The Gainesville sun ( December 23, 1907 )

MISSING IMAGE

Material Information

Title:
The Gainesville sun
Uniform Title:
Gainesville sun
Gainesville sun (Gainesville, Fla. 1903)
Alternate Title:
Twice-a-week sun
Sun
Physical Description:
Newspaper
Language:
English
Publisher:
H.H. McCreary
Place of Publication:
Gainesville, Fla.
Gainesville Fla
Creation Date:
December 23, 1907
Frequency:
semiweekly
regular

Subjects

Subjects / Keywords:
Newspapers -- Gainesville (Fla.)   ( lcsh )
Newspapers -- Alachua County (Fla.)   ( lcsh )
Genre:
newspaper   ( marcgt )
newspaper   ( sobekcm )
Spatial Coverage:
United States -- Florida -- Alachua -- Gainesville
Coordinates:
29.665245 x -82.336097 ( Place of Publication )

Notes

Additional Physical Form:
Archived Monday issues are available in digital format as part of the Library of Congress Chronicling America online collection; these issues have been reproduced within the run of the daily ed. for the years <1905-1909> when the daily was not published on Mondays.
General Note:
Description based on: Vol. 22, no. 72 (Apr. 9, 1903).

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
All applicable rights reserved by the source institution and holding location.
Resource Identifier:
oclc - 32993937
alephbibnum - 002027045
lccn - sn 95026969
lccn - sn 95026969
System ID:
UF00079930:00605

Related Items

Related Items:
Gainesville daily sun (Gainesville, Fla. : 1903)
Preceded by:
Twice-a-week sun (Gainesville, Fla.)

Full Text














--- %






SPublished. Twice a Week--Monday and Thursday


VO)L XX VII1. NO. 4I 1 6AINESVILLE,_FLORMIA. MO.N PA V. i' FM BI) E, h7 -4 NEL)LA



~ ~P R$O S__ERIHED SALOONS TO GLOSE BOON. -IN A FGLOST A FINE DOG.A CH ITS R

In___ Georgia on Jan. lat. Fin -ain of C. F.Goodman,
1Atlarlta, Di),,. 28-ened. there m' So, F ( I
hifre Family Burne to Deat -dI b iIin Atlanta. und-. r the The esn IdadDzn~ t ill Ili,, il ti.. 2 o of 1,0 Raid L1V V

Near Boston, Mast. saloti.,rwenty~three eer Falooons, Injuried. i t IiI Iid an Oriental Qvoirlr,
_______ ~ie wholesale liquor houses ,.'__aLn" two wholesale beerr huuses.n t a d '.
MUSBAND, WIFE, 3 CHILDREN (if thi-e there are sixty-one whisky ACCIDENT NEAR CAMDEN, N, J. m':i sahril-~tidl cff,' R EGULAR POLICE POWER
_____Isaah'ars for white people arid twenty- tiii H i iwi' If I1iii1 01(1 ___ii 'me of the Fire Was Several Miles Fl. o ere;svnenbe atal Rear-End Collis on Occurs on the IIReport that a Cattle
loons foi, whites, and six for flegToes. fil sil'- cf' tit' ia,,.4,itii oif th.- orilnaiicl Pe
F rom the Center of the City, and Wi7th the saloons and wholesale Ellevated Tracks of the Pennsylvania 'U\ ilu" ft.rIwhrIjlg at Been Fatally Wound. R
Upon the Arrival of the Fireman, houses, one brewery will go out of Rala-ieAd. oteDfiu.Il~l''iihraI'IZ':lt' if ratt3e nr
Sthe House Was a Mass of Fire. buiess of toesacwlluee.n tll' Attack. ii~. I ';>
with the brewery Is not yet known, as ties of RescueAio~ \\lil \%il c- Atack
210olifte Dec. 28.-4ve persons were thes propietors decline to give out Caw~en, N. J'., I,, !'. 28. "ll ree au~iti aii- Ito, %,- Pi 'r *ite ortliknd, Greg., 1),
burned to death In AL fire whiohbdo- an,1Y Infrain Veirsna were killed ;I:, I more than a 'anil :tff.-tiitn;tt-, ;wl !;d I,, mi sed patch to the Oreguon;
Mloyed the house of John Clark Lt With tho closing of ttb. whisky dozen others were irij ired In a rear- 'all% I roiill.,. bridge, says:
Watertown, a suburb, early Friday. Ilous will come the cutting down of end collision on the -,evated tracks Mu.(u?,t,;itiely cauhe they bvlie
veymembeir of the Clark family must the city's receipts from licenses to of the Pennliiylvania hilway a short Il4irfoI n itrrt an is- ert citizen had betzL .
490h in the fia-nis the amount of $131,112.50, the exact' I*aefo h tto nti iy iin -~- -tl hns etuat
Theded re;amun ofwhchwaspad ntoth ctyT'he cars were N) bad'v smashed that edand wrecked the 0)
John Clwa, bUi wite arnd thir three treasury from that source last year. it wlI -be several hou i before tile ex- laeCrsi~sngt
~~It Is estimated that the amount of aI ubro esncuh.i h BARBER-GODWIN. teCrtnasih.
ql4'ren, John, aged lit li'l11ip, aged act___ nubro R~n ..uh nteestaurants3 and i Li
* .ad Doors, aged 2. capital which has been !nves."'id In wreck -will e ~Ritwr> Fire added iahdndors%,.:
Ie games boad made great beadiway th~e whisky busib ea in Atlanta Is tW the difficultles, of ithe work of res- tudyl-- .17 h-lfitrsued ndo bds, ..
*' fiart discovered by a neighbor, between $750,000 anid $1,000,000. Cue hoi. Ii-. r tiresfrntes.o uldn
mbrtly after 1 o'clock. Much of this, It Is said, will be in- The trains lnv-olv-e,1 -ere the express ~ .~ i atrau ~ The regular police (if
nTe, house -was about 2 miles from vested In the city- In other enterprises. fillim Atlantic City ad the i'eomber- fin.,wtIo-drleral .oi4s\i 's and a bri-,,
kla oenter of the town an,% by tjhe BSme will be withdrawn to other, ton accomunodiat ion train. Thf'-e uIlona lii 0i dvti I Pow'-ta obecL
~me the ~owen r"~:~be claiesee, Ielde. as several of the whisky deal-jtan eedei i adnsa ud~~ohlt~terf
Me houses Lad bee-ni burned almost to, ers have given notice that they would Uion at 8:21 a. m. Ttiere was a very liittL tIi' .tii'iit> Astory was etcic .
14 hAe ground. t carry on t4~ stunos businosos In (Chat- ickfgwo h c.l-i etr,.W,!ll ~ mtawl nvii
Itte firemen were able to loocalte the tan(Moogi, Jw.ksdifllille and other cities. The express train %%as ii. a, .IerII of T- to t 1 w had hi-en fatally-'~ 2
0=96 Of the 1 1111h-t andi two boys, The willing out of the whisky busi-tohg'aarr.-wp-rcraii011 ietel ill IIin- i'>,lnua Criu.
but the Tnothor atil little girl were not ness all at onep t irne willI cause quite thre baoahes Cars, o., paweo r \ ili ii!f .i i ii norI any Crousl (-I..
omu until the rinsm of the house hail a change in one respect of the ci t to trin consisad of a vxininal au 4i4ii ; ti Iil fr!l 'SI''' b uto any th olnie elo'o
cooled sufficiently to p'ri't a niore busiss affairs. This was done to a and four coaches. Mr I 1i 1, 1.i :1 1 il '111,gl te t~eand two Oril:c
thorougli search. Certain extent once before when lul- both trails, It Is F 'ldd, were run- riar; kli M -etA id \i. fill ite-;in hois e; e charged with. nl::
The house was valiwintiat lln.000. ton county went dry uidf-r local op-, ning catilouisly, as they 8pprl~aC!evd ti.t ill tL I,11ii'mt liar il .'n ;u Ali indl.Lpiant mob :'.
Stein, but then the inte houges an-I a t I siaton. The enigineeor oif thr, %\111t, ti,. :iiid i in ~t-a tw*r the n->raurant and ti,:tASGYPSY CAMP ROBBED. the wlole-inleP whisky detlerg wliomo Ii- (%I JeIto, 1. ('1 trails, he(ia uso of the ft g, d I.,t; ..2 'I:; iu-cI v, 1! J!
-:~ ~ ~ ~ ~ ~ ~~ ~ec ranln overoha koertinTieepim ft open for some dW1 not w-e the Atolmic Cl!y train, 'it 110i 1\4 Ii. .ttii- ;twi 1,00t111i Sildiii SOYflO oil( IA
Own ehohlClbainTivstm fe prohibition wenft Into) ef Is sail, until he wits ci 111trw)[ it. -uhtj~- -.I~;~iiat he nahd a f rwi.:
Steal Large Sum. fect. .ext %Ve'dnt-',tay the city ie utne h rhsdwbt t1C ot 1d-- l' l o1n h rw a

ey com ~..LA unei' I -1*ih nit~'* rr- j was toote td' to 1.n t l hil andi qtol'->lie Tahe- ui n esfrtt I trains earne together wih con- I aad whin- te door% hat *huig dow'n, oil (tttiliiiit'ft )f iii- '1,,-11 HA YAMT NPOKTidirrable fore, 'Iho- tender of thp slhow, ;iiA i ;n\ '. 11:0ai 14) 11(i
another camnp. Th.i L:171e It j-- I'lb'o a t1~~e h fttt ta.-i u, ,ioi and .11>1
Uinder &trust of hiavin4 rxun~w i-i r ofi Stick Exploded, 0Slowing Boy's Body Perrierto tiUi tlung *Jie tbers'itllri, -.sna-ie
1$8.21 G. I Through Parlor Window, anI inuigaWes ou. Tera f-\Iiul:.i.A ~Ttitdii and -Dora Plareq lq qw-i-nrlu of a band of: ivrin;4hani, Ala.-. 1vc. S. ---l):an cii ofth Atlantic City PV s wa 1,.lh rant W jtcoplptetyI
11 fu t a rlat n p ,Ih.- (' i~j ( l o th e i-0 !r e i ai o .i~ 15 'i ) e ~m old iw )Z (,o a % il ti w r et ke ti. T h -% w iir -k a g o i nim it diat e 1- S 2i I i t t in t!,,. i I p P t l d rinq d th e cro w
of ths eki .ng thol a ir tn Cil' S111 at Fratt (t), a uilniig &-.u 2'ro Vi tikk fire fromt the locom otive and the ii -rl 1 nl a. irti -! ofd it e rw l.
toy s kngpe it a han d of pigi ig p 1 r iti lan ~% h r o a y m n poliio and fire departmnilrta of Cam- (4f K. I i~ d ~ te s of p rlin g. V.
en- at. ....nt -I.~ .(c tha tI,- collio lipr-e- rollin-i -











THE cTAINESVILLE SUN: DECEMBER O1)7_______LOVELACE-DEMPSEYi. EXRSIFIC CIE
Narigeo To oulr ongPe- COMFORTING WORDS I EPESOFC CIE
_______fTwopla ougPe- Agent King and His Force Gave Expie In Gainesville Thursday. I celent Service During Holidays.
One (I tI' .~~tpest nwrrage'i or. Many a Fboi ida lit iscioil Will 'IIil:4v1t, oil (.%k~111'"tI
citirrinzg If)ii .1 : for szoip [li( 'a, ; C,~i 1 t .'I lit S '2.


T a: i i I 1, 1


Theis Edi nh fit tll. i f ie, aI *t(L.i, l ) it hU I m I II,",i

Mrs. 8ti, 1. a Df-li'iii ,iftiii A.ftr oiat- sei. of 4tl19 W r4 tet uo.,LIaII~ 1 IA I ~ [I(' ONS L OEC
oe ofd mncitri ,' pa Eas Set l,- ill prSu tI' lciao-, t l ti ho d to ouit. toewh I wl i~ t t i
ontract injri'fh milf (it, il u isa oiii Fl. ny- o od t i ie h(i l i ,i U E C R IONS, GALLS, BRUISES, co:N!
cotatigiati;lig ji''T'itt hDas "From' illy experience with a.- e*~vii te it(- no, t t! i I i t I'. i htId IIyIt ED MlUSCLES, LAME BAMH STIFF JOINTS, FROSTLi. :
oeremonyu' occurrt' Pt:i )~~shw I can strongly .T
eeeoy ofro t2:0 ftv recunmid ti in to anyone In nop led tii.' to rf-izi a h C ho ,l(r BURNS, SCALDS, ETCTI. J. Nixon of Ii-' First Methodist of a good I:,,.di( tue for the kidneys. her wui church offiliathIn m. I in int-tdlately ;tfto r Kidnoy co riplaint and backache Tt lito; I. Iof 4; ciit-%Villet- lpronto ...rvs u an
the ceremony tlit' lia~llpy y(.11iioplo. caused lit,- ufft-riiljg at iiiter~ als for (late. tte e'v'i'f an drve ou~'IiI ~i EERTSth Pn. ksnsteFirusT
y v i i. TI. first or second attac;kI.
took the A. C. I_. iraill -u tetoni, (lidRTE tuheibta ~e ~tl yg tiIh~l iA'tAti ~t t 1'~afe cPz ,:.r. c t Bcosdens~ the us Tol.L
? Where tlI, %%- wit! rim kC' t li eIr fuitutre Lliey l~r ft N orse and tit titrnes laid ijioda t 11 for b' ome. Thlty ,~ y 'i jtint'l at fi t'- & il U;, I could hard!y wal k lind it
Ition by a rilii-rl of I litir foiling frlinds a 1ii:'iicult matter to -tralghiten up JUTC COM 'S OU .
~'oaseijti I ~i hmal a afto'r :toopdng, while the kidney, secre- UTC OMNSCUT tliff. were irregular and unnatural. -114 fI1,%lofonfil os(fdp ~ta xwineIknow tharryhis CURED O F PARALYSIS
'r'l r wualex~erlemceI tht titi Con,:ea led We-p (-7", Discharged. here, is nlow In li t filhts of titf' t~'' rti,tdy cani be depended upon to fill- W .PieP .TuTxs rts
laeLnb--CPrrl..irw I i ill filie represeuntations made for it."' Ahtrw IZ 11;11 :1 1 rlit n.l wife had becu suffering five years with paritlis ;a.
28 i fli~g erri;it'.. reto. jI JF sale by all dealers. Price r,0 ltiTll# hi t I 'l I ai '' icr arm, wlien I wt s persuaded to u~ie Btla rd s
ollrItt; ili of Xcii'j ti l (util cents, 1"oster-M ilburil Co., Bffalo, .V- tI.,.1 .i'StwIiietwihelc~ opeecr
tie8-, liavii,. 1fat IlbIIds Iti',', Ifl iNew York, solo agents for the United I. I' Sii.. o i L inimas uent o oldc soesc afrotpbte cures. I
Js a brother (A Mi., 1). M'loirl(14:i Sttes. 11ill .1; ('lit Iil~ hI? I uos It (1,.es the work."
Til brd. atit TI('('iiti'll-iedf .iiii Remember tile name ---io-an's-and lipoti ht-ali i.. 1!f 1( it t 1, (r.:1, F R
Thdy, rie tIk no nither.f flit'on "til', N't '''ii :' *S LlN lt.[ USE ALL SUI3STITUTES
I~la',u1 u(le of ill if, f1,1lit th~ti lat I t-It 1144 it w t 1-1,1\ 'll THRE E SUZZ5.: 35ce 50C alld $ 1.00

<~f a most alilblo. (11 pw'liion I.' i-lds THIS MAN STOLE CLOTH-ES. ioril'tt'l-n- liii i i if or,I. I f-.1
ill. '! lilie' Mathew Scofield Took Trousers and fil. ;ti4 Sit. r.L LOUIS U.. S.A.
__________i__o-r hll Coat and Vcst, and Was Arrested. laiili'. t~ilt'i& t ;!'ttL (';I['

MR. BENJAMIN PLEASED. lil aII.r Ilio 1, 4 .11 lilOl ~l (iie '.'lt'-i*-l a llb till Itl :1 of I : itfilltt1
e fi I I IuI, iII.wa;s tIf'' 1 A ,\ Ma-slial At- n. 110 tiili hiS Illitl T!.. ('(,lilt lii I (IS.L AND RECOMMENDUD MY
Former Citizen of Gainesville Comvpli- lIotk ;iLt (1 'lof1 ,i v buthaot 1\. [:a f c-ttn o! j-4 hi..L~i Io M _* I/E 11TIO -NT
events City on Its Growth. ot'llng to til'- tlili:slliI of Nlailiv,i lt' m i; I'I I V
Arnouig 11hi'tf- vi lit h i-tt Thuiir dyIlmv ii Se' )IiIllll amitr' fltni thait hot waus :it %:i Vi'. I 1 I f ,~- %',, i i
th ii city Noia' S ii. flie,1jaI1lti of w- tue ~ill V flil, atifl tlVi'ig 14t flit, hi

M~Ir. I ft'ijm~a i I rvaIly :t lit illtti' (II No'ivr i''e I i t o l d 1fI l I f( lit' hiil l Chil ren' her ii I(' rit'itlo-' lit thiI cm~ ttiy l i lln f~in. lit' %,.t, i-lt'lth aiuul sc'tChlre
miiciiiinii'l Ifit nat Ill yt'fis. i-ing tn1 Ilt-1tI w.m :111di'~iiI at i i -i ll Fa' orjtv tori1 Itis Uri.t ( I- ',:, V-1'


salged iliti fill. ii at i t i'lt'iiui. 1 1'- l l .1.i 41,1 ".,ft :iff at I i t \k -I ii a it' ti i l i' ii, ~'I t y il" the!1


are' Idliy i lt i g t 'i'll i e 'if Mill. \Iit ih~Ilil t h i, l'a I licks neosts,. It,, au'loir ('11 tile Child i 1> 1.11(1
,\r. llt'ajuiniiii Iti I; ir jwt iotti'l,1 lll'Iis .iii l iii ; t t f lit ftii'l 's, I*. tol. it idt lt'av's him Ili a le'altli coil 4ti in.
trion NI i('.kilti\ it It Iwi. i''leti toll 11111i1 a t 1 ill~ 'Ilhisi''''t if. Iaiuie .Summic, I'remi says t;hat: HAS BEEN MADE A SPECIAL

I hre. li' ~ a' 'i i it iiiihil', I-.ii: II' i i lft Si il' ii~ ~ a( rt'ain \'erinifige' 'wh n the doctor )'itil'tI t it i \f 11111 I ll 114 n 4. ., pr If l iCl l :tI Il, i i ttd If a t Ie'. through t It had I olIC Mid fre in t he firs t

(1111A11 Ils lit 411f W ~ wolimlUNITED STATES DEPOSITORY
~~hlt'bi' tl' I' 'tififiI i te'S~iIuiirI ~i' .Iit ie'itf. AtN IM~PORTAN~T Me'EETIN~G.

illelit Ili IlII, Illi th lii lit li iI 'itfi itlThe F. E. & C. U. of A. Society Will I






lllt \ -'114 1-1 (, t2 ro w tvav.







c~~o FM Pi AA4


il( lt-il I I' f 1 11 1\ 4 f I ''lti .C' I 20SK SEDPA


I I-..'' ~ A NiF LET CFI(LF
l i~. 11 ~t il it, i Lti S [.1
AS Veul 1A e Shi' [''



II 11' .1vu -jAT r AI Cr C "' 'u r'. r c r










2 THE GAIINESVILLE SWN: D)ECE31I11R 196,b47

NK CARKCRXIS TA FUNCTIONS.
FRIENQR OF PUBIC 1 i 0 ~~rsTree n North Gainevile TuW ________112 r IS day-Ohers Held ThursdayNight.
1, E x r Lo). 1 i:4 1:... ellt crtai ti e Its (I too
esmnfrom second Distre*t E x r Li4 circht A'r dteftrred as it rule for CSOI
esmnol Ii.1 ;( ill somle iiistdiet's long,
ants Cotton Tax Returned. Snu colifNrhFrIfnsailcicrn
Feed ~ ~ ~ ~ Gtii- yorhi; !r i .' held their tree in North
ELONGS To THE PEOPLEi give it something to I v-cn ai, hall a day earlcr hr.lo\% heH v
-i Big ae n t-r. t h, vent occurring on Tted- The Kind You H v
Steuu Efr sBen ae Then it will stop fuli 2:1 dg ev''i il L tas well attended, and
StrfluulEffrtwill gro)w long h 1C:!v "'. iiiany h r !-orne and useful ptresent-, IA w ys~ u~
Have Same Refunded by the Ayeays HarVgr steonyuO'O(iilue.h'hni one i
H~ rf A y r s HitV g r is teaty w r iCr I u e h n i c n e A 'e b s P paratio lfo rA sage of This Bill-Affects Many genuine hair-food you cafl doing th: -_, right the good peoplte'fdtn ffom~oua
&.buy. It gives new life to the ofNorth ;-ainesville ar "there with Bears theBW~30
,i'rank Clark, Congressman hair,-bulbs. Yiou save what rlgos;-dohrltl ifrne o
tihe secondd District, is continual- hair you have, and get more, nefr,*:hmkn ntigasc in tr
kill, aftker the interests of his to.Adi ep'~ zl ces th kin u nde te.g a i;Snaur
tet.He has introduced sev- Ooo. An tkesie Tl es~hur.they unerotae Sbbt
measures at the present session clean and healthy. stonl Thu !ay Frteo thurbbah a ~sand &5t COSaU OI of
grcss,.one of the most import- The best kind of atestimonial- heold a a.v Fit Mth oduch it which loptv rfua
"old fo vrsiaty, heldt. the chrh at whc N cOTIC.
ing a bill to provide for the re- 060113011111 ~ p4:att~rpie ~r~r1
g of taxs illeglly colected b M"d. ..C.Aytw Oo.L,:W' kl&Lu- the little f'Iks and many older ones_____g~~~~~~ ~ ~ ~ oftxsilglycletdb 0mn t eof bad a big time, with plenty of jpresnited States Government during f SARS~k;ARLLA.
fte te wrwhch il ha benV e :_.S ent-s. etc. So
ed to the committee on war j~je Ili the oniftg the First Baptist
-'church to ired the children of its
the informlation ofraesof Sunday solan old-ttime Christmasn
Sun. the bill appears in full as States, and become a part of the rua tre.ft"ihSnaCas svr
S: ~school fund of the respective States.1 mnuch Ii -idence. This tree was
1)rvie efudig "Sec. 5. That this act shall take Igiven at tYi, opera house, and was well
e ri :tful owners, their heirs or adapoaoftePeiet upn HlTriyEisplchchwl lijon, Sour StOMKI.Diambo,
relrt~eltatve, te pocedsofits becoming a law without such all- hold it., 'lristmas tree oil Tuesday, wmiov~in.eiih
ttoii tax illegally collected by the prvl"and tho Presbyterians will also give m aid Loss oFSL5E P F or Ove r
d States fromi the people of theiroa. ___________-actaanhtdte S Sinlrso
I state, inl the years 1803, 1S64, MASONS ELECT OFFICERS. Tt'i"s intno
for the disliosition of such as may Will Hold Public Installation in Jan- Thirt Y ears

li naed b h ent n uary-Big Time Anticipated. Colored Woman, Charged With Sell.t
eit tRer b ties ofnte an Gainesville Lodge No. 41, F-. and A. Ing Liquor, Heavily Fined.
o~' oif Alrnt iatine Congrhes a- It., held a most interesting meeting ('hargti %%v ith selling liquor w ithout
1..' Wednesday evening ait which officers a lict'i- nmd against the laws of LATCP FWAP9
ill ~rot~oing of iletaxoiltor the ensuing year were elected as A la hu i (4inty, Estelle Know ler, a col- CSOI IV
T i. ly, cell ected from the p eo. follows: (tred i wi;ii w vho is well known Ii this 71061 ""PANTem~m. flew wor of".
ft!!, t-ral States of the Unioti It. T. Schafer, WV. NI.; NV. T. Pound. cit, \a wa- araigned Ii the city court H ive nt rneiut of the Un ited S. WV.; Lee Graham, J1. W.; A. MTlesday% ni-n'ring, when she received
it-e years 1,,r,3, 1S1 I Cu shot an, treasurer; itohert NI iCle I t he ii .teal p ntence-$.ti) and costs.
ii i 1111 1~ ndr 'inl 'an cecrotary. Thet re-nai itin g oflic.,rs 'Ihim Ci h. r attorney, Evans Halle,
ilhe arts of Coitgre~zs are to he alipoittd at a later date,. .h- alti-aI. 11 the case, giving bond for
Ifor the levy and ('01-!.and nearly in January it i,; proposed her aillieotrtnce ill the circuit court.
ii 1~ a iid which to hoet a l'ntleil plbi intllto an Th was ~ ~ ~~ later a rraigne'dIHD A MNICCO
ta\ an wh c sa I han ft t as officers of the Royal ArchI liji Ci a i g of lasci viouisness, and H IMi C O
4 ~ .: .1 tiy 1 A 3 t 1 0 ; 2 d o ga r e t w i l l a lI s o b e Ii ns t a l l o d"tt li a s f i p 'i l V nt n d c o s t s T h i s c a s e
1,;1 I. I .reliec 1t I ~ f14y h al e tf Il C' \I ,;i:( ; w dGA N S I L F .
Ilie rightful owners, the-ir ii'eI'tiio'oet t(lla a aaleacae.
I ~ ~ ~ al to soartarv at this iiieetiiig \N' s I4i5 ~ ~'tc tti~ ~ i leci $t iiitt 'costs. t t of Il tl1 I in Id it ttt
tii~tof 'limsisherbya ciminiertt, ats for tit, least twe-nty Oer I t and Wni. (;ritnge'r, both
~ f1:tIal(enlit'~ years heo has filled this t..'-poisilh, le (:ir.4cd ith irr inYlg ('cuI(t vled( A Lag olda trg Room fo Curing Met
.!r. ,(i tand de't-rniu floitIom. 1)lle thle leeiges't inl service 1'oeeu. sti'liive'ai- to liiiy litSt r geM e t
h I, 1;t 1111% )ie tiled il h (if -t i re t-e(-rf t wy n inl the. c-it.\ ~- I ni CCl (' t, ;10 .

1tat' 1hj1. n xpdl ol l a li ;11, i tiitle'iL'Cie'' i.'''iL tii When to Go Home. 6 -t'' flit. thte FA\ 10 1 FN a. l t Ili-w~ [1,1t 14 IaaI)a' I tti l-e ee4tc1
I I 't.' ts ('llti''~ ~ thi fait \0! iittt ('ilii-et f-t int ti Friati Tilt- iflofften Ondl) !ianite'r ltit L ii, filoit (if S'~ .\tr a a1,14Inelat I .Jin't W l.e't oif
r ~ h. ir.. eei- legal rcpr, ili' t %\ Wa wh n tilte'e (Cut, gob hone. WhIiCI )-mi- -'td at r! ttjti,thi' r (1!t TOWN TEAM VICTORIOUS. 1'otit 'iensuatioeut ge !'ee. W~hen v'oni ___________________I:Ivh~ ti ii a I- wmit fun, go hoitw. Nhpn ymu %atlt










VITE GATIESVILLE SUN: PEE3M .0 1907



NGRESMAN LARK NEWS OF CITY AND

ISSTILL CTIVE COUNTY CONDENSED

O Tu#dt t' -nig, at thf home I JHE
*In Xatter of Having Refunded of tb 0. P, \ Nrt Cri-____& ;*the Taxes Collecteld on Cotton. tia chrc #,x (t to, gi%, i o. %~e -- o fsu iwl)t-r, t h e 1, roc.ed #* s hirl will
-HE PRESENTS A RESOLUTION h-, d-''otd to tit, -hvirch. Functionls
____________givo-in by t h-, goodl u i's )f t his church
k ~Following the Bill Providing for the are always succ#-ssful, h, nc* i a iiccess Hpi e sadPopr t
Refud o Mony Clleced llegllyis anticipated at this supper. Oysters Reun f oeyCllctdIle1ly 1 l be served in all ty'sat at reason- ai esadPop
as. a cotton Tax From the Growers able price. I_______________________________________________I o. the South. With a high appreciation of the pat.
AVWith a full determination to ac rorage extended tho-m during the year I h ~ i h o
ompsh bin purpose, If energy vunuts Just coming to it close, The G. W.Is t e Vi h o
tug anythIng, Congressman Frank Hyde Company takt-s advantage of the 43ark. of the Second District, hats fol. opportunity to -ttsend best wishes for'
,,e Weld up the bill recently Introduced 365 days of happiness and prosperity :by bum to provide for the re-furfflfrU to every ciiiiei"nd In fact to
49 tax., collected on cotton during the ever)-body, fir the corning year. ManV"t a resolution. succo-s of the- business for the year
_71The Suu published in a recent issue nIow At :: end. b~cause of two reasons
11,fs biH In toto, which was referred tio -his lmr.4)al cleverness and the- qua]O thecommittee on claims, arnd follow. ity of the goods 'he has handlfAd it
ba this bill Congressman Clark pre. goe Ai*hout saying that The G. WiFor Each One of Their Many Patrons
MInted the following resolution: Hydet~t Company and Its business will
"llodyed, That the Secretary of lir e,1r the game for the year 1968, as
-6 7'rillury of the United States be th', public find It a pleasure, as well
'Mlmb hereby, directed to send to a-- a satisfaction, to deal at this store. .60 R6s. of Representati'ees at the W e cordially thank you for your liberal patronage durnth
Of11104 possible day the following in. COMPLIMENT TO MISS GOODE.
:I.ilda.. namely: ps er n e tutta u ehd f cn utn h.
6"11*-Adetailed statement shG Ainlg This Popular Young Lady Received togethr ad e r ut ha or me od of cn u
1U IMOnt Of money collected by th- Fine Vote as Queen of Carnival. j~n~
buinss ogthrwith the high-class merchandise ofeedA4
.;*numt of the U nited Sucell From Friday'ii Wily Sun:
ofd buy 1irte of thley. o A great deal of Interest has been merit a continuance of the same. Our constant aim isal yst
manifested during the past three or
Stax of one-half of one cent per four days in the successful candidate ofrte"etPsil ecads tte Lw s osbe Pie
on cotton; said statement to for Queen of the Carnival which Is toofe th "Bs PsibeM r an se tteLw st osl
the ~mont olletedin ~chappear in this city tbe coming week. 6Wte and Territory of the United There has been several young ladies
i~,and, where possible, the names in the contest, being nominated and
the pqrsonu, firms, and corpora- supported by their friends and ad- ohLm1 IB t

... Use fom hqi cllcte i eah irers, and on Friday night, when the fuu1 5V .IPU IjG J
Y. Territory and the aniotnt tid&l vote was coGtd it wase aomafromeac ofsuc peson, bounced that Miss Lovie Goode. one ~ ~ & Se c orAdetaledstaemn shw Gainesville's handsomest and most
popular young ladies, had won the
-the 0ount of money collected by hoor Miss Goode receiving (4.451.
low.Mment of the United States This was indet-d a compolimenit to the DAHO RF OKT. Jl)aveIkx'nli f\ it tetoSoealCr
r ad by lrtue of the Act of lady. but one well deserved, and one ____FPRF___ET ~lyavtlliwl 11% fWilo ttnin
ofIarh7t,184 w~hwhich The gun) and her friends feel Oeo aesll' OdCtinshdbe xlui I Itt
a tax of Oro cents per pound'sr she ofrGaianesvPlseds wylrd Nooin. following, fr in The ,ll N-c'w- You are requ.?ste, ozu
eatb; maid shitement to ishow the Panle othar Fridny laNosolon.c'l gi es the I rtila ,f ti!- Out~ il-o, Monday mornnJnt
collected fu each State andcmpinnayvts,~hc ti esd From Saturday's r~aly Sun: Iraie Vf:ill o'clock. Penwos n
taft at the r'ntted States, and., lest d hyas pceitr'Z (Oe of (iainesville's oldt -t and most 'The o i~ hiCrril a'Licii. tit thilt zfers for the welfreoth
possible, tbe name of the per. 1 los to ad tlo, Als apitc l l widely known citizens, Prof. A, J. Fon.' has o(celtrrel iP1 TV s. city. fejr ., ars to iscse.fyodro firms, and corporations from kt.ddinhictyteiitIoci w(k -4a the' acitli' wiIIlhlil if uz ~ OAIODVS o
collected In each State And Ter. HA I AC.Friday ufte'rnooti. tiftur an illne-ss of lte'll Jidy a t K"iiva NO0. C. NI'G RWdjtn
Itqand the amount collaceted from ''ralI mc it hi Mrs. %N ,~i:. lL TtC'~i' l. e.2
Il of such persolns, firmsi', audo ciir- The Pepeo ad nugdWihII(eae 'a iaiN.' (if fir,-a '~i h r r, r i n~ h ____________________3@u~~~tions. ~~Delight In Terpsichorea Art. bti i hs tt'
"Tinrd-A detailed stattnient show.' ,1' I epcoia~At f~r th Iwst t\,-t st,on ,it r% I- ignll~ i!tti *.!d 'I
thl siaiount (if nm1olev collected-4 I'll" hehK 11041n1' tOf Wlorida, ill%'Slt ~ .Int h:f-'.I ~'
4 ythe Government (f th Vni t ik't th'll mntiticitI l ir't' anof ttte\i no
Sttes under sAid by \Irilt, (if 01.th e'ace hnt. iat'laec n x lt rdAli ir'~t i n the'l 'chi- t ;.il '# i I l r .i I





,P,

$ THE G1AINESVILLE SUN: DECEMBER 30t 19.07


LiINSIL ~PRAISE FOR CLARK. :will satisfy craving for war propar.-* XMiAS IN BONNIE MELROSE.
c~,, tions? Ill the~ enld it mu11St tin p'10o lris i
Sj Mr. Crosby Thomas of Cliaveoland, the(, people of all eouiitrikts t Itit A Del ghtfu I Xn~as Tre!, Attended by
Ohio. who has Just returned from strive for ,;upronlincy. for tht-ret I., not Fine Proogr-im-Oth er Notes.

ed po(cenber 31, 1902, at Gaines- WVashingtoI1. where he has been look- only the v-t outa. for- building 'i*~ ~ .
e fi as second-class matter, Ing after legislation regard ifg Florida tlihes eliorniowl Na i cnv~i i s. mit I i 'l ) .1 *8sf
sActo ogeso ac harbors and waterways, in'-ati intter. constantt t'xiltills of keepinc IIWI"i 1 in r thi i ti tot'il Liisi
9. -- iew with a Thnes-I'nion reporter in re-pair.an ll n l wonissoi. VpsIrik lls oxssc iiilti r l
s hed Every Monday and Thursday Jacksonville, has the following to say shosws th I? ill at~okut ttii1 (),117 O f \%IH, h S.
at ainsvlle Foria.in praise of Congressman Clark: filnest wAtrshipis of a few ytars
-----1 was especially pleased andi stir- l1 \ lhut tft for the scrap-heatp. 1-~v~ul artios Quitte a wnowii'. of

M-CREARY, Editor and M'ger. prised at the favor which Congress-! 'I'l# ]I!: itation if lan~d aiA iia%: :n-lxi~i !ruit i:s (ill oil ilit
_______________--mail Clark w'as al~e to proce- for arinaint is soliit i i t he vl,', z
Terms Of Subscription: I me. Frank Clark, although a or-fItt SUI ge pn o ti .i~ Irils ill to\\ii ft) the ~ati
Twice-a-week Sun $1 a year; paratively new member, has command- less to tax people for the trt'atin w 1: 1113a, as Wl' fhut
ontbs. z-Oc.; single copies, 5C. ed the respect of the House and will that whici In really useless. ([ iRev. W. I. Eck of Chicago,
Advertising Rates: prove a very useful mail for the State. WIlls h thei forerunner of qluite a
al advertiements, 16 cents a-He is aggressive, and ye~t make-, no DELIBERATION IMPOSSIBLE. Idl' trv t flay View cottage.
or the first and 10 cents for each enemies, and has attained a standing IMr NiIC K Nlillen has returned from
onal Insertion. slo recebyCnrsmnutl Iwil6ealn tt xwsia sitoI iej'1 -an fins
plaY advertisements for three, seldo recefyriend.n ni twil' og n \ti~~'avsi oL :
d twelve months at special rates. 'hey have had many year-s of service. trip for 1), iocrats from the E~ast to lsrtit io s -r In such p~xr health.
furnished upon application. For the sake of the State it is take to at!, n d the Denver convention iteV. lx'k loild services ilt the'A Fulft
age and Death notices inserted greatly to be regretted that Florida especially its the railroads have giveui 1.1101 1 31 (l:lllrs '1!\t Suivday.FulOs Obituaries, 5 cents a line, will probably- lose both her older rep- uotice thar nio reduced fares will 1w %Ariionh tfho). I., for the holiday I
- Ls.resontatives in the House on account conceded. Ptut those who attend the art, Miss Mitim. iiiiartridge lAsv,
u and bin th hiea-ee of the Senatorial contest, and the Cnvent on as delegates may gain Ii C 11. fluffiari I, r jten. anti
Sun andthubb ic-a-eg $3.20
*Y.) World one year ...$1.65 people should not fail to return M.Nr. Composure \oiiat they lose in cash, hY C'i! Frailik atnd i'Il'arwood, Stt. Sull and The Atlanta (Ga.) Clark by a big vote, for that will still the ahsene. of the noisy enthusiasts ~tI've. N. Mforriskly Constitution one year. 1.7 5 further increase his influence in the who have i:iade some conv-entions a Ft s~ilorA Morn-. !s- returned
Sun and The Atlanta (Ga.) Hue ergrtnmr hnadlbrtv ri ieatN:i i eea
I-WeeklY Journal one year 1.50 Hus siroue. w ~y i aseeby garh toen thn adlbrtv fruitIlti~lt~i~t5~svea im
Sun and The Semi-Weekly Hehsitoue tw veym-asbl. ihtntoundsjieta- floiiit Its \% ith friends Ii A II i. .a Sayanes-Union One year ........1.50 portant bills this session, the passing tors howlii for their favorite candi- nah ands Jack oinille. Pis i-s high-grade, coP.
of either of which would make himi date, nothiii,~ that a speaker says canl It,,\ C. 1'. Hetdrick pr.'.it liil I distilled ReWio
We will not accept stamps of famous. The bill for the sale of the he heard 1). anyone fifty feet from him, iflrst sti-miiop at Trinity, church iii, ti r., of' aboue Whaser denomination than 2 cents. Ph ilipp~ine Islands wil proabl re. a n the art of gesture is nt toalda agh in witol purity;
ar u ge t b p om t he e re liel~5 t h tto' u ti ajI r r i n an ft *'li t or It is
sciesceive very little support, although to linhartin.: ideas. dtn- M r. I ltirick eislai'e-. \I r itively the hst value
srinbeire subscritons Thepremp there n e te y toar h thif during ~t, who i-4 te'ip trarilY h'i~ F ~~or tho mosney on the
gwing~~~~~~~ ~ ~ ~ ~ ~ ~ ~ thi usrpin*'hreulette er hntedeeto 'tvrii ioadhs ponc f0dr KeY's church market today.
excuse for not knowing when that bill will be regretted. 'W fr.,,the brilliant young at- We' it Lrett to iar that Mish's !A's(n,k WNU rptvosi
time expires, as the date of ex- "The refund cotton tax hill1 ought to tsn'yv ort ,icksomiyille who was his 1ak, i ~sfsrli itl na ~ ~ ~ H rN 6 w
on Is plainly shown opposite pass, and it would nivan much to the earni paigmi r iiager in the last guherna- Ill thet li''.is Slit, It-ft y *stvrdayc ftill' We ship dim-.ot to c'mnpumwiis name. Remit by check, stamps, W hssv u uaoir
oney order. Don't wait until people of the South to have those tonial calinv, ign, to succeed the la- th'' hospital at St Augustine. where uth ie bq o h reitars'
ome to town to renew, but DO many millions of dollars returned mlenitd ~S'iitor Mallory. ;NIr. Ilryan her nian.\ friends hipe. ,fit' -ill tid prf Every bo ts iur
OW. The white paper on which which they have paid ouit Ii illegal was alrvasi'. a avowed candidate for ~speedy r.lit. rf~
Sun Is printed alone costs Us taxes." th tit. idtedah fSntr 'Il# hita7 rea hetw algrt o 2 plWpiels
aIf the price of, subscription. WW Orde thblanks.dtedat fSntr leCrs mste tth onhlI rc h
____________________________Mallory IiniS siven him the place coil- Ilast night was anl unqualified success 5~~5 2A.$.
REASONABLE PASSENGER RATES siderahily ,,trlier than his fondest in every way. Thes hall was fieo t$.5 1 t.$.
LET US GET TO WORK. erAweneMd
hopests alit icilited. The people of the so t&astot'ully decora tedl anti thisie' US4,.I
that Christmas has passed and When the Legislature of Ohio in (Wulf (ot.however, are not likely with itc4 man)- gift. candle's4 and glit- iOWls w e
ear is onl the wane, our people 1906 passed the 2-cent passenger-rate to relish the fact that the Atlatictrn trautts rtet'd batti'
naturally begin filling up their bill the railroad managers (iecla-ed C'oast has 1) ib UI'lited( States 8e-fill sight. Tis hall vkits creswdti't to A UL
with resolutionsit was rinous avd confiscatory. But tons, andi N';! so demonstrate at thes tale v'eryc doo rs. t' oist standii Ing roomi &CO
ith r slutions.ego tigI the official returns of all the railroads pirimnary in r-qse We are of the opin- being ait a iremi him Rev. T. 11 SI- I ilr eptthere are soome moresi in the State for the year ending Jnto io n that (;t1 rnor I iroward has inadt' trunk called the iitIines to order. htabo
tant inl their significance and im- 3., 1907, as figured by the Ohio Rail- a iniistak- i making the appointmient. anti the fellowlng isroramin A~i,4 finely m u
Ct'thai oher. Te mst m-road Commission, shows a substantial and also that Mr. B~ryan hast mtadie a renderedi,
nt s ~s~tio wichevry increase ovur the preceding year. This jeol itial ii ike Ii accepting the' all- Sonig. d rt',(diss o n which litte r bo k at Increase is due' to the elIim ination of isointnlie't-It lhii. John Stockton. Ito Prnc I' ir
he t(\Iid his ltht bof unon free passes and excu rsio n rates and huilt uptil- hpresen t crowd Ii tilt IIt's-soniii Sl is'll
siki !sia\iin, "Ili Union Trhere I, the natural growth of ;sasst'ngt'r ti-affic. psdtiical ssli',se''nis to 1111\t' Iwlli Reiltatissti ''(ln islirg t's a. thee on
C niss''. i IcamdAlahuaever, Is not a fair criterion ior soilt peille \ill '*'timit Mr. Stsicktisst ~IR~tlisi lt h.n uise
r~'t dal o eel1)rudother Statos, b-ca use it Is t ra ii rst'd re'w arde-I in 'cilio lo v slat-iiz him nIn Price.
Is'- a vr m idl sow eely pover by Iint rstate railroads fro mt E'a~t to 0., Llhit nulalsi iml chair. R cilt atklei 1.1- 111e Its 11- 1" 111" 0lt

ill isis r thes warmi and Wez h i(h inulst i ncr'asii' t lie re~t ills Thir Iiie N.,: a lii;his '0l0a IeIrl
rn~r\siif which we have all for pas.,;t'nkzo'r traffic. It is al~i a twire' '.t-ta-n it~5 till Somea. VIil'. \ ra, It ilF
I ssshwstlsi determine densely 1ss)JslattAs State'than O Mit 111110 t ii k;l~si I -1a1iumls lsc-ih 'slfuus f tois'KIi.
i 'Ay r to lilt (stir shoulders oh's raki-zhairthn ew reut-'la ta e siineis a. t'ilrii i i'(Is- (ll
5- : unt, ayig aide all York. on It'iinsyl'.ania, lit'lha'-. \ith l \Ii l (,! Ill.. it i'.at a ()af'tr dit,' onfts .Sik'',.'-1f li'


1f.'.t?,,lc il it'll (' sIls we:i -ill o w It: 1i;t ( if ilt (,(sIt 11 'si if Il; 'if is'N t ce t a a e s
tu misl s htli h h r-.. ti i-t. ho ric t


1 t l' a ii-ull~ for, ot'd to 1 c hir gt' r..'sena l drt' thaii i ff ii tA te rexores 1114 rat.( It. 'i i.is-e f 't I i ii tiiht1.1.t 'lelt it ico1









U1TE GAINEVILLE SUN: DECEMBER~1 30. 1907



NGRESMAN LARK NEWS OF CITY AND
KGRSSMN CARKCOMNY CONDENSED

Is STILL ACTIVE Frmnd Duiiy Sun:
I l~oi Tunda DAY Sl
A ~~* 41 --dS~ay r'unilng, at the home 3 6
NXatter of Having Refunded 'if Mr.0. 11. Hiailey, Nimrth G;aines- s
%,ilk', the 1,adies of the Ad%-vent Chris--___________the Tame Collected on Cotton. tian church expect to gihe an oyster of
mupp'-ii, the liroceed.,i of which will
-HE PRESENTS A RESOLUTION be devoted to tht! church. Functions
____________given lby the goodl lad ies of this church
Following the Bill Providing for the are always successful, hvnce a success
Refud o Mony Clleced llegllyIs anticipated at this supper. Oysters I Refud o Mony Clleced llegllywill be served lit all style at a reason- : ai esadPo

of -the South. NWith a high appreciation of the pat- o
With a full determination to ac. rouage extended them during the year.: h X7 '~ o
4*1luh his purpose, It energy counts Just coming to a close, The 0. W.I dst e W i h o
1WIs anything, Congressman Frank Hyde Company takes advantage of the
(Wrk, of the Second District, has fol- opportunity to extend best Iwishes for
ee up. the bill recently introdue 365 days of hiappiness and prosperity-**ft* flC OPNC
*by bim to provide for the refurfflIqy to everFy customjer-iand In tact to.
ad taxes collected on cotton during the oe'erybooly, for the coming year. Man-'If LUl IJ
Civll War and for a period afterward, ager' Giirdiier has certainly made a, TE GW. HDC O
91. *1 a resolution. success or tho business for the year I --IS
-.The Sun published In a recent issue now tit in end, b0,cause of two reasons
00h bill in toto, which was referred to -his 1wrisonal cleverness and the qualthe committee on claims, arid follow. Ity of the goods 'he has handlted. It F rm ar n
In$ this bill Congressman Clark pre- goe without saying that The G. W. F r Each One of Their Many Pa
sonted the following resolution: I'II)(l4 C'ompany and Its business will
k u eved, That the Secretary of prosper the same for the year 1908, as
the T~r'eumury of the United States be, the public find It a pleasure, as well mdibe lo hereby, directed to send to a,; a satisfaction, to deal at this store.
'~heI~seof Represeiitaties i's t the W e cordially thank you for your liberal patronage uin h
arilet possible day the following in-; COMPLIMENT TO MISS GOODE.
fm o, aml:I-past ya, ndwe trut ha our mehd of co
th'MIun moA deaie cr1s~n shoin This Popular Young Lady Rcivd yaadtutL~Lm tos o o u cn i
00*nofmnycletdb0- Fine Vote as Queen of Carnival,.uies tgte he~m rhnie~~o
Goverrnent of the United St,'e5' From Friday's Daily Sun: buies oeh with the hgh-cas merchandise ~
U. ess bfJuy v itue of t6wh e v I f Agetda o nethsbe merit a continuance of the same. O~ur constant aimill ast
es Jly st,1 ~2, h'c 1e- mninifested during the past three or
16i.tax of one-half of one cent per four dayis ini the successful candidateofe th "Bs PsibeM r an se tteLwst osbl Pic.
*U o cotton; saidl Etatenwnt tofur Queen of the Carnival which Is to ofrte"etPsil ecads tteLw s
ibowtheamont olletedin achappear In this city the coming week.L IV *at* and Territory of the United There has; been several young ladies
Staeean, wereJ)55i1Cth naesin the contest, being nominated and '14 the ptrsonw, firms, and corpiora- supported by their friends and ad-Bohoh Monafromwh~mcolecte in achmirers, and on Friday night, when the P o e h .P oe
tato sop Territory ando the amount fitl vote wits counted, it wit an- h n, T e G W Hyde Com pany
ad ~from each oif such perisois,' bounced that Mims IAovie Goode, one
wA4 corporatioi. f Uainesville's hadoetand mosta
~S~od-Adetile sttemnt how popular young ladies, had won the ^6 the iount of toney cUllted ys honor, Miss Goode receiving 4~,451.~Ae ~efimeit f te Uite SttesThis was Indeed at comphlimenit to the DAHO RF OKT. Jlya"1 i f\ il tetoSoealC
undellr and by virtue of the Act of, lady, but one( well deserved, and one DEATH___ OF PROF FOIET Joly a %Nelkohi ~dyo
o of Miarch 7t,1964, whichi Ihad h. i i r
*~~ od It tax of Swo rcerit4 per Ilutid Which The Sun arid her friends fo-el One of Gainesville's Old Citizens following, fri L V~.Ntws i. Youl are rqetdt n
to sswut e she appreciate-s. Passed Away Friday Noon. ivste r 'u1r'flI*!4 I *ylMnar'ofiganI
$0n co9n; said statement toso hrhe- other young ladies alms received Oves th i-i, h \l,,Ml
~ont collected lu ench State arid fonpniitr tewicti s nd Fro Saturday's Dail 144 piolI,(k. if,!on fwhdi. oolt
le s o a dtivii n a y alo ap r l t- roromz Daily :er fo tr 1 i i i
*bore possible, the nninies4 of the per- u htth-e na e u n jeei widely known citizens, Prof. A. J. Fos- has occlrro- it til ci !if r tairs lit, (isctiul. B rd!o
aon, firms, and corporations fronq ki-tt, died Ill this city Itollit I o'clock ast1 "cI ; 11 !.1 if ~i f )I- HOI O VIC
collectedd in each Stitt anid Ter. HAD A BIG DANCE. Friday ufte'riooti, itlter an4 iliniSs of litIle .1()11\ It *t Ilt, i.l 4-r~. ~ NO. C. GIWAjti
Iftory and the amount coll. ct ed froin! iit-,iiral roth s~r. .\"I- .112'! ''~ h~si~.VaDw '
poratiof. suc pesos fims ai -r fi-I
"~~p rTird- le i 10 tstl)'l Delight In Terpsichorean Art. chiistts, linlt hai; hie'-i lit tils s fa1fo 'i thot' h ', 1ii. 4441 .t!.1t 1-~o (iA4\il i.d i i 4 nl '
"T id -A d t ll le t-ny ftso for thet past '..4t s'! igi eittil ffI t i mw -.4
g the nniint or iif) colliecte'l ,~i he vu,01 lt-'I o irlda.t illietlig Ill .I .: IETR
State undvern ant li titan Ifli the s4 11(' hloiif 11t-l, 1i4lillt'l i a n tm i t lin 1-rt ain. th ivllit \ oil r.- .
Matcs une r d Iita No Iri iitN ~ r ~hb fi..4 ~ lltl (it t I' i I*~ ii of tlI1' islliiI at h r \1. A' ud~~1I lil cl~tol .i i i-11tl or1.11'l f. Il' 44
_A04 hiti Cttlinnenu irli-g' s agiei th iof Jul%- ati, he'."\iII' V'!l:! .' .4









_THTE GATNESVILLE SUN: D-ECEMBER, 30 1907


iAlNjbVILLE PRAISE FOR CLARK. -ill aifvtl-N:r XMAS IN BONNIE' MELROSE.
AAILtiois? Il rh er iTlwerhl
s unlf Mr. Crosby Thomas of ( lt&. Il thei tltlt 0 t A CeI~ghtfuI Xmas Tree, Attended by
Ohio, who has just returned froi stiv f(rII t Fine Program-Other Notes.
ed ece bef 31, 1902, at Gaines- WVashington, where he ha4 bN en loo ()ilit NiI Wii l )1 oi).' e 2,- zli iS of
p ia Poe scnd-class matter, ing after legislation regarding Flo ridai tti t11111m Mtl 4, :ollN. -11t A'l iOttfinih
r ~tof Congress of March 3, habrInl'aewyi' an iter ( n-A t ex1ti- ):~ith ~f tett1UI~i
ed Acer harbk s ndle *..rwa t-( t,,[ i.o pri Stt tilt ,~ Mio i ll 11 t) abou
Mondaand~~rsd y lew with a Times-lUnion reporter in rcpair aindi n ". Ih'.\,o 11oillin to o abouht
sh t E viery I1 M o loy rid T h r d y In lpra is e o f C o n g re s snm an C la rk : l n e t wriis o t1 ,:1 0 !i e r Ig Kh i l
at ___Gainesville, _____Florida. '' was especially pleased and su r noW"t hut f*t for' thlt tAithIvma aFis.Qit ubro

MJCR EARY, Editor and M'ger. prised at the favor which ConigreIss-!'~ Ii I: "ttiI 'I ii--i .iiotmiing fruit Is-; still oil the
________ man Clark was able to procure for arm.lie L: s.i t.in ,
Ter s o Bu scrpti n Ime. Frank Clark, although muor- Irtst so01, agree upoil, for it i,'n~ N '. rrivals Ii towon for the sa off
Twice-aWeek Sun $1 a year; paratively new member, has command- le" to ta\ people for the trt*:ivti :1 '~ VliisadWt f mat,
%~tbs, 50C.; single copies, 5c. ed the respect of the House and will that which Is really u-;tless. Williamsl and. i.e of Chia,il
Advertising Rates: prov ateyusfliltfrte ~~ t~iv forerunner of quite a
Advertisements, 15 cents a-lie is aggressive, and yet makes no DELIBERATION IMPOSSIBLE. :~ '1\it Bay View cottage.
ortefirst and 10 cents for each enemies, and has attained a standingle hsreure fo
pl adsertioent. fr e seldom reached by Congressmen until It will e a long and -i \i ii' A.11 many friends
d twlvewonha t spcia raes'the~y have had many years of service. trip for 1), mnocrats from the List t,) F'.2-,r t ~ ~'*ti uhpo elh
furnished upon application. "For the sake of the State it is take to a, dthe Deriver cbnvcTitiflh. wv ]V:(k hodsr ate
age and Death notices Inserted greatly to be regretted that Floridla espijally as~ the railroads have gih' ltv hrii !wrrin !:,.,\t Sunday.
Obituaries, cents aln. will probably lose both her older rep)- notice that :io reduced fares. will 1.' A1110liv tht-t, I *.for the holidays

Our lubbng Lst.resentatives Ii the H-ouse on account coticedlvd. But thiose who attt'nii the art, Miss Vililij I *' artridge 1,ee,
Sun and the Thrice-a-Week of the Senatorial contest, and the convention as delegates miay ai ~~lII C PI'. llffmallI It 'I ()teen. andv2
Y.) World one year ...$1.65 people should not fail to return Mr. compjosure ',.kiat they lose, In cash, b\ C'.. Ftidk imt .d ).ti Yirwood, Stet.
Sun and The Atlanta (Ga.) Clark by a big vote, for that will still the abs;enr of the noisy enthusiasts :Sill Lee, N. Morris
kly Constitution one year. 1.7 5 further Increase hisinlecintewohv iaesm cnetosit A-;FriMrisii eund
n and The Atlanta (Ga.) influeec ineter who have moe some conenletio i.,-li, oa Nou- ~rtre
-Weekly Junlone year Hous0 \iltifsvealm
Suournahegel-We H a introduced tovery i-assembly. With ten thousand spteta- fl lbis %\ ith friends Ili At 1:mtn Savan.
es-Union one year........ 1.50 portant bills this session, the passing tors howlini. fo~r the! r favorite candi- nath id JTuicksoniille'. )g-m c
of either of which would make him rate. noh~-that speaker -says ran IZ, C. P. Ievdrick iprotat h.'d hii r distilled Rye Whis.
We will not accept stamps Of famous. The hill for the sale of the he heard 1) anyone fifty feet from him, fir-t -"rinou at Trinity church (il Auin- of absolute purity; i
er denom ination than 2 cents. Philip pine Islands will piroba bly re 'm d the art of gesture is nt eiiii:l ri % t \t i i to -i 'a lp e a ,, 111. fge fi i w loo ril and ofto lvr It Is
scrbes reured o e roptceive very little support, although to irnpartinz Ideas. riei'' Mi-. 1(edrick replace". Mr. positively the bet value
scie seubsgedtos Thepremp there are likely to he times (luring 10,1111 'Ii M. \\ho Is fehiplorarilY iii vtiirg' for the money on the
ewing their susrpin.Teethe next ten years when the defeat of (oernor llroward has alipejlnted of Ci"lir Key's church. mairke.t today.
excuse for not knowing when that bill will be regretted. IV. .1. Plr~an, the brilliant young ait I 'I zett ei ht~~sL'~ IMCDbUUFU
time expires, as the date of ex- "The refund cotton tax hill ought to tornejY oif .1iucksonville who was: his .LU' ksoni is suff,-riig froim an i i-ct'es N *T IN 311,
on I planly hownoppo~tepass, and it would moan much to the campaign vinaiger Ii the last guherna iitl'La ie etestr yfrWihpf-ttcnuwg
name. Remit by check, stamps, ~peo h ot ohv hs oilt ucet-hsia t4 uutn,%h-eiadtu ieorcmo"
oney order. Don't wait until peo h Suht ae hs oa canwpiign. tosced the In- th hthelatS igitii' hr s a e a( this ,QU'g,,ris
me to town to renew, but DO many millions of dollars returnedlretdSntrMalr.M.Ir'u her nuiuii friends larpt' she will flid( mt vr btl sgm
W. The white paper on which which they have paid out Ii illegal was aireld% an avowed candidate for sleidy13 re-llc f. awe ilbIeudit
I ~ ~ ~ ~ ~ ~ h Ceoic.adtedah fSntr ''~(hiristmas tree, at the town hall riefrM plate VC04H
gun Is printed alone costs us taxes."Viofie :dteeahfSntraw k& if the price of, subscription.it
____________________________Mallory liiai i.'veui him the place conl las-t night %as ;i ufl(lualifit'd muc~'s8 I ft $Si1 12 IOL $.U
LE SGT OWR. REASONABLE PASSENGER RATES sielerahly earlier than his fonldest in cit.iry way. 'ft, hal AOwns~u M.~ve
hopes antic i'lated. The people of the so tiisf ifu li (Itteorutti, aind the- t ree, AlSiiwe td
htCrsms a asdad When the Legislature of Ohio i (Gulf Coast, however, are not likely \'with it, mlanY gifts, can1dles and gilt. bi -lCe
ear ii onl the wane, our people 1906 passed the 2-cent passenger-rate to relis-h thle fact that the Atlantic terhing otinnie'nts, irelsetetd a bletiiti- aturaily begin filling up their bill the railroad managers declared Coast has 1both l'uuited States Semi- fill sight. The hail %%-is crowded to M E
with resolutions. it was ruinous alid confiscatory. lHut tors, andl \\;I so demonstrate at the tit very dootrs, "e,'Ti staninig r(ofl & Co.
ile ri-solutions are good things, if the official returns of all the railroads jiriunar y in Ii{q We are of the opIdii being at at irounim tutu R. T. If. Simart ki-pt, there are some more in the State for the year ending June ion that (;,vi rnor liroward has made trunk called thet audience to order, CtU gU tailt ill their significance and im- 30, 1907, as figured by the Ohio Rail- a mistake Ii making the appointmnnt, "Id the" followlng pireograml Vas, finely Jnu
re tan oher. Th mos mmroad Commission, shows at substantial and als.o that Mr. Blryan hla, ae rnee
trc's(Ilution which every man increase over the preceding year. This political inikake Ii accepting the 11p1 Song. ,,(t doni in his little book at increase is due to the elimination of liehiltnmont, HI im. John Stockton. %\ill Ilraye r.
riam if the tide is that of union, free passes and excursion rates and 1;,:i It upl tiht, present crowd Ill theit- 11pe ill sitit rtenidiiir~ o (,Ii luijxiin, "Iln Union There Is the natural growth of Ipassenge'er traffic. p(diiticail ,aildl.-. stems to hav'iuen eittuii, been rl~g~ 'tli i! c. rta inly a true one. The result Ii the State of Ohio. how- 'ovir lou ke 1-Y the G overnuor btth Price.ti o,' f~tJh u'~n e
(Pintosville and Alachua ever, is not a fair criterion tor s01110 wle! N%' ill s-,. tm-it Mr. 'tcio IS i'iail
it wm~re'at deal to feel proud other States, because It I,; tra versed rewairde'! i Iii liv fl lariniz hinm Ili IPrice.
'r~;ue hs sile seety oerby interstate railroads friui East to th'- v''iowrtati)rial chair. 1tecitatiln. eth B4ie 1.11,. It lu Ouit
West \hich mus increase helt retur.,ToI hv o\ifulad iaV
str-iwi, wid1e01r the warm and rutt tr iiui iv e'aI ii~iu d ~
ax a.of hih w hve llfor passenger traffic. It is also a inart' S4'., il Ln i eu M-.nu'. Nmt l1115 11k v
It Ae should determine densely lijmulateul State' than imny to tl, V sn '1.1ii It ''1 ilillil-i is 1111ut I i i- i' tic ift-i to tilt- K i l'
.''' an toC liut our shoulders others, ranking-. liu'lzir than Ne-w Lreate-r fimni tiat iinsunw(it\, we airi R-'(Itittiull hr tilt. Cht-t '. (irii
t- a unit. lay* ing aside all]) k rPenyvna ueraN~Il All (it tliti- 't-heut q limrt. r 'Cf tilt- (Cuts.
itse't uitht-d ofliili the euIn ll f h' l ri S, 1, L' W,i lwir P1r in i',
1 ilfft'rpuneS. If we 'will itsl I'tl-o-l fui-ui of~ tillth~ ctra ;1. if Eh.h r 1 1 .4i 1i'l Il
hIia~e a year hence a it A'ould seen that the' luitc-tato- file, t'~' h,. OwcL lt h rice- theilift'i i ut Pit I I I .' h nku frI_ ll re- ionnsio '0 I1 lelr. ta o ind tl ,umu li'm'eui .e)I' (..ia li i a #I."ie'i. i












THE GAINESVILLE SN: DECEMBER30197 ______41

NE*S ~Th Cause of Man decide whether or lot the cmirtho "''do1tkeOrdi' Wle
STATE n Caue of ianyshall remain iI T hr~d \'
Sudden Dets ISyn is a P urdidate for Jthmm Mcounnof-~
LiveW Oak isto have a De, nion 7-r i disease 1,pvailitg ilt:.ty site. -IVa. "Because, afe
&epot. COLa tr. m(stdean -c r ous ~~usod The Tam pa Soard of Trad~e aro, 0,11
The saloons of St. Petersburg were '"p1I oe oan a htwl rn for severalyer
closed all da Ch (1ristmnas.Ud e~u the parcels post. They-) suirte that thtd Wi
C -.- it1leart us- I tobe
I '' reason for objectinlg to the sanif robe and trying i1rt14C
The fishing lnd ustry of Pen-isacola he lcr fai~ rc or that It will Injure the sinai I town andiA ~ e itotrle
a)x)mdiieswtnu obtaining r
gives cnhJloynlerlt to over Sir p'vx. vhe re'~ oftu onl berie the miord r hounsc.- iitors anu Tkr
A fvorte a~t in in Pal Pe di IV CiA-ase. if th agr cte.fo i;nJ, in WVine of Cardui, a golden m edici e r
Is to go fishing out onl the long pier. aloedod~nee ~ti -nrcm edi-bv l t
N allowevoalIiieon The vegetable txjire,4s hai 1),: il ills, Jn cnreo m dita ve llth s r
tledu )l ill, atii- into commission onl the Florida fE't
The Salvation Army gave a big tic'i A I d1 Ml t Catadwl u regular during com-,laintS
akiviIorgatns, (tausinig catarrh (of Coas an wil rn S
-Chriattnas diner to the poor of Pensa- tile fIdujliler, or the kidlney's thenmselves the vegetable season. Heretofore tit(
cola. !oreak lIo%%n an(I wAste awa y cell by cell, truck bar been handled by thse regular Cariui fuirnishes safe relief for backacht(2
Strawberries were, among the fruits frm I:elratroublent alote kidnes reslt trains. The crop this season Is r,,- peidia pains, irr,-ua painful or unhelV
othe market itlatwfrCis-'I curle is ob)taindI nickeA by at proper ported extrA large.
mae. ~~~~~~~~~tre.atmrent of teI i evs. If yon are feel-.eilfoadalalet rmw ihsc
Sweet potatoes are selling for. $1.40 ing badly yol Call *iake tic mistake by Bugasetrdheb-omof enlfow adalli etsrm ic
homested, aretaking D~r. El liner's Swamp-Root, the Brlr nee h e-om' efc ~i ~ i~Awmi~rbushel lin Hoet a nd aegreat kldnicY, liver m~id biaelde, remredy'. Capt. 3. W. Collier of Kissimmee while suff er. A pretoicfor dlct o
rather scarce at that. It corre:cts iiuabiiitv to Jlollj urine and he and his wife were both asleep in e tbem dcefogilan w mnwh acsu
______ calding paiii In passing it, anril1 over- the room and took fromi the Captain's e t:b mdci frglsadw en l
The ongegatona chrch f Iay-cotne% that unpleasant iievesitv (If being The Cogregatonalihurch f Day to go) ofteni tlarol'gh the daY, pants pockets $250 In r'a hI and his gold to the complaints pc:ulia-r to their sex. Ha ne;
Wna has Just Installed a fine new pipe ainid to 9(t Uiii Ii-y times dinrg the watch. No clue as to the identity of
*organ valued at $3,500. nuighit. T1hie miid an~d the extraoriinry the perpetrator has bevii found. over a million who used to suffer as v'ou do
__________ effect of Swanip-Roo-t is 5(9011 renlized._____It stiiils the liighec.t1 for its 1"itail1erful
The subscription rate for all week- curfes of tliq i ust dlistressinlg k-,ss The Ocala Bianner iavs that If ant At every drugy store, in $1.00 bottles.
ly papers in Manatee county has been Swatip-Rtot i,4 vIijeals.:t to take and is extra session of the IL.egislature is
raised to $1.50 per year. solil by all siig ill i fiftY-ce lit (11241 called Marion county will be without WRIT US A LETTER VINI
_______ irl-dllu ~ic otle~. o~ti, lia representation, as Njr. \\artmann has dmwribing fully all your symnriorrs IN St.Peersur wil ol anel, c~olsample bottle of tis woirlerful liewv (1,im an ewlItn o reAvc
t.Peerbug il hldanelctoncovery and~ a l,(mil: tla~t tells aill an)it It, resigned to accept a position on the ind pelaill sead enelpe LiAdvie

onthe 31st of this month to decide both setit f rev ) bv uil. Aildres-, D)r. Kil- Board of Control and Mr. Mathews is Med ir Co., Chaltanooss. 'Ienn. whether or not the city will bond for A-in iCoilito4ltrauoi. N. 1,16 gle now In ilartow editing a newspaper. I aO $8,0.oifer in tlhis papt-r. D'Mcnt illike ny __A wood famlae Is thr~atened fit De- mistake, hut reiteutierthle rnini,Swatnp.- The Highway D~evelopment ConiLand, says The Record. Wood is now Root, D~r. iilnitIer's wa -Root, ndi the pany of .Jacksonville has declared a dlv--________________sai~ng for $6 it cordl. tire,m, 11, 119lullto', N. Y., on ever-, idend of 10 per vent onl all preferred
stock and 5 iter e-nt oil all common
The strawberry crop at and around made biy the* prisoners8 In the Perry stock. This cotnianv o~l 20 f h Stake s it ~ie cndtio. he ro choicest lots Inl the secti:tit of HighStakeisinflu cniition ''h copcounty jail. Assistance, however,
In expected to bev worth about 40,receti!jalntmeo sg heway, near the S. A. L. rilway's 119w

Congressman S. M. Sparkmann has jalo,____tonpionrsapd It now looks as though O)cala will
introduced a bill Inl Congress for a pub-W Goivernior I iroward has gran ted Will soon have her public buho ilii g. B ids
Stc building ait St. I'viterslitrg to cost F 'r Th. were opened in Washington s''veral
$100,000. thth n~taid oteprmn days ago and several cario' wit? in the
Citiznis e ni ghtai py tothe ard i i ut of cost fixed b~y ('oi;&gr- s. ('()il- made extenisi 'e pl") Iirations for the hentf-tic'le to one of life imprison itiunt. tract for the erection oif thet linllitig
ei ntertainiing of the. State Teachers' ______will dotibtiesnrly be i2 a 50115 t 1:14 v
Association. Waiichtla has a society known its Vi
C. ~ ~ ~ k -l.t Tu n r ge 1 y ars ('01111k tilt- I atile' Village Impiirovement At45() St. Augus tine will soon9 hav ~e a ji 'as. ted suicidein Jl,' vl lst lweekn cit iont wich hs 111lceonil isbed much tiro resort sin:d lar oil a smiall scale __I
Sby shuitting li usel V in Ills rior andl ml fo r thiat tki itii the way oif plan tilng to what (Coney Island oli, to New York. P
turning oil tilie gas. trees5 and inak~ g nleeded' Improve There will he much nil919 y si 4(11 t int_- --- (WVIll -putting thet place lit shape. They piro- KU
The Clyde I Jihi St 11inlsililolin o ailN iwo int-ii Ail tlivo19is oif fortunoe Ilio5( to have, a first -(lass dano-e hall K E. will have ait ill nv' llaMsl'Igl'in ho011 %%r ikallinlt-9 last we'ek il it hr- restaurant, sconi railway, rnerry-gonanicil the Moihatwk IiiOll omisloilanoh-a:o lcycudnts~ut round, a elnhihusf' and1( n~;iny other early- next !1'l..liv,'l- to 11 I-kl thtIl gaiil'f thc'lt. dill.- ltnisl'liu( ts for yong arnd oild. Souithu
Ing t~w holiiljj~s.lle-aih will ho1 the site (if th-, rs'-ort.R yor Cn W
The, mw-o IiolI'tlnk Hotel1 Ill St.u il tll~t~5
Peetugll, 11115 41911 v forn till, W : i. Iiks-r hats Fipvdacarloadl What's Ex~press~ Prepaid
Ietaal. h19,' Ii I,4 tho~rougly iilli'- Wo(Iiig- '111 lsg'~~ ~ ~~'rth doing Is worth doing w~i.I
9 ~~(.(lull( ..'li is th' first ?5(11 :j. you wish to be cured of Rheuinnatlsnu l%"' k I fhr i kc Ls In rIo
(If Iltln .silI'js9 fruml thalt (919110) 11s8, Itailard's Snow li.niment an~d yv' )s 1)rn tI p r, in I i rest StrliI NI V \ Hi it- iii ?fig grml'.' r. ink. Iil 1 g 'i-4t inwi'9 in ll be ''well cured.'' A positive cureI od .11,1 if flvgs tills \'e'ir (99: ai for~ Sprain.Nuagi.rls o











Wr TVTHE GAINESVILLE SUN: I)ECEM1BER:30, 1907


WEDDING AT FAIRBANKS,~LGLA~~RSMNS


MERSI INSTITUTE

I'wo Populr Young People Joi' ed To- ;).I)I C' ~. IONERS' SALE.

TO BEHELD HERE ~gether on Cistrn.is Dai IiIi II.I


l" awl rcilirtny Locatel, the institute

Well Attended. An'ti II Ir



:N SEAKERS TO COME~ ~ ~ I \ t.~:1 Iif~



ri j Will be the Honorable j, I I*I Ni~ ~N i% I' -.k I I,.\

C, It! of Agriculture, and Con- I i Ai' iII

essan Clark-'Meeting Destined THE SUREST WAY TO111. il'tj t)tik I,*, .'.ii

p'co.e of Grea Benefit. lde 'Ivh\ J'
I FOOL A PIuK-POCKETI Uac I 'ldN ,jri\
It h act a:'raiigefllelts wo' rt, Itt~ 1,11 \
le 1,I )lklig a largely at- J o C 1IN(1 ~ k l~ I1 Ind I I ItIolI'll:it a l i I I' A( f III 4

farsl ~ Sate meeting at AI VIU.4 I t!'ltt- l'n
h iin th m ntsof No- D)o1 t C1111 VX V0111, W1Un' jIhiiliroce'--i tit I he p-ii iLII
linring t<( month .0t1 '
1),t-siiibeI' and January instl- arotm i witlh v l --Iit Tif I "et tr'itti i- lt[tlt\\\I i 11 '''~'~
IIIai ~ s c t O .1 Z- I ill I~ 1' "'elice o 4 1' 1 L... 1 '1 I\ : V I, l ~ 1111' p I Tr't'' ,

bit'as itsy were called for IIlo 1,i lNk of pr11 IIIii& I r L''. I
:ir '' of the VaIrious Seec. l1t~~ dU1(I eliiek it out I,, re-1 fi'I ltk i rt > i r 'r:t('tfik'. lin a'l k'. '> Statte ,u.I' I i' smtli


it *.j1v.is lipisy idea to have I ilmI ill Coill o'i imui I ll I i'' t l.I

at'd Ci(!intral institute, o r i 1 l v h k: t I iS U' '. : ttidi'. i-. I n I .I iiii tt't'I
'III'itI'l for -(W~~ ) tryV tim e. "a-. Ai .'Inl crs limi -l~ \%iib )It~1 utr
A l* itl'I ill thlis i1 0

~4t~ii 'liliiS aitlote a''~' recei' pr'l lt If II(t'' Ithi I k4i'Q t i


I () I'ol a n )co i l i l I I tl % .111 I f, C IsIh'i.




iA.e itt AN il thi'e l v iiii'. knii(0 l (I w.tinm 1 1 1I T N











tj':t i ill Iulrt-i1 l viii hall\\1)t Of, (thi\as'' -r 1 f Ir lt Ianll III. '. I i vi n in e n S r e 1311DS WtANTED.









lo II I k .0 1114Ir t f I 1 a't t




Irn' CTar Getso Bu y.a nk- 'i t k i l s ill hal'I'itit- 11.1, I, !!it- fi ro if, -r NorA !k if 1 1; r,,, it-,te 11.
(wo N t m m e ti'l- Il l I lia io l, m il Il \ I 1'' I. I' ll loxit I ort O the


0- s *'s it's'll oft G at4-; ,f ilS I' .
11p1oI t: ii k ('I ,i ko his' e peo pl ald then l Olodr 11 h OU(11 'tv t l t i 1' 111 rc'I'I I A'b lo\i' I V R I EI iS.. I I 'l I di". 1 1h1
t" I~' _,i .'0 Ilsl r t :1 I,4 1.%s~ ('11)1
1, I (s- (i tbit d ur'4 i n g- : wth e ir w el l. to yi o u. t il l, "(l11i l tr \\ bI l s N I w h c d i i li l f t, -'tI ,i,' -S P 11 'In -'t- '. '111' ' i tt m e .
ttt~~~~~~~~ald i 1.s1i o.it 0-11011,11.-1\ III. -;lis' Italard' mlso o n Iul 1. 1. 1 'I ~ A .4Il Hit I n i,. 1 'lt sf' i

m I i ';.killia e lf I s' Ii sl'" s ) stISQ c for' hold.~ III Such hIii I. 1. V.sl Yut'r' i' *- I 'Ia' t 'ls P' t5 S




1; k ill't. \k~~~~l, chbYl XV.oa ls MI holri toisn.c ib ys
t v iil '4k timi i t' lo t I '' 'l I,..'


