 7th September, 2005. All envelopes enclosing applications
should be labelled "Application For Bahamas Government Registered Stocks".

Units The Stock will be in units of BS100.00.

Applications Applications must be for BS100.00 or a multiple of that sum.

Application Forms Applications for the Stock should be made to the Registrar on the form attached to the
Prospectus and may be obtained from the Registrar offices in Nassau and Freeport, The
Treasury Department (Marlborough Street & Navy Lion Road, Nassau) or any of the
following banks:

1. .Bank of The Bahamas International
2. First Caribbean International Bank (Bahamas) Limited
3. Finance Corporation of Bahamas Limited
4. Commonwealth Bank Limited
5. Royal Bank Of Canada
6. Scotiabank (Bahamas) Limited
7. Fidelity Bank (Bahamas) Limited (formally BritishAmerican Bank(1993)
Limited)
8. Citibank, N.A.

PUBLIC DEBT
Provisional estimates from the unauditedi accounts as at June 30, 2005 show the Public Debt of The
Bahamas to be B$2,627,218,000.*

GOVERNMENT REVENUE AND EXPENDITURE
The following information is extracted from the unaudited accounts of the Government of The
Commonwealth of The Bahamas.


FY2003/2004* FY2004/2005**
BS BS$


Revenue


943,760,000


Recurrent Expenditure (excluding
Repayment of Public Debt)

Capital Development
Expenditure (excluding loans
contributions and advances
to public corporations)


993,987,000



80,890,000


1,051,624,000

1,067,259,000



117,296,000


FY2005/2006**
B$
Approved Budget

1,132,774,000

1,145,691,000



132,901,000


** Provisional estimates from the unaudited accounts.

The Public Debt amount is inclusive of The Public Corporations contingent liability which as at June
30,2005 totalled B$454,138,000.


THE GOVERNMENT OF THE COMMONWEALTH OF THE BAHAMAS
BAHAMAS REGISTERED STOCK 2021- 2025


FOR OFFICIAL USE ONLY.
APPLICATION No
ALLOTMENT No.

DATE:


The Registrar
c/o The Central Bank of The Bahamas
P. O. Box N-4868
Nassau, Bahamas

Sir:


I/We hereby apply for the following amount of Bahamas Registered Stock:

.....;'el6WIh'In~fitapplied for
in UnitsofBS 100


5/32%
3/16%
7/32%
1/4%
9/32%


Above Prime Rate
Above Prime Rate
Above Prime Rate
Above Prime Rate
Above Prime Rate


Bahamas Registered Stock 2021
Bahamas Registered Stock 2022
Bahamas Registered Stock 2023
Bahamas Registered Stock 2024
Bahamas Registered Stock 2025


and undertake to accept any less amount which may be allotted to me/us.


I/We enclose B$


in payment for the Stock applied for.


In the event of the full amount of Stock(s) applied for above is/are not allotted to
me/us, I/we request that the sum refundable to me/us be applied for the following Stock:


% Bahamas Registered Stock
% Bahamas Registered Stock
% Bahamas Registered Stock
% Bahamas Registered Stock
% Bahamas Registered Stock
% Bahamas Registered Stock


B$
BS
BS
B$
B$
B$


BANK DRAFTS SHOULD BE MADE PAYABLE TO THE CENTRAL BANK OF THE BAHAMAS.


Ordinary Signature

Name in Full (BLOCK LETTERS, state whether Mr., Mrs., or Miss and titles if any.)


Address (Corporations etc. should give Regitered Addresses, Telephone Nos.)







(Where two or more persons apply as joint subscribers, the additional names and addresses should be given
below.)

Ordinary Signature
Name in Full

Address

Telephone No.

Ordinary Signature

Name in Full

Address

Telephone No.

I/We hereby request semi annual interest to be paid to:

Bank Name

Bank Branch


Account Type.


Account Number


; ;


L~II~


I r


SIrrll












Brazilian peacekeepers turn



to a natural resource: soccer


* an -


"0- 4b


Corihted Mateial


Synd i cated C o n ten


Available from Commercial News Providers" .


a --
a
.~ a


-
a -


* -m .od -- o --
0a o MI- 0 4 oa l


4b 40 --


a *-m
- b -,= -- -


___

- -.~ a

a -


Share

your
news
The Tribune wants to hear
from people who are
making news in their
neighborhoods. Call us
on 322-1986 and share
your story.


citigroupt

CITIBANK, N.A. BAHAMAS BRANCH
CORPORATE & INVESTMENT BANK
Citigroup (NYSE: C), the preeminent global financial services company has some
200 million customer accounts and does business in more than 100 countries,
providing consumers, corporations, governments and institutions with a broad
range of financial products and services, including consumer banking and credit,
corporate and investment banking, insurance, securities brokerage, and asset
management. Major brand names under Citigroup's trademark red umbrella
include Citibank, CitiFinancial, Diner's Club, Primerica, Smith Barney and
Banamex.
We are currently accepting resumes for the following position:

SENIOR RELATIONSHIP MANAGER
Duties
* Aggressively market the Bank's products and services to businesses in
the Northern Caribbean Region that meet our target market criteria;
* Achieve established revenue targets by developing and maintaining
strong customer relationships through the delivery of the highest level
of customer service;
* Work with Product Specialists to identify opportunities and to deliver
innovative structures and solutions to clients while ensuring compliance
with the control'environment;
* Analyze, evaluate and assess financial statements; and
* Conduct due diligence on new clients and monitor clients' accounts to
ensure that activity is in line with established parameters.
Knowledge/Skill Requirements
* Strong knowledge and experience in Capital Markets & Corporate Finance
(need to demonstrate management and execution of these type of
transactions);
* Strong marketing/sales and technical financial skills;
* High energy, motivated individual, ability to think outside the box and
to adapt in a dynamic work environment;
* Strong analytical skills, good knowledge of accounting, finance and
financial instruments;
* Bachelors degree in Accounting, Finance, Business or Economics (certain
types of Engineering may be consider). MBA and / or CFA;
* Excellent communication skills and ability to work across units within
the Bank to ensure customer satisfaction;
* Previous experience as a Credit Analyst and/or Risk Manager and/or
Relationship Manager and/or Transactor; and
* Travel required.
Starting salary will be commensurate with experience. Interested applicants may
deliver, fax or e-mail resumes to:
Business Head
Citigroup Corporate and Investment Bank
110 Thompson Boulevard
Nassau, The Bahamas
Fax: (242) 302-8569
E-mail: tadesee.anja.mckenzie@citigroup.com
Resumes should be received by September 12th, 2005


PAGE 8, TUESDAY, AUGUST 30, 2005


I H- I HitUNE,


m







THE TRIBUNE I ~ ~, 2'3~~~~h':' ~ A 3 -


LARRY


SMITH


T E L S


AN ABACONIAN STORY


Media event has worldwide appeal


SANTO DOMINGO The
success of a novel gathering of
journalists, tourism industry
principals and government offi-
cials in the Caribbean has made
it a sought after model for oth-
er regions of the world.
The Caribbean Media
Exchange (CMEx) on sustain-
able tourism put together by
Counterpart International and a
host of partners and supporters
this month hosted its first effort
outside of the English- speaking
Caribbean.
Speaking in the Dominican
Republic shortly after the. first
experiment with CMEx in the
Spanish-speaking Caribbean,
Counterpart president Lelei
LeLaulu said the media initia-
tive has become so successful
that other regions are now
requesting it.
"Having encountered our
first CMEx outside of the Eng-
lish-speaking Caribbean we are
now responding to calls for the
CMEx type exercise to look at
sustainable tourism develop-
ment issues in Central Asia, the
Andes in South America and
in the South Pacific," he said.
CMEx, now into its fourth
year, assembles Caribbean and
international media and indus-
try stakeholders to share their
concerns on tourism develop-
ment and sustainable issues.
The Counterpart president
said that regional tourism bod-
ies and corporate sponsors who
Shave supported the exchanges


* DEIRDRE Shurland, director of the Caribbean Alliance for
Sustainable Tourism (CAST), talks about tourism sustainability


over the past three years were
delighted with the quality of
tourism issues now being cov-
ered by the regional media.
"The corporate entities are
the ones who keep a watch to
see if they are getting their
money's worth from sponsor-
ing the Caribbean Media
Exchange and we are really
very pleased with the feedback
we are receiving. We still have a
long way to go but so far so


good," he said.
LeLaulu said while the
response from the private sector
was encouraging there is obvi-
ously room for greater support
as the commercial community
has a key role to play, and a lot
to gain, in the success of sus-
tainable tourism.
"They need to recognise that
sustainable tourism involves
environmental conservation,
which deals with poor and


M CARIBBEAN correspondent Ernie Seon of St Lucia (front
left) listens carefully to the interpreter


needy communities, their health
and culture, and it is in their
interest to become a major
engine of change in these com-
munities," he added.
"They have to see the value
of actually improving a desti-
nation in terms of its health, its
culture and its environment,"
LeLaulu stressed.
Explaining the rationale
behind CMEx and its useful-
ness in the promotion of sus-


tainable development issues, the
Counterpart leader said "while
tourism ministers come and go,
journalists on the tourism beat,
some of whom have served a
range of print and electronic
media, do represent a reposito-
ry of wealth and experience.
"Their expertise has not been
utilised because no one has
asked them, so CMEx has
brought some of these individ-
uals together to bring the


indigenous knowledge in the
open, so that decision and poli-
cy makers can make an educat-
ed stab at doing the right thing
as far as sustainable tourism is
concerned and it is working
very well," he explained.
Set up in 1965, Counterpart is
a non-profit humanitarian and
development organisation that
operates projects directly or
with partners in more than 60
countries.
Counterpart International
was one of the main engines
behind this month's first Inter-
national Conference on Envi-
ronmental and Sustainable
Development, at which its
CMEx model took centre stage.
Delegates from across the
Caribbean, Central and South
America, the Pacific, the United
States and Europe explored the
theme "Environment: Our Part-
ner in Development" during the
three-day parley staged by the
International Center for Envi-
ronmental and Sustainable
Development Studies
(CIEMADeS) in collaboration
with Counterpart Internation-
al, CMEx and the National
Geographic Society,
The talks were also co-ordi-
nated by the Global Founda-
tion for Democracy and Devel-
opment (FUNGLODE), which
was set up by the nation's pres-
ident Dr Leonel Fernandez,
Universidad del Turabo in
Puerto Rico and the Universit6
Quisqueya from Haiti.


Tel: 356-6424/5 Fax: 356-6426 Dr. Anita Brown Dean
Base Rd. Business Centre P. 0. Box N-1594 OPTOMETRIST
Website: www.mjboptical.com* Email: adean@mjboptical.com Board Certified Optometrist


2005 FORD ESCAPE




























Starting at $30,360.00



An Additonal $500 In Customer Cash

License And Inspection To Birthday, Floor Mats, Full Tank Of Gas,
3 Year Road Side Assistance, First 5 Services To 12,000 Miles Free

3 Year or 36,000 Mile Warranty

See The Full Line Of All Your Favourite Fords At



FRIENDLY MOTORS LTD

THOMPSON BOULEVARD TEL.: 356-7100 FAX: 328-6094
EMAIL: friendlymotors@hotmail.com WEBSITE: friendlymotorsbahamas.com


THE TRIBUNE








PAGE 10, TUESDAY, AUGUST 30, 2005

TUESDAY EVENING AUGUST 30, 2005

7:30 8:00 8:30 9:00 9:30 10:00 10:30
aTinv]--! ro hac- ag s, Inc
Great Museums Nova"Origins: How Life Began" David Attenborough Package Wide Angle "Pickles, Inc." Eight
B WPBT n (CC) Primitive organisms. T (CC) (DVS) Crocodile is the only reptile to have widows in the Arab-Israeli village of
survived since the dinosaur. Tamra in Galilee. (N) n (CC)
The Insider (N) NCIS"Hometown Hero" Gibbs Big Brother 6 (N) n (CC) Rock Star: INXS (N) n (CC)
B WFOR n (CC) works to clear the name of a fallen
soldier accused of murder.
Access Holly- Most Outra- Most Outra- Tommy Lee The Office "The Law & Order: Special Victims Unit
SW1TVJ wood (N) (CC) geous TV Mo- geous TV Mo- Goes to College Alliance" (CC) identity (CC)
ments (N) (CC) ments / (CC) (N) (CC)
Deco Drive House"Love Hurts" House and House Three Stories" A woman News (CC)
B WSVN Cameron explore their relationship. from Dr. House's past returns, look-
FA (PA) (CC) ing for his help. F (CC)
Jeopardy! (CC) According to Rodney "Rod- Accordin to Rodney Rodney Boston Legal Schmidt and Crane
S WPLG Jim Beltzman's nes Affair" Jim "The Bache- dreams about a represent a man whose steakhouse
funeral. n(CC) (C) lorette Party" saleswoman. n could go out of business.

American Jus- Cold Case Files DNAtechnology Dog the Bounty Dog the Bounty Inked "Change Inked "Pull It To-
A&E tice: Perfect solves two stabbing cases. (CC) Hunter (N) (CC) Hunter Dog Hart" (CC) ether, Dizzle"
Murder chases "Cats." (CC)
Hardtalk BBC News World Business BBC News Earth Report BBC News Asia Today
BBCI (Latenight). Report (Latenight). (Latenight).
BET BET Style x LITTLE RICHARD (2000, Biography) Leon, Garrett Morris, Carl All Shades of Fine: The 25 Hottest
Lumbly. Based on the life story of the rock 'n' roll music icon. Men of the Past 25 Years
CCB Coronation CBC WinnipegComedy Festival Da Vinci's Inquest "A Delicate The National Crime and Pun-
CB Street (CC) "CBCGala" (CC) Bloodbath" (CC) (CC) ishment
CNLate Night With The Apprentice "Motel 666" The teams fix up and run Mad Money The Big Idea With Donny Deutsch
CNBC Conan O'Brien their own motels on the Jersey shore. (CC)_
CNN :00)Anderson Paula Zahn Now (CC) Larry King Live (CC) NewsNight With Aaron Brown
CNN Cooper 360 (CC)
Comedy Central The Daily Show Comedy Central Reno 911! Secu- South Park Reno911! Drug Stella The guys
COM Presents (CC) With Jon Stew- Presents "Stella" rity guards. (CC) "Rainforest sting. (N) (CC) seek therapy for
art John Irving. (CC) Schmainforest" depression. (N)
T Cops "Coast to Cops F (CC) Cops "Mardi Cops t (CC) Cops t (CC) Masterminds (N) Masterminds
COURT Coast" (CC) Gras2003" F
That's So Raven ** ANGELS IN THE OUTFIELD (1994, Fantasy) Danny Glover, Tony Buzz on Maggie Sister, Sister Tia
DISN "Opportunity Danza, Brenda Fricker, Premiere. Spirits provide major-league hope to a (CC) rethinks going to
Shocks" lonely foster child.'PG' (CC) college.
DIY This Old House Weekend Gar- Fresh From the Garden Sense Weekend Land- Grounds for Im- Grounds for Im-
t (CC) dening Garden (N) (N) scaping (N) provement provement
D Euromaxx Journal: In In Focus Journal: Politik direkt Journal: In Euromaxx
SDepth Tagestema Depth
E! Gastineau Girls Paula Abdul: The E! True Hollywood Story Corey Clarke. n1 (CC) The Girls Next The Girls Next
-Door Door
SPN 2005 World Se- 2005 World Series of Poker From 2005 World Series of Poker From 2005 World Series of Poker From
ESP ries of Poker Las Vegas. (CC) Las Vegas. (Taped) (CC) Las Vegas. (Taped) (CC)
ESPNI (:00) US. Open Tennis Early Round -- Day 2. From the USTA National Tennis Center in Flushing Meadows, N.Y. (Live)
EWTN Daily Mass: Our Mother Angelica Live Classic Religious Cata- The Holy Rosary Threshold of Hope
EVWT N Lady, Episodes logue
IT :00 Lo Max: Ultimate Goals "Family Marathon" No Opportunity Wasted "Execu- The Extremists The Extremists
FIT TV athe Friedrich F (CC) tive" n(CC)n t (CC) A (CC)
FOX NC Fox Report- The O'Reilly Factor (Live) (CC) Hannity & Colmes (Live) (CC) On the Record With Greta Van
-N Shepard Smith __Susteren (Live) (CC)
FSN L (:00)'MLB Baseball St. Louis Cardinals at Florida Marlins. From Dolphins Stadium in Miami. Best Damn Sports Show Period
FSN L (Subject to Blackout) (Live) (Live) (CC)
GOLF Peter Jacobsen Big Break II Inside the PGA Leaderboard Re-
GOL Plugged In Tour port
GSN Lingo (CC) Who Wants to Be a Millionaire n The Amazing Race n (CC) Extreme Dodgeball 3 (CC)
G4Te h (:00) Attack of X-Play Total Cheat "Jade Em- Icons Bungle Filter Cheat NES Cheat "Viewers
4 e the Show! (N) Overdose." pire"Software. games. (N) Request"
:00) Walker, Walker, Texas Ranger The .** PRINCE CHARMING (2001, Fantasy) Martin Short, Christina Apple-
HALL' Texas Ranger Rangers must block the distribution gate, Bernadette Peters. Premiere. A frog prince returns to human form in
F (CC) of deadly heroin. n (CC) modern-day New York. (CC)
(:00) The Block Design Rivals Design Inc. Love It or Lose My Parents' Debbie Travis' Facelift "Bob's Back
HGTV (CC) "Mom's "Dans Living It Living room. House "The Deck" F (CC)
Makeover" F Room" F (CC) (CC) Williamsons" n
INSP Morris Cerullo Breakthrough Christ in This s Your Day Life Today (CC) Inspiration To- Missions
(CC) Prophecy (CC) day
Xiaolin Show- Sabrina, the The Fresh Friends Ross Will & Grace Everybody Everybody
KTLA down "Citadel of Teenage Witch Prince of Bel-Air wants Rachel as Grace considers Loves Raymond Loves Raymond
Doom" (CC) (CC) (CC) a neighbor. a threesome. "The Wedding" Marie sculpts.
WHEN THE CRADLE FALLS (1997, Drama) Linda ** X FALLING DOWN (1993, Drama) Michael Douglas, Robert Duvall,
LIFE Gray, Cathy Lee Crosby, Martha Byrne. Frantic parents Barbara Hershey. Premiere. A laid-off defense worker is pushed to the
search for their missing baby. (CC) breaking point. (CC)
MS BC 0 Hardball Countdown With Keith Olber- Rita Cosby Live & Direct Scarborough Country
MSNBC j __ mann
Jimmy Neutron: SpongeBob Zoey101 Fresh Prince of Hi-Jinks "Mered- Fresh Prince of The Cosby
NICK Boy Genius SquarePants "School Dance" Bel-Air ith Vieira" (N) Bel-Air Show (CC)
NTV MARY HIGGINS CLARK'S LUCKY DAY (2002) Aman- Big Brother 6 (N) F (CC) News C (CC) News
T da Donohoe, Tony Lo Bianco.
OLN Survivor-Aust. Fearless Outdoor Investi- All-Star BBQ Survivor: The Australian Outback
LN Outback gations Showdown "Honeymoon or Not?" n (CC)
SPEED WheelTues- AmericanThun- Texas Hardtails Build or Bust NASCAR Nation 2 Wheel Tues-
SPEED day(N) der (N) day
Unfolding Behind the Enjoying Every- John Hagee To- Bill Gaither (CC) Praise the Lord (CC)
TBN Majesty Scenes (CC) day Life With day (CC)
Joyce Meyer
Everybody Friends The Friends Joey Sex and the City Sex and theCity Seinfeld Jerry Seinfeld Jerry
TBS Loves Raymond One With the and Phoebe sell "Calendar Com- Sex and politics, lacks reservation must intercept
SF(CC) Football" (CC) Christmas trees. petition." n (CC) for dinner, phone message.
(:00) In a Fix Rides "Roush Racing" The unveiling Overhaulin' "52 Pickup" Fixing up a Miami Ink
TLC Timeless Decor" of GM's HHR. 1952 GMC pickup. (CC)
(CC)
(:00) Law & Or- Law & Order A murder case hinges Law & Order "Gaijin" A husband be- Law & Order "Marathon" A frustrat-
TNT der "Sundown" on a girl who refuses to speak out comes a suspect in his wife's mur- ing investigation leads to tension be-
n (CC) (DVS) against her attacker. der. F (CC) (DVS) tween Briscoe and Green.
TOON Home for Imagi- Home for Imagi- Home for Imagi- Mucha Lucha Yu-Gi-Oh! (CC) One Piece F Dragon Ball Z
nary Friends nary Friends nary Friends At (CC) (CC)
TV5 (:00) ONPP vu du bocal (:45) Histoires Fiesta des Suds 2003 (Partie 1 de Gros Plan TV5 Le Journal
S_ de chateaux 2)
S6:00) Weather: Storm Stories Storm Stories Weather: Evening Edition (CC)
T M Edition (CC) (CC) Sea storm. (CC)
00) Inocente de Apuesta por un Amor La Madrastra Casos de la Vida Real: Edici6n
UNIV Ti Especial Dos claveles; Coinciden-
cia.
USA :0 U.S, Open Tennis Men's & Women's First Round. From the USTA National Tenriis Center in Flushing Meadows, N.Y. (Live)
USA

VH1 100 Greatest Kid 100 Greatest Kid Stars "Hour 5" Kid Star Parents Exposed (N) F Celebrity Fit Club Ft
Home Improve- MLB Baseball Los Angeles Dodgers at Chicago Cubs. From Wrigley Field in Chicago. (Live) F (CC)
WGN ment Jillistrou-
bled. F (CC)
Everybody Gilmore Girls Rory is shocked by Gilmore Girls Rory studies up on WB11 News at Ten With Kaity
WPIX Loves Raymond Logan's parents' reaction to their re- Logan's father before beginning Tong, Jim Watkins, Sal Marchiano
Marie sculpts. lationship. F (CC) work for him as an intern. (CC) & Mr. G (CC)
WSB Jeopardy! (CC) Girlfriends Eve Shelly and R U the Girl With T-Boz & Chilli Dr. Phil
WSB K Lynn's brother Rita become ri- The contestants choreograph origi-
comes town. vals. F (CC) nal dance routines. (CC)

(6:30)* THE The Sopranos "Two Tonys" Rome "The Stolen Eagle" Two sol- Real Time War protester Cindy
HBO-E GRUDGE(2004) Parolees change the Soprano-Lu- diers are enlisted to find the stolen Sheehan. F (CC)
A 'PG-13' (CC) pertazzi alliance. F (CC) gold standard. n (CC)


(6:00) Entourage Vince Entourage "Exo- Curb Your En- Curb Your En- ** WONDERLAND(2003) Val
HBO-P CITYBY THE acts out of char- dus" Vince is thusiasmBaby thusiasm Video Kilmer. Porn star John Holmes is im-
SEA (2002) 'R' acter. n blinded by love. shower gift. purchase. (CC) plicated in four murders. Ft 'R'
(:45) ** i EIGHT LEGGED FREAKS (2002, Science Fiction) David Ar- ** THE GRUDGE (2004, Horror) Sarah Michelle
HBO-W quette, Kari Wuhrer, Scott Terra. Giant spiders prey on small-town Arizona Gellar, Jason Behr. A woman and her boyfriend en-
citizens. F 'PG-13'(CC) counter vengeful spirits. n 'PG-13' (CC)
(:15) *** LOST IN AMERICA (1985, Comedy) Al- * THE TERMINAL (2004, Comedy-Drama) Tom Hanks, Catherine
HBO-S bert Brooks, Julie Hagerty. A yuppie couple take a Zeta-Jones, Stanley Tucci. A European living in an airport befriends a
cross-country trip in a motor home. 'R' (CC) stewardess. F 'P -13' (CC)
(6:00)** *iX WIN A DATE WITH TAD HAMILTON! (2004) (:35) MAX on SHREK 2 (2004, Adventure)
MAX-E BOOMERANG Kate Bosworth. A woman's friend and an actor vie for Set: Shrek 2 Voices of Mike Myers, Eddie Mur-
(1992) 'R' (CC) her affection. F 'PG-13' (CC) "Shrek 2." (CC) phy. 'PG' (CC)
M:15) *** NAPOLEON DYNAMITE (2004, Comedy) *** THE RUNDOWN (2003, Adventure) The Rock, (:45) BIKINI A-
MOMAX Jon Heder, Jon Gries. A awky teen helps a friend run Seann William Scott. A bounty hunter must find his GO-GO (2003)
for class president. n 'PG'(CC) boss's son in the Amazon. n 'PG-13' (CC) Beverly Lynne.
(6:00) ** THE Dead Like Me "Haunted" (iTV) Ase- Dave Chappelle: For What It's Barbershop Barbershop
SHOW PRINCE & ME rial killer.stalks the city. (h (CC) Worth (iTV) ( (CC) (iTV) (CC) (iTV) (CC)
(2004) 'PG' (CC)
(5:45) THE FAL- TIMELINE (2003, Fantasy) Paul Walker, Frances O'Connor, Gerard BOAT TRIP (2003, Comedy)
TMC CON AND THE Butler. Adventurers travel back to 1300s wartime France. n 'PG-13' CubaGooding Jr., Horatio Sanz,
SNOWMAN'R' (CC) Roselyn Sanchez. n 'R' (CC)


THE TRIBUNE
-I


Certified Member WO D
(ertfie Mebcr46,Aliadeira Street


Time:
Doors open 11;


Admissi(
$7 w/ Movie Tic
$1,5 without
Movie Pass GivI


Ekxe I1otce
LO U N S


Second Floor of The TUlon




on:
;kets


Oeaways


~













Ousted COB president claims




he was 'ordered to resign'


FROM page one
a lecturer.
At the meeting, Dr Smith
told staff that because he knew
that they were confused after
hearing of his resignation in the
media, he wanted to set the
record straight and explain what
really occurred.
Dr Smith told faculty that
after his confession, he was
summoned for meetings at the
home of Mr Wilson, during
which only two council mem-
bers were present Earl Cash
and Patricia Glinton-Meicholas.
Dr Smith said he received a
call from Mr Wilson after the
plagiarism charge was made and
was told that a council meeting
was being called to decide his
fate.
He said he had contacted his
friend, Dr Sexton, by e-mail
who told him that his speech
was public knowledge available
on the Internet and therefore
established that no plagiarism
was committed with the content
that was taken.
Dr Smith said that after a
copy of the e-mail, made avail-
able to the council was exani-
ined, a five-member advisory
panel composed of Anglican
Archbishop Drexel Gomez;
Bahamas ambassador to the
United Nations Paulette Bethel;
vice-chancellor emeritus of the
University of the West Indies,


Professor Rex Nettleford; pres-
ident-elect of John Carroll Uni-
versity in Cleveland, Ohio,
Father Robert Niehoff; and
retired justice Joseph Strachan,
who chaired the panel, was
established to review the issue.
However, before the panel's
report could be released Dr
Smith suddenly took sick and
had to receive medical atten-
tion abroad.

Meeting
According to Dr Smith, upon
returning to Nassau on July 30,
after receiving medical atten-
tion, Mr Wilson called him to
a meeting at his home.
"I received a phone call from
the Chairman the morning of
the 31 July at 7.30 a.m. and was
asked to meet with him at his
residence at 6.30 p.m. that
evening, When I arrived, I was
surprised that two additional
Council members were present:
Mr. Simon Wilson of the Min-
istry of Finance and Dr. Earl
Cash, attorney with Higgs and
Johnson," said Dr Smith.
"I was informed that the
Council met and took a vote
that I should submit my resig-
nation effective immediately,"
he said, "When I asked what
would happen if I did not, I was
told that the council would
begin procedure for termina-


tion. I was informed that the
panel which also included a
retired magistrate was con-
vinced that the Council had
grounds for termination for
cause."
Dr Smith said he was also
told by Dr Earl Cash that even
if he "decided to fight this out in
court it would cost in excess of
one hundred thousand dollars.
The Chairman added that there
would be significant damage to
my career not to mention all
the negative damage on the
College. I asked if the council
met in my absence while I was
ill. I was told yes. I asked if
there was a majority two-thirds
vote for my termination and I
was told yes."
Dr Smith was reportedly told
by the chairman that since they
were convinced that he could
be terminated for cause that
they would only give him
$120,000 plus a one year con-
sultancy contract at the amount
he would have received while
he was on his one year sabbati-
cal #rom Ramapo College, an
amount of $156,000.
Upon his resignation Dr
Smith was promised an imme-
diate payment of $140,000, an
offer to serve as a consultant to
the college for one year at
$156,000 per annum; with an
option to renew for an addi-
tional three months if dther
employment has not material-


ized within a year, stay in the
house and have use of the vehi-
cle for 12 weeks after resigna-
tion, the payment of the premi-
um on one year of a Life Insur-
ance policy at $5,600, and a let-
ter from the council indicating
that the matter has been com-
pletely resolved.
However, after the Chairman
had reportedly discussed the
agreement with Prime Minster
Perry Christie, who "expressed
disappointment regarding the
decision of the Council" the
agreement was changed.
Dr Smith said that the PM
"had instructed the Chairman
to pay him the $140,000 plus the
$156,000 up front and
not engage in a consultancy
agreement," which Dr Smith
agreed.
Recently, there have been
calls for the release of the pan-
el's findings regarding Dr Smith.
Dr Smith said he himself had.
not seen a copy of the panel's
report that sealed his fate and is
said to have questioned how the
council could call a panel to
investigate him when he did not
know theirnfindings.
He also questioned how a
decision on his fate as president
of COB could be made Without
the presence of the full coun-
cil, as 90 per cent of all meetings
'were with Mr Wilson and the
two named council members.
The former president report-


edly told staff that on a recent
trip to the US, it was difficult
to do things because he is now
unemployed. He reportedly said
that he had discussed this with
Mr Wilson, telling him that he
could not just simply return to
the US, as he would have to
uproot, and it would damage
his family.
Dr Smith told his audience
that Mr Wilson had approached
him in 2004, saying that he had
searched everywhere but could
not find any qualified Bahami-
ans to lead the college to uni-
versity status.

Allowances
He said that although he was
earning about $400,000, inclu-
sive of allowances, he agreed to
return to his home country at
$200,000 per year.
The sources said he told staff
members that when he was told
he could not directly earn
$200,000, but instead $120,000
plus allowances, he left a bet-
ter paying job to return to the
Bahamas because he wanted to
contribute to his country. When
Mr Wilson asked him to uproot
his family to head COB he
came, but questioned why they
could not have at least offered
him a year to arraAge for his
return to the US.
Dr Smith reportedly told staff


that he is still committed to
serving the college in any capac-
ity, whether as president or a
consultant, as he wants to
make a contribution to the peo-
ple.
A college source told The
Tribune: "This college is in a
state of unrest because of this
situation. I suggest the PM meet
with our union representatives
immediately or the college will
face a massive demonstration
calling for the resignation of Mr
Wilson and the entire council."
Perturbed by television cam-
eras outside the auditorium,
vice-president of academic
affairs Dr Linda Davis urged
staff: "Keep them out, block the
view, don't let them see in
here."
As a result, all media person-
al were escorted by the assis-
tant director of security,
Alexander Darville, to the
Council office, where they were
told they would receive clear-
ance to enter the meeting, how-
ever this clearance was never
received.
According to Dr Smith ques-
tions still remain in his mind as
to why the Chairman and his
colleagues were so determined
to move in haste and not engage
the College community, and
since there was no violation of
intellectual property rights why
was the Council so determined
to get rid of him.