"Moit' if CII'lI1:1 1~ 14-Ittlt I;, Y O Ut A R Er I NI T E Dour di 4 h '~ 1 11 111 j A- BIDS W AN ED
N\ it 1 il. ..It4

I7 '': '" I il4al e 'lt IIA 11 1 1 )!"t 1 1 '9 \I"III I i or Jn





1"0. 01*t Ns ,'',. "I 5 ite

1:5 44 Ii '~-' 4.1 ~ DRY GO DS, NOTI NS, CLOTH NG, SHOE, HATS, NECK WEAR t;:;. .1~ w '1 1% 4 9' 1







III~~~~~~ ~ ~ ~ ~ ~ I't '7 5' 1IIl it II Ltd I.ft III iso ),--I PIlI t
I I it! lI ..l c t t t is It pl c m ak e I II)":%I cP ~ I U n U '' V\ Ill 11 m il i' a ],,i I\. I.il' ,



I It'' Ias is~tv .74i ii' ia4 Ii d I III, aI I :i1 'v 1: C
I~411 :1 it ~ ifl

h Ill I t : 1 it I(5 i s .., ' \ I I 1 1111 10 V ~ gb
I 4s ] ,1 ;1 h' l1 4 - I A \% '- ., &1i w






itll jit
It 11) is '.. 't-t a Iti Pure, Genln 1.uv~ Iuaf Fres from onhy trya~ Aar~ A t


Si 4': t *i I :i.4 s "S air -s ~ i '' F' ii.I5A1 I f I
A-la d' 11ir ho n Sy u y(,,it... rt .11 lie hat
... -. (," C ASTIR A '- 11 -,tdrll lm













TILEGAINESVILLE SUN: DECEMBER 30. 1107


book-keeper of Cil W. 1Daukniight, Sllkent yostterday %vith relative es an -I frienuds S Ft CT N yesterday in this city with hi.. i iil\ il Gaiitilt "tr. Arnow N ts formii
O WI RIUMr. "I4 Mrs, 11. 1, Siiialihm ,I o,* ,~ .I\ a 1ks i lle bov, and h it I'ii m

COUNTY CONDENSED tm.Mrs. Si,allbome i, I- i r*~t~tit i a U u 1
-o f A r a n d M r s \V J is a i I 1; ,% pt1 l i". -T 0 11 r

S tiers of General interest Gath. friends het, h ~viti- it ii WILO
71 see her.em
ered by Oufr R~porters. Dr. 171. C. ('ra\ irtl ~ ~rp.tvE .
who is engiu.ed ill iii dli- ill w !"i~e stiliiulattsbt o4 i

RS:NAL AND SOCIAL ITEM s i h iyI0i
was n te (i V ~sttri~y.I Iliitato. It is the but I\.ti4
-ford states that lit, i k '~t, t; i N, G a rantt- 1 or your mnity tatkk 1.
tHas Happened and What Is encouraging CIriI::- trA. ;.. i.&t,: W\. Ifoflni & Co.
&imto Happen Told in Short Para- lie aticij)ptt it 'l Subcriivers on rural fre dullIero CH I ST M AS~IR TREA SU RES,
lips So That ,He Who Runs May as the people ()t' 1,,.1 -1 :t 1:; routes call send in their subscrilltiow., to be inl a mnost jis--ri (' w, ilill by the nwail carriers. Person., who Red. NNinTe'u. Plro ii and lvi S t 1 o desire The Sun oil such routes call
oi Fr day'll P !dNA J Jacksonvillt, wcl, iiii i!,- the\asosn in yte ares NOW ON SALE
,jalso sendl pe bynndn the carritrs
C ii i .:hi aunit, Mrs. H. day It is mildo r~t )i tilit V.. i l '. 1 W A. pt'~ter, a regular '4 intti 'I'
a 'ii to 11who owil (icolsidl'rl1,1 l : I l l ,I ittir. hilt- ii:ived froti tilt, Notrth, Il I ~o a c
1lt-_Af. the Wina~or St-i"L 1 'li (I () I'' %Il renit;,! here until sjil' N1- W e i I ie Y u n p c i n o Our F n y Goods
311. .)tafla left esterday for a desiratlt 1,1' tl-i '.; ITV to I s that 1wi gill ft) Yor1w~~~u
1:d, 1.- li t? IAill spend a few Air. Sat uwwr 4, Nw h ) \Ill it ack anioii his Florida frit nil ai~ inl CLA adC~-BXSDLL-GADLTL
~ ih:ltV'.general wagotn-liili Id 1 Ilo'>en a jiltn i\ lFNY USad ACR

\. i iit to his parents, Mvr. !*Fece liI n i i i:tgthsgoet am hpa ins'-Ls. ( dn rm i-tua~ti'S(tlt r~itr of Elgv'iie, \%a'a t- NECKTI BOXSHANY CUS nSACR
Irs~ VSeJe lestday Hil SanFl(] 1 ness visitor to this city 't-eterila Nil. GLOVE and KERCHE IL30BXES SAIGMG
Ir kV egl.ysed~ofrSmFh~k fiok (;,kildt'u1 hjj the honor of ha~ii ilix NOET BOXES FANCY PLATES AND BOWLS
., r pu,,lt aud sister, Miss Liz- where they *w ill. "pet'id a fk'\N tl11111~1t- lostolfint it his p011, niallit I aft~ in NOET boxES BALLS and OTHER TOYS.
in e ~tyfromn Fort White, ing. Squirrecl and other gaint is saidt hinI abo
J Of thV' 4 4ut,, M Is. R. B. Peeler. to be plenltitiii ill tilt. hia ininoc-k at t his r W TEion(fJakn\I,; MACU NGS S
~ tln~I #Clenny and his in- season, and it ikl xpe('taI thatt, \Nai ityort afe .It'slll. %AIUIGST AKES ~k~
19 tI laughter, Miss Josie, hunilt will prove it profitable one. At, wonay 11i t was cit foutew hit, ill' Tk LE SES. tIn
th 1 r m C dl a e t r a y r t ,fi il f t ooii 'l i Alachuta, \N here~ he h ais beni oil a i i GENTS' TRAVELING SETS tl i I;I 1\ big results. andI all are, gettn tittit pilea.sa visit to this ilren P., LCt I PI N CU SHIO0N S
1 l:stt~f Peale has gone to p)ots In ra-diies anr thrir At. Irn. Eloe NK STANDS;I'l~
1'i, wbe she will spend a day* A. Lass-iter 11,11, a (taina's~1ilelM taY iSad r.A.I.Enoe.IKSAD
%kit.Tier friend, Mliss Minnie who11 has (101W wvel ill Alataliii wht-re Capttaini I L. W. Fontaine of Nlic'almll'Y- GILT CLOCKS / 1 ti~.li
p .he i,, eloyeI0(-d bV tilt' K Jaksl IwoI nlgdI telhsht'li PICTURE FRAM ES IiI S-. irett sto ck
E I'u tenvlstrsbrConipaiy at Lockhart. has bllins erNwer.wsi h 't GOLD-PLATED MIRRORS t ni ia-)Ik.y to
\Vr NIf1a nd, was nal thors in e ;iy fr I iat t O o h e for at few !,urs Thursday. le was tii..F :~ l
route t the mIines froni Ii-, hetil' IPV Oou
Vo itrsday in Gainesville Oil days oil a visit to his fath'i. L. L. het lie tjeiit a most pleasanthistl!'ul 1111.l. assiter hits ilaioy friends hecre Ier as. riMran ~ M. K. Flowers of who are always glad to se'e hii.li 1 L Ladies' and Children's Coats
slijring are lit the city onl a says' Alabania is a fine count r. blt Lost~ql oril Willd-~Ic iniw it
idlati, Mr. and Mrs. T. L. he is Olt to get back hon-e icnce Ill fo"at -t aiite ")'it~rk- I i intb*dt .k p Ii .lt j'i\ai il
1~ t hl. M.IIill I,, inl tho naval I d crop hii one ear, swallow fork~q iiim-Ilrt tllI'--11m
awio other; calf upper slope and utidarlit 'Tt rLttlli itei ali it (alu

Ii one (aswardo fork ndr a uiiit (1,1iS ttt)li-s alp ilk.111i.1. 1 of Newberry, were Cont Iiy l it other.Readfrironto o
'v) spent yesterday ill D r. It. :11Ma 1a41 fain IlIll of Jack- 1\I-, Marchan ny, A lach ua. Fla. DRESS COD
4lV.sonmille w\t-re( Ill tilt. CII' \VI-dIIvesilay,1
., i friends of ttkilss Nlargaret It. 'Ill\ ]or. pI. I it I k aiI I .t l -i ie U\ I i F it K \ ltho is attendiii ing~il \001tiii ~It Mr".Ma
t('i- 1-- tl. Ii Jacksonville, !si~tvr, MrS I's J ail' Ti l lalt -4I v. b gr if d to a'i itji it. 4'I1\ I I I f\I III tit I
I> (t I nahith Ii, mi other, Mrs. Iaild May faill11y e njoyfd t i lic ( I I- %%i e gaife ft) ip a'I-it liat
()t 'Xhtiiug, lihi city. mias trt'a toga i-th'r whilei was a (it.. flit. fiae ti ~ tili 41( i t h 4t.
Y "*J'. Hill and son have l-ltfi atai t% littl tl4 \Jwr-ov. ratiltl ]I)%
aind little folkt-. j'!wri4, aNrt' iatiiratlv tYlI
Il an~oJy, wheier ef r 4% i ic I i e- i f t I % I' I (I f I e ii (I ia I~e
it i rs. H ill's par- flianiY hliiidt-iitiit' jtrcst -its, ar t111 \%.i d'i tle ha'.- I1,11i' raw.n "
'Ahieh wa S tit t f -tt(I \A itli W C lliflll "11111-.wl,
SUE. (' shitty it ( Ia- 11.1 vi 111' ati I h s til I lt ti atui4
colored ctudla's. 11i1:1'10 1lis "'" -s ig Aiilp lt tfit,, c~inl.r- Y I t. *-Ia I N
"lark, A. 1). Me- saco tat- 11 W M1 s a tlt \'t e~~ i it l t i l. I-:141111V o J A
Ia~ t tI tit vii au l I Ill ttld t~i il kill m o of~- i. A .-at Ii ~ / '.
M c atri 1 ofa1l i -. roiln cot Alt li Ntz fil 1)eatmm-~ li l! l~ -.4 -I i- li 1111 I i ih
111"i e o u rs- 'l y S 1' r v 11 -1? i l i 1. 1 i t Ill ty 1111 if 1 .1 4 lit portlU
in t V v lt-t j ka t of \\,4 f (i 'i, 44 .t'
1itr liar.

il tilt, Wt lil"!4 a'n mostria I

1 gI- l i-d ril.lt -,I lala l r g lt.II I. Iw i, f r e l W


n1"lb tar Ittilvr .1.e til ci~ v 111 -11 [1 Il tll fille-' ~ Iru d u r

Fl r ii i hltf iI 11 a- r-ili'' f-in \ t i Ila a-t attai ii q j co at 1011 1 % il iiH I f iI L- p i It'll n i F u I t"n uit o~




Full Text

PAGE 1

butt32OAlAUAGAINESVILLEgine-dLuICrigMseWednasdnyDECEMBERAPrepai-diSStorageTnrCtlttiHOgl-THMUII190-HCnllllIIIuTllfJllflny1tt0-YAhtchtailoudnyRates-advertisementsSAMUELS-COexpress100-8JllarklTuuHdax1908WlleoxcondltlotiK-MfinwhllepassengerrafeMeatsSak-eSangIVavtapplicatio-nageofsubscriptionProgramOtheradvertisementsagricultural-linesDELIBERATIONARMAMENTS-TheIMPOSSIBLE-ItahdThursdayshouldersIGAINESVILLEItsWaldoFridayappointment-andindulKetilnFullJunebloomingrecommendationHfCltntfouI1orINSTITUTE-ThesubscriptionsXrnnsVVeaithiExperiencedneighborhood4experimentalpeekingappropriationCongressmanSubscriptionSemiWeeklyCongressmenREASONABLE100-KMlcanopydisplacementMCREARYPennsylvaniadenominationenthusiasts-whopositivelyexpensive-tripDICKINSONgubernatorialJacksonvilleopportunityTHEtlnnTh1ColdhiphgrradeCOLSON-TaxWashingtonAdvertisingopposite-nameConstitutionrecommendWednesdayagriculturalCongress-manap-pointmentguberna-torialAgricultureconsumptioncommissionerLegislaturesuggestionsSUNdemonstrateLegislaturePASSENGERWednuNilnyimpoverishsignificanceUnited-S11orconfiscatorycon-siderablyprepar-ationsappreciativeaggressive1907temporarilyeachf-ionalremunerationExperienceItPfMiblirafDepartmentGainesvilleResponsivedIspesarylMK-vUmtonpaternalisticanticipatedAgricultureJacksonvilleJacksonvilledoughnutsRepublicandetermine-hEWednesdaytoyNevaparativelylegislationPhilippinescrapheapperHlHtcmwunchangedresentatlves12004WOOOunqualified1-AamountingpracticallyprobabilitygentlemandeliberativeDeceinjierFebruaryMELROSE-ADecembercommand-edCommissionCommissionpopulationshipmentswaterwaysDelightful0HartrldgeInconvenientsomethingprojHirtlotiCommissionThursdayespeciallyImpartingDewing21fln000non190-HMolronoespecially1JO-HTrontonpeopleCommonerconventionsDemocratstraversed-byObituarieslresWrntsregardingcommissionthepolitiTelegraphquotationprecedingIm-portantfaudllacylflKuryappointedcomedypopulatedtholmolreeliminationacceptingsubstantialoverlookedadjournNewbcrryIntroducedFARMERSdifferencesThuridaygenerallyconventionregretteddelegatesfaithfullyHedrlckcollectingtheJIouseInjunctionSenatorialforerunnerfurnished1UO-HArchorFLORIDA-itDemocratsThurHilnybeginningpresentedduring-thefollowingregrettedcampaignassemblyfollowingSaturdaypreparingAugustineCLARK-MrperformedaHHeHHtncntreasonablefollowingcampaignALACHUAtastefullyprobablyresolutionspassing-ofincludingttCHawtbonjcottage-MrYearwoodVontlcelloannouncedproposedprincipalClubbingglit-teringConven-tionlimitationGainesvilleRecitationwarshipsknowingcomposureproposedChristmasconventionRooseveltstandingDorothysRepubl-liiWeeklypracti-calTunndftyinterestedcertainlyrailroads-Informidablealthoughcandidatespecta-torsalthoughsermonautaoritletravelingpropertysupremacybuckwheatresolutionsholidaysRecitationyestertfyprobablyFebruaryUWJITtDTueHdayRecitationoesUnlonexpecteddesignersJanuaryClevelandRecitationJanuarysufferingheretoforeCollectortf-RakiKbindividualSec-retaryfJeurgltiMThomasendorsed-nRecitationJanuaryCotifrpoiiCongresslOOg-HlKhsur-prisedpromotersinterstateBryan-wasstandpatstandingJanuarya-politicaldeclared-ItinstitutesJanuarypremiumTuondaycandidateDecemberCommercebuildingwelltodoInsertionSavannahreturn-ingornamentsChristmasInter-viewJanuaryJanuaryPrewlttsLutheranfollowingreplacesexcursionGeneral-usJanuaryJanuaryjilaoon-onpleasantpreacheddecoratedRecitationrequiredJanuaryChicagodoplotedadoptedconsumedOwgluGovernorYearwoodrailroadsrequiredJanuaryJanuaryWentileldcandi-daterailroadswarshipcandidateworkingattainedfunilHhedpassengerarmamentsMalloryquandryInfluenceGovernorMondaykeepingshippedpoliticalJanuaryJanuarycharge-ofrankingInterstateojipoHltebeauti-fulresolutionBranchAmericanNationalJanuaryabsolutoGovernorWlllefdrdpoliticalprimaryJanuarypassengerMalloryconcededpositioninterestsonetenthrenderedperhapsprop-ertyhospitaldeterminreturnedpassengerreporterTidingsreturnedLatterlyWilliamsSundayrailroadsthousandportionssnippetMondaynaturallynemberhowlingBONNIEpromptRailroadcountriesJllvlnoStocktonftochellgreatlymakingdenselymeetingmanagersAttendednothingrendingdintilledyoungestInformedaudiencepotatoesHuslmndprovidealreadyfeed-stuffsrewardedfiddlingfarmingat-torneyeveningpleasedfire-worksex-pectedStocktonwhereverMondaythurobyMondayattendedannouncessalesmanstandardenginesspeakerde-mandsprintedthankfulcriterionremainedenemiesHandledspecial23rd1-90HBrowardla-mentedreturnedexcitingIIHshuAlrseseaidestinedsupportSAlItnMntrmssingIntendedBrowardexpirespurityWILLIEservicesSeringIncreasehoweverGeneralInstitutedirec-tiondestinedhoweverPayersAlachuavnknbleInsertedshould-beHuffmanreturnedau-dienceIncreaseincreaserespectbrilliantPearsullPRAISElikely-tostampsgesturepopularship-pedAtlanticmarketmakliiKpoliticsItmistakeInvestedcrowdednoiwlayHedrlckreachedmatter-erfinancialplainlyCricketcravingplacingf2-KttninamelydisplayStick-andTrinityczpenwescreationmonthsmanagerfiguredInstituteRail-roadharborsrailroadpartiescopiesstampsmillionsAmongincreasereducedMtlafaotlonholdingAtlantaabsentwateredinstitutenaughtCrosbygrowthpresentWhiapurposeJacksonAtlantaspecialTampaarrivalsval-uablebecausefavoriteMelroseOrangeSena-torspassedMelroseFloridarequirepuactittpartiesrapidlyFridaypeopleendingSenatorrivalryelectionanimalssectionsjmylriKpassedroquontpnrtlruPrayermistakeJanu-arypeoplelraIJ-Wfl1lequal-tosupportrailroadMftcalfsucceedgardenconstantopin-ionpeopleprogramquarterSenatorfurthereverjRradymainlysectionschargesense-lessnaturalacceptfarmersrrldayalreadyavowedseveralNAVALaddresshigherFridayFloridapraiseSun-daypeopleaccountenormousexpensesatisfyInterestfamousdemandcandlesaccountHspeedynumberCowardweeklyWwJuofinish-edpayingirlat-lojtwar-shipsessionAtlantaFloridademandfarmerslearnedgreaterlayingdollarsJournalruinousnoticesIslandsthingssuccess-infigurednumberOeteengreaterrequestRATEStobaccoSamuelfactoryfondestpeoplepeopleirnlnRiTl1eHprlnjfriendsseldomVnnnloenteredpresentClar-kIDenverbelongsingleThricegradesbarleypeoplefriendsTainiiigradescontestlearnedcompleteIllegaltodayuselessOXIXJDHOMtilyorangesserviceprocurefriendsrepairGainesformerWodnoMgerthree-dmonthsurgedvariousBryanoutlaybrokensilencegradeMullenchurchchurchBryanHOWORKfillingreallyMarchHousecentralWilsonlikelyannualburl-nerscountySev-eralofficialchurchreturns1008-WHalruoMinnietwelvenoticeMiscvssdollarsshouldmade-anBritishUnitedowingWorldIslandHiuphtanimalhopesFloridauitMtifriendsmoneyciutoincraearlieranyoneTeresamakesMorrismarketOuoOOOStet-sonshouldsixteenrefundrefundedusefulbeingoughtshownBryanrnwentbeingfinelyproudHyattshouldStateshealthThursCases-NMlradthumanStarkeChoicefigureshouldprmrawhichMorrisdefeats-FancyfixingprobeWeekFancyHousesaddleknownXMASFrankwhichothersTimesconvenereturnsknownQuitevalueMerryEditorcurrentbringHoBHloUnionwherewhereknownknownsheriffsWopassesFrankNoticeeditorregretattendcussedattendwhichDeathTaicegoinjtKeysappearYourseitherdefeatotherswhichGuestsTherereturnalongSavanshowsWeekmoneystationpriceplaceCottonFancyMeatsretaUoraagedTherefillingctvpotlvON6EItouringshowsnoisytenthsbeginwouMcottonStateswhichwhichregretIXKMMagainwouldresultusefulplansflavoreitherfirstwhichRemitownerDontoffer-ItUnionquitewhichwouldWhencannonClarkconiumorshousegivenhenceTUMHmaximKUiKtN18-Flnotrafficpricenightonbattlewouldwheat2centgivenpaperClarktrafficstrivewhichWhenablecheckrulerstJUUJtutErwin250naboutCedarchairSouthtrafficcalledyoungheardPasconever-sowhichaboutwhichErwinbeingClarkwhichUnclewhichIrredTermsproveHotelCoastboxessightquietwhichwhenquotamakeislandlouseTheirXmasrelishIMunderSongEverytimesdeathfancyunion10000centsheardcrowdworldthereFloradaysnightfinestlowedhopecentsrarySincetheseuneyaac-tualjfMJan22ndnavalbrctakboxestrunkNinasXMHIHFortunegoodmadedoorsSongstockthoseCoastXmasaboutbaaedInlaymanyalonewhileStatelistenViewwhenmurlifancywhiteStateunderlatestwoodagreecentsceivevaluemakeotherthosekeyotherStatetlusemunchorderfactorIflJfjNotestrustsmademuchthoseStatethesemanythreemuchmadegreatWiththeirRingeverylatterreturnolderStatethoseWestcouldgreatideaschairPricethatmakenavalofficeChlilse-aIdtheythereRye125therecentsfavoroiborMiinillvhereseasontheremanyproveaftertwicelittletaxescouldnavalvaluemultIRinglongaftertipoWiththeirorderStatethesevalueotheryearsblanksgoodlittlelilacprovefaresLimatheyofficeTakewhat1908officereliefvalueThedutyyearsbuildplayplantherePriceFrlduonlytheytheirOhio1908thornGiftsFlitsmentxtheresectiongiftst-1JOHratesyeareveryrunnywithOftdatesbottUIStatedatesofficeboaofHrenewyearscropscropsTHElittlethemStatethemmanyhavebuiltclassJohnatallStatesuchWedhaveThuroldercoststuxespartycropscropsmanytaxwiapdtheirEvorytHiuntiluntilhellstheirtlmoCarwaitpaidexcuseseemsMadebookhaveYorkfromFlnHbeentotalupon1007noneydonehaveThatfiftyForFla8Fiatsinlllxthe-Mhavetripfromfrom1008fromcourtdownHellsLakehaveruingshedbeenyearswithbest1008YourttittartertownweekJuneshalldonsOhiofromfromJunosakeratesmostwood2-0IzgaingamejustOhioOhiothanfruitseemseveryGladlFoOHellssalesdnjrbunt2500frombeenbaYhaveneverfromafterdirectwill-IsseemsCitydaydeckOhioTreerates1902yeartheirhavenextthanbooncarnekeptMelabilltyrowithff5DO-WhavemustmustthanmustheaduponhavetotalbillsyearFORfarmMissfrombeenyearyearbothhear2itheachhereMont19071008upontownratesJustPlainbeenUbltinsOhiobeerthanGulfhighfromfarmtrM1f30thYearThisslotajajdatelookbothwithBayHtheltcn1008withEasttakewarmfromtheirmustthat1079tltntthattutesthanBest28thwife20thorderuponlastusedQts1110724ththatheldholdGETNewmilecashwithManscarcecitypricebeenprofltwhykind10thtownyearmetathanthatthat1taskwhothatlaudvlewFineverywillthughalemeanpassmorevote1906ithatnoththatheldheldwhoffuarnverypoortfEastthanverythatvisitmosttreatMissmayItiRtivisitverythatKith1906servethatyearakrwellfirstlurrtinsdayTheyearyearthatalsoCalethatthatlustsome175FlorOftnJCththatlosesaysmostlionthatthatthanroomdealsaleItchfirstcomemoneywellwhotnatdayyearthisgrowmayTheIntoFairlosefactfreeTheTheTaxstillthatwhothatthat1908alsoheldmoreBHtWritePIlEanddutysameThehimThe1107TheIfithwaneThethatthatdIM1thatTheListJlftHIts1908wellwhonirrefeeltreesrnandandthisandwillstillTheHellhimHHtNewsamesomelinewillfeetthatRevHerRaidwhoyearnunscost1UOHtidesizeandthiswillwillandOrovastvoryveryThethatThesomeThetruemosthowtimeliarfluidhalland150thlH1111TheandwillLeo150SununitthatTheTheEcksaidfirmfairwithingbigandwillnextthatThewillthisthisandandDecandhallandwillThehasandrollandhimHadIntoTaxseemintorralhasandandhadhimandwillandwilland165willandRevthoJIMstilltreethe-lwaysaveOurutlttKckandhr4andrindthisoatsandandandwillthiswillSheOutriceRevRevmorehaswillandwillandwillandandandIngcentandlastduothisMrhallfairfeelandflirttreewillrevlnextfor-tcostresttonslastandhasduehasButandhasnahandtbwthatandandwillandflMOandtwowillandSunfauyettonsthehasandnullLETevenbillendhasandfairandandandwillandandandtendrindhasandandamiandandOutdejandthoClftoverevernumandwillhashasVeshipherthethewillTheandantwillabelandandandMandDecyrarotrrMtheiwillandhWbutthohasfailendLeoOurandandnotthebutthethetheherbuthasbuttheanyleethefHlButwillsadghepaythethethethethethethelaxthethehasthe4thagothebillbuttheWebillfewbutbutthethethethebutthethetherasJunthethethethethehasthehashwshe2ndthetheleftputthethetheDtli7thiwillsoonFlaWe8thmandlyfrdnotgiveIithethethethethethethetheOMthetheholowthethethethethethebutthinthetheCthcamIngtmybyth-atrephasthetheomethebutthethethethethethethelothvteedHethethethebillthethethethethethewillthehimcomnownotoutperhasthethethethethehasthethethethethehasthebutthethethethethethethethothethethethussayagonewmannotthethetinSlhnotthethethetheHessthethethethethethetheLetthetinthunotSea000thethethethethotheyetwastlymancornMibuttheCanttenthethetheherthetheSismantheSunhiswaswasidakI1butthethetheper3rdwaswaryourSunthethethethethehilthisbymanwasthewastheapenotwassumHesunforout50cforforarybySunAllTlfor12outbutfigtentaxTOtheMrforforforblfAllforhisforwarIiiforonetheandonetaxnotthefortaxforforSuntheforMrforfurbywaswasforforgthryetennotnotairyforforanyforforforforoneareIonEdby5fwillforforareonewasMrGaforhisforforforhisliewasbybyIwanwitssaytocMrforforforforMrforonertxvgo-oGanotbutforbyforforforforforforWebyfurbylarMrhastedtileMrallffforwasUSMrbyourall5clfrashbySriMeWtheallforHeourMraliItrbyforbybycanAnareTL1mandallforourRutartarearehisnprareallranflfthebebybybytheWareimItsallallallofofuplieallmeWareareoldallitsrniOnto-yIsartjotbeWaretkbeMIKbeartheambeFbebeitssetfurbeup15areABhebeseebebebethe=belxas-abewseewebelHtarebehebeMberbeviratatINhobe21an10ofalttbnew31ofarebehebeWsinginItof17gosrtofofofof20at50ofofatret13areInUearweofofofofof30ofofStatInofofofofofofofofofofInofofofofofoftoofof2Jtoofof2Swe1mtetoInfitofInInnoofInofofWofInoftooftoofofInofofoficeofonoftoofofofeerofofatofofat30atofourInonInInIninistoIntoofofofofofistooftotoofofofofofofofofof30attotoonInIsininofInintoofofofnooftoofnftotooftoonantoattoIsonIs11InInInofof16anananofofof17tooftooftotoatattotototoBOononanexenalIsus21intooftototonoonIIofaasIninIttoIsftitoininInontoMtotototoatastotoIHinusinisisisInItisoratisisIsinatattototosoastomonIstoasInofhtXItisisIfItisoftouIasorbetotoreortotoIonInItIsInonhvitisIsIHasit=ashrisIIsinMIfitnMIIIsitC1jIsootIKalIsisIKInAisIsIsIsIfNN=IHAhiMrIKTitasIC4MTItanititYitIisistoECorPittoKjrItItmarLSIsuisTwItiritPHutttliilIfjfioIJp=HC2r-AIJt15Iaaif775IR3aaaaoaitaIndaaaaaaaSaasaJaTaaaaInlBaaaaanaaanraaaaaaa9Itaaa1ygkItnaafIn=aexwflIuIIIraeI11t+yttt1III1li>i1><>Jj1IiIIstt1irW<+<4I>atIrl1j>iIithu


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN00034\ocr\0486a.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:13773
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1694
splitwords:0
ScansoftOCREngine Character Count:11602
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:13953
Abbyy6OCREngine Character Count:12704
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;12704;2152;43.117;89.6725
language:en
ScansoftOCREngine Predicted Accuracy:66.94%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:4581
ScansoftOCREngine Character Error Ratio:0.394
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;13953;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:89.67%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:89.67%
ImgPrep Component Range:12509,13773
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;11602;4571;0.781245;66.943
noPunctuation:1
ImgPrep Component Count Low Estimate:12509
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 10.0 ID4 24.0 ID5 13.0 ID7 31.0 ID8 12.0 ID9 11.0 ID10 17.0 ID11 8.0 ID12 14.0 ID13 19.0 ID14 15.0 ID15 38.0 ID20 6.0 ID21 4.0 ID23 20.0 ID24 25.0 ID25 9.0 ID26 37.0 ID27 35.0 ID28 36.0 ID29 23.0 ID30 16.0 ID31 29.0 ID32 18.0 ID33 22.0 ID34 56.0 ID35 28.0 Layout Page ID1 HEIGHT 31100 WIDTH 19596 PHYSICAL_IMG_NR 8 PRINTED_IMG_NR 7 PROCESSING PrintSpace 31016.0 19400.0 HPOS 0.0 VPOS 80.0 PC 0.89669997 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 2120 15512 904 80 ns1:type simple language en TextLine 84.0 1084.0 String STYLEREFS CONTENT I WC 0.8095238 92.0 68.0 16348.0 1312.0 J 512.0 13784.0 1320.0 1540.0 1736.0 x 156.0 1768.0 1792.0 > SP 368.0 1400.0 64.0 5384.0 1788.0 3560.0 1824.0 296.0 168.0 6468.0 1756.0 f 1020.0 5448.0 264.0 640.0 8408.0 1716.0 THE 1772.0 6636.0 292.0 2064.0 9192.0 1688.0 GAINESVILLE 0.95238096 ALTERNATIVE GAINESVIIJLEAINESVILLE144.0 9048.0 272.0 560.0 11400.0 1668.0 SUN SlJNSl1N11256.0 320.0 1680.0 12176.0 1600.0 DECEMBER 216.0 11960.0 284.0 772.0 12232.0 1632.0 DECE -1624.0 13856.0 280.0 724.0 13132.0 IBER 128.0 13004.0 304.0 288.0 14016.0 SO 0.82539684 RO160.0 256.0 196.0 14180.0 1584.0 0t -124.0 14304.0 576.0 14528.0 1556.0 1907 0.96825397 152.0 14376.0 268.0 14532.0 1560.0 1y -572.0 15104.0 244.0 188.0 14916.0 1552.0 17 116.0 14800.0 228.0 616.0 904.0 1972.0 124.0 0 176.0 1344.0 2048.0 V 316.0 1028.0 xmlns:ns2 ID6 27888 5996 2432 ns2:type 428.0 5808.0 52.0 2432.0 32.0 2528.0 g 48.0 1428.0 2812.0 r 408.0 864.0 2736.0 2448.0 STATE 1256.0 1480.0 400.0 344.0 2452.0 Sf -864.0 3600.0 392.0 3104.0 2460.0 A 3080.0 328.0 3280.0 TE 3256.0 800.0 3824.0 2440.0 NEKS NEVYS3608.0 2444.0 NE -800.0 4624.0 360.0 208.0 4216.0 W 4168.0 384.0 4464.0 S 40.0 4424.0 4816.0 IN 192.0 588.0 5272.0 2436.0 BRIELive 200.0 5072.0 1188.0 752.0 2860.0 2912.0 Jh 88.0 1244.0 t 348.0 896.0 104.0 1704.0 2892.0 tt 404.0 1300.0 76.0 1892.0 2916.0 1808.0 Ji 1948.0 3044.0 i -104.0 2052.0 164.0 4108.0 1888.0 3148.0 112.0 140.0 364.0 2908.0 3172.0 Live 968.0 1940.0 3392.0 3164.0 Oak 120.0 3272.0 132.0 3832.0 Is 3708.0 4088.0 to 3960.0 4368.0 3156.0 have 4240.0 4872.0 3196.0 a 4752.0 340.0 5088.0 new 4964.0 136.0 444.0 5552.0 3168.0 union unloi5428.0 unloidepot -444.0 5996.0 892.0 3304.0 Jr 1536.0 1640.0 3396.0 72.0 448.0 2728.0 depotr 1016.0 1712.0 2732.0 depot 3176.0 depotThe depotTho 5212.0 784.0 3572.0 3616.0 100.0 884.0 s 44.0 840.0 2900.0 3612.0 The Tho1964.0 936.0 148.0 596.0 3312.0 saloons 96.0 3216.0 4016.0 of 108.0 3908.0 180.0 4268.0 3604.0 St 4172.0 920.0 4596.0 Petersburg 4448.0 380.0 5616.0 3640.0 wereeJosed 5516.0 worea -380.0 1160.0 3792.0 260.0 2480.0 4 1224.0 508.0 2708.0 closed eJoseddosed204.0 3284.0 3828.0 all day 3488.0 184.0 da -280.0 3840.0 852.0 3916.0 Christmas 172.0 3744.0 ChristmasThe ChristmasI-852.0 4768.0 Christ 3864.0 mus 4428.0 musThe -320.0 2888.0 4276.0 552.0 3344.0 4272.0 fishing 3204.0 692.0 4032.0 industry 3896.0 4860.0 4724.0 824.0 5168.0 Pensacola 5020.0 Pensacolagives -824.0 5992.0 3800.0 1880.0 4492.0 4524.0 1 424.0 4496.0 gives 760.0 3212.0 employment 3132.0 4320.0 4503.0 4552.0 4528.0 over 4472.0 5000.0 500 4912.0 336.0 5344.0 men 5256.0 menA -336.0 5680.0 menr 1476.0 548.0 4756.0 1324.0 2880.0 4928.0 4940.0 4936.0 favorite 3008.0 648.0 3892.0 4932.0 pastime pasthne3772.0 4668.0 In 4540.0 416.0 Palm 4804.0 492.0 5492.0 Beach Bead5356.0 440.0 Beadis -492.0 5984.0 Beachis -440.0 5932.0 3072.0 2692.0 5148.0 5160.0 is 2920.0 5164.0 2836.0 5192.0 go 3420.0 5155.0 3332.0 4048.0 out 3972.0 4388.0 on 4316.0 252.0 5152.0 the 4572.0 5008.0 long 4920.0 324.0 5440.0 pier pierI -324.0 5764.0 pierTJje pierThe 3100.0 5592.0 5600.0 TJje776.0 3360.0 5596.0 Salvation 3200.0 452.0 4312.0 Army 4136.0 5624.0 gave 4764.0 5476.0 5312.0 5728.0 big 5560.0 bigpChrletmas -252.0 5980.0 248.0 bigClwletmas 224.0 4176.0 1748.0 5816.0 5888.0 220.0 1176.0 2356.0 5820.0 pChrletmas 540.0 1816.0 856.0 2676.0 Chrletmas Clwletmas-856.0 3532.0 536.0 dinner 5827.0 4144.0 4444.0 poorof 4696.0 5848.0 poor -588.0 5204.0 5132.0 484.0 Pensa -484.0 5924.0 Pensaeo1a 6048.0 cola eo1acolaStrawberries -340.0 3032.0 eo1aStrawberrlcs 2872.0 6252.0 1064.0 6260.0 Strawberries Strawberrlcs4028.0 6292.0 were 3936.0 4520.0 among nmong6255.0 5068.0 5524.0 fruits trults5420.0 fruitson trultson-452.0 5976.0 3248.0 2680.0 6476.0 6524.0 3000.0 6488.0 3368.0 market 3252.0 4072.0 6479.0 3944.0 592.0 4344.0 Bartow 4212.0 232.0 5056.0 for tor5416.0 Chrlst5288.0 Chrlstnas -512.0 5928.0 Christa 332.0 6744.0 nas masnsasnasSweet -332.0 3024.0 nsast 1896.0 376.0 6804.0 60.0 2212.0 6896.0 e 456.0 3096.0 2868.0 6960.0 488.0 6976.0 Sweet weet684.0 3452.0 potatoes 3356.0 4232.0 6996.0 are 4592.0 selling 236.0 5232.0 tor300.0 5664.0 6964.0 140 5468.0 140ysr -300.0 5964.0 140er 140per 308.0 2216.0 6983.0 3288.0 2672.0 7184.0 276.0 7224.0 per ysr2788.0 7228.0 er -160.0 2948.0 520.0 3068.0 7188.0 bushel 3764.0 in 3588.0 4092.0 Homestead Homcstead3904.0 5224.0 and 4996.0 5688.0 7216.0 aret 5692.0 -268.0 5960.0 arerather 2040.0 7372.0 524.0 2668.0 7411.0 rather 572.0 2096.0 7444.0 scarce 3192.0 7416.0 at 4152.0 7408.0 thatf thatt4052.0 4156.0 that 4480.0 thatTho 2488.0 7624.0 ir -32.0 2520.0 2256.0 7728.0 t2428.0 7780.0 2296.0 5580.0 7848.0 7892.0 2856.0 7859.0 Tho The2416.0 1248.0 7852.0 Congregational 556.0 4644.0 church 5316.0 5200.0 Day Dayfcma DayI Dayt3696.0 8024.0 t2560.0 8139.0 2300.0 2664.0 8083.0 bona fcmakDa2588.0 3108.0 8076.0 has just 3376.0 696.0 3852.0 8072.0 installed InstnJJed4640.0 8108.0 4548.0 4812.0 fine 4728.0 5188.0 8104.0 5108.0 5608.0 pipeV 5612.0 pipe 5952.0 pipeorgan pipei 2220.0 2392.0 8296.0 8320.0 -72.0 2464.0 476.0 2656.0 8335.0 organ 2532.0 3240.0 valued 3868.0 8307.0 4228.0 3500 3500Tho -384.0 4612.0 8604.0 1Iri -20.0 1r1r 2336.0 8615.0 11 3568.0 2328.0 8696.0 ri r1r2844.0 8744.0 Tho2504.0 1000.0 3264.0 8740.0 subscription 3160.0 4380.0 8748.0 rate 4264.0 4820.0 tor4708.0 8735.0 5052.0 5480.0 week 5364.0 weekj weekIweekt-416.0 5896.0 5452.0 480.0 8888.0 8940.0 544.0 2304.0 8951.0 1484.0 820.0 2652.0 8968.0 ly2364.0 2716.0 9004.0 j -96.0 528.0 9000.0 papers 3524.0 8964.0 3428.0 704.0 3760.0 Manatee 3660.0 county 8959.0 5096.0 5556.0 been beenft beenm-376.0 beenraised 2324.0 2344.0 9168.0 ft 2408.0 9172.0 -40.0 500.0 2648.0 9188.0 raised 3244.0 3576.0 9183.0 150 3956.0 9216.0 4308.0 9211.0 year yearSt -360.0 356.0 2072.0 9320.0 m 3084.0 2840.0 9624.0 9636.0 900.0 3136.0 9628.0 3004.0 4120.0 will 4036.0 4500.0 hold 4412.0 4924.0 9659.0 an 4840.0 644.0 5280.0 election 5112.0 electionon -644.0 2644.0 9844.0 9891.0 0112964.0 9852.0 tho the3336.0 9855.0 31st 3220.0 31 9860.0 9848.0 this 3928.0 month 4348.0 5124.0 4992.0 5400.0 decide decidewhether -524.0 5332.0 10068.0 10115.0 680.0 2640.0 10072.0 whether 2024.0 3412.0 10107.0 or 3320.0 3676.0 10079.0 not 3580.0 4392.0 city 4288.0 4788.0 4688.0 bond fori 5584.0 ror-232.0 rorI 1436.0 1776.0 10208.0 10224.0 1800.0 10296.0 80000 1800002084.0 180000A 80000A -476.0 3416.0 2456.0 10488.0 10628.0 + 2816.0 10560.0 10555.0 wood 2952.0 3548.0 10552.0 famlae tamwofamtne3448.0 4204.0 IB888.0 10548.0 threatened thratened4332.0 thrt -884.0 4868.0 tened 4760.0 5668.0 De DeLand -204.0 5872.0 Des 5460.0 10751.0 420.0 2632.0 10779.0 Land 2128.0 504.0 3184.0 10812.0 says 3052.0 312.0 10776.0 Tho4012.0 Record Hecord3924.0 468.0 4808.0 Wood 4584.0 5372.0 5276.0 10804.0 now lOW5500.0 nowfor 5916.0 nowt 5640.0 lOWN -272.0 5912.0 3704.0 656.0 11000.0 N 1032.0 11016.0 812.0 e1 1076.0 2720.0 eljjng -148.0 3092.0 11036.0 3188.0 3684.0 11004.0 6 03500.0 3844.0 3752.0 cord 3932.0 cordTho -344.0 4360.0 1696.0 11184.0 rim 700.0 11207.0 11299.0 756.0 2100.0 11192.0 1036.0 2132.0 11336.0 ti -4.0 2136.0 5412.0 496.0 11403.0 l 584.0 11420.0 fj 11444.0 Tho2036.0 3232.0 strawberry strawherr352.0 4236.0 11480.0 crop 11448.0 4588.0 11439.0 around uround5220.0 aroundBtarke -576.0 5908.0 uroundI aroundStarke 4836.0 1080.0 11660.0 11680.0 +2624.0 11668.0 Starke Btarke1520.0 1104.0 3400.0 748.0 4140.0 11663.0 condition 4040.0 5136.0 rho4888.0 11696.0 5444.0 cropis -364.0 cropJs CropIs 2616.0 11884.0 Js708.0 11892.0 expected 2756.0 3712.0 11896.0 3984.0 be 4292.0 worth 4164.0 4880.0 11887.0 about ahout5564.0 400 5348.0 2612.0 12111.0 000 000ti 12256.0 2804.0 12368.0 1092.0 12376.0 Congressman CongrcsAmln12380.0 4328.0 M 4652.0 Sparkman Sllarkman5636.0 12371.0 haRhasintroduced -276.0 haRIntroduced hasIntroduced 3308.0 2604.0 12587.0 880.0 introduced 3556.0 12632.0 3484.0 3716.0 12592.0 bill 11111111 -256.0 12595.0 -140.0 4192.0 4280.0 Congress COIIErrCS85100.0 5028.0 5404.0 upubi 5496.0 pub Il1b5864.0 public Il1blie 5876.0 12664.0 3796.0 2116.0 12811.0 12888.0 lie lic664.0 2924.0 12816.0 building lmlhllng12824.0 It3856.0 908.0 4124.0 432.0 12819.0 Pcter -908.0 burg 12828.0 cost COAt5464.0 568.0 13032.0 100000 100000CitizetiB -568.0 100000CltlzclIs 100000Citizens 3112.0 2792.0 13292.0 660.0 Citizens CitizetiBCltlzclIs3656.0 13300.0 at3808.0 912.0 13295.0 Petershurg5512.0 havei 388.0 -388.0 5904.0 havemade 13508.0 2600.0 13519.0 made 1960.0 768.0 13524.0 extensive extenslvo3048.0 3180.0 13560.0 -764.0 ten81 3260.0 3780.0 13552.0 vc 1048.0 4084.0 13516.0 preparations IIrol1lrations3948.0 ror5648.0 tho5508.0 theentertaining thoentertaining thew 13687.0 w 13732.0 13740.0 entertaining 3784.0 13743.0 at3628.0 4504.0 State StnteTeachers TenchorKTeachersAssociation -768.0 5856.0 TenchorKAssociation Teachersi 13891.0 960.0 13964.0 Association AssociationC -960.0 5260.0 14156.0 2776.0 C1 2056.0 720.0 2780.0 14184.0 C 3020.0 14188.0 Turner 3940.0 aged agd3816.0 4408.0 14191.0 43 13436.0 4664.0 14219.0 years yearH4568.0 620.0 commit committed -620.0 5852.0 committad commitr 5860.0 14260.0 14387.0 14408.0 ted tad2104.0 2980.0 suicide sulcldo2852.0 14412.0 3540.0 Jacksonville Jl1cltHOnvl11elast laRt5472.0 14415.0 weelt5360.0 weekMtlby -420.0 5892.0 weeltby weekby 2184.0 14608.0 Mtlby 2596.0 14624.0 by 2800.0 14627.0 shutting 14632.0 himself hlrllAelt14636.0 4324.0 14672.0 n -84.0 4580.0 his hl85060.0 14667.0 room andI alld-292.0 andturning alldturning 14832.0 14879.0 624.0 turning 2144.0 3316.0 14891.0 3224.0 14856.0 time14896.0 gas gat3860.0 gasTho -264.0 4220.0 gatTho gasThu -236.0 15296.0 15319.0 2784.0 Thu632.0 2152.0 15299.0 Clyde CII1l3728.0 Lino LhwHine3644.0 860.0 Steamship StC1fmHhlp5120.0 15304.0 Company Companywill CompanyM460.0 Cornll 5700.0 15336.0 lI lIwill -80.0 5780.0 3456.0 15492.0 15520.0 2496.0 havo3528.0 15556.0 3736.0 15523.0 fllllnew4020.0 passenger IlnHlwllgcrpilss0uger4468.0 5544.0 15528.0 boat huatboatnamed -352.0 huatnamel 15727.0 15739.0 named 15775.0 namel -540.0 3152.0 tiw676.0 15744.0 Mohawk lIohawltlllohnwlc4600.0 1114420.0 972.0 4904.0 commission cornmlHAlonconttulsslun4736.0 commissionearly -972.0 cornmlHAlonoarl 2396.0 15879.0 1496.0 15963.0 early oarlyoarl 15971.0 next noxt3592.0 15968.0 spring Hllrillg3480.0 springTho -504.0 4096.0 HllrillgTho springThe 3060.0 16404.0 The16436.0 16411.0 Il 916.0 16408.0 Hollonbeck JflIoubucltlluubcclc-116.0 Hotel lotul4632.0 16416.0 Ilot 5228.0 5092.0 el SlStPetersburg -168.0 Sll1ctrRhllrg 16628.0 16631.0 l1ctrRhllrg3648.0 hnAhits3520.0 4044.0 Iwon3920.0 opened IHwd16635.0 rorthethoneatjon thoIWaljOU theseation 16799.0 2608.0 16847.0 16883.0 neatjon IWaljOUseation16852.0 Ihetimehotel hot13688.0 16855.0 1M4508.0 thoroughly thorollghl5504.0 mod nUIIIniod5396.0 modern 5836.0 nUIII1n niodCrn 16915.0 5832.0 17071.0 17104.0 ern 1nCrn2988.0 every 3124.0 elr -436.0 17088.0 respect uHpert3584.0 580.0 respectM uHperttrespectlrespectfrespectW-584.0 4376.0 17284.0 3880.0 17359.0 17463.0 17516.0 112884.0 17519.0 ACoy eor 3720.0 IhlAlvin AlvlnAIln3968.0 4564.0 fig 4832.0 17552.0 grower hror5528.0 ralCd 5532.0 rais rnlHral-216.0 5748.0 -304.0 17583.0 17735.0 ed 1111Cd17740.0 idO jOO40017771.0 cases lnHlA17743.0 ut3732.0 Hgs IIgl1llgs4556.0 thlA4980.0 4852.0 5172.0 nr 5036.0 III5796.0 17776.0 n5656.0 aono -88.0 5884.0 17955.0 17987.0 1110 ono3036.0 111113464.0 17992.0 nnr 3468.0 onethird olllthhllthird -392.0 acre nto4828.0 grove grovu5568.0 17959.0 TIlt ThoThe5284.0 Thofigs TIltf1g1ol Thefigs 5840.0 2340.0 18176.0 figs f1g1ol2984.0 18196.0 net 18183.0 3364.0 18219.0 -120.0 3404.0 18216.0 < 3388.0 18179.0 him hllllhint3432.0 18188.0 3884.0 4256.0 18211.0 IHIcase CIHWcnso4512.0 cnsoIho -348.0 4948.0 4604.0 caseTho CIHWrho 18624.0 rhoIhofarmers rlllII1rMfnrnmt -624.0 3872.0 18655.0 rs 3668.0 4000.0 ot4304.0 lloynton lorlltlJllIioymmt18667.0 -176.0 4824.0 n1 arc ar0nl com COllicoin5248.0 coinmouci11g 5828.0 cominenclng -316.0 COlliIUOIICIlH 18840.0 18843.0 inenclng IUOIICIlHmouci11g3380.0 18860.0 t0break brenkhlflnlt564.0 4132.0 ground tOl5012.0 5424.0 plant 5340.0 plantof -400.0 5824.0 III plantMpg -128.0 5576.0 18879.0 nil -248.0 5788.0 18856.0 5760.0 IJllg -36.0 3236.0 19059.0 Mpg Jllg2956.0 19067.0 ot19064.0 thlltthls668.0 19100.0 seasons IIIISOIIHsinsons3512.0 19095.0 1011crapor19072.0 tomatoes tOIllIIUlHtoumtoes4984.0 tomatoesThw -748.0 tOIllIIUlHThu 744.0 toumtoeskTho 2512.0 19255.0 kTho 19283.0 Thw Thu628.0 3016.0 19316.0 acreage acreng19319.0 arII -628.0 3504.0 19324.0 19288.0 Illhi4024.0 4404.0 lll11l1tnbottt4952.0 as IUIusual UIIIII11usualTho -424.0 UIIIII11I usualI 1588.0 19523.0 212.0 5296.0 19744.0 19764.0 The2060.0 716.0 3228.0 total tolnl19767.0 shipment slilpnCntHh -752.0 19800.0 3888.0 19772.0 IIIor 4004.0 -152.0 4748.0 4876.0 cigars lharltfrom rromfruit5368.0 fruit9atnpa fromampa rromlanllU 19988.0 lanllU 9atnpa2724.0 20019.0 ampa 3276.0 19991.0 rromfrontJanuary lmunlery4396.0 20024.0 4208.0 4296.0 19999.0 1st -208.0 20004.0 19996.0 lu4720.0 5064.0 December cmlllrDlcemIr4960.0 December7th DlcemIrr-820.0 600.0 cmlllr7th -600.0 20207.0 20304.0 7th 7tli20239.0 was wnA1mis872.0 3476.0 20211.0 It5l17riiiin 3328.0 tH1 2ttmI-872.0 jfIIIIII IOU4544.0 20248.0 nilmill4896.0 Increase ItIlftlHUhmerensa5736.0 Ini 5740.0 111-132.0 Injjlahlpmont 111tah 472.0 20396.0 20447.0 2468.0 20404.0 jjlahlpmont shtpuunttah -828.0 2808.0 20427.0 IaHulnt 20463.0 mlIhint IHIlastytrrl -356.0 4712.0 20432.0 lIf732.0 4968.0 IfiliiOOlM 15450014864.0 IfiliiOOlMlov -732.0 20439.0 5040.0 r1 5004.0 5268.0 20435.0 iiOOOO 5236.0 iiOOOOOm -480.0 5572.0 20864.0 20887.0 9 20943.0 2164.0 Om 20872.0 lov ivllrownrd IhoIIIImi -680.0 20895.0 vimm 3952.0 hits hllHhas4560.0 20867.0 boon hnen792.0 5080.0 requested lIl1lhrHI11requestedby lIl1lhrHI11b-792.0 21079.0 b -192.0 21083.0 21104.0 2976.0 hi 2944.0 21088.0 Tampa Pampa464.0 -516.0 3804.0 736.0 Chamber thllnlrImnber21091.0 Conumrce Conumrceto 5880.0 lOIII1I locnin5712.0 21124.0 Cl ceClto ceto 21303.0 21311.0 mil cf1Icall2760.0 21339.0 nil996.0 21307.0 Immigration Innnlgration3460.0 1t1l1l1 -996.0 111101I 3988.0 convention OIlllIthmcunvvttlon5732.0 21323.0 tomeet tol111ut 21524.0 21539.0 meet l111ut21527.0 III1anliutTn -548.0 21559.0 Ill UItill4672.0 10th lOth21531.0 Febru Fihru5240.0 February FihruI 5844.0 21591.0 21771.0 21784.0 ary nrynryet 22000.0 22031.0 et Workmen orlmlllI1Vorlnnvlart nivnll22036.0 HIIWnun22003.0 busy hlsy4416.0 but 22008.0 III4784.0 532.0 projwr prpal5176.0 projwrlug -532.0 prpaltug 22216.0 lug lilttug3040.0 22224.0 fur22255.0 01 22219.0 lhlthaopening IIII1Hhlopo11ing3664.0 4452.0 thlInnpmtTampaJay -564.0 5352.0 22232.0 Innpmtlay 2688.0 22435.0 22443.0 Jay lay111 -244.0 2932.0 22439.0 lotiIMotel240.0 2832.0 3672.0 hleh whhhwldih3496.0 wIUvlllformally rllIIIII1forn -676.0 tlly 5016.0 22479.0 open 011111opendoorn 011111i 22647.0 22715.0 l2172.0 2744.0 22695.0 2936.0 22659.0 doorn dOOlHduors2820.0 22663.0 Crfar3384.0 3848.0 thll4100.0 22728.0 season 4112.0 lo1ll 4432.0 8501 -28.0 4460.0 22700.0 OIl 4740.0 4916.0 011min1aituaryJanuarysra -668.0 5252.0 1aituarypde 22855.0 sra 22876.0 nUt pde-200.0 2928.0 pdeThe sraTho 23087.0 Tho110 3120.0 23100.0 South SOllthoath23095.0 3788.0 Florida 1IorillalurldaNormal 0111111Nornntl4364.0 Institute Instituteof -696.0 IastIt 5336.0 396.0 23107.0 tltlltl -164.0 tltlltlit -396.0 23111.0 ate ates 23275.0 23335.0 23311.0 2188.0 it -108.0 2772.0 2896.0 Dado nllbade23319.0 City Cll 23352.0 111muow4300.0 1m hl23363.0 4476.0 4532.0 4676.0 23355.0 ntolal4704.0 23324.0 enroll Illrollenrollment -472.0 IllrollnWlIl enrollnieut -468.0 23391.0 23531.0 23556.0 ment nWlIlnieut3128.0 ot23535.0 HOO 1001o023539.0 Prof 4336.0 Corr CUIICOEI4196.0 4800.0 hng23543.0 had luillIulphi phe1111lphenomenal -288.0 phinominal 23612.0 3268.0 23752.0 nominal nomenal23783.0 -704.0 2828.0 Ul1I 23791.0 604.0 success BucoortsHUClIIt4148.0 with wi 4340.0 23775.0 23755.0 h 4616.0 hIt4956.0 school tlIlllllschio4844.0 23763.0 thisyear -296.0 thIsoar 2628.0 23996.0 year1v 23999.0 oar yearW oarV24183.0 1v2996.0 3144.0 24192.0 T Coin ColoCole24228.0 a3748.0 24231.0 3976.0 4080.0 24223.0 car enl740.0 24200.0 Inspector luspactorhll -740.0 4628.0 24259.0 24215.0 llIIctor 24203.0 furtill tholitthoAtlantic tillAtllltll litAtlantic 2636.0 24375.0 Atlantic Atllltll24407.0 Const CtOItCOns24411.0 1lu1J11e24435.0 ntOcnlit 01111Ocnht24447.0 wan Willwas5076.0 5620.0 24455.0 run runover 5704.0 1111 -184.0 1111our 24623.0 372.0 24651.0 our3140.0 24659.0 24663.0 -76.0 freight hhchtfre11ltmt4352.0 cnr24627.0 nail anil24667.0 nlll 24639.0 Instantly IlIsllllltlyttttitmmtly4972.0 Instantlykilled -720.0 IlIsllllltlyktl1lll ttttitmmtlyktllid 24835.0 killed ktl1lllktllid24851.0 24839.0 thl24847.0 Ocala OI 4400.0 yards rnrdyartln4188.0 24855.0 Saturday SllUlhSaturdayaltornoon SllUlh1ltrnllulI 728.0 Saturdayntternoou 5752.0 25063.0 altornoon 1ltrnllulIntternooualtornoonTw 1ltrnllulIa25272.0 Tw 1744.0 1068.0 25275.0 -220.0 3076.0 25307.0 vt 25279.0 iit utyone -144.0 -408.0 3776.0 ow 1040.0 3876.0 25287.0 refrtKortitorH 1lfIKIntlurlfrrfrtgeratorsot5264.0 25311.0 seventy sievantyseventyquart sievantyquartz 25267.0 5956.0 25419.0 4884.0 1072.0 ilntrrles 1752.0 25491.0 25575.0 25511.0 quart quartz836.0 2740.0 utlrt ouch lIHheurh25524.0 wits 3624.0 25531.0 ns -172.0 25499.0 till4440.0 25544.0 4488.0 amount nmoultunotumt5144.0 25507.0 or5044.0 5392.0 25527.0 straw Ntnn5304.0 strawIwirrle -432.0 Ntnnlrr 25707.0 Iwirrle lntrrles25735.0 lrr 608.0 3352.0 htppoU sbtpplMI2992.0 25715.0 frntntruth25723.0 Plant 1larttIlh 25731.0 4792.0 Cits5024.0 5140.0 Clt Itto1tlastFrKl lastFrld 25819.0 25923.0 FrKl Frld2768.0 rllh -224.0 25963.0 25927.0 They ThiyTh 25975.0 4064.0 ohl 0114068.0 25939.0 fur for25955.0 o 025959.0 cent eetlts25979.0 Iltrperquart 26067.0 iQURrt -24.0 IA 4384.0 26143.0 26263.0 26168.0 QURrt2232.0 3208.0 rb3680.0 26147.0 1111t1iaut26155.0 C1l C1lThort 4648.0 26163.0 lIty It Itt -92.0 2424.0 26399.0 2376.0 26579.0 26627.0 2824.0 Thort Jlwr-460.0 26583.0 htra 26616.0 HAS 3552.0 26619.0 -52.0 IvM tmd26603.0 ittoiu IUInlUttoit 4944.0 26647.0 III26631.0 tealta tealtL 5812.0 oacnpo tealt-456.0 1208.0 26871.0 26988.0 1iLQ 27083.0 27019.0 F 1968.0 27455.0 27459.0 3116.0 27483.0 2492.0 3296.0 27555.0 27527.0 5244.0 27499.0 L 5408.0 27563.0 tCU 5432.0 27471.0 j3544.0 27828.0 27775.0 101 1884.0 27632.0 27751.0 28052.0 27996.0 aI 27975.0 27991.0 2572.0 28103.0 il 28151.0 28175.0 lit litt 1112.0 28228.0 28343.0 2904.0 28295.0 CU 2752.0 rvt 3348.0 -48.0 28299.0 Iw 28263.0 tllld 28231.0 x11 28284.0 4848.0 1ir 28335.0 htb 28508.0 28463.0 1288.0 2968.0 28419.0 Ny 28435.0 ire 28499.0 5156.0 II 28547.0 28648.0 28655.0 28767.0 3900.0 28739.0 IrK 4732.0 28719.0 28704.0 oJ 5972.0 28872.0 28875.0 rK 28887.0 5320.0 iI 28891.0 2420.0 28971.0 28987.0 28991.0 -44.0 28975.0 K Ks0 3408.0 2564.0 41ft 29059.0 29096.0 1ft 2876.0 jttuful 29180.0 29199.0 ttuful 5968.0 2412.0 29359.0 s0 1tf 29363.0 t11a 1I 2076.0 3692.0 29315.0 29467.0 tr trU -136.0 29543.0 1440.0 2576.0 29608.0 29627.0 U 1J4 29615.0 29619.0 29623.0 too toolt11D -100.0 29636.0 1596.0 29707.0 29739.0 Iruu 2960.0 29771.0 lt11D 29807.0 4104.0 5536.0 29811.0 1412.0 29891.0 4252.0 29895.0 29931.0 956.0 1612.0 3516.0 29899.0 ruu 29955.0 D >29967.0 p29903.0 29959.0 Les 1056.0 30235.0 es -240.0 1304.0 30171.0 1512.0 xmlns:ns3 ID16 12776 3448 6036 2308 ns3:type 8732.0 2308.0 6164.0 780.0 6776.0 Cause 6668.0 7668.0 7556.0 Many 7916.0 ManySudden 8728.0 1976.0 7368.0 940.0 Sudden 8444.0 2843.0 Deaths 8308.0 DeathsThere DeathsI-900.0 9344.0 6316.0 There 6880.0 la7092.0 n7004.0 7272.0 disease isease7176.0 7948.0 prevailing prcmlJing7828.0 8892.0 ill8768.0 9128.0 thiscountry 9040.0 9132.0 9432.0 thiscountrv thiscountr 6156.0 3372.0 country countrvcountr6796.0 most 6760.0 U1ostdan 7180.0 828.0 7208.0 dangerous dangcrous-284.0 7492.0 7612.0 crouj 8036.0 8080.0 because hccmscso8880.0 8180.0 ecatcse 8116.0 8712.0 so 8680.0 8916.0 decep decelrdecepi decelrou9428.0 3652.0 4J 6168.0 ou -328.0 6496.0 ou4J 6500.0 6360.0 7076.0 6472.0 7628.0 if 7104.0 7956.0 tive tic7812.0 8388.0 Manyeudden lIamysudden8248.0 ManyeuddenAMd -1032.0 9420.0 lIamysuddenctaulisc 8484.0 rnnlitddCl -932.0 9416.0 6400.0 3632.0 6632.0 r6512.0 AMd 948.0 6680.0 7640.0 7884.0 7952.0 3724.0 deaths cJeuths7672.0 8556.0 3768.0 8472.0 8896.0 caused 8796.0 causedby cauS 9336.0 9248.0 6172.0 ry 6748.0 6300.0 1164.0 6792.0 -188.0 8144.0 7988.0 8040.0 8584.0 heart Icart8404.0 ctaulisc 8624.0 ctauliscb 9288.0 9144.0 dis -228.0 9372.0 9308.0 9236.0 scase -64.0 9380.0 3980.0 4083.0 ease casepneumonia pnC1mouJa8276.0 pneumoniaheart -880.0 9364.0 pnC1mouJarolli p 8688.0 tutnonia 8568.0 tutnoniaII 4248.0 412.0 4251.0 failure fuslure8360.0 9268.0 9092.0 orr orIorapoplexy rolli 6324.0 7584.0 6280.0 7764.0 7600.0 7944.0 apoplexy apop1cx7836.0 ore nreare8676.0 9012.0 often oftcnoftenthe -404.0 oftcnI oftenI2500.0 6900.0 4608.0 thc6920.0 result 8200.0 8848.0 8736.0 9108.0 kid kidney kIdlIey kidncy 9376.0 1844.0 4700.0 ney lIeyncy8432.0 4772.0 8228.0 9292.0 If 8992.0 Ifkidney IfI 1840.0 7580.0 kirlncvkidnc -552.0 8500.0 8620.0 troubl trouble8400.0 9300.0 9204.0 isJ isiisnllow 6136.0 5127.0 7448.0 5116.0 1264.0 6184.0 7736.0 7604.0 7940.0 allowedtoadvance allowe1toadv01ice7772.0 allowedtoadvancethekidneyjxMson -1480.0 nllow allowe1toadv01icettekidnev1 8372.0 952.0 8468.0 lJtoadvnnce -948.0 lJtoadvnncethe -952.0 1416.0 5295.0 thekidneyjxMson thekidneyjxMsonxv -1416.0 9356.0 ttekidnev1 8192.0 8224.0 kf -664.0 8496.0 ncpoilon 8376.0 ncpoilonto -860.0 8904.0 8944.0 nison 8936.0 nisontack 9352.0 2224.0 7200.0 5575.0 7392.0 7280.0 7516.0 7576.0 xv 7936.0 cd7704.0 8240.0 blood hloOft8800.0 8672.0 9208.0 5519.0 nt9104.0 attack 9360.0 nttack 9368.0 6132.0 5652.0 tack 6528.0 6464.0 6840.0 vital ital6780.0 7268.0 organs orgauA612.0 7924.0 qfausing 7796.0 5696.0 c -612.0 8536.0 8100.0 using usiug7960.0 8612.0 catarrh 9200.0 ofthe oftime 3292.0 6128.0 time6440.0 bladder 6372.0 bla -592.0 7032.0 6784.0 ller 5868.0 7456.0 thctime7348.0 7804.0 kidneys kidncs8532.0 themselves thcmseles8436.0 themselvesbreak -888.0 thcmseleshreak hreak6000.0 down 6564.0 clO 7048.0 6040.0 Vll 6816.0 7120.0 U1l181117480.0 6016.0 waste wnfte7412.0 7980.0 6044.0 away awnj7920.0 8460.0 6008.0 cell 8820.0 6012.0 hy9076.0 ceIJ9008.0 cellBladder ceIJnJa 6296.0 Bladder 6176.0 nJa -608.0 6904.0 6756.0 6216.0 6540.0 652.0 7012.0 troubles trouhlcs7748.0 almost nlmost7664.0 8348.0 6180.0 always nlwus8284.0 6191.0 8908.0 resultfrom resultfront 6348.0 front6560.0 6395.0 1044.0 6700.0 derangement dtran17clllcntrallheillellt6640.0 -1000.0 7744.0 1024.0 6788.0 6352.0 7972.0 992.0 thclddncjs 8292.0 kitlleys-640.0 9028.0 audamidanda audaamida6124.0 6520.0 6568.0 6264.0 6563.0 cure ctnecute6204.0 6604.0 6848.0 obtained obtumcdobtutnedquickest CJuickest7532.0 8396.0 bj8692.0 6580.0 R8588.0 6576.0 proper propcr8776.0 propertreatment -528.0 propcrtreatment 6120.0 6660.0 6716.0 treatment 6940.0 6696.0 ofthc 7100.0 7136.0 time7384.0 7432.0 lillncR6688.0 Iidnevs 8060.0 8244.0 6703.0 8056.0 8428.0 yon you6752.0 8716.0 8764.0 Lire nrcnre9068.0 6712.0 feel frel9020.0 feeling 9348.0 feelfag 6787.0 9480.0 6764.0 iIng 9484.0 6843.0 6864.0 ing fag6871.0 badly 6376.0 6936.0 6912.0 you 6876.0 7040.0 011 7284.0 can 7212.0 7648.0 Make iiakelI1ke7552.0 no 1108088.0 8488.0 mistake 9220.0 6888.0 6116.0 7039.0 taking 6692.0 pr tJr rr6892.0 688.0 7044.0 Kilmers Jillllcrsihncrs7052.0 -688.0 7732.0 7832.0 SwampRoot 7088.0 Swamp -1164.0 8996.0 8592.0 7056.0 koot 9152.0 7064.0 thegreat -260.0 9412.0 7235.0 great 6588.0 kidncy7252.0 liver 7124.0 7680.0 Ilnd7620.0 8044.0 bladdei IJlmtdebladde8708.0 remedy remelyrClllcd -604.0 9312.0 rClllcdIt -496.0 7403.0 corrects corrccts6416.0 7164.0 inability illnbilitv7096.0 7420.0 urine urinc9116.0 alldandscalding 9404.0 alldficalding 6112.0 7543.0 7564.0 scalding ficalding6836.0 7568.0 pain 111116772.0 7296.0 passing passinK8304.0 8600.0 amid8416.0 7627.0 oerovercomes oerCOIIICJ overconics 7663.0 3300.0 6104.0 7747.0 7788.0 comes COIIICJconics6656.0 7752.0 6592.0 7016.0 unpleasant uuplel1mnt7756.0 necessity cessity7900.0 -728.0 8720.0 8948.0 being 8884.0 beingcompelled hei 7808.0 ng ngcompelled 7915.0 compelled 7192.0 7964.0 7132.0 7452.0 oftellthrough 7860.0 throu -648.0 8368.0 7943.0 thc9060.0 8952.0 dayand dayancl 6100.0 8096.0 ancl6456.0 8124.0 tu6384.0 get 8132.0 up 6908.0 7356.0 many lIumr7232.0 times tin 8208.0 8152.0 8136.0 during cluringdun 9024.0 8156.0 u 8924.0 8900.0 9148.0 8120.0 thenight 8268.0 night rhemild 8279.0 thctime7840.0 1116.0 8288.0 extraordinary extraordillary8188.0 extraordinaryeffect -1116.0 6096.0 effect 8447.0 d ect 6584.0 8440.0 6824.0 SWantpUoot SWampRoot6736.0 SWamp -1036.0 7488.0 Root 7992.0 8112.0 8236.0 soon foon8028.0 8464.0 realized realizedIt 9340.0 realize realizeIt 9400.0 8628.0 stands st3l11186232.0 6872.0 8623.0 7244.0 highest highetthighel7784.0 8648.0 -56.0 8632.0 8280.0 8636.0 its itR8168.0 8572.0 nonderful lIllerfulconderfulnonderfulcures 9396.0 conderfulcures 8808.0 lIllerfulcurC 6092.0 8791.0 8836.0 cures curCth tillthe6952.0 8847.0 6984.0 8824.0 moht1II0ft6988.0 876.0 7544.0 8804.0 distressing diHtressinEdistressimlg7484.0 8856.0 8420.0 casesSwampRoot 8860.0 cnSI 8816.0 sSwampRoot 6256.0 8972.0 7344.0 8976.0 jllis7292.0 7536.0 8984.0 pleasant nlCIIStllltulettnt7472.0 9007.0 8196.0 8512.0 8987.0 take 8448.0 8912.0 RIIlI8852.0 9276.0 issold 6088.0 9124.0 9140.0 sold 6396.0 6720.0 7140.0 druggists tlruggitH7036.0 8004.0 9155.0 illhl7896.0 8264.0 9164.0 fiftycent fiflrccllt8148.0 nndandonedollar 9388.0 nndolledoJJur 6080.0 9315.0 808.0 onedollar olledoJJur9323.0 size Rizcsire7312.0 9332.0 bottler otllcrYou VonY 8384.0 9379.0 olt 8184.0 8452.0 may ilia nia8784.0 8872.0 lUll9252.0 asample 9392.0 9500.0 sample bottle bottlc9508.0 7168.0 9504.0 7816.0 9512.0 wonderful wonlterf1wotulerful9556.0 9519.0 tliadiscovery tliacovtry diseovery 9596.0 9676.0 9712.0 covery covtryeovery6676.0 nml6612.0 7024.0 9728.0 9680.0 tool booh7108.0 9684.0 001 7636.0 9687.0 tllutlint7508.0 9692.0 tells tdls8424.0 9695.0 8364.0 t11olIt9212.0 9704.0 ilitboth ilboth 6084.0 both 6484.0 9863.0 sent scutRcut6436.0 6860.0 free 7160.0 7308.0 9900.0 y 7404.0 mail lIIuiI8032.0 Address AIlc1rcfis9876.0 Dr 8660.0 9080.0 9868.0 Kil RiIKflKiltuer 9328.0 RiIUlcr Kfltiter 9324.0 10028.0 10064.0 titer tuerUlcr6448.0 6388.0 10036.0 Co 976.0 10031.0 Hinghamton HillghumtollIlingliumuto1110044.0 10048.0 Y1When 1Vllen8664.0 Whenwriting Whenwritflln 1Vllenwriting 10196.0 writing writfllnmention nlentiomm10227.0 1IICll -656.0 10247.0 olI 10212.0 reading rending10252.0 rcu 10216.0 illg 8260.0 Uli10260.0 generous generousoffer generousotTer generousoiler 6072.0 10372.0 offer otTeroiler10420.0 11110380.0 6704.0 7256.0 10428.0 paper papcr10392.0 Dont Iunt7692.0 10404.0 10412.0 olll 10395.0 make nlake10440.0 any nllYanyiiistakc nllYmistake anymistake 10544.0 iiistakc6800.0 hut6708.0 1096.0 10563.0 remember TflIIelllhcrrenmelnbertime10568.0 thc10572.0 namcSwamp lIalIICSWU1llprialneSwanip10728.0 10731.0 10736.0 6452.0 Ii1l11crsKilniersSwum SwanmKoot RWlllllpRoOl10744.0 trout 8656.0 8760.0 nllll0111theaddress 9384.0 theLltlclrcHs 10899.0 address LltlclrcHs980.0 10904.0 Uinglmmton illghallltollBillgliaimmtomt10912.0 -980.0 8012.0 10920.0 F10955.0 on10960.0 ever everottle everbottle everIottlc 11075.0 ottleIottlcIottlcmade 6076.0 bottlemnde 11120.0 ottlemade 6064.0 11532.0 mnde11536.0 6504.0 6948.0 tho6820.0 7336.0 prisoners 7204.0 8232.0 8524.0 11540.0 8380.0 11548.0 Perry Perrycounty 9036.0 11571.0 erry errycounty 6060.0 11756.0 11764.0 6828.0 Jail jull7468.0 Assistance Asslutancehowever howevcr8356.0 howeverreached -716.0 howevcrrenched 6056.0 11976.0 reached renchedtho7172.0 jail jnll11979.0 7440.0 7800.0 time thne11991.0 11984.0 assist 11988.0 9016.0 theallor thejailor 12200.0 jailor allor 12203.0 end randnd -180.0 6928.0 12236.0 one prisoner prluoner7688.0 8580.0 12208.0 escaped escapedGovernor 9228.0 6236.0 12688.0 Governor 7112.0 12692.0 Hroward Brownrdliroward7908.0 636.0 12696.0 granted WillEdwards Will WIJJWIJJEdwards 12908.0 Edwards 12944.0 uarespite reslllle7700.0 12912.0 at12916.0 30 7856.0 days 12920.0 order Olderorderhat Olderthat orderthat hathe 6380.0 might apply ullilly7248.0 13140.0 8160.0 13135.0 848.0 8520.0 pardoninghoard pardoning rdonlng-844.0 pardoningoard -848.0 13172.0 rdonlnghonrd 13351.0 hoard oardhonrd13396.0 6684.0 13356.0 tor7068.0 13392.0 7320.0 commutation corumutntlon7156.0 13364.0 13359.0 death delthlentildeathsentence -464.0 delthHItnce lentilsentence 13575.0 13588.0 sentence HItnce13592.0 13616.0 oueomic7520.0 13580.0 7776.0 life 1172.0 Imprisonment ImprisonmentWnuchuln -1172.0 9316.0 ImprisonmentWauchuln ImprisonmentWauchula 6224.0 14023.0 Wnuchuln WauchulnWauchula14028.0 ImnhaR7588.0 14059.0 7464.0 society Roclety7676.0 8508.0 14036.0 known 9184.0 14064.0 9052.0 asho astho asthe 14247.0 ho thothe14252.0 Ladles LalJloAiDallesVillage Vlllago7724.0 improvement hl1prUement7632.0 14263.0 Asso AuaoAuaoelation 14324.0 6036.0 14471.0 ciation elationwhich 7300.0 14476.0 hus1120.0 accomplished IccomllJlHhed7572.0 14479.0 much 8792.0 muchor muchror muchfor 14695.0 14700.0 ror14728.0 6272.0 thut14708.0 town h17596.0 the7476.0 14731.0 way 7844.0 8392.0 planting Illnntlng8548.0 plantingroes -692.0 IllnntlngtIClH plantingtrees 14927.0 trees tIClH6108.0 14947.0 roes 6444.0 6616.0 14919.0 alldmaking lIIakhlHntakhig7868.0 needed 7696.0 improve ImJlroveimprovo9304.0 14991.0 xmlns:ns4 ID17 15080 3392 6020 15151 ns4:type 15151.0 ments lUmltHtuentsmentsTwo 6532.0 lUmltHlwo tuents1tvo 15400.0 Two lwo1tvo6728.0 15431.0 rulnawn7720.0 wheels whCt -560.0 IH 8092.0 15403.0 ot15408.0 fortune rortunefortunevero fortunewere 9408.0 15500.0 15624.0 15652.0 veroweru6552.0 disappointed dIHaIIIIClhlldlsappoluted6424.0 15660.0 7608.0 7524.0 15627.0 hutwookhtHer 11crHeruuulo 9296.0 Hernando 11crnando 6028.0 15844.0 nando uuulo6644.0 15848.0 bcoculuwthey thoy7760.0 7876.0 could 7660.0 15859.0 15884.0 secure HceuresecureICUIIHU HceureJlculHm securelicense 6032.0 16068.0 license ICUIIHUJlculHm6724.0 16080.0 tu6600.0 16103.0 rUII7396.0 16072.0 their tliilr1I1lIr7264.0 game 16108.0 gll 8340.0 there thlroclurlug dur clurdurng 9232.0 rlug -60.0 16287.0 16292.0 16324.0 6284.0 thu timeholidays hOliIlityI46648.0 holidaysW hOliIlityI4IV-684.0 hollllu 7380.0 16327.0 H HW -68.0 6228.0 16727.0 IV16732.0 10 1I16735.0 -112.0 6664.0 Maker lakerJlaklr7304.0 hnH6852.0 7792.0 Shipped RhlllJllddhiDped7684.0 16771.0 carload cn1IOHIcarloadif cn1IOHIurcarloadof6024.0 16956.0 16959.0 ur of6336.0 16987.0 oranges OIIIIItIHoraugis7196.0 16992.0 10111 hlH7512.0 8052.0 H1IIegraveIII8516.0 Cln ClaClacounty Clay Clayounty ClnCoulltr 17175.0 17183.0 ountyCoulltrThis lhlHThin17180.0 ItIsthe8064.0 first llrstUrHt8544.0 solid liolld9084.0 17216.0 onr ralonrf raloC 9280.0 rof 17399.0 17404.0 oC of17435.0 17432.0 orange urangenlIlIglH shipped HhllllH1I7824.0 17407.0 frolllrout -308.0 8332.0 thnt8780.0 17420.0 countyinco 17440.0 cumin 8868.0 Ollllt 9160.0 OlllltHhll ty tystnctt 17620.0 17623.0 inco stncttHhll -412.0 6368.0 17664.0 thothl6412.0 17636.0 grout grllt7328.0 17628.0 freeze Crllzo8048.0 iii1895 UHHi13951895Wauelmla UHHinllhu1I 139511nuchula 6220.0 18059.0 Wauelmla nllhu1I11nuchula672.0 18067.0 recently rieently18099.0 7880.0 held 1lltl8576.0 18104.0 n8840.0 18064.0 horse hUHIhorshorseswapping hUHIHWIIJlJlIII horsHtvnpping 18288.0 swapping HWIIJlJlIIIHtvnpping18291.0 01111101100ventlun6808.0 18300.0 Itwhlrh1fif 1t51t5tlalis 1fiftrades 18295.0 9136.0 nr1ltlltH 18507.0 trades 1ltlltHtlalis18543.0 WIIIVile7128.0 18512.0 lIIalllIniUIe18515.0 8008.0 prize pllzlIlrizwits8644.0 UN OtTered OfTlIOtTeroffered OfTlIlll 18580.0 9256.0 18728.0 18731.0 lll6328.0 18736.0 rOlfar6200.0 Hit thothebout hlHthest6916.0 trader trndlrtrailer7360.0 8084.0 ht7976.0 8344.0 tilltime18764.0 conven convctt9284.0 convcttlion 18767.0 8980.0 1thm 18800.0 18952.0 18955.0 lion tionthmalll18983.0 willWII won 18988.0 8172.0 n7932.0 IMant PllllltIlutt8256.0 CltyCltyman Citymnu 19207.0 man 1111111mnumanLoRoy 1111111IlHu mnuLeRoy 19391.0 19395.0 LeRoy LoRoyIlHu -520.0 linker lIakIItaker19431.0 a19428.0 negro IWJro7500.0 8212.0 boy h08492.0 8412.0 wat9056.0 runr 6020.0 19612.0 19647.0 19652.0 6508.0 19619.0 lJ 111mitt924.0 automobile nllollolllllnutuniolllle6992.0 19632.0 1119615.0 corner UIlIllcornerof -536.0 UIlIllIIr 19831.0 19839.0 IIr19836.0 Hrldgo 11IIIIHIIt1iIgo111111nodForsylh Forsyth7768.0 19843.0 tll streets IIlllttHIIIJack JuckJa Jucksunvlllu k klulIlIIn 19904.0 20060.0 sonville lulIlIInsunvllludied tiled20095.0 a20099.0 20063.0 few fl 8204.0 8352.0 hour hllllllhours8020.0 laterfrutu later Inlllaterfrom Inllfloll 20279.0 20284.0 flollfrutu6548.0 tilt thot1106408.0 6932.0 effects lITItri7592.0 20287.0 urthotllInjuries IlIjllIIH20315.0 HUH sussustained HUHtnllitd 9096.0 stamed 20348.0 20503.0 tamed tainedtnllitdtnllitdlllIIl tamedthas 20547.0 764.0 20511.0 1692.0 VIlms 6212.0 20719.0 Ilms lllIIlthas20727.0 6608.0 Wolfe Wolfl1111167716.0 20724.0 who whllsvhuhaHhlllIlhetheSouthern lhe81111thl11 theSOUthirn Southern 81111thl11SOUthirnlOxpross Ixtress20948.0 516.0 20976.0 xplHH 6972.0 20959.0 agent agelit20979.0 ullt 8328.0 III8616.0 Jacknou Jnclwol1aclcsutrJacknouvule 1aclcsutryule 8652.0 Jnclwolull 21160.0 21163.0 yule vuleull 21172.0 COlfur6332.0 tilt21175.0 pant 11IlItpast21195.0 lal 7984.0 8140.0 haHhits8528.0 21167.0 11ll1Ipro JIIOpromoted JIIO1II0hII pronlted 21231.0 21384.0 moted 1II0hIInlted21399.0 tll21387.0 thotlw6812.0 1372.0 superlntendency HlIIIrlllhllllIICsuperintendencyottheFlorida theIlorlda 11t 11tJ1I111I11 21603.0 J1I111I11Ilorlda21608.0 division 11IIlulIltIslonii -636.0 7364.0 7528.0 aItIi1088.0 headquarters hul1clllurhI1headqunrters7872.0 9072.0 InSavannah 11nal1H1h 9272.0 InSnvnnuatt 804.0 21827.0 Savannah nal1H1hSnvnnuattSavannahAt nal1H1hAtSnvnnuattAt-804.0 22048.0 22051.0 At 22084.0 22087.0 6672.0 22064.0 recent retellmooting meeting22067.0 IIHlt -652.0 7656.0 22079.0 -156.0 till8608.0 Husliiens ItualneesHusliiensMens ItualneesMens 22263.0 22272.0 Mens 111I122267.0 League 1IaHIIlIecthuein7560.0 22275.0 HIAugustine 7712.0 August -836.0 Il1thl1 lime 8812.0 22300.0 wasdrelditi wn-312.0 wasdecided wndtIlIhll 22487.0 decided dtIlIhlldrelditi22507.0 tll6856.0 7028.0 repeat rtgleutthl22491.0 Ionee IUIlIuuc0de do8920.0 Leon 1101Lena8704.0 Lenacelebration Leoncelebration 1101llhhrntloll 22703.0 celebration llhhrntloll22708.0 again agmtht22747.0 -448.0 nll 7864.0 thlllwinter whtIrwhttir8928.0 Amotorboat AlIH1t1rhnat Anu1orboat 22924.0 832.0 22927.0 motorboat lIH1t1rhnatnu1orboat7000.0 association 14t1oclntlullassoclatiun8068.0 haN hnll8252.0 also nll1022932.0 beenurgaulzid blllbeenorganized blllol 23143.0 organized urgaulzidorganizedIt urgaulzidIt23179.0 ol 6304.0 IIII1ll IIII1llIt 23367.0 23372.0 111thought thCnghtthllu ht thnttill23403.0 23408.0 1I1 ro wholIl11l11lth1 whocotntulttetl lio liocommitted 23591.0 lIl11l11lth1cotntulttetl23623.0 23632.0 criminal lrlllllIalcriutinalassault IMwaultltsruultnear IwarnearKan nearIaii 23808.0 Kan 1111IaiiJnlllo UIIIIIlltlllixoxonil sevelat6980.0 23847.0 -580.0 IIU 7652.0 23811.0 months I1lllllthago 23856.0 O 1111hayhaybiro hastieen 1111hI1I 24024.0 biro tieenhI1I24027.0 captured 24063.0 -616.0 24047.0 7008.0 11111 24039.0 III1olumhln ulullIllOlu11Ihla8832.0 24035.0 88HhlI11T 8932.0 SShtiICT CSheriff 24243.0 Sheriff HhlI11TShtiICT24248.0 Hrown ItrownoC7220.0 24251.0 Urcvard Invnrll1irevard24263.0 Coullt wllwillgo wll1I 9260.0 24463.0 24495.0 24500.0 24467.0 fllfartlu24487.0 hI 24472.0 IU180IHIlnIsontrprisonerin IU180IHIslnIsontrtitItblili 24903.0 24911.0 titItblili 6312.0 hlIII 24939.0 24915.0 ttl24936.0 7260.0 24908.0 1111vi7504.0 hn -372.0 24956.0 24943.0 It7928.0 24947.0 IIlWmlewbaseball bnlHllllbnseball8552.0 baseballpark bnseballttitrk 9224.0 nlIu 25124.0 park ttitrk25152.0 lIu 25155.0 25127.0 wlllttr25163.0 gmuos gltntez1lIl 8000.0 TluMrouml 7888.0 TluMroumlre 25132.0 lh 8456.0 pruunds pruundsHi 8772.0 routIlll routIlllHII 25343.0 25371.0 HII Hire 25376.0 trotsbelnltll 7340.0 25351.0 lIlt 25379.0 preimre 25384.0 prii 25387.0 25348.0 nttl 25395.0 1l1l1mindstandstrecttd 8640.0 Iltatulllstandserected IltatulllIrlcht 25559.0 erected Irlchttrecttd25563.0 Whll11ht1125567.0 completed cotulIeted7324.0 25600.0 0111 Jlhhd Iw25587.0 8668.0 grounds rllnllbgroundswill -660.0 25776.0 6188.0 6340.0 6432.0 harm25804.0 CSt7316.0 25787.0 neurly HIurlueiirlySt000S 15000 OOU nml 11111nntl25779.0 wIHwitlwillIK witlla 2704.0 25995.0 IK la6320.0 26003.0 voroutl ittcoita26035.0 11ont 26019.0 tn26039.0 Imam notio1onl26007.0 In7996.0 8312.0 SlateStateTbo SlateThe 26023.0 tlh tlhTb 8700.0 26420.0 26435.0 TboTb Hwiito1fi llehneIlaisthi1et26476.0 26439.0 riHolptH teIptsM1ntnshuw Miami M1ntnMiamihtw -500.0 26652.0 htw shuwahU 6536.0 26691.0 min 26667.0 Imreim hUJthwIntmtnrt26663.0 ol7496.0 26655.0 11Ot 100 -196.0 26683.0 11118596.0 d0 oorOHr26687.0 oorhut OHrIft overit 26863.0 hut Ift it26904.0 stars 6556.0 26911.0 6516.0 26907.0 ar 26883.0 tvcolpt rceIptis26879.0 ror26876.0 tl UNIt llrtltrytthlr thlrt thlrtetra 27055.0 tetra 27107.0 6392.0 6152.0 27123.0 27119.0 27091.0 t1Hyt 27143.0 6740.0 27100.0 IIIihc1Mmouth itiouthwomilh27087.0 aminhllUMpast pastH MMMark 6052.0 27303.0 27307.0 Mark 27339.0 27343.0 6364.0 halO has6652.0 27324.0 boil 27355.0 MV 27347.0 tcb 27319.0 thith27315.0 busiest hwahtbuihwthifntktthtl -212.0 kliitU7 kliihistory bi bitory 27371.0 2400.0 27539.0 tory tU727531.0 Uu thltheMtatnlportotlet 7288.0 portotletI -744.0 7708.0 27543.0 pot Uf UftIt 3056.0 6276.0 28011.0 28007.0 tIt M27999.0 Uaulhhrs 1Multtittr28043.0 oCUf7904.0 ih thihiTtml Ccasfndenuy Ccasfndenuytik uCttd 28024.0 tM 8864.0 2972.0 6356.0 28215.0 28219.0 tik bA bets 28235.0 tttch iTtml ertleitMi8216.0 28251.0 nttaU 28247.0 28243.0 Nia 28427.0 28439.0 h28467.0 Hi HIIttnuittao 1tJItUcmary6544.0 ortU 28452.0 7968.0 rtikn Ha Haof ktroM 28643.0 urlbh MuhitMu 28663.0 ton 28683.0 oowny tUUtycuuetY7644.0 28659.0 Ut hilitmink 28679.0 28676.0 wur wxrwurth 8480.0 28651.0 bts4Hwts bts4Hwtslime -672.0 28687.0 Ith 28851.0 28895.0 Slat 6460.0 sutrH Ntatrll28867.0 Tbe1he 28883.0 monunmit nneanumetitmoIlm 8560.0 28863.0 wallbedtdk 9196.0 28907.0 ItHIStk 28911.0 3028.0 29068.0 29071.0 ck dtdk 29083.0 rd trd29115.0 tu w29087.0 tbt29079.0 IStk lsik29091.0 IS tit29127.0 8300.0 JxnturJluanJluanI JanuaryAJxnturintuit 29119.0 29431.0 29515.0 29527.0 intuit 7148.0 tltl 29531.0 Iii29519.0 lwiit IHIUC 29547.0 WIII circuliu 29539.0 itLttrt 29567.0 9176.0 tn Intoto1aUalm 9180.0 tncouitv 6068.0 29731.0 Vl4Ut1U 1aUalm29751.0 couitv Clul1tanuU29743.0 requesting 29767.0 nQUI nIuetlIN ttng29735.0 ike Uuiketo 29759.0 OUUQcountyrotcrassloue 29776.0 29947.0 cor1I rotcrassloue lou 7400.0 29963.0 7020.0 call caU29983.0 an0qtlCtlonetcctIOn9064.0 30131.0 xmlns:ns5 ID18 12792 3388 9488 2340 ns5:type 9592.0 2384.0 10220.0 10120.0 10988.0 10892.0 11156.0 11608.0 11520.0 11968.0 courthouse 11864.0 courthouseshall courthouseshaU-896.0 12864.0 shall shaU10244.0 remain 9988.0 11076.0 11476.0 DeLmd11224.0 12500.0 New 12112.0 NewSmyrna 12860.0 2796.0 Smyrna 10356.0 10236.0 10604.0 2864.0 10808.0 2815.0 candidate 10696.0 11724.0 Cor11600.0 12076.0 11952.0 12440.0 coun couu12332.0 couuty 12444.0 12832.0 9588.0 9880.0 site Bite9748.0 BiteThe 10176.0 siteThe 9764.0 10188.0 10084.0 10860.0 Board 10760.0 ot11340.0 Trade 12288.0 12188.0 12640.0 op 12544.0 opposed 12820.0 9572.0 posed 10448.0 10328.0 10864.0 law 10740.0 11268.0 11140.0 11712.0 wUl11596.0 12140.0 bring 12012.0 us 12568.0 usthe 9576.0 9920.0 parcels 9840.0 10600.0 3812.0 post 10516.0 11096.0 10936.0 11516.0 11592.0 state 11412.0 12072.0 12480.0 12404.0 theirreason 12868.0 theIrreason 4060.0 reason 10264.0 4027.0 torobjecting objectll110500.0 11524.0 11396.0 11808.0 4008.0 11676.0 12196.0 same 12064.0 12740.0 fs I512608.0 fsthat I5that 10008.0 9916.0 10128.0 10616.0 injure 10520.0 11196.0 4244.0 11104.0 small smaU11452.0 12088.0 11980.0 12572.0 andonly only 4475.0 benefit 9932.0 10720.0 10612.0 844.0 11092.0 mailorder mallordcr10976.0 12052.0 houses 11936.0 12720.0 III11112600.0 inthe IIItho 111the 4692.0 tho9948.0 larger cities cltl810452.0 citiesThe cltl8The 9752.0 788.0 10168.0 vegetable 11052.0 5208.0 express 10956.0 hns12136.0 12040.0 12612.0 put 12512.0 putinto putInto into 10012.0 9896.0 5435.0 10980.0 11416.0 11292.0 11780.0 5388.0 12508.0 East 12392.0 EastCoast 12872.0 5603.0 Coast 10200.0 5628.0 10040.0 10660.0 wllJ11128.0 5659.0 11568.0 regular 11404.0 12336.0 duringthe 9568.0 9832.0 10828.0 10732.0 11612.0 Heretofore Heretotore11372.0 12616.0 thetruck 6051.0 truck 10088.0 haG hachas10368.0 handled 11656.0 11844.0 11928.0 11744.0 12276.0 regulartrains 9564.0 trains 10052.0 10648.0 11272.0 6288.0 11132.0 11708.0 11576.0 12260.0 12660.0 6308.0 12528.0 reported 6339.0 ported extrrt extrl1extrmt10092.0 10752.0 large 10640.0 largeBurglars 11164.0 9744.0 Burglars entered 10472.0 11244.0 11800.0 bedroom 11648.0 12716.0 oC12564.0 ofCapt oCCapt 9560.0 7207.0 Capt 10056.0 10144.0 10576.0 Collier 11432.0 Kissimmee Klsslmmee11356.0 12432.0 while 12352.0 whileho 7431.0 7436.0 9864.0 10276.0 7439.0 10156.0 wife wire10984.0 11604.0 lJoth11492.0 asleep Inthe 9552.0 7655.0 9912.0 9816.0 10424.0 10324.0 10820.0 took rrom11172.0 11644.0 12096.0 Captains CaptnlnR12004.0 Captainspants -776.0 CaptnlnRpants 7887.0 pants pockets 10004.0 250 21010712.0 11116.0 11392.0 cash cnsh11328.0 11820.0 11740.0 12212.0 12116.0 12524.0 gold 12452.0 goldwatch 9548.0 watch 10292.0 8111.0 No 10632.0 clue 10524.0 11064.0 10964.0 11348.0 11240.0 11500.0 identity IdenUt11852.0 or12876.0 orthe perpetrator pOretrator9812.0 10868.0 bcpn11812.0 found round11700.0 foundThe roundThe 10780.0 Banner Danner10652.0 11496.0 sas11380.0 L12316.0 12548.0 12668.0 12476.0 anextra 12856.0 3324.0 9540.0 extra 10136.0 session 9980.0 9032.0 se8 -596.0 10492.0 lon 10384.0 11208.0 11048.0 11624.0 Legislature 11464.0 12736.0 iscalled IscaJJed 9536.0 called caJJed10148.0 Marion Marlon10856.0 ountywllJ11924.0 without withoutrepresentation withoutrepresen4Ltlon withoutrepresent4tion 9440.0 1228.0 9444.0 representation represen4Ltlonrepresent4tion10764.0 11200.0 9448.0 Mr 11580.0 Wartmann Wartraann11440.0 12588.0 hasresigned 712.0 resigned 9672.0 10248.0 accept 10536.0 11300.0 11188.0 9664.0 position JWHltion12292.0 9700.0 12168.0 theBoard 9883.0 10132.0 9888.0 or10032.0 10396.0 Control 11108.0 11012.0 11512.0 lr 11732.0 11880.0 Mathews Iathewsisnow Isnow 9532.0 10104.0 10140.0 9968.0 9872.0 10112.0 Bnrtow10108.0 editing 11484.0 10143.0 newspaper newspaperThe 12636.0 Highway Development Com 12804.0 Comparry 10619.0 9528.0 10807.0 pany parry10000.0 9928.0 10228.0 JacksonvlJle10160.0 11264.0 declared 12420.0 10815.0 12360.0 dlv divdividend 12812.0 dlvIdend dlvidend 10843.0 10996.0 idend 10364.0 11032.0 11008.0 10896.0 11460.0 11352.0 11752.0 aU12068.0 preferred preterredpreferredstock -784.0 12852.0 preterredstock 11220.0 stock 10080.0 9960.0 Fi5 11271.0 IlCr11072.0 11232.0 11528.0 11260.0 11424.0 11828.0 aU11716.0 12156.0 common 12028.0 commonstock 12844.0 9524.0 11436.0 fhls9964.0 company compnnyowns OWI1811992.0 200 12348.0 at12504.0 thechoicest 9520.0 choicest lots 10204.0 tbe10900.0 11672.0 section 11288.0 orHigh 12800.0 11736.0 9516.0 11915.0 11920.0 10376.0 10852.0 10952.0 11228.0 11652.0 railways rallwaY111504.0 12516.0 npwnewshops npwshops 12103.0 shops shopsIt 10024.0 9956.0 9828.0 10416.0 looks 10284.0 12408.0 10840.0 11252.0 though 11944.0 11816.0 wllJwillsoon 12840.0 wllJsoon 12623.0 10016.0 9884.0 10528.0 her 10400.0 10916.0 10796.0 hulldlng12484.0 Bids l3Ids12220.0 Bidswere l3Idswere 10788.0 10636.0 11080.0 Washington 10932.0 12240.0 several 12080.0 severaldays severaldas 13035.0 das9976.0 13068.0 10352.0 13040.0 10644.0 13076.0 came carne11332.0 within 11856.0 12584.0 thelimit 13256.0 limit 9996.0 13259.0 ot13272.0 caRt10684.0 fixed 10588.0 11176.0 hy13264.0 11364.0 13267.0 Con ComeContract 12784.0 Cometract 13331.0 13480.0 13488.0 tract 13483.0 ror9908.0 10360.0 erection 11776.0 12148.0 ImlJdlng12032.0 buildingwill ImlJdlngwill13700.0 944.0 9972.0 doubtlessly doubllCt819800.0 13707.0 12024.0 sometime sOll1uthue11868.0 sometimesoon sOll1uthuesoon-808.0 9496.0 13959.0 80011soonSt 80011St 14196.0 14199.0 wlJJ11276.0 14236.0 11640.0 12108.0 pleasire pleasmire12364.0 pleas 12776.0 12780.0 12560.0 14232.0 a8 a8ure 9492.0 14451.0 uremire14423.0 resort 9760.0 10540.0 14420.0 similar slmllnr14456.0 11124.0 11588.0 scale 12264.0 scaleto 14639.0 14652.0 9736.0 what 9644.0 10240.0 14644.0 Coney Island 10748.0 IB14647.0 11908.0 12372.0 York YorkThere 9488.0 14860.0 14863.0 bo be10844.0 14899.0 money monlY14871.0 spent sIlent12672.0 InuuL 15084.0 uuL 9924.0 15087.0 10288.0 12252.0 15120.0 11136.0 xmlns:ns6 ID19 15960 3476 9456 15136 ns6:type 10180.0 15136.0 uic piace lIlce10436.0 12128.0 12520.0 proose 12416.0 15308.0 15339.0 ose IOROnoso15327.0 havo10124.0 15344.0 10624.0 10948.0 firstclass firatclnss15311.0 -788.0 class dance dlnce12468.0 hall halJhallrestaurant 12768.0 halJreatnurnnt 15535.0 restaurant reatnurnnt10556.0 Bcenlc scenic11204.0 railway 11060.0 12020.0 15564.0 merrygo merrygoround 12772.0 15747.0 round 15792.0 15752.0 clubhouse 10232.0 15755.0 nnd11772.0 15783.0 ninny many11628.0 15788.0 other otheramusements otheramUHNl11nts 9476.0 15988.0 amusements amUHNl11nts10608.0 15976.0 tor16007.0 young 10836.0 16012.0 lg 11148.0 mid11860.0 old 01112340.0 12100.0 Southleach SouthIllfich SouthBeach 16195.0 16200.0 leach IllfichBeach9984.0 10480.0 bnbe10656.0 11100.0 11488.0 otthl16203.0 rlHortresortWhata -508.0 rlHortWhats resortWhats 10848.0 Whats WhataWhataWorth 11428.0 Whatsforth WhatsWorth 9656.0 16892.0 16895.0 Worth forth10280.0 doing 10192.0 10824.0 well ItIfyou Ityou 12808.0 17116.0 17152.0 wish wlsb17124.0 17119.0 cured Rheumatism RheumntlsmRheumatismisc RheumntlsmuseRheumatismuse-1056.0 17336.0 17371.0 use iscBollards Dal1nrdsBallards17340.0 Snow 10592.0 11248.0 Liniment 17368.0 youwill 17555.0 17564.0 9776.0 weU10584.0 11472.0 17560.0 11688.0 positive 17588.0 cllrecureor cllreror curefor 17779.0 ror9544.0 17812.0 9716.0 Sprains Sllralns816.0 Neuralgia 10468.0 Bruises DrulsesCotlCotllracted 12752.0 Conractcd Contracted 18003.0 ractcd tractedlracted17995.0 Muscles MUBclcsal111720.0 Ills I1Jsthatnosh thatflesh flesh nosh9856.0 18252.0 10116.0 heir belr10688.0 11388.0 G Q11508.0 12000.0 Williams WilliamsNavasota -756.0 12756.0 WilliamsNI 18428.0 18440.0 Navasota NI -760.0 18443.0 nBotn 9640.0 Texas fexns18431.0 writes ha 18471.0 12428.0 used usedSnow 12792.0 18647.0 18660.0 Llnimeut11040.0 sprained ankle ankh12180.0 anklemd 12796.0 ankhnnd ankleand 12760.0 9472.0 18868.0 18876.0 md nndand18907.0 gavo18871.0 tho11028.0 best satisfaction sntlstactlonsatisfactionalways 12748.0 sntlstactlonalwn8 19083.0 19092.0 alwn8keep 10704.0 11044.0 h119087.0 thohouse bouse11560.0 12448.0 Sold 12144.0 Soldby Soldy 19268.0 19276.0 19304.0 9660.0 9768.0 19271.0 NJohnson JohnsonBitten JohnsonBIt 1920.0 10172.0 19683.0 19703.0 Bitten BIt 10664.0 10596.0 19736.0 19696.0 11084.0 19724.0 11280.0 Tarantula 11160.0 TarantulaRome -812.0 12092.0 TarantulaRcnme 19892.0 19915.0 Rome Rcnme19912.0 Ca GIGct10768.0 19899.0 Doc DccDec278 11056.0 27 -556.0 19895.0 2 11308.0 11912.0 ncjcroIgro12472.0 moanmannatrcd man11II moannanecl 20088.0 20123.0 natrcd nanecl20155.0 11II 20127.0 cd 9796.0 10184.0 20119.0 1t Joti ht10484.0 20144.0 10708.0 20108.0 Jones loutsJoUl 11324.0 20131.0 wns20091.0 bitten 12400.0 12580.0 12724.0 20111.0 0natarnntula 0tnrnntlln ntarnntnln 20295.0 20327.0 tarnntula tnrnntllntarnntnln10968.0 20307.0 rnnHInc 20343.0 11692.0 u1 ln n20299.0 bich bt1rlbt 20332.0 12656.0 ciofbannuna cibaaamns IhmIOn3 bannuna hmIOn3baaamns20531.0 Tie TJieThl20551.0 11020.0 20556.0 vri 20559.0 works otklcvorke12248.0 20508.0 12104.0 1C E1CFlorence EFlorence 12648.0 20755.0 Florence 1lorpnee10432.0 20740.0 20763.0 11304.0 11112.0 Unian ItNIanltaIan20732.0 testarant icstai IOottTtestaicstairant 20936.0 20987.0 rant mnt9936.0 hce 20995.0 10456.0 ntd 811 20971.0 uaj WtUwa320939.0 Cnga4I 11212.0 20967.0 enlist 11876.0 f1 nI1 tilputttiR lIUUIputiasputttiRa lIUUIaputiasa21135.0 21211.0 string tltrln -488.0 aronad MOIlldaraua121188.0 21144.0 bunch 11316.0 mh 21139.0 12036.0 bannnn blulnlUubananasbannnnHe 12712.0 bananas1Ic 12624.0 21343.0 He 1111Ic21395.0 Pllt21371.0 hit iii10100.0 10716.0 21363.0 j1 10928.0 21348.0 irettgwl121359.0 1trt 11728.0 uI11 tllOmho12216.0 butc1VI111 buacla butc1buaclawhen 12328.0 U1C1 U1C1whln 21567.0 when whlnVI11121623.0 21595.0 tttanaa tairt 10924.0 bit 21575.0 te tl11320.0 11804.0 21587.0 rnu rlHm11704.0 11956.0 au 21572.0 Ofto0tftfhnnl trhan tr1mnnl 21763.0 21804.0 han hnnl1mnnl21791.0 10268.0 21824.0 21787.0 21812.0 Horv 10668.0 11832.0 MrMv 12344.0 v 12464.0 21768.0 to1 to1tho 12744.0 rr irrrt irthe 21980.0 22015.0 thoho22039.0 10336.0 10460.0 21995.0 dwn l10884.0 22023.0 nvn vndrug dnigdItS11296.0 21987.0 store slortlantho am unan12704.0 amtho untho 2248.0 22188.0 22204.0 wound 9772.0 22244.0 wount 10512.0 22235.0 wns WIIwmn10344.0 cauterized Ctutt1ze11cauterizedEarly 22207.0 rlt Ctutt1ze11I 22571.0 22639.0 22644.0 Early 22652.0 Bed BedAnd BedAntI 22899.0 22907.0 And AntInrh22915.0 rise makes 12496.0 onehealthy onbonlthr 12680.0 23115.0 23123.0 healthy bonlthrhappy hap 23120.0 nndwise 1380.0 wiseespecially -368.0 11564.0 ls -1236.0 12576.0 especially SllclllhifOU 23247.0 IOU -16.0 9468.0 23380.0 OU 23344.0 Lithe atkonto23339.0 llerblne lIlIblnelIerbinebefore beforo11768.0 retiring rotlrlnJrotlrlnJIlusltho 23347.0 Apositive APositive 23563.0 Ilusltho23595.0 10672.0 23559.0 tor10564.0 1004.0 constipation tonstlJlltlon12152.0 llrJwl dyspepdyspepsta 12728.0 llrJwltn 23587.0 12460.0 pej 12436.0 pejsa 12684.0 9464.0 23767.0 23787.0 sa tnsta23780.0 9696.0 10312.0 10676.0 Ucrcomplaints c0111111alntM12424.0 Mrs MrsS Ir 23836.0 12652.0 12700.0 23923.0 23987.0 24004.0 23991.0 Columbia Tenn Tonnwrlh912320.0 Ialways 12764.0 Ial118 ialways 24116.0 24211.0 al118kecp10504.0 10772.0 supply 8ulPI24207.0 or24235.0 your 11552.0 our 12008.0 Herblue IlerbiucHerblueon Ihrbl Ilerbiucone 24424.0 9648.0 9808.0 hand 24439.0 Am BO 80so11236.0 pleased 11088.0 Jllca 24427.0 11572.0 thl12356.0 therelief thlrt1cf 24643.0 relief rt1cfshos24648.0 luiu1012.0 consUpntlouanti111allnilliver 111Ihlr allliver 24859.0 24872.0 Ihlr24867.0 C1D1llalntswords worll24883.0 cant cautCRUtex lXerlXpress erpress 25031.0 25083.0 press 10020.0 25076.0 tuy wymy25040.0 anprvclatlon plllclnUon25079.0 aopr 11408.0 cfatiOU 10792.0 25035.0 br1VWM WI 1VI25223.0 25231.0 9604.0 JotuusonJohnsonAti 2380.0 2580.0 25496.0 Ati 11111AtiY 10476.0 AtiOf 25552.0 R RC 25583.0 25572.0 25555.0 rC 11376.0 25539.0 11168.0 rCk1 1108.0 pN 25720.0 25763.0 25799.0 1r 25768.0 25751.0 tv4 25755.0 25743.0 12536.0 G1v 25967.0 1v 26031.0 9784.0 26011.0 e126000.0 10308.0 26028.0 wr 25987.0 rP1 r11 12488.0 26063.0 f26183.0 26215.0 P1 9892.0 rt 26196.0 itii 10320.0 mot 26207.0 1548.0 11068.0 tbuluf 26203.0 Cbuetne 12676.0 26379.0 26383.0 buluf buetne26423.0 Of et26392.0 tfI tetfII 26411.0 11872.0 e11932.0 26456.0 aj 12708.0 26415.0 26588.0 26591.0 9780.0 10872.0 26611.0 i26624.0 Tr 12596.0 Tat 26599.0 12552.0 ran 9708.0 26792.0 26807.0 filrt 9940.0 10880.0 26827.0 26823.0 26840.0 10992.0 t26803.0 tj 26835.0 12228.0 ain 26843.0 lAn 27031.0 An in27039.0 vir 27023.0 Crtltamr 27044.0 ui 27047.0 26999.0 Iru 27007.0 27059.0 e1180.0 etie 27191.0 27231.0 27212.0 tie eUtl 27240.0 ru 10152.0 Ukn tunaut 27207.0 un 10800.0 27263.0 1t12280.0 27243.0 a27235.0 titlI tltiti4s io 9688.0 27447.0 4s a27439.0 test 10272.0 27411.0 Wtli10756.0 11284.0 27419.0 rears rU 12396.0 27487.0 12836.0 12932.0 12904.0 27619.0 27635.0 27655.0 27647.0 27643.0 rexey 11360.0 11456.0 lait 27683.0 Wt -8.0 12224.0 27663.0 o0 27675.0 iPubl1c I3ttlis 27819.0 3ttlis 27823.0 ss IPublic 2320.0 -12.0 28019.0 I1Public 28159.0 Public Publ1c28239.0 Speaker SpuktrInterrupted InttrrvpttdI1PubUl 28287.0 ltcrmj 28363.0 28487.0 PubUl28495.0 51ftk 28527.0 sl 28531.0 aeiker 28536.0 Art nra28511.0 frt rrqu 11796.0 28519.0 garutly 28555.0 toU 12044.0 Ia In12304.0 Iat Intcrraptl4 28707.0 28723.0 tcrmj rnItd tcrraptl4tml 28715.0 28743.0 1jt 10888.0 ogle 10944.0 28755.0 pl 28732.0 roughing mugt 28760.0 Q htC1 28751.0 ts ThiwowM 28747.0 ThirblrblIM Thiswld 28919.0 wowM 28959.0 wld 9652.0 IM 9944.0 28963.0 iH 28939.0 iwt 10508.0 28928.0 baptHMi baNlUtiappeutt28943.0 Fokys Fokya11344.0 Fokysnail Fow 11996.0 11836.0 HoofJ liotverHoofJIsHI liotvermatt 29099.0 29139.0 IsHImatt29143.0 9756.0 TAr wdre rv N29152.0 taken takrtsk29191.0 a329155.0 11664.0 29195.0 eureat Mar cnr29211.0 tOU tOUand 12456.0 raigh3 raigh3and cold Oldeoldii29395.0 29367.0 ajjJaftt29399.0 pjvventn prwventispjvventnand -712.0 29403.0 vtnlft 29415.0 SnU 29411.0 Meutaraia 12900.0 29503.0 29575.0 Ind29583.0 coatumpttaa coJlumpUoLcoasumptlon29591.0 Tbct 11632.0 geaulno 29631.0 11784.0 nulno BUInOnulnotajni 29655.0 coo coacoons coatatas 29791.0 tajni tatas29827.0 10304.0 29795.0 opiate oplGttIopZotieaSind29832.0 OJu 29815.0 ia trafa11584.0 11972.0 29851.0 nUopa 12192.0 nUo yeilotryeilotri 9456.0 30003.0 30035.0 pa 30043.0 10332.0 9720.0 10444.0 30011.0 10496.0 Wt3f 30091.0 30243.0 9j 11900.0 9X 30339.0 30807.0 X 30567.0 1908.0 iiiiia xmlns:ns7 ID22 28779 6388 13012 2252 ns7:type 5776.0 13280.0 2252.0 2352.0 tf d15808.0 2272.0 do 13472.0 16208.0 2264.0 I16063.0 16391.0 16256.0 16972.0 Cardui CarduP16864.0 CarduiJelemma 17784.0 18160.0 2332.0 17707.0 18456.0 2292.0 Hes ites18395.0 itesJelemma 18799.0 18967.0 lrm1 19056.0 13020.0 2592.0 m1 15800.0 Jelemma 13212.0 16868.0 Mullins 16772.0 17675.0 18087.0 Odessa OdessaVa Odes OcleS18752.0 418632.0 4Va IVa 18892.0 Va 16487.0 Because IBecause16076.0 17732.0 after 17456.0 18439.0 cy 18240.0 18744.0 18555.0 18920.0 18651.0 18976.0 infor 19088.0 19020.0 nfor 0for 19152.0 15804.0 16268.0 16095.0 17192.0 17027.0 17988.0 17796.0 wit 18472.0 withtrouble 18320.0 18360.0 2t 2ttrouble ae aetrouble 19159.0 15824.0 trouble 16720.0 16576.0 17184.0 try 17108.0 trying 17488.0 17515.0 17855.0 17907.0 diff 18024.0 diffflrent 18272.0 diffflrenttors -876.0 18784.0 18055.0 iff 18279.0 18404.0 rent r1nt18311.0 18836.0 doc doctors 19024.0 Ctors 13248.0 tors 13764.0 13632.0 14284.0 medicines 14132.0 15468.0 15332.0 16460.0 obtaining 16307.0 17652.0 17483.0 18432.0 J18212.0 3 a18476.0 18636.0 18723.0 astaqatfound 19156.0 astfound aqfound 13252.0 4744.0 14032.0 13840.0 14312.0 Wine 14212.0 14964.0 14876.0 15260.0 4684.0 15164.0 16144.0 15960.0 16352.0 golden 1008.0 17187.0 medicine 17064.0 18195.0 18659.0 18572.0 18947.0 4776.0 myj myjills my myills 19164.0 Yr Yrills 19208.0 ills 13704.0 13536.0 14216.0 5180.0 14076.0 5183.0 14556.0 14444.0 5084.0 recommend 15928.0 16360.0 5071.0 above 16211.0 17128.0 17007.0 al 17364.0 17476.0 others 17288.0 18267.0 18163.0 18644.0 5104.0 female fealeIe2le18540.0 femalecomplaints fealecomplaints Ie2lecomplaints 1132.0 13240.0 complaintsCardui 1128.0 13244.0 -1128.0 14372.0 13736.0 5920.0 furnishes 14424.0 15592.0 safe 16008.0 16712.0 16640.0 17084.0 backache 18264.0 headache tleadahellcadachheadacheperiodical 19107.0 Iperiodical 19144.0 iperiodical 6268.0 periodical pains 14248.0 15192.0 irregular 14948.0 painful 17200.0 17056.0 1100.0 unhealthy unheahhy17419.0 18772.0 cata catarcatamenial 19168.0 catarmenial menial 14084.0 flow pow13932.0 14752.0 14536.0 15212.0 15116.0 15588.0 ailments 15436.0 1544.0 ailrnentsfrom -904.0 16492.0 17132.0 17232.0 18032.0 sick sicJ17928.0 18380.0 18452.0 18560.0 women vcmenwomensuffer 19179.0 vcmensuffer 19176.0 mensuffer 7123.0 suffer 14168.0 14472.0 perfect 14316.0 15324.0 tonic 15183.0 15992.0 7080.0 15828.0 16423.0 delicate deJicate16284.0 17260.0 18224.0 18819.0 purl 18712.0 purlvegetable pur purvegetable 19080.0 Purvegetable 14348.0 15356.0 15284.0 15700.0 7487.0 girls 15639.0 16236.0 16699.0 wome16620.0 17576.0 17512.0 7540.0 18564.0 7515.0 subjec suhe18468.0 subjecto SU suheto 18796.0 18912.0 Je Jeto 13544.0 13448.0 13976.0 13876.0 15252.0 peculiar 16508.0 sex 17020.0 17860.0 Has 18352.0 benefne18256.0 benefneover 19063.0 benefitover 18999.0 13804.0 13708.0 14008.0 million 13908.0 14808.0 14720.0 15340.0 15912.0 16112.0 16911.0 16820.0 17224.0 17744.0 doAt 18012.0 13744.0 14068.0 13972.0 14756.0 14660.0 15224.0 15996.0 15819.0 16428.0 16191.0 16968.0 bottles bottlesWINE 17712.0 bottlesU bottlesWRITE 13296.0 13332.0 WHITE WRITE13911.0 14000.0 US U314296.0 14520.0 LETTER 14432.0 LETTERdwcrtblnr 15144.0 15703.0 WINE VtHE15708.0 9071.0 VI -772.0 16480.0 15956.0 16332.0 E 16280.0 En 16476.0 2088.0 13216.0 4lescrlbinrfully 13220.0 dwcrtblnr -920.0 14140.0 13868.0 fully 13828.0 13928.0 9460.0 ill iii13984.0 14384.0 14280.0 14460.0 9452.0 14727.0 9435.0 symptoms jymptomijymptomind symptomssad15160.0 ml 9547.0 sad 13432.0 13484.0 wt we9600.0 13680.0 x11113564.0 lend WIdsend13880.0 14396.0 Fret FruFree14928.0 Advice Mvce14864.0 AdviceIn MvceIn13428.0 plain pUIn13324.0 13496.0 lain 13792.0 MJtlfd Ualtdsestedenvelope eneIClptenvelnQe14144.0 14904.0 tidies LaJlt5LlJlestidiesAdvisory 15268.0 Advisory AJvlsory9824.0 Dept UeptUtpl13756.0 14272.0 9820.0 14120.0 14560.0 Ch 14500.0 ChllanOCta ChsttanoctaChllanOCtaMedlcln ChsttanoctaMedicine 9835.0 ttanoCE ttanoCEMedicine 15244.0 15920.0 9740.0 OF OFRye 16264.0 o16127.0 13224.0 Medicine Medlcln13760.0 14116.0 9947.0 Chtttinoog Chstunooas13968.0 Challanooaa 14788.0 14852.0 Tnn Tenn15052.0 TnnJO 15124.0 nn nnJ 13344.0 JO 1013408.0 2556.0 13752.0 14872.0 11543.0 kIEJ 14488.0 kIEJIt -1436.0 5604.0 13572.0 15488.0 12315.0 14704.0 18552.0 rlI rlrrlE15348.0 13175.0 18548.0 16052.0 1580.0 17172.0 13771.0 18664.0 14107.0 15924.0 EK 18532.0 14163.0 18520.0 14604.0 19132.0 IE 14955.0 15664.0 1332.0 14332.0 17176.0 15196.0 1472.0 15075.0 Ri RiI17568.0 RiRye -632.0 19115.0 Rye 14823.0 16019.0 14680.0 15544.0 15900.0 Corn Gore15392.0 CornExpress -1256.0 16800.0 15923.0 Wl 1592.0 16916.0 Whe 17648.0 WheExpress -1592.0 18508.0 19112.0 1E 15416.0 16432.0 16544.0 Express 15632.0 16600.0 15584.0 15712.0 16592.0 15688.0 16440.0 16559.0 Prepaid 16328.0 PrepaidHoses 19136.0 1796.0 IHosls 4576.0 14088.0 17079.0 Hoses Hosls17099.0 14552.0 14732.0 Ask 15112.0 15012.0 15432.0 17112.0 Itcvenno 15328.0 16060.0 Itcrct 15796.0 17155.0 15832.0 15944.0 17160.0 rc 15972.0 16152.0 17127.0 Officer Officcr16056.0 16808.0 17135.0 whiskey whiskcy16632.0 17480.0 17144.0 17384.0 17672.0 tnnclnnd17704.0 18168.0 tnrllou mrl1mmcliou18076.0 mcliouperfect 18172.0 tnrllouperfectly mrl1mprfct1 17308.0 perfectly prfct117356.0 pure JIrport14952.0 17323.0 mid011115316.0 17328.0 full 15215.0 tlf15908.0 17343.0 nourishment 1376.0 ulIurisluJcntwl11 tmurislanentwill-924.0 16832.0 17024.0 17283.0 17376.0 rest rcsfres 17640.0 17608.0 17592.0 17720.0 strength nnlnlld18368.0 andrebuid 18459.0 nnlrebuild nlldflbllid 13748.0 17524.0 rebuild flbllidrebuid14360.0 17536.0 tissues tissncstissuesFour 14848.0 tls tissncsFour 14620.0 17580.0 IJs IJsFour 17611.0 17679.0 4976.0 18023.0 Four 15000.0 18043.0 Full 14768.0 Quarts340 QuartS34OQuarts340Express Quarts340EQuartS34OExpress-2648.0 -976.0 15464.0 14984.0 18812.0 ress 15575.0 16656.0 18851.0 Oil16536.0 Sotern SoIJernSohern16940.0 18804.0 SoternExpress 17936.0 SoIJernI SohernExpress 13164.0 19148.0 964.0 15480.0 2288.0 13192.0 Lines LiTJes16444.0 LinesIn LiTJesIn17251.0 13720.0 19475.0 19492.0 ordering ordeting15368.0 19528.0 specify pecify15204.0 19535.0 RJe16859.0 16760.0 19587.0 rrn rn17140.0 19599.0 17544.0 19596.0 18136.0 19548.0 botl118048.0 bothWe botl1tboth11c18676.0 14056.0 We 11c14224.0 20175.0 lmuhnn20179.0 14712.0 14804.0 20187.0 pun givt 15188.0 15032.0 15064.0 20164.0 liltthennmr IItlllllnnnie15491.0 20195.0 Aim llrri16664.0 16884.0 20256.0 ourt 17300.0 grade gJndc17212.0 17832.0 20200.0 17748.0 corn orn17996.0 18500.0 orrn orrye 18592.0 20251.0 18648.0 tIll 18628.0 2196.0 13716.0 20383.0 rn ryetthlskey13943.0 hLfk 20371.0 14468.0 15044.0 20379.0 k14924.0 liltthe20391.0 kind lilltl15472.0 16024.0 20399.0 20411.0 plnsieirtn 16028.0 16724.0 ph 16316.0 20480.0 16204.0 16384.0 20424.0 iljms sldllnuniccialists ccrlnIilltsimieCialists17764.0 17884.0 20419.0 16984.0 tlll 18232.0 18336.0 20467.0 pn prcpnscribed prcRcritcI 20472.0 flo 13712.0 20495.0 scribed RcritcI20612.0 13864.0 20564.0 rlbccllllld 14579.0 20575.0 14600.0 14676.0 20607.0 rmmiiiendrd rCtIIl11l11lIlClrti20628.0 rccIImnu 15676.0 ndctl 15772.0 20623.0 15671.0 20640.0 lIudil aid nid17303.0 aidto iiuclkiiml lntdirinl16551.0 20651.0 nal 20699.0 17164.0 js 1s17096.0 17388.0 20671.0 an17919.0 20780.0 17559.0 17976.0 17951.0 18200.0 20648.0 discs digesdigcs18119.0 digestion 18575.0 digcstlllll discstlon 18587.0 13696.0 20791.0 tion tllllltlon14108.0 20839.0 a14264.0 20808.0 Minudaiit stlllllllHIIlstinnil -700.0 14736.0 20836.0 urt 14759.0 15048.0 20827.0 1111115384.0 20883.0 a20859.0 inipnifirviit rrigniticcut15448.0 tOllktunic16388.0 20880.0 uarantee unrnlltlluarantcc16827.0 17896.0 Atro 18260.0 20892.0 tro tm 18348.0 Hyp ltY18180.0 Hypor Ih Ihor 21015.0 21051.0 13940.0 Corll13852.0 14399.0 21040.0 In14300.0 21032.0 1Ifhe14780.0 15180.0 21060.0 equal 1111111115092.0 nial 21076.0 IIr17076.0 hnc11272.0 21020.0 nionA 17348.0 nionAand 2660.0 15892.0 21119.0 IIlIr 0n 16148.0 15979.0 tly 16248.0 vhisker hiskrtchiskcy16920.0 16824.0 tJ to16975.0 17016.0 21147.0 tilcnlcy 17924.0 18151.0 lionI 18407.0 13688.0 111111amid14072.0 21239.0 13960.0 14276.0 21283.0 a21287.0 21255.0 trialorder lrialllnllrtrial 14855.0 21264.0 ortlcr 15352.0 ib21247.0 oiir 15459.0 oiirmoney 18619.0 13148.0 21259.0 15548.0 nut tiulriot13168.0 15880.0 pirftrtlv pcrfcctls15780.0 16644.0 16540.0 16647.0 21335.0 satifry itielry16708.0 17219.0 16815.0 titr 16748.0 21351.0 we 17663.0 21328.0 refund 17556.0 Jo 18444.0 yourtiiOiiCV rUlont 21488.0 Ulont tiiOiiCV14172.0 UlontI 21615.0 21888.0 15168.0 21924.0 14992.0 2204.0 15787.0 21931.0 RevemOfficer 15607.0 RevemOfficerWe -2204.0 1060.0 21936.0 Revent 16928.0 Officert OfficerWe-1064.0 1388.0 22428.0 14204.0 22476.0 14268.0 14340.0 22448.0 IIlIh tilke14568.0 kv 14724.0 22463.0 ilIi a22471.0 rule fllir15056.0 1740.0 15504.0 22495.0 22547.0 15536.0 16936.0 irstArst1168.0 15768.0 15784.0 22499.0 hip 22527.0 orcY orfy16084.0 22551.0 22555.0 Irrr 16168.0 very 16252.0 22560.0 rrv 16472.0 17320.0 cxJlrcssczpressexpressR 17900.0 cxJlrcssa cxJlrcssIczpressm13128.0 23528.0 13664.0 13144.0 14256.0 23548.0 14440.0 15456.0 1504.0 15648.0 Re 16763.0 eJA 17296.0 23627.0 CoJACKSONVI -1024.0 COJACKS01VVIE -1016.0 JACKSONVI JACKS01VVIECKSONVIEJA -2480.0 16728.0 24635.0 24480.0 16468.0 FLA FLAit 24880.0 24887.0 15427.0 24891.0 15412.0 15444.0 15572.0 irCUAnQoCA 15748.0 15612.0 15904.0 Fortitrect 15680.0 For 16224.0 ptrect 16216.0 ptrectCIltf7t1JJC 13996.0 25264.0 CUAnQoCA CIltf7t1JJCClI -1680.0 1200.0 25283.0 1iOOGA 15620.0 15864.0 TEN TPN15868.0 Tf -428.0 16296.0 16496.0 25328.0 ATLANTA TLANTA41 -1100.0 17596.0 GA 1124.0 16652.0 GAOrder 25807.0 Order 15696.0 25843.0 15604.0 25832.0 st 8tpoint 16380.0 pointv pointo19043.0 25851.0 2124.0 26059.0 26075.0 19040.0 26179.0 eateatt 16891.0 26971.0 27111.0 13924.0 15816.0 27079.0 16400.0 fc 17444.0 27095.0 17600.0 27075.0 14176.0 16740.0 27311.0 1240.0 ifltIJ ifltIJI -1240.0 17547.0 27335.0 17688.0 27259.0 17808.0 18140.0 1J 17960.0 18691.0 18996.0 13444.0 27296.0 27492.0 13584.0 13596.0 27451.0 14364.0 13644.0 27436.0 14428.0 15236.0 27567.0 14900.0 27595.0 27431.0 868.0 16519.0 17788.0 27443.0 14512.0 27587.0 I27639.0 14696.0 17804.0 17983.0 27651.0 17887.0 27667.0 tbmdl 18028.0 Jt 18688.0 27744.0 27747.0 fatll 27931.0 atll bmdl 16684.0 27935.0 lE 1396.0 28127.0 JJ 16448.0 MG 16196.0 17052.0 28187.0 16996.0 13016.0 28379.0 bnlMtt 13200.0 28383.0 28399.0 13348.0 cf cl28396.0 xl1e 14012.0 Ti 14404.0 r28455.0 14576.0 Dlt1hld rn13htt115568.0 nei 4284.0 13468.0 28592.0 Ifttt 28595.0 ttT 28583.0 0A14020.0 rJIadtnlt rrgardtng2552.0 1780.0 14516.0 28623.0 thin thi1424.0 17100.0 28671.0 2032.0 count eoant15372.0 thir thirs0 1192.0 16888.0 28763.0 17032.0 Hlrty yeah 161128811.0 28831.0 15851.0 15940.0 16132.0 truth 16336.0 28816.0 16596.0 lac 16756.0 28835.0 16840.0 16943.0 17059.0 28855.0 titles UtleUtle8J 17492.0 titlesl1 17416.0 17424.0 4076.0 29055.0 29063.0 8J 29259.0 l1 14292.0 15560.0 OYLE 15684.0 JL 18000.0 4988.0 13012.0 29435.0 29479.0 iKY 13052.0 13232.0 29491.0 13320.0 13316.0 13692.0 IlH 14040.0 17904.0 14200.0 14796.0 29587.0 29611.0 14828.0 15516.0 ICUt 15896.0 29599.0 16752.0 29647.0 16964.0 13424.0 29675.0 29715.0 tfnI 29711.0 ntr 13812.0 14096.0 29787.0 to14884.0 15279.0 29819.0 15108.0 29823.0 15628.0 Mt 29951.0 16020.0 nca 16243.0 29835.0 2I 16312.0 std 29855.0 16804.0 16696.0 16856.0 Ea 17091.0 1140.0 29687.0 EtjhCRAN LiliCRAN 17332.0 tjhCRAN tjhCRANr 29916.0 29919.0 oom 14791.0 oomai 1992.0 15220.0 16260.0 29975.0 15264.0 T1 30047.0 16624.0 29991.0 16692.0 16736.0 30000.0 30023.0 30051.0 13652.0 30095.0 ai 30155.0 SV 13956.0 17136.0 30247.0 Jj 30287.0 17324.0 18084.0 13520.0 30315.0 30383.0 13540.0 14944.0 30479.0 15668.0 30499.0 mix 19172.0 30955.0 19332.0 19280.0