CC SweetingJunior school




teachers stage sit-out


ri~l


FROM page one
As of press time he had not returned calls to
The Tribune to comment on the claims,
Yesterday teachers staged a sit-out at CC
Sweeting Junior school on Gregory Street
to alert the public about the problems at
their school, which is still under repair.
CC Sweeting Junior accommodates
almost 1,000 students and more than 65
teachers.
According to Michelle Hudson, the
group's spokesperson, the contractor told
the teachers that he had not been paid
enough by the ministry to complete his
work. He said that the initial deposit had
already been exhausted,
Therefore, she said, the contractor had to
stop work in July after already using some
of his personal money to complete a portion


of the project.
"From September of last year we were
promised that the classrooms would be
ready. Here it is September again and they
are not finished. We at this point are deter-
mined to sit-out until they get the school
functioning properly,
"The contractor has told me that he has-
p't been given enough money to finish the
school. He has had to let workers go as he
couldn't pay them, and apparently he could
finish the place in two weeks if he had the
money.
"This is phase one, so I guess phase two
has been totally scrapped," she said,
"because that includes redoing the principal,
vice principal,,and the senior mistress'
office, along with the staff bathrooms."
While visiting the school yesterday, Mrs
Hudson pointed out that the main building


facing the public road had not had its win-
dows at the back installed as yet, and that
many of the classrooms were not tiled as
yet.
The contractor, only described as "Mr,
Petty", was not at the school to be inter-
viewed.
"This is not a matter of the contractor
being able to do the work, this is a matter of
the funds," Mrs Hudson added.
"So I doubt very muchtr that the school
will start on Monday as planned. All I can
say is for the parents to watch the news to
see what will happen," she said.
Today the teachers will meet at 9am at
the school with representatives from the
Bahamas Union of Teachers to discuss what
further action will be taken, as they could
not mneet with Minister Sears yesterday.


Ministry officials fear even higher fuel prices


FROM page one

expect even higher prices than
originally projected at the
pumps, possibly exceeding $5,
Last week Mr Miller project-
ed that Bahamians could expect
to pay.anywhere from $4,24 to
$4.40 a gallon when the next
shipment of oil arrives in the
Bahamas.
"They (Shell, Esso, and Tex-
aco) are now going to use Gulf
Coast prices, so I expect them
to say that due to the closure
of the oil rigs they will have to


raise their price even higher.
Although that would be true for
the prices over there in the US,
but it won't be true for us here,
Now their purchase order will
be showing something from
Houston, but in truth the fuel
will be coming from Venezuela,
because we get 85 per cent of
our fuel from there anyway, and
we have been getting it for the
past 50 years," he said,
"So we could look anywhere
now to pay between $4.75 and
possibly $5 a gallon," Mr Miller
added. "See why we need


PetroCaribe to stabilise our
prices?"
As a result of Hurricane Kat-
rina, crude oil prices reached
near record levels on Sunday as
nearly 80 per cent of oil pro-
ductions in the Gulf of Mexico
were shut down.
Gas prices have been making
significant jumps throughout the
year with the majority coming
in the past month. Mr Miller,
since signing the PetroCaribe
accord, has pushed for its full
implementation, promising dra-
matic relief for local motorists


from escalating gasoline prices,
The PetroCaribe accord was
signed in July in Puerto La Cruz
with Venezuelan President
Hugo Chavez and 13'other
Caribbean countries cementing
a deal for "cheaper oil" with
the petroleum-rich country,
However, the accord has
come under constant fire from
critics questioning the intentions
of President Chavez, his close
affiliation with Cuban President
Fidel Castro, and the resulting
international repercussions for
the Bahamas,


Zhivargo Laing plans to




retire from active politics


FROM page one
remain daily inquiries and speculations
about my political future. I wish to satisfy
those inquiries today and put all speculation
to rest.
"I have decided to remove myself
from active politics,
"This means that I will not offer
myself for any political office within the
Free National Movement nor a seat in
the House of Assembly in the next gen-
eral election,
"It is my determination to focus on
other interests more in line with my per-
sonal, family, professional and spiritual
interests. This decision is a deeply per-
sonal one. It is mine and mine alone,


arrived at simply by deep soul-search-
ing," Mr Laing said.
He said he enjoyed the experience he
had in politics and remains deeply inter-
ested in the station's development.
"Perhaps I will return to public ser-
vice one day. For the time being, how-
ever, it is my choice to remove myself
from frontline partisan politics to follow
a different course. I have conveyed my
decision to Senator Tommy Turnquest,
Leader of the Free National Movement,
and to many of the party's officials. I
want to thank them all for their under-
standing and for having given me the
opportunity to share in their noble
efforts," Mr Laing said.
The former minister also thanked for-


mer Prime Minister Hubert Ingraham,
who first invited him to enter politics.
"He has been a mentor, friend and
father-figure. I also wish to thank all of
the political colleagues with whom I
have served over the years. Each has
assisted my growth and development in
so many ways," he said,
Mr Laing also thanked the people of
his former constituency, Fort Charlotte.
"My gifts and talents will always be
available to The Bahamas. Indeed, it is
my hope that my experiences over the
next several years will further enhance
those gifts and talents, enabling them
to be of even greater service and bene-
fit to our nation in years to come," Mr
Laing said.


I U-SUAY, AUGUb i u, .uu), ,, ..


THE TRIBUNE






PAGE 12, TUESDAY, AUGUSTO3,A2005NETHESTRIBUNE


N YOUNGSTERS enjoy playing on the slide


* THIS girl was in high spirits yesterday


Children

enjoy last

days of fun

before start

of school


MORE photos from a fun day in Cynthia 'Mother' Pratt's St "
Cecilia constituency yesterday Children were given food, drink
and 'back to school' packs courtesy of anonymous local donors.
(Poto: Felipi Major/Tribune Staff) i TWO boys head home after the fun day


n A YOUNG girl picks up her school supplies


N HUNDREDS of children in the St Ceclia constituency received hot dogs and drinks yesterday


Lrrrrc~ur--------- -Y---lrrrr--u-- -----~--- -----------------r- ------ ------- -;- -;-- --- -,.~... .-- .. ~....... - ------ --- -~-- u---- --I-- . ---- rr- ..-.Y- I- -


PAGE 12, TUESDAY, AUGUST 30, 2005


* CHILDREN enjoyed the playground equipment yesterday


THE TRIBUNE,









TUESDAY, AUGUST 30, 2005


SECTION -


business@tribunemedia.net


a 7j'


Miami Herald Business, Stocks, Analysis, Wall Street


Renewed call



for workers'



'Skills Register'


* By NEIL HARTNELL
Tribune Business Editor
Renewed calls for
a "Skills Regis-
ter" and a more
transparent
work permit
approvals process were made
yesterday as suggestions for
creating a better balance
between the needs of Bahami-
an companies and workers.
Richard Johnson, general-
secretary for Civil Society
Bahamas and a trade unionist,
repeated previous calls for the
creation of a 'Skills Register'
as one mechanism that could
balance 'Bahamianisation' the
policy that suitably qualified
Bahamians be given first pref-
erence for a job with compa-
nies needing to hire workers.
with the necessary skills.
Speaking as Civil Society
Bahamas unveiled its recom-
mendations to the Government
for dealing with this nation's
immigration problems, Mr
Johnson said: "A greater bal-
ance could be struck by insti-


Civil Society directors urge
greater transparency in work
permit approvals process


tuting a Skills Register.
"I have seen over the last 12-
15 years that for some reason
the Government has been very
ineffective in identifying needs
in the workplace, what the var-
ious professions need. There is
no record, no database of these
skills, so consequently there
has been abuse of the system.
Employers
"Some employers go about
going through this rigmarole
of advertising for a position,
knowing quite well that the
skills they are advertising for
are not going to be met, allow-
ing these situations [where
expatriate workers are con-
stantly employed on renewed
work permits] to continue to
the exclusion of these skilled


Bahamians. The right balance
would be met if we have the
Skills Register officially estab-
lished."
Freddie MunningsJnr, Civil
Society Bahamas' interim pres-
ident, said all work permits
should be vetted by a commit-
tee consisting of representa-
tives from the Government,
trade unions and private sec-
tor before approval is given.
He added: "There has to be
due diligence to ensure every
opportunity for employment in
this country is given to a
Bahamian.
"I believe that we need to
have the right committees in
place to evaluate these work
permit requirements, and when

See SOCIETY, 4B


Nassau room revenues



grow 8.1% to $219.5m


* By NEIL HARTNELL
Tribune Business :
Editor
TOTAL room revenues
for New Providence's largest
hotels increased by 8.1 per
cent to $219.5 million for the
first seven months this year,
the Central Bank of the,
Bahamas reported yester-
day, with room rates and
revenue, per room up by 7
per cent and 14.3 per cent
respectively on 2004.
The Central Bank report
showed that Nassau's major
resort properties, such as
Atlantis, the Cable Beach
Resorts and the British
Colonial Hilton, had enjoyed
a stellar first half, with occu-
pancy rates "broadly high-
er" for the year through July
at 83.4 per cent, compared
to 78;1 per cent for the same
period'in 2004.
The report, which exam-
ined Bahamian financial and
economic developments in
July, found that total visitor
arrivals for the 2005 first half
had fallen by 5.6 per cent
compared to 2004, standing
at 2,642 million.
It echoed the data pub-


* THE Central Bank report showed that Nassau's major resort:
properties, such as Atlantis (above) had enjoyed a stellar first half.


lished by the Caribbean
Tourism Organisation
(CTO), agreeing that there
had been a "broad-based
falling off" in tourist arrivals
to the Bahamas, with air
arrivals down 2.5 per cent
and cruise ship visitors off
by almost 7 per cent.
The Central Bank indicat-
ed much of the arrivals
decline could be attributed
to the ongoing problems of
the Grand Bahama econo-
my following last year's hur-


ricanes, and the Royal Oasis
resort's subsequent closure,
costing that island significant
room inventory.
The report said: "The
decline in arrivals was, led by
Grand Bahama, where the
weakness was most pro-
nounced, with total arrivals
falling 23.6 per cent, includ-
ing a 16.7 per cent reduction
in sia arrivals and a more

SEE page 4B


$137.2m fiscal deficit 60% up on 2002004


* By NEIL HARTNELL
Tribune Business Editor
THE $137.2 million fiscal
deficit for the first 11 months
in 2004-2005 was 60 per cent
ahead of the previous year's
comparative, the Central
Bank of the Bahamas report-
ed yesterday, with the Gov-
ernment's continued inability
to rein in its spending the pri-
mary factor behind the grow-
ing red ink.
The Central Bank report on
monthly economic and finan-
cial developments for July
found that the $137.2 million
deficit the Government had
run up in the year to May 2005
was some 77.2 per cent of the
budgeted $177 million deficit,
indicating that it should at
least come in below that tar-
get.
Revenues for that period
came in 4.96 per cent ahead
of fiscal 2003-2004, standing
at $910.6 million, which the
Central Bank said reflected
"generally improving eco-
nomic conditions".
Tax receipts were up by 8.2
per cent, and this was only
partly'offset by a fall in non-


tax and capital revenues. Non-
tax collections fell by 21.1 per
cent and capital revenues by
32 per cent, due to "last year's
higher dividend and leasehold
income and sale of govern-
ment equity holdings".
But "in contrast", the Cen-
tral Bank report noted
"broad-based increases" in all
expenditure categories, with
total recurrent spending high-
er by 6.8 per cent at $927.3
million.
Net lending to the public
corporations rose by 45.5 per
cent, while spending on infra-
structure projects to repair
2004 hurricane damage and
road improvements boosted
capital spending by 37.9 per
cent to $77.1 million.
Striking a positive note, the
Central Bank recorded its
analysis of the Government's
fiscal prospects by saying:
"Some fiscal consolidation is
expected as we move into the
new fiscal year, as the Gov-
ernment seeks to increase the
efficiency and effectiveness of
revenue collection by the
introduction of a revenue sys-
tem that facilitates the use of
credit and debit cards to pay


tax assessments to govern-
ment agencies."
The Central Bank added
that the Bahamian econoiny's
prospects for the 2005 second
half and 2006 "remain gener-
ally favourable", due to for-
eign direct investment inflows
for tourism projects, plus con-
struction activities,in both the
domestic and residential sec-
ond home markets.
However, it warned: "Key
vulnerabilities remain the per-
sistent record high energy


prices, which are likely to
impact travel costs, and con-
cerns surrounding the 2005
very active hurricane season."
There was better news on
the monetary front, with the
Bahamas' external reserves
standing at $740.21 million at
the end of July 2005. Growth,
though, slackened to $75.6
million from $195.9 million in
the first seven months of 2004.
Growth in the banking sys-
tem's excess reserves more
than halved to $21.6 million


from $52.7 million in 2004,
while gains in excess liquid,
assets fell from $65.4 million
last year to $44.6 million.
The Central Bank report
said: "The expansion in
Bahamian dollar credit
[between January and July
2005] strengthened to $254.7
million from $204.9 million in
2004.
Private sector credit was
higher at $210.3 million from
$141.8 million in 2004, with a
more moderate rise in mort-


gages and consumer credit, to
134.3 million and $55.1 mil-
lion respectively."
Growth in the Bahamian
dollar deposit base fell to
$283.6 million during the first
seven months of 2005, com-
pared to $375.1 million last
year, "largely due" to a fall in
demand deposits from $215.9
million last year to $132.1 mil-
lion -this time around. Fixed
deposits dropped from $85.6
million in 2004 to $71.1 mil-
lion this year.


Elegant 3 bed 3.5 bath condominium in exclusive gated community on Cable
Beach with gorgeous white sand beach, 2 swimming pools, lush tropical
landscaping, waterfall, lake, seaside gazebo and bar-b-que grill. Tennis
courts and gym to built. Spectacular views. Quality fixtures and finishes,
double mahogany entrance doors, designer-tiled foyer, marble bathroom
finishes, granite counter-tops and more. Bayroc is exclusive, relaxed living at
its finest. Asking sale price is $875,000. Internet Ref. #1729

Offered by:
Damianos Realty Company
Tel: (242) 322-2305 IliRRO,
sales@damianos.com
www.damianos.com


HELPING YOU CREATE AND MANAGE WEALTH

NASSAU OFFICE
Tel! (242) 356-7764

FREEPORT OFFICE
Tel: (242) 351-3010















Government must establish




Catastrophic Disaster Fund


Every Sunday
afternoon as I sit
down to pen this
column, some-
times I have a
topic in mind. Other times I
have to search for a topic that I
feel would be interesting to
readers. This Sunday, my 10


year-old son, Leighton, came
to me and said: "Daddy, I think
that you should write about the
hurricane." Although fully con-
sumed with preparing to return
to school on Monday, he was
more concerned about the
potential damage arising from
a major hurricane. And on Fri-


day, one of my colleagues also
suggested that a hurricane-
related article would be timely.
Enough said... Hurricane Kat-
rina it is.
As I write, Hurricane Katri-
na is barrelling its way through
the Gulf of Mexico, headed
towards the Mississippi Delta
as a category five hurricane. In
the history of the US, there
have only been three other
occasions when a storm of this
magnitude has actually landed
in the US: an unnamed Hurri-
cane on Labour Day in 1935;
Hurricane Camille in 1969; and
Hurricane Andrew in 1992.
Hurricane Camille landed in
the New Orleans area, while
Andrew struck south Florida
(also causing extensive dam-
age in the Bahamas). Hurri-


cane Andrew is the costliest
hurricane on record, causing
some $26 billion in damages.
Katrina, which formed last
week in the Bahamas as a trop-
ical storm, wove its way
through our archipelago, pro-
ducing only heavy rainfall and


LEGAL NOTICE

NOTICE

PARKTOWN RIVER LIMITED


Notice is hereby given that the above-named
Company is in dissolution, which commenced on the
19th day of August, 2005. The Liquidator is Argosa Corp.
Inc., of P.O. Box N-7757, Nassau, Bahamas.