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN00034\ocr\0484b.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:16188
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1532
splitwords:0
ScansoftOCREngine Character Count:14484
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:16346
Abbyy6OCREngine Character Count:17039
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;17039;2611;43.4855;91.6116
language:en
ScansoftOCREngine Predicted Accuracy:73.64%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:5447
ScansoftOCREngine Character Error Ratio:0.3161
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;16346;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:91.61%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:91.61%
ImgPrep Component Range:14064,16188
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;14484;4578;0.824634;73.636
noPunctuation:1
ImgPrep Component Count Low Estimate:14064
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 23.0 ID4 10.0 ID5 14.0 ID7 13.0 ID8 11.0 ID12 12.0 ID22 21.0 ID23 30.0 ID24 22.0 ID26 16.0 ID27 4.0 ID28 28.0 ID29 17.0 ID30 20.0 ID31 3.0 ID32 33.0 ID33 26.0 ID35 15.0 Layout Page ID1 HEIGHT 31016 WIDTH 18580 PHYSICAL_IMG_NR 5 PRINTED_IMG_NR 4 PROCESSING PrintSpace 30663.0 18544.0 HPOS VPOS 244.0 PC 0.9161 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 968 12616 5948 244 ns1:type simple language en TextLine 136.0 8168.0 7832.0 String 72.0 80.0 308.0 CONTENT x WC 0.8095238 76.0 52.0 14852.0 a SP 6940.0 7912.0 116.0 56.0 15944.0 252.0 r 1040.0 14904.0 68.0 17444.0 484.0 4THE -68.0 17511.0 356.0 11788.0 5948.0 748.0 STYLEREFS 264.0 640.0 788.0 THE 284.0 2088.0 6740.0 780.0 GAINESVILLE 152.0 6588.0 268.0 588.0 8972.0 804.0 SUN 144.0 8828.0 272.0 1700.0 9776.0 816.0 DECEMBER 216.0 9560.0 796.0 DECE -1700.0 11476.0 260.0 756.0 10720.0 828.0 IBER 148.0 10572.0 248.0 11612.0 844.0 HO 0.82539684 ALTERNATIVE t0140.0 11780.0 o -140.0 11920.0 600.0 12144.0 852.0 1907 0.96825397 224.0 112.0 1 -600.0 12744.0 296.0 12448.0 07 192.0 12256.0 92.0 17668.0 776.0 4924.0 180.0 168.0 18395.0 1032.0 N xmlns:ns2 ID6 10212 2896 536 1504 ns2:type 188.0 1132.0 1236.0 1504.0 0.95238096 GAINeSVHLEGAINFzSVILLEGAINESVILLEdec GAINeSVHLEed-1132.0 2368.0 GAINFzSVILLEcP 616.0 2560.0 872.0 1716.0 1168.0 cP 464.0 620.0 2812.0 1764.0 rnit 772.0 2040.0 rnitred -620.0 3432.0 288.0 3124.0 n -308.0 236.0 2464.0 928.0 2344.0 800.0 2400.0 December 160.0 1804.0 2384.0 31 1728.0 352.0 2104.0 2363.0 1902 1964.0 172.0 2588.0 2356.0 at 132.0 2456.0 556.0 2836.0 Gaines Gainess2760.0 GainesIe Gainessle-556.0 3392.0 280.0 2848.0 548.0 2476.0 t 212.0 636.0 red -104.0 740.0 700.0 ed -148.0 848.0 124.0 432.0 768.0 dec -80.0 564.0 2832.0 2532.0 matter 1632.0 1200.0 mattereeV -564.0 3396.0 matterd matterder416.0 2280.0 2544.0 class 220.0 1796.0 900.0 2616.0 Fla Pla108.0 1364.0 as 228.0 1136.0 1028.0 1668.0 secondclass 1532.0 2596.0 sec -1028.0 2696.0 156.0 2548.0 second -260.0 1928.0 672.0 2024.0 ndclass -200.0 2224.0 304.0 628.0 2660.0 Ie le676.0 2684.0 eeV -64.0 1288.0 2768.0 of oC440.0 760.0 1548.0 2752.0 Congress 100.0 1448.0 2408.0 2720.0 2308.0 528.0 2676.0 2708.0 March 2576.0 3316.0 2704.0 3 3204.0 3Every -72.0 3388.0 3g 3Ished 3384.0 568.0 624.0 2792.0 d der 692.0 64.0 784.0 256.0 936.0 Act 88.0 1056.0 ct -136.0 1192.0 60.0 3008.0 9 g9Ished -60.0 732.0 2800.0 3404.0 Ished 448.0 Every 984.0 1580.0 3340.0 Monday 292.0 2276.0 3324.0 and 2216.0 176.0 2624.0 Thursday 2568.0 Thursdayat -804.0 3428.0 1944.0 808.0 3548.0 3640.0 888.0 1072.0 3572.0 Gainesville 940.0 2152.0 FloridaMCREARY 1960.0 596.0 2156.0 Florida -596.0 FloridaEditor FloridaMCR 2592.0 792.0 4016.0 380.0 4084.0 MCR 200.0 908.0 4044.0 MCREARY -380.0 1172.0 488.0 1212.0 EARV -488.0 520.0 1872.0 4032.0 Editor 300.0 2492.0 4020.0 2392.0 2920.0 Mger 128.0 MgerTerms -464.0 4448.0 476.0 4528.0 Terms 1384.0 4479.0 1268.0 1052.0 Subscription Subscriptlon1536.0 SubscriptionL SubscriptioneSubscriptlone-1052.0 2764.0 560.0 4628.0 L 196.0 1100.0 4688.0 TwiceaWeek TwlceaWeek96.0 704.0 4727.0 Twice -1100.0 1900.0 1300.0 4744.0 1240.0 468.0 1428.0 Week 48.0 1380.0 312.0 2020.0 4684.0 Sun 1896.0 2556.0 4676.0 2332.0 104.0 2756.0 4708.0 2632.0 360.0 2964.0 4691.0 year yearnonths -360.0 yearonths yearontbs 4800.0 e 240.0 612.0 4851.0 460.0 4916.0 nonths onthsontbs1208.0 4892.0 50c 492.0 1676.0 4856.0 single 516.0 2268.0 copies 2168.0 164.0 2936.0 5c 2784.0 5cAdvertising -164.0 3100.0 208.0 -168.0 3104.0 1512.0 976.0 5132.0 184.0 5136.0 Advertising Rates 1904.0 Ratesadvertisements -468.0 2488.0 Ratesl 2644.0 5332.0 40.0 5416.0 l1228.0 948.0 5352.0 advertisements 2388.0 5344.0 15 162176.0 436.0 cents 3320.0 5360.0 3156.0 athe -92.0 3412.0 aor 2740.0 664.0 5508.0 5632.0 or 868.0 5584.0 the 316.0 5559.0 first 1096.0 1560.0 5536.0 1488.0 1932.0 5532.0 10 84.0 1848.0 2188.0 2100.0 2712.0 5520.0 for Cor2628.0 376.0 3028.0 each 2952.0 eachbonal -376.0 eachonallnsertlon 372.0 eachanal 1160.0 5727.0 388.0 5748.0 anal bonal1064.0 684.0 onallnsertlon -292.0 onallnsertlonplay -1064.0 1748.0 688.0 1060.0 Insertion -688.0 Insertionknlay insertionplay 5868.0 5931.0 knlay 668.0 5952.0 play -280.0 1248.0 5892.0 2512.0 5880.0 2348.0 444.0 5872.0 threenotices 2924.0 three -440.0 3364.0 threend threed6055.0 6136.0 nd 836.0 6108.0 twelve 1392.0 6076.0 months 1324.0 2056.0 6072.0 1988.0 580.0 2288.0 special 2228.0 specialage -580.0 2868.0 420.0 2940.0 6060.0 rates ratesfurnished -420.0 3360.0 2336.0 832.0 6232.0 720.0 6267.0 furnished 6284.0 upon 1552.0 2240.0 application applicationrage applicationage-928.0 3168.0 232.0 2736.0 660.0 6412.0 408.0 6504.0 rage 824.0 6508.0 age -244.0 1068.0 6456.0 1500.0 6440.0 Death 1416.0 2044.0 6424.0 notices 1968.0 insertedd 2640.0 insertedfurnished -684.0 680.0 2716.0 Inserted -680.0 InsertedObituaries 2096.0 728.0 6595.0 6639.0 Obituariesthe Obituaries -780.0 1648.0 6628.0 b1516.0 428.0 1812.0 6612.0 1720.0 2324.0 320.0 2504.0 line Une2420.0 lineOur -320.0 2824.0 UneOur lineSun 1540.0 964.0 7019.0 7072.0 Our 712.0 1352.0 7036.0 Clubbing 1252.0 328.0 List 2064.0 Listfsun -328.0 ListSun Listb 2432.0 552.0 7196.0 340.0 7240.0 fsun 652.0 7276.0 -240.0 892.0 1008.0 andObituaries -272.0 1280.0 1400.0 7228.0 120.0 1220.0 ThriceaWeek 1644.0 ThriceaWeekI ThriceaWeeky-1220.0 2984.0 7208.0 Thrice 2360.0 7236.0 2320.0 480.0 Weeky -480.0 2840.0 7364.0 I 744.0 7444.0 Y 7408.0 World 7432.0 one 368.0 2072.0 7416.0 3092.0 7372.0 16o 1652440.0 7376.0 16ofaun -300.0 165Sun 2296.0 7559.0 7592.0 faun 648.0 7636.0 988.0 7600.0 1372.0 7584.0 The 1260.0 7572.0 Atlanta 1684.0 Ga 204.0 Gafcekly -224.0 Gakly 7736.0 384.0 7799.0 fcekly kly -212.0 944.0 1036.0 7760.0 Constitution 2128.0 7780.0 2520.0 7772.0 2416.0 3080.0 175Sun 2896.0 3084.0 175 2200.0 644.0 7923.0 7996.0 7960.0 884.0 7948.0 1788.0 7931.0 AUanta1680.0 GaWeekly 2620.0 -220.0 GabjWeekly 2844.0 GaIWeekly 592.0 8096.0 8135.0 Weekly bjWeeklyIWeekly1476.0 8132.0 Journal 2220.0 8140.0 2608.0 3076.0 150 2976.0 150Sun 150SUD 2312.0 8280.0 8352.0 SUD1024.0 8320.0 1424.0 8308.0 1880.0 SemiWeekly 1740.0 SemiWeeklynesUnlon -1096.0 SemiWeeklyes 2748.0 632.0 8460.0 8504.0 nesUnlon 8560.0 es 1332.0 Union 1444.0 8520.0 ODe1840.0 8507.0 876.0 150We -304.0 3380.0 8463.0 1We 3144.0 3208.0 60 2604.0 8892.0 8936.0 We 1120.0 8915.0 will w1111020.0 8912.0 not 1404.0 532.0 8900.0 accept 1776.0 2516.0 8896.0 stamps 2412.0 3224.0 3112.0 ofeer ofer 9080.0 9156.0 eer er -120.0 820.0 1076.0 896.0 9091.0 denomination denomlnatfonthan 1972.0 2528.0 2 2436.0 centsbscrlbera 3148.0 centsscrlbers centsscribers -436.0 9543.0 9579.0 scribers bscrlberascrlbers1328.0 9600.0 are 452.0 9548.0 urged 1576.0 9556.0 to 2132.0 be 2772.0 prompt 2672.0 promptnewlng 3372.0 promptewlng promptowing 9768.0 9804.0 owing newlngewlng1156.0 9784.0 their 1088.0 1604.0 9772.0 subscriptions 496.0 2872.0 There Thereexcuse -496.0 3368.0 9992.0 10055.0 excuse 1336.0 10020.0 1696.0 10011.0 1568.0 2084.0 knowing 1952.0 when 2788.0 whenI -444.0 whentime 10200.0 656.0 10256.0 time 10236.0 expires 956.0 1752.0 10268.0 1612.0 2036.0 10228.0 10220.0 date 2292.0 10215.0 3140.0 10248.0 ex 3032.0 exion -180.0 exon 10444.0 10491.0 ion 10520.0 on 952.0 10476.0 la Isle540.0 10455.0 plainly 1956.0 shown 2656.0 opposite oppositename -704.0 2664.0 10628.0 10688.0 name 10640.0 Remit 10636.0 by 1708.0 check 2000.0 2724.0 stampsnoney -592.0 stampsoney 10804.0 10868.0 oney noney1128.0 10832.0 order 980.0 424.0 1844.0 10820.0 Dont wait walt2968.0 untilcome 2804.0 2972.0 until 3348.0 -356.0 3328.0 untilome 10988.0 344.0 11056.0 come ome11020.0 932.0 1276.0 11016.0 town 1768.0 11003.0 1656.0 500.0 2048.0 renew 1924.0 but 3096.0 10992.0 DOOw 2980.0 DO -248.0 DOIOW DOOW 536.0 11168.0 11184.0 IOW 11199.0 OW 856.0 11188.0 1452.0 11176.0 white 1360.0 11204.0 paper 2856.0 which whichSun -492.0 2816.0 11352.0 44.0 11375.0 11388.0 11367.0 is 1292.0 11356.0 printed 1144.0 2008.0 alone 1856.0 11360.0 costs costa2452.0 3176.0 11380.0 us 3020.0 ushalf -176.0 3352.0 usall usalf 11524.0 half 11560.0 all alf11551.0 11543.0 price 1112.0 11535.0 1616.0 1296.0 11527.0 subscription ofsubscription-160.0 xmlns:ns3 ID9 17467 3312 20 11980 ns3:type 2172.0 11980.0 12000.0 LET 11995.0 US 11987.0 GET 1860.0 11984.0 TO WORK WORKthat 2820.0 12264.0 has 764.0 12424.0 12436.0 that 12432.0 Christmas 2028.0 1936.0 passed 12460.0 an 2944.0 anear -192.0 3036.0 andear -188.0 12620.0 tear 12695.0 ear 12672.0 Is 1456.0 12656.0 1344.0 1820.0 12684.0 wane 1704.0 276.0 2404.0 our 2796.0 12648.0 peoplenaturally 2680.0 -536.0 3332.0 12876.0 12879.0 naturally 1396.0 begin filling 1824.0 2584.0 12907.0 up 2444.0 396.0 theirwith theiwith -396.0 13103.0 13108.0 with 864.0 1048.0 resolutions resolutionslie resolutionsjille-864.0 1912.0 572.0 13292.0 jille 13331.0 lie -152.0 13328.0 resolutfons1772.0 13364.0 2108.0 good 524.0 2564.0 13323.0 things 2480.0 f 3088.0 fare -44.0 3252.0 3212.0 ifare -40.0 2692.0 13552.0 13592.0 13556.0 kept kelJt412.0 there 1272.0 13587.0 2352.0 some 2236.0 2904.0 13584.0 more mor2776.0 morertant -424.0 moretant 332.0 morcant 3248.0 3236.0 2688.0 584.0 13775.0 13791.0 cant rtanttant13780.0 In 912.0 1196.0 1116.0 significance slgnlficanre1572.0 2612.0 1m im1mInce 3272.0 1mnee imace 13976.0 Ince 608.0 14036.0 nee ace324.0 14000.0 thnn1368.0 14003.0 others 2116.0 1864.0 404.0 2552.0 14012.0 most im2956.0 1mInt 3276.0 1mnt imnt 14224.0 14235.0 Int 604.0 14243.0 nt -132.0 736.0 resolution 14227.0 1608.0 2364.0 14260.0 every 348.0 man mand -348.0 14447.0 14472.0 jot down 1564.0 14455.0 in 1816.0 14452.0 his 392.0 2160.0 little 400.0 book 3160.0 14491.0 3056.0 aruins 3164.0 14464.0 -88.0 aturntng atrnlng 3268.0 14672.0 14692.0 ruins urntngrnlng14676.0 ot1012.0 1600.0 tide 1524.0 1976.0 2180.0 2580.0 14679.0 2508.0 union unionbe unioneuniona36.0 14832.0 576.0 14891.0 14927.0 a708.0 old 504.0 maxim 972.0 14899.0 Pnloninion2600.0 3188.0 isth -128.0 Isgth isa 2876.0 15100.0 15124.0 gth th 15127.0 15119.0 certainly clrtalnl1140.0 15160.0 n336.0 2196.0 15139.0 true 15163.0 oneof -288.0 2912.0 oneot onett 3288.0 24.0 15315.0 tt 15340.0 ot15348.0 Galnesv1lle15356.0 1940.0 15351.0 Alachua Alachuay 3312.0 Alachuahap 15496.0 15591.0 y 15568.0 hap hae15599.0 1080.0 1308.0 15584.0 great 1232.0 1792.0 15571.0 deal 2212.0 15588.0 2124.0 15576.0 feel feellJroud 2744.0 feellJroudortullP 3308.0 proud -476.0 proudfortune 472.0 proudortune 15783.0 fortune ortullPortune15788.0 15796.0 smiled smUed1464.0 15800.0 sweetly 2092.0 2948.0 15836.0 over oversection -368.0 overltlon oversertton 2652.0 16020.0 16036.0 section ltlonserttonunder ullder16023.0 16059.0 warm 2992.0 16028.0 nndandrlni 3292.0 nndrln andring 16240.0 ring rlnirln968.0 16268.0 ras rays16243.0 ot2252.0 16284.0 we 16252.0 have 2468.0 16255.0 aller 3300.0 alll alllr16464.0 16483.0 lr er4i32.0 l -32.0 16472.0 16499.0 ve16467.0 should 16475.0 determine determinethf determinethe-852.0 3304.0 16671.0 thf the16712.0 ne hIret16715.0 yrarycoar1828.0 put 1756.0 16736.0 2496.0 16703.0 shoulders 2424.0 shouldersas shoulderswhshouldersh-808.0 16907.0 wh h 880.0 16943.0 16948.0 1556.0 16919.0 unit ul1lt1480.0 laying -500.0 2500.0 2256.0 16924.0 lng 16927.0 aside 16932.0 3012.0 allne -208.0 allIIg allng -204.0 3296.0 17139.0 17147.0 IIgng17152.0 1312.0 differences 1108.0 difft -876.0 17180.0 > 0.0 1660.0 17172.0 ronces 2428.0 If 17183.0 17155.0 2884.0 willIs willAwillb17348.0 b 716.0 17392.0 A 17364.0 tU 1176.0 11 1472.0 17359.0 ha 1760.0 17403.0 0 1948.0 17408.0 2144.0 2244.0 Ear 17376.0 hence hen 17415.0 ce 17420.0 adaI aii aII 696.0 17571.0 daI II -252.0 17579.0 ii il1084.0 17615.0 anl 1124.0 iiv nr17612.0 17591.0 17596.0 thankful thanktul3016.0 17607.0 foran -236.0 3256.0 3260.0 17816.0 17839.0 i 17844.0 11316.0 1148.0 1320.0 1492.0 say 17847.0 1980.0 17824.0 1640.0 2204.0 17827.0 task well 2536.0 17863.0 re rev re1a 1620.0 18028.0 18051.0 v 1aIll992.0 18040.0 performed IPrtormedperformedtht IPrtormedSperformedS-832.0 18524.0 18532.0 s rM rd18535.0 rr 41 former Cormer1876.0 18539.0 United UnitedS UnitedrUnitedSamuel 18723.0 S 18780.0 18759.0 18748.0 Samuel amuel18764.0 Pasco 18767.0 wfll3108.0 18772.0 he2988.0 bedja behtt 18932.0 dja htt19004.0 r18971.0 Vr 18999.0 -52.0 1304.0 tlw19012.0 same 2248.0 18991.0 office otnce2932.0 thear theg-264.0 thegr 2648.0 19196.0 g gr 19203.0 -56.0 920.0 19219.0 ar H1204.0 ry 1284.0 19235.0 1348.0 1588.0 19199.0 1800.0 he 19243.0 announces 3048.0 19224.0 forIs 3052.0 forit 3120.0 19260.0 -172.0 orjar 19376.0 jar 996.0 19428.0 it 1216.0 19439.0 19420.0 19415.0 dollars 19451.0 1992.0 doughnuts 2284.0 doughnutsrtg doughnutsthtdoughnutsthF1544.0 19599.0 tht thFthts 19659.0 < 19627.0 1rg rtg -256.0 544.0 19640.0 silence 19663.0 General 19676.0 Ed 2928.0 EdMontlcello 3284.0 EdIf EdMonticello 2484.0 19847.0 Montlcello rOIitlcelJoMonticello19883.0 1784.0 2340.0 19891.0 19896.0 broken brokentti brokenftbrokenI-576.0 3232.0 20079.0 20092.0 tti ft752.0 ral ml20087.0 1092.0 20115.0 1460.0 20128.0 yet 1832.0 et 2304.0 20111.0 been 20120.0 heard henrdheardfO henrdMlrheardFan-472.0 20307.0 20312.0 fO MlrFan20343.0 + -76.0 840.0 1508.0 20319.0 defeat deteat1356.0 20335.0 CorRailroad RaUroadRailroadi RaUroadI-716.0 20519.0 20560.0 I120539.0 1188.0 1688.0 20552.0 1906 20555.0 -332.0 1808.0 lOG 1736.0 20563.0 20575.0 Uncle Unclee UnclejpUnclehe3280.0 20751.0 jp he20756.0 20779.0 >20759.0 Miulidaey 1Hdldacrlldidaev20823.0 any 20795.0 officeut officejtoffice4t-432.0 20983.0 ut jt4ttedly 20999.0 tl 1596.0 21020.0 dh 1712.0 20996.0 bring 21012.0 2136.0 2636.0 21159.0 ls21224.0 724.0 960.0 21239.0 J -24.0 cannon 2052.0 again ngaln21244.0 into 21252.0 thelts theE theIV21836.0 IV E 21875.0 21916.0 Its lts1388.0 21908.0 recommendation recommendationrnment recommendationthrecommendationtha-1388.0 22043.0 tha -116.0 22128.0 rJt rnment ndnent-144.0 22136.0 men -392.0 22156.0 pay pa 2472.0 22131.0 2208.0 22172.0 cam 2732.0 camff -336.0 3220.0 came 22100.0 if -4.0 2668.0 22307.0 e22327.0 ff artC 1584.0 22332.0 1340.0 22343.0 polltlcar5parties pollticalpartles1836.0 polltlcar5partiesliscussed -1340.0 pollticalpartlesp 1984.0 Iolltlcal -1284.0 22363.0 parties 22324.0 iI22515.0 22527.0 p 22544.0 liscussed isrussedIiscussed-708.0 22580.0 22583.0 endorsedi endorsedjendorsedTheendorsed -748.0 1884.0 22775.0 22815.0 j1412.0 Th 22792.0 Commoner 2996.0 22807.0 22811.0 butso buti-268.0 3264.0 23023.0 23040.0 so 23027.0 paternalistic IJaternallsUcpaternallstic2960.0 andIt andt-296.0 2004.0 23227.0 23271.0 1440.0 23244.0 It -36.0 1528.0 23247.0 23255.0 3024.0 23296.0 enIemocrats -184.0 enVemocrats enDemocrats 1496.0 23448.0 Democrats IemocratsVemocrats23483.0 23523.0 athat 23671.0 23696.0 Mr 1868.0 fr 23704.0 Bryan Br 2900.0 23740.0 23743.0 asad aslir asseems 23891.0 ad lir 23931.0 23944.0 seems 23927.0 determln determindetermlnwith -744.0 3196.0 24071.0 r5 24128.0 24151.0 24159.0 1920.0 Ith 24139.0 24143.0 Ir 2272.0 Roosevelt RooseeltRooseveltat Rooseveltoat-824.0 24203.0 1628.0 24360.0 24368.0 oatoC24371.0 thepollti thepolltiif -800.0 3200.0 24379.0 poIlU lsolltlpoIlUI lsolltltr-428.0 24572.0 24583.0 tr24619.0 1432.0 either tlther24595.0 oC24599.0 them 24639.0 can cnncanleiv cnnh canText 25247.0 Text leiv25259.0 ot25267.0 25275.0 battle battleI battleTtcnlf 25252.0 25391.0 25555.0 1520.0 25463.0 Ttcnlf -516.0 1592.0 25471.0 tcnlf FtCfllt25519.0 was 25531.0 BO25539.0 sea seat sea1a 1692.0 25687.0 1a 25715.0 1t -48.0 25727.0 Ilapmr npptittrnpp 25748.0 nr 25755.0 2808.0 25723.0 deck deckInjunction 3184.0 decki -84.0 2892.0 ck 25828.0 25952.0 25919.0 Injunction 1636.0 512.0 25979.0 seemsr -512.0 fj seemsNraeomedy 2860.0 25988.0 2908.0 ems emsraomoo 26156.0 Nraeomedy 26167.0 -840.0 raomoo roRiedy -524.0 26171.0 Stick Stickand 26175.0 Sticksad 26371.0 sad26415.0 never Ufn 26427.0 26431.0 go tobe tob toty 26591.0 26611.0 ty 26608.0 rulors rulers26623.0 oC26619.0 thefi thed26711.0 26947.0 -28.0 27228.0 27299.0 27251.0 fi d27291.0 27263.0 oCMoro sWo1000.0 27280.0 27311.0 oro fiddlingurning fiddling fiddltngfiddlingumlng fiddltngurnln5 27491.0 umlng urnln5urning27503.0 bucImc2828.0 27511.0 18Isthat -124.0 27608.0 27699.0 27639.0 2140.0 27723.0 27732.0 Republl RllaubltRepubltRllaubltIII Republtall-640.0 2540.0 Republlwblle -636.0 27927.0 III all27947.0 sandpu standpat27955.0 while wbllewblJwbllefrom -448.0 27999.0 28035.0 1624.0 28163.0 sreriag 28148.0 1888.0 rl 1780.0 28203.0 28171.0 from trom28179.0 2780.0 thetmeta thetntet thetrgt 28251.0 28383.0 trgt 28396.0 tmeta tntet-284.0 tmetaCrkketPrewitfs 28415.0 tS tSCricketPrewItts 28812.0 28831.0 1484.0 CrkketPrewitfs CricketPrewIttsCrkketPrewitfsww CricketPrewIttsns-1480.0 28827.0 rkktt -1360.0 2460.0 28843.0 Prewitts Prewittsfatore -760.0 29063.0 ns 29067.0 fatore PMftred29075.0 ww 2448.0 2080.0 29104.0 -96.0 2396.0 29079.0 luluyoungest 3216.0 Itsh 29251.0 29295.0 youngest 29299.0 editor xmlns:ns4 ID10 10108 3424 3492 1436 ns4:type 4244.0 1436.0 PRAISE 5072.0 FOR 4940.0 5580.0 CLARK 5452.0 CLARKMr -648.0 6228.0 3764.0 1892.0 4196.0 Crosby 4008.0 4840.0 Thomas XTliomas4784.0 364.0 5052.0 bon1 -560.0 5612.0 5540.0 5756.0 6056.0 ClevelandOhio 5916.0 Cleveland -812.0 6872.0 -816.0 6876.0 3588.0 2032.0 2120.0 Ohio 4184.0 who 3972.0 -344.0 4696.0 5144.0 just 4980.0 5644.0 returned 5476.0 6536.0 2112.0 fromWashington 6360.0 6540.0 CromVashlngton 3580.0 Washington Vashlngton4748.0 where 4592.0 5364.0 5260.0 5664.0 5560.0 6044.0 5940.0 look 6428.0 looking -352.0 6888.0 lookIng 3584.0 ing 3924.0 2572.0 after 3844.0 4432.0 legislation 4336.0 5400.0 regarding regarditug5308.0 6324.0 Florldharbors 6332.0 Florldot 6824.0 6024.0 2700.0 2779.0 harbors 4344.0 4220.0 916.0 waterways waterwns4656.0 1n5700.0 6156.0 6496.0 Inter 6352.0 Interlew Interrlew interslew 3576.0 3004.0 slew rlew3688.0 lew 3960.0 4068.0 4560.0 3044.0 4760.0 TimesUnion TlmesUnlon4652.0 Times -1088.0 5848.0 5348.0 5284.0 5968.0 reporter 6776.0 InJacksondlle 6664.0 6916.0 itJacksonville 3228.0 Jacksonville Jacksondlle4768.0 bas4620.0 5156.0 following 6404.0 6304.0 6660.0 sa 6556.0 saIn sayin 3452.0 3480.0 508.0 3824.0 3464.0 praise IJralse3728.0 4428.0 oC4332.0 3460.0 Congressman 4588.0 5928.0 Clark 5820.0 ClarkI -460.0 6388.0 3040.0 3836.0 3724.0 3735.0 4024.0 3760.0 3892.0 4472.0 especially 4340.0 5432.0 pleased 6184.0 6052.0 6616.0 3756.0 stirprised 6484.0 6620.0 sur stirsurprised surprlsed 3948.0 prised prlsed4208.0 3964.0 4500.0 3956.0 4376.0 4896.0 favor 4764.0 5496.0 5336.0 -768.0 3356.0 3560.0 4176.0 4056.0 4180.0 3908.0 4660.0 4216.0 4520.0 5112.0 abe abteabbe4976.0 5608.0 5464.0 5908.0 procure 5768.0 6680.0 fo 6544.0 fome 6832.0 6684.0 forme 3564.0 4396.0 4444.0 me 4080.0 4412.0 Frank 3804.0 4600.0 5404.0 although 5212.0 6292.0 4436.0 6148.0 com corncomparatively comparatlvely cornpartitively 3544.0 4624.0 4632.0 paratively paratlvelypartitively4484.0 4668.0 new 4408.0 4884.0 member 4820.0 5712.0 5588.0 6064.0 command 5988.0 commanded 6864.0 6880.0 SSthe 3556.0 4864.0 3848.0 4860.0 3736.0 4212.0 respect 4108.0 4928.0 or4828.0 5192.0 theHouse theBouse5092.0 6192.0 6084.0 6608.0 wllwllprove 6912.0 willprove 6848.0 5076.0 5116.0 prove 4100.0 5120.0 4272.0 very 4192.0 4724.0 useful useCul4648.0 5324.0 5236.0 5772.0 5080.0 Cor5676.0 6008.0 6436.0 5084.0 State 6348.0 StateHe 6868.0 5304.0 5320.0 He 3912.0 3788.0 4164.0 aggressive 4040.0 5240.0 5064.0 5311.0 5548.0 5780.0 5932.0 makes 6712.0 no 6596.0 noenemies 3552.0 enemies 4380.0 4232.0 5184.0 attained 5568.0 5876.0 standinseldom 6080.0 6188.0 standing standin-612.0 6800.0 standingseldom -728.0 standIngseldom 6820.0 5572.0 5763.0 seldom 5760.0 reached 4128.0 4992.0 4888.0 5288.0 Congressmen Congresumen5292.0 Congres -1128.0 6420.0 5784.0 5976.0 6520.0 untilthey 6524.0 untl6904.0 untlrhey -384.0 6908.0 untiltbey -324.0 5984.0 they rheytbey3992.0 5992.0 4464.0 had 4848.0 6016.0 many 456.0 yeas years5316.0 5500.0 ears 5856.0 5936.0 6176.0 service 6096.0 serviceFor 6772.0 3820.0 6152.0 6220.0 For 4260.0 6216.0 4672.0 6212.0 sake 5196.0 5048.0 6208.0 5356.0 5920.0 6640.0 Isgreatly 6900.0 isgreatly 3540.0 6435.0 greatly 6452.0 4136.0 4564.0 regretted 4756.0 5680.0 6280.0 Floridawill -624.0 Floridawl11 wl11probably 4792.0 lose 5216.0 both 5688.0 her older 5964.0 6584.0 6700.0 relresentatives 6492.0 rep rel-216.0 6804.0 representatlves 6856.0 3536.0 6887.0 6892.0 resentatlves resentatives4680.0 4568.0 4824.0 5312.0 House 5204.0 5944.0 6924.0 5844.0 onaccount onaccountof -960.0 6240.0 account accoun-664.0 accounof accountof 7112.0 7124.0 3868.0 7116.0 3704.0 4296.0 Senatorial 4124.0 5340.0 7120.0 contest 5168.0 5956.0 thepeople 7339.0 7344.0 people 4072.0 4872.0 7347.0 5272.0 fall fail5672.0 5544.0 7352.0 return 5832.0 6480.0 MrClark -232.0 6844.0 3532.0 7564.0 4364.0 7608.0 4276.0 4548.0 big 4452.0 4908.0 7568.0 vote 4812.0 5736.0 6164.0 6568.0 stillfurther 6472.0 6572.0 still stll-312.0 6884.0 stllfurther 7792.0 7796.0 further 4252.0 Increase 4132.0 4960.0 Influence 6344.0 3528.0 8028.0 HouseHe -520.0 4048.0 HouseIIHe 3712.0 8240.0 8244.0 IIHe 8251.0 4616.0 introduced 4460.0 8256.0 two 5516.0 6116.0 8284.0 6632.0 Imtin6488.0 tinportant 6636.0 1mportant -196.0 Important 3524.0 8468.0 8480.0 portant 4240.0 8471.0 bills b111s4144.0 4704.0 this 8476.0 session 5020.0 5884.0 5724.0 6248.0 passing 6140.0 passingof passingor-628.0 3516.0 8696.0 8704.0 or3808.0 3680.0 4424.0 8700.0 4300.0 4716.0 would 5220.0 make 5852.0 6564.0 8708.0 him himfamous 8920.0 8923.0 famous 4368.0 4116.0 4804.0 bill b1118928.0 sale 5804.0 6340.0 thePhilippine thePh11fpplne 3520.0 9148.0 Philippine Ph11fpplne4532.0 Islands 5300.0 9152.0 w1115776.0 probabl5604.0 9192.0 reoreceive reocelve 6828.0 9232.0 8.0 9372.0 ceive celve9408.0 9375.0 ftUe4496.0 5252.0 9388.0 support 6112.0 9383.0 5896.0 althoughthere -732.0 4088.0 9636.0 3952.0 4492.0 likely 4356.0 5104.0 9608.0 4964.0 5728.0 times 6316.0 9612.0 during duringthe -548.0 3508.0 9827.0 3860.0 9832.0 next 3772.0 4304.0 9835.0 ten 9860.0 years rears4556.0 5108.0 5744.0 5636.0 6004.0 6696.0 9843.0 ofthat -156.0 2232.0 10047.0 10052.0 3936.0 4284.0 w111regrettedThe -776.0 5740.0 regrettedliThe 3684.0 10276.0 liThe10280.0 refund 4096.0 10292.0 cotton 5436.0 10295.0 tax 10287.0 5692.0 ought 10300.0 topass 6852.0 10499.0 10535.0 pass 4004.0 10504.0 4404.0 4524.0 5224.0 10543.0 mean 10512.0 much 5668.0 6328.0 thepeoplo 3344.0 3500.0 10728.0 peoplo4160.0 4052.0 4324.0 10732.0 South 5512.0 10744.0 10739.0 those thosemany 3504.0 10951.0 10984.0 millions mfllions5008.0 10959.0 4816.0 6120.0 10972.0 returnedwhich 6124.0 -712.0 6836.0 3492.0 11180.0 3988.0 5148.0 paid 5012.0 out 6040.0 iii5904.0 11192.0 illegal fllegalillegaltaxes -508.0 fllegaltaxes 11411.0 taxes xmlns:ns5 ID11 4196 3380 3456 11896 ns5:type 11896.0 REASONABLE 11900.0 PASSENGER 4808.0 11912.0 RATES RATESWhen 3668.0 12331.0 When 4312.0 12336.0 4156.0 12339.0 Legislature 5836.0 12352.0 oC5684.0 5996.0 3336.0 3496.0 12548.0 12560.0 12563.0 3840.0 4504.0 5000.0 12576.0 2cent 12584.0 cent 5492.0 1224.0 passengerrafe passengerrafebill -1224.0 12612.0 passenger passengerale raferalebill rafebill 3488.0 12788.0 3752.0 4320.0 12791.0 railroad 5152.0 12832.0 managers 12804.0 declared declaredIt -696.0 6816.0 decla 6644.0 12808.0 edIt 13012.0 3716.0 13047.0 3608.0 4148.0 13020.0 ruinous 4036.0 13023.0 apd atId4776.0 13028.0 conflscatory conflscatorconfiscatory13036.0 But Butthe 3484.0 13240.0 3832.0 13243.0 official 3744.0 4468.0 13256.0 returns 4372.0 5176.0 13248.0 5420.0 13251.0 5624.0 railroads railroadsIn -740.0 13468.0 3732.0 3632.0 4092.0 13472.0 13476.0 13508.0 5408.0 13512.0 ending 6416.0 13483.0 June 6336.0 13692.0 30 13695.0 3652.0 13731.0 4152.0 4584.0 13700.0 figured 4476.0 13703.0 5160.0 5576.0 5468.0 5840.0 6432.0 13708.0 Rail 6764.0 6784.0 13920.0 road 1004.0 Commission 5100.0 13928.0 shows 4952.0 13964.0 13932.0 substantial 5792.0 substantialIncrease -920.0 6812.0 substantialincrease 14144.0 14180.0 4168.0 14147.0 4604.0 14155.0 preceding 14188.0 6020.0 14191.0 14160.0 This ThisIncrease 6808.0 14367.0 14372.0 14375.0 due 14392.0 5088.0 14380.0 elimination elhnlnatlon6648.0 14388.0 oCoffree oCfree 3472.0 14596.0 free 3928.0 14632.0 passes 3796.0 14599.0 14604.0 excursion 4880.0 14615.0 5816.0 14607.0 6372.0 andthe 6796.0 14824.0 natural 3720.0 14827.0 growth 4392.0 5128.0 14863.0 l3ssengr6276.0 14835.0 traffic 6200.0 trafficThe 6756.0 3468.0 15048.0 result 3784.0 15051.0 4728.0 15059.0 4988.0 5620.0 oC5524.0 15056.0 how 6272.0 however 6748.0 15276.0 15304.0 ever 3976.0 15292.0 4580.0 15312.0 4788.0 15279.0 fair criterion 6036.0 15287.0 5912.0 15320.0 sOllle6264.0 someother 6792.0 sOllleotber 15499.0 other otber15504.0 States 3900.0 4700.0 because becnuse5488.0 15508.0 6000.0 15511.0 traversed 5864.0 traversedby 6780.0 15723.0 interstate 15728.0 15736.0 5472.0 15731.0 East 15744.0 toWest 3456.0 15948.0 West 5hich3880.0 4540.0 15964.0 must 5044.0 15951.0 Incr 5732.0 5372.0 15992.0 15987.0 l1s 5424.0 5824.0 15956.0 15976.0 t1 15995.0 5980.0 15968.0 rtturllHxmlns:ns6 ID13 14304 3468 3336 16172 ns6:type 16172.0 16175.0 Cor16207.0 4664.0 trame16180.0 als 1115708.0 also 16219.0 6032.0 06012.0 16216.0 6356.0 mortmorpmortdensely -416.0 morpdense 6736.0 moredensely 16224.0 3448.0 16400.0 densely dense populated IWIl1latetl16408.0 Statt5036.0 5600.0 16444.0 5800.0 16403.0 16439.0 manyothers 6768.0 111111 111111others 3444.0 16623.0 ranking 16627.0 higher 16632.0 6408.0 16635.0 Now NewNowYork NewYork 16664.0 W -112.0 6760.0 WYork 16852.0 York 4012.0 16888.0 Pennsylvania Pennsrl -1116.0 5412.0 5068.0 16891.0 4948.0 16855.0 16860.0 perhaps llIhapswithits 6244.0 withts withIts 17075.0 17080.0 17087.0 ts 3644.0 welltodo -784.0 17092.0 4388.0 io 4288.0 farming fanning5392.0 population IJOIJUlationpopulationIt IJOIJUlationIt6268.0 3132.0 17343.0 3888.0 4516.0 17379.0 seem 4932.0 17351.0 Interstate IlItlrstatlInterstateCommerce IlItlrstatlCommerce Commerce 4488.0 could 17576.0 figure llgurtlgUlfllgurout tlgUlfout 6668.0 figureout 6732.0 3440.0 17795.0 3700.0 17808.0 cost per IIPr17800.0 mile 4944.0 17831.0 IU 5428.0 JJ 5388.0 17836.0 5328.0 5564.0 JIISSllIgrpassengertraffic JIISSllIgrtraffic 18020.0 4120.0 5444.0 bo bpbe5828.0 18023.0 used u8er118059.0 6196.0 6672.0 astandard 6752.0 18243.0 standard 18247.0 Hxlng flxlllgfixing5208.0 5096.0 18260.0 18252.0 6260.0 eachState 18472.0 4060.0 18508.0 5164.0 haHhasdone haHdone 18695.0 done 18700.0 4348.0 thnt4204.0 Fair 111ar5888.0 6100.0 sla 6384.0 do r1lICdomands 6708.0 r1lmands ICmands 18904.0 18919.0 mands 3968.0 18924.0 4416.0 4780.0 shall lie6560.0 al 6312.0 alowed 6704.0 allowed 3436.0 19144.0 lowed owed19164.0 3904.0 19147.0 charge 904.0 4912.0 reasonable resonahle19159.0 rntsthat5x111 thatvlll thatwill 19371.0 vlll will5x111provide fnlrInterest 19407.0 6180.0 actuai ac ncactual nctual 3424.0 19596.0 tual tuai19632.0 money 3740.0 mone Invested 19635.0 19615.0 rturn6552.0 onwatered 011onvatered 011watered 19775.0 3420.0 19816.0 watered vatered19823.0 stock 4732.0 19836.0 expectedTHE expected lXllected-724.0 lXllectedTHE 3692.0 FARMERS INSTITUTE 5172.0 INSTITUTEThe -1040.0 3600.0 proposed IJroposEd3920.0 farmers fnrutersCnrIl1 20792.0 rs Institute Institutewhich -692.0 6692.0 institutewhich 20979.0 vI1121015.0 convene conene4352.0 5460.0 city clt 6368.0 6512.0 forhree forthree orthree 3416.0 21203.0 hreedays das21208.0 beginning February FImllrbbis 6688.0 5s 5Is 21428.0 21467.0 3672.0 21431.0 destined 21451.0 4772.0 21464.0 IlrOe4644.0 21436.0 grt 5860.0 21472.0 5900.0 practl Ilretlprsctlprsctlcal practlcal Ilretlcal 3240.0 21655.0 cal 21660.0 value Rlue21671.0 4188.0 4904.0 agricultural agrlculturnlInteresInterestof 6652.0 Interesof 3408.0 21880.0 21888.0 21883.0 5016.0 5276.0 6088.0 shouldbe 6720.0 22103.0 22107.0 3592.0 attended 4972.0 22111.0 brCarmers5924.0 6532.0 allections 6724.0 allsections 22335.0 sections ectionssectionsSince 4076.0 ectionsSince 22559.0 Since 4140.0 4268.0 4740.0 22563.0 4636.0 learned 22596.0 eam 22599.0 5648.0 Sec Stc6300.0 Secetary StcreUlr Secretary 22784.0 22800.0 etary retaryreUlr -504.0 oC4316.0 Agriculture Wilson WIl801lWillson5280.0 hebehere hhere hehere 23007.0 here 3884.0 23012.0 address addrss4172.0 4936.0 5448.0 meeting Tnf1IUngrne4ting6296.0 thustthostthosenterested thustInterested thostInterested 23231.0 Interested nterested23235.0 CCEOIEtthlrtilllclalspecialduty -552.0 6716.0 tilllclaldJt specialdaty 3400.0 23456.0 23459.0 duty datydJt -364.0 23475.0 3664.0 23495.0 listen lIst 23479.0 6048.0 ttwvaluabie 6308.0 6444.0 val -228.0 valuable aluable 23676.0 23683.0 uable uabie4000.0 23691.0 suggestions along 3Jrlrulturulagriculturalnes 3JrlrulturulIagriculturaltnes-984.0 23903.0 23908.0 Hnes tnes3512.0 nes 23911.0 thlHIlarnedgentleman spntlemunhaso hn 24135.0 24167.0 3648.0 otTer offerotTerIt offerIt24355.0 3800.0 24391.0 may 24395.0 ma 24376.0 24363.0 hegenerally gnenLllknown 5656.0 6464.0 hutbutihe hutlhe butthe 24575.0 24580.0 ihelhelast 4028.0 5376.0 thlH5296.0 Stlt6288.0 made mfullmadean mfulla24803.0 24836.0 24843.0 24807.0 annual appropriation 311prollrlaUoll5696.0 24811.0 oC5552.0 250u 250325Ouayear aar 25032.0 25059.0 25068.0 3568.0 25035.0 Corholding hollhtg5720.0 these theso6160.0 -8.0 25076.0 25063.0 Instl In4t1InatiInstltutes Inatitutes 25271.0 tutes tuteR3984.0 25295.0 25280.0 4400.0 25255.0 held 5004.0 hf ld undlr6256.0 direc dlncdirection -412.0 6676.0 25319.0 25479.0 tion tlon25484.0 oC3944.0 4384.0 experimental exrlerlmpntnl4292.0 25487.0 station st1t1onstatlonSev6128.0 Several 6656.0 Sernl Secoral 6528.0 25515.0 25543.0 25699.0 25704.0 oral eralernl3816.0 25707.0 oC4104.0 3980.0 tll 4536.0 25743.0 4256.0 25711.0 institutes-788.0 tltutf -388.0 alwuly Alrfftdrslrrelyalwulybeen -616.0 Alrfftdrbeen slrrelybeen 25931.0 hld hPid25939.0 25935.0 various Rrlous4456.0 stctlonsections25927.0 6320.0 Flor PlorPlorIda FlorIda 25996.0 26143.0 ida 3792.0 26151.0 3624.0 26164.0 Intended Intrndoilh1nd26192.0 5244.0 5368.0 26148.0 inakotnak5660.0 tblltbllthe thisthe 3376.0 26363.0 26368.0 26379.0 central 26383.0 institute IJHltltutf5188.0 26375.0 26399.0 lfHlt26412.0 m vnhtabio vluabevattabMvnhtabioand vluabeandvattabMand-700.0 26587.0 26595.0 26603.0 ufleCulot4248.0 26599.0 5060.0 4984.0 5396.0 ariianl5268.0 LhlilMend emlemlthe -276.0 endthe ndthe 2380.0 26815.0 26847.0 promoters laromotn26859.0 arc areAr 5056.0 26820.0 working workingNAVAL orkin orkinNAVAL 5628.0 2060.0 27319.0 NAVAL ARMAMENTS ARMAMENTSThe ARMAMENTSTbe-1240.0 27751.0 Tbe27759.0 BrJtlsh Dr1tlshfgrttish3864.0 27755.0 natal naralnanlautttorUle autborHIfauthorttlrs5200.0 27783.0 Itrtartareaid ItrtMid artsaid 27975.0 aid Midsaid4064.0 27983.0 iJtpreparing Irelrthprepsnag5256.0 28019.0 j 27980.0 plans 1011Uns 5808.0 torfur28007.0 ft Itawar wnr6224.0 wnrship warship 6580.0 rshJp 28043.0 28195.0 ship shJp28199.0 50 iOoO28239.0 28236.0 28243.0 c 4440.0 28231.0 greater gresurtr 28207.0 Umnthnnlb 6092.0 Dread fJT6RdDreadnaught fJT6Rdnaught Crc -16.0 rtd rtdnaught 28419.0 28423.0 naught 28467.0 3940.0 28431.0 28471.0 4968.0 displacement 28427.0 dl -1108.0 dtl4la ilaceraont 5456.0 28455.0 pau 28447.0 6172.0 or34 M6600.0 28644.0 28647.0 000 28667.0 tons ton28688.0 28655.0 28652.0 naval naaldesigner dOJIE1Idosigaera28679.0 bur hvhavehaveproposed burproposed hvpropole1 28867.0 28875.0 propole128895.0 build bulJd28907.0 warohlphlp 5484.0 jCMKh t00n1t00n1tons 6204.0 jCMKhtons O1t O1tton 29111.0 ton29095.0 wbJch3708.0 5180.0 cot29083.0 200000fl UOOOOOO0000000UOOOOOOWbn 6548.0 200000flWhen -720.0 0000000When 29308.0 29319.0 Wbn29323.0 thl29315.0 rivalry rtraJrytor for5960.0 29311.0 Size Sizeand iz Jlizand Jland 29523.0 29547.0 number numoorof4576.0 29539.0 varehlpfl Iuahlpsxarehlpa29564.0 cease ctnUewainwhatelL4M what wb3t-404.0 30311.0 30323.0 30415.0 elL4M xmlns:ns7 ID14 8484 3484 6976 1432 ns7:type 6996.0 7080.0 7020.0 7516.0 satisfy saUsCr7388.0 8188.0 craving 8072.0 8944.0 8820.0 9012.0 9184.0 9296.0 9736.0 propara preparaproparations 10372.0 preparations 9836.0 rlJ 10212.0 10096.0 mtlons tions tlons7768.0 1664.0 Inthe 7496.0 -528.0 8296.0 8036.0 7936.0 8384.0 emd8672.0 8780.0 8992.0 9488.0 1672.0 impoverish Impoerlsh9400.0 impoverishthe Impoerlshthe-932.0 10420.0 7084.0 7556.0 lCople7348.0 8312.0 8472.0 9096.0 countries 8880.0 10092.0 tlmt tltnltltttt9872.0 strive stlle7668.0 Cor7560.0 supremacy 7892.0 supr -908.0 8904.0 macr 8368.0 9060.0 Cor9392.0 9288.0 9928.0 9820.0 10168.0 10056.0 notonly 10428.0 notonh 7076.0 2328.0 only onh7624.0 7440.0 vast 7884.0 8608.0 outlay outlar8424.0 9320.0 9128.0 building 9552.0 buildingthese 10424.0 7632.0 enormous 7520.0 8568.0 8452.0 engines englne8876.0 9780.0 9620.0 10048.0 theconstant 10416.0 6988.0 constant 7008.0 expense 8692.0 8584.0 keeping 8856.0 9732.0 tlwm9616.0 10144.0 repair ropalr7660.0 nnd8048.0 7952.0 8276.0 commission 8200.0 9480.0 Experience BqJlrleI1ll9260.0 Experiencet -936.0 Experienceshows BqJlrleI1llshowfi -900.0 10380.0 showfi7004.0 thafthae7588.0 8220.0 8108.0 about 8372.0 9140.0 tcn9544.0 rears10136.0 ourfinest 10140.0 10408.0 10412.0 finest 7616.0 warships wnrshlps7532.0 8688.0 8612.0 8872.0 few 8776.0 9248.0 rearsago ngo9688.0 10148.0 nrt10064.0 arenow nrtnow 10360.0 10364.0 7068.0 now 7504.0 7848.0 fit I1tlit7752.0 8104.0 8000.0 8432.0 8340.0 3691.0 scrapheap srrnphenIscralheap8684.0 scrapheapThe srrnphenIThescralheapThe-888.0 9664.0 7256.0 812.0 7732.0 linitatton IIniltaUonlimltatiom7580.0 3916.0 ot8544.0 land 9508.0 9356.0 9956.0 3932.0 naal9800.0 navalarmaments 10400.0 naalarmament 7064.0 armaments armament8176.0 8004.0 something 8304.0 9512.0 9348.0 9932.0 world worldmust 10392.0 worldI 7056.0 soon 7484.0 8032.0 agree 7928.0 8592.0 8496.0 9144.0 8988.0 9472.0 9680.0 9580.0 9904.0 sense 9808.0 senseless 111 10172.0 tless 10320.0 10316.0 6976.0 less 7000.0 7480.0 7744.0 7640.0 7984.0 -544.0 8640.0 opl opld8184.0 8744.0 4596.0 9092.0 thl8984.0 9448.0 Creation breatlonrentlon4612.0 10124.0 10404.0 7060.0 4752.0 7528.0 7404.0 IBlg 8264.0 4815.0 really reall -484.0 8868.0 uselessDELIBERATION 8756.0 useless -588.0 9576.0 7340.0 5264.0 DELIBERATION 8916.0 IMPOSSIBLE IMPOSSIBLEIt IMPOSSIBLEg-1156.0 10072.0 7232.0 5752.0 7512.0 7368.0 7992.0 he7808.0 5796.0 8632.0 long 8444.0 9564.0 expensive 9420.0 expensivetrip 10388.0 exp nsll 9844.0 nslltrip 10456.0 7048.0 5972.0 5975.0 trip 7476.0 CorDll1ocratsmocrats7704.0 Dt -892.0 8724.0 8848.0 Crom9364.0 9236.0 9748.0 10112.0 totake 10452.0 Itake 10460.0 take 7748.0 attend athnd7656.0 8260.0 Denver 8628.0 convention conentlon9328.0 conventionespecially -912.0 10332.0 conentlonesJeclnlJ 7044.0 esJeclnlJ6476.0 7864.0 8232.0 8040.0 8492.0 9444.0 6448.0 haegiven givenuotice 10376.0 givennotice notice uotice7676.0 7552.0 8120.0 1107988.0 reduced 9228.0 6675.0 fares CareH9764.0 10192.0 bt10068.0 beconceded btconceded 10336.0 conceded 8052.0 Rut nutBut6895.0 9020.0 9460.0 10116.0 tht9988.0 theconvention thtconvention 10344.0 7032.0 8060.0 7160.0 7944.0 delegates 9272.0 7164.0 -340.0 7135.0 gain 10224.0 7140.0 10088.0 incomposure 7028.0 composure CO -896.0 7924.0 7424.0 Josure 7204.0 8024.0 chat8428.0 7356.0 9312.0 9660.0 cash 10176.0 10024.0 bythe 10368.0 bthe 10264.0 absence absenct7288.0 oC8056.0 8456.0 7576.0 8836.0 noisy nols 9284.0 enthusiasts enthusiastswho 7788.0 hav7360.0 7807.0 7876.0 8576.0 7840.0 8440.0 9136.0 7816.0 conventions 9000.0 10272.0 7856.0 abeer 7972.0 8016.0 beer 7488.0 garden 7384.0 8160.0 8064.0 8680.0 9160.0 9052.0 deliberative 9256.0 deliberativeassembly -1004.0 deliberativeassembh 7016.0 8248.0 assembly assembh8088.0 With VithVlth8540.0 8436.0 8908.0 thousand 8804.0 specta saecta9668.0 spectators 10304.0 saectators 8344.0 tors 7456.0 howling howllll8216.0 8488.0 8100.0 8484.0 favorite 9856.0 candi candl9744.0 candidate candldate 10296.0 7508.0 nothing nothln 8228.0 8020.0 8664.0 8748.0 8572.0 8716.0 speaker 8755.0 says 9960.0 9788.0 9888.0 9848.0 8760.0 callcanbe 10340.0 callb 7176.0 8967.0 7248.0 htard7716.0 anyone anrone8940.0 fifty 8648.0 feet 9524.0 8948.0 9456.0 9908.0 himnnd himnd himInd 7012.0 nnd Ind7108.0 7296.0 tht7824.0 9179.0 art 7708.0 9168.0 8288.0 8348.0 9176.0 gesture 9240.0 9100.0 9500.0 9368.0 9896.0 equal equalto 9331.0 Imparting 7464.0 Jmrtlng 7280.0 8136.0 ideas Ideasn 9887.0 xmlns:ns8 ID15 5804 3412 6920 10096 ns8:type V 7180.0 10104.0 7620.0 BrY1I110108.0 brilliant brillfant10152.0 young oung10128.0 10000.0 attorney 10288.0 attOrt1t 10331.0 torney tOrt1t 7536.0 7392.0 7428.0 7672.0 7964.0 8084.0 1ckRon -916.0 8652.0 10339.0 vllle 8624.0 9492.0 10352.0 9944.0 hiscampaign 10328.0 hiscamrmlgll 10556.0 campaign camrmlgll10595.0 manager 7784.0 8668.0 10564.0 8588.0 10568.0 8808.0 Jast Jlst10584.0 ast 9528.0 10579.0 guberna gubernatorial -676.0 gubernatorlal gubernatonal 10648.0 6992.0 10780.0 tonal torialtorlal10791.0 8604.0 10799.0 8356.0 succeed 9588.0 10132.0 lamented 10871.0 11011.0 mented Senator Srl1ntorMallory 8360.0 9412.0 11028.0 9816.0 11031.0 9644.0 Bryanwas 10308.0 Dr 10008.0 11064.0 10120.0 10084.0 anwas 11236.0 11259.0 7400.0 already 8112.0 11279.0 8008.0 8420.0 11243.0 avowed aowed11248.0 9044.0 9972.0 forthe 6984.0 11455.0 11463.0 ol11cl7956.0 11472.0 8380.0 11468.0 death dentb9376.0 11480.0 oC9532.0 SenatorMallory -652.0 SenatorIallor 11684.0 Iallor 7628.0 11692.0 11695.0 8660.0 9076.0 11700.0 8964.0 9452.0 11703.0 place Illacl9340.0 9976.0 11744.0 con COliconS9876.0 conSsiderabiy 9980.0 considerably COlisldembl 11776.0 10252.0 6980.0 11907.0 siderably sldemblsiderabiy7940.0 11915.0 earlier arller11928.0 9696.0 11932.0 fondest Conclestfondesthopes -608.0 Conclesthopes 12136.0 hopes 7544.0 anticipated anthlpatedantiIpated8720.0 12148.0 8464.0 12152.0 9036.0 12160.0 oC12155.0 9940.0 theGulf 6972.0 12359.0 Gulf 7468.0 12367.0 Coast 7320.0 9004.0 12411.0 9424.0 12396.0 9276.0 12380.0 likelyto Hkel Hkelto 10188.0 6968.0 12587.0 12596.0 7264.0 relish 12623.0 rt Hsh 12592.0 8268.0 fact tact8124.0 12600.0 9220.0 tbe9068.0 12607.0 Atlantic 9476.0 AtlanticCoast 12816.0 7980.0 12819.0 7844.0 12824.0 lnlted8336.0 9188.0 12835.0 Sena Stna9704.0 Senators 10244.0 Stnators 10260.0 6964.0 13044.0 13052.0 und7868.0 lll 8152.0 13083.0 demonstrate 13067.0 9632.0 10028.0 13060.0 thltheprimary thlprlllll1ry 13268.0 primary prlllll1ry7724.0 13271.0 13276.0 1008 1OS19058552.0 13312.0 8824.0 13284.0 13279.0 9436.0 9880.0 13287.0 opin oplnoplnon opinIon 6956.0 13488.0 Ion 13524.0 7308.0 13491.0 13496.0 Governor GOtrnor7648.0 13504.0 Broward Brownrd8512.0 hns9344.0 madea 6948.0 13716.0 13747.0 7132.0 mistake mlstakf13764.0 7880.0 13720.0 itmaking 13728.0 8736.0 appointment allpolntmtnt9084.0 appointmentind allpolntmtntandappointmentand6944.0 13940.0 ind13943.0 tlmt7684.0 8224.0 13956.0 8316.0 8616.0 Brrnn9116.0 9640.0 9520.0 10184.0 10076.0 aolltkal a1I0Htkal apolitical 14163.0 political olltkal1I0Htkal14171.0 8500.0 ht8752.0 14183.0 accepting accept1nK9924.0 10032.0 ap opapolntmont appolntm oppointment olntmont pointmentpolntm -836.0 14408.0 14400.0 Hon lionilonJohn Stockton 14416.0 5vhowhobuilt 5vhobuilt built 14651.0 14620.0 thothl7652.0 8172.0 14640.0 present Iresenl8044.0 8980.0 14636.0 crowd 9672.0 10004.0 9812.0 thelolltlcal thepolitical 14695.0 14844.0 lolltlcalpolltlcul14847.0 saddle 7604.0 7852.0 nclcll 14888.0 8180.0 9108.0 14868.0 8996.0 9384.0 14855.0 9264.0 IINnbeenoverlooked -372.0 IINnorlooklCl 15067.0 overlooked orlooklCl15080.0 hr8292.0 15075.0 8144.0 9648.0 15083.0 9516.0 15088.0 thothtthoeople thtpeoJIl 10208.0 6936.0 15296.0 eoplepeoJIl15331.0 15300.0 8012.0 see Itl 8392.0 15307.0 toot tnattoat8208.0 IH isIHowarded IHrowardeil isrewarded 6928.0 15519.0 rewarded owardedrowardeil15524.0 7696.0 8116.0 1908 7976.0 15532.0 8236.0 lOS 15527.0 placing 8788.0 hint15535.0 Inho Intlw 6920.0 15739.0 ho tlwthe7272.0 gulHrnntOllal15752.0 chair 8396.0 xmlns:ns9 ID16 10332 3472 6836 16227 ns9:type 7096.0 16227.0 7128.0 Ih7380.0 16271.0 7312.0 cattyahll 16235.0 7920.0 8364.0 16232.0 farm 16263.0 crops croJis8740.0 9440.0 10040.0 16276.0 9916.0 goo goto 16452.0 7220.0 thoHUPIIOIl7472.0 ot8252.0 16455.0 animals aninmlsnlmnlH9352.0 muchgreater 10216.0 muchgrlattr 16679.0 16695.0 grlattrthnu16684.0 16687.0 consumed onHumed8448.0 16723.0 ratan9604.0 ratanAll manAll 16899.0 All 7144.0 7460.0 16904.0 7804.0 wheat whel1t8408.0 n8580.0 quarter gaart4rIlIl rtlr 16912.0 tit 9760.0 9840.0 oats 0l1t8omits9656.0 oatsonetenth 0l1t8ouetenth omitsone 17128.0 onetenth ouetenth17163.0 7252.0 tenth 7188.0 17131.0 ot8204.0 8092.0 corn COlII8800.0 nil9088.0 17136.0 oCtlwbarleythe barley barleyhe hl1rlt hl1rlttll the17387.0 rye 7700.0 17356.0 thl8068.0 buckwheat buckwlwat9124.0 9496.0 rice rlcol9268.0 thepotatoes 9796.0 9964.0 tI tIIlotatoCH potatoes IlotatoCH17583.0 ami8076.0 tobacco tohaccu8784.0 belong Illlofll9720.0 17604.0 9624.0 Uw9868.0 thecrops UwCIOJIH CIOJIH7540.0 ntlll7836.0 8524.0 17811.0 portions portloui9404.0 crollscropsdestined crollsdtsUnf11 dtsUnf11human 7908.0 8620.0 18036.0 consumption rOfommptfonsunnption8528.0 18067.0 -1048.0 9892.0 TIll Thorhe8840.0 Thosum -316.0 TIllHIlII rheSum 18284.0 sum HIlIItotal rnlllfarmtmhll9064.0 18296.0 9332.0 thlHHonDecember 10196.0 onIJ onUecennber 18480.0 cemhtrUecennberIJ 18519.0 18483.0 i1007 lUi1907ns8792.0 9948.0 tho thethoDepartment thoOllIrtll1 theflopartunent 18707.0 Department OllIrtll1flopartunent7720.0 18720.0 rat 18712.0 oC8196.0 -956.0 riculturt 8300.0 18739.0 WUS18715.0 1079Ooo000 9568.0 1079 lOitlOitOIJOOOO 18927.0 000000 OIJOOOOOoo000rime Thofhl8212.0 uhw8796.0 oCanimal unhnal8956.0 feed HtIIfeedstuffs HtIIstutTs 19152.0 19155.0 stuffs stutTs7336.0 Just jUflttwice twlcltviee8596.0 required rlClulrclbyman hman byratan ratan19412.0 ur7224.0 19379.0 321 7548.0 2190000000 2100OOnOO9000000Including IlIrhullnJ8768.0 19392.0 mORtmast9692.0 mastof mostof mORtof 10180.0 thoprincipal Irlncllnl7412.0 8376.0 crop croJlIcrops19604.0 oC9212.0 tho9584.0 19619.0 current curnnt9468.0 currentyour curnntear currentyear 19860.0 your yearyourE yearE7244.0 earJ 3068.0 20263.0 20271.0 20268.0 -100.0 KrAIn Ertln7688.0 EI 20276.0 urLak LikCity eltr8932.0 9596.0 119432.0 WtlIsell9684.0 wellknown WtlIknow sellknovn 20491.0 20495.0 knowknovn7328.0 20527.0 traveling 20516.0 tm tlIl1l salesman ImltmuIIsalesrnnn9204.0 IHtilllatest Inttstlatestto Inttstto20715.0 20735.0 7148.0 20720.0 break -456.0 20764.0 7396.0 tk 7420.0 Into lratopolitics pollticHpulitirs9032.0 IIIIlew hIhtacandidate aandldat 20939.0 andldat20943.0 20976.0 ratflraaclcommissioner ummISHIOlltrconimissiumier8832.0 commissionerMr ummISHIOlltrIrconimissiumierIr-1148.0 21167.0 21172.0 7100.0 Erwin Erwln7872.0 IIissaid Imld21183.0 tu8416.0 1lbe21195.0 vory8976.0 9180.0 popular rlOlJlllIrpopuhlrpopularwherever rlOlJlllIrwhtrcr popuhlrwherever 21387.0 21395.0 wherever whtrcrkraown7644.0 21392.0 nradhlfihlR8712.0 9208.0 friends frlNlllH21423.0 spy Hilrspyhe HilrhI spyht 21552.0 21619.0 hIht7136.0 21627.0 7332.0 21632.0 mOJoitn1ost21555.0 everywhere 8328.0 9380.0 tnCwh 9224.0 21643.0 9104.0 21616.0 IffIleIIttlhits9824.0 hasnot IIttlnot hitsroot 21867.0 root7216.0 21844.0 heretofore htfItofon21764.0 Indulged 21839.0 IlIdlI lndulgr evertvhere -572.0 fntillexciting flxclUIIJ9428.0 excitinggame 10164.0 flxclUIIJgalllt 22059.0 game galllt22071.0 uf7304.0 o111re22063.0 ollljoIlfklll seeking neeklng9024.0 hut1149536.0 22095.0 expetted X X11rH1 22283.0 22296.0 petted pected11rH122291.0 ho5v1117664.0 Jlrfllprune8656.0 n22319.0 8924.0 formidable forrnfrlahllfonnlItblefonnlItblecandIdalcStnrk4 formidablecandidate 22508.0 candldaleStnrkt candIdalcStnrk4-796.0 22519.0 Stnrke 8400.0 8548.0 Telegraph T1tgrallhIlegraphTelegraphTho T1tgrallhIT1tgrallhThltIlegraphThe22991.0 ThoThlt7448.0 23004.0 probability IrohnhllltprolabllityInla22999.0 thllt8564.0 tWrt9984.0 luhe9884.0 beIn 10160.0 luIn hein 23216.0 23223.0 neighborhood lIlhhborhooc1nelghborhoodMlxt sixteen il 23260.0 9216.0 tfm enndldates 9676.0 ulldlenndlulldlr1af 23291.0 23443.0 dates6860.0 r1af 23500.0 23492.0 ur 23451.0 sheriff lihfrllT23464.0 III8600.0 thin thisthl minity roultty8812.0 Ullllt 9652.0 tltIthenext 10156.0 tltIIltxt 23651.0 Iltxt23679.0 election INtlol1eleettouJest JimtJUlIlwb23707.0 23668.0 thlllthis8968.0 particu Imrtlcupnrtlruparticular pnrtlrular10100.0 23735.0 Ilar 23887.0 lar olllce olllrlollle23899.0 ihoultl hou1dshoalI8508.0 23935.0 flOsoJUllrhwuxlit s4nukhtwuxlitafter -540.0 s4nukhtafter 9792.0 23924.0 9996.0 ht htnttlr 24112.0 nttlrqunrulry fJunruln24164.0 quo -672.0 8388.0 adry 24120.0 Ihp9008.0 Sui SU lanll24115.0 IWIIbeenInformed IWIIluforuwd beenIn 24332.0 Informed luforuwdformed-736.0 24383.0 tmUltnar8412.0 24343.0 lio 110ho9048.0 24335.0 9324.0 hate 9700.0 IIhlheldtne heldtoo IIhltnn 24519.0 24607.0 too tnetnnportion IJltlontueitlomtlmt7888.0 tIll thr 8636.0 24603.0 24611.0 tSII 9316.0 9716.0 24555.0 Inudltnorhmuchremuneration InudlrfIIlUltration tnorhrernunration 24784.0 remuneration rfIIlUltrationrernunration24799.0 ftttpr8728.0 pnylnK Iorlng8556.0 24823.0 pn 9028.0 tIK deputies dejutledejutleand deputiesanl 9592.0 24787.0 Iutlt IutltlUll 6840.0 anllUll otherA 25051.0 01 bfr 25055.0 PtltIIIt PspensPspensJ1s 3060.0 25492.0 J1stlw25511.0 Republican npuiJlIhRNpnblleaaXatltmAl tiatlonalUulud Cot Censrn 9756.0 Censrntinn 9572.0 25523.0 AJQnft AJQnfttlon vn vntlon 25663.0 25751.0 tlon tinnx111bP25735.0 bId lHMbradJunJlJhtHtb 14tb14th9132.0 Itbl 9416.0 9540.0 Ibl 25719.0 prol prolhl 3192.0 25971.0 bl hl7168.0 tbatConnelm C4xltResS7680.0 25999.0 -644.0 8324.0 25955.0 foi btbe25991.0 adjoumH adjQunwlsdrnurnPdadjoumHthe -828.0 9864.0 25944.0 b10036.0 26200.0 26215.0 hJ 26236.0 RJUblwaaRPuhllcaa26183.0 Id IPadrre -452.0 8888.0 26207.0 rn brJun M MThat 10080.0 26187.0 ITbftl 26395.0 26419.0 That TbftlThatwouukf -400.0 wowkl otlld26448.0 26440.0 n26407.0 tbat26404.0 hw 9336.0 8952.0 flforxmlns:ns10 ID17 3852 3320 6808 26619 ns10:type 26639.0 tbPrHldPl1r PrestdPntPrwld 26663.0 iu 1468.0 rfromrrwodaUn rPrnrmrndatl4nerw -1464.0 26660.0 miwn JaU 26655.0 rrIiwillb rrIiire IIbe 3244.0 26803.0 26871.0 ire26864.0 enacted aacuductLd26911.0 tntl26851.0 law 8164.0 aa Ia26856.0 bat but9016.0 Spak4 26900.0 9112.0 mk 26875.0 26839.0 Can Cannonn sn snnoas nnoo 27071.0 27127.0 nonn noasnoo 7268.0 27087.0 plan fllan27083.0 otuifing utsslna8516.0 Inl 8764.0 27076.0 fJf rherb 27104.0 api aflrfJlr1a approprlaaflrfJlr1atlo approprlatknp-792.0 ropr1a ropr1atkw 27324.0 tkw tknptlo bllla billbills7052.0 7756.0 27303.0 aniltaen tyrnu 8536.0 27339.0 3ell going horn htJlJth4anlr9120.0 4111Allb AllA 4111b4 IIIbfiI 27531.0 27551.0 b4bfiI 6960.0 7104.0 27572.0 27535.0 dopt sdopi7184.0 7212.0 doptA lA 27951.0 27988.0 trw28003.0 28011.0 rare ao so27967.0 Ux 1Mttttel9300.0 27991.0 iopl IIO ofX ofM1aI 10016.0 Jf JfRI 28175.0 RI M1aI7900.0 28187.0 voted voiMlYcKe4oat oniouttb 28219.0 -108.0 9504.0 tits 9304.0 aalxxu aalxxuand JOI8 xyssxyssand JOI8lad ladublUh Ktabllhetrtah1h h4 8156.0 28411.0 1s28407.0 uaHry 4lapeafser7Olc ttwry 8844.0 Tb nmlTbAiitr ntAu mlIattsr 28623.0 Aiitr IattsrtAu 28683.0 28675.0 KMfto JttrlDlwetea28659.0 28635.0 hat batelea 8676.0 ptiarcwlprovefactorr rGMt eaaatla eaaatlafaetor7 U Uattorr 28839.0 28879.0 factorr attorrfaetor728863.0 00borr Pf 8128.0 T 28856.0 lot twfor8852.0 28847.0 teat tacIsatteattb w4 Atk tft 9708.0 uvot4rI taw tawvoters 29055.0 29115.0 voters vot4rIpal pat7324.0 29087.0 tier dt8 dap jwiiiry frrjwiiirycount NSnr7 Me odtof01nM 9628.0 9728.0 lane4M 29279.0 29347.0 nM ne4M7316.0 tJt4fcount tOUnteuaatr29335.0 29303.0 g4nx ln 29331.0 8860.0 tOfforb 29283.0 VUiiioJu VUiiioJub -904.0 -848.0 tiivithip tiivithipbj 29520.0 29543.0 bj 29571.0 29527.0 major maftmaJortj7172.0 29567.0 29531.0 7764.0 7800.0 29556.0 tx 7 i30264.0 30371.0 30435.0 xmlns:ns11 ID18 8468 3476 10464 1456 ns11:type 10844.0 XMAS 11504.0 IN 11384.0 11816.0 BONNIE 12660.0 MELROSE 12536.0 MELROSEA 13560.0 10488.0 10576.0 10808.0 Delightful 1908.0 Xmas Xmils11628.0 12204.0 12308.0 Trc Tre12312.0 Tree 12588.0 12624.0 12680.0 12840.0 Attended 13712.0 13588.0 byFine 13892.0 2076.0 Fine 10508.0 Program 11328.0 1376.0 ProgramOther 12180.0 2148.0 Other 12852.0 12996.0 Notes NotesMelroso 13448.0 Noteshose 10484.0 2264.0 10760.0 Melroso Ihot11012.0 hose 11416.0 11568.0 Poc nlChtc11996.0 L1 11852.0 12012.0 IThl 1The12060.0 Tho 12712.0 12800.0 shipments hlpnHntssiiilnnnts13740.0 oC13652.0 oforanges 13900.0 oCoraulS oforauries oranges oraulSorauries11316.0 11228.0 11784.0 Melrose ItItHWJlelrose12512.0 arl12856.0 ahollt12780.0 13396.0 finish 111118hfulsh13316.0 finishJed 13844.0 111118hed fulshed10480.0 Jed 10496.0 10880.0 fur11108.0 IIlSlnt11488.0 12388.0 tllt12212.0 12760.0 2864.0 12640.0 1lImhtIuumbtr13132.0 numberof uumbtrof10560.0 boxes 10716.0 11300.0 shipped shippotlshl1llltt12164.0 amounting amoulltlngannountlug12048.0 13172.0 13428.0 13320.0 10472.0 I2500 2501110696.0 500 10956.0 11676.0 11528.0 11936.0 whllh11832.0 12520.0 12408.0 12768.0 Coward Cowtml12616.0 hlpslip13388.0 slipped 13840.0 shipi 13596.0 hlplIed lIed ped10588.0 10612.0 10656.0 10940.0 1500 15lO10011732.0 11820.0 rest nst11624.0 12228.0 being bllng12772.0 12676.0 shIPII 13204.0 110111trouttroutindividual 13880.0 13500.0 fromindividual 110111Indlldunl individual Indlldunl11492.0 3748.0 partlls12288.0 Quite Qullt12064.0 12828.0 12736.0 13016.0 numbornumbl12912.0 13576.0 3812.0 13632.0 3780.0 ofJunoblooming 13888.0 ofJlIIllbloomlng ofJune 10548.0 Junoblooming JlIIllbloomlng11772.0 10996.0 blooming 10936.0 11924.0 fruit 11768.0 12724.0 tlll12568.0 13236.0 uu13628.0 tho13420.0 thotrees 13884.0 13784.0 thet 10552.0 trees treesj 10952.0 10616.0 4231.0 rtl10468.0 New 11172.0 arrivals nrrlmls11076.0 11916.0 11828.0 12068.0 12556.0 12980.0 thl12884.0 season f1asunseasonare 13868.0 f1asunill seasonart10544.0 artill 10800.0 10948.0 10676.0 10980.0 Williams 1tilliatns11988.0 wife wifowlr12428.0 13092.0 oC12940.0 13400.0 lintaOhio 13404.0 Lima linta13816.0 LimaI 13820.0 LImaOhlu 10464.0 4868.0 Ohluanti10920.0 Rev Re 12008.0 12120.0 12268.0 I12480.0 4895.0 Eck 12316.0 12896.0 oC12792.0 13168.0 4900.0 Chicago ChicagoI -660.0 13828.0 wbkb5107.0 11024.0 11452.0 11304.0 11708.0 11860.0 forerunner forerunn11608.0 12704.0 12908.0 13220.0 quite qulto13072.0 13776.0 ahouse 13864.0 3000.0 10540.0 house hOll 11004.0 10928.0 5384.0 11140.0 5355.0 party 10976.0 11680.0 11556.0 11956.0 Bay 11840.0 View 12272.0 12932.0 cottage cottagl12812.0 cottageMr cottaglMr13540.0 5556.0 11092.0 11220.0 K E11224.0 11636.0 Mullen hlllen11424.0 12188.0 turnld13368.0 froma 13860.0 10528.0 5812.0 10736.0 visit Islt5807.0 11080.0 11464.0 Tampa rampa12280.0 Hot HojIles12020.0 12696.0 nlRnyfrlll1lls13160.0 friendsregret -584.0 10532.0 regret rlgr 11032.0 10884.0 10872.0 6019.0 11136.0 11288.0 ll 11640.0 11740.0 Ihr11604.0 12096.0 6028.0 12344.0 such 12236.0 poor 12716.0 13288.0 healthRev 13192.0 health 13800.0 healthHev hl 13432.0 10712.0 HevHo 6236.0 Kck lckEck10924.0 6252.0 12036.0 hold bold11908.0 12504.0 services 12372.0 13308.0 nt13188.0 thotl1l13464.0 thoLutheran 13848.0 theLutheran 13796.0 6311.0 13924.0 ILuth Lutheran Luth -764.0 11296.0 rnn 10904.0 11404.0 6468.0 church churdlIIlXt12528.0 Sunday Sunda12412.0 SundayAmong 13156.0 13064.0 13916.0 13124.0 10704.0 Among 11408.0 thoso11292.0 thU 11844.0 11764.0 11664.0 Ihr12420.0 6719.0 12764.0 13144.0 holldajs holldasholldajsare holida 13772.0 6771.0 sare art10724.0 10768.0 10900.0 Miss lIssMinnie lInnll11276.0 12100.0 Lee 11968.0 Lt 12544.0 Hartrldge HlrtrJdgellartrldge12240.0 LeoLeoC LeeeleeC13792.0 13912.0 10516.0 e7143.0 P 10620.0 11096.0 Huffman HulTman10912.0 Mrs11808.0 12484.0 7179.0 12776.0 Osteen Osteon12552.0 13528.0 13344.0 andCalo andCale 13908.0 Call CaloCale11008.0 rank FrarikTnlk10864.0 11648.0 11512.0 12040.0 Had Hatland12608.0 Yearwood tnrwoodl1tarwoodStet 13356.0 Stetson 13788.0 son teeLeo10776.0 11340.0 11620.0 Morris MorrliMorrisMiss 12168.0 MorrisMtss 113Mtss11260.0 Flora FlomlorllH11712.0 12644.0 7851.0 13100.0 returnedfrom 11396.0 8055.0 pleasant plcumnt8080.0 ot12652.0 13216.0 several severnl13004.0 severalmonths severnlmonthH monthH11196.0 11652.0 Crlnds12320.0 8295.0 8303.0 12456.0 Savanhuh 13260.0 Savan 13768.0 Savannah Savannuh 8383.0 10500.0 nah nuhhuh10908.0 10788.0 11324.0 JackHollllh11200.0 JacksonvilleHov JackHollllhHlVJacksonvilleRev12364.0 3128.0 10680.0 HovHlV11308.0 Hedrlck HtdrlckHedrick11632.0 12668.0 8763.0 preached 12496.0 prta 13392.0 lltt 13076.0 13564.0 hiS hulhulfirst 13808.0 hiSfirt hisfirst firtsermon sl sermoq 11048.0 11100.0 rUlo 11616.0 nt11856.0 Trinity 12532.0 churrh12444.0 13180.0 ll1113088.0 13456.0 13756.0 day evening 9223.0 tln -656.0 11592.0 Ing 11752.0 9207.0 12044.0 11904.0 12392.0 appreciative appreclnttre-1016.0 13412.0 12500.0 pprl 12472.0 12864.0 9244.0 12968.0 13120.0 9251.0 auaudience ant anIlIlnlp anlien dience IlIlnlplien -532.0 11344.0 9419.0 10824.0 Hodrick IIttrlck11572.0 lcdrick 12004.0 replaces rllllncts13536.0 MrHyatt 13608.0 IrH 10492.0 9631.0 Hyatt H att 11600.0 1Mtemporarily tfmporlrl111728.0 12972.0 lu in13244.0 9667.0 rhar 13324.0 13600.0 9719.0 9871.0 13856.0 11436.0 xmlns:ns12 ID19 7848 3668 10344 10068 ns12:type 10664.0 Wo Werlgret11540.0 hoar 11lI1Ihear11800.0 thnt13184.0 12976.0 13112.0 13296.0 10119.0 Loonu 10111iaontLoonuJackson 10111Jackun iaontJackson Jackson Jackun11256.0 10324.0 IN11124.0 11496.0 suffering HutrlrluJflulII10375.0 un12732.0 13164.0 abscess nbtltSSabscessIn nbtltSSluabscessluIn10748.0 till thothehead hoadIItn110551.0 She Shl12220.0 left lft12092.0 yesterday shrttny12488.0 13424.0 12752.0 10600.0 fortho forth tho10848.0 hospital 11144.0 pltt1 11040.0 10783.0 St 11796.0 Augustine AugutthH12084.0 10796.0 whore wlltrtwhere13104.0 whereher whoreher wlltrtht 10608.0 10652.0 10852.0 mnllY11000.0 rlludshopo bOlllhope12024.0 she HIll12924.0 13480.0 find t1ucItimid13348.0 timidspeedy 13484.0 findspeedy t1ucIrtIIlC speedy relief rtIIlCreliefThe 11564.0 reliefrhe 11444.0 rhe The11447.0 Chrhtmastree tnl11892.0 tht12892.0 12984.0 hall 13376.0 halllast hallla 11672.0 10756.0 10700.0 10592.0 10860.0 night IIlght11716.0 11284.0 11824.0 11720.0 12128.0 11688.0 unqualified unquallthdsuccess NUCl8R13040.0 successIn NUCl8RIn10740.0 10596.0 l1lr 11336.0 way 11940.0 11944.0 11544.0 12260.0 12860.0 11951.0 WON was12708.0 nlfrneverso nlfrso10448.0 12132.0 tastefully 12140.0 tn hCulh decorated dl1coratddecoratelnndtho12904.0 13408.0 tnttreewith tntI 13688.0 12292.0 12348.0 10384.0 11112.0 11792.0 gifts KlrtRcandles candll812156.0 nnd13444.0 Hilt glitgilt13332.0 glittering HilttrlnK gilttering 12439.0 10440.0 12579.0 tering trlnKornaments presented 11rl8ntl13008.0 12628.0 12888.0 teautifurl 13208.0 beauti teauti13704.0 beautiful IJl uU uUful 13724.0 12667.0 12799.0 ful furl10784.0 sight 11456.0 12848.0 wn8way12784.0 crowded cruwddtotne totile totime 10436.0 13031.0 tile tnetime10828.0 10692.0 doors even etnHtnnclllJ13340.0 13080.0 room 13200.0 roombeing 13752.0 roombllng 10432.0 bllng13295.0 11448.0 13264.0 premium promlulJlprorulutn11332.0 HevHuv12900.0 12740.0 IISIs SlaHIH13304.0 Slatrunk HIHtrunk SIstrunk trunk called call1d10876.0 12076.0 tuIlIlnco12964.0 13516.0 13499.0 ordlr13116.0 orderand ordlrnnd nndprogram Ilrogram11964.0 12880.0 13755.0 W812756.0 13300.0 finely fhwlyfinelyrendered fhwlyrendtrtd rendered rendtrtdrenderedSong 11152.0 rendtrtdSOIl SongPrayer 10604.0 Song SOIl SOIlPra 10892.0 Prayer PrayerResponsive 11160.0 Pra PrayerRespmtsive 14419.0 rHtlIIOlltlll 14612.0 Responsive HtlIIOlltlllRespmtsivereading IlRltll1grending11536.0 readingRecitation IlRltll1gRlcltatlon rendingRecitation Recitation Rlcltatlon14840.0 Glad GJnd12276.0 TldlngH 12116.0 rlcllnJtIHtliRI hlgsBesserlcllnJtIHtliRIPrice -1304.0 13620.0 rid 12580.0 hlgsBessePrice Hesslc HesslcPrice Price PriceRecitation ItHlcltatloll 13568.0 15072.0 MRecitation Hlcltatlolllifts Olfta01ttli11432.0 JllvlnwNannie JllvlnwNanniePrice -1452.0 fIvlrt 13128.0 Nannie NanniePrice PriceReciUltmu 10396.0 PrrpPrrpHfltn ReciUltmuHfltn 11412.0 15747.0 1011 Let Jpthi hells MellsnI112248.0 King U13056.0 tug IIJOut OmitOutTheir OutThllr OmitTheir Their Thllr15959.0 Joy lay10836.0 oyn Neva Husband lIushllldMela Ida Idnflirt WrtHlrtWrtSong 13640.0 HlrtSongIIrry flirtSongMurry 16183.0 SongIIrry SongMurry-1196.0 Merry 10960.0 11868.0 XIIWHXmlls12440.0 16188.0 Helix 11t1lhellsHelixHocltatloii 11t1lHpeltIlUon hellsRcltntioltIfts 12748.0 Hocltatloii HpeltIlUonRcltntioltIfts -844.0 11704.0 16428.0 16411.0 Ilftx lCtIl12224.0 16423.0 thl16416.0 KingKooltatlou KingRecltntlouFor 12916.0 13024.0 IUJ IUJHtcltntlouIor 13224.0 Kooltatlou HtcltntlouIor RecltntlouFor11400.0 16640.0 11992.0 theChrist ChrhtChrINt12404.0 13252.0 Child ChildSake 13680.0 ChildSakI 13384.0 Iii IdSake 16819.0 Sake SakISakeSong IYour ISong1Vave Song1Vave -408.0 11240.0 Wave 17084.0 Your 12324.0 Branches JlrnnrhtoIilrnnrhes12208.0 BranchesKooltutlon 13084.0 ilrnnrhesteritationihe 13744.0 17160.0 17307.0 Kooltutlon 1IrftatlollTlw teritationihe11392.0 XIIHIH Xlllntlrnns 17315.0 Siients OIIlI4tollu4stsOIIlI4tolHrltnt lu4stsRrltntlnnItlug SiientsIrritation 13996.0 17532.0 Irritation Hrltnt RrltntlnnItlug 11116.0 11156.0 17535.0 101 11696.0 Ring 12176.0 11960.0 thll12468.0 Helln 1111IIelIs17539.0 fur CurfurXnmn 13672.0 17648.0 17756.0 XmoloWInllln Xnms11enlthiy10348.0 17759.0 Xnmn 11812.0 Wealthy 10816.0 1it Yoarwood YlIrwuoti12200.0 12232.0 rwood 12720.0 xmlns:ns13 ID20 8512 3392 10296 17979 ns13:type 10536.0 17979.0 17984.0 HcltntlolDorothyB UolothyIkrothys11376.0 12516.0 XIIIUH XIIII1HX11111517987.0 lift mttItmttTtfM liftTereHa 13212.0 ItTeresa 18208.0 18211.0 Teresa TereHaTtfM860.0 Yoarwond Inlwood18itcuatlVYoarwondAn 18itcuatlVAn-860.0 -856.0 InlwoodAn 3116.0 18431.0 18436.0 An 10840.0 18467.0 u114cld 924.0 unexperted 11128.0 11880.0 18444.0 treat tnat12368.0 18464.0 12416.0 va CHI announced 1111110111111nnaallnrPdannouncedfor 1111110111111ornnaallnrPdfor-884.0 13648.0 18651.0 18663.0 18692.0 Wednesday 1VodndsQny18656.0 tIIIIIIIIIII 11644.0 I1I 12192.0 namely 11111111118684.0 18659.0 fire nnfireworks nnworkK fir 13572.0 firworks 18728.0 18875.0 18880.0 works workKdisplay IIIMplllrfurnlHhed fllrlllKl1tlIfur111slted12572.0 lty12872.0 thothllkind kilHIklldkindIIOHH kilHIIWllli klldmieys 19100.0 19139.0 IIOHH IWlllimieys19108.0 1l11500.0 19103.0 Poaraall Itl1r1I11748.0 trsall 12540.0 WeHtflold tiltfplil1VestlhId12692.0 WeHtfloldN 1VestlhIdN-772.0 tiltfplilJ tiltfplilSea 19332.0 19335.0 19772.0 Sea Bea11588.0 Island 1IAndCotton 12080.0 CottonSavannah CottonSII CottonSovonnmih 20027.0 Sovonnmih20040.0 11312.0 20067.0 0111111 11232.0 20035.0 Ja iu20071.0 11668.0 11872.0 Deeoujber 1I11IIIHr Ieeeuher12688.0 5M 2420031.0 2tJIn 12948.0 Early KarlyKarlyIn EarlyIn11In 13532.0 20255.0 20260.0 thfweek WfHk10944.0 weektinre tinrethlorl20279.0 wart wan20288.0 wn 12956.0 IIItgooddemand 20291.0 gigs gigsdemand 20407.0 20480.0 20483.0 demand dfrnalllJfancy fanrytUIU ulIllmildtilrchit12400.0 domtmd IhllIltllIldeutanddomtmdfor IhllIltllIlfordeutandfor13624.0 20704.0 10644.0 20707.0 theollwrgrades gradex1111111111Fnney innrywan WUKwasfirm flrlllfirmand 13580.0 flrlllolld SI rum 13336.0 rumrtnd 10312.0 20927.0 olldrtnd20932.0 tin tilttheotlwr10968.0 Jrndtfi20955.0 4515 20960.0 iHy 20963.0 114 12604.0 hiltlimitquota rillfllugnotngnotndons quotatlotiH rillfllutlonM 21144.0 dons tlotiHtlonM21155.0 remained rtJllllluf11remnhud21147.0 practically prartlnlly11584.0 21188.0 Ilr -880.0 Ithnlly unchanged 1IfUlmllgcIJunchangedLatterly 1IfUlmllgcIJInttrrl unchangedLntlerly 21376.0 Latterly InttrrlLntlerly11120.0 thlthomarket IIInrkltnaarkrt11372.0 21407.0 WfMwitsquiet Iulllt12564.0 ltllthat13136.0 butfancy ltlltrUIIC hatharry 21599.0 harryrUIIC 21611.0 IM11164.0 MUll21607.0 IIIrciucni n4lutMt11760.0 11111112508.0 vi 21640.0 C21635.0 rMont ryniriirt ryscore 21823.0 21863.0 score iriirt11072.0 21831.0 Mont IOJIltlost11552.0 uCtillMale 141111101sales21859.0 nrtnre21828.0 forearn forarcoiinlH orflhn 22056.0 earn flhnarcoiinlH nrraunts22084.0 fatOlln 11368.0 tH 22051.0 American IIIIrlcllIl22048.0 mill cnlils13096.0 13232.0 havebe 13612.0 lun lunIIIflI haveteen 22267.0 22275.0 IIIflI teen22315.0 22311.0 slot nlow22271.0 10932.0 IIIlulining filling11548.0 nllhl thilr 1IIfIrth4Ir12108.0 require nflrrequiremetiLH nflrnlflItJ4 requiremeats 22492.0 meats metiLHnlflItJ422500.0 owlIII11460.0 mainly IIIulnlnutinly12112.0 22511.0 Ifl12016.0 12340.0 hIthe22495.0 iHTHlMtcnre IIIrHIHttlIrepersistenr422712.0 22723.0 Ijironveiileiit Imirortveolont22715.0 fliiiinclal nllnlwlllifimiauciittIcondltloiiM flllltlollMondlIonH12476.0 condltloiiMMeanwhile ondlIonHM4nnwhlle flllltlollMlfIUlwhllf 22939.0 22943.0 Meanwhile lfIUlwhllfM4nnwhlle22947.0 till11212.0 small HlllulliroKirtloti JlruJlnrthmproKSrtlon13272.0 ofbkb 13604.0 of1I11h ofhigh 23164.0 23172.0 high bkb1I11hcnuleM KrarflMgrarloMIKIxlm hlIubIng12184.0 rapidly rttilltll12072.0 depleted depletedThe depletedrhe13548.0 23167.0 de IJIttlfl 23387.0 23395.0 rhe10792.0 fulla followliiK fullllwlllll11272.0 23399.0 23427.0 prices Irtras23423.0 urn 1Lrf12304.0 12820.0 bused banedIUIIdfJlIonfactor fJlIfuorlll ontartars 13684.0 23519.0 23616.0 23627.0 factor fuorllltartars23624.0 quotation gnatltIntl11084.0 23635.0 fIIotll 11011 11520.0 5acid ntidulIll23647.0 rar 12836.0 13000.0 revised rfIMI11revlsedrevlsedweVkly revisedweekly rfIMI11wIfklr 23839.0 23843.0 weekly wIfklrweVkly23875.0 nil11268.0 frliiu IrlliuIrlliuIt Irhius 24059.0 24103.0 24063.0 1lorlIllarllas2J w2lftao itcOr12 24283.0 10580.0 24288.0 GffrJr leorgicts10684.0 ZS 24291.0 13152.0 j24503.0 24515.0 rjiolr dlfJlrtchuirc11348.0 24551.0 OorKni ntonhlerglas12700.0 24511.0 21 I12844.0 13140.0 2f 13196.0 24727.0 24735.0 Ou 24776.0 24767.0 aS tutlJ24763.0 tutu Flax FlnKw12052.0 24947.0 24999.0 24971.0 flat flnonil 24963.0 rjnM Gn4rns24991.0 nn 24955.0 Hiid ttltll11848.0 11976.0 Plax PIIIFIstx17 Ii13068.0 24952.0 fIS i124960.0 I8 B25171.0 25192.0 On1 On25219.0 11216.0 25183.0 twit nnAaolKlnu PhxIiuxJr JrouunfJU 25244.0 25399.0 25407.0 non rarenO 11428.0 mid Alldsurd25404.0 F FUtx tnw12088.0 11tr If25412.0 C4Zfthnv -20.0 15T SrKU 25459.0 25887.0 25903.0 rKU 25895.0 Irr lark 25900.0 inuring tourlral11252.0 25923.0 rur rnrM25891.0 hnv Icnttan lM 12868.0 ttClI h4nttClIf h4nd13492.0 26112.0 26179.0 26127.0 26131.0 IT hr26120.0 t14fli Ti 26115.0 rAI1 rn1a1a12196.0 Hay 1lxyHotel lIutelIlotcl13352.0 Corfar26335.0 26360.0 126391.0 10764.0 ur26343.0 rIhe IIlf1h426355.0 UItJl IIlrMle12028.0 KUe tM xmlns:ns14 ID21 2924 3408 10188 26779 ns14:type 26779.0 26795.0 THE1408.0 AlAUA ALAMUA12384.0 26784.0 IG 0ALACH 0ALACHUA 27623.0 ALACHUA 27627.0 ALACH UA 11580.0 FLORIDA FLOPIDAFLORIDAj FLOPIDAtFLORIDAIe27843.0 28167.0 28184.0 Ie11104.0 flowflewReady Rudy12632.0 Take TakiTlkoTakiMeats 13048.0 TakeMeats 28531.0 28535.0 Meats 28615.0 11756.0 Cold 12492.0 Storage 12284.0 StorageMeats StorageMelts29291.0 MeltsHandled HandltdB nest aut12928.0 29339.0 Cars CroCaroCroby Caroby Carsby 29515.0 experienced ExperlncedCxperlencedMan Mlnxmlns:ns15 ID25 16548 4168 13936 1308 ns15:type 14280.0 16256.0 14324.0 laXpress 16316.0 17936.0 2260.0 15480.0 O 17951.0 15096.0 13936.0 4975.0 14720.0 Full 15028.0 15952.0 Qts 15776.0 17716.0 rrexpress 18104.0 15848.0 7820.0 14712.0 7916.0 express ixpressaXpress15671.0 Prepaid 15552.0 Prepaidfhis PrepaidfhiPrepaidIbis16479.0 Ibis fhisfhi15064.0 8631.0 14976.0 highgrade hiJthgrad15184.0 16168.0 corntver 16652.0 cop 8835.0 tver Jerpcr14952.0 distilled diHtilled8807.0 15596.0 15200.0 til1l 15040.0 8816.0 15556.0 15732.0 Rye 15592.0 16064.0 15984.0 15860.0 Whis VhltJVhtsWhiskey 16584.0 16244.0 VhltJklY Vhtskty 16580.0 16591.0 14608.0 key klYkty15008.0 14912.0 15280.0 absolute absolutuIb 15972.0 15560.0 oluto 15472.0 16072.0 9003.0 purity puritynpred 16572.0 purityllge purityaged 9163.0 aged npredllge 14996.0 9215.0 14956.0 14944.0 15128.0 15444.0 wood 16080.0 mellow mellowand 16644.0 9347.0 14968.0 14896.0 15208.0 15140.0 tiCo iipo15256.0 15500.0 15420.0 15400.0 flavor ttuvnr16308.0 16520.0 16456.0 ispositively 16648.0 Ispo8ltivel positively po8ltivel15484.0 the15408.0 15816.0 bestvaluo 15740.0 15819.0 best bc 16164.0 16104.0 16003.0 16208.0 valuovaluelor valuofor 18056.0 14600.0 9703.0 lorthe14856.0 15384.0 9747.0 mOnlY16075.0 9752.0 15920.0 16392.0 9711.0 thu16259.0 thomarket thumarket 9879.0 today tooaytodayCUUNmO 15720.0 tooayIUWTD todayIAIANiUDUNDRPUREfOODMi CUUNmO IUWTDIAIANiUDUNDRPUREfOODMi 15316.0 15372.0 UNDER UMDR-1268.0 15764.0 P01E PUlE16096.0 FOOD rOOD16052.0 16420.0 AH1 ANI16376.0 AH1NBC ANIlUG 17748.0 R RBklG 17856.0 NBC lUGBklGVT 15152.0 15428.0 15368.0 UN15540.0 DI 15748.0 15812.0 10383.0 SB 383I15676.0 16084.0 UBS 1101IVUUBSWo 16356.0 1101We IVUWe 14715.0 WohIpJlrwjt drrot15264.0 1J1 15696.0 15648.0 15424.0 15908.0 conMtmcn tOntlmOTSroneumort15872.0 conMtmcnand 16600.0 tOntlmOTSand roneumortand 16596.0 14580.0 14928.0 thu thui15303.0 10752.0 Kivo givo15220.0 Ivo 15656.0 automero CItomerlcuilonters15891.0 CItomerlthe cuilontersthe-668.0 15980.0 automerothe 2016.0 bonont bonuflt14808.0 15232.0 15364.0 15476.0 ot15724.0 15616.0 10915.0 15940.0 retailers retallra16111.0 retallrapront retailersprofit 16192.0 Ull 16476.0 10923.0 ra raprofit profit pront15136.0 Eory l1I1J14992.0 Iti 15528.0 15352.0 11047.0 iry 15288.0 botllelmnuirmn IflllIlluaranbotllelmnuirmntetd bot boatlela 15768.0 15852.0 IflllIlluarantoed 15828.0 16120.0 11052.0 Ruarsn Ruarsntotl 14576.0 11135.0 toed tetdtotl14984.0 11148.0 14860.0 RVO ahoRho15112.0 15600.0 11155.0 nlInfection IQllIraetlonsnttafacUon16500.0 orourmonoy or7ourmonClY orrourmoney 14568.0 ourmonoy 7ourmonClYrourmoney15432.0 bo15988.0 11287.0 refunded ItutoJ15896.0 ItutoJWrito refunSnt 14564.0 Writo Vrito15020.0 forromplota romplalOcomplota15228.0 16008.0 11419.0 nrlca LlncaGdce15912.0 16432.0 lilt lUtlist16344.0 lUtand liltand listand 14556.0 11532.0 crier14792.0 11576.0 15204.0 15248.0 blank blankiblankI 15684.0 blankQt 14560.0 11747.0 IQtt Ots14644.0 Qt p25 14876.0 11755.0 125 15460.0 12 15884.0 OltQts15804.0 16248.0 900 tMS0016156.0 S00AISAlpmne 16331.0 900In tMAll SAlpmcnt AISAlpmne15092.0 12075.0 MaJ AradMaJn AradIn12251.0 15172.0 Plain 15664.0 Cam 15604.0 CamA Ca CaIff CapM pM 14816.0 Iff in14776.0 15000.0 Cal1IC ult14948.0 15344.0 fro 15436.0 froA reA 15523.0 14552.0 12728.0 14768.0 12731.0 SAMUELS SAMUEISSAMUELSCO SAMUEISco13039.0 COClilliMjja COattaDO02a 17760.0 15260.0 13439.0 ClilliMjja attaDO02aClattafloogaClilliMjjaIllHUII -872.0 ClattafloogaTsauusos 14788.0 13452.0 attaDO02aTIItSS 13711.0 IllHUII TIItSSTsauusos17832.0 14116.0 16032.0 15488.0 16004.0 V1 VM 15936.0 VMwjjj 1996.0 15832.0 16067.0 wjjj wjjjAiutuasi 16532.0 Aiutuasi 3776.0 13984.0 17279.0 17700.0 17723.0 14304.0 xmlns:ns16 ID34 12944 4680 13724 17963 ns16:type 17727.0 17963.0 aNotice 14536.0 18131.0 Notice Nollcc15168.0 18147.0 15060.0 18136.0 Tax TJ1P 18139.0 Payeri Payera15904.0 PayeriWo 16364.0 16012.0 18172.0 yer yerU 16288.0 18203.0 fl 17736.0 13988.0 18387.0 14164.0 14248.0 18392.0 14192.0 III14660.0 15076.0 18411.0 litnt14964.0 15224.0 Ihl18447.0 15608.0 18400.0 fnllowlng 1IIInwlIufallolIcg16616.0 18403.0 plaoonon flilloolnnpladxalton16508.0 16620.0 plaoon flilloolpladxalt17143.0 18612.0 18648.0 nn14088.0 dates Ilutlli13972.0 18632.0 set KetHlt14528.0 18624.0 ippoHltn IIJlIIOIlItIfappasita14972.0 15668.0 15780.0 18627.0 15004.0 thotllt16488.0 purpoiMi IlIIrpoltOptlrpotso16371.0 purpoiMiof IlIIrpoltOufptlrpotsoart18836.0 18839.0 ufart14020.0 colleetliiK culhtlucollecllttg14920.0 18855.0 taWHLILeH14836.0 18844.0 din Ihllldart18883.0 15712.0 18863.0 tux laxroll ruU16328.0 16775.0 10011130716692.0 1907and 1001unll 11307and 19059.0 unll14232.0 snaking14072.0 14336.0 mklrl 14848.0 19079.0 aiiseMsmunt IUUUHmuntasseasnnant14732.0 16100.0 19075.0 19111.0 16264.0 19087.0 property Irocrtrpropertyfor Irocrtrfor17132.0 19283.0 19288.0 tHIN HMH19usHMHAlachua 14495.0 19usAlachuailoudny 14200.0 14244.0 tHINAlncllllllMuutJny 13968.0 19503.0 AlncllllllMuutJny Alachuailoudny19511.0 19547.0 II19552.0 111III15760.0 19516.0 11111116068.0 16672.0 19519.0 Tue 16548.0 Tueday 16984.0 Tu Tudu 19728.0 du 14064.0 14236.0 19736.0 DIJC Uoc14276.0 14456.0 19767.0 14696.0 19731.0 nodi Itll10th15148.0 UIIII15032.0 19743.0 Gist 15448.0 lHt UHt15880.0 1H07 1I0119071H07Wllleford 16407.0 1I01lIhfortltulnuMllu 17632.0 19783.0 tl1tiIllefordt 17704.0 19952.0 Wllleford 1tiIllefordt1652.0 14156.0 lIhfortltulnuMllu 14744.0 WednoHday ediaokdlay15808.0 19963.0 January Juuunry16840.0 19971.0 liltlet16732.0 lotIMIK 17076.0 liltI1II1H let19i 20183.0 IMIK I1II1HIMIKMoll 14124.0 I1II1HJlullThllrtulny 19i 20188.0 14024.0 1lollIhnrsday 14120.0 20400.0 Moll JlullThllrtulny lollIhnrsday14480.0 Thurmlny nllilamid20403.0 Friday hrlday20412.0 16460.0 ItJ 20451.0 16663.0 Junumy 16668.0 Jiurn JnlluJunu17064.0 Jiurnary JnlluAry 20627.0 20660.0 ary my2nd 14032.0 14252.0 llIf 14436.0 20632.0 lIIJ lrtl Irdard1casAreher 15404.0 100H 1cas100HAr 20635.0 15512.0 JIJH JIJHArcolltrlulllhL 20847.0 20855.0 ArcolltrlulllhL 14148.0 Areher -1316.0 15272.0 14520.0 14728.0 20852.0 Monilay14524.0 15520.0 JanunryJnnunry15380.0 16312.0 Cth GtllGth16196.0 16728.0 tD01i1001116560.0 1908Newberry 17060.0 20859.0 tD01iIwtltrryfufHln 10011NewberryIueMdny 17056.0 13952.0 21071.0 Newberry 13960.0 IwtltrryfufHln NewberryIueMdny14772.0 Tuenday 21079.0 Alld21076.0 WChICHln 1VadneslayWChICHlnJlLuuar -948.0 17048.0 1VadneslayJanuary 16952.0 16384.0 21084.0 dnoMday dnoMdayJanuary 17052.0 17828.0 21120.0 13760.0 21291.0 JlLuuar 14424.0 14540.0 21296.0 7th 14892.0 21299.0 lIlJ8th tithhth15180.0 21307.0 1HOH ItlflLitIUW15544.0 1HOHTrenton ItlflLIrllntou 16044.0 itIUWIrntonihnrrdny 21516.0 Trenton Irllntou21519.0 Irntonihnrrdny -632.0 14812.0 ThllrJllny15888.0 21527.0 Jt1l1l1nryJnnunry16804.0 Otli Otb0th16568.0 OtbIOOH 21743.0 IOOH100s100s1VtlcoxVrldny 14096.0 1908Wllc 21960.0 Wllc WIIu1VtlcoxVrldny 14420.0 14384.0 22004.0 ix 15267.0 14724.0 21963.0 14508.0 21968.0 Irllln 15416.0 21971.0 JIlIInrylath 10thOth16092.0 21976.0 1008Ifnkuel 16716.0 1DOH DOH100817044.0 1DOHHa 16796.0 DOH1Inl0 16764.0 22183.0 22191.0 Ha 1Inl0 Ifnkuel 22219.0 ie Murilluy14760.0 fandayinnnrtry -568.0 15328.0 15451.0 22195.0 16128.0 22227.0 uHlry Kith Iltlllth16720.0 22200.0 190816564.0 1908Mlartd 1008HlnrtdrufJtllltty 1008lllnltt1ruuslay 22379.0 22412.0 Mlartd HlnrtdrufJtllltty lllnltt1ruuslay22415.0 TuoMtluy 22420.0 JU1IlBty22407.0 Hth loth22423.0 14 16412.0 16380.0 1008JjiCroHiio 1008InCqHHlt 1008LaCllpssoWednesday 13944.0 22575.0 LaCllpssoWednesday 13948.0 22635.0 JjiCroHiio InCqHHlt-1940.0 22632.0 WediMfuday 22640.0 IIIJrIC1Iuln 22643.0 Rud15784.0 16536.0 Thura Thurn16360.0 Thurnday 16540.0 Thuradny rhu rhufILY 16868.0 13748.0 22855.0 22859.0 dnyfILYJnnuaryJnnunryiCth lGth111h22864.0 Rnd10th Irthlfth100R1001116108.0 1008Waldo 16608.0 100RWuJcJuorlduy 10011WaldoFriday 23079.0 Waldo WuJcJuorlduy WaldoFriday14468.0 14664.0 23084.0 15216.0 15376.0 23087.0 Janunry16184.0 23092.0 10081008Hochollif 1908HnchfIIIt 1908ftach4rllIr 23303.0 Hochollif HnchfIIItftach4rllIr23311.0 14936.0 foflcJf JnfllluryJanauary16696.0 23319.0 20t 16468.0 20t1DOS 16699.0 23307.0 20tli 20tla20tli190H 23531.0 190H 190141DOS1DOScaanpvllluruisdny 190HCnmpvlUo 19014CAIIIIvfIJTufUulny 3136.0 23751.0 CnmpvlUo CAIIIIvfIJTufUulny caanpvllluruisdny23756.0 Tuomlay 23759.0 JIUlunry2ht 21st16880.0 2htl 21st1eus 16988.0 23763.0 tJJUS 23979.0 JJUS 1eusJJUSOrango 14084.0 1eusOrange 23983.0 UK UKOmrlK 24200.0 Orange OrangoOmrlKlioliht UIylttltWodnfJIlday heightsWodnasdayWodnonday -976.0 16496.0 24208.0 Jan JoriJoritry 16944.0 Janir Jane JaneMulrusoThursday 17107.0 24427.0 24456.0 try 24459.0 ir 22nd 14311.0 14500.0 14700.0 24431.0 190M14440.0 190HM 190MMeJrolThunday 3180.0 24647.0 MeJrolThunday MulrusoThursday14048.0 24683.0 irotii -1460.0 15580.0 24652.0 24655.0 JADUI1Tr24663.0 23rd1iJOS 16512.0 23ruX 23rd123ruX1DO 17103.0 23rt 23rtI 17000.0 24867.0 1DO iJOS24875.0 14080.0 iJOSlIawtbornrrlday OJC OJClIawtbornPrlt1nr 25095.0 Hawthorn lIawtbornPrlt1nr lIawtbornrrlday14764.0 25099.0 15743.0 25103.0 cuduud16280.0 25107.0 SaturdayJanuary Saturday Snturd SnturdJUlillary 16847.0 JUlillary14516.0 25324.0 21th 14404.0 25332.0 nnd15068.0 Illf 15252.0 26th 2rth190111008Mlcanopy 16220.0 19011111canopy 25335.0 08 08Mlcunuly Mlcanopy Mlcunuly111canopyTumldy luasday14924.0 25551.0 Tuo 15640.0 15332.0 25547.0 15236.0 15548.0 25583.0 JI1nul1ry25563.0 28th 16544.0 28thIvvlnnton 28thI1QH 28th1OS 25771.0 I1QH 1OS1OSlvlnsttn I1QHF Ivvlnnton lvlnsttn14656.0 lntlJn Wt1dn6tJduyWndnsday26011.0 Jl1uunryJanuary20th January2Dth 13732.0 20th 2Dth26223.0 1109faland 11091908I 14572.0 14348.0 26227.0 10S 14284.0 10SJaIuul faland lancl JaIuul14648.0 arojfo OrOloThundar GrcipThusdar15156.0 26451.0 26463.0 JanuarJanuary30th Januar30th 17008.0 30th 26675.0 f94A14068.0 f94Allhh 1908High 14352.0 l08 l08J 26891.0 High lIhllhh14320.0 14492.0 26895.0 HprlnK Hprlrii8vrlnlf1ufldny 15336.0 Tu4 TtiMday 15620.0 26955.0 sday 16212.0 16515.0 16424.0 r1 16680.0 26903.0 Wed WcJWadWednirtulay WcJnntlday 17848.0 26952.0 inesday 17888.0 27119.0 nirtulay nntldaynesday27123.0 olrunryPobruary15392.0 27135.0 4th 15492.0 15652.0 27139.0 amirlll 16060.0 16187.0 27131.0 6th 5th16436.0 lv6S 1vOblv6SWo 16968.0 IVWI 1vObWy 27335.0 WIWy14292.0 27351.0 earnestly earnontlyftarnolUy14184.0 27383.0 rwquom ruqtJoJltroquwt15932.0 27355.0 thlttaUall27391.0 prop prorprorert 27427.0 17031.0 27579.0 erty ert 27603.0 owners ownerJt14932.0 27583.0 avail 15564.0 15900.0 thojriolvov tholraolvt11 thelraelves-924.0 16824.0 ofthis ofthl ofths 13736.0 27787.0 ths14128.0 27803.0 opportunity oJlportunlty27812.0 or15132.0 paying 15688.0 ylrll 16132.0 27807.0 Ind27823.0 ruturaIn 16524.0 ruturareturnIng rtu rtuIn 14104.0 14616.0 taxM tAxutaxw28031.0 15052.0 ud ththrtby roby urhy28063.0 RUVO sava28071.0 16739.0 vo tbothotbotime thotlmo thetime 28247.0 tlmoDnd14704.0 28287.0 arpenwe 14748.0 28291.0 aprm 28295.0 ro 15680.0 28311.0 15632.0 28259.0 iulrod Hlrudlairud15716.0 28272.0 16660.0 makomakea 17116.0 makotrip 28507.0 13824.0 28479.0 14628.0 28476.0 tho14512.0 28499.0 court hou hQuhouYoun hQuY hnuae hnuaeYours 14208.0 28699.0 Yours Youn14340.0 28735.0 Dun 28719.0 28739.0 servo Hftrro15516.0 15628.0 faithfully althfullyfaithfullyW althfullyW28923.0 15308.0 28936.0 D a15116.0 15464.0 15360.0 28939.0 28927.0 DICKIN8OV UrCKIN80NiICKINSONDICKIN8OVTnx UrCKIN80NTlxiICKINSONTax16704.0 29155.0 29159.0 TnxTlxCollector CollectorWILLIS 29371.0 WILLIS 29379.0 29375.0 COLSON COL90K15927.0 COLSONTax COLSONTCOL90KS1180.0 15707.0 29607.0 29635.0 Auneasor Aeeasor16124.0 36110 14328.0 29743.0 S18312.0 30863.0 Fe



PAGE 1

1-11ATTENTIONFARMERSINVITEDSSSTITUTEi-CASTORAAREDOlTBIGYOUCODuttonGAINESVILLEPICKPOCKET-Isu-tCoeUortinerraCLBhNG-LawyersSWIFTADVERTISEMENTSDECEMBERBankADVERTISEMENTSCharlestonURESTJR-ATTOUNKVATLAWTheIATTOXtiIKSIrkIronltCAut14-nrFIKLWN-CSCliAUKHELDHEREADKINS-tomnilssloncrHcheckbookVOWER3-UliNTISTCommlHHlouorBBuugiil-BoaraCOMMISSIONERSliiatndltnINttalnINothingCoinmlHslonur-aAtietSIMMXCShrlrIUrrrrpll-MrroC1IUqulteirkEngineerCjastsofSurveyorrobberyClarkMeetingprnillNcGROCERIESFOOLHonorable-ecretaryyoultHARDWARENECKWEAR1JLCLOTHINGAlwjsINIHTItATOKHWAYAtUlllicillagainstreceiptnhtnlnochf-llIlIIpayingeconomyarrangementscongratulationsmoneyPeruvianquiredceAttendedIni-siiniiliitpplliiilliitl8INhSVHl-JJertlllnuteuenurkIComnilnnnners17131NnHSGAINESVILLETHEprotectattendantstJMondaysGenuineIlMMCATloS-LumInstituteNOTIONSAgricultureFtOKID-FUANKJptlntloHnle-ofprogressedJKM-fAMirllofHwdistinguished190TTILEDAMIIKU-CliuSPEAKERSCommlKsioneiopportunityuarflcularlyDiisivtinLEGALSUNagriculturalLocatedaroundculminationaccountlI11t1IATtONroriui-rCoiiiftliitCIIttW1ILii-AExperimentLEGALFederal-OnicesFAIRBANKSiKpnrtniontOpenGainesville-econventionalApicultureAgriculturediningroominformationIslandsUniversityproceededcontractingsuggestionPulmonarySHOESparticularsIMenberAgricultureaaccustomedWIKNfKS-MilIgivesHIGHWllMAMH-tiutninUtoHTERcomfortablestandpointeverythingAdmtaUtmtrlxdecorationslIkIOl01eremblematicgentlemaneverythingproportionWIUWUKSrieritwentyoneperformedCiuutl-ptrrhuserespeciallyIntelligentWIKNffiSrobligationshospitalityAIMMlATlDXTtlrAcWlzObdntaperformedAlIUCATIONinstituteapplyingIleaideuongentlemenGainesvilleInformationGainesvilleiunanimitycustomarynamcuf-InUnuvviiAefen494-itDontcontainingcltLIIK-NOTJiKdruggists1tillnier-yitulrfnvoratiloGOODSproceededAlongn-iwihTciKHstolenWEDDINGCIIINtIIAhappinessIhnturcltrdurGainesvilleGainesvilletruthfullycheckenntainliiKGainesvilleHAMPTONHarpphurnGuanoTogetheru-intssUuiersTOrespectiveiiiniXSecretaryHorehoundDecemberxaat-sllirt-1gnuttladdreHflodattendanceWuslihiR-DcheckChristmascompleteCompanyhelpattendantscreditnAMPifmholdinguMftH-KKUYCliiMrenInventionIHIHI-OiHoiFairbanksqutt1IheatFebruaryREIvliiiissiKsoilBankBronchitismarriagethoroughHrxnttfadfundsFLORIDAlUackwellChristmasconventionocrtllliMitoiiiHiTinentmercantileDoardmanTrustingenablingilimtdoirannoyanceNovemberFreshiiiincHViiiflolSwiibeeCongressWackwelV1INENTattractionInterestedHlaekwelltrs1uwadfrVrtihwrxWatitnti-iuriliiihacceptedHlaekwfllFairbanksevmNrutltl11speakersweddingdec-orationeveryAdmiefaUaDMALKKDecemberpartitionTWOteachannuLifWANTEDUlackwellnixingtrallyWlttstockELMSAtfimvniafternoonMttstockyourselfdescribedWANTEDDecembersubscribeInfantsCrematedCANNONrotixtioutpossibleFebruaryIJrekniantnjbHetuooin-Alachuameetinggrwrptllte-InblclmractirHaveimitationgracefulattendedv1it-Novninbtira-riQ1Stwrafternoonfarming4rceremonymeetingmeetingholdingPopularMutiiay-lineetluflcarrybeautifulelaborateAttentiiMiever-greensfollowingcarryJanuaryrrllholInlilitbrrrfurdyourJanuaryPracticeiandsointpleasantpositive271cceremonyitliilUiUlunflrtCrryDestinedTOsli-dIIprsPromptconvinceiimigededlngljrbeautifulyouryourcountiesrender-edbeautifulconditionUUUX1excellentAlachuaspreadsTwentyCarolinaBallardsBenefit-woNationalitltutlonAftcrthereceivedISTATiyourhallwayCHARGENClntobrpopularM-MXOTllltoQ1rKRntcon-nectedFnmlfSwlHATSMatkeyCarolinayour11100-4btallltenderedwhereinMlhUJItrrJohnsonPuretonuiLipS-fo1enoilngwlwceiroccasionpointedtiunnnryutI-CuanntMKindat-heroinoftunltycompanyseventeenreservedJameslargelybusinesswlnhlngwithrultQraJmakingIO11cwithViititllneMrlllrlVIorlltrassistedpresencerHKVKJiUIAJTKU-StimeIlllllliJHlllltlmake-stalwaysruMtlngIxTMnoiirftriUrtitiiltlvntUHi-urtr1nUnurtInstituteAlaelmninstitutepartiesUIHlLIlIt-trtaAhMIrkingIluutcntiMlt-1t11tyr-IliltshMilIstroyedCoughsI-hashdnrlof-HonrdFurtherKighthgeneralepUncprogrambillsCnuiiilvor-stinljdivisionLinereeelxedMemberH-MuriatirhorsPeruVnnnetwhereinCoregularthereforAlaehnaJoseph1rtier-LundiipiicHrlivaddressThomasbecauseriilciMiKilmonthshai-lhuI-SIIIIIIINiRADK-iCiroullUsbsdtifmayW-NiiTIlKWIKVOKSpresenttuningFRANKsituatedcoloredrnurrKlufromCivil1iitilliitiliinYoungDpledgelocationCLARKruUr4itut-ofduringmyselfvariousiiurmgtnerTmonthspeopleInterestreputa-oColmnuschemealll1IPeoplepeoplevariousMichaelnumberTwlldlitNlra4rutanxlouaJudicialIMVdltlvIticilrcr-HifarmershighestllfinitiMrtlllnuioUetHinlirrccrtltlcntndesirecitizensHudsonsolemnCountyHiiirduiHcDuringdresedllardeeCoughcoupleFriendMlAlTKKWellinterestYoucentralCountygetherBus-yrlikethirteenIH-WlliionJItIf1tr-IcitizensWINjVclassollorldaCountydetoserdfarmerspublicNVuJnesFloridawonderStationStationFloridaurgentfwnlni-TnubilesecuredvisitorstlfllHlHIltrppvltkrseveralfulowlnuIcrtllltMitoiMnllUittoandc-NOTItKparlorpeopleFloridadesiredSKiVIOVHar-rietimutcilUlosUlciithappySKCTKINfatallynumberTheicrtltliittipeopleIfKNKYM-CouatrClirilerhappyjoinedaroundberrieshI1IhWIIIIrwilliuiillniioiilostFloridaressmanJudgeCourtsredeemedpurposeminorsLlllie-MtlUMYillandPhonehIAI111lpractlCrouchtwentyCIIKVKSdtaJcconUAurniConnivpubliclocatedWilsonnilirrvrUagothappyawake-ncrtllllcnirthereofSO1ricWilloutcry1t11l4t111ockiialncovlllccough1iretlltSyrupaJiubUROUTfarmersoMlorlilnrlpnMrt1-ttburnedthingsyoudepartwantedfriendsyounauwlnirhappyriinentCOMEreturn-GliarsCircuitburnedandMillerMMiiiturccitizenschosenVouchKOTKiiirvisnmldiMrllirdFloridamownknownIndeedVonrtHiltonlirllt-uItesteemt1v14rreserveslookedi7tatq-f1llarejectcentrallulhllUDRYCircuitlookedKloiiiihllok1OK-Nuitcenewsia-IigivenunitedVeltrlebeingprettyrel4rrerrilrernMrJoinedptlf-rUblrimatterknownCIdtIlGIIll7-NotlocprepsptrlorfestiveiI4a4ishareMayorwishesdinnerspasmslady-oftUiuitnrfSriCSTOJllncLHUMprettyKainittermntativeFathertenderiftfUterPrltrttrUnrdrrrlliliiitiautirgn4ladleenergyluluserveddocreoItnultrat-tiredriluMMMrriililrridoacceptynllliinuaryO-Miipociuiul-tinMillpapersbidderMllrtlfmuliIHfnuuUJamesThatsuIHlnItriYoursservednsnibleCIAIWbeforeMASONhtALfarnescthingwherewILnrrrlnderIMCHMnativeL0111IAFloridaETCOurollnwliikfcalledrortamamongAtanulshouldreplylargeTUGSlimedIntentionwhereplacecalledM1zsriHriiniandbeingbyHoardPenwlIIllItvigorprupcriVUIIiItoirurrNorthFrankbottleUifiipleaslargellsUI-sNrltisealedrr-AioU4earlyonJvrilWoStoreshoseAIMnhuarillUiiCItearlyJulloiiluttindlOllllltrthrrwtlrIJcfQttnkenpatenwhichllKsJnnuiirtentirepiecehlchhousebottleNavalHoardIsstmruMTininldbe-ingMnmUvunderbelniNorilihn-ulivrilbeingwllhllUVUNDKUClerkiiroporivUltncsilINkyoungttrtlrtrlUxnrorpartsmerryMonrdAliiiltuaso-bermatterwhomNoithSALEunderMonrdUNDKHtheseKowlboardhollytheletterwhitenottoflyingdoubtSouthAKtlallJulIitiulUUII111101StateTractgroomyoungdeathPlantotherClarkwhileHIoincltKotUiegoodrirniHotherunderbervbrWhomCircuitpartyIhrtiHITiendHotnwhitdeathuantliinuarvClarkIIINKVtrulydressuadeuth1IeyidreoSouththosewhichullliliixltMiicemadetliiMoiinItlaeknuresstheyiinlcriitrwliuiCourtllnrfU-inrtheir-fknowIutmaketendsInsistoordlnirlrhtGreatStatewIttrrblackattrMabed00irerthirdtIIIVSStatetheiroilictpnowINttibi4valuethorfeyearsthegroommalluiltirifullyHolfjsthemreachmakewadeliiniiKtCourtLAWSWWIllNiprovethemblackStateStateoutbridecrnppBIDSFLseasontheirtheybruteVlllsJowiuiStatemadefromtheirFrankdaysClivnltrlhttlCUrKBIDSVjr1caaparthillsrmentrJrlfGwhirrClarkpartyyearsLAWSsillelaatdrItmikSrolliintherllt1rii-eellrxaftertlulrmaketheirandhightheyonlyonlyprIUrtdontlivedhavetheAitrhenrrtrcultForwideclaaZlrYrl-tAlMilmiNntleernlitKmrldiiIUiriiliithentheirbwrbrat-dedgown-itieSltnThisiwnotfIltisrvUirrionhelmgreatirniliinKhirlUtheylatertheyKnrtiliiUfrriyriurlddfIrIICIOIHT-DKIlhavehsarMissIrretroadpcrcreamTopehavhandhavet-InlllliwhyfiftyrrbtrntlittereallIAIThislerwltlnllUliillhtru1-llrndourwishtheirsltuniohourcountinstimeetSbiitillSlicrchvInforeliirulirtheirWIJIkIof-KitiiihaveStatedoneCourtToProveCitycreamfullcrentileKnnrHonomustformllnxliMMissMisswithsuchhaveuftrrSalnefarmrrrlimRailslotrtnmenupasthhlycityuponmostA4Kil4UMoilikhli7worktildetiredreelAKinhtliCoracakewiththenstoreLnievscenetubei-cutiiKitnameWiUtriHiohvUrIChnmostafterwrtcIhnWardingreMissoathj1VMMholdii-moMIIIIDaymustSaidlachiiubeenlntTwoyourSoldComlongJtrnhawtororfacopyuntyUrdulandFnvillelatecashrbiiiuIltakeiimUi1CtitvisitHalfhartIUlitwithIKMIIwithholedfromnnatiGetstWnswithliuiiithornironsIutrlIinfor-ththlanoticeMilluiSco-TpniKheldyourtinierwellIhPnlKpeaseshate111111jvrdaywithIrofyourtvirotaibogWillMutedyourwellIltiTipeiasM4andandideadaySCUlMMIthatthatnclalStlltC-hiMintytbqsateKo-BWtlthurtveryMtirUMoutiivuitvrOiurlsnapOneTheriledebtWthatwellTherrtinrI9il7-IX-AAQwithbestalsoHunbestheldnoxtproofKletaacresMmwyearwill-rtinyThelIar1008said4tuttJuntiMuifirmwellbidsKouflulnrlicforritsdaytractThethisttatrtlbitslandrl14ithcioiIhliniliuu-UiryoufrwthiswerehiitfHSMSCIIntoNitrweree-iMNrr1ThehirelorlititviMeaasImuiMvthheldKin-iiyluvliwliiinthisthinhlelwhoConlidsrunethisaiulnarylUbedinidalsoanyirlvnnlionloxtruiifdulinCtwrtthatKinilof-Irthat10wereweremoreandandTheandthisM-allPiMrsPiniritfliratiwerewnjilIn14511HonofYmiidokfierthflfPtimidJanandandtnwitIfunflugandandwillandtimiduttbMwillRevInlirJohnthatatauYouHeMandandandandtihuiioillicsilkareawillinadoandIgoeeuCAmemContliuifoiifllimixmay1iiriioruniurr1878endandandh-In51andsilktaaaaandandandForConfirst115141OfllnyearonceindsymandtilliiruiUiHiwillthisandlessandandandwillwerewiniiuliu11111andSuilgetcoununitmidSHtrtilUcilThewIjIattnhandJantalltiiiudisellAllfeelandandanilandwereuponJulnnHiiknLrllilnVHandhadciolfiinodandsailMmandClirlTneDOaldstntryourtilepratewillTheantiandandwillthe-ruffft4evercooniianitqTAXherriistheandandiCMJrrJ100andlordJhNrentinnrtruHtctrtsilktiltthat011JohncureforleeHtheJunenfwillantocrTITIIV4thehasDoryoutreeandyou218tlioflllrIIrUHVf-HeslmlldeedHisMrliftthethothetiti-iVIaHIMagethetholayMoot1IUimtiinxtheIMuritheroditstheheryoutrythetheIVrthethe50cthethetheyouhulrSciyell-tsiiiidulytwoanygen-t110111111thertiurHinditoanIthethethethethorniYKla-MthethethethehtGkhJellGillthetiorcHyoummctheIlIrIIUnd1MUlimetheIVrtheIIMrfthethethethehallagoraymanIirtilfortyouIHSIIIwjitagewastorelayhutdueLndthatNf4dcrdthe25cthethethethisthethethekmthatHilthiIthebehinddrodSIJWf-It9fuurIwntoutandlietheOVIthetiethettPrrATthetinanJulywliliwashiiolidotSiildiimci5-4thhthoFlaIllrdilIHforlirethetintheOCtrytolUOthethewaswasityourucJabIllidyraI-IhewasthethothetheV-AttillaidTOmdyouCIIheO-He11youRe1umSlllllYltLotthesintthefnreTeaUJtforTtihidthiltsuliniincIStbUttheKhidnxittulcrythefileaodbyforforyeHwasthatyouthethethatwrttproatf-Itsrlex-lvthewillwasTuxforsixvainMmIJIi1KOKdlsMbwasHtmlbyUnittlniii3ngeattinforLatNowasitnIlliltloudi4alanrlforrrrfallknKdWIIHdsriivohinfoutusersandtilednotSlittinareMildIciiforHeeroaisleAiKiuoveriiidnMitilayYl8HunIhiittinttiltiritAWfio-fiiforVieforwasfurfurOKthutthatmildbyPastortusklityeastforeall111ralitHiiAvtheoneforfinalallto-pHirnlCo-MAnlibyujH1X111tiltteallIrltusHeUTCTtluMdbydIydirtlintnnai>HeIhatnp-Hihy11wlIttaJogareIlolhsontheIttTuxNItarcairyetdaydayt144NILOHtthalilltlmforercthatMVMfasIsslayalltitsueIMVIbisruticilwillandlotinsandItrrIteiiotIMhnilfewbybyCVMW1OffourOfitshiltToaredigtbctotsarekiidlrnrealtualtcaMaDdtlwttrotluluhoranhrIourNwandin-niliithetyhuwAsrU-tithltlibYininnsouIIIVNvllitanandtintallnltHh4al-itkUuiMtKerr-anrnM4ttniiipimaseeiiiifiJJI5rmIerNaglenbeMillwillimlNutlirtitheIXatut-itifairssituiiilMittuhrrfUuH4pwbebeJIItaKn-tIra-tiiiitf1atollnifiW1tpfitiiiositUItthoUMJlllHmidnettorupreiIJSotarheWUllllJlft4unHMtiubehmofUKImttilltimtheOKlitlatetheHherit-IHlIlliIbelawof-Teonuinat1belKtiltltIIanheofinofIM-IInAsluHofatiInilIllOKtinacsIIHHHailbobetitGtautinNw44iindockofWItlofoftindieletofUKtiiInnunINltN4oftlfivTrInnIfJIbIJ71tliitylullhoViattufofIaliretinhItbartheuflieofWoruiofofofforhMipoftoOKaigIUtwinOIKnilNutheniiiLcforJbadofofofofofofofofofofkHHlt-uofoftitoihrofofofNoitllNriituxthinh1uIf1sinlatoofofofofoflurfurIltiforatofofofofofprehooftoofofofatofUirIbfofliliofatnttoofoftitart1111furIUonfurIJof111lItVUthiduin-irIMofILinltieofoftoofofufofofofatnon111tostfantuxattoofantotheofanairIMIIIiu17ofofinMinofillallfartoofofofIUDalfurartoofoftoofofjioonwlluutbttoofofdJrWaicnogaraptInIntaxinInCoininan411IninttototohfcartulHitoIhrtoWtoVasHi-smyanonAUonfurtOttuxPO-IalatInInnlIninInWutoftlflllfoftotIra-trortanon17t1MrltdonfarlieuntphIIIMHA-rttlvMrininIttinInIntoonliroftototitiMn0tWontarhillnooftfloftohftinanontwtUastlIsInl9tlnIlltearisiTzahnortoinofrToftototocoISoHituiarvUC-SorrollIsIsIninisKRtoanatillolftfitviurNOontutailasastryinvtoCorIIItotilacIfisSnasinvItoroftoattoofnntrytotouttVvutnasIMtinInllho7tQHInIBMIftillhi1DntnvsotttAItIIvInAterofWa111UjIlePbeAItoUlirbaUrNKJotjHIIWinofOilIrrmeiuInIeaDtuItistinreCtinofItriuUrnfofofofufoftinll14iurIINKIJM0of0ofwbrIItoofofnftuAmiiftlonISoftHfUUtoiiIillHIufunofaeontlrWulMofofofaufatCribPlnItInInfOPtoinVHoftitK10ufIMlliarwaLitLZtrHrM41InMItU11lilliiU11AaltoitufWBStonfpututoftyocti-AInInInMulIllJJIIIIIIIII31KinillfelitCNIofYef1tumii1ofitInMMIn14InC0inittnCFjtstoMItultVtuxlInhIMtdHItItSAJt8VrInlilUNdJoruKKiiURsHmInintrJIeIiirIsqIsAntAIIIOKItLKHinIIII7iMb11IfiTtoixfUHUJvlUIttfAiAitsy5jitInn4IatlGMhrtb1lsUItMTItL1tt-tIIIsuliiiaJ1inItunlaKAdaIIHAhqjI111yIIIdIIMIqhJnhaaaaAjahIfUCgHaI-iaa19IsnCS1ialltruwaaaaaPTxIiIiintflIiiia-yIIIIIiifrtaAsSAstIshIeaaaAiaAAIJstohnat1aSAKildoaasrvirBI2JJIIKssIt13rH11riNtYIJVKtI+>ciisJrntra0xljII11IIItyntIt11t1Ir3tiwfjrIit1tf+rNwoititrIittAIfIItffii11JatJlI4rrl>IrfrPjI1>rIlIrrpiIrItIIfI>>>rntti<+aj>r>IIII>++IIIiIIi>IiPfWiiIt1itIIi+irfIl<+>v>>iiiIIir=fiiili>i1iewviiei>jiidtI>>ttiJIriiIIiiieteeee