ARGOSA CORP. INC.
Liquidator


^III_=,1A -si imColina ]]lnllnf/llm
Financial Advisors Ltd.
Pricing Information As Of: Pa
26 August 2006

52wk-Il 52wk-Low Symbol Previous Close Today's Close Change Dally Vol. EPS $ Dlv $ PIE Yield
1.10 0.80 Abaco Markets 0.80 0.80 0.00 -0.207 0.000 N/M 0.00%
9.35 8.00 Bahamas Property Fund 9.35 9.35 0.00' 1.452 0.340 6.4 3.64%
6.60 6.55 Bank of Bahamas 6.60 6.60 0.00 0.561 0.330 11.8 5.00%
0.85 0.70 Benchmark 0.80 0.80' 0.00 0.187 0.010 4.3 1.25%
1.80 1.40 Bahamas Waste 1.40 1.40 0.00 0.126 0.060 11.1 4.29%
1.15 0.87 Fidelity Bank 1.10 1.10 0.00 0.066 0.040 16.7 3.64%
8.81 6.76 Cable Bahamas 8.80 8.80 0.00 0.618 0.240 14.2 2.73%
2.20 1.69 Colina Holdings 1.69 1.69 0.00 0.004 0.000 NM 0.00%
9.08 6.75 Commonwealth Bank 9.00 9.00 0.00 0.705 0.410 12.8 4.56%
2.50 0.67 Doctor's Hospital 2.46 2.46 0.00 0.429 0.000 5.7 0.00%
4.12 3.85 Famguard 4.12 4.12 0.00 0.428 0.240 9.6 5.83%
10.61 9.25 Finco 10.61 10.61 0.00 0.695 0.500 15.3 4,71%
9.50 7.00 FirstCaribbean 9.50 9.50 0.00 0.695 0.380 13.7 4.00%
9.00 8.31 Focol 9.00 9.00 0.00 0.675 0.500 13.3 5.56%
1.99 1.27 Freeport Concrete 1.15 1.15 0.00 0.022 0.000 52.3 0.00%
10.20 9.50 ICD Utilities 9.60 9.60 0.00 0.526 0.405 18.3 4.22%
8.50 8.25 J. S. Johnson 8.50 8.50 0.00 0.561 0.560 15.2 6.59%
6.69 4.36 Kerzner International BDRs 5.86 5.81 -0.05 0.122 0.000 48.0 0.00%
10.00 10.00 Premier Real Estate 10.00 10.00 0.00 2.010 0.760 5.0 7.60%
52w1-l 5 12wk-Low Symbol Ask $ Last Price Weekly Vol. EPS $ Div $ PIE Yield
13.00 12.50 Bahamas Supermarkets 12.25 13.25 11.00 1.488 0.960 9.1 7.25%
10.14 10.00 Caribbean Crossings (Pref) 10.00 10.35 10.00 0.000 0.800 NM 7.80%
0.60.0.40 RND Holdins 0.54 0.00 -0.068 0.000 NM 0.00%
43.00 28.00 ABDAB 41.00 43.00 41.00 2.220 0.000 19.4 0.00%
16.00 13.00 Bahamas Supermarkets 13.00 14.00 13.00 1.105 0.810 14.6 6.93%
. .0.35. RND Holdin 0.29 0.54 0.35 -0103 0.000 N/M 0.00%
82wk-HI 52wk-Low -Fund Name NAV YTD% Last 12 Months DIv $ Yield %
1.2490 1.1822 Colina Money Market Fund 1,248955*
2.3810 2.0058 Fidelity Bahamas G & I Fund 2.381 *'"
10.4855 10.0000 Fidelity Prime Income Fund 10.4855*"***
2.2636 2.1330 Colina MSI Preferred Fund 2.263627"**
1.1273 1.0576 Colina Bond Fund 1.127305**""
SIlX ALL SHARE INDEX -19 Dec02 = 1.000.00 YIELD- last 12 month dividends divided by closing pricr
82wk-HI Highest closing price In last 52 weeks Bid $ Buying price of Colina and Fidelit)
82wk-Low Lowest closing price in last 52 weeks Ask $ Selling price of Colina and fidelity
Prevous Close Previous day's weighted price for daily volume Last Price Last traded over-the-counter price
Today's Close Current day's weighted price for daily volume Weekly Vol. Trading volume of the prior week
Change Change in closing price from day to da) EPS $ A company's reported earnings per share for the last 12 mthe
Dally Vol. Number of total shares traded today NAV Net Asset Value
DIV $ Dividends per share paid in the last 12 months NIM Not Meaningful
PIE Closing price divided by the last 12 month earnings FINDEX The Fidelity Bahamas Stock Index. January 1, 1994 = 10(
- AS AT JUL. 31.20051""*- AS AT JUL 31, 2008
* AS AT AUGUST 19, 200W1* AS AT JULY 31, 2005/ ""** AS AT JULY 31, 200f


some minor flooding but, most
importantly, no real damage.
After leaving the Bahamas,
Katrina struck South Florida
as a category one hurricane,
passing over the Florida Ever-
glades and gaining strength
from the warm marsh waters,
before heading into the Gulf
of Mexico and growing to a cat-
egory five hurricane.
Katrina made landfall in the
New Orleans area, a city I
know well from having spent
almost 15 years of my profes-
sional life working for a New
Orleans-headquartered corpo-
ration and making many trips
there. New Orleans, which has
a population of about 1.4 mil-
lion within its metropolitan
area, sits about six feet below
sea level. With a forecast of a
20-28 foot sea surge, the
prospects do not look too good.
However, by the time this col-
umn is published, we will know
the extent of the damage.
Impact on Oil Prices
Following on from my col-
umn last week, which dealt
with oil prices, the Gulf of
Mexico is home to some 21
major oil platforms, which are
responsible for producing some
25 per cent of US domestic oil
and gas output. Further, there
are some nine major oil refiner-
ies in the projected path of Kat-
rina at the time of writing, Gulf
States house close to 50 per
cent of US oil refining capacity.
The implications for oil
prices, in the short term, are
obvious... Katrina will lead to
even higher crude oil prices. In
the best possible case scenario
- no damage to production and
refining facilities a minimum
of at least two weeks' produc-


tion time will be lost. In the
worst case, there could be long-
term supply interruptions.
Unlike the Bahamas, the US
has significant strategic oil sup-
plies that it holds in reserve,
which could be released to mit-
igate short-term market dislo-
cations.
While the Bahamas does not
source its oil from the Gulf of
Mexico, the forces of supply
and demand will drive world-
wide crude oil prices up.
Catastrophic Disaster Fund
(CDF)
The second point I wish to
address today is the issue of a
Catastrophic Disaster Fund. As
I have written on numerous
occasions, it is a known fact
that the Bahamas sits in the
'Hurricane Belt' and we will,
most likely, get a hurricane
every year.
Generally speaking, govern-
ment buildings are self-insured.
What this means is that in the
event of a catastrophe, central
government will have to bor-
row large sums to replace need-
ed infrastructure. In other
words, taxpayers such as you
and me, and our children and
grandchildren, will pay these
costs for years to come, in addi-
tion to personal losses.
I believe it is time for cen-
tral government to establish
and finance a Catastrophic Dis-
aster Fund, which is totally seg-
regated from the Consolidat-
ed Fund. It is essential to our
long-term economic security.
A little self-help and forward
planning can go a long way.
Concurrently, the Govern-
ment must establish policies
restricting the maximum
amount of risk it will self-insure
until the CDF achieves critical
mass. Otherwise, we are tak-
ing unnecessary financial risks
with our fragile economy.
CARIQCOMhas also moved.
to establish a similar initiative
on a regional basis (Cata-
strophic Fund), but thus far it
has not really been funded by
member countries,
It is allo a know fact that the
world's major reinsurers are

SEE page 4B


THE MEDICLINIC. CABLE BEACH
Requires: (1) Full Time Registered Nurse
(2) Part Time Registered Nurses to work
in Primary/Urgent Care Facility

Qualifications:
Current Bahamian licence
Must have at least three (3) years experience in the
field.
Must have current ACLS Certificate
Must demonstrate strong public relations,
communication skills
Must be responsible, dedicated, competent and
independent.

Attractive Benefit Package

Please send resume to:
The Mediclinic
P.O. Box N-4302
Nassau, Bahamas






WINDING BAY


REAL ESTATE SALES
REPRESENTATIVE


The Abaco Club on Winding Bay, a spectacular 520 acre
International Members Golf & Sporting Estate on Abaco,
is seeking a senior-level REAL ESTATE SALES
REPRESENTATIVE. Candidates must have a minimum
of 5 years experience in luxury market sales. Real Estate
license is preferred. Successful candidate must have
exceptional communication skills, both verbal and written.
Must be personable, professional and willing to commute
or relocate to Abaco. The Abaco Club's estate lots range
from $875,000 to more then $4 million. Please email cover
letter and resume to info@theabacoclub.com or fax to 242-
367-2930, Attn: Sales & Marketing.


Second Senior Officer

A progressive offshore bank with an unrestricted bank
and trust licence is looking to engage a capable
individual to fill the position of Second Senior Officer
as required by the Guidelines on Minimum Physical
Presence of the Central Bank of The Bahamas.

The individuals must meet the following qualifications:
Minimum of FIVE (5) years employment in a senior
capacity with a licensed financial institution;
Ability to take charge of the entire back-office
administration of our institution;
Experience liaising with The Central Bank of the
Bahamas;
Familiarity with AML and KYC procedures
Highly organized
University degree required, post-graduate degree
preferred;
Knowledge of Canadian income tax and business
practices
Computer literacy is required

We offer a flexible work schedule with very desirable
job benefits and a very satisfying work atmosphere.
Salary is commensurate with experience and is
negotiable. We are an equal opportunity employer and
do not discriminate on the basis of gender, age, race
or religion. We prefer to hire Bahamians but will
consider hiring a non-Bahamian if they have the right
credentials.

Please reply in 'confidence via email to:
SecondSeniorOfficer@Yahoo.com


NOTICE


The immediate family members of Mr.

Clarence Ferguson, Mr. Garnet Knowles,

and Mr. Arlington Brown Jr., deceased

employees of The Bahamas Electricity

Corporation are kindly asked to contact

the Human Resources Department, at

telephone numbers 302-1303, 302-1304
or 302-1720 urgently,


LEGAL NOTICE

NOTICE

CAPUCCINO ENTERPRISES
LTD.


Notice is hereby given that the above-named
Company is in dissolution, which commenced on the 12th
day of August, 2005. The Liquidator isArgosa Corp. Inc.,
of P.O. Box N-7757, Nassau, Bahamas.



ARGOSA CORP. INC.
Liquidator


i HE TRIBUNE


PAGE 2B, TUESDAY, AUGUST 30, 2005








1 ni1 I i rIL't) IMr-


Concerns over citizenship




for work permit holders


* By NEIL HARTNELL
Tribune Business Editor
THE Government has been
urged to be careful in granting
citizenship to former work per-
mit holders, on the grounds that
this could "prevent Bahamians
who have spent thousands and
thousands of dollars qualifying
themselves" for the same posi-
tion being unable to find work
in this nation.
This suggestion was among
several recommendations
unveiled yesterday by Civil Soci-
ety Bahamas, a non-profit organ-
isation, that have been sent to
the Government as a means of
tackling problems associated with
immigration in the Bahamas.
The group urged the Govern-
ment to develop an "action plan"
to address illegal immigration
issues within the next 38 days.

Letter
A letter sent by Civil Society
Bahamas to the Prime Minister,
and several other Cabinet minis-
ters, last week generally called
upon the Government to do a
better job of enforcing existing
immigration laws and regulations
associated with the work permit
approvals process.
Among the recommendations
were that the Department of
Immigration publish the number
of work permits issued every six
months, along with the profes-
sions or crafts that received work
permits.
Other recommendations rele-
vant to the Bahamian business
community were that the Gov-
ernment must ensure there were
no qualified Bahamians avail-
able to fill jobs for which work
permits were being sought, "to
prevent Bahamians being
deprived of legitimate lucrative
positions".
Civil Society Bahamas sug-
gested: "Positions requiring inor-
dinate amounts of languages and


* RECOMMENDATIONS were sent to Prime Minister Perry Christie


long years of experience should
be looked at with jaundiced eyes,
as some of those jobs requiring
20 years' experience are being
filled by 30-25 year-olds. The sole
object being to deprive Bahami-
ans of lucrative positions".
The organisations also recom-
mended that when work permits
were issued, the Government
had to ensure that Bahamians
were given the necessary training
so that they could take over posts
requiring expatriate labour.
Civil Society Bahamas said: "If
the permit is granted for three
years, then within that time a
Bahamian should have been
identified and trained. Work per-
mits must not be continually
renewed, as to do so deprives
Bahamians of lucrative positions
in their own country."
It also recommended that


when work permits came up for
renewal, a Council comprised of
representatives from the Gov-
ernment, labour and private sec-
tor first needed to give approval,
so as to "prevent the continual
renewal of permits where
Bahamians are deliberately being
deprived".
The Civil Society Bahamas
recommendations drew upon the
findings generated by a Town
Meeting on immigration in July,
where speakers called on the
Government to "deal decisive-
ly" with persons and companies
that hired illegal workers.
They also called for all work
permit applications to be refused
unless it was established that no
Bahamians were available to fill
the post.
Freddie Munnings Jnr, Civil
Society Bahamas' interim presi-


dent, yesterday called for a "zero..
tolerance" policy towards com-
panies and individuals employing
illegal workers.
He urged the Government to
enforce the existing laws "imme-
diately and rigorously", and to
make the regulations effective
where they were found to be
lacking.
Mr Munnings identified the
construction sector as one where
there were "serious problems"
with illegal workers.
He also called upon Bahami-
ans not to hire workers without
the proper permits, saying that
some Family Islands did not have
a problem with illegal immigrants
because people there did not
employ them.


A leading law firm with offices located in Nassau
and Freeport is presently considering applications
for the following position.


SYSTEMS ADMINISTRATOR


The successful applicant should possess the following
minimum requirements:

Associates Degree in related Computer Sciences.
Two or more years work experience in the
computer field.
Excellent working knowledge of Microsoft Office
products.
Very good working knowledge of Windows
Networking Systems.

General responsibilities will include but not be limited
to:

Maintaining and troubleshooting hardware and
software on the Network.
Maintaining Network trustees and security.
Maintaining system backups.
The recommendation and implementation of
new technology.

WE OFFER

A Competitive Salary, Pension Plan, Health and Life
Insurance and other attractive benefits.

Interested persons should apply in writing to:

The Office Manager
P.O. Box N-7117
Nassau, Bahamas


KINGSWAY ACADEMY
P.O. Box N-4378
NASSAU, BAHAMAS

Kingsway Academy High School

invites qualified applicants for the following positions
immediately.

Art and Design
Business Studies
Librarian/ Media Specialist
Bible/ Christian Values (Needed for one semester)

Successful applicants must:
Be a practicing, committed born-again Christian
Have minimum qualifications of a Bachelor's
Degree in the appropriate subject areas or higher
from a recognized college or university
Have a valid teacher's certicate or diploma where
appropriate
Be willing to participate in extra curricular activities,
etc.

Applications must be made in writing together with full
curriculum vitae, a recent color photograph and names of
at least three references, one being that of your church Pastor
to:

Ms. Kelcine Hamilton
Academy Affairs Manager
P.O.Box N-4378
Nassau, Bahamas

For further information, please contact the Business Office
at Telephone numbers 324-6269 or 324-6887.
DEADLINE FOR APPLICATIONS IS THURSDAY,
September 1, 2005


ASSEMBLIES OF GOD IN THE BAHAMAS







WARWICK STREET, SHIRLEA
ANNOUNCES THE FIRST CYCLE OF CLASSES
SEPTEMBER 5th NOVEMBER 10th, 2005








MONDAY
PENTATEUCH....................................MINISTER LUCINDA ROLLE
ORIENTATION.............................................BRO. DENNY JAGESSAR

TUESDAY
SYSTEMATIC THEOLOGY I..............................REV. VERNON MOSES
CHURCH HISTORY................................................REV. NEIL HAMILTON

THURSDAY
EPISTLES II (ROM. & Gal.)..................................BRO. ERIC BROWN
EVANGELISM II....................................MINISTER TAMEQKO COLLIE

CLASSES HELD 7:00p.m. 10:00p.m.
Registration Begins August 29th September 2nd 1p.m. 4p.m.
September 5th at 6p.m.
Classes begin September 5th, 2005
$20.00 Registration, $30 Late Registration (After Sept. 9th, 2005)
$60.00 Tuition Per Course (Plus Price of Texts)
ALL CHARGES ARE ON A CASH BASIS

NIGHT CLASSES ARE FROM 7-10:00P.M.

APPLICATION FORMS ARE AVAILABLE AT THE NATIONAL OFFICE
& FROM PASTORS OF THE ASSEMBLIES OF GOD CHURCHES FOR
FURTHER INFORMATION
TELEPHONE: 393-3453 or 393-3141 FAX 394-6361

THIS SCHOOL IS RECOGNIZED BY THE MINISTRY OF
EDUCATION TO OFFER COURSES TO THE POST
SECONDARY LEVEL


S ...-- -. .,, .. . - . .......-- .