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN00034\ocr\0484a.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:12002
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1847
splitwords:0
ScansoftOCREngine Character Count:11701
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:13238
Abbyy6OCREngine Character Count:13371
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;13371;2470;42.1492;87.8326
language:en
ScansoftOCREngine Predicted Accuracy:70.93%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:4791
ScansoftOCREngine Character Error Ratio:0.3476
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;13238;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:87.83%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:87.83%
ImgPrep Component Range:10260,12002
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;11701;4067;0.810871;70.9296
noPunctuation:1
ImgPrep Component Count Low Estimate:10260
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 10.0 ID4 24.0 ID6 31.0 ID7 27.0 ID8 17.0 ID9 15.0 ID10 14.0 ID11 12.0 ID12 6.0 ID13 32.0 ID14 11.0 ID16 8.0 ID18 65.0 ID19 52.0 ID20 26.0 ID21 63.0 ID22 72.0 ID23 53.0 ID24 69.0 ID25 58.0 ID26 33.0 ID27 25.0 ID28 22.0 ID29 29.0 ID30 49.0 ID32 9.0 ID35 13.0 ID36 16.0 ID37 21.0 ID39 18.0 Layout Page ID1 HEIGHT 31436 WIDTH 19968 PHYSICAL_IMG_NR 4 PRINTED_IMG_NR 5 PROCESSING PrintSpace 31431.0 19959.0 HPOS 0.0 VPOS PC 0.8783 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1772 19144 816 0 ns1:type simple language en TextLine 1772.0 19028.0 932.0 String STYLEREFS 88.0 76.0 224.0 CONTENT o WC 0.8095238 64.0 36.0 3764.0 F SP 2756.0 1008.0 1828.0 18132.0 iN 14332.0 3800.0 408.0 13896.0 816.0 1256.0 56.0 1260.0 a 44.0 3320.0 1344.0 + 2480.0 840.0 272.0 632.0 8096.0 1392.0 THE 4732.0 3364.0 280.0 2056.0 8872.0 1368.0 GAINESVILLE ALTERNATIVE AINESVILLE144.0 8728.0 584.0 11064.0 1352.0 SUN ShN136.0 10928.0 312.0 1624.0 11880.0 1296.0 DECEMBKK 0.82539684 232.0 11648.0 292.0 1200.0 1312.0 DECEIB DECElII3-1624.0 13504.0 260.0 212.0 13292.0 R 0.96825397 13080.0 256.0 296.0 13640.0 1280.0 80 240.0 132.0 13804.0 O -132.0 13935.0 13880.0 1288.0 I -56.0 552.0 14160.0 1907 917xmlns:ns2 ID5 28583 6016 1936 ns2:type 100.0 2632.0 1936.0 1952.0 > 2788.0 r 120.0 2668.0 1068.0 968.0 2012.0 60.0 1992.0 2024.0 1 952.0 1040.0 1y -44.0 2036.0 484.0 4352.0 1416.0 2072.0 128.0 104.0 2428.0 y 480.0 2208.0 2576.0 CONGRESSMAN lCONGRESSMAN1056.0 1520.0 400.0 864.0 4904.0 2104.0 CLARK 4784.0 CLARKIS -864.0 5768.0 424.0 5064.0 944.0 2672.0 96.0 2988.0 i ih -72.0 1016.0 68.0 2960.0 40.0 116.0 1664.0 2956.0 544.0 1120.0 3568.0 2696.0 IS 1840.0 1728.0 720.0 4072.0 2680.0 STILL 264.0 3808.0 5040.0 ACTIVE 248.0 4792.0 ACTIVEIn -968.0 6008.0 172.0 556.0 776.0 3188.0 48.0 3272.0 < 112.0 800.0 h -24.0 824.0 1220.0 3232.0 356.0 1e -112.0 1332.0 244.0 4820.0 1188.0 3472.0 20.0 3508.0 e 196.0 236.0 3492.0 In 1472.0 1208.0 188.0 672.0 3108.0 3488.0 Hatter 0.95238096 Matterutter192.0 2916.0 3952.0 3476.0 of 3780.0 752.0 4284.0 Having 4140.0 792.0 5112.0 Refundet 5036.0 888.0 5120.0 Refunded Refunde-784.0 5904.0 Refundedthe -888.0 4812.0 936.0 3776.0 3932.0 t 208.0 304.0 2884.0 3792.0 the 1892.0 992.0 536.0 3796.0 Taxes 84.0 200.0 844.0 3904.0 Collected 220.0 4824.0 3840.0 on 4748.0 616.0 5132.0 3788.0 Cotton 5044.0 CottonHE CottonBfo-616.0 5748.0 3292.0 2700.0 4312.0 140.0 4360.0 HE 176.0 1000.0 3192.0 PRESENTS RESENT8bRESENT8228.0 2964.0 124.0 4408.0 4348.0 A 216.0 4192.0 1232.0 4760.0 4336.0 RESOLUTIONm RESOLUTIONr4532.0 1228.0 4764.0 RESOLUTION -1228.0 5992.0 RESOLUTIONFollowing 624.0 4584.0 648.0 4664.0 184.0 3308.0 2688.0 180.0 Following 3632.0 4827.0 tho3512.0 4036.0 Bill 3896.0 804.0 4452.0 Providing 4308.0 5384.0 for 5256.0 5736.0 5620.0 theRefund -260.0 5996.0 thes 5372.0 5084.0 80.0 s 612.0 2868.0 5092.0 Refund 2164.0 704.0 160.0 3556.0 3480.0 164.0 532.0 3824.0 5096.0 Money 108.0 3716.0 760.0 4460.0 5088.0 4356.0 168.0 664.0 5332.0 Illegally 5220.0 Illegallyasa IllegallyQI-664.0 4248.0 1748.0 5304.0 148.0 388.0 2852.0 5396.0 asa 956.0 1896.0 5400.0 QI -388.0 3240.0 5328.0 -184.0 3036.0 548.0 3324.0 5316.0 fcotton totton3448.0 5368.0 otton -424.0 3872.0 320.0 3980.0 5360.0 Tax 440.0 4396.0 From 4300.0 4948.0 5356.0 4836.0 684.0 5312.0 5352.0 Growers 5204.0 Growersof -684.0 Growersofte 680.0 Growersoithe 1060.0 2848.0 5604.0 5624.0 516.0 ofte oithe-172.0 3020.0 3084.0 th -280.0 464.0 3444.0 South 3268.0 SouthWith -464.0 3908.0 SouthStith 3096.0 With Stith3440.0 5964.0 152.0 3288.0 276.0 3688.0 5928.0 full tull3540.0 1164.0 4128.0 5920.0 determination determlnaUon3964.0 5460.0 5924.0 to 5292.0 5947.0 ac nc156.0 5612.0 ac4omp1ish -176.0 5944.0 acmpllshbls ncoinpIsh 204.0 3336.0 2660.0 6116.0 4omp1ish oinpIsh896.0 2860.0 6128.0 mpllshbls -576.0 3436.0 6144.0 his bis-244.0 3756.0 644.0 3836.0 6180.0 purpose 4608.0 If it4480.0 560.0 4808.0 6172.0 energy 4724.0 5452.0 6156.0 counts counts10T -544.0 countst 2360.0 6348.0 6412.0 2384.0 6448.0 T 2376.0 2448.0 6436.0 28.0 2420.0 2664.0 6372.0 10T foi6352.0 -264.0 2928.0 740.0 3140.0 anything anythfng2740.0 472.0 6376.0 nnyth -740.0 3880.0 6408.0 ng 3612.0 1104.0 4156.0 Congressman Conbrressman508.0 5484.0 6356.0 Frank 5260.0 FrankHark -508.0 Frankij Frankt3604.0 6564.0 6600.0 ij -84.0 2468.0 396.0 2748.0 Hark nArk324.0 2424.0 3040.0 6596.0 k -104.0 3144.0 3548.0 3452.0 580.0 6588.0 Second 92.0 3804.0 636.0 6584.0 District DlstPict4476.0 has 5728.0 6576.0 fol 5632.0 followed -208.0 5936.0 folJ folloxed 5956.0 6644.0 3520.0 2464.0 6800.0 6860.0 J 512.0 2656.0 6820.0 lowed 10wedloxed2528.0 6848.0 up 3168.0 3588.0 6812.0 268.0 3940.0 6808.0 bill blJJ3832.0 676.0 6804.0 recently recentl4208.0 880.0 5104.0 introduced 4988.0 introducedby introducedfc-880.0 5984.0 4096.0 6996.0 fc 7044.0 by 620.0 2048.0 344.0 2976.0 7032.0 him nlmbfm2880.0 7048.0 3708.0 7036.0 provide 3596.0 4448.0 tor4328.0 4796.0 7028.0 4676.0 5180.0 7020.0 refurfflfn refurtlfr5056.0 refurfflfnof refurtlfrs-704.0 5884.0 808.0 returftJfrw returftJfrwf -808.0 5988.0 5424.0 564.0 7244.0 7247.0 7264.0 2040.0 2772.0 f 2844.0 456.0 2908.0 7268.0 taxes taxea724.0 3432.0 7256.0 collected calJceted4240.0 7288.0 4508.0 7260.0 cotton 4428.0 5108.0 during 5016.0 5656.0 theCivil theCivIl thet 5376.0 7459.0 Civil Civ1i2020.0 376.0 3156.0 7480.0 War 3072.0 3616.0 7476.0 and 3532.0 4004.0 tor4332.0 7508.0 4504.0 7471.0 period perio4412.0 4924.0 -96.0 5020.0 4968.0 7464.0 afterwardr1th 812.0 5116.0 afterward -812.0 afterwardirJth afterwardIPS 1488.0 7683.0 384.0 7704.0 irJth 2784.0 IPS r1th3048.0 3132.0 7736.0 832.0 7700.0 resolutionTheSun 828.0 resolution resolutfon-828.0 4152.0 resolutfonoJ 3464.0 2508.0 7907.0 8004.0 oJ 736.0 7928.0 TheSun rhe8un284.0 2560.0 3652.0 7916.0 published pubUshed3580.0 4540.0 in 4444.0 4776.0 7952.0 4684.0 528.0 7919.0 recent 4864.0 412.0 5560.0 Issuethehlii 5476.0 5564.0 issue -408.0 5972.0 issuethe Issueothetiin 3352.0 2620.0 8095.0 688.0 othetiin thehlii2652.0 8143.0 -656.0 3008.0 3380.0 8148.0 316.0 3620.0 8152.0 toto 3528.0 4064.0 8136.0 which whlch3936.0 4644.0 8167.0 was 4544.0 668.0 5048.0 8131.0 referred reterred5816.0 5716.0 totttecommittee -156.0 2540.0 8352.0 8355.0 8367.0 tttecommittee ttttconimittee2596.0 tile -1256.0 3912.0 876.0 committee 2936.0 4020.0 8400.0 4324.0 8360.0 claims 300.0 5004.0 4852.0 504.0 follow tallowfollowing -504.0 tallowIn followI5940.0 8415.0 5156.0 8576.0 8675.0 8588.0 ing 1860.0 this 2816.0 252.0 8584.0 b1Jl3356.0 3852.0 3732.0 448.0 Clark 4956.0 5664.0 8608.0 pre 5536.0 preMated -268.0 5932.0 preHoied preae 2752.0 8776.0 Mated Hoied8844.0 ae -548.0 3204.0 2824.0 3016.0 8808.0 ed 2932.0 8803.0 764.0 3700.0 tonowlng4580.0 8800.0 4464.0 resolutionResolved -824.0 5404.0 resolutionKet 820.0 resolutionke 3044.0 2920.0 8996.0 Resolved Ket ke-764.0 3684.0 500.0 3184.0 9000.0 J1ved Ived3236.0 9063.0 -448.0 392.0 3888.0 9027.0 That 600.0 4436.0 9024.0 4280.0 4844.0 Secretary 5804.0 at5644.0 ofthe -160.0 atf ofr4940.0 976.0 9240.0 9316.0 r2648.0 9251.0 1612.0 1036.0 2836.0 9284.0 9248.0 692.0 Treasury -48.0 9275.0 -632.0 3304.0 9260.0 asury 3220.0 ury 3864.0 ot4120.0 4472.0 United 4372.0 5128.0 States 5732.0 9244.0 be 5636.0 beaadtoo 5916.0 be1D4jt bettady15 3316.0 2644.0 9444.0 aadtoo 1D4jt848.0 9448.0 ttady15 -500.0 3344.0 IB ls-148.0 3592.0 9468.0 hereby 3484.0 4296.0 directed 4148.0 5068.0 9476.0 4960.0 364.0 9464.0 send 5228.0 5800.0 tothe 5696.0 5960.0 totae toQ 9676.0 9692.0 tae theQ -272.0 3032.0 Hdpje ROoeeHo -532.0 3564.0 9728.0 3296.0 3680.0 1348.0 9688.0 Representatives 5420.0 9696.0 at 5300.0 5704.0 9680.0 5584.0 theearliest -252.0 thec therearlIe 2456.0 9879.0 9920.0 2460.0 9944.0 c -60.0 2520.0 588.0 2536.0 earliest rearlIe2500.0 9916.0 U 3124.0 3216.0 9908.0 possible p08slbletpossible3028.0 day 4040.0 9912.0 4432.0 772.0 4888.0 tollowlng4788.0 5752.0 init 5660.0 5756.0 -140.0 5896.0 Informttdoo -144.0 5900.0 intonndoo 3744.0 460.0 10100.0 10115.0 it 2628.0 formttdoo tonndooformtt4lxr1924.0 592.0 10136.0 namely nnmelnamelydetailed -592.0 4204.0 nnmelnr namelyjI -484.0 1672.0 10339.0 10348.0 jI 2888.0 10356.0 nr 1108.0 1780.0 6A 3148.0 3500.0 10360.0 10351.0 detailed statement 5272.0 sho 5216.0 5276.0 shoeing showing5544.0 shoeingike -676.0 5952.0 showingbe 5700.0 Ing Ingtie 10544.0 10560.0 tie ikebe640.0 atabunt 10548.0 Ji -640.0 3628.0 3348.0 10584.0 unt 3136.0 10587.0 nt 3624.0 3712.0 10575.0 6f of3816.0 -52.0 3868.0 10611.0 money 728.0 4496.0 5412.0 5688.0 theGovernment 5596.0 5692.0 thGovernment 5840.0 thpthpGovernment -256.0 5948.0 3312.0 10796.0 1044.0 10799.0 Government ot3676.0 4220.0 4680.0 5440.0 StriesStriesVoder Stp StatesI -240.0 5680.0 5776.0 10832.0 es -168.0 4088.0 1856.0 10984.0 10996.0 496.0 Voder lutdir732.0 11023.0 12 308.0 3256.0 11020.0 virtue Irtue3892.0 ot4536.0 4964.0 Act 5224.0 5784.0 11016.0 ofCosfreaa ofeCoepeas 4984.0 1028.0 11151.0 11199.0 6000.0 1076.0 ISttI -12.0 6012.0 4016.0 1928.0 11235.0 11259.0 m 860.0 2552.0 Cosfreaa eCoepeas2016.0 2952.0 11271.0 crC88 -460.0 3412.0 11244.0 340.0 11240.0 July 3664.0 11247.0 1st 1862 5072.0 wbchwhch4920.0 Icy lev1ev5556.0 leva 368.0 1648.0 11300.0 288.0 1796.0 11336.0 2624.0 11444.0 SttI 1944.0 11459.0 14 11495.0 2820.0 11524.0 -108.0 3176.0 11468.0 tax tar2996.0 3544.0 11464.0 656.0 onehalf onehalt11500.0 one 4144.0 halt 4572.0 at4828.0 348.0 11476.0 cent 11492.0 per 5572.0 perad perpn4 4636.0 11671.0 11688.0 524.0 2612.0 pn4 oun4ad 11724.0 3100.0 11692.0 11683.0 said 4112.0 4816.0 stdtement4672.0 toow 5788.0 tobow toI 3960.0 1988.0 12024.0 IllIG 2000.0 2704.0 11904.0 bow -192.0 2896.0 11916.0 ow -236.0 3060.0 11892.0 tho11907.0 t1 3376.0 11943.0 3608.0 amount lmount4224.0 5268.0 each vch5408.0 11940.0 f-380.0 336.0 vchAUte cb -200.0 cbJtateand 1380.0 12027.0 12072.0 452.0 hate AUte784.0 12131.0 Jtateand -376.0 3064.0 3160.0 -312.0 12128.0 Territory Terrltory4568.0 4720.0 12119.0 5176.0 Unitedtates -564.0 UnitedItatel Unitedttee 3428.0 2524.0 12284.0 12487.0 2616.0 12352.0 tates Itatel404.0 ttee 3260.0 3704.0 12348.0 where wheJe5076.0 4952.0 5416.0 12379.0 names 5336.0 namesC namest-536.0 12508.0 5140.0 768.0 12567.0 12620.0 2600.0 K 1776.0 2712.0 C r-76.0 2924.0 3340.0 12608.0 p 12603.0 persona -100.0 rsons rsoue3992.0 428.0 4196.0 12579.0 firms flrms12576.0 4624.0 corpora corporait 5908.0 corporatIool corporatjtaitta -636.0 2604.0 12792.0 432.0 tIool tjtaitta2904.0 12827.0 3172.0 12795.0 from fromf488.0 3736.0 12800.0 wham whpmwhqUl3656.0 4376.0 eachTerritory -368.0 eachta eachItate 4008.0 13016.0 13031.0 13019.0 Itate 1976.0 2736.0 ta 780.0 Terr1tory4520.0 nnd13028.0 5200.0 amountfrom amounteon amounteo11 3300.0 13231.0 eon eo113496.0 13248.0 596.0 2900.0 380.0 13240.0 enoh4500.0 13243.0 4384.0 372.0 4768.0 such 4656.0 13272.0 persons personscorporations 13252.0 personsaDd 4172.0 13424.0 13508.0 13464.0 aDd aid1168.0 13460.0 corporations corWfIUonacorporationsSecond -1044.0 4648.0 13500.0 corpq tions 4056.0 tionsI 6004.0 1356.0 Idftalted -8.0 13676.0 13708.0 608.0 2864.0 13688.0 2060.0 13684.0 gecondA -608.0 3668.0 -128.0 652.0 3848.0 dftalteddptslled4612.0 5496.0 13679.0 show showfag showhI showIMg 3396.0 13824.0 13903.0 fag hIIMg13891.0 ajbount tslitount3244.0 13912.0 ount 3968.0 4044.0 13840.0 -164.0 4292.0 13932.0 4228.0 colJect5488.0 5580.0 13900.0 d 5760.0 byGovernment byGo II ICJovetnment 14076.0 14100.0 14108.0 CJovetnment14136.0 Go -1040.0 716.0 ernmert 4132.0 14127.0 ot at14163.0 4316.0 4400.0 14132.0 5320.0 Stateswdcr States40r StatesS 4992.0 960.0 14279.0 S 14348.0 visor wdcr1584.0 40r -288.0 14356.0 3128.0 byvirtue 14312.0 -832.0 4028.0 3944.0 ot4972.0 4832.0 14351.0 5796.0 14339.0 ofCongress ofConlte ofi 744.0 14515.0 14580.0 1876.0 14659.0 1072.0 14572.0 Congress Conlte1912.0 3332.0 14608.0 l 3408.0 14575.0 at14568.0 March 7th 4936.0 1864 4744.0 5464.0 14563.0 whichlevied 4180.0 14731.0 4eYle4 -68.0 14792.0 levied eYle43248.0 14796.0 h3456.0 14799.0 ot3728.0 4100.0 iwo 3996.0 14820.0 wo 110-228.0 4524.0 cents 14823.0 pound poundcotton -488.0 paun pauncoUqI -384.0 5844.0 14975.0 15044.0 15023.0 M 2052.0 476.0 15008.0 coUqI2840.0 328.0 15011.0 stUd4032.0 15052.0 ptement-64.0 4104.0 4124.0 -736.0 4860.0 576.0 15020.0 tement 5196.0 how5608.0 theount theountcollected 15175.0 15247.0 1240.0 ountcollected 15235.0 Mu tu lu4576.0 15232.0 436.0 15240.0 State Stnteandt andi5524.0 aud-284.0 andof audTemto 15408.0 Temto Ttarrltol15439.0 15492.0 3552.0 15432.0 Qfat15459.0 3720.0 15451.0 tatted Vnltedlnlted4780.0 520.0 4916.0 Stnh9tntes5364.0 8 5436.0 5616.0 15456.0 nnd andnndjwhero nndero andahero 15600.0 15743.0 15656.0 jwhero ahero1768.0 2608.0 -552.0 15711.0 ero 15680.0 3164.0 posslbfethc possfbfethe15675.0 4320.0 15707.0 5288.0 0105192.0 5648.0 5552.0 15615.0 per1 per1f1lt -364.0 perIntl 15632.0 j jfirms -16.0 332.0 3208.0 2804.0 15824.0 15911.0 Intl 15931.0 f1lt -188.0 15899.0 ftrm8Arms3080.0 3884.0 15895.0 l1ud1052.0 orporntlonB4168.0 5380.0 fromhorn -392.0 fro 15860.0 frottj -232.0 5852.0 16075.0 16092.0 tithora 2084.0 2796.0 16119.0 horn hom-348.0 3224.0 collcct3784.0 16159.0 3876.0 4052.0 4272.0 4184.0 4736.0 16123.0 5236.0 nnd5160.0 Ter 5532.0 Terfltory -300.0 TerIJtorl 16096.0 Terrltory 4012.0 1940.0 16332.0 16383.0 1984.0 16379.0 16335.0 fltory IJtorl-36.0 rltory -480.0 16340.0 3640.0 16343.0 16352.0 4728.0 colllcttd4620.0 5568.0 tromfromeach tromNeh 16559.0 Neh16564.0 16595.0 -620.0 4092.0 3984.0 ons 4160.0 t1rm5248.0 anllcor -248.0 5912.0 corporatlons cororations 16627.0 16756.0 16783.0 porations poratlonsporationsThird -792.0 orations 16911.0 3812.0 4uThfrdA -40.0 16879.0 tit 17004.0 uThfrdA ThirdA1316.0 Third 17012.0 3388.0 detnlledtntlmlnt5504.0 ahow5388.0 showg ahowC17224.0 17260.0 g C17240.0 anlount17228.0 17255.0 mOIW -528.0 co1tlctldcollectedthe collectedby17431.0 2760.0 17476.0 2856.0 2968.0 17443.0 1024.0 17440.0 GOlmment17448.0 4932.0 Unltld5184.0 UnitedStates Unltldatatcs 4804.0 1160.0 17631.0 17664.0 atatcsllltatesunder untler3180.0 17667.0 aud4424.0 4484.0 17696.0 W -136.0 17672.0 Irtue5712.0 tho5576.0 thect thoctbf theCt 2792.0 17883.0 17891.0 ct ctbf tf bt3372.0 17888.0 Confres4136.0 Jul 5172.0 13 l34884.0 ISGfi S6t11S66ISGfihlch -340.0 17896.0 1S66jwhtch 5668.0 S6t1which 18079.0 jwhtch 360.0 2800.0 18103.0 hlch -360.0 loled3856.0 18144.0 3748.0 18119.0 tnx4388.0 18107.0 420.0 three thrN5168.0 18127.0 CtlltKrents18139.0 pernd 5600.0 5708.0 IltrIltrnd 3000.0 18324.0 nd 18363.0 3636.0 18336.0 18327.0 Bnlll18339.0 tltnttl1lt1I4704.0 18343.0 -152.0 5968.0 toOW 18543.0 18575.0 3200.0 tho3572.0 18563.0 3460.0 OUNtl18548.0 5024.0 nrheachUto 5588.0 eachMate -372.0 5684.0 nrhltate -276.0 18751.0 444.0 Mate ltate18772.0 ate Uto-324.0 18767.0 nnd-768.0 rrltn 4628.0 uf4420.0 till540.0 Tutted tlIlttdlnitedlnitedI -540.0 TuttedStates tlIlttdtatel 18948.0 18991.0 tatel tates18987.0 4048.0 18984.0 whln660.0 4772.0 IIOlllbltposslble5432.0 19003.0 theea ht -180.0 htea 2892.0 19199.0 19239.0 ea -80.0 3116.0 19203.0 3212.0 3560.0 tho3828.0 3724.0 tl 4552.0 rsm 4708.0 19211.0 nrlllK5264.0 19208.0 11115672.0 19244.0 lorcortlonfe lortlOD cortlonb 19423.0 tlonfe tlODtlonb3648.0 19427.0 whom 4896.0 rol1lchd5828.0 InState InBtato 2716.0 19644.0 19648.0 Btatonnd3696.0 4404.0 Tlrrltornndtillthettount tillount theNtigount 19860.0 19868.0 ttount Ntigount3424.0 ro1hctld19863.0 lRchotbitch tluchsuch5468.0 bitchrsanft tluchaDD suchpersons 2872.0 20024.0 20060.0 20108.0 rsanft -452.0 2948.0 aDD 20120.0 20087.0 flrms20084.0 nndnud3920.0 conluratont4364.0 corporationsFourth -1036.0 20092.0 conluratontourthA corporationsFourthA -1000.0 5500.0 3228.0 2692.0 20279.0 20303.0 Fourth 884.0 ourthA FourthA-568.0 20308.0 -116.0 tlltnUNIdetnlled3820.0 20323.0 tctnhmlnt5512.0 20299.0 howI showx5516.0 how-404.0 showthe 20344.0 20520.0 20556.0 g3024.0 20539.0 nrnoullt20527.0 4000.0 20559.0 mone1IOIIY4244.0 20523.0 4856.0 colll -724.0 20532.0 hyhytate byWe 1032.0 20643.0 x 2676.0 20735.0 tate We20739.0 Goycrnnwnt20747.0 4080.0 20744.0 thtUntttd4692.0 tIIUt 5344.0 20751.0 StnttriStatesor Stnttrier5976.0 2168.0 20951.0 21052.0 otter 2196.0 3004.0 20992.0 or er20963.0 Bndb 468.0 Irtut20968.0 4564.0 5008.0 tht20975.0 AN5676.0 ofDongre 5980.0 ofongrts ofVongreas 3252.0 21180.0 Dongre Vongreas21207.0 -772.0 2780.0 21211.0 ongrts 3384.0 21216.0 3536.0 21183.0 ln1lh21192.0 24632.0 21187.0 1SG7 21195.0 -328.0 H 4688.0 21247.0 4.0 C7 liilet lev5592.0 -224.0 It ItW letZh 21368.0 Zh 21387.0 lid1736.0 21431.0 Bn3276.0 21416.0 tux3152.0 21404.0 or21423.0 two nlut4236.0 21399.0 ollthnJr21440.0 oue -652.0 balt centsper 5548.0 rtllt-428.0 centsfer rtlltfer 21616.0 21647.0 fer per492.0 21655.0 21643.0 cutton rUUIIIcotton21628.0 Enid tnh21659.0 MI -316.0 id 4696.0 htatement ItnttnHIIlrtatetnettt5832.0 toJ 5836.0 toiow toplio 5080.0 21804.0 21835.0 21867.0 hon iow1712.0 21831.0 plio 2728.0 2980.0 tholho2776.0 21864.0 nmOUlIl21843.0 ltl11lCttl4288.0 21847.0 III5148.0 5448.0 eachBtato eachState 22055.0 Btatoltatenudanti22059.0 Terrltmy TlrrltlllYTerritory22067.0 4980.0 22064.0 5052.0 Iw 5444.0 Tnlted rnlhtnitedTnltedwhere rnlhJtatt tnitedy 5848.0 5152.0 22175.0 Bfo 22267.0 Jtatt 1636.0 tatesranti -292.0 3112.0 22276.0 rnl1ll -396.0 3768.0 whtrl22279.0 pUSlllbltposslble4268.0 tht the22315.0 aunt nameHWlItKnameHpersoiih WlItKit 5864.0 22319.0 sthe 1268.0 22403.0 22435.0 3012.0 22491.0 22527.0 persoiih11lr 4060.0 22531.0 3692.0 4264.0 22495.0 llrms I1rmtlrtns4872.0 22500.0 nUll22536.0 corjmra corpomcortoracorjmrafrom corpomii -624.0 cortoraI 22671.0 22716.0 2812.0 ii 22755.0 whotn whontchont22719.0 colltctl22727.0 22723.0 5456.0 eachand eachlate 22883.0 22911.0 late 22928.0 te 22935.0 nndTerrltorv TtrrlOr756.0 22940.0 11111anti4440.0 tht22963.0 nmountntnountntnountbisected amountfeollectcd nmountnccfed 23128.0 bisected feollectcd23135.0 nccfed 23155.0 etch enchtth23159.0 tHIlh4700.0 23191.0 Irlluntl5188.0 personsms Irlluntlml1824.0 23367.0 23403.0 ms ml23383.0 corporationsFlttbA rofOmUOn8-1032.0 corporationsFifth rofOmUOn8IFUtbA 23583.0 IFUtbA FlttbA23588.0 Fifth -728.0 3584.0 23595.0 ful1l1111 23591.0 atnlcomplete cumltttcoulplele5252.0 detailedatcment detailedalatvment ttaU ttaUt -356.0 23795.0 836.0 alatvment 23807.0 atcment -668.0 -572.0 23819.0 mtnt showing 6howlnt23812.0 lrh23815.0 nlulnud23851.0 eer eerale 23848.0 every ltryltryM -444.0 23964.0 24012.0 ale Matle -344.0 24024.0 ot24043.0 3976.0 24027.0 tho the4068.0 24031.0 Inited lnlh24036.0 Statta24051.0 tnh 5856.0 24055.0 tofay toIi topay 1272.0 24203.0 Ii 24267.0 fay J1pay1364.0 24236.0 thotbt24260.0 tawstt 24275.0 24243.0 thereon tbrt 24287.0 4492.0 24284.0 ln 4488.0 24248.0 untr24251.0 ttll5208.0 24255.0 thlsaidof -320.0 saidActs thlActs 24436.0 Acts 24460.0 3092.0 ConKroCOII -756.0 4200.0 24499.0 3740.0 24472.0 4712.0 24467.0 luh24479.0 I5060.0 lsG2 5628.0 lsG2arch 02 02arch t1rCh 5820.0 3120.0 24675.0 arch rCh24679.0 7 24687.0 UOi 1t424684.0 Juh24691.0 24696.0 4892.0 5124.0 1S60 StiliIStiGnudnudarcb -296.0 nndarch 24811.0 0arch 4512.0 24895.0 arcb24899.0 2 24903.0 lsG lv lM24932.0 3860.0 iT 3916.0 3972.0 24908.0 ghhiK thhlgtII iHirtUulurs ptrtkuhmittrticuluratfofsale tfph ofcb 25083.0 ph 2912.0 25111.0 25115.0 sale alQbv byhhowini hh hl-612.0 4368.0 25131.0 Ins 25147.0 Amount AUhH1Itrruount4592.0 25123.0 Mid bold1t1 5744.0 inrilrcb 5868.0 InInstance InJIicb 25279.0 JIicb rilrcb25335.0 Instance Instanct3104.0 -692.0 25351.0 stRUt 25363.0 nmouut RUlullht25371.0 atn 4392.0 Ilot 25343.0 Inlmcd dlthUNelntmed25375.0 as us5720.0 duetaxes 5724.0 due tluttlutI 2940.0 3068.0 25555.0 25567.0 -436.0 3504.0 3660.0 25575.0 Inwuu25587.0 25559.0 reItaed 4588.0 Uu 4660.0 4752.0 25563.0 5640.0 emch5520.0 eachi emchplace 25631.0 25823.0 1236.0 1804.0 25772.0 place Sl111Ctt3056.0 or25767.0 etwh 25815.0 lf 4340.0 4256.0 25779.0 Ml 1111sAI4880.0 elt hlliltlou 25807.0 -776.0 5764.0 25831.0 25819.0 5392.0 Hloti ttfottofnee 3760.0 2216.0 25987.0 26039.0 26023.0 nee 2260.0 25991.0 hUUUhjtnstfltswhrv 4560.0 ah 5028.0 26027.0 re26003.0 theB hl lWO DrolWOS Dros26203.0 26247.0 B26208.0 ofroalo 3416.0 tsalc Il 748.0 excrebtt 26244.0 ovct -744.0 rcot 4260.0 4304.0 Hl 26239.0 uni am26235.0 Mt utMttaxes 26211.0 Iftp1 eLatsneileLatsneila -648.0 6016.0 26259.0 -644.0 Iftp1taXC5 1128.0 26384.0 26423.0 26427.0 taXC53772.0 uut3516.0 wluiv 26459.0 w bd 26456.0 rr IOMI 26463.0 t352.0 26439.0 ult 5232.0 Jol V Vo -124.0 26435.0 tllt ib1960.0 26547.0 26644.0 26683.0 urea 111126680.0 3264.0 -92.0 3468.0 26647.0 1ht26675.0 ltfMt4S peruoserwm -524.0 26656.0 rrnlI trmc26668.0 nrn 26692.0 26687.0 rt 26651.0 1tlonn mr mrr rtlons 1252.0 26847.0 1816.0 26863.0 26871.0 tlonn tlonstions1868.0 26859.0 who trhoowned 26895.0 own -516.0 -336.0 IUltt -120.0 26880.0 cvtu tuttw26883.0 -416.0 5240.0 n 26868.0 hnl hllhu5324.0 hnllon hllIon 26875.0 hur 27075.0 27164.0 27087.0 ssinn 2008.0 1192.0 lon Ion3956.0 27099.0 rottOIoW thlold27095.0 tc 5144.0 27107.0 pto iM1 iM1aA 27128.0 IikSmd -32.0 1096.0 27227.0 aA 27271.0 1204.0 2708.0 27303.0 ikSmd iliatmed2532.0 27323.0 3368.0 27307.0 bl27299.0 duddu 27295.0 thlftOnthrreonthereonIn thlftOnIn27195.0 1812.0 27648.0 27651.0 27655.0 tho4084.0 Mayors MIYOr1Court CurtCourtCla Curtar 27855.0 Margaret 27908.0 ar 27884.0 1ft 27863.0 Cla Clav27879.0 1f 4116.0 27896.0 4344.0 wwd568.0 27860.0 Fxettir 27891.0 IUU1 5480.0 Jots JnlJotnr Jotnrcolored rrco1olttt rmunicltnl 28079.0 colored co1olttt3928.0 28115.0 omn womau28108.0 wrre 4848.0 28111.0 tIIrt -216.0 28091.0 errtsne errtsnethe 5892.0 5340.0 rra t1tbe 28296.0 28303.0 tbe28299.0 municltnl mUlllell1muuicipnl28323.0 court NurtSntwnlnv SnttniltYsrttanisySntwnlnvupon 28327.0 Inorb tmtraInorbupOn 28507.0 28515.0 28544.0 upon 28556.0 n572.0 28523.0 charge chnltt28519.0 4596.0 4756.0 disorderly 11Orhrbtilsornlrrly700.0 11Orhrbt 28547.0 co cot 5888.0 con conand 28731.0 28755.0 28739.0 IUldaad3576.0 28767.0 were wtrtwerrfined Aned28735.0 nUt 28771.0 16 Usarial -196.0 28747.0 coats roo6lJis irh firt5652.0 irheckert firttckert Irt Irtcckert 28951.0 28959.0 eckert tckertcckertMurray Surrav28983.0 urrnr -456.0 WR nads28987.0 au ttlao 4840.0 dl -304.0 arrnlpnHJ arralgxarrnlpnHJa 28955.0 frmlt frmlta arralgxe 29007.0 5876.0 -20.0 28991.0 29163.0 29215.0 e29171.0 clarce29175.0 otdkaorderly 29167.0 dlt -804.0 ni nltrh rly 628.0 5348.0 cotnlict cwdrtctcotnlictwa cwdrtctc-628.0 ro4td 5780.0 29203.0 lutrtC1 29383.0 29431.0 29427.0 wa inns712.0 required requtnd4108.0 utrtC1 29403.0 4900.0 29419.0 29415.0 Itay 5284.0 29423.0 -88.0 29395.0 ftwe saesaed 5772.0 Utt 5872.0 old 5740.0 oad 1572.0 29603.0 29615.0 29611.0 nheua 912.0 trlmmlnpj trlmmlnf1otrtmminte868.0 trtmmintef -912.0 30239.0 3052.0 30355.0 xmlns:ns3 ID15 28420 3428 2072 ns3:type 2432.0 6084.0 2100.0 6184.0 NEWS KEWS6108.0 6972.0 2096.0 OF OP6836.0 7372.0 CITY 7252.0 8024.0 ANDCOUNTY 7896.0 8028.0 AND 8516.0 ANDI 3360.0 2324.0 904.0 7112.0 2388.0 COUNTY 6112.0 1340.0 8104.0 CONDENSED 8016.0 CONDENSEDFrom -1340.0 2188.0 6168.0 6712.0 Sundays 6608.0 Sunda 7440.0 7212.0 7540.0 Daily Dall 7964.0 8060.0 Sun SUIl7860.0 Sunj SUIlj8356.0 SunOn 6080.0 3127.0 6340.0 On 6104.0 6696.0 Tuesday Tuesda6560.0 7516.0 evening 7384.0 8320.0 8604.0 8472.0 8992.0 home hottle8864.0 homeof hottleof-440.0 9432.0 6160.0 6452.0 Mrs 6316.0 6540.0 lrB -220.0 6760.0 6940.0 O7240.0 H137056.0 7536.0 Bailey Balle7348.0 8220.0 3375.0 North 8040.0 orth -332.0 8688.0 8832.0 Gaines Gainesville 9380.0 Gaines11Ie ville 11Ie6668.0 6512.0 ladies ladles6924.0 7620.0 7504.0 7884.0 3611.0 7776.0 8244.0 Advent AdentAd -588.0 8672.0 8452.0 8948.0 Chris ChrlsChristian -432.0 ChrisI Chrlstian 9392.0 6072.0 6164.0 3823.0 tian tlanchurch 6468.0 3847.0 expect 7140.0 7900.0 7792.0 8164.0 give gie8052.0 an 8496.0 8916.0 oyster oster8788.0 oystersupper osterI ostersUJlper 6076.0 supper sUJlper6908.0 6708.0 7320.0 proceeds proceedB7160.0 8180.0 8032.0 8488.0 8332.0 9128.0 will vm8968.0 willbe 9420.0 vmhe 4295.0 hedevoted tlcotetl7192.0 7076.0 7452.0 7812.0 rhurchhllrrh7708.0 8600.0 Functions 8348.0 FunctionsI 9428.0 6064.0 6152.0 given ghCIlgivens6088.0 6676.0 br6864.0 good 7188.0 7720.0 ladles Indies7628.0 8260.0 8188.0 8484.0 8412.0 churchI churchare-556.0 6068.0 6148.0 4767.0 are 6488.0 always alwa 7052.0 6984.0 6868.0 7136.0 successful successul8100.0 4716.0 hence 8636.0 8556.0 success successIs 9424.0 4928.0 Is anticipated 6284.0 7284.0 4944.0 8020.0 Oysters 8560.0 Oysterswill OysterswlJl3280.0 wlJl6528.0 6444.0 6780.0 served 7404.0 7308.0 7616.0 5164.0 all a11styles stles7816.0 8432.0 8660.0 8592.0 8824.0 reasonable 8748.0 8828.0 reason 9368.0 9372.0 reasonabie 9384.0 able abie6580.0 price 6480.0 pricej priceI6988.0 priceWith 6060.0 5559.0 I6320.0 Vlth6720.0 high 6896.0 1004.0 7428.0 appreciation 7332.0 8524.0 8772.0 9120.0 pat 9028.0 patronage 9376.0 3284.0 6140.0 5860.0 ronage extended 6692.0 7600.0 them 8088.0 7992.0 8716.0 8632.0 9060.0 year 8976.0 yearJust yearjust 9160.0 ear earjust 6136.0 6100.0 Just 6096.0 coming 7180.0 n7472.0 7828.0 close 7684.0 8416.0 The 8236.0 8884.0 G 8740.0 9192.0 9004.0 WHyde WHde 9256.0 VHyde 6304.0 Hyde Hde6640.0 Company 6572.0 7488.0 6312.0 takes 7408.0 7988.0 advantage advdntage-860.0 8848.0 8384.0 ntage 8172.0 8924.0 6308.0 theopportunity 9088.0 9164.0 9416.0 6132.0 6524.0 opportunity 7200.0 6556.0 7092.0 7444.0 6527.0 extend xtend7484.0 -492.0 7976.0 8084.0 best 7520.0 8520.0 wishes Fishes8424.0 6532.0 9084.0 for3G5 6744.0 6763.0 365 3G56500.0 days das6392.0 6976.0 7236.0 6751.0 happiness havplnes87124.0 8048.0 prosperity 8440.0 prosperityto 6975.0 6999.0 7016.0 6288.0 ecr 7060.0 6992.0 customer custonurnnd customerand-752.0 8000.0 8296.0 8464.0 8784.0 6980.0 fact fnct8612.0 9264.0 6987.0 9104.0 toeverybody tooerrbodj toof 6120.0 6124.0 7204.0 everybody oerrbodjerybody6280.0 7108.0 7416.0 604.0 7748.0 7196.0 7664.0 8436.0 7232.0 8536.0 8796.0 9016.0 7199.0 Manager 9020.0 Man Ian9112.0 IannJer ager nJer6632.0 Gardner GardllPr7436.0 7292.0 7856.0 7420.0 certainly 8744.0 made 9320.0 asuccess 9188.0 9324.0 aI 6044.0 7640.0 7680.0 6856.0 7644.0 6732.0 7008.0 7496.0 business 7376.0 8328.0 8208.0 8676.0 9056.0 7671.0 jear8936.0 yearnow jearI jearnow 6036.0 7864.0 now 7876.0 6756.0 all6684.0 end 6936.0 because 7304.0 7636.0 7895.0 cnuse 7532.0 7868.0 ot8404.0 7880.0 reasonshis 8700.0 8780.0 reasons 9412.0 8080.0 8092.0 6612.0 8124.0 6536.0 6616.0 iKTsonal KrHOllal6792.0 rsonal 7296.0 cleverness 8324.0 8252.0 8696.0 8083.0 qual quality 9364.0 qualIty 8304.0 8312.0 ity 8316.0 6332.0 6716.0 7080.0 goods 6968.0 7656.0 8307.0 he lye7560.0 7984.0 8376.0 handled bandJed9280.0 Itgoes ItI ItJoes 8512.0 8567.0 goes Joes6048.0 6604.0 8528.0 without 8532.0 saying 7224.0 sa 7888.0 lng 7524.0 8012.0 that 8456.0 8340.0 8900.0 9012.0 WI 6028.0 8791.0 8756.0 6056.0 6368.0 6244.0 6660.0 8752.0 7552.0 7432.0 its 7840.0 8284.0 8168.0 8984.0 willprosper 9404.0 8972.0 prosper 6724.0 9008.0 same 7072.0 8980.0 7584.0 7980.0 8760.0 1908 9236.0 9108.0 asthe 9408.0 asthp 9200.0 thp6472.0 public Jlubllc6360.0 9196.0 find flnd7380.0 9232.0 7932.0 pleasure leasure7808.0 8624.0 9064.0 well wen8952.0 wellas wenas9456.0 9452.0 6272.0 satisfaction satisfacUon7500.0 9419.0 deal 8308.0 8216.0 8552.0 8460.0 store 8856.0 storeCOMPLIMENT -412.0 storeI 6020.0 9740.0 9900.0 1300.0 COMPLIMENT TO 7580.0 9903.0 MISS 7908.0 GOODE GOOOE8444.0 GOOOEThis 9180.0 GOODEThis 10336.0 This 6624.0 10344.0 Popular 6464.0 Young 8108.0 Lady 7940.0 8664.0 Received ReceivedFine 10563.0 Fine 6768.0 Vote 6648.0 10599.0 ao7144.0 7556.0 10568.0 Queen 10572.0 8068.0 Carnival CarnivalFrom -700.0 9172.0 2256.0 10816.0 10820.0 Fridays Prldas6544.0 Dally Daily7344.0 10823.0 7904.0 SunI SunA8336.0 6268.0 11080.0 11083.0 11092.0 great 6396.0 7084.0 6960.0 7548.0 interest 8480.0 beenmanifested been 9400.0 beenmanlC 11304.0 920.0 manifested manlC -920.0 7004.0 11307.0 sted 8204.0 11324.0 past 8072.0 11340.0 orfour 6092.0 11528.0 four 11531.0 7280.0 tho7168.0 candidate candidatefor candidateCor-816.0 11748.0 11755.0 Cor6420.0 QUl -512.0 6932.0 6844.0 11784.0 7024.0 11752.0 ot8428.0 11764.0 9144.0 toappear 11972.0 12003.0 appear 11976.0 6664.0 tbls7448.0 city 7336.0 tbe8228.0 8120.0 8932.0 week 8820.0 weekThere 9360.0 12191.0 12196.0 There 6704.0 7592.0 several 7468.0 12232.0 young oungladlesladiesin ladlesIn12415.0 12420.0 12432.0 contest conteHt6636.0 7528.0 being nominated 7972.0 9096.0 8964.0 andsupported 9396.0 12639.0 supported 12644.0 6904.0 7424.0 their friends 7820.0 8704.0 admirers 9352.0 admlrers admiters 12711.0 12803.0 12863.0 mirers mlrersmiters 6764.0 12899.0 Friday frldaynight 8616.0 12868.0 when 9136.0 9048.0 thefilial thetidal 13060.0 filial ndaltidal6652.0 13096.0 vote 13120.0 wns13092.0 counted 8736.0 13123.0 9152.0 announced anpounced 13156.0 13308.0 nounced pouncedlhat6776.0 7360.0 13311.0 Miss MssLovle Lole7740.0 Goode 13347.0 onef onet8940.0 9116.0 13527.0 13535.0 tGainesvilles OalnesllIesGalnesvilles980.0 13532.0 handsomest 8596.0 nnd13544.0 mostpopular 8888.0 most 13756.0 popular OPUlnr13792.0 6728.0 6872.0 13783.0 6188.0 ladieshad 8648.0 won thehonor 13975.0 honor 7364.0 13983.0 8044.0 13980.0 receiving 9951This 8816.0 8956.0 9451 99519336.0 9451This 9340.0 14199.0 6568.0 14231.0 6460.0 Indeed 6876.0 14240.0 n7512.0 compliment comllllment14219.0 9040.0 thelady 14420.0 lady 14423.0 but 6440.0 14455.0 weB14428.0 deserved 8544.0 14459.0 onewhich onewhIch 14644.0 7152.0 14652.0 14647.0 nnd7456.0 her 7872.0 8396.0 8280.0 feel teelfeelsure teelsurc 1792.0 14868.0 14900.0 sure surcshe 948.0 14871.0 appreciates allpreclatls6832.0 appreciatesThe allpreclatlsThe-948.0 15088.0 15092.0 other 7172.0 15124.0 7100.0 7276.0 ounJ 7672.0 7752.0 Indiesladiesalso nlso8224.0 696.0 15095.0 received recelcd8628.0 receivedcomplimentary -696.0 recelcdco 15312.0 complimentary 15343.0 -1252.0 pllmentar 15328.0 votes otes7248.0 15316.0 8564.0 15319.0 8764.0 needloss need 9348.0 needless needlell 15384.0 15531.0 less lellloss6484.0 15548.0 6404.0 15536.0 add they 7228.0 15540.0 appreciate aIreclnte7836.0 8896.0 reallz reallzlog reallzIng reallzIag 15736.0 log IngIag15755.0 15760.0 there thoro6772.0 7388.0 15796.0 can 7772.0 15764.0 7956.0 15800.0 oncqueenHAD 8684.0 queen -476.0 IU tn tnHAD 16200.0 HAD 7340.0 16208.0 7572.0 16203.0 BIG DANCE DANCEThe 16639.0 6552.0 People 7088.0 Waldo 7368.0 708.0 Indulged Indulg16643.0 8860.0 WithDelight -400.0 WithDollght 6492.0 16860.0 Delight Dollght7216.0 1196.0 Terpsichorean Terpslchorean7356.0 16867.0 Art ArtI 9068.0 ArtThe 17115.0 6040.0 6276.0 17120.0 TIlluotI people IIlullle17123.0 or8140.0 Wnldoaldo alwasIwaysalwasawake 17159.0 alwaysawake 8912.0 IwaysnWlke 17339.0 17344.0 awake nWlke6828.0 17363.0 6628.0 tillmutual l11utunl8420.0 17347.0 interests IntlrtltH9252.0 ofthose oftho 17563.0 those 17607.0 u 6364.0 6680.0 about nhuut988.0 participated parllcllatlil7688.0 17568.0 IIIhl8876.0 17599.0 abig 9168.0 17604.0 1I -28.0 6024.0 17783.0 17876.0 17787.0 big danco dnllcddallct17804.0 ut6944.0 7324.0 till7692.0 17795.0 town tow7576.0 17823.0 hall hulhull8504.0 17819.0 operi olllraopera8836.0 operihouse olllrahOllse operahouse 17972.0 18004.0 house hOllse6748.0 18043.0 UIIou18007.0 Thursday 7852.0 dny 18040.0 evenng evet4ng I4ng -352.0 8712.0 whenthe whenI wl1 9268.0 18047.0 9296.0 nwhoo 3392.0 18172.0 6192.0 18231.0 18228.0 whole whoowholo7156.0 18243.0 7760.0 turned lurnltlout 8292.0 18252.0 cele clltcelebrate clltlJrntl 18295.0 18452.0 brate lJrntlChristmas ChrlRtUlaHuntlIndulge hltlulfl7824.0 18456.0 III18488.0 ugoodsocial 18671.0 social 18712.0 10 6432.0 6456.0 18676.0 time tinutimeThe tinuThe 6784.0 18707.0 IIH IIHTlw 7000.0 18892.0 Tlw18895.0 music 7912.0 18928.0 7804.0 nK uptodate UIItodatl18907.0 tO date IIIInevery IIItlr intvery 19112.0 19148.0 tverytlr 19131.0 respect rotllllctwaK7848.0 19119.0 19152.0 n7936.0 local 10cRJ19116.0 orches orchtsorchestra orchtslm19184.0 19331.0 19355.0 tra lm6508.0 lJut6884.0 19335.0 tho19340.0 tlnll7732.0 19367.0 WUHtuns19372.0 so BO8036.0 perfect IllrCrtnlldandthe nlldth 19555.0 19559.0 1IUtilluntslc6264.0 19591.0 yoodood tlmthe19567.0 aggrega aggregation aggregatine 8792.0 rtgl rtgltlnll -308.0 9312.0 19624.0 19747.0 19776.0 tine tiontlnllsounded Iwullddlike IIkl7716.0 19815.0 7612.0 19819.0 professional profeselonnl7960.0 19779.0 lroftt 8908.0 10nnl hand bandbandfrom handfrom 19995.0 Jack Jacksonville JacklionlIle20031.0 oi 7392.0 Ille 20027.0 some tlUIIW20000.0 otlltrcityThe clt cltThl cityrho 20215.0 20219.0 Thlrhodtncoda11Ce20251.0 WRR7208.0 wlBattended nttllIdtd20224.0 frontfromWaldo frontaldo 20431.0 6296.0 20436.0 20439.0 nrulturdImmediate Immtdlnh1092.0 8272.0 20443.0 surroundings tmrrUlltlnJsurroundingsnnd tmrrUlltlnJIlHIsurroundingsturd-1092.0 20655.0 20660.0 IlHIturd20663.0 6840.0 nlttllproved Iruttl7040.0 20699.0 n7728.0 20684.0 20691.0 Ulo 8476.0 enjoyableaffair 796.0 8620.0 enjoyable tmjoynhlo-796.0 tmjoynhlonrralr 20875.0 20879.0 affair nrralrlastiiiK I1NlIllh1Utll htstiugtuttllmtll 7764.0 20915.0 v wgll 8116.0 11 ll20887.0 Iu20884.0 thomorning morn -420.0 mornSuccessful mornIllg 21099.0 Illg ingIllgI 1724.0 6892.0 21452.0 852.0 Successful Succellful21459.0 Cat 7744.0 Hunt HuntFrom HuntIrom HuntFroth 21707.0 21712.0 IromFroth6672.0 SUIIIIHIXUly 1atlyDal1 SUII7832.0 SunAn SUIIAu SunIt 21924.0 21951.0 An Au21972.0 21927.0 tIIJU3blo6520.0 21967.0 us uawelt7996.0 t1I ilti8568.0 21955.0 8372.0 aful 8656.0 21963.0 tetlcCes5 tetlcCes5fun IlCl -472.0 9304.0 9176.0 Sful 22143.0 22151.0 ful funwildcat wlldcut6336.0 tvild 22167.0 cat hunt hUlltoccurred 7604.0 22184.0 ocurrl -712.0 earl Burly lurhSat SutSulSaturday SutUrtty Sulurday 22367.0 urday Urttynu 6700.0 22375.0 IIwrnlllt6888.0 22415.0 6952.0 rutng 22372.0 theparticipants IIIrtlcllllIt7788.0 htllIt8880.0 beingSnerlff htllIt1Ilrr beingSnet9IT 22591.0 22596.0 Snerlff 1IlrrSnet9ITI7068.0 Fentull tlIl111Ieuuell8112.0 22623.0 nllt 22611.0 guests guestsJ lt4tri lt4triJ 22811.0 1Uoulware Buulwart13ouitvarelit22815.0 Texas Tt1I1eztts22847.0 allt Steve SteeShtSteveCullen SteeCullen Shtlulltm 23032.0 Cullen lulltm6736.0 23035.0 23071.0 Hague IIugue6824.0 HagueTho Ha IIugueTho 23068.0 lt ltTho 23244.0 23251.0 Tho limn hUllthunt23287.0 wits23256.0 inltd0UIIII tho8212.0 788.0 hammock blmnwckhammockon -788.0 hanlnn cl clou 23468.0 23504.0 011ou23471.0 Nevnans Ntnuns6796.0 IIIIt 7220.0 Uike lnklnke23475.0 nud1111 8248.0 tht23492.0 party pUrl8492.0 23507.0 sueettdtal sue MICtilltMICeevde tilltltth 23687.0 eevde ltthettdtalt416.0 mirly extrlyttrl 23704.0 III23695.0 tll murlling7676.0 8644.0 23691.0 IIIJump JumpsJumpIng JumpIII JumpsIns 9388.0 23907.0 23915.0 IngIII 6380.0 23943.0 23947.0 23911.0 bit6592.0 23931.0 lUttartAfter Ahrit23952.0 8196.0 chase 8652.0 ufahulabouttwo ahult aboutttvo 24123.0 24147.0 ttvo6220.0 24159.0 wu 24132.0 24163.0 6852.0 ImU htllf24127.0 24135.0 7312.0 hour hufthours8264.0 tilt8692.0 24151.0 24167.0 Ct waskilled watlwasMr watlklllI 24344.0 klllI killedklllItr killedMr 3088.0 24559.0 24568.0 Mr 6416.0 tr Uoulwure HuulwnrtBuuttvnre24611.0 7652.0 24583.0 tnttltatteta8548.0 24571.0 lit8448.0 24580.0 9044.0 fromTexas from1tI 24599.0 ruin ruin1t 24783.0 1tI1t 24819.0 tutd7104.0 24792.0 24787.0 regarded re 24835.0 7784.0 ardtML nlassrather rntt1trruttier24823.0 agootl aooit ImnrkM1Ul1 24999.0 gootl 6240.0 ooit 6516.0 25004.0 ninrXhiiuui mnrkM1Ul1ntnrkstutul25011.0 huttint25007.0 tbM7892.0 Sheriff hrUThrUTlltn 9080.0 Fenne11 Fen FenHell 25219.0 Hell lltnne1125228.0 tvhokilled klllldthl lhl425240.0 cut lMCteat8368.0 25223.0 HUlll8892.0 25259.0 lIhtftfOw 25435.0 25440.0 thoOw25452.0 prettiest Irttltprttuest25464.0 7272.0 Shots liots25483.0 25455.0 Oot tal7608.0 25471.0 ever eerSAW 8920.0 25476.0 fa ai25443.0 11lltheanutiunl 11llhunl theeuttuunl 25655.0 anutiunl euttuunlhunl 25691.0 wits WHS25700.0 kUh 7924.0 25703.0 25659.0 through thruUlChthruughumleru1hrumlerat u1hrhnit under1nlrh 2548.0 25876.0 hnit 1nlrh25891.0 ntiii25915.0 a25888.0 KrrtU Rrat6964.0 25879.0 tlia til diadtantaWetiten 7756.0 25927.0 25883.0 luitAc adtantaluitAcWestsn 25900.0 mtA tWuton 2320.0 26307.0 Westsn WutonWetiten26331.0 7596.0 26319.0 MaKe 26355.0 oe 26351.0 8156.0 26343.0 Change ChtngChangeF Ch 8540.0 t1F 6344.0 26563.0 XI M26575.0 vWstou 26583.0 -596.0 26587.0 rotm 7632.0 Mho bt 8064.0 26567.0 ha hn26571.0 CorfurUUt tilr8804.0 26611.0 ifew 9092.0 26595.0 9184.0 26599.0 9140.0 9288.0 ill illt 26771.0 26783.0 few 6424.0 mouth mOltbmortth6216.0 26791.0 IMHT 7064.0 ti 7352.0 26844.0 7396.0 26819.0 tiis 7712.0 26839.0 26799.0 8056.0 26787.0 Iutl 8200.0 titl ntkUlllnc filling8720.0 IUD Uuof lI1tpotttlOb -212.0 lI1tthethepoettlou 9440.0 26995.0 27007.0 potttlOb poettlou27003.0 uCbilling blU1111bdhtnt7780.0 27055.0 Urk 1ert7800.0 Itr 27011.0 la8076.0 8344.0 27039.0 27047.0 26999.0 thof frefbt frefbtd fr btdftrUalDl 27215.0 27223.0 dftrUalDl ywrtmcnt27219.0 tht7944.0 ctbtNrd 27247.0 aMt 8144.0 boArU 8500.0 Air Airl 9072.0 Lhtt UieLhttUro4 Uiersih 27431.0 27443.0 rsih Uro4 6496.0 6816.0 puns 6956.0 27471.0 MA 27436.0 UTdtlvd 27439.0 trod tnch-708.0 red hi bthl928.0 tvlguAttaa rlCUAtbattttatku8288.0 tvlguAttaaU rlCUAtbaIn-928.0 8468.0 27463.0 8724.0 ttttatkuxtte 6548.0 27679.0 xtte 27663.0 totat lufcftart 7660.0 ff 27672.0 27687.0 th27660.0 9220.0 Ut letlitUtv litetletU 27915.0 et 27872.0 It27867.0 win won27911.0 sev dd8680.0 27875.0 t16208.0 28087.0 28096.0 28151.0 28127.0 rwbo twboSB 113snl 11tow 28120.0 28123.0 7948.0 iruod ruvlrailnwd rat1lctrttArtdrailnwdn rat1lctnttarttArtdtowtt28339.0 towtt ntta 28311.0 aad6400.0 28347.0 -4.0 6912.0 I1to 7164.0 28344.0 OWill w1ll28335.0 tK tx28308.0 doubt iMht28368.0 AM 8256.0 28332.0 170 1101 provr28351.0 eArpvvatatt 9436.0 auabl elthusbtr lthusbtr 28531.0 uabl rep rpvvatatt NIataU1veenttltr 8132.0 28563.0 uf wf viwfF tbr 28551.0 tC ecxc8928.0 ecxciwtn 1336.0 28751.0 iwtn nv Uitfiv lah Intnts 28975.0 a28967.0 feubdemtixxi utltlNht1uudrrttn29003.0 7796.0 lU t1tl28971.0 Xr Xrwill ir 28995.0 rUS Wrrtt Wrrttviii 9300.0 29151.0 viiiUS 6476.0 1a eiit 29211.0 vm 29199.0 1Nh 7148.0 ctt 29179.0 ctcd Mlth wttbttJl 8232.0 tb tbUMiMi d4tas kIta kItaWf 9344.0 3196.0 29391.0 UMiMi 29399.0 Wf tauwtxettrrt utwt -496.0 rtOK 7568.0 Cooir Copt -760.0 0Ia fn bl29411.0 29435.0 NaNdt apttdty 29623.0 pttdty dt 6656.0 6740.0 29619.0 tKl 29659.0 kk ke4pM 30147.0 30187.0 YN 1172.0 30115.0 30307.0 xmlns:ns4 ID17 12124 10480 9480 1792 ns4:type 1904.0 15892.0 1908.0 15852.0 10428.0 9512.0 19788.0 10252.0 9536.0 9508.0 2240.0 1360.0 2400.0 872.0 2512.0 3 -1976.0 13856.0 13264.0 12488.0 14400.0 DAYS DAYSof DAYSi-3072.0 17472.0 15112.0 -2360.0 16736.0 2407.0 15903.0 9500.0 9516.0 ofHappiness 14896.0 OI 14632.0 OHappiness 14704.0 3644.0 9492.0 1400.0 10476.0 9484.0 10128.0 4416.0 Happiness 9704.0 14000.0 13408.0 Prosperity 15120.0 ProsperityIs -3248.0 19072.0 19912.0 1116.0 9480.0 12504.0 13288.0 tlie13088.0 1560.0 14504.0 Wish 14224.0 16279.0 16064.0 ofTHE -584.0 16864.0 5812.0 ofr 16284.0 -580.0 10112.0 1328.0 6703.0 11728.0 6688.0 11440.0 12144.0 1744.0 13776.0 6655.0 HYDE 13312.0 15839.0 COMPANY COMANY15520.0 COMPANYFor -3264.0 19104.0 1496.0 COM 17399.0 P 17336.0 Pfor 17784.0 1264.0 17832.0 ANY ANYFor -1264.0 19096.0 11408.0 8215.0 For 12200.0 Each 11920.0 13224.0 One 12936.0 14048.0 13784.0 14591.0 Their 14344.0 Many 15392.0 16672.0 Patrons 16480.0 PatronsWe -1232.0 17903.0 1592.0 11452.0 12316.0 11508.0 13012.0 10092.0 We 10792.0 cordially 10648.0 12104.0 thank 11956.0 12996.0 9643.0 you 12864.0 13616.0 9499.0 13484.0 14123.0 9612.0 your 13996.0 14952.0 liberal 14740.0 15995.0 9556.0 15768.0 908.0 17596.0 17328.0 18764.0 9472.0 18504.0 thepast 19115.0 9036.0 9948.0 10084.0 10776.0 10640.0 11600.0 9992.0 11380.0 12228.0 10132.0 we 12092.0 12828.0 10076.0 trust 12640.0 13644.0 9988.0 13416.0 14368.0 10120.0 our 14152.0 9968.0 methods 14788.0 16428.0 9956.0 16164.0 1516.0 16944.0 conducting 16680.0 18728.0 9959.0 18459.0 thisbusiness 19128.0 10088.0 10443.0 1100.0 10484.0 1112.0 11420.0 together 11188.0 12664.0 with 12532.0 13436.0 10479.0 13284.0 14020.0 10467.0 highclass 1668.0 15516.0 10452.0 merchandise 15308.0 17403.0 offered 17183.0 18688.0 10455.0 vill18364.0 willmerit 18779.0 villmerit 10936.0 10987.0 merit 10924.0 11112.0 10788.0 1632.0 11212.0 continuance 11072.0 12980.0 10972.0 12844.0 13380.0 13928.0 11104.0 13796.0 15059.0 10963.0 Our 14584.0 1084.0 11035.0 constant 16984.0 10960.0 aim 16848.0 17616.0 10956.0 17484.0 17899.0 17812.0 18920.0 18828.0 tooffer 19132.0 10080.0 11432.0 offer 10828.0 11456.0 10680.0 11540.0 Best 11252.0 12212.0 Possible 1504.0 13404.0 Merchandise 13216.0 11480.0 14908.0 16108.0 11447.0 Lowest 17172.0 16948.0 18367.0 PricePhones 18188.0 18371.0 11435.0 Price 18944.0 PriceBoth 19032.0 55 55es 19136.0 10264.0 12976.0 Phones 10408.0 Both 11288.0 BothPhones -680.0 11088.0 11024.0 13111.0 11776.0 12596.0 12604.0 GW 13116.0 13420.0 14268.0 15572.0 12600.0 15352.0 17984.0 12971.0 17608.0 Ph -1008.0 18140.0 18536.0 18803.0 18647.0 18760.0 19027.0 13848.0 xmlns:ns5 ID31 15504 3372 9476 14300 ns5:type 9832.0 14300.0 DEATH OEATH10612.0 14303.0 10488.0 PROF 10860.0 892.0 FOSKETT F03KETT11484.0 FOSKETTOne F03KETTOne-892.0 12540.0 9548.0 14736.0 14743.0 9864.0 10448.0 GalnesvillcEGalnesvllles10236.0 11708.0 14739.0 Old 11504.0 CitizenPaaaed 11984.0 12204.0 Citizen CitizentCltizenl12776.0 CitizentPassed CltizenlPaa 12840.0 10008.0 14924.0 Passed Paaaed14963.0 Paa 10576.0 10496.0 10296.0 10696.0 Away 11284.0 14960.0 11160.0 11944.0 Noon 11820.0 NoonFrom 12368.0 2396.0 9544.0 15220.0 15227.0 10108.0 15223.0 Saturdays Saturdnys11096.0 Dally10992.0 11632.0 BUDSunOne BUDOne 9720.0 15444.0 15447.0 oC10048.0 10372.0 Galnesfllcs10288.0 oldept oldest11428.0 12080.0 nnd12004.0 12472.0 12380.0 mostwidely mostwldel 15668.0 15671.0 widely wldel 10176.0 known 9976.0 10804.0 citizens 10708.0 11572.0 Prof Prot12052.0 11932.0 12312.0 12184.0 12520.0 Fo Fos12400.0 Fokett 12824.0 Foskett 12736.0 12752.0 15704.0 kett 10016.0 died 10480.0 10724.0 10616.0 11140.0 11036.0 11544.0 nbout12124.0 I12000.0 12296.0 oclocFriday 12172.0 12300.0 ocloc ocloeh12756.0 ocloehFriday oclocorldn 16116.0 9596.0 orldn 10216.0 afternoon ntternoon11200.0 after nftor11028.0 nrt 11596.0 11532.0 16147.0 11720.0 16152.0 illness 11912.0 12712.0 ol 0112584.0 olfederal 01b os sfederal 1tral9616.0 9732.0 veral 10144.0 10272.0 months monthsDeceased 10880.0 monthsDc 9736.0 16591.0 16600.0 Deceased 16607.0 Dc 10504.0 ased 10032.0 10660.0 16631.0 WIlS10964.0 11348.0 native Itathl11196.0 ur11856.0 Mrtssa lrlMsnMdssa12156.0 Mrtssachusetts 12820.0 Mdssachusetts 12404.0 lrlMsnrhutItts 16788.0 16819.0 chusetts rhutItts10416.0 16824.0 10244.0 had10676.0 hn 11216.0 bttn10988.0 16815.0 11584.0 11864.0 12440.0 StnUfor Sm Smtor 12700.0 17040.0 17048.0 tortlw9776.0 10304.0 17055.0 pnst10172.0 1088.0 10768.0 twentyseen twentyseventwentt -1088.0 11672.0 17072.0 11436.0 11996.0 years lnrt hi12408.0 In18bO hilSSO inI 9560.0 17272.0 18bO lSSOISS010004.0 17267.0 hc9896.0 17299.0 came cmno10200.0 17276.0 Florida 11840.0 investing h1estlnginvestingan 12612.0 12720.0 lu IlJluan IlJnn 9552.0 17479.0 17523.0 nn9848.0 orange ornn 10340.0 17544.0 10540.0 17508.0 property IlrtJlfrt10388.0 11356.0 III11236.0 11612.0 11496.0 11980.0 vicinity 11868.0 Iclnlt -520.0 17515.0 oArredondo 12716.0 17491.0 oj17500.0 olArredondo ojArrtdolllto 17703.0 17708.0 Arredondo Arrtdolllto10608.0 Il10436.0 10836.0 10712.0 11084.0 haldtnld11664.0 Thl11404.0 12160.0 17715.0 Jlrowrt12032.0 propertyfailed Jlrowrtfallltl -600.0 12760.0 17915.0 17927.0 failed fallltl10208.0 17944.0 924.0 17924.0 materialize mnttrlallzl17951.0 any financial tlnallrln111964.0 financialbenefit tlnallrln1hllltnt 18151.0 benefit hllltnt10280.0 18148.0 whinWhllI10116.0 18180.0 10948.0 abandoned nhnIIlIOlnbandoneci11388.0 12568.0 and112396.0 and1the 12572.0 18175.0 nru nruHIl 12812.0 18360.0 18372.0 HIl9892.0 deceased INIaslt9804.0 10732.0 18380.0 went Wtnt10636.0 18375.0 11132.0 11448.0 Ocala 11364.0 whc 12548.0 12336.0 18399.0 12328.0 18396.0 12376.0 foi torto12456.0 foiisexeral -204.0 torlars toseveral 18584.0 18587.0 isexeral18623.0 jearslars 10688.0 10780.0 Ill11068.0 18611.0 TaSengaged clIgagtI11372.0 12244.0 12136.0 busl busi12384.0 busliff 12816.0 bu busit1e 12676.0 12784.0 lflfI 18796.0 iff t1eflfI flfIllnln 9904.0 9760.0 18856.0 71e 9876.0 18851.0 9872.0 9744.0 19023.0 19035.0 IiatliiK llnlnLtavtngOcnla Ocala10404.0 Irof11576.0 Joosktl12304.0 19039.0 return rturllreturned rturlllId19251.0 lId19275.0 10164.0 19247.0 Galnestville10028.0 Gllne 10844.0 lllt 10644.0 11272.0 nbout11052.0 eight llhht11732.0 12424.0 19271.0 12288.0 yearago 12428.0 12616.0 ari nnariago nnngo 19459.0 19511.0 ago ngo9984.0 19475.0 since slncl9836.0 10520.0 19468.0 10412.0 tllIt11000.0 11592.0 19463.0 11772.0 12152.0 12264.0 residedhere 12068.0 12268.0 resided rtsldtl12808.0 rtsldtlltrt 19680.0 19695.0 here ltrt19731.0 10232.0 19704.0 greater grcat 10840.0 19723.0 10656.0 19707.0 part lIart19687.0 11616.0 11516.0 11960.0 tlmtbeanengaged 12324.0 bean belnphlnbelnpengaged hlnllIgagt 19899.0 19911.0 19952.0 llIgagt 10316.0 IS10564.0 19947.0 10736.0 piano Illano11260.0 19923.0 tuner tllllr11180.0 anti11700.0 repairerHe repairerlie12064.0 repairer 19935.0 rtII -672.0 lrlr lrlrU 20135.0 He lie9788.0 20131.0 9684.0 beenn10152.0 10620.0 10532.0 20167.0 10400.0 10720.0 fOf11032.0 till10944.0 lnst 11712.0 11804.0 20140.0 20152.0 12100.0 12452.0 throtthrttthrotyears 12836.0 thrttfnrs threeyears 20340.0 20388.0 9660.0 fnrs 9996.0 20356.0 10364.0 10248.0 10552.0 20347.0 condition roudltlon11316.0 12016.0 would 11908.0 20364.0 noi 12500.0 noipermit nOI1Nllllt 20376.0 no nopermit 20580.0 permit 1Nllllt10224.0 20576.0 20568.0 working 10456.0 orklll 20564.0 hllugIII20592.0 very ery12112.0 20595.0 lr ithealth 12496.0 HIitillhealth HIhnl 20795.0 health healthDeceased 10072.0 healthIeceased 20816.0 9960.0 hDCCl 3076.0 9752.0 20999.0 21011.0 Ieceased21023.0 DCCl 10512.0 10256.0 Hd 21040.0 W35n11040.0 11548.0 21004.0 member 11344.0 21035.0 n1t 12216.0 Ulber 12332.0 orthtKnights tin HitthttinKnights HitKnl 9568.0 21219.0 21235.0 Knights 21240.0 Knl 10220.0 9972.0 ht8 9856.0 10332.0 21228.0 Pythian IthlnltPythias21223.0 nnelnud11232.0 11744.0 Odd 11624.0 Fellows 1ellows12060.0 Fellowsand 1ellowsand 12308.0 ell 12516.0 21259.0 21255.0 vInd 12688.0 21435.0 21455.0 IndlJt 10168.0 21495.0 10604.0 21488.0 21447.0 10692.0 11108.0 21443.0 musician 12252.0 12648.0 21476.0 accotnplished 12524.0 12652.0 ncaccompllshed nccOIllI11l14hld 21671.0 compllshed cOIllI11l14hldcotnplished21703.0 10492.0 21683.0 grtntdlal11248.0 21664.0 fur forthest thsthestlodges thslolt 12768.0 21883.0 21895.0 lodges lolt 21939.0 9800.0 10188.0 21900.0 III10444.0 21891.0 Ultlr10328.0 10940.0 work Ul11924.0 21915.0 wnsa21919.0 12416.0 12528.0 21912.0 man ruatlmat12364.0 manof ruatlof matunderstood 22100.0 22119.0 9840.0 22112.0 peculiarity peculiarities9712.0 IItculllrl -1024.0 10864.0 22115.0 tltt 10556.0 22107.0 hu22124.0 22103.0 whlu11948.0 understood 11828.0 understoodwas understoodwar22136.0 -836.0 12056.0 uthrs 12028.0 tnod tnodwnl 22327.0 wnlwar22331.0 w01l9880.0 10424.0 likedThe liked kt 10516.0 ktTho 10684.0 22555.0 Tho10156.0 22548.0 funeral turwrnl10056.0 10856.0 22543.0 10748.0 bt11144.0 held htlt11968.0 Sunday SundnrSundny11860.0 12672.0 nf nratnfternoon nrttrnoon atternoon 22791.0 ternoon ttrnoon22772.0 further furthtr11004.0 22767.0 mention lImlloll10920.0 11756.0 22760.0 at11668.0 12088.0 12140.0 12476.0 22763.0 wIl 12668.0 wIlMcClellan 12804.0 111 111bo 111ho 22971.0 22999.0 bo hohe22991.0 IUndlanticlater nttr22979.0 Robert KobertHobtft10932.0 12040.0 McClellau McClellanMcClellauwill McClellanICIl1t1l1 CIl1t1l1I CIl1t1l1Im 9572.0 23199.0 23211.0 Imwallhave hanIlave9860.0 10432.0 23207.0 ehnrgc10528.0 hllr 11076.0 lr11328.0 tht1152.0 arrangements nrrnngements11580.0 23220.0 arrangementsProm -1152.0 23227.0 nrrnn nrrnngementsIrto 23232.0 tlDt 23239.0 12580.0 12560.0 ntsI 23331.0 2300.0 23671.0 Prom rromIrto10104.0 23683.0 8ulldl -748.0 10852.0 23679.0 lltrDaily23675.0 SunThe SunTht 23887.0 Tht10180.0 23899.0 10064.0 tun rnl 10440.0 10884.0 23903.0 11676.0 11512.0 11716.0 23896.0 12012.0 23891.0 osklltosket12272.0 Foskettthe osklltth osketthe 9564.0 24111.0 9824.0 9936.0 sail saflInf110312.0 24120.0 death hmthur24115.0 hornwhotni11928.0 24143.0 curr Fri FrlPrlFrlday Prld 24327.0 24347.0 nftenuxninthruoou9644.0 10900.0 24335.0 10744.0 wilftle 11192.0 11296.0 24339.0 24375.0 htI11thtsnfferICttfnfferntxw ICttfnuon 24544.0 noon ntxwnuonIt24563.0 230 10588.0 10888.0 oclock nchxlc24551.0 11460.0 11608.0 24556.0 tltIUtrout24547.0 Ult11988.0 12536.0 Odtl Odd12388.0 OdtlFellows OdtlHnu OddFellows 9576.0 24771.0 24780.0 10376.0 Homo HorneHnu 24775.0 Rev Itev11488.0 811128.0 IIRogers ItOCtfSItofers11872.0 12704.0 24807.0 othe 12708.0 ojolth ojthfO 24983.0 thfO9724.0 First Ir 10352.0 Uajitlst lljII1Uaiitl25031.0 11220.0 rhurch24992.0 otllrlntln Uttfttlngetileintingetileintingthe -820.0 12728.0 otllrlntlnI UttfttlngI9748.0 25211.0 Thl9888.0 9828.0 10204.0 25216.0 IK hdn 25247.0 RmemWrmtrulltlruj ujI 25255.0 li 9488.0 25327.0 25428.0 25519.0 tht9504.0 Knttht25431.0 tit10596.0 Pythias Irthhuland11604.0 12116.0 skid12552.0 Fl 12436.0 FlLOWS 12556.0 12636.0 12772.0 1lows 25643.0 lows low10096.0 25688.0 HS IUAS10260.0 25647.0 10624.0 10716.0 25683.0 10916.0 11120.0 theof 11376.0 25676.0 lit 11164.0 11332.0 11536.0 11620.0 ebekab 25652.0 rtM 12192.0 knb 11848.0 degree degreeof rthl 25863.0 thl10184.0 25871.0 tOO 10228.0 010664.0 10508.0 25867.0 10980.0 HunntMr utitnbe11044.0 mbtfll 11896.0 11832.0 25895.0 or12340.0 Muutl1eixxt 12224.0 12344.0 Mount MuutlMountVeiHHi 9580.0 26079.0 26095.0 VeiHHi 1eixxt9708.0 26127.0 lno 26091.0 Ix JA26087.0 lodttN No 11268.0 26099.0 2i 11124.0 26111.0 Kn1 IntKnight 26131.0 Rht hb 01ofPA 12480.0 PAtftliB 12780.0 ltl1IU1 12660.0 ltidnS 26172.0 tftliB l1IU1tidnSCenter CVutirCutfr26303.0 MHljte rlRrtJat 26295.0 11552.0 11680.0 11toOU 12276.0 12148.0 026315.0 Fiuul 12764.0 Iu 26523.0 26559.0 iuul OU 9816.0 ColfHX CoUIColfaxReNUh ltetMkas26527.0 tkab 10764.0 iodltr 11568.0 XM od3 26531.0 So 26539.0 26535.0 tO0 tIO 12796.0 26743.0 26747.0 0O0 026775.0 Art10728.0 rptju rewurPQufItd ntd 26759.0 11320.0 26763.0 hl26767.0 tnrtt mtmret26779.0 12484.0 tI le leI 9496.0 26952.0 26959.0 koohr kwlt9520.0 26991.0 trotxt tCo 11012.0 26964.0 Unit 14tttt26979.0 th1lt 11400.0 11560.0 11780.0 lUok nADk1Ltuk26987.0 12180.0 lt1for lI tp 27131.0 27212.0 9784.0 tot 9664.0 9796.0 27176.0 fec9844.0 10124.0 27171.0 10592.0 27207.0 iurtxrr 10872.0 urpu 11412.0 utS 27183.0 27203.0 atte 11652.0 tti 12008.0 ittcci ltutentf 12632.0 rfur 27355.0 27391.0 futt tutentf27400.0 ml 9820.0 10268.0 ami xttd10472.0 27407.0 pr1mt pytagtbrir thtUtLr27412.0 27451.0 fC 12492.0 27475.0 etetin tto 27612.0 27631.0 in9812.0 27615.0 10068.0 clM dtcee 10812.0 10868.0 broth brothrrbcother11768.0 27619.0 Tlw Ttti12320.0 orfort12164.0 onollklal 12544.0 orI 12696.0 27667.0 rI 27831.0 AN 9524.0 ollklal otUalotlktei10876.0 27887.0 10908.0 10912.0 27836.0 tun11168.0 fullMRS 27843.0 dttre4nerrytrst 856.0 atttlI4btt dttre4neatttlI4bttt -856.0 28051.0 28072.0 rrytrst rta 10368.0 28207.0 2720.0 28487.0 28583.0 28495.0 MRS 28491.0 JOLLY JOLL28499.0 BURNEDFarther BURNED BURNEDFurther BURNEDI BURNEDF28671.0 28927.0 Further Farther9808.0 28931.0 rther Partku PrkuPartkut11116.0 n11384.0 28943.0 11660.0 28947.0 Sad SidAeci AeelAeciI AeelI28999.0 12564.0 29135.0 9756.0 dent ent 10212.0 29147.0 ef el29183.0 eo 1012.0 10468.0 Wet1Krwn 10300.0 29155.0 Wel Wetot Kn 29191.0 notINn 29195.0 wn WdeLJldy12108.0 LadyTin LadyTAB 29300.0 IITin TwTAB9528.0 29407.0 SUDSte10040.0 29443.0 10800.0 10848.0 11184.0 29455.0 11224.0 Ur Ura 11760.0 Ko 12048.0 29451.0 tlCMltA tlCMltAMtkQ tvoptAiad tvoptAiada 29655.0 9764.0 totes MicMtkQ29647.0 la to10524.0 10628.0 29627.0 Utt29635.0 sect offrct29671.0 29679.0 fCt 29639.0 tiut t1uttAtttMnMrihUe Bolleladlexmlns:ns6 ID33 11940 3432 12920 14296 ns6:type 13008.0 14296.0 Jolly Jo11 13412.0 13608.0 14336.0 13304.0 13844.0 13692.0 wellknown 14168.0 14228.0 14764.0 14916.0 lad 15396.0 15144.0 15696.0 14308.0 Waldohad 16215.0 Waldobad 14520.0 bad14524.0 13984.0 14527.0 seriously slrlously13828.0 14860.0 14532.0 burned 14708.0 15612.0 15416.0 16016.0 14536.0 15868.0 thefollowing 16264.0 13020.0 to11owlng14024.0 14751.0 trumfront14600.0 14756.0 14912.0 15832.0 14760.0 News Newsgives 15963.0 ews ewsglvcs 14967.0 gives glvcs13548.0 13440.0 13904.0 14972.0 particulars IJartlrulars14892.0 14979.0 15148.0 15048.0 15004.0 mosl16040.0 14987.0 deplorable 15935.0 16044.0 de 16228.0 1644.0 15191.0 plorable 13779.0 15196.0 misfortune misfortuneThe 14660.0 2984.0 15415.0 13764.0 15435.0 13604.0 14304.0 horrible 15100.0 15427.0 accident 15948.0 15788.0 thathas 16272.0 15639.0 14148.0 15644.0 14440.0 15651.0 14884.0 15464.0 15524.0 15687.0 15688.0 yearswas 15932.0 15695.0 tars tarswns wns13324.0 13152.0 tts 13112.0 13467.0 13320.0 13868.0 15863.0 accidental ncrldpntnl13732.0 14844.0 burning 14692.0 15608.0 15880.0 15472.0 15916.0 15883.0 MrsHelle 16212.0 16004.0 15887.0 lr5 16084.0 Helle lillleBelle13536.0 13432.0 J01l 14040.0 last Ja 14328.0 14276.0 16111.0 14184.0 Frlda 14964.0 15072.0 16099.0 14864.0 afternoonMrs afternoonlr8-780.0 2972.0 13296.0 16304.0 16308.0 lr813740.0 13600.0 Jail 14128.0 14232.0 14028.0 14620.0 16316.0 standing 16323.0 before IJPQre16328.0 15924.0 thefire 16268.0 16528.0 fire 13488.0 13836.0 13628.0 13916.0 13967.0 13976.0 14036.0 14004.0 room 16544.0 upstairs uIstalrs16552.0 15544.0 16008.0 15844.0 herfathers herallwrs 16752.0 fathers allwrshOIl whell14016.0 14808.0 l1Pr16764.0 dress 15068.0 Ire 15508.0 16804.0 15403.0 15664.0 16771.0 became lJramtbecameignited -604.0 16224.0 3328.0 16908.0 16971.0 ignited Ihnltd16976.0 hr13584.0 14064.0 13920.0 16983.0 hurlllllghttrulufi15080.0 16988.0 hrand brand14928.0 15683.0 17031.0 16024.0 16995.0 thlthehearth 16928.0 Ihearth 16348.0 17195.0 hearth 13656.0 17204.0 spread sprpall13972.0 14715.0 17207.0 15168.0 17216.0 urh15623.0 17219.0 rapllity radltyralldity15628.0 rapllitybefore radltybpforl 17419.0 bpforlsl1e17424.0 could 13944.0 14636.0 17428.0 descend dfsr11I114496.0 15428.0 17436.0 tht15276.0 15816.0 stairsthat 15676.0 15820.0 stairs tuhsIthat 17628.0 17640.0 13444.0 13348.0 clothes Iothes13700.0 14452.0 17679.0 Wlrl14364.0 11115208.0 17691.0 15495.0 17660.0 fir 15752.0 wlltn15660.0 whensh 17655.0 ishe 16344.0 islip 17864.0 sh slip she13180.0 13384.0 reached rlarhireachd13884.0 17900.0 17867.0 11lr14480.0 17871.0 mother motHrtnntaer14384.0 15200.0 17879.0 15620.0 assist assistl16260.0 15888.0 htd 15648.0 16180.0 Iby IlJy 18083.0 lJy18091.0 13196.0 13560.0 18088.0 L 13664.0 13800.0 King hint14316.0 14728.0 18095.0 heard l1lardchp15172.0 creams 8rpnmsscreams8rpnmswhll Iwhile 13024.0 18303.0 while whll13572.0 18312.0 passing pnslng18319.0 succeeded succeeed14172.0 18348.0 SUlc 15140.0 14776.0 18355.0 14668.0 14812.0 14816.0 rlId 14852.0 15256.0 15512.0 wrapping fUJlIllIgwrapiingwrappinga fUJlIllIgnwrapiinga18527.0 nlargo Inrgelargerug 13660.0 14204.0 lurhtr14640.0 ttin Ixtinextin15672.0 extinguished 18579.0 ttinguished 18724.0 guished hrtll 13364.0 hd 13256.0 13760.0 lh 14008.0 14120.0 18755.0 firllire14528.0 hut14380.0 18787.0 too 14779.0 15252.0 InteInlt18799.0 15912.0 18815.0 saveher 15804.0 save 16076.0 18847.0 18972.0 19008.0 13168.0 18975.0 frightful 14700.0 burns bumsbursts15268.0 15164.0 15576.0 18999.0 diffinnt dltfrtllt15452.0 diffinntportions difkrt 16056.0 19196.0 portions Ilorllons14044.0 hflr14412.0 body bOllybodyi bodylbOllyIrs 1540.0 12928.0 19384.0 12932.0 19451.0 12960.0 19420.0 Irs Mrs12952.0 Hicks 14324.0 bUfned14216.0 14996.0 19432.0 11tr14876.0 15364.0 19439.0 hands 15944.0 bad 15836.0 badly 19579.0 Ilr 19632.0 ly 13276.0 19639.0 13044.0 meantime nntlme19675.0 14696.0 19659.0 Dr 1r14032.0 19663.0 Boring 15967.0 15848.0 wassummoned wasI 16100.0 19711.0 ts 3420.0 Isummoned summonltlImmediately ImmldlnlI13888.0 15204.0 19887.0 uIII15640.0 15484.0 16072.0 15920.0 a1l1 a1l1tosflhll 19907.0 IjMMrlble 19836.0 IIKtsrible 20075.0 20080.0 jMMrlble tosflhllIKtsrible13752.0 done Ilone14208.0 20104.0 14432.0 relieve relll 14988.0 14772.0 To1lywhoIs whotIIs still stili13140.0 critically rrltka1l14552.0 20311.0 III14424.0 20320.0 14888.0 20352.0 20328.0 effcts rrtl15580.0 effctsThis 16220.0 20379.0 off 15747.0 15740.0 Thl13496.0 13372.0 13736.0 OIl14096.0 20535.0 second lOIIlJsccond14744.0 daughter dauqhterctl1uRhttr14156.0 15604.0 15488.0 15976.0 nUllandJin 16256.0 nUllj andfirs 20828.0 firs Jin12948.0 13108.0 13328.0 D 13208.0 13728.0 13588.0 baw14180.0 20759.0 hnd14648.0 20763.0 bUfnttJ15024.0 15807.0 15980.0 20792.0 15896.0 allwill 20971.0 nwrnber rmtmberrrntemberthl20980.0 sad 14540.0 atllHtrnln 14956.0 20987.0 burnint15480.0 15588.0 thrirbeautiful 15884.0 tlwlr thrir16032.0 tlwlrbtnutlCul Mrbeautiful beautiful btnutlCul13876.0 13744.0 14476.0 21199.0 tlftuhter15376.0 lIssIIss15212.0 15871.0 Lola 15744.0 Lolaten Lolattn ten ttn13340.0 13260.0 tnrs 13852.0 21419.0 14340.0 amenmO15236.0 hoiiM15160.0 hou 21479.0 15856.0 Tlvy ThfYThvTlvyhave ThfYhl 16247.0 hate13392.0 21640.0 sympathy mJlathysympatlty13632.0 14688.0 21652.0 14596.0 14920.0 14836.0 alli 15116.0 allSTATE 22003.0 2484.0 13376.0 22071.0 STATE 22079.0 AID 13992.0 22088.0 FOR 15000.0 22091.0 SCHOOLSApplication SCHOOLS SCHOOLSI 22512.0 940.0 Application 14200.0 22519.0 Has 13952.0 Been 14500.0 15388.0 Made 15132.0 16048.0 forSchools 16275.0 2304.0 22731.0 Schools 22743.0 14080.0 Alachua County 15084.0 CountyFrom CountyFront 2184.0 22987.0 JrornFront13552.0 Sundays13448.0 Sll1d -720.0 14272.0 23047.0 Inily14656.0 23008.0 StintSunApplication 15192.0 12924.0 23131.0 13192.0 IllimtlonAppiicatlnu14288.0 23223.0 14664.0 Stat14512.0 23235.0 aid 23271.0 15467.0 15344.0 23247.0 furtJEtle15864.0 theschools tJEshool8 tleschools 16232.0 23427.0 schools shool823435.0 23431.0 Allchln14800.0 count ottnt14672.0 county 23459.0 15336.0 bfiled bn bntiled 1468.0 23648.0 filed tUtdtiled23651.0 whlrh14104.0 23663.0 atInterest Illterfst15332.0 23699.0 15591.0 Iht15956.0 23731.0 11tO 11tO1tt 23740.0 16132.0 23735.0 ople opie 13004.0 23867.0 pie ple1tt23875.0 ot13244.0 13652.0 23872.0 tlwtits13520.0 14564.0 14903.0 TIH14456.0 23935.0 apportion AIIICrtloIlapKrttem15224.0 apportionmem apKrtteminent 23995.0 24096.0 mem rnlntinent13528.0 ot13808.0 13680.0 tbl13956.0 24103.0 school fchootschools14056.0 14880.0 III15123.0 24155.0 15292.0 followsfollowsGainesville 15992.0 15420.0 followGainesville foUo 12920.0 24227.0 916.0 24311.0 nnlntsl1lt14176.0 24323.0 atd andWJdo14467.0 24332.0 15180.0 1I1 24356.0 schixls 1hodl1schoos1hodl1i 1hodl1rschoosC24539.0 6 C61M 13176.0 13300.0 13232.0 io 13344.0 13492.0 24535.0 lftda14088.0 Hawthorn IirtWthorn14091.0 thorn 14264.0 15096.0 Inland hllndisland24575.0 Grove GroeGroeKoettelle 15876.0 rot rotI 24747.0 24859.0 13000.0 Koettelle ltoebelfe12940.0 24751.0 13716.0 13316.0 btlll 13860.0 24756.0 A1lcbunAlnehunHigh JUgh14508.0 15156.0 Springs Srln 15776.0 15708.0 24828.0 15584.0 24804.0 ioach 15984.0 16183.0 0each 16188.0 24840.0 III1th 24975.0 oachII1th13556.0 13360.0 LaCrosse lnCossCrosse 14435.0 Trenton TrNtnnTretltlnrind15104.0 25019.0 N Ntwh 25023.0 br hrbrrv hrr 16151.0 25059.0 25199.0 rv ry13160.0 42 13072.0 25231.0 td13620.0 25207.0 oHrhACh13648.0 oHrhThis eachThis 13832.0 AChi 25419.0 ThhftipmprUtk ItlllIJOIrAUonKpprniriatlon14832.0 14752.0 15040.0 wil1kill25491.0 jnno Irnrn 15559.0 25507.0 alr aRret Rret 25667.0 iit 13164.0 thine thtncthll frfor13872.0 25664.0 thtt 25679.0 thou 25707.0 25712.0 fhno 25724.0 hxi 15368.0 15300.0 15400.0 kh khr 16176.0 hr 13228.0 13476.0 favtri 13524.0 25903.0 14072.0 13988.0 n1 14488.0 thO25907.0 tri 14948.0 15380.0 25955.0 15504.0 25939.0 s15440.0 25912.0 15568.0 andtrots 16027.0 25948.0 TI TIr 1trntJIi 16059.0 1608.0 trots trntJIi26124.0 API ai 13748.0 13672.0 ro f26119.0 IT lt14247.0 Ituxmlns:ns7 ID34 11876 3228 16408 14315 ns7:type 2284.0 16852.0 14315.0 14320.0 Attention 17779.0 Stonewall 18711.0 Camp CarrpCanp18591.0 CampYou 18715.0 CarrpYou CanpYou 16587.0 You 16972.0 16896.0 17288.0 14763.0 requested requlsted18164.0 14768.0 18087.0 meet 18320.0 18864.0 18792.0 18899.0 19068.0 14804.0 18988.0 19399.0 14787.0 afvllle 19448.0 14784.0 Pj Pjille 19512.0 aville 16408.0 15016.0 vllle illeville16876.0 15028.0 Monday 16967.0 Ionda 17512.0 15032.0 17412.0 18416.0 Jan 18292.0 18839.0 618704.0 atj 18903.0 16420.0 16700.0 16576.0 15259.0 Pensions PenslonePenslon17256.0 acid asdnlid18240.0 18775.0 01 Olof18651.0 Olters 18912.0 19288.0 18908.0 19412.0 tl19312.0 tlters 19520.0 uters 16416.0 15463.0 ters 16832.0 16724.0 17160.0 17504.0 15483.0 welfare 17408.0 18220.0 18484.0 tbe18384.0 18740.0 cbe 18896.0 19472.0 lbe 19523.0 15699.0 16696.0 discussed 16596.0 17700.0 By 17456.0 order 17908.0 18448.0 ofHORATJO 18700.0 ofHORATIO 16820.0 15928.0 HORATIO HORATJO17768.0 DAVIS DAYIS18472.0 Com Corny18335.0 ComJNO 18916.0 ComJ CornyJNO 2348.0 16580.0 JNO 16940.0 16828.0 16651.0 17316.0 MGREW lGREW17180.0 18215.0 Adjutair AdjutallAdjutan18080.0 AdjutairGalnesUlle 18927.0 AdjutallGnlnesl11e AdjutanGainesville -660.0 18876.0 2220.0 16376.0 GalnesUlleGnlnesl11e17676.0 Fla 17495.0 18156.0 16391.0 Doc 17935.0 16388.0 20 20Hir 18812.0 20HEATERS 20I 20lIE 16887.0 16584.0 17168.0 HEATERS 964.0 17176.0 lIE -2876.0 17444.0 AT 17364.0 18424.0 18732.0 RS 18608.0 RSc 2032.0 16903.0 18659.0 17024.0 Hir lur16952.0 17156.0 18719.0 17304.0 Store BtureStun17268.0 18520.0 18668.0 Hca HlFL1Hcaquarters 18935.0 Hlll1arhl 18532.0 FL1tllalttIs 16912.0 18931.0 18955.0 quarters ll1arhltllalttIs17928.0 f0117756.0 18392.0 Sto StovStoHeaters StOt StOtHeaters StovHeaters 2592.0 16760.0 Heaters 17960.0 BornOil BurnOil 19348.0 18656.0 19656.0 Burn Born19352.0 16536.0 20255.0 Oil 20272.0 Wood 16920.0 18192.0 20287.0 18023.0 Coal 18736.0 CoalIf 19504.0 16800.0 21127.0 21135.0 17132.0 16963.0 17332.0 lt1 17683.0 want 17848.0 tlnt 18204.0 18388.0 21159.0 tw18200.0 21144.0 18720.0 21151.0 119151.0 19108.0 118976.0 1grt 19188.0 19440.0 19339.0 1get rgpt 19516.0 16527.0 get gptgrt17076.0 tIll17388.0 21471.0 famous 17747.0 21527.0 mnons -688.0 18435.0 LIIV LI 1119228.0 IV 19156.0 IVAK 19376.0 Y 19260.0 21755.0 21763.0 16656.0 lA 16868.0 16720.0 AK 17084.0 16980.0 21787.0 17644.0 18463.0 21772.0 18284.0 halll 18848.0 19144.0 11lit 19147.0 Ilor 22047.0 lor16740.0 22127.0 16816.0 16992.0 firtlr17367.0 bed 17196.0 17371.0 bedroom bedroOJn17732.0 17839.0 18807.0 1i 1i1n 19284.0 Pi 19100.0 rf 19020.0 rfin 22363.0 16732.0 22427.0 1n 16619.0 22432.0 16728.0 16884.0 22396.0 conlruction Ctt11tIUCt1U1117128.0 l1otrtlct -1052.0 18179.0 ion 17820.0 alllC1111dull andfro alllCandfroluitimi 19036.0 22475.0 lIhnotilln 19179.0 2444.0 22668.0 luitimi hnotilln1111dull22707.0 17292.0 17788.0 gases 17636.0 18508.0 fromcoal 18980.0 fromcnal 2764.0 16524.0 22984.0 coal cnalhahay16924.0 23080.0 more 17532.0 18272.0 23015.0 hcAting hcatinheatirehcAtingface 19080.0 19256.0 23075.0 tIfH tfact 23292.0 face factfH 23376.0 23304.0 than 111nn16892.0 23379.0 un 17952.0 18064.0 23328.0 heater Hcator17807.0 Hent 18788.0 18568.0 23391.0 18559.0 23311.0 ma1 11111Iralma1luavy 19292.0 11111hla IralhtaVV 16540.0 luavy htaVVhla 17151.0 23655.0 cast catclst16888.0 23631.0 fowl 1owl10wl23639.0 nndfluI18408.0 andhoilv 18967.0 fluIilnpos 23667.0 tbnl1ynlmost 19215.0 1448.0 bnl1ynlmost 16548.0 hoilv -1436.0 23927.0 almost 17032.0 impos itnposilnpos24048.0 18871.0 ililurn ilit ili19123.0 ilitlltlu 24212.0 1urn lltlulurnnut24303.0 tftP t4I17892.0 18052.0 18296.0 nndlwtt1ltft 18692.0 bott lwtt19192.0 bottdraft bottdmt 2808.0 16532.0 24523.0 draft dmt1ltftdoors doorlours17008.0 17740.0 18084.0 18256.0 regulutt regulattregultitt17940.0 19220.0 24595.0 Pfluat lhlat 19268.0 Pheat heat luathlat17247.0 24855.0 nickels nickehdnickllt18012.0 24879.0 18128.0 1080.0 24875.0 footraili1 footraili1trii -1080.0 19320.0 footrai footrail24939.0 aBaird 19252.0 996.0 25143.0 trii triiBaird 25192.0 16792.0 25235.0 17211.0 25163.0 I1g 19608.0 25719.0 Baird 1140.0 17352.0 25743.0 Hardware 17136.0 18679.0 25739.0 Comp CompyComp5YI18491.0 xmlns:ns8 ID38 4828 7016 12912 26603 ns8:type 19508.0 26603.0 26663.0 19636.0 26899.0 26983.0 16000.0 BABYS BABY5S17220.0 XMAS 18123.0 27059.0 GIFT GIR17912.0 GIRa GIFTaGIRVYJ 19612.0 27555.0 27639.0 41 at14516.0 14992.0 27824.0 15064.0 27691.0 27703.0 27767.0 1424.0 27751.0 17144.0 17420.0 27719.0 27723.0 iok 18279.0 27791.0 18644.0 27731.0 ak 18784.0 akd 14680.0 15108.0 2292.0 16836.0 27931.0 27947.0 27943.0 tipCl 18696.0 27983.0 28027.0 VYJ 14724.0 28060.0 28047.0 16312.0 28075.0 16664.0 gal 16668.0 16856.0 28099.0 28132.0 17307.0 17384.0 17555.0 I28084.0 Irgairnbnut rJ -896.0 18867.0 ifonlltr 18068.0 19040.0 19279.0 art 19344.0 27987.0 28171.0 28199.0 15012.0 Itt IMt28223.0 28235.0 15960.0 16020.0 28239.0 x16144.0 16568.0 28255.0 rA 16704.0 28275.0 16784.0 28227.0 17044.0 17119.0 28271.0 tIO 17100.0 28283.0 17243.0 17360.0 28263.0 17559.0 28291.0 fI n17600.0 28251.0 vtlac 17967.0 18332.0 Jeen 18552.0 aIIo 18940.0 28203.0 28371.0 28387.0 28415.0 tL lri 14940.0 15091.0 15320.0 28356.0 28380.0 28399.0 niNr 16244.0 16036.0 28407.0 16440.0 lhP16356.0 thIrbil 17064.0 28447.0 cr 28403.0 28443.0 f28467.0 17651.0 28431.0 3rt 3rtIU 19012.0 Ipan pan 15076.0 15424.0 28587.0 28527.0 15448.0 15772.0 28595.0 tfJf 15812.0 16136.0 16431.0 28604.0 28568.0 28580.0 tite 17463.0 28635.0 17392.0 17632.0 28623.0 28643.0 l17728.0 wit Neill18523.0 28599.0 Iil1t twiai1R 28727.0 q 28691.0 14747.0 15128.0 28687.0 tttll 15288.0 28715.0 iU iUp 28759.0 16743.0 28787.0 i1R17252.0 28783.0 11114616.0 28895.0 14848.0 28867.0 28883.0 28871.0 lilfil11 28887.0 15779.0 16500.0 16612.0 ii16616.0 uL 16708.0 llt lltT 18032.0 28792.0 51 18376.0 29040.0 SI 28795.0 Up UpL 19408.0 29343.0 14840.0 29351.0 SMITH 14984.0 GainesYille12912.0 30367.0 19828.0 31375.0


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN00034\ocr\0487b.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:16649
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.2228
splitwords:0
ScansoftOCREngine Character Count:13237
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:15068
Abbyy6OCREngine Character Count:14867
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;14867;3312;42.5637;83.267
language:en
ScansoftOCREngine Predicted Accuracy:60.25%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:5571
ScansoftOCREngine Character Error Ratio:0.4719
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;15068;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:83.27%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:83.27%
ImgPrep Component Range:15227,16649
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;13237;6247;0.735212;60.2466
noPunctuation:1
ImgPrep Component Count Low Estimate:15227
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 20.0 ID4 10.0 ID5 23.0 ID7 53.0 ID8 38.0 ID9 16.0 ID10 14.0 ID11 11.0 ID12 12.0 ID13 8.0 ID14 13.0 ID16 34.0 ID17 29.0 ID18 18.0 ID23 27.0 ID24 46.0 ID25 49.0 ID26 35.0 ID27 19.0 ID28 15.0 ID29 28.0 ID30 24.0 ID32 7.0 ID35 42.0 ID36 36.0 Layout Page ID1 HEIGHT 31412 WIDTH 19340 PHYSICAL_IMG_NR 10 PRINTED_IMG_NR 8 PROCESSING PrintSpace 30808.0 19184.0 HPOS 92.0 VPOS 380.0 PC 0.83269995 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1748 18272 164 380 ns1:type simple language en TextLine 204.0 1464.0 3896.0 String 40.0 500.0 CONTENT z WC 0.8095238 112.0 96.0 4004.0 448.0 t SP 80.0 3924.0 48.0 56.0 4268.0 436.0 v 168.0 4100.0 572.0 4788.0 Jif 464.0 4324.0 JifrTp -572.0 5360.0 52.0 44.0 17592.0 612.0 STYLEREFS < 0.82539684 76.0 84.0 17895.0 768.0 a 1084.0 3536.0 164.0 876.0 1128.0 rTp 104.0 72.0 3628.0 1104.0 ALTERNATIVE I2336.0 1292.0 364.0 12716.0 5720.0 1764.0 268.0 628.0 1792.0 THE TIlE292.0 2056.0 6496.0 1808.0 GAINESVILLE GAINEsrILJE148.0 6348.0 580.0 8704.0 1848.0 SUN SIfN152.0 8552.0 272.0 1700.0 9508.0 1856.0 DECEMBER 224.0 9284.0 256.0 316.0 11300.0 1872.0 30 SO81111208.0 252.0 600.0 11848.0 1876.0 1907 H07232.0 11616.0 228.0 1896.0 1 -600.0 12448.0 376.0 12076.0 1O7 144.0 11932.0 216.0 18011.0 1836.0 5560.0 12452.0 128.0 18396.0 336.0 18060.0 xmlns:ns2 ID6 24696 3336 292 2396 ns2:type 696.0 2268.0 844.0 2396.0 2264.0 IFciruNo IFciruNotiers -2264.0 3108.0 416.0 288.0 888.0 2660.0 VS is-2220.0 408.0 304.0 1312.0 2620.0 OF 0.96825397 136.0 1176.0 488.0 1324.0 1788.0 2508.0 CITYAND 172.0 1616.0 CITYANDQOUNTYCONDENSEI -1324.0 3112.0 432.0 584.0 2564.0 CITY 0.95238096 -1320.0 440.0 560.0 2552.0 AND 176.0 2376.0 ANDCOUNTY -560.0 576.0 2736.0 856.0 3040.0 1000.0 3127.0 COUNTY 2632.0 860.0 QOUNTYCONDENSEI -996.0 QOUNTYCONDENSEIIters -2632.0 3492.0 480.0 1624.0 1968.0 CONDENSED -1524.0 CONDENSEDHers -1624.0 3592.0 248.0 2216.0 3804.0 200.0 3852.0 Interest 196.0 476.0 3064.0 Gath Gatl2984.0 Gathered -476.0 3540.0 468.0 3068.0 -472.0 420.0 Gatlerect -468.0 1376.0 760.0 3915.0 184.0 344.0 4000.0 tiers HersIters944.0 1184.0 ofGeneral 1188.0 of -940.0 2128.0 716.0 1420.0 General 64.0 1356.0 296.0 2076.0 948.0 4168.0 208.0 4248.0 ered erect1384.0 4236.0 by 324.0 1688.0 4220.0 Our 1592.0 924.0 2100.0 Reporters Eeporters88.0 2012.0 EeportersRSONAL -924.0 3024.0 ReportersRSONAL ReportersI 156.0 4428.0 I 588.0 3012.0 4691.0 ITEMS ITEMJITEMITEMJt ITEMSatITEMat-588.0 3600.0 676.0 2144.0 4724.0 SOCIAL 1204.0 740.0 4776.0 624.0 4804.0 RSONAL 1564.0 1364.0 2152.0 1452.0 5188.0 792.0 5244.0 Happened 2408.0 5224.0 and 2244.0 2856.0 5200.0 What 160.0 2696.0 140.0 32.0 3464.0 ing 3296.0 3468.0 -28.0 3496.0 ILng -36.0 3504.0 Is IsQlng -136.0 3604.0 524.0 764.0 5312.0 5351.0 at 120.0 824.0 -52.0 280.0 1008.0 Has 132.0 320.0 2944.0 604.0 5436.0 424.0 Lng 1988.0 5508.0 Told 960.0 1028.0 2436.0 5504.0 In 2352.0 2648.0 5479.0 Short 2568.0 388.0 3160.0 5467.0 Para 3080.0 ParaLphs -388.0 3548.0 Paragl1phS 3164.0 Paragiphs -384.0 1212.0 700.0 328.0 5616.0 Qlng 5628.0 ng -152.0 124.0 1096.0 5583.0 to 68.0 Happen 1236.0 356.0 2988.0 5708.0 496.0 Lphs 684.0 5860.0 gl1phS giphs-416.0 1100.0 180.0 1196.0 5836.0 So 1476.0 5812.0 That 100.0 220.0 2036.0 5784.0 He 2316.0 5768.0 Who 60.0 2256.0 2732.0 5752.0 Runs 240.0 3244.0 5736.0 Ma 3140.0 MaRed -240.0 3484.0 3248.0 May Maj-236.0 300.0 MajRed -344.0 MayRlild -300.0 1604.0 6056.0 6124.0 Red Rlild108.0 1164.0 6108.0 It 988.0 1372.0 6092.0 1272.0 1612.0 6076.0 The 1508.0 1996.0 Sun 1908.0 Sunelude -304.0 2300.0 212.0 1580.0 940.0 6364.0 708.0 6412.0 Fridays Frida -708.0 1648.0 1408.0 6448.0 > 0.0 1448.0 6436.0 18 -8.0 1456.0 452.0 6368.0 Daily 2220.0 8un8unCLude 2520.0 SunClude 332.0 2904.0 704.0 6480.0 428.0 6644.0 CLude elude01 -392.0 1132.0 360.0 6615.0 Dyal 1656.0 6603.0 oC1572.0 1852.0 6560.0 Fernandlna Ferml11dlnaFernandina2880.0 6548.0 2792.0 3100.0 6540.0 3008.0 3344.0 6536.0 th 3252.0 thiv -160.0 264.0 the theIl -264.0 3608.0 thv 3524.0 6576.0 192.0 1768.0 6768.0 6835.0 2032.0 6808.0 his 1912.0 2380.0 6787.0 aunt 116.0 2916.0 6776.0 Mrs 2744.0 MrsIhlstetu -320.0 3236.0 3412.0 H Hl61Il -140.0 3552.0 HHMeh 6772.0 -148.0 3560.0 992.0 664.0 6844.0 6912.0 iv 736.0 6932.0 -64.0 800.0 868.0 6908.0 in 932.0 Il n-80.0 1012.0 1124.0 6892.0 1332.0 visit 1208.0 608.0 7080.0 HMeh Ihlstetu512.0 HMehW Ihlstetuh1328.0 1036.0 7132.0 l61Il -244.0 1280.0 l61IlB -292.0 1344.0 7171.0 2884.0 724.0 7260.0 7379.0 W 788.0 h -100.0 1056.0 7352.0 E B536.0 7316.0 Moluar folnarlolaar7292.0 left 1880.0 820.0 7263.0 yesterday esterday2292.0 3360.0 for foifo3228.0 foijrd -248.0 foranlld -192.0 foaup 688.0 7488.0 348.0 7580.0 anlld 7620.0 aup -348.0 812.0 jrd 912.0 952.0 d -84.0 1192.0 7563.0 where 1032.0 308.0 1320.0 here hlle-308.0 1628.0 1744.0 7528.0 she 1824.0 he -172.0 2104.0 7507.0 will wlll2512.0 7495.0 spend 2400.0 2992.0 3304.0 few fen3192.0 fewwlth -252.0 3556.0 fenyw1th 236.0 1200.0 752.0 7760.0 456.0 7800.0 yw1th 340.0 wlth -340.0 1288.0 relatives relativesj0n -664.0 1952.0 relativesJ11 relativesJun2876.0 732.0 7972.0 j0n 8100.0 J11 Jun-224.0 956.0 1076.0 8063.0 F 516.0 8027.0 Staglo Seagic1156.0 1336.0 8048.0 S -512.0 1516.0 agle 1972.0 8015.0 has 2364.0 8032.0 gone 8000.0 2752.0 3168.0 7988.0 Palreaa 3172.0 Pain PalmPalr3516.0 384.0 Painleao -436.0 Palme31 2548.0 8220.0 8235.0 onVi 8316.0 011 om1360.0 1172.0 1472.0 8252.0 Islt1924.0 8259.0 1812.0 2184.0 8240.0 2064.0 2528.0 8228.0 parents 2412.0 3324.0 Mr Mt3152.0 MrIrs -232.0 Mrd Mtd 880.0 756.0 668.0 8020.0 8344.0 leao eaa692.0 8356.0 e31 -212.0 904.0 352.0 1072.0 fi 748.0 8396.0 8548.0 8528.0 Irs ire260.0 1232.0 1112.0 8488.0 V 540.0 1724.0 8464.0 Seagle 1588.0 Seagleo -540.0 SeagleQ1e1t 532.0 1728.0 SeagleOllrt -532.0 2260.0 832.0 8708.0 8780.0 Ollrt Q1e1t836.0 8836.0 o -312.0 1148.0 ert 1256.0 8764.0 Pope 8788.0 pc -164.0 284.0 8740.0 aud2148.0 8728.0 sister 2780.0 8711.0 Miss 1lfiss2600.0 3292.0 Li1 Li1ire -176.0 Liz Lizsre Liz1Ie 2688.0 872.0 8936.0 9040.0 ire sre1Ie8996.0 1048.0 620.0 8967.0 tUocUy ecltr8948.0 -620.0 1992.0 1528.0 9008.0 e 1428.0 1704.0 city 1596.0 2088.0 8960.0 from 2572.0 Fort 2468.0 3048.0 White Whltt2952.0 Whiteof WhitetsWhltttt2700.0 864.0 9144.0 9264.0 ts tt1016.0 9220.0 thelVauut 1168.0 9200.0 thel -748.0 1984.0 1736.0 uut 1500.0 2092.0 9187.0 2516.0 9180.0 R 2772.0 9175.0 B 9168.0 Peeler 2892.0 PeelerdtalnC -536.0 Peelere Peelert2788.0 772.0 9356.0 648.0 9472.0 dtalnC 9511.0 -648.0 9548.0 -4.0 976.0 9484.0 talU 9475.0 C 1228.0 1540.0 9460.0 1556.0 Y -16.0 9451.0 AcClenny 1668.0 828.0 1732.0 tlicCleuny JlcClenny-828.0 2560.0 2652.0 9440.0 244.0 3056.0 9436.0 2960.0 3404.0 9432.0 ft3300.0 inMUM -156.0 Ing 3408.0 ftg 2460.0 9644.0 9743.0 g 372.0 1284.0 9680.0 MUM 1404.0 t1 tI712.0 laughter hughteraughter392.0 2612.0 9664.0 2440.0 3124.0 9660.0 Josie JosleJosic3004.0 Josiein JosleereJosicerr-440.0 3564.0 2808.0 9820.0 9992.0 ere err968.0 9951.0 896.0 thlltVfrotn 9924.0 -988.0 2176.0 1536.0 9903.0 it II1316.0 368.0 9912.0 9892.0 Cadillac Cadlllac520.0 9896.0 yester yestetyesterI yestertis-520.0 484.0 yestetMs3 1640.0 10060.0 2828.0 776.0 10340.0 jliss 10412.0 Ms3 -256.0 840.0 tis 10372.0 Kstee Esteelstee1720.0 10360.0 Beale DealePeale2392.0 10352.0 2168.0 2908.0 10379.0 2672.0 3448.0 10348.0 tc totcachua tocbua -116.0 tcbua -60.0 3508.0 2832.0 10572.0 10635.0 cbua achua1268.0 10584.0 wire wivewhe10587.0 1632.0 2112.0 10580.0 wlll10575.0 10608.0 3308.0 day daj3196.0 dajtwo -296.0 daytwo 188.0 da datwo -188.0 2748.0 852.0 10795.0 10867.0 two 10807.0 wifiher wlt1herwithher1060.0 492.0 friend 396.0 10800.0 2344.0 552.0 3016.0 Minnie Minuii3020.0 MinniebavL -548.0 3568.0 MinuiihaaL -580.0 744.0 11075.0 bavL haaLbavLE -68.0 1j -32.0 2816.0 784.0 11232.0 11307.0 j E984.0 11280.0 1040.0 -88.0 Milan MlLn11259.0 n -420.0 1780.0 an 2048.0 460.0 11256.0 naval 2296.0 472.0 3096.0 stores store2976.0 storespertor 504.0 storesperotor storeperator -504.0 2824.0 11435.0 11536.0 pertor perotorperator11491.0 1496.0 yaldo 1560.0 aldo 1904.0 2068.0 11524.0 was 2488.0 11515.0 among 2372.0 11479.0 those thosthosebo -408.0 thosbo 11624.0 11756.0 bo 964.0 11735.0 spent plnt632.0 1rSday 1412.0 11699.0 Tjrsday -628.0 2040.0 1584.0 11716.0 rsday -456.0 2132.0 11711.0 2384.0 11704.0 Gainesville Gainesvllle2280.0 11744.0 or onof3316.0 oraslness onulnCss ofatlnes 11907.0 11984.0 aslness ulnCssatlnesulnCssMr atlnesdr1512.0 J JMr -72.0 2804.0 12199.0 12240.0 dr1088.0 12211.0 12204.0 M 1844.0 12208.0 2248.0 K 2640.0 Flowers 2388.0 3440.0 oi ofoibite ofhlte -132.0 3572.0 12236.0 obite 3528.0 2796.0 12428.0 12468.0 bite hlte12436.0 Spring Springare -492.0 1672.0 are -268.0 1940.0 2072.0 12431.0 2348.0 cftr2616.0 3184.0 12463.0 on 3060.0 3380.0 aIsit 3512.0 ollsit asIt -96.0 2864.0 12644.0 12675.0 llsit 12692.0 sIt Isit-180.0 936.0 12704.0 relath 1140.0 1888.0 12663.0 2272.0 12656.0 2116.0 12660.0 T L 3284.0 LF -124.0 Lulwan Lulaare 848.0 12908.0 ulwan ulaareulwanF ulaareF2768.0 808.0 13147.0 13176.0 980.0 13168.0 892.0 Geiger GcigorWaldo 13152.0 2324.0 N 556.0 Raines Raiuet2912.0 Rainesson RainesdRaiuetd-556.0 3576.0 2760.0 13367.0 13396.0 13420.0 son 900.0 1416.0 13376.0 11488.0 13379.0 2160.0 Newberry 3200.0 13403.0 were werwerennn -376.0 400.0 wereong 13408.0 werotig -400.0 13596.0 13652.0 nnn 13647.0 ong otig1024.0 13656.0 1092.0 13608.0 thoNe thoie1044.0 tlto 13632.0 1692.0 13620.0 1776.0 13644.0 1932.0 SICtlt1816.0 2500.0 13599.0 3444.0 iu initiuForrcbt 3596.0 inalne8lIIl itaintsviIk 796.0 13828.0 alne8lIIl aintsviIkalne8lIIlForrest 1396.0 592.0 aintsviIkForrest 14075.0 14108.0 Forrest Forrcbt1432.0 Whit 1Vlllt2052.0 14096.0 who 1820.0 14092.0 attending attendiuattendingcolLj -784.0 attendingtusll1ess attendiutustltess -808.0 2692.0 14300.0 14336.0 tusll1ess tustltess1552.0 colLj co1L2124.0 14319.0 in1900.0 14360.0 -92.0 2276.0 2496.0 14316.0 Jacksonville Jacksonvillerrt Jacksonvillet-1056.0 Jackson vflle vflleIt -360.0 14539.0 14575.0 rrt -44.0 Christmatith Chrttnnaeith14548.0 hri -884.0 596.0 1492.0 14544.0 tmaElth 2172.0 mother 312.0 14551.0 MrsJohn Mrsohn Mrsohnt1hlting 14740.0 John 14779.0 ohn -204.0 14768.0 ohnt1hlting Whiting 14747.0 l 1115 Iltis14771.0 ils -200.0 2180.0 clhcityMr 2492.0 clhIr -280.0 2728.0 14911.0 15047.0 908.0 15056.0 Ir -104.0 1136.0 15035.0 nid tldtnd1436.0 15011.0 Mrsj jIlRtJ 1892.0 15040.0 Hill HUl2448.0 2368.0 15080.0 sou sonhave havc3116.0 havefrom -380.0 3580.0 havcO 15243.0 15267.0 O 1380.0 15264.0 frnnl1264.0 1440.0 15284.0 rnm -284.0 1828.0 Zanopy 15300.0 anopy -500.0 2424.0 2596.0 they theyMrs 3584.0 theyth theys 15492.0 15511.0 15504.0 s 1796.0 15499.0 + 4.0 1944.0 15496.0 444.0 2724.0 Hills HUls3280.0 15523.0 par parg -272.0 par1I1c parig 15719.0 15724.0 1I1c 2484.0 Q41tu Q41tuig -496.0 2980.0 1752.0 15944.0 ig 16004.0 2096.0 15996.0 Clark U1ark2720.0 A 2556.0 D 2844.0 Me Mc3144.0 Mccrr 16019.0 c cct -76.0 3544.0 2636.0 16147.0 16224.0 ct crr 16248.0 I16239.0 1468.0 16204.0 oj 1532.0 iJJ 16200.0 Ji 1884.0 16268.0 i McLaurln McLaurinMeLaurin16216.0 3176.0 Medith Medllh 16219.0 Medish 2676.0 16412.0 16427.0 dish dithdllh1260.0 i1I1Jata01916.0 16415.0 Jrlce Mrlce-524.0 2080.0 16451.0 2576.0 16447.0 16436.0 Melrose Molrose660.0 2888.0 Molroseen MelroseWMelroseers16572.0 16688.0 Wers16683.0 llhongauoug636.0 1708.0 thqlvho thqJvhothqllo1600.0 2464.0 16679.0 16667.0 yesterlay yesteray412.0 ester -412.0 estera 1304.0 16823.0 16872.0 lay 16903.0 -128.0 ay -56.0 884.0 m IIIus1216.0 16879.0 this tbls1568.0 16876.0 cltjr1480.0 clt -288.0 cltL 1760.0 cityi 4 2708.0 17128.0 17140.0 31 -108.0 1108.0 17200.0 1248.0 17164.0 Lra 1252.0 brace laPt1504.0 1784.0 IlaUr BalliItfMI1680.0 Ocala QcalaOcain17155.0 iu3340.0 17152.0 thety theIt3588.0 theIty 816.0 17351.0 17367.0 Ity 17384.0 ty 1052.0 17404.0 IIn ft1296.0 17416.0 iI a1340.0 17423.0 -24.0 17363.0 brief 1368.0 1960.0 tifto 10so 2312.0 2420.0 17392.0 her 2308.0 508.0 father 3456.0 17379.0 JIah JI 2624.0 17515.0 17599.0 j972.0 17595.0 Iah 1004.0 tin Ih -168.0 17587.0 17563.0 slsft slab SIs1-332.0 2208.0 17619.0 Mss2212.0 728.0 17611.0 Florence 2680.0 Florenceta FlorenceIa-728.0 17815.0 ta 13Ia17887.0 17824.0 Hr 1Jr1Ir1652.0 17831.0 numerc numalnuwerc -596.0 17844.0 friends rlends2996.0 17868.0 3364.0 deIgttI 3260.0 3368.0 de do-184.0 doibrd 17955.0 OJ OJIghd 2232.0 2016.0 18035.0 ibrd IghdIgttI18092.0 18100.0 vvelcouitH Hlcowwlcoulo1352.0 18068.0 again againJ -452.0 2712.0 18296.0 18324.0 18347.0 11 II1180.0 1300.0 18308.0 Shta Sh Stn-364.0 1664.0 18339.0 1772.0 18300.0 aud18320.0 2360.0 18335.0 iave2304.0 ha -396.0 18368.0 returned rltnrlledreturnedOIL rltnrlledMrreturnedrut2740.0 18516.0 18552.0 OIL Mrrut 1116.0 18532.0 ocala urilaucdawheretwheae1544.0 18567.0 8IeDtslleotChrist 2936.0 Christa -508.0 2756.0 18704.0 18779.0 18815.0 18755.0 111 1alav -120.0 18752.0 with Ith -208.0 1928.0 18748.0 thol thel1804.0 theld 2236.0 18787.0 3mis mdsntds18891.0 18784.0 MP Mr3156.0 r 3044.0 18772.0 aiuiaiuiV andIrandr2764.0 18968.0 18999.0 -48.0 19016.0 18980.0 18984.0 I548.0 1868.0 18975.0 Sheriq Sheri 2416.0 2540.0 19011.0 amiantiMartin MaltinAlautiu2840.0 MartiniRi MaltinIcE-552.0 AlautiuIcHh 19192.0 IcE IcHh 19207.0 iRi gh1308.0 19200.0 They 19231.0 re2004.0 rofl 2332.0 19275.0 19219.0 delightful delightfulI delightfulJdelightfulilrdelightfull-800.0 19383.0 19415.0 ilr ilrJ 19459.0 19640.0 319647.0 IlUmlwaro BOllwaflAoulware1144.0 19644.0 f 2544.0 19727.0 tit 19719.0 iny 19724.0 2940.0 19712.0 years ears 3384.0 19707.0 aiMnt alwnt alit 19807.0 19891.0 iMnt lwntlit 19876.0 1608.0 thl 19872.0 elt AW 2200.0 1576.0 19947.0 IW 276.0 19951.0 w 0 19911.0 2920.0 19908.0 Hemp 1IemllHemptfiI 3072.0 1Iemlltnil hemptnI20096.0 20104.0 tfiI tniltnI20099.0 Texas llxaJ2164.0 2028.0 2668.0 20140.0 nls20123.0 annual annualto annualw20312.0 20348.0 20339.0 916.0 20319.0 1740.0 bortuor borturbortuer1620.0 2504.0 20355.0 Boulware noulvvnrenoulvvnrerunds BoulwareIlj BoulwareI20488.0 20532.0 Ilj 20548.0 runds rhIirtnds20580.0 aroglad 1964.0 -336.0 lld 2524.0 income 2704.0 20592.0 kume Icutne-484.0 3188.0 20575.0 him hinthimOliver hintylr 20803.0 20979.0 ylr 20991.0 Oliver OlerFutch Putrh2452.0 20996.0 atfco 21027.0 21080.0 o2588.0 2924.0 21039.0 interest interestdnltlron 640.0 2928.0 InterestIb Interesttg-644.0 21211.0 21235.0 Ib tgdnltlron hllclnnlubiren21252.0 wore Wl11were2404.0 21216.0 hl2644.0 21219.0 Hetty 21267.0 ity -112.0 21264.0 front3076.0 fromua frontuafrom4Ua 2684.0 21439.0 404.0 21475.0 4Ua ua 21448.0 estrtJ -692.0 2860.0 21523.0 wercwercto 3256.0 3428.0 21511.0 ellIntu ellto 21663.0 21680.0 tu11aldowhtro21704.0 IIlr 21675.0 tMjjj 21716.0 ill fIl21747.0 8It 3208.0 5J1111115J111111t spendt-464.0 21868.0 21888.0 1160.0 21912.0 ot Ptii21915.0 -40.0 21907.0 to21924.0 111860.0 652.0 21891.0 threys thre -652.0 21975.0 y5 21984.0 3264.0 21927.0 vItltwithOIR withf vItltr22115.0 r22151.0 tt ttt 1276.0 1244.0 22159.0 22367.0 22383.0 22403.0 tho22376.0 visitors vi -604.0 2136.0 22379.0 itorfl 2024.0 22400.0 rug OIRtjty 1444.0 3000.0 22431.0 lt22456.0 yes yesv -260.0 3312.0 yest Pt PtIf 22591.0 If 22632.0 y 1220.0 22627.0 vvtre1460.0 lre 22599.0 Ilo Reese RlISI2020.0 22656.0 2288.0 Orma OrmaIlautor 568.0 22679.0 22683.0 Irogn1lauhr 3052.0 rogres Irognrogrs3452.0 rogrsa rogresroad -516.0 2812.0 22816.0 22831.0 564.0 Ilautor 1lauhrilauter22819.0 aDd aadand2320.0 22823.0 22828.0 2432.0 2604.0 WJsor 22867.0 road roadiformor -352.0 roadiol roadti23048.0 23079.0 ti 23055.0 Jsor ttioriol Hawthorn 1864.0 Hawthornlit -812.0 2776.0 Jlawtl wthorn nrn 23103.0 former iformoriformoro formerl-568.0 3136.0 23128.0 orullr orullrht 23263.0 ht-144.0 1348.0 23271.0 23299.0 680.0 quantity qUlmtltyfine fluefinehere 23367.0 0n3288.0 23316.0 cold 3212.0 coldivllle -324.0 3612.0 coldr 23488.0 23571.0 23531.0 +1224.0 1424.0 htflhereMur htflthur heret -316.0 23747.0 23759.0 Mur thurLur23756.0 111956.0 Chitty Chilloftn 23812.0 ivllle 1l11etvilleivllletlmo 3624.0 1l11eIII tvilleas-404.0 23976.0 23999.0 tn IIIas1524.0 thp23979.0 cltjrrit 23983.0 far24020.0 aitu18 24044.0 tinttlaas tint tlmotlIIHtlmoomc tlIIHtll8 1800.0 24199.0 24219.0 itu18 tll8tlaasdnydft -276.0 24208.0 Ho HIlie24243.0 as 24240.0 ononMlcanopy 24295.0 omc omeouleomci -328.0 omet1can ouleMlean 1240.0 24419.0 t1can MleanMlcanopy 1696.0 24460.0 opy apy2000.0 2140.0 24428.0 vb whwIll -220.0 24472.0 2444.0 24467.0 re nho hehf 3088.0 24523.0 24535.0 tan 3356.0 tanf 3436.0 onand 0113616.0 011f 2328.0 24643.0 24648.0 vibit24659.0 2204.0 24651.0 24667.0 parent IllrtntparentC 3092.0 24711.0 11111am111111r am1t24868.0 24871.0 Chittynil Chittyand25132.0 nil and25168.0 1400.0 25135.0 Mrrira 544.0 lumti Lurtan-544.0 Ian 25139.0 ItRwere 3488.0 25199.0 01ofor 25204.0 01r 1936.0 25364.0 25383.0 25388.0 wer25391.0 rc 25395.0 amotigaUHlI1 thothotori1 3028.0 theYt 3500.0 25451.0 tct 3620.0 1920.0 25584.0 25591.0 1548.0 25611.0 Yt yrstertty tori1 hrtT 2156.0 25620.0 25623.0 7 Those ThplcThenThplcI Thenunly 25615.0 yonly 3232.0 25799.0 25847.0 only unlyuI 25811.0 recently ncullcntly25840.0 2224.0 25843.0 mar 2252.0 marIxing 3268.0 marhfir 25911.0 u tctcbt 26027.0 Ixing hfir -424.0 bt 26031.0 26060.0 adaughter il -744.0 2196.0 hI 2476.0 Khter Khtern -432.0 ht 2784.0 26072.0 26063.0 2820.0 oforf 26103.0 di 26247.0 i26280.0 Torodn TomdoTnrndn26283.0 amOUF2356.0 amongof 26263.0 3328.0 26292.0 tIof 26347.0 iof 26471.0 tho rho2536.0 Windsor WlndKOr1VindwrWindsorli 1Vindwrl-712.0 WlndKOrtHft 26691.0 26695.0 li ride 26723.0 ido there tbfrtHftthere1Vells -428.0 2284.0 tbfrWells 26863.0 Ii IiW 26952.0 Wells 1Vells1948.0 26991.0 26987.0 -12.0 Us 26955.0 26959.0 Archer ArchrrArrhrtIttherogres 26995.0 xmlns:ns3 ID15 3692 3712 92 27496 ns3:type 27496.0 27612.0 27619.0 PECAN 27643.0 CRN 1840.0 27648.0 TREES TRFESFOR 3352.0 SA SAi 3672.0 sA 3784.0 SaP1 27984.0 28047.0 3644.0 Si SiI 28147.0 Ik 3732.0 28275.0 28467.0 k 28400.0 hr h1aP1 28343.0 p 28279.0 Iecul 28287.0 28347.0 win lml2848.0 2896.0 28284.0 rreas 2900.0 28308.0 28355.0 rees 2948.0 reest ol olTTiniinous 28351.0 rtArmtllloll 28547.0 28608.0 TTiniinous rmunOl1tArmtllloll28639.0 -1012.0 Van gall3376.0 28591.0 Je 1e1etcul 3660.0 28807.0 28864.0 28840.0 tcul 28843.0 ai 28855.0 Nut Nvit1748.0 ut -196.0 3032.0 28815.0 Youn YounV 3216.0 28883.0 oun ounv 29067.0 29091.0 Jr 29103.0 Ct tx29079.0 f2108.0 lwtllthy htnltllYalthy Vigorotoek vigor igrrvigorCall 3676.0 igrrTbetock 29283.0 Tbetock 1712.0 29323.0 otoek 2628.0 29335.0 Call aU 3180.0 29408.0 tinoraddrl -216.0 3768.0 29507.0 29536.0 JO JOdrfl 29599.0 29703.0 addrl 29711.0 drfl 29756.0 29763.0 29655.0 29659.0 prluo prluoPhi 29663.0 pru iel 29976.0 el 29983.0 29979.0 BENNET 30927.0 31115.0 Phi xmlns:ns4 ID19 24948 3448 3660 2448 ns4:type 3744.0 2456.0 bookkeeper 4848.0 5096.0 5016.0 5100.0 5152.0 5332.0 5220.0 5404.0 5516.0 5644.0 Bauknlght Bauknight6624.0 slier6500.0 spentyesterday 7024.0 slieryesterday -444.0 7068.0 3736.0 4664.0 la4580.0 4920.0 4828.0 5324.0 5232.0 2687.0 5636.0 6172.0 6504.0 family famllr6416.0 familyMr famllrMrfansll fansllMr 6916.0 3332.0 3740.0 3992.0 2907.0 an44372.0 4616.0 4480.0 5168.0 4940.0 5540.0 G 5308.0 5876.0 Smallbono SnmllboneSmallbone5656.0 2964.0 6732.0 01Wilmington 7028.0 ofViImlngtoll 7072.0 2972.0 cWilmington 6972.0 3336.0 3139.0 Wilmington ViImlngtoll4884.0 4752.0 5144.0 5420.0 5252.0 hero berehere5680.0 6188.0 6492.0 6420.0 short shorishot6572.0 shoritime shorttime shottime time 4396.0 4128.0 4888.0 Smallbone 4712.0 5880.0 6128.0 3416.0 6008.0 6336.0 daughtei daughtlldaughte6204.0 daughteiof daughtllofdaughteof-700.0 7036.0 11Ir3908.0 4392.0 4256.0 4792.0 4688.0 5256.0 Vells5104.0 6260.0 6148.0 3648.0 man 1111111unto6528.0 manfriends 6952.0 1111111friends untofriends 6980.0 3652.0 3824.0 3828.0 4472.0 4352.0 4956.0 4832.0 3860.0 arc5292.0 5772.0 3832.0 always alwari5664.0 6452.0 3840.0 6792.0 tcsee 7032.0 tsee 6968.0 3748.0 4056.0 4096.0 see herDr 4012.0 4136.0 4416.0 3084.0 3932.0 4320.0 4332.0 Dr 4348.0 4152.0 4692.0 4496.0 5008.0 Crawford 4796.0 5924.0 4328.0 5776.0 780.0 6236.0 4336.0 MIeanopy lIcanorMlcanopy6084.0 MIeanopywho -780.0 7016.0 Mlcanopywho 6332.0 lIcanorwho 6976.0 4552.0 4556.0 4200.0 4092.0 4444.0 engaged 5240.0 5128.0 5496.0 5388.0 5844.0 drug 5744.0 6324.0 4564.0 busltesawas 6224.0 6328.0 business bul11csbusltesabusinesswas -688.0 bul11cswas 4780.0 4819.0 4180.0 4784.0 4072.0 4800.0 4700.0 5116.0 5208.0 sterdar5012.0 6256.0 11Ur6596.0 4795.0 Craw 7008.0 Cm Cmford 6872.0 5015.0 ford 4244.0 states 4892.0 that 4748.0 5368.0 5236.0 5696.0 enjoyed cl1jored6472.0 5060.0 aver 6564.0 averencouraging 6964.0 6516.0 -448.0 6700.0 verv vervencouraging 6800.0 tr trencouraging 5235.0 encouraging 4880.0 Christmas 5247.0 trade tmd5724.0 6240.0 6740.0 thai6648.0 thaihe 7060.0 thatbe thathe 5464.0 5472.0 be4068.0 anticipates 3940.0 5000.0 5336.0 good goud5212.0 year rur5712.0 6320.0 5476.0 6192.0 6680.0 5488.0 innS THKVTHKVas -356.0 innSas 1110 1110as 6920.0 5740.0 4060.0 5699.0 3920.0 4468.0 people 5140.0 5004.0 5432.0 5300.0 5796.0 section 5968.0 ction 528.0 6508.0 appeal apJlmappeaappealto apJlmto-528.0 appeato 5928.0 5940.0 5931.0 be 3904.0 4280.0 4184.0 4516.0 5964.0 most Illost4608.0 5184.0 5960.0 prosperous l1rOSlH11UUS5088.0 6164.0 5936.0 condition 6080.0 conditionJ -752.0 6200.0 6196.0 4024.0 4224.0 Brown Brow114344.0 Harry Hatlr5400.0 6060.0 SaundorH SauIHIlISaundet5980.0 6904.0 6212.0 olJacksonville 6820.0 6208.0 of7040.0 ofJacksonville 7064.0 oJacksonville 6988.0 4936.0 5452.0 6424.0 ht5592.0 6428.0 citr5972.0 6512.0 yestet6392.0 7012.0 yestetday 6612.0 t8tlr t8tlrday 7020.0 6499.0 3752.0 6656.0 4272.0 4048.0 is 4408.0 6652.0 understood uuderstood4620.0 5624.0 6660.0 6040.0 6220.0 6360.0 6488.0 Drown BrownDrownwho Brownwho 6880.0 6884.0 4204.0 owns owtla4744.0 considerable 4632.0 consl -1048.0 5792.0 5284.0 6915.0 eru 5556.0 b1l 5536.0 5900.0 real Ial6316.0 6900.0 estate 6888.0 inthe Inthe 7052.0 itthe 6992.0 7108.0 7112.0 4132.0 Wina 4016.0 WlnoEor4684.0 7140.0 4852.0 4968.0 sectlunhats5544.0 disposed dibposeddl 6784.0 6340.0 poslll 6232.0 ofa 7147.0 oa 7332.0 3956.0 desirable 3848.0 7336.0 piece 4740.0 5280.0 property IJlolwItyptoperty7343.0 tcMr 6788.0 to7044.0 toMr 7056.0 ttMr 6996.0 7560.0 7575.0 7572.0 Saunuers Sauntlers3988.0 5160.0 5492.0 establish stnblish5932.0 7599.0 -696.0 ageneral tgeneral 7788.0 7795.0 general 4488.0 7824.0 wagon 4384.0 4492.0 7792.0 wagonbuilding wagonhulldlng672.0 5080.0 building -672.0 5804.0 6152.0 blacksntitlshop 6088.0 6156.0 blacksmith hlacksmithblacksntitl-840.0 blacksmithshop -900.0 hlacksmithshOI -888.0 8024.0 shop shOI4508.0 4404.0 WindsorJ 5216.0 3132.0 8283.0 8295.0 4176.0 8288.0 Fletcher JNetchel4008.0 lull5428.0 1C E5716.0 5948.0 6112.0 McRae lcRae5884.0 lef6668.0 leftyesterday lefyesterday 3272.0 8508.0 8520.0 8515.0 4588.0 5048.0 San 4932.0 5468.0 8512.0 Felaska Fe1llskn5348.0 hammock hanunock6116.0 hammockwhere -796.0 hanunockwhere -776.0 7000.0 8735.0 8752.0 8747.0 ther4260.0 4768.0 8744.0 4696.0 5072.0 5684.0 5608.0 days dashunt hunting huntIng 8803.0 8980.0 4252.0 8972.0 Squirrel 5036.0 4928.0 other 5328.0 9000.0 game 5864.0 8964.0 6396.0 said 6632.0 saidto 7048.0 sat satto 9184.0 9216.0 plentiful 4980.0 9192.0 9204.0 6432.0 6756.0 tblsthh6676.0 thisseason tblsseason thhseason 9412.0 9468.0 season 4504.0 9428.0 4304.0 4944.0 5204.0 9424.0 expected 9419.0 6184.0 tluthehunt tluhunt 9668.0 4240.0 4140.0 4672.0 9683.0 prove proOproVO9688.0 5132.0 5440.0 profitable lrofitt1bleone 6228.0 6864.0 9648.0 At 6628.0 Atany 6868.0 Aany 9876.0 9927.0 any rate 9880.0 fllends4476.0 5196.0 5528.0 5872.0 parties Imrts5780.0 expect expecexpectbig 9900.0 expecbig 10091.0 10120.0 big 4116.0 10112.0 results 10108.0 5268.0 10104.0 all 5584.0 10140.0 5956.0 10100.0 getting 6664.0 theftputs 6544.0 their thefttheirpots 10328.0 10355.0 pots puts4208.0 10343.0 4088.0 readiness rcadlness4360.0 5372.0 10336.0 5264.0 5604.0 return 6100.0 returnA 6724.0 3928.0 10616.0 4232.0 Lassiter 5040.0 10599.0 4916.0 5520.0 5344.0 920.0 5728.0 boy boywho 6816.0 Joy Joywho 10843.0 10840.0 4084.0 4544.0 10836.0 done 4460.0 5028.0 10828.0 well wen10824.0 5692.0 Alabama 5596.0 6556.0 wherhe wher6956.0 wherehe 11039.0 11072.0 4052.0 11063.0 3936.0 11056.0 employed 4188.0 11060.0 emplo 11096.0 4988.0 hr11051.0 5396.0 5868.0 11044.0 5760.0 Lum LutnLumber Lutnbar 11104.0 7004.0 11264.0 ber bar4156.0 11292.0 Company Compauy5356.0 11276.0 Lockhart Lockhnrt6276.0 11268.0 6688.0 been beetbeenin -368.0 beenill beetfn -372.0 3320.0 11488.0 illfn11520.0 3900.0 cltr4808.0 5148.0 11508.0 5512.0 11512.0 past P1t5848.0 6352.0 11527.0 016244.0 6640.0 three threothret6520.0 threedays threodas thretdays 11747.0 das11780.0 4584.0 11776.0 4456.0 Islt4676.0 11740.0 5576.0 11732.0 11723.0 5808.0 6620.0 11720.0 146444.0 6672.0 LHill 11940.0 11976.0 11114300.0 11967.0 Lassltr4064.0 5084.0 11960.0 11988.0 many 5364.0 6016.0 11943.0 5916.0 herohersherewho 6704.0 herowho herswho 12163.0 4192.0 12231.0 4560.0 12192.0 alas12184.0 5952.0 12172.0 6832.0 Heh1cHosays -228.0 Hesars h1csays 12392.0 says sars12424.0 4108.0 5108.0 12416.0 4976.0 5572.0 12412.0 5992.0 12407.0 country 6804.0 but buthe 7076.0 12612.0 4288.0 12688.0 4292.0 12648.0 gtti4376.0 4448.0 aul 4636.0 4764.0 4640.0 get 4908.0 5380.0 12636.0 back 5276.0 12627.0 homo home12651.0 once oncohra hrIna Inn 12835.0 12920.0 n3964.0 12876.0 while 3836.0 4104.0 hUe 4412.0 4772.0 4860.0 12864.0 1111112859.0 5568.0 12852.0 5828.0 12847.0 6096.0 6616.0 navalstores 13072.0 13120.0 13100.0 department deJlaltuwnt5600.0 13084.0 5416.0 13079.0 tho5764.0 6388.0 JucksouJacksonCompany JucksouComlmnr -668.0 13340.0 ComlmnrCompanyDr ComlmnrDr4528.0 13552.0 13604.0 4592.0 13592.0 4420.0 4864.0 13587.0 Mar5316.0 13575.0 13567.0 5612.0 13563.0 Jack 6532.0 Jacksonvlllo JackSOI Jacksontille 13780.0 656.0 13819.0 sonvlllo sontille13864.0 SOI -656.0 llle 13848.0 WNO13812.0 4900.0 13804.0 U1 5456.0 13836.0 13800.0 cltrWednesday Wel1nesdnWednesdayspending -952.0 Wel1nesdnspending 6928.0 yspendltg 14012.0 14048.0 spending spendltg4628.0 14036.0 14024.0 1186588.0 14015.0 Mayssister 6404.0 6592.0 Mays In8 In8Hlster 14227.0 14280.0 Hlster4380.0 14276.0 4868.0 14268.0 5136.0 14252.0 Halle Valle14239.0 5908.0 lIal1eIlaileHalleand Ilaileand lIal1eaud 14455.0 14503.0 aud4032.0 14488.0 famllr14476.0 14479.0 enJo -640.0 5840.0 5668.0 ed 14508.0 n6120.0 14472.0 finoflue6024.0 ChrlritChrlritmas 14524.0 14675.0 14764.0 mas 14732.0 tree 14708.0 together 4536.0 5552.0 14696.0 which 5376.0 6168.0 14723.0 6036.0 6836.0 deIlghtful 6840.0 deIIghtful 14924.0 14948.0 lightful IIghtfulIlghtful4484.0 14943.0 affair aftalr4356.0 both 5788.0 6292.0 grown 6296.0 14940.0 grownup 6812.0 grownupand -764.0 6876.0 uand 15131.0 15184.0 4124.0 15172.0 little 4028.0 15168.0 folks 4524.0 15156.0 There Tlwro5824.0 15180.0 6300.0 naturally natUlnll6216.0 naturallymany -760.0 natUlnllmany 15363.0 15436.0 15395.0 handsome 5176.0 15380.0 presents 1reseuts5996.0 15368.0 nnl15412.0 nd 6028.0 tho6288.0 6692.0 truewhich 6696.0 true 15583.0 15627.0 4388.0 15660.0 15603.0 decorated decomted5816.0 15596.0 beautiful beautHulbeautifulcolored -740.0 beautHulcolored 15808.0 15852.0 colored 4432.0 15840.0 candles 15832.0 made 5056.0 15859.0 5632.0 5896.0 6384.0 pleasing Illeaslllpleasingspectacle -680.0 IlleaslllslIcctnCle pleasingspecutcle 16035.0 16076.0 spectacle slIcctnClespecutcle16084.0 16060.0 16091.0 eye 16096.0 16055.0 16048.0 lay6064.0 6720.0 6584.0 6780.0 16067.0 6852.0 Ilaprominent Ilprominent aprolnincnt 16255.0 16304.0 prominent prolnincnt16284.0 physician physlclnn16275.0 JacltsonlllcJacltsmullleJacksonvilleFrom JacltsmullleProm-1036.0 JacltsonlllcF07n -1008.0 3760.0 16543.0 16584.0 From F07nProm16555.0 Saturdays 5408.0 JailIISll1ISunOrlando 6308.0 5984.0 Sll1IOllundo 16548.0 3148.0 16736.0 16783.0 Orlando Ollundo4704.0 16772.0 Weeks Wlls1Veeks4596.0 16768.0 5260.0 5640.0 16756.0 6272.0 6160.0 traIl tradtrarl6580.0 trading traIlIng trarllug 16804.0 16988.0 17024.0 lug17015.0 17007.0 4720.0 17000.0 yesterdayMiss -816.0 5944.0 17003.0 stl -616.0 rday rdayMiss 17227.0 17283.0 4400.0 17268.0 McGinnes 1tcGinnes4500.0 17271.0 IcG 5228.0 Inuls 17256.0 17244.0 5484.0 17259.0 Ha -824.0 6408.0 wtholll 6824.0 Ini 17459.0 17512.0 3680.0 17503.0 4576.0 17488.0 yestelday4440.0 17476.0 dining 6716.0 17464.0 6568.0 MrsH 118 118I 3664.0 17723.0 17732.0 17744.0 3684.0 17740.0 3868.0 P holstein HolstoinHolstlInHolstoinMr HolstlIn1I1tholsteinAl4960.0 17952.0 18003.0 Al 1I1t18032.0 4312.0 17988.0 Ilnd4160.0 4736.0 Airsln 17979.0 Geo 5676.0 Taylor 5524.0 antl6748.0 sun HonsumsunHal HonlIal sumIlal 18172.0 18223.0 Hal lIalIlal18219.0 18208.0 Palmer Paln1PIrainierHlent804.0 18175.0 18228.0 -704.0 6760.0 tlIdf 6136.0 JaJathis 6924.0 inthis Inthis 18416.0 18451.0 18443.0 4644.0 18448.0 guests 18467.0 gll 5032.0 t8 5288.0 18419.0 lplaUes5448.0 relativesMrs lplaUeslr-716.0 18668.0 18723.0 4020.0 18719.0 lr Lulu Lutu4872.0 18692.0 Moody lloody5500.0 18683.0 5412.0 faomfrontfrontRockledge fromRuckled faomRoekllli 3756.0 18888.0 18936.0 Ruckled RoekllliRockledge 4436.0 ge SI4824.0 18919.0 whcf18912.0 sIll5320.0 5892.0 18903.0 hns6304.0 18895.0 heu6684.0 forthe 19111.0 19171.0 19168.0 Ilast19156.0 ft 4708.0 19183.0 4728.0 4984.0 19144.0 19175.0 5164.0 19163.0 5660.0 19123.0 19132.0 rela ltln6600.0 ltlnti relatves 19180.0 19395.0 tives tvestivesGco 19412.0 tvesGeo 3856.0 3880.0 19427.0 ve veGcn 19659.0 Gco GcnGeo1V19632.0 4972.0 al 19627.0 19608.0 Monteocha Mouteochalont -804.0 19652.0 ocha 6012.0 Iipro progressive proglc8sle progresslve 19823.0 gressive glc8slegresslve19855.0 merchant nnerehant19847.0 anti19840.0 citizen 6376.0 6752.0 19828.0 thatplace thatJllacl 20036.0 20107.0 place Jllacl4144.0 4308.0 20131.0 waJ20079.0 transacting transactllgtranm -948.0 20116.0 t1I1S 20063.0 20072.0 1l 5lnNi 5888.0 20055.0 20092.0 20043.0 thiscity thiscltr 20316.0 20331.0 cltrestertlaryesterdayMrs 4964.0 estertlartrs -724.0 20599.0 trs20635.0 20583.0 4924.0 20568.0 Prowltt PnlttPretvitt20556.0 lullrofitinterostInterestIns lullrofitIninterostlug20759.0 20827.0 Ins lug20812.0 children Chlldreneltlldren3892.0 4912.0 hae5392.0 20779.0 20771.0 front6104.0 6708.0 Wal 11al11aldo alI 20984.0 21056.0 do whore whpIewhere3952.0 21032.0 111lr5192.0 20999.0 htate21020.0 1111 21011.0 IHwn5384.0 6484.0 21035.0 IlIt6372.0 hrhfbriefvisit 7092.0 hrhfIslt 7088.0 21136.0 3764.0 21255.0 21271.0 Islt4228.0 21279.0 relatlvcsrelativesJ relatlvcsJ-732.0 21423.0 21540.0 21527.0 AsJ A1 21499.0 Strickland 21496.0 Hague lJagl1litigue 21515.0 onooneof 7084.0 onoof 21767.0 21759.0 till3916.0 21764.0 moKtmOHt21775.0 Iro -908.0 5172.0 Itruus 5068.0 21728.0 farmers armt11iharmwrs6524.0 111la6440.0 thatKuctton thatteclion thatsection 21931.0 21995.0 Kucttonteclion4452.0 21972.0 Ili tilt tho5092.0 21979.0 county countwustaustrudlng6936.0 IIIlalathe 6940.0 IIIthe 22187.0 22219.0 22207.0 4120.0 4424.0 yesterdaylass-820.0 22248.0 22239.0 steflla stefllalls 3960.0 22427.0 22475.0 lasslls 22451.0 hazel HazollIazll22447.0 Price PrlCcharming ehnrmlug22444.0 young younglady OUII OUIIladr 22487.0 3776.0 22644.0 22703.0 lady ladr22691.0 4532.0 Lake Iake22688.0 4948.0 4652.0 ake 5076.0 22671.0 City Cltr22664.0 IR22647.0 Uw6004.0 6828.0 eltI nguest 22859.0 22939.0 guest guet22915.0 or4212.0 720.0 22899.0 relathca22883.0 thufarnllrfatallyofSheriff ofSIHrltr 3688.0 23003.0 3772.0 23147.0 Sheriff SIHrltr3712.0 23143.0 Ia4540.0 23131.0 23111.0 Fonnell FnllollFennellFonnellAlexander 616.0 FnllollAIxaudcr -612.0 FennellAlxauder 23360.0 23399.0 Alexander AIxaudcrAlxauder23391.0 Mewsar Metnar4820.0 23411.0 081al 23372.0 ufHell Bellwa Wlit wni23384.0 avisitor 7096.0 23643.0 visitor 23647.0 4716.0 23619.0 Galn 23599.0 Gnhnlvllle Gainesville23659.0 5648.0 ville 23587.0 osterdl1rbar havhaving h1 h1Ing barlag 23635.0 23795.0 23807.0 connected connNtld6736.0 6608.0 withthe 3780.0 23836.0 23875.0 lag23891.0 corno contCHIlt 23883.0 buslnoshUKhlN23863.0 2480.0 24015.0 24095.0 24071.0 United lnltldStates StatlSland 1uidlaid5296.0 olllco ufilco5732.0 olllcoMr olllcotra ufilcoMra 24283.0 24359.0 Mra24356.0 tra 4276.0 24339.0 Kmmett ImnwtFnuntt24347.0 5112.0 24315.0 Tnlor24300.0 24303.0 Hrun 6048.0 HrlllliW IirUttswlck -608.0 IirUttswlcktla -880.0 wlck wlckla Ick Ickna 24508.0 24591.0 la natla4172.0 24559.0 arrival arrhttarrivwi4876.0 24563.0 ht24547.0 thliii 24539.0 5852.0 yu yi6132.0 terdiy terdyterdty6796.0 alldandwill alldI 3788.0 24743.0 24803.0 24799.0 he4080.0 II 24787.0 thu tho4896.0 24808.0 gw Wit 8t 5444.0 24759.0 horIlt 24752.0 slafr IahrslrPrMrKo MrItosa trHOin 3696.0 24779.0 3792.0 25040.0 HOin Itosa3724.0 3796.0 Ko 25064.0 25015.0 Waters 25003.0 25031.0 25028.0 24987.0 5460.0 feW 5704.0 24975.0 daysI cia ciaI 6140.0 24979.0 daysFula 3708.0 25211.0 3396.0 25243.0 25323.0 3976.0 25339.0 Kilns EIiRsFula3728.0 25331.0 Snpp SRIIISapp25347.0 25296.0 wejl 25335.0 tteIknoWts known 6180.0 25284.0 c1t1zoncltizn6176.0 25267.0 orofi orI7104.0 orwhlrn ofNewberry 25487.0 25563.0 Nowborn Newberry25579.0 4036.0 whlrn 25571.0 WHS 4600.0 25575.0 ItS aa25531.0 ifs25516.0 th1l25495.0 Plttfrtl16072.0 Plttfrtl1on yesterdayon25535.0 yp 25523.0 tfr 6860.0 ly lyon 25715.0 25831.0 25763.0 IwintMiS buttwt43972.0 25795.0 hu tnutj 4904.0 25739.0 cunictudcouncte25779.0 25731.0 25727.0 theoffice olicttofiichofficeof olicttoofiicho25956.0 26036.0 26015.0 County CounO3872.0 4756.0 25995.0 TAX Tx25968.0 Collector CollecwrDicfcinaoti DlcklnllOttDleklnwlaDicfcinaotiMrs DlcklnllOttIrDleklnwlaMrs26251.0 26327.0 26323.0 4296.0 26311.0 4216.0 4816.0 26304.0 4604.0 Jordan Jonlan26271.0 1126307.0 26259.0 home 6712.0 frnDfromJ frnDJn fromJul 5976.0 26491.0 hal has26483.0 btfti 1MtfhMPs6252.0 6848.0 tlitlin titINt tb4 tb4g 26500.0 26559.0 Jn Jul26595.0 26567.0 fcftnn h26575.0 Lt 4368.0 U 26531.0 26512.0 vMeri4732.0 26547.0 vII 26539.0 rl IShe 26699.0 26824.0 g26819.0 3944.0 26815.0 4044.0 3948.0 26787.0 INt 4340.0 26763.0 26756.0 26747.0 26783.0 1p itOr iMr26751.0 5352.0 26759.0 26727.0 J4r 1lrsIra 26711.0 Soriv sruSertli 26739.0 Ix JJoIxtIxtzir IxZUT JJozlIr 26931.0 27035.0 ZUT zlIrzirfur4572.0 26983.0 27003.0 26976.0 tstst 26971.0 txuIrtit6000.0 26940.0 lhr Uar6728.0 26964.0 IIi 27231.0 27307.0 27312.0 27295.0 Iff rs 4680.0 5340.0 27259.0 115652.0 27239.0 Smalltioti SlRaUbollSMllbnlorxmlns:ns5 ID20 2888 3308 3808 27463 ns5:type 3808.0 27463.0 27543.0 27539.0 ilinmginn 1lInlltnoalningtnn27491.0 27479.0 27508.0 27471.0 hut UYtbareb 27487.0 6960.0 nh 27687.0 27767.0 27799.0 rt4076.0 27807.0 27783.0 04512.0 27779.0 27743.0 dirt vlUt14IL27752.0 27703.0 reteUf relaUTrelUPL 5904.0 27691.0 tl tUft thrI1 thrI1Wh1left 27728.0 MclK 11lls 3120.0 3820.0 27911.0 27972.0 Wh1left clK Jrt27955.0 27943.0 tbir tMiItbeI27927.0 town JaotDft5532.0 ornP 6068.0 27948.0 1HLrrla6264.0 -772.0 27939.0 rt UMr 28235.0 28296.0 Mrs4840.0 28267.0 5124.0 28255.0 Sui Saubdlrs 5480.0 28272.0 6144.0 28259.0 5820.0 Jbating asIllampr 28443.0 28531.0 Illampr 28491.0 bating tutrtt5180.0 28519.0 28507.0 b45688.0 HI calked cftltal28475.0 tenmof 6764.0 lt ltnut 28659.0 28755.0 nut 4364.0 28731.0 4264.0 4624.0 28724.0 4520.0 28703.0 1Jlnrss 4992.0 28715.0 28739.0 5620.0 28687.0 28683.0 Mm MrsMmof 6356.0 ldstasrd ldstasrd1o -624.0 28907.0 29007.0 1o 28959.0 lax 28947.0 b4U 28944.0 5024.0 28935.0 quit 5272.0 5700.0 28939.0 1th1 1th1Ion 28919.0 29191.0 Ion Ionrg 29483.0 ns rg4316.0 29443.0 Nn 29431.0 29403.0 Gavela 29391.0 29387.0 Mayon 6636.0 29367.0 Ga Gan Gto 29591.0 29707.0 29675.0 ott29667.0 29619.0 rialt 29640.0 29611.0 dau daugb daugbMi 29815.0 29895.0 Mi 29879.0 29875.0 5052.0 29867.0 29848.0 IieIL 6020.0 29872.0 rsl 29819.0 Crrellu le lepml31he 30043.0 30092.0 pml31he 30099.0 30051.0 bey 6460.0 friendsS -584.0 7116.0 30271.0 xmlns:ns6 ID21 24664 3560 7124 2500 ns6:type 7208.0 resterdar8152.0 8640.0 9496.0 awlaurl9368.0 9936.0 9792.0 friendsin -592.0 10528.0 2716.0 928.0 7468.0 GalnesUle7360.0 8624.0 8720.0 8864.0 8760.0 9004.0 Arnow 8860.0 9656.0 9560.0 9800.0 9984.0 10084.0 form Corm9980.0 formerly 10480.0 10088.0 Cormcllr 10476.0 10488.0 erly cllr7616.0 7532.0 7796.0 Galnesllle7704.0 8804.0 bor8716.0 9224.0 9096.0 9608.0 9520.0 9940.0 9848.0 friendshere 3472.0 7212.0 7640.0 7568.0 7980.0 7904.0 nhn -564.0 8544.0 8476.0 8360.0 9048.0 8968.0 welcome 10080.0 3204.0 10000.0 himPiiuUUil 10388.0 himllnthied 10672.0 Inllddll 10684.0 7384.0 3460.0 PiiuUUil nllddllllnthied8108.0 pecan 1tlllIl8668.0 trees trowtrlS8540.0 9112.0 9032.0 9332.0 the9260.0 loading keatling9576.0 9652.0 ll 10224.0 ldill 9748.0 10304.0 3520.0 va vuvariflio 10472.0 vuriPtit 10396.0 1rittil 10428.0 riflio rittilriPtit3683.0 fur for7600.0 8160.0 8164.0 silt Hll8224.0 8420.0 8568.0 3720.0 8796.0 3695.0 rodncod nthlctlinluced8700.0 3692.0 prices priers9404.0 pr 9716.0 10016.0 till thothe9824.0 ro m10260.0 muntinilr romaimlor 1I 7124.0 3876.0 1111111111 7204.0 maimlor untinilr7636.0 7660.0 7864.0 7708.0 7696.0 7992.0 ti7860.0 III 8144.0 8276.0 3912.0 8128.0 8280.0 8376.0 8644.0 semen8492.0 8672.0 oca -488.0 9160.0 8888.0 9464.0 9156.0 9572.0 9536.0 9540.0 E9720.0 lo 9832.0 9964.0 Stokes StokesCampville 10532.0 9968.0 10172.0 10188.0 10168.0 10240.0 10228.0 kt 10320.0 ktaunpvkll 10420.0 3980.0 10380.0 Campville llIlPilllaunpvkll8172.0 4135.0 Fin Fla7268.0 FinOrlno 8404.0 FlaOrino 7396.0 Orlno Orino8036.0 Laxative LaxatleLaatlve8940.0 Fruit Syrup SrruJl9372.0 10268.0 thl10040.0 thenew 10520.0 thlnew 10496.0 7200.0 4648.0 new 7628.0 laxative 8424.0 stimulates sthnu1ates8296.0 9296.0 does 9708.0 10272.0 notIrritate 10176.0 10276.0 not nut10536.0 notirritate nutirritate 4836.0 irritate 8132.0 8472.0 8268.0 8808.0 4844.0 8600.0 9280.0 best 9072.0 9816.0 laxativeGuaranteed 9624.0 laxaUl10492.0 644.0 laxaUlGuaranteed 7196.0 5064.0 Guaranteed 8572.0 your 8680.0 our 9080.0 money 9084.0 mont 9632.0 9752.0 Jack10400.0 10148.0 JW 10404.0 J1V 3424.0 1V7516.0 McCollum cCollumdicCollum7380.0 -736.0 8352.0 Co 7652.0 CoSubscribers 1716.0 8892.0 ISUbscllbers -20.0 10628.0 7400.0 Subscribers SUbscllbers5595.0 8384.0 onCrural 8812.0 Crural 8848.0 rural 9408.0 5564.0 free 9864.0 delivery delhlr9728.0 deliveryroutes 5800.0 routes 7828.0 can 7732.0 8204.0 send 8104.0 8580.0 8832.0 8932.0 8724.0 subscriptions subsCrl1U9336.0 subscriptionsby -1116.0 10548.0 n8 n8by Idesire 10632.0 6011.0 7544.0 7404.0 themail 7804.0 7944.0 mail mall8304.0 8452.0 carriers Persons 9116.0 10216.0 10064.0 whodesire 6231.0 desire 7848.0 7716.0 8300.0 6248.0 6267.0 8616.0 9092.0 such 8956.0 9604.0 6243.0 10264.0 10128.0 canalso 6463.0 also 7632.0 scnd8004.0 8748.0 8660.0 9392.0 9300.0 carriersW carriersV-660.0 10052.0 7388.0 6719.0 7456.0 7724.0 8008.0 Porter 8688.0 regular 9612.0 winter wlntlrvis Nis10156.0 Nisitor 10376.0 IItor 10408.0 10512.0 6948.0 itor 7500.0 arrived ulrlved7932.0 8632.0 9244.0 6951.0 9136.0 North 61t119504.0 10248.0 10092.0 10540.0 7176.0 7184.0 7668.0 7192.0 remain 7508.0 8392.0 8248.0 8912.0 until 9456.0 7180.0 spring sllring9304.0 MrPorter MI10508.0 MIPorter 7416.0 7884.0 7428.0 statts7744.0 8504.0 7408.0 8372.0 8984.0 7403.0 9312.0 9172.0 9580.0 9444.0 10072.0 7420.0 9920.0 10368.0 beboback 10544.0 uback 10452.0 beback 7680.0 7672.0 amollS7596.0 8328.0 bls8232.0 8656.0 Florida 8564.0 9376.0 frlelllis10044.0 agtln9956.0 againH agtlnBagainE7392.0 7892.0 7908.0 BE7504.0 Gaulden 8852.0 8664.0 9088.0 luomlnent8944.0 10096.0 9952.0 3432.0 8119.0 8148.0 operator oJlmtor8584.0 Eugene Bugene9592.0 8155.0 wavas9988.0 busi bU8110500.0 10516.0 8192.0 10552.0 iness ness Isltor8375.0 8496.0 8351.0 estelhr10280.0 8348.0 111MrGaulden 10620.0 8380.0 IGulden 8556.0 Gulden7888.0 8576.0 honor hOllor8648.0 9352.0 9620.0 8571.0 9512.0 hn 10180.0 9928.0 9804.0 10296.0 8583.0 tla tlotlopostoffice tlaJlostoffice tlapostotfice postoffice Jlostofficepostotfice8156.0 8827.0 8320.0 8908.0 8800.0 point lOlnt8736.0 named IInnllllcanted9344.0 10152.0 after nftlI10012.0 afterhim 10556.0 nftlIhim 9035.0 himDr 7512.0 9279.0 9303.0 7752.0 Win Wrn8076.0 9291.0 Elmoro Elmore8364.0 9288.0 Jacksonvillewas -1040.0 Jacl onll1l 9828.0 onll1lwas 10524.0 9528.0 7524.0 9523.0 tiltCor8588.0 9052.0 9552.0 9140.0 hours 10244.0 rlSrlStprdar 9584.0 3348.0 9736.0 terday tprdar9755.0 Illlie8332.0 9780.0 8652.0 9060.0 route homo9500.0 9740.0 fromAlachua fromAlnchua 9975.0 Alachua Alnchuahere8604.0 9972.0 8880.0 8792.0 9248.0 boon uecnbeen9712.0 10004.0 n10164.0 hrh10076.0 briefbut hrhbut 10448.0 10192.0 10207.0 10200.0 pleasant llleaslnt7472.0 10195.0 Islt 8732.0 8828.0 10212.0 lIarent10196.0 Captaro 10048.0 Cap CallCaptain Calltaln 10263.0 10424.0 10427.0 taro taintaln10436.0 7912.0 10440.0 8468.0 nItElmore ElmoreCaptain 10696.0 8120.0 10700.0 Bfi8044.0 10688.0 WecrFontaine oC9704.0 AficanopyAficanopywho10908.0 10920.0 7540.0 7852.0 10916.0 7764.0 8628.0 8536.0 8876.0 9228.0 phosphate bust busibuslbustness 10976.0 10860.0 11184.0 7688.0 11179.0 near 7576.0 8180.0 11143.0 8068.0 11140.0 ewberr 9012.0 9176.0 11172.0 11136.0 the9764.0 cityfor 10564.0 cltfor 10456.0 IIness 10648.0 11363.0 11375.0 11408.0 7448.0 11372.0 7612.0 8084.0 7996.0 8620.0 Thursday Ho9976.0 11392.0 10292.0 enroute 11583.0 11604.0 11600.0 7648.0 11595.0 7952.0 8500.0 11592.0 mines mlncstrom8992.0 9684.0 hhi9532.0 homehomowhere homewhere 11808.0 11824.0 11820.0 8060.0 MentIpcnt7984.0 11856.0 n11815.0 111easa1tChristInas 11875.0 11872.0 Imas 12080.0 InasmasLost 7536.0 12296.0 12315.0 Lost 7896.0 12344.0 018200.0 12308.0 Strayed 8072.0 12300.0 StrafedDlack StrayedBlackBlack -480.0 white whltowhitecow -460.0 10568.0 whltolnw 3372.0 12523.0 12591.0 cow lnw12544.0 7492.0 7940.0 mil laliraft7868.0 12535.0 branded hrltHhtibranlctl9016.0 Hi ill12576.0 now 9384.0 nO 11l mark 9760.0 marked markcdinn 10344.0 rk 10316.0 rked 12603.0 12743.0 12760.0 cd12792.0 crop 8012.0 12755.0 7876.0 12787.0 01108696.0 12784.0 ear 9132.0 swallow fork lork9812.0 10416.0 10288.0 Inother 10560.0 inother 12912.0 12968.0 12980.0 13007.0 12984.0 calf 7740.0 13011.0 upper 8168.0 uP1 13016.0 8596.0 er 8872.0 12975.0 slope 12972.0 9844.0 underblt underblunderbit9724.0 underbltin underbitin10576.0 13192.0 13212.0 7452.0 13244.0 7844.0 13239.0 eal13200.0 8112.0 13195.0 rork8916.0 Md9364.0 uuderblt underhltunderbit9756.0 uuderbltIn underhltInunderbitin13436.0 13432.0 Reward HowardRenard7920.0 13427.0 information 10284.0 toW toMarclolllt to1S 13667.0 1S7476.0 Marcionny MarclollltMarclonny7324.0 13688.0 9348.0 Fla 9196.0 FlaFriends 9616.0 Flal 13908.0 13923.0 Friends rll1dH13932.0 7432.0 13976.0 7444.0 or7464.0 13920.0 Mss lnssAlss8840.0 Margaret Margnltt13916.0 nllTaylorwho 13911.0 Tn Taylortvhto lol lolwho 14131.0 14148.0 tvhtohaHbean7956.0 8184.0 14184.0 lon 14140.0 Quito qultoquiteIII9020.0 9308.0 typhoid typhoidfever -632.0 9932.0 14152.0 typhoidtecer 14355.0 14380.0 fever fewItecer7812.0 14372.0 wUlw11114368.0 gratified Iratlflod8432.0 14467.0 14375.0 9676.0 14363.0 learn leamfliattllatfliatshe thatshe Ishe 10644.0 14583.0 14600.0 7608.0 14636.0 wag7480.0 14595.0 enabled pnahldnabled8816.0 14604.0 14592.0 sit 14624.0 up 9744.0 yesterdayfor 9840.0 Isltldn -720.0 10624.0 Ifor 14807.0 14827.0 14824.0 7440.0 first 7780.0 t1r 8140.0 14839.0 14820.0 timotlmo8636.0 14815.0 about 9492.0 14812.0 throothlloweeks WllkHweksweeksHer WllkHHpr weksHer 14976.0 Her Hprrecovery rcCotI 8448.0 15044.0 8212.0 xJpctedrapidly lnpldlr15064.0 110Wnowfor jfor 10636.0 jfUI 15260.0 15279.0 fUI15272.0 8428.0 anti 1111118928.0 nnt 9476.0 9588.0 tlhndHfrlraads15288.0 UItauearevory 15291.0 auevery 15315.0 iir 10640.0 15532.0 very vory7304.0 ir grateful glltlfulgratefulAmong glltlfulAmnnu 15740.0 15772.0 Among Amnnu8092.0 15755.0 the15752.0 promlncnt9452.0 falIIIlIH9328.0 10220.0 whospent whosPlnt 10364.0 hospent 15963.0 16007.0 sPlnt15984.0 lshIt1a 8608.0 8756.0 15975.0 thlH8896.0 15972.0 9796.0 9944.0 W1ivas15968.0 PPAlan FMarlon Ilarlon 16192.0 Alan 7216.0 16212.0 Marlon larlon7964.0 Ilampey Hllm81YItluuey8772.0 16195.0 Wacahnota WucahClola1VucahootatcIto10008.0 tcItoraises hoi hoiraises 16236.0 Irallies 16439.0 raises rallies7816.0 16471.0 osmuch milch16432.0 16424.0 16420.0 necessities 1IPHo1llllHuecHNlties9240.0 ufoflifo oflife 16516.0 IIIfo 16635.0 16659.0 lifo IIfolife7588.0 anll16652.0 lived lives7880.0 16656.0 16691.0 Oi ih as16700.0 8784.0 16647.0 8920.0 lll 9232.0 16676.0 IllYuny9400.0 mallnulnIntlw 16864.0 16884.0 tlw16891.0 coutitV7676.0 OUllt 8400.0 And AIIII8028.0 Au 8976.0 16908.0 Ramsey HlmH enjoys PIIJoya9700.0 enjoysthis PIIJoyathis 17087.0 17108.0 living 1Ilngring8236.0 17111.0 too ton17119.0 8484.0 8868.0 17099.0 Judge jud 17131.0 9120.0 17096.0 9916.0 bin hilihis17104.0 outnard out Olltoutward Olltwalli 17312.0 17331.0 ward wallinard1388.0 17319.0 apparatncand 7756.0 17360.0 nppeaninr -1384.0 17316.0 genial gllIlalgenlnidisposi IlsposI9788.0 disposition -576.0 10504.0 IlsposIinit 10184.0 17348.0 pOll It1oll 17387.0 17556.0 tion t1ollinit7284.0 initdirs 17795.0 17819.0 lIsdirs117960.0 8176.0 17807.0 Langdon 1lIgllllnlatngilon17803.0 Rood Hill8884.0 17812.0 Rt 9188.0 17856.0 9324.0 fOllIIlIlyofthis ofcOllnt 18020.0 18039.0 18056.0 cOllnt8264.0 hut8612.0 18064.0 raw18071.0 IIO 9028.0 18027.0 18023.0 Washington ushhlJton11aslaingtouIH IiiIsIsspend IHHpondlng IiiHP 18247.0 18264.0 Hpondlng HP -756.0 7684.0 18303.0 llIlIlIg lug nfwfen8216.0 18255.0 tlnYKlital9212.0 lIclnopAllcanopyAllcanopyhnvhag Mlcanopyhaving lIclnophavlllg 18472.0 18491.0 havlllghnvhaghfl1I7768.0 18479.0 Mwimonud fUllIlI10llutlsuntnnonc19416.0 18499.0 9692.0 9568.0 10136.0 18475.0 11I111Itpoital10024.0 pointon poitalon11I111It1count 18728.0 account 1count18711.0 18707.0 tillIllness illiusst1111tIoIH18699.0 9380.0 hr9636.0 moth anuthmothIanuther18760.0 18927.0 PI18939.0 1irsi 7712.0 IIR 18931.0 I0dwanlh i8900.0 8412.0 wards lIIl Hr18955.0 18948.0 numoroun nunlruusnumorounfriends 18951.0 1I11111 nunlruusfriends 18960.0 10208.0 IOIlK IOIlKfrltllIls 7220.0 19159.0 frltllIlsIIIdais thh8460.0 8560.0 jectlon PClIol1srlloulrc 19147.0 Iatl 10300.0 HOOKllHOOh seeher 19371.0 11117300.0 19424.0 7484.0 7644.0 19388.0 hutregret ntgrrtrttgrN19376.0 9068.0 Hill1111huts19403.0 come curiaenrllt 10256.0 011onsuch 011such 19587.0 a7584.0 sad 7776.0 ad 8284.0 19603.0 mission mlfoijoilon19599.0 IlIK Is9524.0 19591.0 hoped h0111111hopethatMrs thatlrH thatAirs 7228.0 lrHAirsKdwards Idvards19831.0 Ed 8416.0 7924.0 19864.0 wur ollllltioncundttiou19816.0 wIII9320.0 9836.0 19852.0 soon MoonIm 11111niImprove 1111I 1niprove 19879.0 JIron7156.0 proveFrom JIronFrom 7656.0 7224.0 20307.0 20327.0 7820.0 Sunr11JlR SunrlayN7700.0 Stnr jfl Dally nnll1DORYAtmAtmNelll SunNtlll SunNeill 20515.0 20536.0 Nelll NtlllNeill20539.0 Sutton Buttonwan waKsvaN9396.0 tradlllJtradingIn 20631.0 20764.0 7364.0 7832.0 7736.0 8244.0 20751.0 8040.0 yesterdayK yesterdayH9056.0 20795.0 8440.0 20788.0 trdn trdnH 8952.0 K7728.0 7520.0 Dradley Brad nradlc21023.0 of8692.0 Wacahoota ncnhnotn1Vacnhootntivs tivstrading 10384.0 21068.0 11tradlll 21044.0 atrading tradlll8196.0 21247.0 8080.0 21240.0 eltryobtonlayMr yesterdayMrsyobtonlaytlitlrdar-788.0 tlitlrdarlrK MrslrK 1V11Mathews MathowHlath 21544.0 9420.0 21503.0 CUm CltraCilra10252.0 war warshopping WIIwashopping 10468.0 WIIaholJplno 21699.0 21743.0 shopping aholJplno8064.0 21735.0 21731.0 8208.0 21740.0 ell 21723.0 t8terdn 9732.0 Ilr 7412.0 22016.0 22011.0 22004.0 7916.0 22007.0 IN8256.0 Klncaid KfllcliidKincaidNewberryIn 9640.0 pwIJIrr -676.0 22023.0 21987.0 bnrry isIn 22211.0 22231.0 22227.0 thleft 22260.0 22224.0 vl vlNlt Iilt 9076.0 rolatlvfrelntlfJiIrelntlfJiIW relativesW10036.0 nW 22499.0 22483.0 atrlckland atricklaud1120.0 22480.0 trlcklalllllltld rand22516.0 Kon9544.0 I22507.0 wen WlrlwerewenIn WlrlIn werelit 7232.0 22700.0 22724.0 lit22715.0 lIw7368.0 22719.0 frumfrontParadlm Pl1rndllHInradiAyoHturday9388.0 yoHturdayMUH 9628.0 uRturtJn 22787.0 I1I8s 10652.0 22959.0 22987.0 MUH1I8s22975.0 Sarah Snrah22983.0 22971.0 Vernon VurnonYumon22963.0 Chicago Chlcnoiu10444.0 1MIsInIn 1MIn Isin 3276.0 23179.0 23212.0 7460.0 23207.0 tIll thothe7376.0 23200.0 7720.0 cll 23239.0 guehtJUCJt23195.0 MrslrH 23191.0 S9672.0 Ulnnd Ull1tulIlland9904.0 UlnndIng Ull1tullng Illandlug 23435.0 Inglng7424.0 23640.0 23652.0 Waterman 1Vnterutan7604.0 23675.0 nltrlllnn Johnson JoiuiHonJohulIlmMIctinopy UCfIIlrlMlennopy9292.0 23663.0 wn wntrnnMa W1UIW1UIII wastrnnaa 7236.0 23851.0 23899.0 trnnMa trnnaatrtu 23879.0 lIl1U 23919.0 7872.0 23867.0 iliigtm ting 8312.0 hUllneu busitwcs23872.0 iiue 9024.0 lnthus 23860.0 citytonlay 10132.0 yestrday 23887.0 10356.0 10308.0 ttrda 7152.0 24103.0 tonlay trdatrdaytonlayMlh trdaA 7244.0 trdayMb 7308.0 24343.0 24371.0 Mlh Mb24363.0 Hattlo HaUioIlatttoHoili HolJhodss 24351.0 ut9100.0 High 9480.0 9596.0 9888.0 SllrlIISiiriiiSpringfontHrly SllrlIII 24375.0 sformerly 24567.0 24588.0 fontHrlyrorJlHrigf yftf24579.0 thU8712.0 8844.0 crt clt24612.0 9124.0 9600.0 24600.0 ngUll giiMitguestoffriends ofrMenth 24811.0 rMenthhorn hornMr 8056.0 24839.0 oro oror 25043.0 25088.0 25107.0 25067.0 awl und25111.0 8088.0 25071.0 MrJ8516.0 8904.0 25052.0 1125055.0 Melton MoHon25059.0 10144.0 Cltrn CitrnCitrnsere Cltrnvtru CltrnIirU 7248.0 sere vtruIirU25327.0 nino nmnJCthowho thorewho8444.0 25291.0 UOH woo IMIU stmt25303.0 nl jnvtr ptrptrplay 25299.0 jnvtrday 10204.0 jitr jitrtin playthfoBtht8340.0 cityMm dlMrs cityhrs 25760.0 25791.0 Mrshrs7900.0 25783.0 25787.0 8188.0 Warn1t Wgrren8820.0 rnM 8368.0 25775.0 oft25771.0 Hnin nntuck ittunswlccwirc GeIs 0is Oft Ge25983.0 1826011.0 lhclbf7624.0 1t u8308.0 stsie 8856.0 9044.0 26007.0 UHt ur25987.0 ltLr htr9556.0 26023.0 Dothr mtxhvrinoth Dothrfrs 10460.0 rMr 7256.0 26223.0 26243.0 111126239.0 frs 26231.0 7564.0 7976.0 UItJobti JobnJohuuoii JtI8776.0 oiiMr 8768.0 26268.0 AMr 7164.0 26351.0 26503.0 7836.0 ftiuialldMraCra26479.0 If119152.0 Smith 5mUharc Mrl9884.0 1r 26515.0 Hhonn rat rathum 26604.0 7168.0 26795.0 hum honnhon1faxaln aialn8116.0 8260.0 26720.0 Bfl 26715.0 Itfttr26744.0 as26708.0 9064.0 1w 9360.0 26735.0 Uay Qayr9488.0 Uaywith cJa Atc Ihl 10312.0 IhlI rcl rclwith 26928.0 26943.0 7264.0 wit tridfrind426947.0 Outi Oulrl8324.0 Julio Iuflh26935.0 rite ritClh 10124.0 xmlns:ns7 ID22 12932 8104 11000 2380 ns7:type 18420.0 iraiWILONTSa 18996.0 11632.0 BmWllSON aiWILONTSa9 -956.0 16140.0 9CHRISTMAS 15344.0 15408.0 15992.0 15816.0 uaCHRISTMAS 16520.0 18548.0 18568.0 18572.0 JiCHRISTMAS 19104.0 11004.0 5044.0 CHRISTMAS CHRISTMASNOW -2952.0 13956.0 14312.0 TREASURES TREASURESNOW -2888.0 18456.0 5988.0 ijt ijtNOW 18620.0 12508.0 6127.0 NOW ON OH13476.0 14684.0 SALE 14340.0 SALEWe -984.0 15668.0 18464.0 6255.0 17792.0 6683.0 17804.0 17872.0 18200.0 17848.0 18224.0 18144.0 18559.0 18191.0 IWe 18580.0 11000.0 We 11544.0 Invite 11396.0 12368.0 Your 12224.0 13052.0 Inspection 12904.0 14540.0 14324.0 14992.0 14780.0 15615.0 7055.0 Fancy 16468.0 Goods 16328.0 GoodsCOLLAR 17224.0 16472.0 18520.0 17992.0 dCOLLAR 17996.0 18088.0 COLLAR 11876.0 12284.0 CUFF 12164.0 12888.0 7772.0 BOXES 12768.0 BOXESNECKTIE 13520.0 14104.0 DOLLS 14128.0 DOLLSlUG DOLLSSIG14996.0 BIG 15512.0 15600.0 LITTLE 16000.0 LITTLEFANCY 16800.0 dNECKTIE 18083.0 lI 18028.0 fNECKTIE 18111.0 11012.0 7959.0 8075.0 NECKTIE 12000.0 11864.0 BOXESGLOVE 12620.0 14107.0 14124.0 14392.0 FANCY FANCV15136.0 CUPS 15032.0 15723.0 15628.0 16120.0 SAUCERS SAUCERSSHAVING 17028.0 18000.0 JGLOVE 18096.0 SHAVING 15404.0 MUGS 15244.0 MUGSFANCY 15932.0 18052.0 11008.0 GLOVE 12152.0 KERCHIEF 12032.0 13256.0 8399.0 13144.0 BOXESNOVELTY -636.0 13892.0 13260.0 3700.0 14396.0 15152.0 PLATES 15896.0 16508.0 BOWLSin 16396.0 BOWLS 17212.0 BOWLSBALLS 17208.0 17975.0 tNOVEL 11020.0 8699.0 NOVELTY NOVEL11676.0 TY 11924.0 12060.0 BOXESIn 12680.0 13132.0 8791.0 BALLS 15132.0 15012.0 15543.0 OTHER 15416.0 OTH 16199.0 ER 15928.0 TOYS TOYSBASKETS 16840.0 TOYSMANICURING 11376.0 11612.0 box 11700.0 boxMANICURING 12096.0 11032.0 9252.0 MANICURING SETS 12264.0 SETSTOILET 12916.0 14384.0 BASKETS 15507.0 tip Sinip15232.0 15644.0 9236.0 lIIp 16100.0 16315.0 BitskoU B1skctsIj1ketBitskoUWork 17144.0 B1skctsTOILET 17964.0 fTOILET 9407.0 TOILET 11852.0 11724.0 SETSGENTS Work 1a1l14640.0 Olk 15328.0 UiktK -872.0 15332.0 1tal 15460.0 15716.0 klt 15572.0 16024.0 15856.0 15748.0 16588.0 Stand Stln116592.0 StandBaskets 17231.0 StandGENTSI 17936.0 17984.0 flinskt 9707.0 Baskets linskt15224.0 14800.0 14536.0 14936.0 14836.0 15568.0 F1uit15100.0 16320.0 9695.0 16072.0 BasketsWood Hn IA16704.0 kots k1tq16564.0 16708.0 kotsoud vGENTS 18108.0 GENTS GENTSI 11640.0 TRAVELING 11684.0 13000.0 SETSPIN 13472.0 Wood 15020.0 oud OUtI14552.0 HliklltPIN BaskiU HliklltBaskiUSCKKtiNS ISII 15548.0 15400.0 15592.0 10043.0 15588.0 15687.0 15656.0 tlPIN 15848.0 11028.0 10135.0 PIN 11464.0 CUSHIONS 11324.0 CUSHIONSINK -992.0 12456.0 11564.0 11860.0 11828.0 12012.0 ION 11972.0 12364.0 12328.0 SINK 18240.0 1INK 18288.0 2592.0 SCKKtiNS SCHIhN-1212.0 10332.0 15076.0 10324.0 IEN 15028.0 16064.0 15651.0 16256.0 ilti vii 16440.0 various 16660.0 varioussixiri -792.0 16567.0 111018 111018GILT 16696.0 l10118 l10118GILT 11040.0 10471.0 INK STANDS 11364.0 STANDSGILT 10596.0 sixiri 14432.0 iiZl 14868.0 lf 1f14716.0 15O 15472.0 15536.0 10604.0 15516.0 15756.0 ti500PICTURE 15952.0 16196.0 500 500KUCJS 10736.0 10744.0 GILT CLOCKS 11468.0 CLOCKSPICTURE 10763.0 11036.0 10940.0 PICTURE 12048.0 FRAMES FRAMESGOLDPLATED 12836.0 14660.0 10956.0 KUCJS lilliti10959.0 15355.0 14860.0 lru 14796.0 10952.0 15200.0 15964.0 10980.0 givat gllIntglltt15792.0 stock HtooktOak16484.0 stockuf 17236.0 HtookGOLDPLATED 16764.0 tOakGOLDPLATED 11212.0 GOLDPLATED 12548.0 MIRRORS MIRRORSSHAVING 14376.0 11228.0 uf 14452.0 11312.0 14568.0 14480.0 14511.0 11247.0 14572.0 11224.0 Hugs Uilg15216.0 14876.0 11288.0 llg 11115128.0 11215.0 sizt 15764.0 sios iZt411220.0 rue iOerote16252.0 17036.0 11244.0 toJ toSHAVING 11024.0 11460.0 11548.0 12044.0 14120.0 12520.0 14520.0 14143.0 14712.0 11568.0 14612.0 14852.0 11500.0 00 14744.0 each inch15104.0 15204.0 eachLadies9 15680.0 17728.0 18168.0 17787.0 17280.0 Iladies 17336.0 18384.0 11832.0 18440.0 11895.0 18428.0 MLadies 18487.0 11979.0 ladies Ladies913096.0 11991.0 12896.0 13856.0 Childrens 15632.0 Coats 15432.0 15636.0 CoatsPont CoatsPuut12071.0 41tI 18404.0 12559.0 Pont Puut12552.0 hll 1tI11664.0 11784.0 luMliucivcdliy 12024.0 13172.0 13448.0 13724.0 Iiwtiulliuk 13304.0 13728.0 spirial 14547.0 slut sik14436.0 12547.0 14896.0 12615.0 you yuu15900.0 16400.0 utl w11willlind wiLLfind w1111111lxttr 12816.0 12820.0 find lind11111lxttr 11452.0 11552.0 better hlttl112200.0 12288.0 goods good12432.0 OOI 13088.0 hen firm12800.0 13736.0 lit13484.0 12891.0 Olll14676.0 14484.0 15420.0 15023.0 lllnl 15624.0 12823.0 plill15384.0 16596.0 Coino 16235.0 Coinoand 16776.0 12880.0 un10 un10tlIl1 16920.0 1110und undtlIl111528.0 soo Sou11432.0 11840.0 11956.0 till12408.0 values valuoull 1tlllltJStill13348.0 13720.0 plainly 13612.0 plni 14475.0 Illy UUUkldIllilrlrImarkedDRESS 15391.0 UUUkldDRESS Q 15388.0 QDRESS 18176.0 12568.0 DRESS COODS GOODS13904.0 GOODSTin COODSTlli-1544.0 15672.0 17724.0 13783.0 18299.0 17776.0 ti11ii 18348.0 11368.0 13899.0 13968.0 Tin Tlli11ii11788.0 13971.0 t411900.0 n11816.0 14019.0 12052.0 12132.0 13983.0 gnu frreatgrtat12004.0 12608.0 12684.0 13964.0 torK tllktOk12664.0 13108.0 uinl 11111attil12996.0 13532.0 13400.0 13660.0 tll 11113840.0 13992.0 urth urtlttnrtiimir unrluor14444.0 15092.0 1114956.0 15236.0 14027.0 15276.0 14007.0 15256.0 lIidlIul 15448.0 ii 15888.0 15488.0 lrtIttIso 15692.0 nili 16156.0 15947.0 16423.0 Nil16544.0 16628.0 Utlor bttrIMstberUtlorvaue 18227.0 i17tlll vaue 17tlll11124.0 111111 11356.0 14200.0 11400.0 11580.0 14203.0 11584.0 tainalih IIhtuillllhuhtllilnllle11620.0 12396.0 14191.0 11672.0 12504.0 anywlieii 1I1I 13232.0 12804.0 wlI 13416.0 ami tlliI13164.0 13792.0 brit13704.0 14240.0 jmi yt4114088.0 IIII nv 1110ion14188.0 HIUV MIIt14892.0 15480.0 14160.0 nt 15360.0 15620.0 15776.0 14167.0 jWtllll 15860.0 ctlin 11111116220.0 16459.0 ihe IIIl16464.0 Ill 16852.0 right riijht16616.0 rightprinv 17239.0 16856.0 riijhtIri 14164.0 alritr 18332.0 7240.0 14271.0 14328.0 prinv lritrIri 11484.0 JIM as11240.0 11768.0 we tit11692.0 12056.0 12136.0 12008.0 12624.0 12988.0 12808.0 12992.0 ONK 13240.0 13288.0 13388.0 13480.0 IMMCl 13320.0 iI13972.0 13739.0 I13936.0 Jo h13772.0 14343.0 14004.0 14272.0 14156.0 eirj rry14840.0 oitfti lUtttur1UKT tur15188.0 UKTMRS 15556.0 2664.0 tMRS 18272.0 14759.0 MRS 13268.0 H13272.0 WILSON RWILSOT13708.0 ILSON -2020.0 18400.0 15124.0 18147.0 15231.0 18204.0 xmlns:ns8 ID31 11596 10692 15460 ns8:type 12144.0 0l 12168.0 10904.0 15612.0 1111216.0 11320.0 11476.0 HaKiie IInHlIlIingue12092.0 anilltld11996.0 12492.0 won Hunsun12380.0 DoWltt Ik11Itl13668.0 war13500.0 wereIn 14060.0 warIn 13900.0 13960.0 ItIII 15835.0 IIIlie the11344.0 Hty rlty11076.0 11644.0 15871.0 fstrnlay 1ItcIla12856.0 12588.0 12948.0 Maunc Ilague13048.0 IIUH 114iM13584.0 IHone 14044.0 iMone 011111092.0 uf10988.0 11248.0 16079.0 leading hllIlIlIInrltt12440.0 farmertt fllrlllllHfarmers12320.0 Habit llayullayuFran 111I Habitralz 13820.0 lIt lItIIIIIIZ 3104.0 10888.0 Fran IIIIIIZ11016.0 16359.0 ralz Wenton 11estun16343.0 lItoll 12120.0 12256.0 Newberr Ntt 16367.0 12872.0 12924.0 IIIT heir12720.0 16352.0 13560.0 16355.0 timing maua111111111mauaKer 111111111Jel timingget 10704.0 16587.0 KerJel11084.0 16552.0 16591.0 11348.0 tin1 11168.0 titphohph phulilhntlphuspl11504.0 12260.0 +12356.0 16563.0 ite 12340.0 12572.0 InlirentH 11I1111HtMImtrsts13528.0 elfIhltheCumber IhlClIlIIhll theCumhr 16775.0 16780.0 Cumber ClIlIIhllCumhr11480.0 Ltitnber JulllhlrItunhrrCoiiipitn oiiil 16807.0 ollllllIr 12728.0 12744.0 13160.0 wax Willtsas12960.0 13580.0 tramt tllIl1lUaits13464.0 tramtact tllIl1lhllllhwHH UaitsautIII 14000.0 16992.0 17019.0 act autIII 10924.0 10968.0 lim 11144.0 lniHliiiHH hllllhwHHbusiness12124.0 IIIlti12016.0 12372.0 16995.0 tIi12560.0 1M 12776.0 elcy17031.0 12812.0 13180.0 yehtenliiy ilhltlllryehtenliiyMIH ystrdnyIystrdnyIdirs ilhltlllr111i 10892.0 17263.0 MIH dirs10992.0 111i 11436.0 Haddock lIaddockIlatldoek12148.0 12668.0 12488.0 12672.0 Ulchmonil HllhlllOlll1lchmulnt12772.0 13744.0 Ca 13508.0 CaUrn 13940.0 11uarrived 13944.0 11hi 10692.0 17479.0 17520.0 Urn 11296.0 10964.0 Ired 10944.0 11416.0 hi11668.0 thothe12020.0 rlti 11916.0 12228.0 yeHturday ttltlItlIlYvsltrday13404.0 anil IIlIdati017483.0 13692.0 14052.0 13880.0 01Uw 14016.0 14112.0 17655.0 17699.0 17720.0 Uw11088.0 next IIlxt11572.0 17708.0 11440.0 fit fury 11708.0 11844.0 dayw17703.0 17747.0 12160.0 vIllIIIhe13220.0 Ihl13092.0 13600.0 gueM gueMof nni 13648.0 ni tlniof 14032.0 14116.0 17752.0 Iuf 17928.0 17940.0 uf17931.0 hlI10852.0 17943.0 imrtiits 11I1IllIhlpurvaits12108.0 Indue 1nQgellId 12708.0 IIl1dstud13124.0 11rs13216.0 11H 13440.0 IIMltHOII 13716.0 13884.0 tL tLMason 14040.0 13888.0 13996.0 ItllIlOlI 18136.0 18163.0 Mason MltHOIItllIlOlIMasonFor 11236.0 10708.0 MltHOIIFor 2872.0 IFor 10884.0 18371.0 18383.0 For 11272.0 IlII11180.0 18412.0 18380.0 or11920.0 18375.0 the12280.0 ordinary orlllnlr12180.0 diseases UlnoaHOHdhHIHIK13896.0 13796.0 oftho oftill ofthe 18591.0 18603.0 thothe18600.0 Kkln Hklnskla11560.0 ChamborlalnNH Chutnbrhtlnxs11424.0 18595.0 Chlllllll -1296.0 18636.0 12252.0 rlallllilt4 12196.0 Halve HllltlHnly13568.0 lifIN18624.0 oxcelletit 13700.0 13824.0 ox oxccllont oxtcllollt 18808.0 18823.0 ccllont tcllolltcelletitIlIlIIl 18832.0 nut11980.0 12072.0 duly12524.0 18811.0 allays nllayn13112.0 the13008.0 13468.0 ItchliiK ItdllllgItching13368.0 Itchingand 14056.0 ItchliiKand ItdllllgIIlItI 19031.0 19047.0 IIlItI11116.0 19035.0 smarting HtnartliiKKmnrtJlIt19040.0 bul12348.0 19043.0 effects offectMttrechl12244.0 19072.0 a13196.0 19064.0 cure CIIIl13076.0 13764.0 IcuForualo IcuMalo 14020.0 orsale 19267.0 sale ualoMalo11112.0 19263.0 11380.0 19260.0 11200.0 11660.0 19255.0 druggists drugRlHtisdrugKlaldrugRlHtisMHH druggistsMss12444.0 10896.0 19516.0 19536.0 MHHIIHH19528.0 Alice AliiIAll 19531.0 Cnto l11co12040.0 19540.0 ufu 12404.0 or19519.0 AllldllllL11uInut12564.0 19551.0 wau 13352.0 13788.0 116 nwhiluluthe Intho hitill 10712.0 19739.0 19760.0 thothe19756.0 19787.0 ona ut1at11764.0 19792.0 vlnl VINII12064.0 hllt 19763.0 relative reintites13496.0 19775.0 13572.0 Itlll Itlllt1 19768.0 rrhily 19963.0 19983.0 rhily10996.0 19976.0 HIll Hhe10788.0 11308.0 11576.0 20012.0 vax sitsWII 12140.0 aroompanled antnpnaied13372.0 19968.0 13228.0 Mrt Mnl11rw13456.0 11rwIiro 13696.0 MnlIlruWI MrtHrowu 10724.0 20188.0 20212.0 Hrowu IlruWIIiro 20235.0 vn 20203.0 or11252.0 20200.0 1Ult12272.0 Pierce PlurcoPIrcH20191.0 20223.0 13328.0 ilo 13492.0 hiINherKliest herguest 20415.0 20443.0 Kliest11I18l20432.0 11156.0 20420.0 lh20440.0 IIIxlItext11728.0 fw12748.0 rtayH 111101QnysrtayHMrn 13116.0 Qnysht 20464.0 IMrJol 3240.0 10900.0 20667.0 20691.0 Mrn MrJol11064.0 20723.0 11636.0 20687.0 111908.0 20679.0 Folk Folksfllidrind12360.0 chfldnlIchllllren12764.0 haverturitt 13556.0 13676.0 havereturned 20735.0 13852.0 Ilftullllc1 20895.0 20931.0 rturitt 10716.0 20911.0 lftullllc111336.0 11428.0 20907.0 trum20943.0 ruin 11952.0 12104.0 20899.0 Ixjvyvlll IevyVIlie12796.0 20947.0 12848.0 12828.0 13056.0 whero wlllrttwherethoy lIwytIIOY13564.0 thoyhav lIwyhu tIIOYhaVU 21119.0 hav haVU21179.0 11052.0 burnt 11384.0 21167.0 Joon 11496.0 rurfur21131.0 thotht12400.0 21139.0 pant partaMt flwhew13252.0 21155.0 tricks wlk13360.0 13384.0 13752.0 21163.0 13412.0 13512.0 ka 13664.0 21160.0 21335.0 21399.0 II21356.0 hclt21368.0 tu11628.0 21351.0 relatlvfM lIlnthirtIatlvesI 12596.0 21347.0 FrletidM 1rltUlhtrlrtids13324.0 21380.0 nr Irsr13224.0 nrto gladto 21607.0 10984.0 21571.0 wflemnlwlcurite10868.0 11812.0 21576.0 them tlwlIItheistIIUIIIIhuttie12216.0 lLJulllagainL lLJulllI13336.0 21827.0 21847.0 21839.0 21851.0 Htur 1tIlIst 21875.0 au 11588.0 IIlld 11rc421871.0 21835.0 Faliynn 1nhlnFabynnTlinnum Tllulluulhanmts13004.0 IIrofWhulkur IIrhuhlur of11Indsur 10728.0 22067.0 Whulkur huhlur11Indsur22064.0 122055.0 Hotilware UoulwareHIul 13028.0 22088.0 wun 13156.0 IIr12976.0 22059.0 Oratmw OrnllJOratmwHolKhU 22083.0 range rangeIeights 14008.0 IUhhtH 10720.0 22272.0 22291.0 HolKhU UhhtHIeights22287.0 22279.0 INttlt IttitIettit11948.0 12712.0 22275.0 alldItnd12580.0 IJ H13452.0 13680.0 Ken KInKInnerd 13684.0 Kenimrd 22504.0 nerd imrdIInrd22519.0 Walrin1Pa1lo11352.0 uIIIIunitJit12616.0 etroiKr 1lrnUIrtrouer12900.0 orofUnchulli orItnchoill ofItochulle 22731.0 Unchulli ItnchoillItochulle22767.0 WlruwcruIII12332.0 22727.0 till12220.0 rlty clly12584.0 YUf4torll yetatnrdayetatnrdadims 13808.0 22751.0 YUf4torlltlH 22739.0 22760.0 13424.0 13548.0 rdayKllzaboth 13912.0 22980.0 23000.0 dims tlH 22991.0 Kllzaboth lUznlwthFIlutbth11188.0 lllandliiK IIlulldllllotidlug22995.0 wliii12476.0 1l11 13428.0 13516.0 IM IN13640.0 23015.0 flUWslownowd flUWfInlld 14028.0 slowngaged 10812.0 23203.0 23219.0 fInlld ngaged23223.0 IIIliar Hartuw Itartuw12128.0 23232.0 tow 23244.0 stsaliarlior tIHcaortnciurufofButnrncrlln ufSurnnarllll of5urnnurlhi 23427.0 23443.0 Butnrncrlln Surnnarllll5urnnurlhi23439.0 Institute IrmtltutenlUtutlhiIs23432.0 hernIwnt12700.0 13236.0 oil olTwt13148.0 23467.0 vU 1ltvisitvUto visitto23476.0 23691.0 23667.0 IMTIurniotbcr IIIl1thrtnother12268.0 12304.0 12676.0 K12964.0 23655.0 MlaiidltiK IIlulllfluJIlbunlinsa13068.0 MlaiidltiKHer IlbunlinsaIIirIIlulllfluJIr 23895.0 IIir23928.0 nuirioroux IIIJfIlfrOIJII11umurOUMfrfiid rrllltlK11928.0 12088.0 12604.0 12324.0 nds ar un12600.0 tine 23923.0 13040.0 iliIlghtiM t1lhlstmtdellghtudtll13816.0 toKrtMt 14064.0 iiureet IJftt 24115.0 24131.0 KrtMt Jfttureetbur JwrherburMTH Jwrlrl4 herA1rs 24368.0 24380.0 MTH A1rslrl4 11404.0 11444.0 11532.0 JI11Hiuindcrn BnlllldrHnun4ernluu hllllhnAnitiirnodnitiirnodfrom returnedrrotn 24595.0 wli whuru 12312.0 hlr 12780.0 Bli 12868.0 lae mlkd nlltJnadnada mlkda24603.0 fruanrrotnMlwinujiy h1ll1ulrd11risaliy11100.0 24627.0 24631.0 i24624.0 WUtIwars24663.0 jU 24859.0 U10752.0 10796.0 24820.0 24856.0 twitNfl Ilgo 12036.0 KO 12068.0 filloti24827.0 ftlIClulitnccourlt13524.0 tlicUwtlicllln 14071.0 theIhlti 24844.0 IIIh llln IIhIhlti25091.0 +Nt wl 25047.0 firMr111688.0 11760.0 25079.0 11904.0 25035.0 lvrnnifl wlrdlydwardsYct 25083.0 13024.0 FrliMidK rfIIIIIMFrla11dswillbo 14068.0 willPe 25260.0 25272.0 IwPe25263.0 clad glad11132.0 25287.0 tlllurii flflrl urltHint tlmtthatAlrrMmIn 12892.0 13296.0 IdWnr Iwnr4IdWnrtOntlIUIII 13832.0 Iwnr4ao1141lun tOntlIUIII ao1141lunIsInJ 25499.0 UttrcncI lopraredUttrcncIJ lopraredJ25807.0 11152.0 wild fwd1114rI11772.0 12100.0 KnitllMti lrtcIlshsfua 13020.0 12732.0 Uh 13140.0 stub25819.0 fUll stubIblm Minor JtlrMinorQuint1 JtlrIh 10740.0 Iblm Quint1 QhnQalney11912.0 26055.0 worn 12292.0 rlt 12376.0 lh thll12944.0 26019.0 dly13036.0 fruUI26051.0 IaTnrday Tou 13928.0 Iamyna myna 10808.0 ou 11284.0 tlmll1 12084.0 Mlsa Ml Mab I1tihiMull1 13208.0 i13488.0 Curttr Curttrn eu Curt rttr rttrnl rf 26415.0 26476.0 10880.0 10820.0 26467.0 VwlvitrtuN hrtorL1alvnrton11800.0 12388.0 leas ltaAfn filltin13732.0 13616.0 13860.0 lstn lstnin Itnto ItIIJ 26687.0 IIJin11048.0 MlM a1isstI Qulnrr Qulttlytlulnry1080.0 afTnntuilH areortalmnlwi12156.0 IUOUI -1076.0 12884.0 13104.0 fI Ihhlthen13184.0 thenhw themi Ihhlh26915.0 hw 10932.0 wsts 11656.0 arout niutrllut11748.0 luan hili 12740.0 xmlns:ns9 ID33 11676 4264 14188 15455 ns9:type 15455.0 17560.0 2956.0 3888.0 15608.0 111Fir14792.0 tiltboHthOHlprinted 1IIIntutiitrlnted16292.0 Htutlonory tltutionOt1stutlonory16184.0 call sill17156.0 callat sillat17576.0 18212.0 18280.0 14220.0 15791.0 15847.0 14492.0 Tho ihoHun Sun14816.0 olUclIolllceolllcoTln 15795.0 olllceThe 17656.0 17684.0 18376.0 17707.0 tTill Till TlnThe14680.0 16144.0 14700.0 addition 11111111011nd0lton14704.0 16111.0 tu15904.0 till15784.0 hatna16160.0 16848.0 16103.0 or16732.0 17372.0 AludwIn 17375.0 17508.0 Aioixlwin 17696.0 18164.0 18312.0 14284.0 16311.0 ioixlwin ludwIn01111 14915.0 14784.0 16323.0 viii15280.0 h1111 15604.0 comprlrfoH comptliteK16760.0 nn an16608.0 17115.0 16316.0 extra oxtraoxtrti16960.0 extramom oxtrtiruutn 17568.0 14204.0 16531.0 16575.0 mom 11111111ruutn14960.0 tiiMt16579.0 Inlllt 996.0 15440.0 comfortable olllrOlllIhh15528.0 lurluhli 1020.0 proportion pruportlontfyproportionIM pruportlontfyit-1020.0 17552.0 16536.0 prollnr -1016.0 Uon 17084.0 14208.0 1Mit14416.0 abiMit nlwllttthtt14332.0 inmpleiid totnpletrtl16040.0 15800.0 16264.0 16127.0 16168.0 16387.0 loodwln Ouotlwlnoorlwln16228.0 16799.0 17123.0 nowban 18080.0 asIIhll ashat ban hat hll14408.0 IIIH14879.0 14984.0 14776.0 15144.0 16983.0 linmNniuotit hnnd4OtIIetlt15468.0 16719.0 nntlanti16624.0 mout IDOUtmoMttmoutthe 17652.0 17664.0 17712.0 tCL1tI 17051.0 tUIIIIIlIlIllIlliI 18216.0 14192.0 CL1tI 14292.0 UIIIIIlIlIllIlliI Illalllo11N15352.0 17215.0 IHlIIIIII1I huomM15976.0 17220.0 15872.0 15980.0 Irl 16016.0 16080.0 tllttcJlolt 16124.0 17223.0 -1032.0 16672.0 Iorlon 17383.0 of17284.0 ofihrll 17247.0 itill 18352.0 17440.0 till17435.0 ihrll 14460.0 17447.0 Ht IItHtV 18343.0 Lo LI 18124.0 A14404.0 14464.0 14560.0 14888.0 InrltMin lurlc11Inrhavn16279.0 11116428.0 17735.0 items ownii11111117012.0 17260.0 In9findhome 17580.0 nnhllllll 17460.0 In9hum 14216.0 17919.0 17923.0 hllllllhumlllld1111114656.0 oraim ortitrge15072.0 15196.0 0111 17960.0 15452.0 15584.0 15884.0 wove grey15983.0 16340.0 16260.0 16456.0 unan16788.0 1Yguburtk 16791.0 Wauburg Wnuburl1Ygubur17472.0 Wauburgl 17588.0 18260.0 Jlkl 18316.0 18143.0 18155.0 18148.0 tk 14260.0 tko lkl18184.0 wits WIIHWilliIII15324.0 rlly15576.0 15875.0 fillfur16504.0 18187.0 ntifowIwhour IlourlhouryeMerdav 17524.0 hourlit Ilourlyrtrdnv 18363.0 yeMerdav yrtrdnv15247.0 litIIItvits15464.0 15720.0 hl 15924.0 18387.0 nrouto lIUlIutranautlf16560.0 18424.0 15956.0 16636.0 hometromtromhnthMtoll 17168.0 fromCharUHioii fromhurlNlorl 18047.0 18588.0 CharUHioii hnthMtollhurlNlorl15524.0 18607.0 t15372.0 wlWflwhrtauhit16348.0 ImlbOOD17056.0 boonon bOODUIIboontin18856.0 UIItinIIpleaxnnt 1I11hMllntplrnsaptUnit hlltvisit15960.0 tllhlr16112.0 hi 16448.0 Htatofy 16356.0 HtatofyICminett alf1teflr situ -876.0 17428.0 17356.0 rih 16943.0 rihiatltllttt ICminett III1I1Itliatltllttt14972.0 JoliiiNon luhllIIohiits111114244.0 JoliiiNonDr Iohiits1111UrtiDr 18263.0 19279.0 19311.0 Ur19304.0 NI119308.0 II14904.0 15396.0 pound loundIound16088.0 19291.0 tormcry15908.0 16956.0 19296.0 ct16832.0 ctcity 19284.0 tllltitlllticity 17248.0 tillell 3844.0 19480.0 hut14944.0 19563.0 vowmaking nlllklllJntstklug19524.0 111s16052.0 16288.0 16372.0 Iunno16904.0 16824.0 19560.0 11nnotnlllo JNQIc 17132.0 Jq 17516.0 19575.0 17411.0 isoil 19667.0 notnlllo soil 14856.0 19751.0 tllle 14608.0 rittirned rltllrll11returtnI15911.0 tnttiatthnl19743.0 lolntyw 17120.0 ywterdny 17480.0 19780.0 XlIrlhtr 17332.0 18140.0 tyterllny 19980.0 terdny Irlhtrterllnyaftttr uUllrafter14736.0 20007.0 15336.0 19971.0 pluatmut pIeatNatltt16528.0 vlnlt vhsit16392.0 16899.0 tomother 17311.0 bl blmini 17436.0 14212.0 20179.0 20220.0 14804.0 mini 14500.0 14620.0 horohUIIfr15828.0 Pnuntlu loundlnundsblends frlondatrlcnc17252.0 wtl wllwlll wtlIn 17400.0 17504.0 lJlaut 20379.0 20423.0 KladJlautlenrn hlruInrn15088.0 15704.0 lhnt16136.0 lIuhe16032.0 Is16324.0 IHIn IlroHporJri prosporlIlroHporJrihi 20411.0 tIII 18388.0 20559.0 20652.0 hiIII14456.0 20648.0 14348.0 20643.0 hln hll414532.0 14788.0 profoMHlon IluflllIllIlIlnotMNIon15744.0 111ItFlorjdurt FlorIrlue16116.0 Iorlel 16728.0 16820.0 20655.0 inotropo lIIotroponIOtropoinotropoIU 17536.0 17884.0 tlJIj 18252.0 20604.0 18360.0 1Its 18307.0 JIj 17760.0 20831.0 20868.0 IU Its17959.0 14388.0 18016.0 20872.0 tiki tikiII 20919.0 ydlr 21063.0 21095.0 dlr14616.0 21087.0 Jackfton JlIkntlukann21127.0 21092.0 orArkaiiHaw ArknIlHIArknnsar15768.0 17352.0 21115.0 rectiitly rah 21187.0 18188.0 ili 18044.0 iliIilt 21283.0 21312.0 ctiitly 21320.0 14872.0 ptirclmHftil JlurchlKffdpurchaiKxd14672.0 21324.0 Irolltlrty21339.0 IIC1rnnnr16603.0 17296.0 21303.0 theelty 17300.0 Uiotho17572.0 Uiocity thoIt 17980.0 21411.0 ibf 21416.0 18183.0 14196.0 21535.0 elty14504.0 hiss hKIC14932.0 IHM 15036.0 21532.0 tlrrludnrrlvud11111nail21547.0 oxpoctf flXIHctltexisets16912.0 16808.0 17172.0 hfiTQ llato17072.0 hfiTQhlH 21564.0 ChiM 17519.0 hiM hlHh1N21755.0 fntltllJItnlll 15060.0 15175.0 follow rnlluwallow15780.0 111111hUm16188.0 11121796.0 ashnrt nhort hort17048.0 17148.0 ulna titnotlIDDtitnoHln ulnaIlly JII Hln Illy21999.0 propfity IIfulIlYptuplrty1ftiM15564.0 4c 15708.0 15864.0 lrabln rlrnlllhlt rotmtry nttntryruun 17064.0 try prop wopwoprty 17188.0 1O 1Ortr propart 22168.0 art rtr 14424.0 rty 22204.0 nhoutnbnut15208.0 22215.0 twatllIlla22199.0 half lUllhalt22195.0 miles alliesmlh 17176.0 22183.0 wet weak16935.0 wetof 17584.0 weakof 17660.0 22251.0 Iur 17704.0 3224.0 22419.0 urth14356.0 14632.0 rlty22468.0 14951.0 Jt nulltutu15052.0 22424.0 Inokxon IneksouJft klloU 16312.0 16928.0 oxpoc xpocoxpecoxpocto oxpect 22635.0 22676.0 10opornto IJHrntoptrnto15283.0 22651.0 truck trrwkfarm Gtrna15820.0 farmI GtrnaI1068.0 14420.0 22896.0 114644.0 14752.0 22911.0 Iutchfit22903.0 Alaoltua AtnehunAlachuawo waft22944.0 116816.0 1city 17068.0 icity 17079.0 22947.0 2836.0 23123.0 23135.0 ycHtirday YNltMllny23152.0 yesb 15424.0 15004.0 14987.0 23171.0 mi utitits23167.0 avlnitvhllt15868.0 16408.0 hilihisbinMr 16888.0 16976.0 fIr 17040.0 fMr 23348.0 14304.0 Fiiiih lItcI1Fuieh23355.0 whuwinhiIsthoUI Mentor Menlornlor 16880.0 mentar PleMNtpieMbermentarof PleMNtIpieMberof3392.0 23568.0 23592.0 HIM thse23604.0 14556.0 hff firm nrlllflrln15304.0 ot23583.0 Thu Tilu16008.0 23580.0 tutch utoh16376.0 Olp Ci23575.0 OlpPHHV Cipsnv 17527.0 23739.0 23843.0 PHHV psnv23848.0 IIKII HtiiiiiK IUIIIUKstunnnghoIlse23824.0 15920.0 23800.0 IttndlnlCleading16664.0 t16524.0 16668.0 23827.0 23791.0 tl1h1 16952.0 f6hlii 16907.0 f6hliiof 17779.0 17408.0 Fof 17832.0 18160.0 23952.0 fot 23971.0 24039.0 ot24035.0 IUtl14364.0 24051.0 tlJl4lIIIIlN24023.0 retiring rfUrlnlfrontth 24027.0 frOtl1 rflttlo 16748.0 17100.0 23988.0 bs IwbIISIt 17468.0 24003.0 jUf 17643.0 24127.0 jIHMK 17700.0 17671.0 24124.0 24139.0 ptr ururII 18072.0 ptrof ttI 24235.0 IHMK 14320.0 14296.0 24259.0 1111414352.0 lid 15164.0 24264.0 24255.0 Isumlcrittoodunl1ntoo424279.0 corn coroocoroolu COr cornhere 24416.0 24479.0 lu 24499.0 14688.0 14748.0 24487.0 Mimlti rutntn24520.0 24511.0 nomR MimltiMilllonit lCrrnaumtJr liermanantlyliermanantlyMillions -1068.0 24551.0 18340.0 17851.0 14412.0 Milllonit tflltuflMillions24747.0 Moforin 15340.0 24740.0 hotUft lsJtti24735.0 16336.0 FoloyH FoloyFoleysHouof lIouotllouel16932.0 24823.0 tnolri 17751.0 24723.0 17764.0 24835.0 17756.0 24671.0 foU foUit 18119.0 24683.0 18304.0 raul 18236.0 14224.0 24948.0 24963.0 aul14228.0 24995.0 Tar 24960.0 tart hnv 15240.0 24951.0 15348.0 24991.0 15648.0 nolri 1tOIt1ILol115940.0 without wlthlut16384.0 24984.0 ally ntyAny 17544.0 rrutt rruttperscal 17859.0 rhaving 25100.0 Hlh WrKfIfl perscal25227.0 25171.0 hulllihaYln 25175.0 opcrlf experlenccd 25215.0 x 17136.0 rJfnc 16752.0 ncnd 17043.0 25223.0 I17748.0 17904.0 JMir JMirrtth udthr 25400.0 rtth dthr 25419.0 14439.0 25435.0 25407.0 than hall25424.0 15268.0 nofliUl llUfJUlAthnefktal16180.0 roiulU Inlultresulta16068.0 16868.0 fropj frolafro 17264.0 ItsIUn ItJ 17496.0 18415.0 tI1 25551.0 25659.0 I114628.0 25635.0 fur14980.0 1J1lactUf runyths14843.0 25663.0 15220.0 tachx 15728.0 coltlcolds16271.0 uuSlung 17192.0 25627.0 troljl 17076.0 17195.0 tro trnutrntltrntlbl 17540.0 14236.0 ljl 11bl25883.0 14848.0 25852.0 1lah 14920.0 Is15676.0 lrtican bt1 16152.0 25876.0 capso thn thoXununo XununoIrtl 16916.0 jconulno lnufnojconulnoIlimoy 4196.0 25971.0 Irtlrys honey IlimoyIllnftytulanalTgr TtrTyr26115.0 Ifyc t11e16924.0 yottait fJU01iyc11owyottaitcontain 17772.0 11Itt1CknJIt 17876.0 17840.0 25975.0 Jit 26003.0 GIwtcknge Itt1CknJIt Iwtckngecontain ccmtAlruicontalns14900.0 no 26287.0 opfatn OfJl4tC1oplatn16836.0 26316.0 ortlnitf otltt otlttharuhll 17916.0 crfl 14232.0 26507.0 haruhll 26543.0 ru tlnitf dnudntgrOunrd HuardOu 16036.0 rd 15916.0 16296.0 26536.0 yplsr 16680.0 healtlJ hrsaltbhealtlJtiny hrsaltbrAl4I11K 16964.0 Altb 26275.0 otbtrfj otbtrfjcrfl 17944.0 17347.0 -972.0 17455.0 26495.0 1rruIrU 18180.0 rruIrU rAl4I11Ktiny unrun 15228.0 15836.0 tliotlJJ15732.0 Konulno lonunoIscnulno16104.0 Konulnofc Jl 17491.0 26771.0 26903.0 14308.0 26907.0 nlllf 15192.0 fc IeIc14912.0 26911.0 Cj eJC115316.0 d15640.0 IfMIl 18075.0 27059.0 MIl 17939.0 27063.0 xmlns:ns10 ID34 3788 12116 7160 27247 ns10:type 27247.0 27255.0 ww wwI wwJA5 27367.0 10668.0 27435.0 27483.0 JS JA5JAS27467.0 CRAHVM GRrHAiGI11M9272.0 Pi P9148.0 27455.0 CEO GEO27459.0 IYDE HYDE10832.0 VK 11316.0 VlCcPr xePI4Ff IIL27447.0 TAYU TALOHTAYUktM 27451.0 1i4v LEE IEE15308.0 CRAI CRAHAM TAM 1AM16163.0 16276.0 27443.0 Aui As16611.0 cdt 16796.0 Csslaros 17004.0 17184.0 JFIRST Jf 17900.0 uraYt uraYt1DYIt 27563.0 27567.0 1DYIt 101 27587.0 xY xrler 27600.0 7276.0 27707.0 27875.0 FIRST 27868.0 NATIONAL BANK GAINESVILLtLA 12756.0 GAINESVILLtLACAPITAL -4408.0 3128.0 27851.0 -4404.0 GAINESVILLECAPITAL -3128.0 27711.0 FLA 27827.0 rler 17892.0 28415.0 Ally AllyCAPITAL 18268.0 18152.0 27823.0 27963.0 CAPITAL 28711.0 AHD AHOA0DSURPLUS 9340.0 13000000 S130OOO13000000Offer -1144.0 28707.0 13952.0 UNITED 28675.0 STiltS STATESOIIT -1168.0 DIWe 18128.0 12116.0 7160.0 29207.0 29375.0 Offer 29359.0 nexcelled 29355.0 Faci1ifiand 1684.0 12652.0 UptoDate 29343.0 Methods 29331.0 19240.0 29527.0 Eyr 19276.0 29891.0 yr vlrmtt 15016.0 30991.0