PAGE 4B, TUIESDAY,,AUIGUtST30,2QE,, 5


FROM page l


:than one4-third contradfion in
air anrivals.
"However, air arrivals bto
New 'Providence and tthe Fam-
ily Islands rose by 721per cent
and'0.4 percent Trespetivbly.
"Improvementsrinocupancy
rates, averagedaily iroom ates
and room revenues iin tthe


mii*jor'wIewlBW idenr e prop-
tities hoosted itmouism output
.,and tdipad ta toffset'weaker
tEaHv rianiniv ad1"
'iaiBk1Gaomito,;tthe3Bshamas
,-:Ea ethiierepEidBnt, yes-
ei~edyibrae-iyagreedwiithtthe
(entter.allBa3iknmpcnttus tomism


;Requires: (iJ4FllTrimrte1Rgi utedlme
;(-i2, m ,rtTinmegitted.iluIE.tto~w~tk
iirfARfimaq/ ,eBitnGam F atility

Qualifications:
Current BAhamnianilicne
Must haveeatileastthi m ()yearsmnesBoieneilin i
:field.
Must have outlturettAm StettifiT~ate
)MusttidemonstratestmpognlpBicoritions,
commuriicationtkills
iMustibeirespionbltdiW-bishi tad;ourmptetfamnd
iindependatit.
,Attractive.BenefitfRatkage


PRieasemendresunmito:
,TOheiSM clinic
jNassaif lBhamas


assessment, fta iig'7heFie i- ctNheiy-heildI',r!C miEto
' ebune: "lhenhAth&tlhattare s aiid:'"iaSduananualiaibe
opperatmng< ontimne to.migema rmomawiS eteidaipgwlliibatit
fairly saccessfimfil yi& e. dd(esm~airsaoreItkhe ed for
Mostarepnlp last ast, ]" msB tonmenrse moom apadityin
,He an~awdOged thmt tthe rfithih hamna:"
IBahamashad ao taddremmithe IbesdBH "-sseuailiverWie-
area xoft oom inarWsttapanid rpprsidaentsaidsatiitherAddhahl-
capacity hutsaidtffieqpTsent- ilagee h aenirwmniiventiry
agesdecdineiinitdseaaidair wasmoIsidItildibettifill
annpiyals-matediin ietheppoBt iiatnegtthiak westipn ioddif
outld laiggly ibe attmbutdl ito ttfhe tteniinsm; 'seamn-pEpialy
i tthe loyelF asis lEtsreplB6 ;ptamiiber.
ottiher meaennts l.haitwmla a d
shut oniW vwRovidence ;sudh
as G panastiOant-aGii dlikhe
'Saut'h ~ceanncffi&1ieanh Hiowe Brallaii3miitao>said
d.Resrt. itfhe'd fflteranidthl pBrSEtit is
meanaontihetmt-,.asdh-al04tihe aWteiiatndsd.dMBeu thusiness,g
AtlantidrBhasd Hi lHappBaiisOn p, laipi~t iay wdith ithd 1.1S an-
andtlBihahMartaev.ippment wa1itimittasibre~k willieviig
'.Gompanys$112ilillindl;^Ghle ,^maiianstatttmiiliig tanrifer-
iBeanhl rfdEavelppml nt;w,,otiUla .nniiEsinilthdlBhamastelddilnt
'ilikBly itumnianoimd"iiissues ;asaoDiitud nepBpeaSes 4aginist
-;Ailatilg ttioionmiiDmvintiitorn titiheiifinmamettax fi'mmimet
tthemeaitfuture. .year.
- (in ithe Ma"viillljggms9 Vio- aMiedadilldthai(mntibbersanid


Stheaomii .gieskemitotptzp ile gowsepnmiaitilywtithteazh
lbmiuimaneoverageEpaBitytto ithuitiane.
tthemiitire(GsiiBheamaniunninas 'ihemiatdifflhmuicBanEaEMsr-
ithe ramoutt dffifdamgge ithey *g~ewilliinmas eitShmninEane
ihavettouilruibnrsu eaniigjy amiizittyiintheiggimiiincreas-


,A'I well~stdblilhed aheamritienwa dias inesJi~ ltkiJfofadfl9aFnanD~tIlrS~ .
SApplianftsimustdemonat attetthiBttieltthtemauti .ti W i
:|ttheipreparationcfmiortthlyifinanjialtati."iimemtits
degree eirnccutitgaridaprlfeiinaldegatonnatti eastfF
:.asaaifinandiWalicotrtHle oute:~a m te tMene.

'Senrd;a coveiattter pl ihiagiin~t tilwyuwi qehtffttet% n
IfoDward your reume wm ith pifessionhal iees-samTd:a ~pthnerm~nurnbittto:


(aiolltlribune b
I8 95892 : 0sa s n **7 '


*a 8 I '' ** *


yx~ien,~f


IlD~ogyouthaeasnenesieei hio~R*iaticonsli
wanikwuantmeamorditarneexpandigg~tfa~tspaeedd ffna? il
pruductsardsewieeseconmpaif?

If you axeaganotlwariteir creative thilker and ~havetthe ability
tooEganizennidui4J w exw aifiike adtoihearfromyou


PR!!EIIliE: *
S naches IBreeMncatreqgniz-c ''a diaEiigerg(nmumissitions
~ProficiencyximiicresdlExciloweinu Access,
Booklo mndiantme lone l
** miod..cnesm~iainantsar~^^^ .

*E FxcdaltwMakethicnd~al iliade .
M'Ainlitvttomoidllexibldi uoursmland ev


IRESIDlE:


Alm I'ElM'-lFlj Bms E* I


was a rill] ^ l


i.beingmtany~, tfarmmnes

14bhaekixgs.
Tilhe lOidatafhm1wakilhe
g' eiswhrafte ihrni haiiiiman
tithis mafini'&dahibTIGafilibean
Tt;he aaif fiEani opeiniieneddSUl1 ppar 'e:dt.



agneWthiminpeO etranifsitisidr
lthr ?~2a0 iimtifthdiWvtairGa-

;!ABMh]lBBEn.tali@2pBEt
ani Jmam i f2aqmmeait.

lba,^hidhihastheen ialby
rmagaittiie ('eanoae usiHif h inhe

;grneothuin'apaversHiniVAs.
Ir(iGomiittiaididthifeHnssev-
ain2Oa:e unipaiwayputilished
li iri2IOfta:"W~emndaeesraniiegg


aisfinaEsinmbioWamdTiiBasithe
illibinatimsnotannirthe


-Tilhe.Rulicfistherebyavt~sedithatilWERNA MMtUEWllD-

tt dta niTyrnamenltt6](iRUANMIRRIEM^ilNU fftthUer y


immhassauBemanansm6tttlrantthity((3D) ysatettihetite
ff:~iletiBontfsttitisambtiiae.

-,.-


U
* 1' w


E Ah- iistI.ve Aisistat
<0iganization and lleadershiphinstitneletthat f
n5etoRami ithki drmfanilssdz!5l^ne^lth *










S S .. posses xcelltsi ii nation
gimi ici:aiabi itB 1



Musliaemonnuasynaisyperimeaianaa^s *,




I~T~sjjaii~a fesaeqpeihiimiwshinggogna Mnl

U ___________M~iiom_ ,

( vilwirttlo::
Tll^&dfti iafliiniidiescaf^lflEisagr |
Iil iS
.


au;gnmEnt that h iehe Bahamnas
was Natbtlgrowmgattle ratenmf,
sse m f 'oxur airtmaugeSt -oom-
Ipfitrs."


iMHe adddhtt ithelBuhamas
""tm'ifhtget awy Ifiama tfitheffact'
4tthatitheiemstofidftoigibusiness
fer:aatdai"'iintithisuaimiomwre;
aimuidhiiJgher Ithan an iieaha-
t itnmsis hmas ltheJliaii ean
IMpaBlih whmnhamaintneflrplay
'wenidewvhiaperps warevaBsess-
aig1f hailikly amateofirnatmnoIn:
ithBiriiiwestment.
Uhtsigg tilhefs ,nidlSenuifiesiy
iBklannif(ammissinntszewm-
rmiaddatbion i ithatthhadxst he,
.enaeiuyragdttpjySfllBeaittrii-
hitinits Ibhased ikaan liraities
-atherithanibase!pay~ilMf(mi-
i tto.isaid: ".heseameithb fthimgs'
.iwmlblievemeedttibIlloaidl att
anlthewiln~rtiilitieiftm an
i iiina E ttnit ttt .sta diip iiit ,,


i1h bathxt.rausessgiirfintt
ddamnggeiii' Wewl(idiEennEmiur-
LpHmmiBMWOUillSlliinarease.
l Bmm*weiyamaneammdi ithath
!mnay3BMhaniiiansaarestledtigg,
ttto:idrhpihumnaneEoaraageiinm
ianxfffitttomfltueithouseiinsur-.
maunexassts.qln-ondlhaifMithe
.itifUndr ga((aiiddAththutr-t
imdneimviIageiisimmsai-t1f) .'
?lMvnwxtthantflltoouiifaav-
niigupaisgitifi alismmiiEidfe
uniiibamida nlaipfitiEsiithe



IhutiheiweHBkW- - -
MIBilTrmmmyR.Ma aibannlaa:
(4BOhfaterh.&Eiunai umndWn


iffiileaffionit! liliiiiownsp

is11mhnewal epanshans crdose
fBfamat)liaWhhldflwlynnezds-
trythGndtionmniidomoames-'




; roiiy nsaeeonmmnms&nAiHB-
lrfiuw nTiiJuMmm iibs -
mfddmiantthoiseEo#6-is .
("S*d^dduA s su


sitheiareiaequ 2l=etHIahami-
neasavfihhle~ttheyhboikiiget
ztiatheeeyt.




itatshefmd" immo
Wiathileatowiikneltmgilu
zmitsEailtllrpd9Cym1ls
lAimvritwmaato
FOO yeme~itsoaff

Iunniizggsssiirtltime-

. s tamokkr .... ..
fffmmtmeasiihilit'e
klmitshiothatkh e nmasaihe
'dOuraltofamianciaftfle

i wevlantaeiceseattifto



*tagretareferaenedac6f











Boo--iEsiqgpo- n--B.mn
iawresiiiibmiimyh
reRmitsshatimonntgulthe
rwaenmtifieidadiaett









ataiiatezmm
IEtmikipermhithe







Mete


frB-teh


naUswmuu~iitarrMviihI~


mOuIrE


3IiEN~lIMN~


ousanonsoluma e


." '- .I -" ---"-U N NE-L
IMRIMB~lHNIMM F rtID" .




ommit fi t 'w:sfy ]
M5Fiffa edbeSt

NRf 3hosImIaS
a ail ,/ ^ ; :N t s a u .-*.*


(1, 1 J'V2, E


he


ArEilMNM&iMNAtMEHeM


imiRL


isrni
-A*bonor

MANEMn


'I


pataHet siumianasajttta tma ygpen
^ynggisflantinoatarbiain1 idotsernatvkobds


law


~f'""~Y""""""`"~'r~""""~"rrr l~oD;;Rluau~r~plsrru~~


IIIicetanalo#NFal2pNassappa
lt)SI sdillerithedd&tecOf th


THIE1nRFIBNE


4 LI OilE


i~P~~EB8~~'~3~(1~[


BE


rrt fE~i ks ttefcitileaii~~diiiiti,








THE TRIBUNE BUSINESS


-'The 'bank reported a ewt prfit fi64023Dritheflit isix-mnths f the r : hi, although
slightly lower tthan the 'baik"'s pmifpfomnnanmffoi ithefifirst- ix- months f the prior year, was
marginally ahead of~tan. )dii nhrp. cntt.,ito: prii, pariads' Dwev,'C Thans grew 'smartly
aefleating ibuthh tyaiitdemand adthe baxik'ss5mreaigg eise 'tance'nm nIiiting:and building
a qailitylomitAbok. 1Iheakik'h s ahskdhstare afera gnagising he ifnipensepsinicunedfer
n .wii getting d heraiiigEh iaeinhehaik'sameo
pEiddlitylBatk!(IBahamri&)JLmiited.

uinitgihe .last- six-monthsi theBaikalsd .henxfited'froma -mmberw'fmewinitiatives hat were
'a mnplementtedao-bthibtgmw ithedhaik-andioeduce penses. p nareasi dledigguatiity iisAleuted
initheagrowfldnithe ia boktk and should esuiltin improved. nterestargins asprevioslynmnn-
interest bearing munds;are ptepoyed(Conritinundifocus on'dilinquenies ashtildd siltsiniai.igher
levebBfpeiorminigilanswlhidhshoilddirtherimpraveinterestmugs.
:IDjspitte the enannityroftthe itask anda limited itinme frame t heirdAiranilingffithi ihaikwent
'smoililyandimstlbeenmwlhreivemifiihennafket.:Se ni nd gnan iaeffehae
'tbe.beirueaited-toadillowiformnresp.ibioiati .pfduatsuto'hexfesd :aiodt. nonttianue ithe

?proesses.'toMentalseaamsurifitrfrithe administiatekveidaamuitipgfu iatons ,,aious e pens e
nrdidlinoiiitiatives tei laneeattthe satftthuseuduat aiditisxepatedthafurther
fiiiitiativies wilhEontinudffifMtheWalaneiEf2aD5,, ithbenffitssartiiiau ga lmg ods.
2Plansimare uiderwayBforithd~Rabkadjlamitdlididl tyFjinatii lICen tEs -igaone-stqp ghop
SIfor .tbith lending and fidnstment-prdauihts. -fheBlinaniialC(Geresivlillttflet ithe latest in
ttEdhntidqgyaiiIro-duuttd'liv.y-temsadwtlvillinitiailty hete ippdtiatitheErJred ricdk.treet,
C-itile iea landFrqpoi- t aeovtions. tltiasppoetealtittithti*bail111i sona intrdluee :a- ider

,willtheaagnisdirfinifuture pfrids.
C p drtjA4premtisysiflaettifaahkiasmeadhl iad ettlemetitn ,theogoutstang!R dlligglllHs
.mattersandAifm amtdee .yttea dnirtinttlisyear.

'e Weaemain4eofifidentttlatitheTnumerous haigestthatihave tbzeniin ilemenrtedinientmotiths
Siindlhdiogg aSmstretthenid--thaidmaadimanagement ax Ifonzus mn c.quhalitygrWthmiand iiplpromvi~g
ustomersseie lditlawieagevicesilsiltiinasustiiable
Srnimprovementiin earii.gs.rtEhisn~ibuilfdingicexeise wlilhnitinueerTsevehi1fqlarters mnitiltthe
ibaik'.silimfrmanemis stiliilyDnrtridk. 4Asih1waysAweemminai pciatixebl theuepntrtnfuour
:ianayshaihdlitmbrsiurigratiisttransitioniadenin ten ts
_ ganaijghseritiomerialsttoeouretustomes.


'(itiminnman


. ,anislidatdBilBlani nShet iinauditedI)

,, '_es, di BhaffiiamilllarO)


MRf-sident


O.g4manW5 -0IJnUio4 3S14DeOi4


BlSSEHES

investmients

eaateaets
~ ^ ,.

*enesse '

T posits L ,
!daggagehabaciibn Us

<:eaheillMil6ifes




mEfareaseeapistal

jwetainesognuringsaw
Hitinianhliami~rggs pii


41
11






-I





















I

















I







II




-S


I6.l Sg O 800 i t7(44*4OO T 76I3SO *0
r-4Ms 0stss9 i fic\ nirs4o3 ,
92II5B1 ____8___5 i.a3Ko9s62
-tp1 ls si 1n4M 13 JU3W,4'82 987 .



/755M51 77Z55526 73555 43
4 900%Mq00 7OO 00o0
S6M 514 i.39%B55 2 65B621
* filM6143 2T 90 .S2 FSISK 67
u2l4a142 33 W1143 113i56 1310SO 7 I03
,;NO1Q,0010 7aeoi io0o000 000
-814474'0633 111 l6~f 356 1,Mad0 03


,T is"Offlol 4gOO irOl -53ofIooj1
- 8 fS3 ,616 iA 44S124 '79961J58
1 lJ6B88S8 US17,7%M23 17,35M5
R0,0391185 lb'1 2la557 n lW332a4
144.MS35818 1MMS3jS 1 314438Z987


ACMUilahUiRNEPOOEMES

M ioaiden in@AcouBilia laudamismigehao tigdas jim p



..... ..... .... ,



Cr> )ge gsase ahmgssesnse


firiltiB-Eaa -.oB .e
ianknetiadspfliSeasaeB3 &Be
"^ikeiidiiitte~sogi~irmce ane ims



TimonlifflZHHD


*S~acasiyanaflstM.aniiriniiftBsn
TrgeabimamiidiihAniiiiiiiiiimimrtie
IB'adi natf.^' emibir^ l itess

'T~rouBIiSpeaniec~lt~s ti


NIMidiigiaeiraione it



cammumbitmum entM:iumtliinrir~;g


TraiftE^imrffnltllisac lame g


AM')) (1i4lM53)
< *pssm. liwwili









R1W1AW3 AiAl|32Sn47
JI ~IIZ55 ,II5$


43M,4 33____M_

39SW 339Mgi


oame
OConn


4A1,92173 5295W 7





19$51 4M n(A4 49
P s- I5)) n t I

4i11TSSr i~33S>iii
*I!,50Sa>^ /1 : I;256 li39





2233),g1114 g33357,II6


allisrsill ways *
((141UW6 l __________
33.FU ~ 343^Z Ui


6E4il^SS W4S49j
SIif66WOisAD111( dd/YADA

An&


~XI2 ~AOIl~ll


i~b( ~EAiaad' -'~'


Fuloithe1Seodnd Quatr Eded 30hiln





Guda idlowiframtupflardtingastivities
Ne1-fitneome((hfabreimino:ityiitetestu)
A.djustmentsfdr:
ilncreasWe,(Dereas)iinipromismnifor wid itlkess
ieporeciation

qiassolT-,ialeedflfm'dmssots
Alinpairneint uaizhages

C0pemtingiinomethireedhaigeshiinrpeniig
&assetsandiiliaibilities

:(Inread)15Zeereaseimdiansmi fappaymBlts
UBeereas(insreasnseiiianthEnEsBets
D~eei3eHSt|Ineiease)imatmielil&Hiiiities
Aimneraseiintidepdsitsg wtfifithtiinwhs


iahlihflowsi dms atit stingstikities
Ei-ltseSfigoxemnmeitimsinities

"Slitieaseiiffigfio ase sets
;lSecbtifiifiBeduasaets
Nteraufflxowsiuseass iarestinematitities


fslitlftlowsus ifinaiiities
2HroceedA/(Maturities)ifmiMnminsgagsahalked rmds
HIR dentOnihefeishares
ilssuaneel PibT rrendisihares
< ne ai ....

tcOinaityowdsi'iidiiffinan fdtitM es
. etiineas/(decrease)ih leii

CjAshEinxtid-a nnie B-tad aier it
~T.


B(W, (96 7
e 80mi5


AnL31) (115(I#M) f"9770
22 fflli1l14 '1T11f (' '



*$S 'HP 37li{r H~l

3(C(51in4B5) 3 10-gu4 aaiJB14041 *
S(^SIII *$1 ) my (((firRso .. 715


5I 1 ,9 .J9 447T256 2 .M.



~((d 5750 ) '{(,a..

(.oW8) 'W892..) @W
-- 3
AMR")


g TID)

I 0)
770 ) I
Iowa!


c(58)


A.... (M66M 6)
(e333a) (c6senY) 'mnosos)
- (]S5iS @2) (j S3S4 ^S3) *B1135333S

lttlri?9,29S8 1UB373ftj9 i1uT731I79
21 8709E ;22 ai$sB2 2pi6B92a8
..... M7M9
.. .. .. .


III


uaassnannya e position


i~~oaiihn l:~~clE~tin.1~~~ -


413;Rskl~d~l~"~f`~4iF~r -


a.s ElscEmOWMgpeati-uleitMil~andiila- e

* .Mliiillitpeaaliflaiibldamsma had




"* ii iif C~ae~iai~fl~^

* ?idlii~m~ir~gB^
v&GALail se
"SS gMlatfo ...............
Ao~f~yjPB~~l~f-H~iP


40CflfiiiBt'aeiai~ii~^


(..~,iluwRpn,;uurplmm 1M~~drkmj j&&.Cma~ i


1 iwftidwniiIDdAG!X


. -- _...- I -'" _-
-Ar

551FIFeetdidibflst.

fiBsMWIaA s
^ i fJ a--
e i W: --{ : : -"


jNUIE~TOTfflE*


DLL~WY;UUUW


i


I


1


.((1)


S__ _u _- - )


- I


Cmass
coam


(eIUn
(021


TESDMAY, iAJiUST, 3 ,, 5, Fp E SB.

FIDELITYMA lgBA llEAMM^A^laBED
Consolidated Statemn~ent4filhaged inSfharhder' tynaMitd)
Enr the Secnmd i^Qaiterdedaih -e OSl 5
(Eppressed inimhhlzmimAdniuir)ar


ICi


/Atat I anuary2004 $ 5 BOGOY,01 S$ 171C 53k2 l$ 77Uaj0B2 14$ la91,7S9

7BixedeassetirevaHati n *4('I77) W |
Net Income mo gimpY6 \I4091lU6
iDividenlsnaid ...- P Sj 6 (-S.g_ )_j
iAs at 3i05Decenmbiber204 50MIO, (00 HI ,$SS25 7,9SS I,43,84

Asat -54Manuary20 5,4001 171492 7 3S8 a147134 84

'Eixedassetinedhation (I42T357) 44p57 / -
Naetincome (6#iW^ (WS5
IDimddendsTaid 3033 ,(3 )
Asat 30.!Iune 205 5$ 5if0040B11 S$ I11g'8 i 5$8 m ^BSS5~6ik6 $ I tt a1K 8


MR IMIt:








PAGE 6B, TUESDAY, AUGUST 30, 2005


SPOTS


Winning race pays





off for Pieces of Eight


em
-
-a.. a


- -w
a. a

a a

0 -
a.- __

a -

* -


* a -
a

a-
-


a m a ~. -
* -
a a. -
a-
a a-
a - -.


* -gn a

- ap q
aa. 4b- -.









q- O~ a- a..


* By BRENT STUBBS
Senior Sports Reporter

THE Pieces of Eight have
emerged with a slight lead over
the Good News as the National
Sailing Association's Regatta
sailed into full swing at Mon-
tagu Bay.
During the second weekend
of action, Pieces of Eight man-
aged to come back and pass the
Good News on the second of
the three-lap race to surge out
front in the six-race standings.
The Pieces of Eight would
add a second place finish from
the first week of competition
last weekend to her first on
Sunday to surge out front.
The Good News, which ran
aground on the second lap after
leading the way, finished in
fourth. She won the initial race,
but has dropped to second
place.

Third

The Lucayan Lady clinched
another third place to add to
her third from the first week-
end to occupy third place. Who
Dat moved up from her fourth
place in the first race for sec-
ond on Sunday. But she still
remains fourth in the standings.
Despite the fact that only four
boats are participating in the
series, association vice com-
modore Kurt Wallace said they
are still pleased with the way
the regatta is going.
"The series have been very
well sailed, very competitive,
especially this weekend," he
said. "The A Class was one of
the most exciting race that I've
seen in a long time."


The course is being held on a
three-lap course covering a
total of 10-12 miles.
Also on Sunday, there was an
Ocean Race for the B Class.
After losing the initial series
race on Saturday, the Campari
Lady in Red, Lady Natalie
bounced back to beat out Ants
Nest.
Lady Natalie's owner, Elea-
zor 'the Sailing Barber' John-
son, said the performance was
dedicated to the late Mack
Knowles.
Knowles was the boat builder
of the Lady Natalie. He died
recently in a boat accident on
Long Island.
Coming behind the Lady in
Red in the Ocean Race was
Ants Nest. Ansbacher Queen
finished third, the Cobra was
fourth and William's Auto
rounded out the field.
On Saturday, the first race of
the B Class.series was held.
Ants Nest emerged as the
champion with the Campari
Lady in Red second, the Cobra
got third and William's Auto
ended up in fourth.
Wallace said he was really
impressed with the perfor-
mances in the B Class. He said
both races were really tight and
weren't decided until the final
lap.
The series will take a break
this weekend.
But Wallace indicated that
they will be back for the third
races on the weekend of Sep-
tember 10-11.
Wallace said they also intend
to host a 'Back-to-School' spe-
cial for the students.
The regatta is being organ-
ised by the Ragged Island Affil-
iates.


Top rrfcrrc


to rrmegn


frnm Italian


xKUmc itNio


'. 4b" .- a


- -.a .


- 4b. a a ft.-

W- 4b qw 410
0 ~ ~ 4 -- .wwaa


-- Copyrighted Material



": -Syndicated Content



- Available from Commercial News Providers'
a.,.-o


- o 0


-w
~


m-


a -


.- .0
- a - a
-a. .
a ~ -
-a.
a. -

a
a. a.--
a -
- a. -
~ a a -
a a

~- a
a-ma S a.~
a


4b


- ab

- p o


a.


a -


a.. a a. a.
- - a. -~ -
-a a a.
S a. a a.- -

a.. a __
- a. . a


C -~ -
* a
a a
a.. a -


* -
* a
- S ~


a - -
- - a..


aNI a


I HIbUNI tbiUH IS


- -


t


b
o Q


~-~I- --





1 r-ilBUlNt or-U I o


Lee predicts Australia will


peak in final Ashes match

I tonw m ounts sith IngLand klading wrc* 2-1













S




"Copyrighted Material

SSyndicated Content
Available from Commercial News Providers"



So-
-









so.. ___


-b~= --- 6-
q=" m -


am 0-w 00m- O
_ ._ 0 = h-
m4-


3= 010-0 sm
o5




* -
-- "" --
'C. C.~- -age 4w


iu~,uul








TUESDAY, AUGUST 30, 2005

SECTION


Fax: (242) 328-2398
E-Mail: sports@100jamz.com


0


MIAMI HERALD SPORTS


reside


ugb


orPld


up


Chris Lleida in

place for new year


* By BRENT STUBBS
Senior Sports Reporter
WITH the Bahamas Rugby
Union focussing their atten-
tion on the second leg of the
World Cup qualifying tourna-
ment, they will have a new
president to steer their course.
Last Thursday, at the
BRU's clubhouse in Winton,
Chris Lleida was elected as
the new president for the next
year, replacing BJ Saunders,
He will be joined by return-
ing vice president Paul
Winder; secretary Stephen
Thompson and the new trea-
surer, Ken Hutton.
"I'm very confident and
comfortable with the slate of
officers, but it's probably good
to have a change of officers
on a regular basis because run-
ning a committee or an organ-
isation takes it toll," Lleida
stated.
Officers
"But I think we have done a
good job with our officers in
the past and I think it will con-
tinue with this executive
board."
With a programme already
in place, Lleida admitted that
they don't intend to make any
drastic changes. Their aim is
just to improve on what is in
place.
"Whatever development we
do is going to be a long term
commitment, so our overall
aim is to continue the youth
development."
Before the elections, the
BRU saw its men's national
team clobber Bermuda 25-15
to win the Northern
Caribbean Rugby World Cup
qualifying tournament in June.
The Bahamas will play Bar-
bados, the winner of the
Southern Caribbean Rugby
World up qualifying tourna-
ment on October 1. The
venue, however, has not been
finalised.
From the matchup between
the Bahamas and Barbados,
the winner will be crowned
the Caribbean champions and
will earn the rights to play the
winner of the match-up
between the United States and
Canada on the road towards


the World Cup qualifier.
At present, the coaching
staff are currently preparing
the national team for the
match-up against Barbados.
"While we have a national
team training, we don't want
to neglect the rest of our play-
ers because we have a season
to start in October or Novem-
ber," Lleida noted.
"So the coaching staff have
opened the training sessions
to accommodate as many
players as possible to ensure
that the best team is select-
ed."
Lleida, however, declared
that they will have to find at
least one replacement for
Anton Roberts, one of the
prolific national team players,
who won't be able to play in
the next tournament because
of an injury sustained in the
first tournament.
"I think we have sufficient
players out there that have
been attending the practices
for us to select a replacement
for him," Lleida declared.
"We just can't rob Peter to
pay Paul."
Based on what they did in
the first tournament, Lleida
said there are some players
who may not be available to
play. But he said they have a
number of players to select
from.
Although the qualifying
tournament will be the focus,
Lleida said his administration
will be working just as hard
to ensure that the regular sea-
son is a successful one.
When the new season starts
in October, Lleida noted that
they intend to play a junior
game on every weekend that
they play a senior game,
In that way, Lleida said,
they "will be able to work on
continuing to build their pro-
gramme for the future."


* THE Bahamas enjoyed a
successful Northern
Caribbean qualifying
tournament (right) and now
looks forward to a clash with
Barbados
(Photo: Felipe Major/
Tribune staff)


O


lead


bid


'--;::,- ~b;~;l'~'"-";~'~~""?~.~~"""""""""B"~i~


9 A









B A H A M I A N

HI N




A AA


TUESDAY, AUGUST 30, 2005








The Fergusons'sound advice




on living happll ever after


0 By PETURA
BURROWS
Tribune Feature Writer
WHAT'S the secret to a
successful marriage? It's an
age-old question that has no
straight answer, but some.
lucky couples have found a V
formula that works.
Take Pastor Eliakim Fergu-
son and his wife Dorcas, who
on August 24 celebrated their
50th wedding anniversary.
The Fergusons' long lasting
marriage is not only a testa-
ment to the belief that there is A.
a "happily ever after", but an.
inspiring story of love.
On Sunday, Mr and Mrs 7
Ferguson sat down in their.
church, the Church of God of
Prophecy on Soldier Road, to
share the secret of their love's
longevity. And it was no sur-
prise that the couple credits
God with bringing them
together, and for keeping their ,
love alive for so long. Mr Fer-
guson has been pastor of the
church for 22 years.
The couple met in Major's
-C-aCaf66ked Isgtaird. Shlewas
20 years old and he was 26
when they decided to get mar-
ried.
But the seed of their mar-
riage may have been planted
many years before, in their
prayers.

Prayed
"In all of my days growing
up as a young lady it was myK:
desire, so I prayed to God for
a Christian husband, and (Mr
Ferguson) was praying too
that the Lord would help him .... :
get a Christian wife. So the
Lord helped us to meet and
agree, and when the time U FIFIY years of marriage: Pastor Eliakim Ferguson and his wife Dorcas.
came we got married," Mrs
Ferguson told Tribune
Woman. thing (Proverbs 18:22)", and this is right. Honour thy father your heart," he adds.
"And I thank God that dur- not the other way around. and they mother that your The couple feels that once
ing our marriage life, because But regardless of who does days may be long upon the each individual in that mar-
we all knew the Lord and we the asking, both husband and earth and God will bless you riage understands his or her
were able to pray and agree wife agree that young couples for generations'. And you can- role and place, a marriage can,,
with one another, we have today are losing that most not beat God's word...," says work. It may be that when...
made it thus far." important step of involving Pastor Ferguson. roles are confused that mar-,
With 50 years, and count- their parents or other older riages deteriorate, they
ing, of marriage under their persons in their decision to tie BleSSog believe.
belts, and having raised nine the knot. Pastor Ferguson believes
children (two deceased), it's In the Fergusons' relation- Inthat the role of a husband is to
safe to say that the Fergusons ship, like other marriages of In fact, in his relationship, first be the "priest" of his
are an authority on marriage that' day, the man obtained though he knew that Dorcas home, which means that his
woud b hi wie, e didn't home, wich mhefialwrins that is
and family life. And they are permission from the woman's would be his wife, he word is the final word in tha*
not shy about sharing that parents before asking for her proceed until seeking advice household, and it is not cohn
advice, hand in marriage. The Fergu- from his mother, father and tended under any circum.-
First of all, when it comes sons feel that many of today's two sisters, who all believed stances. "I am the priest of tie
to popping the question, Mrs couples have neglected this that she was a young woman home, no doubt about it. And
Ferguson says that there is step. who would be a "blessing" to when I speak according to the
nothing wrong with a woman A return to this tradition hi word of God, it stands. My
asking for a man's hand in may not be such a bad idea. "They gave good instruc- children respect it. My wife
marriage, since both of them "The generation today is tion. I took it and today I have respects it. And as priest of
must eventually agree to stay not particular with that a wife that I am not ashamed the home, God has made me
within that marriage, because they are calling the of. One that I can hold my the provider of the home," he
But Pastor Ferguson is parents out-dated. So they use head up anywhere, in the says.
quick to disagree. He believes the way the television and church and out of the church, "And therefore, my wife,
that the man should be the Internet present things to and say this is my wife. So I she is the mother of the home.
one who does the pursuing in them. That tells me that things advise anyone who looks for a And who can find a virtuous
any relationship, since the are out of order because the wife, please don't just look at woman who will learn how to
Bible does say that "a man word declares, 'children obey the outside. Talk to God and
who finds a wife finds a good your parents in the Lord for he will give you the desire of SEE page two


_ r~sa, p~se~---c------ ------ --------- 9








PAGE20,TUESAYAUGUT 3, 205 TEWTRBUN


Yo-yo


a


dieting


health


* By PETURA BURROWS
Tribune Feature Writer
THE desire to lose weight
has many Bahamians bounc-
ing from diet to diet, losing
and regaining weight over and
over again in a practice
known as yo-yo dieting. But
what these individuals may
not know is that they could
be defeating the purpose of
going on a diet by jumping
from one programme to the
other.
According to Dr Idamae
Hanna, dietician at Better
Living Health Centre and
Deli, yo-yo dieting, or weight
cycling, destroys the natural
"rhythm" of the body.
Many persons who yo-yo
diet run to the high-protein
diets. But protein, she adds,
is used for health and repair
of the body, and not for ener-
gy. Carbohydrates are con-
sumed for energy.
High-protein diets though
do allow some carbohydrates
which, are gained from veg-
etables. "But they are miss-
ing the foods that are high in
carbohydrates. With the let-
tuce and the other vegetables
you get low amounts of car-
bohydrates, very little ener-
gy. But you are not getting a
good source of carbohydrates.
"When you are eating like
this, the body thinks that it is
in starvation and automati-
cally lowers its metabolism.
So you are eating very little
now but burning less calo-
ries," the dietician explains.
"So by the time that you get-.
off! these crazy diets and
resume eating as normal, you


put on
m o r e
weight and
much faster
because of the low
metabolism," she
adds.
While there has been
much research on the long-
term effect of yo-yo dieting
on the immune system some
say it is harmful, others say it
is not the author of a recent
study on the subject, Dr Cor-
nelia M Ulrich of the Fred
Hutchinson Cancer Research
Centre in Seattle, has con-
cluded that yo-yo dietifig is
harmful to the immune sys-
tem. The study was published


t h e
Journal
of the
American Dietetic Associa-
tion.
,.,Dr Ulrich and her col-
leagues questioned 114 over-'


YOUR OWN ISLAND

Just the way you want it


Av aalea


no-no


HIGH-PROTEIN diets though do allow some carbohydrates
which are gained from vegetables. 'But they are missing the foods
that are high in carbohydrates. With the lettuce and the other veg-
etables you get low amounts of carbohydrates, very little energy. But
you are not getting a good source of carbohydrates,'
says Dr Idamae Hanna


bSweight
healthy women
over the age of 50
about their weight his-
tories. Almost three-quar-
ters of the women, the
researchers found, had lost
more than 10 pounds at least
once by dieting in the previ-
ous 20 years. More than half
had done that two or more
times.
The researchers also mea-
sured the levels of natural
killer cells, immune system
cells that aim at viruses and
may have a role in fighting
cancer, as well. The women
who had yo-yo'd most often -
five or more times had the
lowest levels of the killer cells;
the highest levels were found
among women whose weight
had been stable for several
years. The study found that
even women who had only
twice lost large amounts of
weight showed a decrease in
the cells.
Overweight women clearly
benefit from losing weight,
and Dr Ulrich does not rec-
ommend that women stop
dieting. But she suggests a
more balanced approach.
Dr Hanna agrees. More
effective than dieting, she
says, is a lifestyle change that
includes planning meals and
exercising discipline-in eating.
* EATING LATE
AT NIGHT
IS DISCOURAGED.
According to the dietician,


.E DO NOT
SKIP BREAKFAST
Dr Hanna says that persons
who skip breakfast aren't real-
ly skipping breakfast. "By 10
o'clock these people are at
the vending machines getting,
a (chocolate bar) and soda to
snack oni: The (clholate barf)
and soda are about 700 calo-
ries, whereas a serving of grits,
tuna and an apple is about 500
calories. So it makes sense to
eat a balanced breakfast," she
says.
* CUT DOWN
ON SNACKING.
Eating balanced meals
throughout the day, accord-
ing to the dietician, minimises
the desire to snack on
unhealthier options.
* BEWARE OF CALORIES
IN BEVERAGES
Most persons do not know
that beverages carry calories
as well. According to Dr Han-
na, five cans of 12-ounce
sodas account for roughly
1,200 calories. She noted that
persons who are losing weight
are usually placed on a 1,400
calorie diet. "So the sodas are
basically all of their caloric
intake," she adds.
Dr Hanna recommends
checking juice labels as well,
because most bottles that per-
sons take as one serving are
really two or more servings.


Sound

advice

on living

happily

ever after

FROM page one
take care of her home, and
that shows when the hus-
band goes out because he
goes out looking clean and
in tact, only someone who:
seeks God for that can find'
it."
Adding to that, Mrs
Ferguson says that a
woman's role in the
home is to be a good
caretaker. She should
take care of her husband
and make sure that his
needs, as well as the
needs of her children, are
met.
Even with the husband
and the wife being care-
ful to fulfill their respec-
tive duties effectively,
there is still the challenge
of argufilents in that rela-
tionship, which the Fer-
gusons admit that they
have had many of.
"I don't say you would-
n't have (problems) but
whenever these things
arise we know where to
go. It's to pray and to ask
the Lord to help us go on
for Him," says Mrs Fer-
guson.
The Fergusons say that
a husband and wife lov-
ing each other is essential
to the success of any mar-
riage. They'discourage
marrying someone on the
account of a child.
"You should marry
because you love the
individual, even if you
have a child," says Pastor
Ferguson. "If you love
that individual then you
will love the child. Then
the two of you will be
able to see eye to eye and
raise that child, not as an
illegitimate child but one
that is a part of both of
you. And together, you
will be able to raise that
child as God wants him
(or her) to be. It is love
that covers a multitude of
sins."
Mrs Ferguson adds: "If
you want to be married,
make sure you look well
into it first and make sure,
that you love him before
you take that step."
You may call some of
their views on marriage
old fashioned, way too
traditional, or out of
touch, but the Fergusons
have been together for 50
years now, which might'
make their advice worth
holding onto.
And from the looks of
things the smiles and
blushes, the way Mrs Fer-
guson automatically
clinches her husband's
arm to take a photo the
honeymoon is still going
on after all these years.
They've found what
some couples just starting
out wish for the fairy
tale "happily ever after".


( 1kw rrp rpr d to hc l4ip

qmncr t4 hrAhhk tnjusS3ilAn6q


- C


"Copyrighted Material

Syndicated Content

Available from Commercial News Providers"


THE TRIBUNE


PAGE 2C, TUESDAY, AUGUST 30, 2005


w















Does your child have





a balanced diet?


Provided by Adelma Penn,
Camelta Barnes and Shandera
Smith, nutritionists from the
Ministry of Health/Department
of Health
Well it's
almost time
for school
again. This
means that
parents will be shopping not
only for books, pencils, uni-
forms and bags but also for
breakfast, lunch and snack
foods for their children.
But are you providing the
right types and amounts of
food your children need for
energy and healthy growth and
development?
It is essential that children
and adolescents have a bal-
anced diet to prevent becoming
underweight, overweight or
obese. As they are in a state of
growth, they particularly need
adequate energy, zinc, iron, cal-
cium, vitamins A, B and C.
This also lays a firm "nutri-
tional" foundation for their
adult life. For example, if they
don't get sufficient calcium
they may be at an increased
risk for osteoporosis later in
their adult life.
Last week we spoke about
the amount (portion or serv-
ing sizes) as well as the types of
foods that should be a part of
your child/children's diet.
Today, we will talk about
breakfast, lunch and snacks.
When planning, purchasing,
preparing and packing meals
keep the food groups in mind.
Each meal should provide
about 1/3 of your child's daily
vitamin, mineral and calorie
requirements. You should also
bear in mind balance, variety
and adequacy.
Many challenges arise when
attempting to provide our chil-
dren with nutritious meals,
especially lunch.
A major one is "peer pres-
sure". Children can be easily
influenced by other children.
They see what others have for
lunch and usually the tastiest
lunch prevails. It's sad but it's
usually the sweet drinks, pota-
to chips, fries and cookies that
seem to be the most popular
eaten lunch, and even as other
meals.
The nutritional content: lots
of fat, sugar salt and calories
and very few nutrients. In addi-
tion, they are not getting suffi-
cient exercise and physical
activity. It is no wonder then
that our children and adoles-
cents are becoming overweight
and obese.
Statistics show that over 14
per cent of children between
the ages of two and ten are
overweight and almost nine per
cent of adolescents between
the ages of 11 and 20 years are
overweight. Because of this we
need to closely examine their'
diet because they are more
likely to become obese adults,
which increases their risk for
serious chronic diseases -
hypertension, high cholesterol,
diabetes, heart disease. Addi-
tionally, what we are now see-
ing is a significant number of
our children actually having
some of these chronic condi-
tions.
All of this demonstrates the
need for us to have healthier
meals and lifestyles.
Another challenge we face
is time. We usually complain
that we don't have the time to
properly prepare meals and
therefore we usually choose the'
less healthy alternatives "con-
venience foods" and "fast
foods", which are loaded with
calories, sugar, salt and fat.
We want to empower you
with the knowledge of making
meals healthier for your family.
Here are some guidelines to
assist you.

Breakfast time
Breakfast is still the most
important meal of the day. Its
importance cannot be under-
scored or over emphasised. It's
like putting fuel into the body
for it to run optimally for the
day. It's the fuel that provides
your child with the energy to
listen and learn during the day.
Children may skip breakfast
because they get up late and
have to rush to get to school, or
because their parents/guardians
don't eat or prepare breakfast.
Research shows that children


their school work, they may not
learn as well and they may not
get all the energy, vitamins and
minerals they need to function
optimally and for their normal
growth and development.

Here are some quick, healthy
and not-too-expensive ideas for
breakfast: (Please keep in mind
the serving portions.)
Cereal (preferably whole-
grain, e.g. raisin bran, cheerios)
with milk and fruit or unsweet-
ened fruit juice. However, they
will get more nutrients from
the fruit rather than the fruit
juice, but limit fruit juice to a
glass or two a day.
Toast with peanut butter,
jam, jelly, cheese, tuna or egg,
fruit and low fat milk.
Toast and a "fruit smooth-
ie" milk and fruit (such as a
banana) blended smooth in a
blender. This can even be pre-
pared the night.before.
Cut fruit for fruit salad with
low fat yogurt, and toast.
French toast or french toast
sticks with turkey or hotdog.
French toast, tater tots with
eggs or turkey slices.
Pancake or waffle with
eggs, sausage (lean) and fruit.
English muffin sprinkled
with cheese and a fruit with
milk or tea.
Grits with tuna, egg,
turkey, sardines, scrambled
tofu or corned beef, with a
fruit, milk
Johnny cake with cheese,
chicken souse or stew fish, with
fruit juice.
Granola or cereal bars,
fruit, milk.
With the advent of modern
conveniences, such as the
microwave, certain foods like
pancakes can be prepared the
night before and heated up the
following morning or if you
prefer it fresh, you can just
keep pancake or waffle batter
in the refrigerator, ready to
pour on the griddle.
If you like to bake, you
might keep a supply of muffins
or quick breads (bran, whole-
wheat, blueberry, banana) in
the freezer, ready to warm in
the microwave.

Lunch time
Lunchtime is still the best
time in school. Lunch should
be exciting, enjoyable and
nutritious.
A healthy lunch offers whole
grains, fruits, vegetables and
other nutrient-rich foods that
children need for proper
growth and development. How
can you achieve this? Here are
some general guidelines:
Involve your children in
planning, buying, preparing
and packing their food for
lunch. Before you shop, pre-
pare a list that includes foods
that are safe to pack and con-
tributes to a healthy diet. They
will not only learn and practice
healthy eating; it is likely to
become a permanent part of
their lifestyle.
Variety is still the spice of
life. In order to get a variety
of nutrients and to decrease
monotony, we need to eat dif-
ferent types of food vegeta-
bles, fruits, meats, carbohy-
drates, nuts etc. When mak-
ing sandwiches, use different
types of breads whole-wheat,
pumpernickel, rye, bagel,
raisin, pita, English muffin,
croissants. Cut sandwiches in
various shapes and sizes.
Let them decide and select
what they will take their lunch
in a lunch box or a lunch bag.
Serve more whole grains.
Choose healthy wholegrain
bread, small sandwich buns tor-
tillas, pitas, bagels or crackers.
Lower the fat content.
Choose tuna packed in water
instead of oil, low/reduced fat
mayonnaise, reduced fat milk.
Choose a variety of veg-
etables when making sand-
wiches or salads and be cre-
ative! For example, slice them
indifferent shapes and sizes
and use a variety or different
colours.
Choose a variety of fruits
(fresh & dried). Make fruits
finger foods. For example, peel
oranges and section them.
Slice apples. Just pour
lime/lemon juice on them to
prevent browning.
Select different types of
flavours of low-fat/non-fat
yogurt. You can add fruit (fresh


who don't eat breakfast may
find it harder to settle to do


LIGHTEN UP & LIVE HEALTHY


* ARE you providing the right types and amounts of food your children
need for energy and healthy growth and development?


(Posed by model)


Storewide

Village Road Ph.394-2378


Wash away

those back-to-

school blues

* By SARAH SIMPSON

GOING back to school
can bring about teenage
breakouts associated with
the stress of busy schedules
and trying to fit in home-
work with all the fun of
after-school activities.
Just a fact of teenage life
you say? Not so!
Advances in both pro-
fessional treatments and at-
home products can dra-
matically clear teenage
skin, but beware of unlike-
ly-sounding promises from
companies preying on
teenage insecurities.
Many of these products
contain inexpensive ingre-
dients like SD alcohol, syn-
thetic colourants and arti-
ficial fragrance all of
these should be avoided, as
they can further sensitise
the skin if left untreated,
leaving scars long after
puberty is over.
Your skin care profes-
sional can help you identify
the best course of action
with a free skin analysis
and will advise you
whether.to get a dermatol-
ogist involved or acne med-
ication. Also, they can rec-
ommend an at-home skin
care routine and profes-
sional treatments appro-
priate for your skin.
Sarah Simpson is a
medical skin care specialist
at the Dermal Clinic at the
Walk In Medical Clinic
Sandyport. This informa-
tion was taken from the
Dermalogica website. For
more information log on to
www. dermalogica.com.


TUESDAY, AUGUST 30, 2005, PAGE 3C


THE TRIBUNE


SEE page 6C







PAGE 40,TUESDAYAUGUSTCOM30,C2005ATHEETRIBUN I


irf-


n-


9 .4


0*


-U

-4

a


o


C So. ~-


'V

I. S~.


-PW


"Oct


lIO


I,
6~


*


-


a


* _


-I.


0,1


* 0 Mf -u


.-saw 4b quoen

q-m ft -
41 M -gme


I ..__


-o qu e 0


-4w~.
*


- e~ .
* -


W^ C- --
. jJS m -.."- 0 "---" --:-


-. "Copyrighted Material 7-

'F rSyndicated Content .

Available' from Commercial News Providers"'


S


MS


N -


T I
OflS
*Ui


* m


I i


*
NoI
*

D I


0 Sdoma* z .'411 00
qb 0 -qpw 0 Ow 0 4 dM ag4w ,
41,- qlow,0 Ow 49000 olo0 o.D,.
S mq w seem oSo *
aw ,w --,eqO 0 W - o0
- * o ** *o

mon m o 1 0
* * ****- -
go 0 4M aSO "ND Mo 0 00
. a O0S low 040 04M0,O,. *o s

G oo -ama
o e e
- le*** me
*. 0 *O *


**
SO.

* *


0

p


'j


b e


0


-AD o O


-p 0m* m s0


_ _I


PAGE 4C, TUESDAY, AUGUST 30, 2005


THE TRIBUNE


amob


o


i*
;X


a
ST


u


too& r*


bk


LL*q^


ML
i&
6b log








THE RIBNE TESDY, AGUS 30,200,WPAEA5


:=
=
olm


McQueen to





terrorism m 0


attend food






workshop


* By PETURA BURROWS
Tribune Feature Writer
Making sure
food is free
of contami-
nation is not
the only
concern of suppliers and han-
dlers these days. Now there
are fears that the next terror
attack in 'any country could
involve its food supply
through mass poisoning,
according to a local microbi-
ologist.
And the Bahamas is no
exception, says Ricardo
McQueen, head of Bahamas
Food and Health Safety.
Mr McQueen, who notes
that a large percentage of the
Bahamas' food supply is
imported from the US, will
attend an upcoming workshop
on food terrorism, in Talla-
hassee, Florida. The workshop
will focus on how to detect
and test contaminated prod-
ucts.
In the event that there is an
attack on America's food sup-
ply, for example, the Bahamas
will be affected, he says.
"The mind of a terrorist is
such that wherever he goes he
wants to make a serious
impact," Mr McQueen told
Tribune Health. "What they
always try to achieve is mass-
es. They want it to affect the
global arena and that is what
we are afraid of.
"One of the things that
could happen is that if we are
doing a lot of imports, which
we are because.a very high


percentage of our food still
comes from outside the
Bahamas, and (terrorists) are
able to get in contact with
those products and bring them
here and the persons who
receive it are not trained on
how to test these products, we
could be in danger."
Franchised restaurants and
those in the hotel industry that
receive bulk goods from
abroad can detect contami-
nated goods long before they
reach the consumer's plate, if
proper inspection measures
are taken, says Mr McQueen.
Every five to six "samples".
or batches, of food brought in
should be tested, he says.
"There needs to be routine
random testing. There just
needs to be some serious mon-
itoring. If we are not doing
that then the possibility of us
becoming infected is going to
be very high."
The Department of Public
Health recently passed a
mandatory training pro-
gramme for all individuals iu
the fo.Ldand beverage' ind.is,.
try. Participants are required
to take a four-h11lur course and
upon completion receive a
health certificate that is valid
for one year.
But Mr McQueen says that
the responsibility of any good
restaurant is to put its own
"controls" in place.
"Within your restaurant,
you need to have an internal
audit going on where your
staff and your managers are
making sure that the flow of
food is in such a way that


there is no indication of cont- That is how you really prevent
amination, which could cause any food borne diseases to
some serious issues. Then you make sure that your system is
have the government which is solid," says Mr McQueen.
responsible for the nation... Relying on only one of
And then an external person those agencies of inspection
who is not attached to gov- may prove to be a disadvan-
ernment and not attached to tage, says Mr McQueen, since
your facility that comes in. internal auditors may be
biased and the government
does not have sufficient man-
power to police the hundreds
of restaurants in the country.
Mr McQueen believes that


many restaurants may not be
very concerned with the qual-
ity of food they serve to the
public. "In the Bahamas we
don't take quality seriously.
We speak about quality but
we don't take it seriously.
That's a major problem I find
with a lot of establishments
here. You go in and you see a
lot of problems and the estab-
lishment, for the most part,
they would leave it.... I think
we put a lot of concentration
on making the dollar but we
don't want to take that dollar
and spend it to make sure that
our product is of quality."
While those persons who
serve food on a commercial
basis should be concerned
about proper food handling,
those preparing food at home
should also be concerned.
When it comes to handling
meat, temperature is very
important in reducing health
risks. Meat that has been sit-
ting in a temperature between
35 F and 140 F for more than
four hours should not be eat-
;en.,This is thep "temperature
danger z '". whete bacteria
and other food borne illnesses
flourish. But any meat falling.
in a temperature above or
below that range is safe, says
Mr McQueen.
When thawing meat, there
is a proper way to go about it
which minimises the risk of
food contamination, he points
out. One way is the use of the
microwave. But here, the food
should be prepared immedi-
ately after it is thawed.
Or run water (700 F) over
the meat, he suggests. "Not
soaking in the water, but with
the water running over it. And
we like to take it out and leave
it (in the sink) until we come


home from work, but that's
not allowed. It sits in an envi-
ronment and then you get
time and temperature abuse,
and then microorganisms are
going to start to grow," Mr
McQueen warns.
But the best way to thaw
food is in the refrigerator, he
suggests. "So if you are really
going to plan a proper meal it
takes about two days, because
you need to take your meat
down from its frozen state, put
it in the fridge and let it thaw
out over two days."
There is also a concern with
the temperature of food in
general, says Mr McQueen.
"Cold foods should be served
cold and hot foods should be
served hot, which should
make persons very wary of
eating food that is sold out of
the back of someone's vehi-
cle.
"How can you sell food in
the back of your car when in
the back of your car you don't
have any idea what that tem-
perature is. And you have it in
the back there for hours and
the temperature danger zone
is between 35 F to 140F ?"
Most canned products are
packaged with a certain
amount of acid that is in place
to discourage the growth of
microorganisms. So after a can
has been opened the contents
should be placed in a plastic
container with a lid and then
put into the fridge. Cans
should not be stored in the
fridge.
"Remember, a can is metal
and metal does have toxins in
it after a while so you need to
be able to take it out because
when you open that can you
release that preservative (the
acid)," says Mr McQueen.


\I hI VIC a wpcr m xncd


Si< >a (jili jrh n ni


"Copyrighted Material

Syndicated Content ..0-"-.

Available from Commercial News Providers"




Irahh and thnks nrww


. -- O


S I_
-. m -
qn -


0 w w 0b


d- ft ft o


- ~ib - ow 4 -
0 .04m 0MMOEW.I
4 0 - - a m 4 1 0
0~ *-.-


THE TRIBUNE


TUESDAY, AUGUST 30, 2005, PAGE 5C


d


r


- --







PAGE 6C, TUESDAY, AUGUST 30, 2005


THE TRIBUNE


WOMAN


Going






their


- o


&f, 04 M m-


for the gold in


golden


a
- 0
S __ a.-
- ~- a
- -- S. -


-
- a. -


b .10 Wp m -


S W A w


.: -. -I,- -


. 4D. -


- a
-
a -
S -
a. 0
a a. -~ a


w 4 - -
-040


C "Copyrighted Material .


-. Syndicated Content -'- -
Available fro Commercial News Providers" -

Available from Commercial News Providers"


b a. -


- a



a. 0-e
a ~-. b
Uq


- ~ ~ a 0


. m
o md o -


.f t 40
- 4m 4b


-m 0.~t .l a


.7
. eec4,


- *- 0 -


0- ___ a a .4m


- -~ .a.
a -


a. a -
- a .
a. a -~ a.
** a. -~ a o


* a
.0 -
a a.


4D o-.6 0


-a a


a -~ -a -
0. - a -

a. 0. a. -

~ a.- a. a. ~


. a


- a f
O -mmm


a. -


-0
- a. -
a a = .a. a -
* a - - 4


- a. a


- 0. ab


S
a *. a.
- ..~ a -0 ___ -a


.* -- n
** *
* -



G- -490M =dom do


FROM page 3C


Get your blood


pressure checked


regularly


USUALLY, people with
high blood pressure experi-
ence no discomfort or out-
ward signs of trouble. For
this reason, you should get
your blood pressure
checked at every office vis-
it.
Uncontrolled, high blood
pressure increases the
chances that you will have a
heart attack, a stroke or kid-
ney failure.
Many who have high
blood pressure don't know
it. Worse yet, nine of ten
people who know their
blood pressures are too high
are doing nothing to try to
control it.
The amazing part is high
blood pressure is one of the
easiest health problems to
control.
To control high blood
pressure:


If you are overweight,
lose weight;
stay at a healthy weight;
don't smoke;
avoid secondhand
smoke;
limit alcohol use;
follow the "DASH"
(Dietary Approaches to
Stop Hypertension) diet;
get regular exercise, try
to do at least 30 minutes of
exercise a day;
learn to handle stress;
if you are a woman, talk
to your doctor about oral
contraceptives and blood
pressure;
monitor your blood
pressure regularly;
take medicine as pre-
scribed and;
don't skip your pills
because you feel fine.
Source: Doctors
Hospital


or dried) or nuts, even cereal to it.
Encourage milk and water drinks, they
are the best drinks for every day. Children
may enjoy water more with a slice of
orange or lemon or ice blocks in it. Try
not to let your children have drinks just
before meals (especially sodas and sweet
drinks) because these fill them up and
make them want to eat less of the foods
that they need.
Junk food should not occur on your
shopping list too regularly.
Don't keep foods like sodas, sweet
drinks, biscuits and chips in the house. Buy
them just for special occasions if you need
to.

Here are some lunch ideas:
Sandwich with lettuce, tomatoes, egg
salad, cheese salad, tuna salad, turkey slices
or grilled burgers (beef or vegetarian), a
fruit or fruit salad/cocktail.
Nut and dried fruits, sandwich or
crackers, milk or yogurt.
Pack a frozen unsweetened juice or
milk and water.
Chicken wing/drum stick with
rice/rolls/potato, carrots and sweet peas
and an unsweetened fruit juice.
Fish sticks with potato wedges and
vegetable salad/cherry tomatoes.
Sandwich, fruit (melon cubes or slices)
and cookies (e.g. oatmeal cookies) or
baked potato chips or popcorn
Banana nut bread, cornbread or pump-
kin bread, with a fruit, yogurt, nuts.
Cheese or peanut butter and crackers,
a fruit (kiwi slices) and milk.
Pasta salad (with/without meat), a fruit
(grapes) and an unsweetened fruit juice
or milk
Soup with crackers/roll, baby carrots,
fruit (peaches). -
If your child/children buy lunch at
school encourage them to choose healthy


choices. Keep in mind that pre-packaged
lunches may be convenient, but they are
often higher in fat, sugar and calories than
meals that you might prepare yourself,
plus they are more expensive.

Snack time
Children and adolescents often cannot
eat enough at three meals a day to satisfy
their hunger and provide all of the nutri-
ents they need. Therefore, snacks can be
eaten to provide the additional energy and
nutrients they need. However, these should
be healthy snacks and should be planned as
a part of the day's diet.
Mid-morning and mid-afternoon are
good times to offer snacks. Avoid snacks
that are high sugar, fatty and salty snacks,
such as candy, chips and sodas.

Here are some examples of healthy
snacks:
Low-fat popcorn
Granola bars
Yogurt with/without fruit
Pretzels
Crackers
Fruit snacks
Cheese and crackers
Unsweetened fruit juices
Baked chips
Cookies (fig bars)
Graham crackers
Gingersnaps
Vanilla wafers
Pieces of vegetable carrot and celery
sticks, etc.
Peanut butter, jam, jelly sandwiches
Fresh cr dried fruit
Wheatables
Wheat thins
Baked tortilla chips
Rice cakes
Trail mix
Cereal


Cereal bars
Fruit smoothies
Yogurt drinks

Keeping lunch safe
Lunch bags, boxes and containers should
be washed each day in hot soapy water.
Do not use the same paper bag two days
in a row.
Be sure to wrap the sandwich well in
plastic wrap, aluminum foil or plastic sand-
wich bag, plastic sandwich (e.g. Glad, Tup-
perware) container.
As far as possible separate different
foods. For example, don't put meats and
fruit salad together in the same container.
Pack frozen water, unsweetened fruit
juices and milk to keep the lunch contain-
er cool.
Encourage your children to wash their
hands before and after eating and after
going to the toilet.
Why should your children eat healthy?
Explain to them why. Show them the
results of having a healthy and unhealthy
lifestyle. Research shows that when a
child's nutritional needs are met, he/she
is more attentive in class, has better atten-
dance, fewer disciplinary problems, active-
ly participates in the education experience
which benefits him/her, his/her fellow stu-
dents, and the entire school community, is
sick less often, and is more creative.
While it may be a challenge in making
the switch to a healthier lifestyle, don't
give up. Focus on small, gradual changes.
These help form practices that can last a
lifetime. Encourage your child to influ-
ence his/her friend's eating habits.
Please apply these principles to other
meals. Remember that the best way to sus-
tain good nutrition throughout adolescence
and adult life is to learn it while we are
young.


years


-.4b .-.0


- 0 0 -O


. 01 -- .b -


- 4a a qm.


%* .,-a di. ."
411. 4m MD. -


- ~0


-mb a4


o a a
- S S -
a .~ - -


- -


- I


---------


.rob


'11111W -


o 0


amlalmdme





I 'I I


III


* *s* 3?. ?tjt~I.e
~ *93g Og..~


9~g
6@


illttls *l.


a 0 .


!" .1 I lltt ll.S


tI 116114


*4


t -;


60.
e 0.


:','


,I .8 96 1 4.8.,
110,114 lll16

it'sttll**


opI'




0pp


I
44

S:


ii


14


91


,I


'4


.4


hted N


A
p.V


vailable 1
4 I


a


I


I


Syndicated Co
From Commercial


"1


d,


0 I


U1


late
nte
New


5 5 0 *

' Id
.!b) .iS.


* a
* a
* U
S
'U


I

a.

&:


rialI


nt.,s id
is Providers
*J 1


I


I'I tr'o' s I I ,lot"I *ttt
* **


* *


1:f0


,, 'S's., Sq
S


*o~ *9.6
0*


' g i4!tolqill1.ioIu uItl.ot tgl 'O i*itiS ll It l:Stt .8 i .


04 o** **


* se'i'1
* 4
-~


0

:"

0,*
I
I
(III


.*'!'


"S
S


9~ t


.O1:s.t~..
00* 0


11[2
1 *11


i 1 6


I o* **


1"04


0. l*"l pti 11 1.*1II (ij ,I

* I lt!l't

*.
*


'I


'1(


-41


fi''l


61







PAG 8, UEDAYAAGUTD0,200ITEGRIUN


on gardening


'Bamboo is



an important



plant in the



Far East' i


local store
sells bamboo
plants that are
plaited or
formed into
loops to make an attractive
presentation. I received one
for Valentine's Day this year
and gave it to my daughters
to keep watered. It is now
dead. I recently replaced it,
determining to water it myself,
and thought that while I was
at it I might as well use bam-
boo as this week's topic.
Bamboo is technically a
grass and there are almost
1,000 different species, some
growing to 120 feet tall. They
are grown from both rhizomes
and seeds and all share the
characteristic joints, or nodes,
that appear at regular inter-
vals along the length of the
stem. Once above ground
each bamboo shoot is called
a culm. The bamboo shoots
of Chinese cuisine are shoots
that have just broken ground,
rather like asparagus.
Bamboo is an important
plant in the Far East. Besides
bamboo shoots it is used for
buildings, furniture, scaffold-
ing musical instruments, bas-
kets, chopsticks, fishing rods
and dozens more applications.
It is a water-loving plant that
grows along the edges of trop-
ical rivers. The ornamental
bamboos require, according
to the instructions, only water
to allow them to grow. I think
I'll add a drop or two of weak
orchid food now and then.


boo for a few years until the
seeds germinate and produce
large enough plants to be of
commercial use. The bamboos
all flower at the same time in
Japan, China, India and
Indonesia (the main bamboo-
growing countries), so you
can't import from anywhere
else.
Favours


Copyrighted Material,

yindi ted Content

Available from'CommerciaL News Providers"


V


%


rMw


.r -
- mno4=


c~CIC~I~


- ~


THE TRIBUNE


PAGE 8C, TUESDAY, AUGUST 30, 2005


Ir r


.o 4 94w *


0
M1 ]MN







O
action

ssin

or


1


I




University of Florida Home Page
© 2004 - 2010 University of Florida George A. Smathers Libraries.
All rights reserved.

Acceptable Use, Copyright, and Disclaimer Statement
Last updated October 10, 2010 - - mvs