PAGE 1

AlAUAcPGAINESVILLEtodayI-AIANiUDUNDRPUREfOODMiDECEMBERwjj-jAiutuasiTHEStorageClilliMjja-IllHUIItmet-aCrkketPrewitfsPrepaidiJO-SlIawtbornrrlday19u-sAlachuailoudnyIGRates-advertisementsrnitexpress100-s1VtlcoxVrldnyJllvlnwNannieIMPOSSIBLE-ItMeatsRrltntlnnItlugsubscriptionProgramOtherSAMUELSadvertisementsDELIBERATIONlollIhnrsdayrlcllnJtIHtliRIGAINESVILLEthojriolvovCrom-VashlngtonrecommendationQtsFullexperiencedThriceaWeeksubscriptionsINSTITUTE-Thepeople-naturallyeverywhereSubscriptiondisplacementneighborhoodCongressmanenthusiasts-whoCongressmenappropriation41008-Mlcanopy190-HCnmpvlUoMCREARYexpensive-tripWednesdaySemiWeeklycom-parativelypositively190-8NewberryPennsylvaniaREASONABLEgubernatorialexperimentalColdresolutions-lieappointmentdenominationDICKIN8OVAdvertisingXmasIndulgedTHEARMAMENTSopportunityPASSENGERWodnondayhighgradeJacksonvilleconsumptionguberna-torialconflscatoryeaaatla-faetor7Constitutionoppositen-ameagriculturalCongress-manAgricultureLegislatureWediMfudayWednoHdayDeeoujberapplicationThursday-atappreciativesignificanceSUNagriculturalExperiencecon-siderablydemonstrate1H0-7WlllefordimpoverishGainesvilletemporarilyIfnkuelaggressiveJacksonvilleremunerationDepartmentpaternalisticcommissionerAanticipated1907LegislatureResponsivesuggestionsprobabilityJacksonvilleIjironveiileiitscrapheapdeliberativeresentatlvesunchangedunexpertedWednesdaylegislationRepublicanRepublicansomethingJjiCroHiiounqualifiedAgricultureamountingVUiiioJupracticallyMELROSE-AdoughnutsDecemberCommissioniHTHlMtcnreDemocratsCommonerCommissionprepara-tionsDelightfulconventionsThurndayCommissionPhilippinepopulation0command-edshipmentswaterwaysgentlemanSAlpmcnt2190000000Hartrldgecommissiontraversed-byiroKirtlotiInjunctionespeciallyolntmontTelegraphFebruaryregardingadjoumHbeginningObituariesfaithfullyImpartingMiulidaeyespeciallySaturdayintroducedbloomingbotllelmnuirmntheHouseeliminationprecedingThursdaypopulatedyesterdayMontlcellodelegatesconventiondesignerAugustinecolleetliiKoverlookedfurnishedWeeklyfollowingearnestlyacceptingregrettedduring-thecampaignsubstantialSenatorialfollowingYearwoodPayeri-WoDemocratspreparingforerunnerconventionregrettedCLARK-MrpresentedThursdayFARMERSprobablyfnllowlngwarshipsassemblyTumldyautttorUledifferencesperformeddetermineChristmastastefullyMeanwhileALACHUAIncludingalthoughformidableCOLSONIm-portantcampaignknowingspecta-torsgenerallyglit-tering1008-Waldorailroads-Inalthoughprincipalreasonablebuckwheat200000flcondltloiiMaiiseMsmuntRooseveltparticu-larvarehlpflFLORIDAnumberInterestedholldajsJanuarycandidatelinitattonannouncedAuneasorsupremacyproposedindividualClubbingFebruarystandpatstandingprobablySavannahDorothyBproposedRecitationRecitationGainesvillesufferingcomposureresolutionsRecitationKooltatlouRecitationquotationTtiMdayJanuaryYoarwondTuomlayOorKniTuendayheretoforeshouldersexpectedinterstatea-politicaldecoratedbuildingCollectorCongresspeopleKooltutloncertainlypleasantcandidateHocltatloiiornamentsThomasClevelandJanuarypremiumstandingropr1a-tkwJanuaryChicagodeputiesliscussedJanuaryJanuarycandi-dateChristmasYoarwoodInterest-ofthousandWhis-keydnoMdayCommercepropertyJanuaryexcursioncandidateConnelmyoungestJanuaryreturn-IngconsumedWeHtfloldJanuarypurpoiMi-ofpassengerpromoterstravelingDecemberdepletedInsertioneveningdetermlnTreepreachedLutheranwelltodosur-prisedrequiredreplaceswarshipinserted-dTuoMtluyMondaySec-retaryrailroadsJanuarymajorIvvlnntonarmamentsworkingcandi-dateGovernorJanuaryJanuaryJanuaryresolutionrailroadsSavan-nahcountrieskeepingXatltmAlWealthyleorgictsendorsedWilliamsJanuaryJanuaryattainedspeakerabsolutemanagershospitalinstitutesHochollifmakingMalloryGovernorroRiedyInterstatepassengerpassengerrankingippoHltnpoliticalLatterlyshippedRailroadconcededhowlingMalloryreporterfarmingprimaryJanuaryfurnlHhedInfluenceStocktonannouncesshippedrewardedmeetingfeed-stuffsfiddlingmemberBONNIEcravingMondayarojfoat-torneyAmericanwateredBranchespassengerpassingInformedSundayperhapshoweverWILLISublUhaudiencerenderedsalesmanrendingprop-ertyRepubllnothingndclasscriterionStocktonbrilliantpleasedsweetlyex-pectedAttendedrailroadsexcitingMondayportionsstandardprintedMondaysnakingprovideportionHandledservicesbeauti-fulpromptthankfulvnhtabioexpiresBrowardreturnedengineswhereverremainedsupportdeclaredgreatlyfire-worksreturnedspecialInstituteCreationdenselyreturnedattendedHuffmanGeneralau-diencealreadyIncreaseIntendedholdinglikely-toIncreaseplacingrespectpopularslip-pedAlachuadisplayscribersIThlstampsshould-bePRAISEplainlyHprlnKmillionsInvesteddestinedmarketreturnedHusbandGeneralIncreasecrowdedAmongTrinityfliiiinclal4managerreducedPtltIIItgesturenamelyenemiespotatoesrailroadInstituteconstantstampspoliticsAtlanticelL4MendingTrentonarrivalsdestinedreachedlv6S-WoSena-torsCrosbyOrangeSenatormistakeHedrlckIncreasepartiespresentabsencepartiessreriaggrowthTampaAtlantanirtulayHodrickmonthsnaughtpassedsense-lessPoaraallseekingIolltlcalfiguredbecauseJacksonpurityanimalsMelrosorequirerivalryval-uablesucceedspeedyalwulyFloridaliolihtfavoriteenactedinstituteInterestMelroseFridaypeopleFloridasectionsspecialpayingmistakenumberavowedequal-tocottageAtlantaopin-IonelectionharborsumlngCowardpeoplerapidlysatisfyrwquomenormousgardenfarmersprogramfarmersrailroadjwiiirythingsruinoussupportpassedmellowweeklypeopleSenatoraccountorangesfondestFloridabelongpraisePrayeracceptwar-shipnlInfectiondemandcandlesplaooncopiesReadyAtlantaarcoiinlHideaspeoplelearnedchargelayingal-lowedhighernumber900Fridaydollarsourmonoyaddressexpensethei-withnoticeslearnedchargeillegalsectionsoutlayuselessquarterfiguredtobaccopnylnKJournalRATESabscessgradesarpenwefriendssessionIslandsDenvermonthsJr-ouunfJUmainlyfriendsdomtmdfurtherseveralcontestUnitedservicenaturalrciucnigradespeoplegreaterbrokensingleSpak4NAVALGainesmentedIrhiusFlor-idaIPadrreOsteenreallyurgedrepairbarleySamuelprocurenonthsrn1a1aseldomfamousformerfriendsWORKSev-eralsilenceromplotachurchmade-anWilsonfriendsdollarsowingiulrodBryangreatervariousMgerearlieruifingUnitedchurchcentralmarketBryanmakesshouldmatterproveanimalBryanreturnsranknoticeMarchMinnieinuringtwelvefillingwuxlitanyonerevisedMullenoughtlikelysixteenminitypresentMorriscnuleMHOproudBrJtlshusefulshouldihoultlofficialMerryThuraWorld000000lan-e4MrefundhumanannualmandsmoneyTeresaMorrisHousefortuneioplreturnspractlHyattMorodefeatregretsheriffdefeatClark-IshowsattendbeingcurrentTimesshouldfactorconveneXMASnoisyPrwldeditorsmiledhealthhopesMeatsEditorwhichFnneybringothersowingsdopiknownHxlngwhichBryanStatespricesHouseThereslewautomerorulorsattendUnionlanclgivenbeingEarlyrefunded100H-Armade-ashowsknownNoticewhichStnrkestationreturnWeekfigureStatesregretshownknowneitherYoursagedFrankalongsermonClarkcannonWhenfinelysaddlewhichwouldQuiteownersagaingoingRIliningflavorSiientswhereknowntraffic250uwouldThereothersnightDeathRemithencetraffichnuaebattleTwicevaluewhichKrAInborrwillplansCottonJaneeitherSouthwowklbeginmoneypoIlUwhichUniongivenpassescottonfancycountheardaboutwhichMlartdcrowdplacewhichWhencalledrjiolrheardretailersUnionChristwhoreboxeswhichwhichUncleDreadrobystrivehouse2centpricepaperClarkcheckwhichresultwhichusefulErwinLoonuconMtmcnth-egrdeathabesightEverywhichwhichyoungquitedoorsmakeCoastrelishaboutXIIHIHIbisJedonwouldanaltrafficunderjCMKhFloraboxesunionttClI-fSongIslandTermswheat23ruXg4nxClarkmaximWedIxlmsuccessaboutPascowhenvotedfinestXnmnHotthreethosequietXmasNotesWaveUItJlagreeXIIIUHthosetcnlfwhilethesequotacentsproveHotelcan-leivnighttimesnavalfinishfrom-aworldTheirRyeasideHighCoastwhiteSincemakenatalharryofficePricealoneyeasbreakac-tualcentsViewcentsfavormuchthoseotherrelieftrunkSongmakeunderhopobusedwoodmanyfaunIsheddaystherecouldcouldmadevaluelatestorderruinstedly190H-MthatlisteneveryStateolderwhenthreevaluelongSongnavalmanycropsceivestockgreatthereChildtheirmanyprovettwryonlycentsdatestheygoodofficeStickmuchseasonthereStatevaluetwicemuchothersmallStatemaderaleplayreturnotherthereofficetenth125StateStateStatetheseStatemuchcropsvoterstheythereKingpartyLimadutytheirthosetheseyearscropsofficeothereveryyearsgainmanyThethemWestStateolllcehorntheychairlittleliftsyearsragethemKlnulittlefaresKingratesStatevaluemeatstaxesthesegreatJiurngiftsthemwhatwhatgoodfiftylittlehaveplancostscropstheirwithrenewmanybookbuildJohnafterThatt-JJUSavailPricefromafterdirecWithhavehavePlaxDontblanktaxMpaidweektheirafterorderQtttaxesseemsTHECOseemsJunepruneIntershallTakedoneNevamusthavetimemanyapdprofithaveOhiofromJuneFlaxQttwaitthanYorktnesbonontexcuseratesbeen20tlieachbeenMisscourtdownfromFUtxfceklyOhiountilhatadrysuchtroutknlaysectionthanthanhellsmostSakehavebeenHellnOhiohaveJuneCars2500hellsYourmillprolmiwnjustCitygameKMftoMelahaveseemsupondonssalessakeoney1500builtfromfromuntilOhioMissft-hnvtripratesbeenotTerthilruponwhobestearnmust1902bothbeentotalOhioheadneverwithend1907haveEoryFOROhiofor-thuponratestotalhoarfromhaveMissbeermusttheirdeckfarmthanEastthatfruitthat30thGlad26thfromhavewithkeptBayyearbillstakefIStearupontownwithwarmeveryfromfarmthantownWithbradyearThisherebothnestJustJast22ndyearvery1HOHcashvisitbllla28ththandateEastmustand-ItMontHthiCthhighJlrwjtthatPlainmostyearwillI-sroadtutesceaseGulffJfmancitythatyearused1079loseftaoTaxtownFinenextthathold1008thatland19061907eeVbeenorderthanvotethatlookmileman-dIIHelath1DOHverywhothat20theachNewwithneverStet190821thCallMantreatwithwifemoreListCamFairkindpoorTheHtb1008welltlmtwho1908thrnodiGETslotNowWrito1908visitcudSizeheldultveryyearfactthatKithyeardealwellthatthatthatTaxInstlfullapassmeanservoThethislineyearroomveryNewthatthat1908firsthPidalsomoresomealsowhofirstwillThethisyourdayThethatThedayfreeThewellthatthanthatheldsaysverytask1906RailvastthatmayVTandrheTueintoThelose10thThetreesnonnthatlionthatIlftxmostsamemostdayrarenrlcathe-Ebig175150stillfeelThesaleTheThesomefeetmaythatthatthislarkandNBChow1008whoThewanethattaenrimetonsveryMaJSunThethatseemtoot1007JestI1QHsameandthat16otideyearandwillwilllaynexttrueTheunitthatTheTIllrjnMIntohapsaidfirmandingnextthisthisRUVOandandand150himwillthisandwillhimhimlandandtionThestillandEckRevThethatRevscorerKUandwillcantIMIKtimeandKckhallandandteatHaya-daIsaidcomesomewayrollandandRevandwillOurstillirotiimoreIntohaswillhadthiswillhimlastandandandfairwillwillthisRevShewillandlasthallwilltil1lUBSandwillLeeoverhalftlonGistomitsandandnppandandandandhallandcosttreecostvlllriceandmhastverfeelandandthinandandtwothisSunMrthothatRutwillHiidsurdandwillandandandhasandTheandwilltimidflirtSuiTaxyetyeartonstreeendwillduefairandandwillandandnndandandfewCotcam-ehasbutandandandandhasTbCanandUoccentoverOurandwillandhasnotandtheandForButandandteetwitwillandhasandwillandLakOutwillthethethorareeverandhasherhashasthethesheanddinLETfairOutandbuthasbilllawthethetheandeventho1tJaUhasthethefallWehatebutmildandandpaythetherestanylifttheActxysshasbuttheleftthethewillPocacidhasputthethethetherMflatcomehiSmanIIOHHnothw2ndbutbutthethethebillthebillthethethewillIts-hJunthethehttthethethethethethethethethetheagoOtlimanCthUxtAuthethethethethethethethethebutthetheher4thhas000thethethethetheRVOmanthehasthethethethethethethethethethethethethethehothethethetilltheLettenhasherSeaForringthemen6thanysooncornforwarthebillhasthethethethethethethethethethethethethenowquohasthethe8ththumanFlaLeenotthethethebuttheouthitsnewrascornAperthethethethethethethethethebuttheherherWohatthethebutthethethethotrwAtkwillbuthiswas50cOlctherepouthashethelrtlredthebutpatthethethothethetherhethethethetoedsumforKivotiertinnotyetthethethethethethewasDOthe7thSunOWforSunWetitswasIhewasthenotTOthistheEdlotSunbythehiswasLtaxthewaswartbywasbutthethefornotarytawthertgfortheforfortaxforhisforforforhislotiivtentheLnotnotperredtenandforOn1limitfordt8SIswartheforcalforsayryetuxonetheMrHeforWONforforforbyMrforMrbyoneonewayMrforforhisrurbyGaGaAllforforbybynotspySuntorAllforMrItsoneforforforforforgo-oarewassea-twasItryforMrbywasforforgthwaswillbyNMroutodtforforMronebj12tillfurforforapiMewitstimenotforwhbyvnforfornottooarebyallMrforhe-nHeforhlpaolirbyallcanfurourtUoldbyHeAnf-areareourWeandwwallbutallbyMrforsec1mbybyUSallarearerwalloneheareOuthesonbyWallareurnbeb-isourarebeanhisfroItsWallupItsofartof1mbeallmeartpMbe>iHylistbebebearearebeareartjotbethfhebebeWIntupre-vthesetfurthtMhebeseeanheapbeof10iudoof15weWboatbethabebelioINbo21betbireofofVratgobeIiioffoi5cofofofStofInre30Wralneejar50bebeSBbeof31ofofofweof17ofofwhofofofofofatwebefOItinofofofoftoofofofofofofofofofofoftoatWofofofatZSoftosee34eerinofofofofinofoftoofofintoofoftbDbfiIofofofIntoofoftoofofofof5MofinluourIninofinofoflitoftooftoofatofofofofofofofofofat2JofofanatanInin15InInInofIn17oftotofoofatMoftotoatofofonnoonnotototoofisanonat20soInInInInoninInofinoftoexoftototoanonInneenbeinlaofof21ITusbltototonotoatantototototoonantoInofInIninluffinIIIInIsInononontototoasastoistototoorasInnrinJaisitItIsInasasIsisIsIsItsoIstoatonontoattotoisinIsNisistoIntonetoitnstoasattoasortototoonIsonInasHMofIfItisItItIsItXIsorTsooforitrytotorobeto8RtysaisIHisitIsitCTasonIs1aInIsIsInIsiisIsIsIsnoitMNsoitIsfirOIMSIIinIsAAIfItasorItItTClaanIsEifKrJtPIstotoCPLmYudAisttiitifesIorutSIIfr5lrhllhIyIIsp1ttI7fiVM2J9aaaaaaI35JlaaaaaaaattaaaaaJgtljpaaaftaaaV1anaIyadaSIIgaaitanneaaaifaaaItIfIyaaII>iitIa1Irlv>l1rtrtatsrrIt1l1xaIIi>lIs>IrlaI1lrrp9>>tIttr>tv0t


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN00034\ocr\0485b.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:15850
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1552
splitwords:0
ScansoftOCREngine Character Count:14442
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:16222
Abbyy6OCREngine Character Count:17134
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;17134;2660;43.5977;91.3704
language:en
ScansoftOCREngine Predicted Accuracy:75.53%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:5440
ScansoftOCREngine Character Error Ratio:0.2941
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;16222;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:91.37%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:91.37%
ImgPrep Component Range:13445,15850
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;14442;4247;0.839427;75.526
noPunctuation:1
ImgPrep Component Count Low Estimate:13445
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 24.0 ID4 10.0 ID6 21.0 ID7 13.0 ID8 12.0 ID9 11.0 ID11 2.0 ID12 7.0 ID13 3.0 ID22 9.0 ID23 19.0 ID24 26.0 ID26 35.0 ID27 40.0 ID28 32.0 ID29 29.0 ID30 23.0 ID31 16.0 ID32 15.0 ID33 20.0 ID35 17.0 Layout Page ID1 HEIGHT 30932 WIDTH 18784 PHYSICAL_IMG_NR 7 PRINTED_IMG_NR 4 PROCESSING PrintSpace 30628.0 18528.0 HPOS VPOS 84.0 PC 0.91370004 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1312 12680 5824 84 ns1:type simple language en TextLine 72.0 112.0 17904.0 String 36.0 CONTENT i WC 0.8095238 17983.0 SP 44.0 17940.0 408.0 12680.0 5824.0 988.0 STYLEREFS 272.0 640.0 THE 288.0 2088.0 6624.0 GAINESVILLE 160.0 6464.0 592.0 8848.0 1012.0 SUN 136.0 8712.0 1688.0 9664.0 1020.0 DECEMBER ALTERNATIVE DECEIBER224.0 9440.0 256.0 312.0 11496.0 1036.0 HO 0.96825397 30144.0 11352.0 608.0 12032.0 1040.0 1907 11808.0 252.0 120.0 1 -608.0 12640.0 296.0 12344.0 1044.0 07 192.0 12152.0 360.0 108.0 18396.0 5756.0 xmlns:ns2 ID5 5356 2920 444 1712 ns2:type 188.0 1132.0 1100.0 1712.0 140.0 380.0 1760.0 GAIN 0.95238096 -380.0 1480.0 GAINESVILLEfl -1132.0 2232.0 1608.0 51ILte -624.0 51ILteA 2216.0 496.0 2768.0 528.0 1908.0 320.0 392.0 2048.0 ttC 0.82539684 232.0 596.0 2120.0 fl -324.0 920.0 484.0 884.0 1184.0 1920.0 A 332.0 852.0 464.0 1000.0 2296.0 gin 228.0 2068.0 gined -1000.0 3296.0 2984.0 1972.0 U -312.0 Ued 2476.0 788.0 2552.0 180.0 796.0 2604.0 December 656.0 1664.0 2568.0 311902 80.0 1584.0 168.0 2588.0 31 -656.0 2320.0 148.0 352.0 1968.0 1902 1832.0 172.0 2448.0 2564.0 at 128.0 564.0 2700.0 Gaines Galnes2620.0 GalnesPla GainescGainese-564.0 3264.0 304.0 2720.0 548.0 2660.0 152.0 156.0 ed 248.0 760.0 2816.0 Fla Pla56.0 704.0 1224.0 2820.0 as 216.0 1008.0 164.0 1028.0 1528.0 2748.0 secbndclass sec6ndclass1392.0 560.0 2756.0 secbnd -1028.0 2556.0 404.0 2148.0 class 60.0 572.0 2696.0 2736.0 matter matterer matterr-572.0 3268.0 2728.0 532.0 2892.0 100.0 c e536.0 2536.0 2912.0 March 1932.0 604.0 132.0 76.0 3184.0 3 3072.0 3hed -76.0 3260.0 1284.0 1152.0 2924.0 2972.0 of or1412.0 2956.0 Congress 104.0 1308.0 2276.0 or2172.0 2996.0 116.0 3052.0 er 64.0 r -64.0 264.0 792.0 M ActAnt88.0 3212.0 9 260.0 2772.0 3512.0 3604.0 shed hed448.0 3596.0 Every 848.0 644.0 1444.0 3548.0 Monday 1368.0 184.0 1156.0 2144.0 ahdThursday aidThursdayaitdThursdayahdThursdayat aidThursdayataitdThursdayat-1156.0 3300.0 1952.0 664.0 3752.0 3844.0 892.0 936.0 3776.0 Gainesville 800.0 2024.0 Florida 196.0 1828.0 FloridaMCREARY -592.0 2616.0 FloridaMCREARV FloridaM 4024.0 4056.0 856.0 4043.0 844.0 92.0 996.0 4032.0 984.0 208.0 1088.0 4224.0 200.0 908.0 4248.0 MCREARY MCREARVCREARY4300.0 -908.0 1564.0 68.0 784.0 4296.0 + 768.0 520.0 1736.0 4236.0 Editor 928.0 808.0 2360.0 and 2256.0 472.0 2788.0 Mger 2656.0 MgerTerms -472.0 212.0 1936.0 652.0 4656.0 4732.0 Terms 1256.0 4684.0 1136.0 176.0 1052.0 1536.0 Subscription Subscrlptlon1408.0 1048.0 SubscriptionB SubscrlptlonTaice-1052.0 SubscriptionTwlceaWeek -1048.0 2584.0 468.0 4880.0 96.0 5000.0 B 1104.0 4888.0 iwlceaWeek TwlceaWeek4928.0 Taice -1104.0 1768.0 1168.0 4948.0 a 1112.0 1296.0 Week 1252.0 316.0 1888.0 Sun 2424.0 220.0 2204.0 2624.0 4911.0 124.0 2500.0 364.0 2832.0 4892.0 year 2716.0 yearfontbs -364.0 3196.0 4904.0 ye yeoDths -188.0 3020.0 yeartenths 2548.0 5040.0 fontbs 428.0 512.0 5120.0 tenths oDths-428.0 940.0 236.0 1080.0 5096.0 50c 1544.0 5063.0 single 1316.0 516.0 2136.0 5044.0 copies caples2040.0 2800.0 5056.0 5c 5ee2652.0 5cAdvertising -216.0 3016.0 5eeAdvertising -176.0 2976.0 1520.0 5336.0 5340.0 Advertising 1892.0 Rates 1772.0 Ratesadvertisements 2364.0 632.0 5536.0 5616.0 1236.0 812.0 5560.0 advertisements 668.0 5548.0 15 16436.0 2592.0 cents 2432.0 3192.0 5564.0 3028.0 athe -96.0 3288.0 aor 2760.0 524.0 5711.0 5832.0 or 728.0 5784.0 the 660.0 5760.0 first 964.0 1428.0 5740.0 1356.0 1808.0 5736.0 10 1716.0 440.0 2056.0 1976.0 5724.0 for Cor2496.0 384.0 2900.0 each eachfional -384.0 3284.0 eachonal 1176.0 444.0 5888.0 400.0 fional 5964.0 onal -296.0 692.0 5928.0 Insertion InsertionInlay -692.0 1620.0 Insertionplay insertionplay 2792.0 6080.0 372.0 6136.0 Inlay 292.0 6160.0 play -292.0 816.0 968.0 6096.0 2392.0 6084.0 2220.0 2796.0 three 2628.0 threed threend-440.0 3236.0 420.0 2812.0 6259.0 rates ratesfurnished -420.0 3232.0 2252.0 6256.0 6340.0 nd d -72.0 636.0 504.0 696.0 6312.0 twelve 1264.0 6276.0 months 1200.0 1928.0 1860.0 2164.0 special 2104.0 2352.0 6436.0 732.0 6472.0 furnished 1568.0 6487.0 upon 1424.0 2116.0 application applicationage applicationrriage-928.0 3044.0 6616.0 424.0 6692.0 rriage 688.0 6712.0 age -252.0 284.0 6660.0 1372.0 6640.0 Death 1292.0 1924.0 6628.0 notices 1844.0 684.0 Inserted 2516.0 InsertedObituaries -684.0 3272.0 insertedObituaries 276.0 6792.0 6844.0 Obituaries 1516.0 6828.0 5 1388.0 1680.0 6815.0 centa1592.0 2200.0 6840.0 2380.0 6800.0 line 3340.0 I xmlns:ns3 ID10 8884 2856 7224 ns3:type 836.0 7224.0 7276.0 Our 720.0 7236.0 Clubbing 1128.0 2060.0 List 1944.0 ListIBun -320.0 ListSun 2416.0 7396.0 7468.0 IBun 7480.0 -248.0 764.0 280.0 876.0 7439.0 nnd1272.0 7432.0 1636.0 ThrlceaWeek ThriceaWeekThrlceaWeekI ThriceaWeeky-1224.0 2860.0 7408.0 Thrice 7436.0 48.0 2184.0 480.0 2376.0 2328.0 WeekY -480.0 2856.0 2824.0 7568.0 7644.0 Y 500.0 488.0 7607.0 World 712.0 7632.0 one 7615.0 300.0 2968.0 7576.0 165 2316.0 165ISun -300.0 165SUD 7764.0 7812.0 ISun 244.0 7835.0 SUD-244.0 864.0 7800.0 308.0 1248.0 7788.0 The 1140.0 1668.0 7772.0 Atlanta 1556.0 2504.0 Ga Gn2304.0 GaConstitution GnkI1 Gady 2676.0 7935.0 8003.0 kI1 dy992.0 7960.0 Constitution 2004.0 7980.0 1900.0 376.0 2396.0 7972.0 2292.0 2960.0 175 1758un 175Sun 8124.0 8196.0 8un268.0 860.0 8160.0 752.0 1240.0 8148.0 628.0 8132.0 GailWeekly GaWeekly 8300.0 8336.0 Weekly ilWeekly8331.0 Journal 8340.0 1984.0 368.0 2488.0 150 150I -308.0 150Sun 2384.0 8480.0 8536.0 8556.0 900.0 8520.0 772.0 1304.0 8508.0 1172.0 1096.0 1756.0 SemiWeekly BemlWeekly1616.0 SemiWeeklyoesUnlon -1096.0 2852.0 BemlWeeklyesUnlon SemiWeeklyesUnion 508.0 8660.0 8703.0 oesUnlon esUnlonesUnion1324.0 8719.0 1212.0 1604.0 872.0 2084.0 150We 3256.0 9092.0 9136.0 We 9115.0 will w1111384.0 9112.0 not 540.0 9099.0 accept 1652.0 9096.0 stamps 3104.0 2992.0 ofeer -168.0 ofer 2524.0 9280.0 9359.0 eer -124.0 1076.0 9288.0 denomination 1948.0 than 1848.0 2412.0 2 2492.0 centsbscribers 3032.0 centsscrlbera centsscribers 2776.0 9739.0 9780.0 scribers bscribersscrlbera9796.0 are 1120.0 460.0 9752.0 urged 1460.0 2112.0 9755.0 to 2016.0 be 2264.0 9747.0 prompt promptDewing promptewlng promptcwing 9904.0 Dewing 568.0 10007.0 ewlng cwing-400.0 9988.0 their 1488.0 9972.0 subscriptions subscription1420.0 2752.0 9967.0 There Thereexcuse -504.0 620.0 10192.0 476.0 10256.0 excuse 1220.0 10219.0 1576.0 10211.0 1452.0 700.0 10196.0 knowing 452.0 when 2668.0 whentime -452.0 3248.0 2680.0 10420.0 10455.0 time 932.0 10440.0 expires 828.0 10468.0 1500.0 1912.0 10424.0 1804.0 356.0 2288.0 date 2180.0 2644.0 3024.0 10452.0 ex ox2916.0 exIon -184.0 3208.0 exon oxon 2804.0 10644.0 10688.0 Ion 10723.0 on -148.0 10676.0 Is 10656.0 plainly 944.0 1836.0 10652.0 shown 1656.0 2544.0 opposite oppositename -704.0 2672.0 10808.0 10892.0 name 1124.0 10840.0 Remit 1692.0 by 10828.0 check 1876.0 2608.0 2460.0 stampsnoney 3200.0 stampsone stampsaney 204.0 11003.0 388.0 11068.0 noney aney544.0 11076.0 432.0 1004.0 11027.0 order 1728.0 11019.0 Dont Qont1436.0 wait walt2160.0 until 2692.0 untilsome untilome 11192.0 11255.0 ome some11220.0 1160.0 11216.0 town 11204.0 1540.0 renew 2596.0 but 2436.0 2988.0 DO 2864.0 DOOW DOW 11368.0 11391.0 OW 11399.0 W -132.0 11388.0 1336.0 11376.0 white 1244.0 1880.0 11404.0 paper 1780.0 2444.0 2740.0 which 2636.0 whichsun -496.0 whichSun 2724.0 11551.0 11588.0 sun 912.0 11567.0 11556.0 printed alone 1740.0 2480.0 costs costa2332.0 3064.0 11580.0 us 2904.0 usalf 3240.0 usai usalt 11727.0 11760.0 alf altai 672.0 11751.0 11740.0 price 1288.0 ofsubscription subscriptionofsubscriptionfc subscriptionLETofsubscriptionLET-1288.0 2896.0 11735.0 456.0 11963.0 fc 12071.0 -44.0 fcr -36.0 492.0 12180.0 12199.0 LET 12191.0 US 1276.0 12188.0 GET 240.0 1744.0 12183.0 TO 588.0 WORK WORKthat -588.0 2708.0 2580.0 648.0 12624.0 12636.0 that 12632.0 Christmas has 1820.0 556.0 2280.0 passed 2192.0 2920.0 2836.0 andbar 3228.0 andear 2844.0 12692.0 12831.0 bar 12896.0 ear -208.0 832.0 12871.0 12892.0 1348.0 12855.0 1228.0 1704.0 12884.0 wane our 2684.0 12847.0 people 2572.0 peoplenaturally -544.0 8.0 3292.0 2732.0 13072.0 13080.0 naturally 13075.0 begin 1148.0 1852.0 filling 2472.0 13107.0 up 2336.0 theirjwith 3224.0 theirwith 1344.0 13276.0 jwith 13303.0 with 13300.0 resolutions resolutionslie resolutionslile-872.0 1800.0 13524.0 13531.0 lie lile13528.0 676.0 1660.0 13560.0 1588.0 1992.0 good 2456.0 things If Ifare -120.0 ifare 2704.0 13752.0 13791.0 324.0 840.0 kept 736.0 412.0 1332.0 there 1164.0 1864.0 13783.0 2248.0 some 2128.0 more moreftant -432.0 moretant moreCant 2712.0 13912.0 344.0 ftant 13992.0 Cant tant-268.0 13988.0 In 13975.0 13972.0 significance 13980.0 im 1m2880.0 1mice -200.0 3168.0 imee imce 14195.0 14236.0 ice 576.0 ee ce-140.0 716.0 328.0 14200.0 thnn1260.0 others 14208.0 most 1m im2848.0 1mit -204.0 3172.0 1mt imt14423.0 14444.0 it 580.0 t -40.0 resolution solutlon14460.0 -768.0 1504.0 52.0 14464.0 > 1640.0 2260.0 14455.0 every man manjot -352.0 mand 14648.0 14667.0 jot lot396.0 down 1456.0 14656.0 in 1708.0 his 1600.0 little 14651.0 book 3056.0 14659.0 2944.0 atbrnlng atruing 14848.0 brnlng 14884.0 ruing 904.0 14876.0 oC1180.0 14872.0 14868.0 tide 1868.0 is 1792.0 340.0 1996.0 2408.0 union unionlie unione-460.0 3164.0 unione 15024.0 15123.0 e 15092.0 old 15100.0 maxim Jn1916.0 15095.0 Union 3080.0 isgth 3084.0 Isgth -128.0 2308.0 15307.0 15315.0 gth 916.0 15328.0 708.0 certainly cprtalnh1024.0 15356.0 1824.0 15336.0 true 2000.0 2520.0 15359.0 2428.0 oneof 15540.0 880.0 952.0 15543.0 Galnesvfl1e776.0 15548.0 aid adand2528.0 Alachua Alachuahae Alachuahal 680.0 Alachuay 15711.0 15792.0 y >15763.0 hal haehale15800.0 15776.0 great 15768.0 deal 1612.0 15787.0 -156.0 2340.0 15771.0 feel 15779.0 proud 2640.0 proudFortune -468.0 proudortunt 15983.0 Fortune 16028.0 15988.0 15991.0 ctvpotlv wppt1v824.0 1280.0 16031.0 npr nvorxmlns:ns4 ID14 14496 3248 20 16216 ns4:type 16216.0 16224.0 section HctlonsectionI 1216.0 under 16219.0 1672.0 16256.0 warm 2888.0 andring 3188.0 andIng 16435.0 Ing ring16468.0 ras rass756.0 ra -316.0 1108.0 16471.0 s 16440.0 oC2140.0 16479.0 we 2020.0 16448.0 have 2368.0 all 2876.0 allfrd allfd allr 16655.0 frd fd16684.0 780.0 dd 624.0 16663.0 bllt1352.0 16696.0 16704.0 1560.0 1696.0 should 2356.0 16671.0 determine determinehE determinethe-848.0 3204.0 2784.0 16867.0 hehE -144.0 744.0 16912.0 new tifu16915.0 ew 336.0 yrar ypar1016.0 1512.0 16904.0 16907.0 put 16928.0 16896.0 shoulders shouldersfHl shoulderswit-808.0 shouldersI 4.0 17064.0 -4.0 17103.0 17108.0 wit fHl lltl948.0 1068.0 17140.0 17148.0 17116.0 unit 1376.0 1896.0 laying -508.0 2404.0 17119.0 lng 17124.0 aside 17127.0 allIng alldifferences 17171.0 IIg 17279.0 17352.0 Ig -112.0 17347.0 m It 1072.0 1208.0 17331.0 differences dlfCerences2324.0 It17379.0 2452.0 willIs willl17536.0 l -24.0 17596.0 -52.0 17575.0 tt 17555.0 Mi till1116.0 111 ha -372.0 vc 1548.0 17604.0 17607.0 lar -256.0 17572.0 hence 3108.0 17612.0 aal -88.0 ad aI 17767.0 17799.0 < -68.0 612.0 17772.0 al 17808.0 nirre Iirrtncre17788.0 1632.0 2072.0 17791.0 thankful 17803.0 forn -236.0 3156.0 foran 18000.0 18016.0 an 18019.0 n tq Lat748.0 Mtily 18035.0 IY -180.0 18044.0 say sar1648.0 2096.0 task 18024.0 well 2440.0 18060.0 rear 2884.0 re -164.0 3152.0 realiI 28.0 3160.0 18095.0 18223.0 18244.0 ar aliI -104.0 i-32.0 888.0 18255.0 ut titll 1144.0 IIl 1320.0 1188.0 18275.0 -136.0 1232.0 H 18236.0 performed rformedperformedar performedS-836.0 18263.0 II 1596.0 18271.0 rformeds 1624.0 18716.0 18727.0 rM rttdrtd1312.0 1464.0 18724.0 former 18740.0 United Unitedi UnitedS-560.0 UnitedS11or 18915.0 S S11or 18960.0 -388.0 18971.0 18968.0 -56.0 18944.0 Samuel 18955.0 Pasco wfll3008.0 bejr bet13 584.0 19151.0 11 t131064.0 19196.0 jr drIr19231.0 1300.0 19164.0 tl1l1084.0 416.0 19207.0 same sam19188.0 office omce19199.0 2576.0 2932.0 19191.0 theg thep-260.0 19391.0 g 19403.0 600.0 rary p -476.0 19416.0 art ir -196.0 1700.0 19395.0 he 19440.0 announces 19419.0 forlaca -232.0 foris 19448.0 -172.0 orlac 19576.0 laca lac 19611.0 ars 896.0 19619.0 atlIS976.0 19616.0 dollars 2032.0 19647.0 19631.0 doughnuts doughnutsfig doughnutshtdoughnutshr-892.0 2632.0 552.0 19796.0 ht hr19855.0 fig mg19863.0 -80.0 19836.0 silence 19852.0 2176.0 General 19867.0 Ed 2828.0 EdVontlcello -224.0 EdonUcello EdMonticello 20048.0 Vontlcello onUcelloMonticello1816.0 20075.0 2240.0 20083.0 2108.0 2560.0 20088.0 broken brokenral brokenrr-576.0 3136.0 brokenrral 20276.0 20287.0 rr rral ral hao1328.0 1476.0 20308.0 1360.0 20316.0 yet et 2092.0 been heard heardr heardtinheardsing20503.0 20507.0 tin sing 20523.0 20512.0 defeat deCeat20531.0 2468.0 20536.0 Railroad 2300.0 Railroadr RailroadIHRailroadI-708.0 3176.0 20704.0 IH 20751.0 t20756.0 20735.0 20739.0 1906 1400.0 2152.0 20767.0 Uncle Unclefaudllacy 3180.0 Unclet Uncler2664.0 20943.0 20971.0 20995.0 20956.0 faudllacy ulIlIdacr20987.0 -780.0 1748.0 20984.0 lldacy 1904.0 20975.0 Cor21016.0 any 2132.0 20992.0 officeM officeIJtofficet21179.0 IJt 1032.0 1tNII ttedly 1396.0 21211.0 1496.0 1268.0 dly 21215.0 21187.0 bring 21203.0 tho2044.0 Generalus -648.0 1060.0 21431.0 21436.0 cannon annon1960.0 again 2512.0 Into 21439.0 thel theItheftheIts 21687.0 21835.0 22031.0 f L 1204.0 22071.0 Its dtslts1784.0 22099.0 recommendation recommendationrnwent -1384.0 22239.0 h hr -60.0 22315.0 rnwent rnutent22323.0 1788.0 ment 22343.0 pay pa -280.0 22364.0 cam camof -336.0 3128.0 camuC camt 22500.0 22524.0 uC1404.0 1840.0 22535.0 political 2600.0 22555.0 parties 2508.0 partiesli partiesrpartieslisussed 22727.0 740.0 22739.0 lisussed Liscussedli -724.0 1416.0 22760.0 cussed 22771.0 22776.0 endorsed endorsedn -748.0 22972.0 22996.0 1432.0 22983.0 Commoner 23004.0 butso butIbutaS23219.0 23227.0 aS -28.0 1472.0 23235.0 so 1732.0 paternalistic Iatemalfstlc23232.0 2780.0 andit andt2012.0 23419.0 23455.0 t23435.0 1856.0 23447.0 2936.0 23487.0 enUernocrats 3120.0 enIJernocrats enDemocrats 23644.0 Democrats UernocratsIJernocrats23671.0 2268.0 23712.0 2952.0 athat 23867.0 23883.0 Mr 23888.0 Ir 2312.0 23895.0 Bryan Dr -500.0 23932.0 23935.0 asa asIor asad 24087.0 24116.0 lfr Ior1552.0 24124.0 1764.0 24135.0 seems geems24119.0 determin determlndeterminwith -756.0 3112.0 determlnwith determinr 24268.0 24323.0 24336.0 24331.0 348.0 1484.0 1956.0 24344.0 Roosevelt Rooseveltil Roosevelt1jI-828.0 24483.0 G 24551.0 24564.0 1jI il lt24555.0 804.0 thepoliti 2196.0 thepolitiT -804.0 3116.0 2688.0 24567.0 politi politit -424.0 o1fU -332.0 o1fUIt 24719.0 24775.0 24808.0 -84.0 T 24767.0 either fitherIther2064.0 24783.0 oC24791.0 them 2872.0 24827.0 canvlew can -276.0 canof canIl 25435.0 vlew 1580.0 Il -264.0 25456.0 2244.0 25459.0 25464.0 battle battleMftcalf -488.0 battleftcalf battletlNtcalf -484.0 25535.0 25655.0 Mftcalf ftcalftlNtcalf25711.0 was nos2540.0 25723.0 2400.0 25727.0 sea searseat seaId 25883.0 Id Iu 25907.0 25928.0 appear apiwar25947.0 25915.0 deck deckInjunction deckr 26115.0 26131.0 26147.0 pi rInjunction 2648.0 26172.0 seemsracomedy E seemsrs 26175.0 m8 -228.0 m8rcomedj 26351.0 26367.0 rs comedy racomedyrcomedj26363.0 Stick SUckStickd SUckk3148.0 Stickand 26555.0 k 26607.0 26563.0 And 26603.0 never 26619.0 go 3000.0 toy -152.0 tobe toiy 26788.0 26807.0 iy bo26796.0 rulers thec theri theM 26911.0 27139.0 cIIrnln 1492.0 27415.0 27447.0 ri27444.0 27455.0 27491.0 0 -160.0 sWo Iro-348.0 27499.0 pro 2080.0 27467.0 fiddling fiddlingirnlnR -628.0 3144.0 fiddlingM 27688.0 irnlnR arningIrnln 27691.0 27695.0 27699.0 i8Isht isthat 27771.0 M27895.0 ht27916.0 27911.0 27919.0 Republl RepubHRepubliRepubllii RepubHdRepubliI-644.0 3100.0 28119.0 ii dai28139.0 stand standpat -436.0 28167.0 pat while whUewhileSering -444.0 whiletering 28236.0 28347.0 28447.0 Sering trlngtering1508.0 28391.0 j 28363.0 from tram1572.0 28367.0 thetrusts 28583.0 trusts lrust8trustsCrteket -464.0 lrust8rlcket trustsCricket 29007.0 Cricket Crteketrlcket29035.0 Prewltts Prewitts2272.0 Pr -760.0 Prewittsis 29039.0 vdtt 29223.0 29259.0 1448.0 616.0 29256.0 entered ntered29295.0 uronurgn2372.0 2940.0 29267.0 ItaItayoungest 3140.0 Itsoc1gest itsOLngest 29492.0 29495.0 youngest oc1gestOLngesteditor editorW 2224.0 30643.0 xmlns:ns5 ID15 5392 3400 3416 1640 ns5:type 4128.0 1644.0 PRAISE 4956.0 FOR 4828.0 5460.0 CLARK 5332.0 CLARKMr 6104.0 3644.0 2076.0 2100.0 4084.0 Crosby OrosbY3892.0 4724.0 Thomas XThornasZlJnomas4668.0 5632.0 or5488.0 820.0 5944.0 Cleveland 5792.0 ClevelandOhio -820.0 6764.0 3360.0 3456.0 Ohio 4068.0 who 3856.0 4584.0 4412.0 5028.0 just 4864.0 5520.0 returned 5360.0 6420.0 Crom6236.0 fromWashington -396.0 6816.0 CromVashlngton 6488.0 2348.0 ruin 6812.0 ruinWashington -328.0 3368.0 3448.0 2532.0 Washington Vashlngton4628.0 where 4476.0 5248.0 5144.0 5540.0 5444.0 5924.0 5820.0 6416.0 look 6300.0 looking -356.0 6772.0 lookIng 6780.0 ing 3812.0 2771.0 after aCter3716.0 4312.0 legislation legislatlon4220.0 5288.0 regarding 5192.0 6200.0 Florid6112.0 Floridaharbors -616.0 Floridato Floridharbors -612.0 5908.0 3364.0 3452.0 3004.0 harbors 4232.0 4112.0 4672.0 waterways waterwa4540.0 5508.0 5580.0 Iii 6044.0 5992.0 6372.0 Inter 6232.0 Interview -404.0 6776.0 InterIew interfew view Iewfew3960.0 3848.0 4448.0 4336.0 4644.0 TimesUnion TlmesUnlonTimes -1084.0 5728.0 5224.0 5168.0 5848.0 3220.0 reporter 6544.0 InJacksonville InJacksontlle itJacksonville -100.0 6760.0 3372.0 3444.0 3432.0 3436.0 Jacksonville Jacksontlle4652.0 4508.0 5036.0 4940.0 5404.0 following tollowlng5304.0 6280.0 3440.0 6184.0 6536.0 3468.0 sadin 6540.0 sad6788.0 sayIn sa saIn 3660.0 3684.0 3708.0 3668.0 praise 3600.0 4316.0 4572.0 3664.0 Congressman 5808.0 Clark 5704.0 ClarkI ClarklOr-456.0 6264.0 3628.0 3928.0 3944.0 lOr 3720.0 3784.0 3916.0 3964.0 4360.0 especially 5316.0 pleased 6068.0 6500.0 3959.0 sur stir6360.0 surprised 6768.0 surprlsed stirprised 3996.0 4152.0 4164.0 prised prlsed4096.0 4392.0 4160.0 4264.0 4788.0 favor 5228.0 5852.0 -772.0 3376.0 4380.0 4424.0 3948.0 4384.0 3800.0 4548.0 4420.0 4408.0 5004.0 able abjeab1e4868.0 5496.0 5356.0 5788.0 procure 5648.0 6568.0 forme 6424.0 6572.0 Cor6808.0 -240.0 Corme 4604.0 4648.0 me 3972.0 4612.0 Frank 4640.0 4488.0 Clarkalthough 5104.0 5292.0 although -740.0 6032.0 6180.0 ncom 6272.0 comparatively -340.0 4675.0 3392.0 3420.0 4827.0 4835.0 paratively 4372.0 4872.0 4772.0 4832.0 nember member4712.0 5596.0 5480.0 5948.0 command 5872.0 commanded 6756.0 4900.0 3428.0 5068.0 3728.0 3620.0 4104.0 respect 4004.0 4820.0 5060.0 or4716.0 5080.0 theJIouse theJlousethe4louse4984.0 5976.0 wilw1116376.0 wilprove 6804.0 w111prove 6740.0 willprove 3332.0 5280.0 5320.0 prove 3992.0 3912.0 very ery4616.0 useful useCul4536.0 5220.0 5128.0 5652.0 5284.0 tor5892.0 StateHe 6316.0 State 3380.0 3424.0 5524.0 He 3796.0 5512.0 4060.0 aggressive 3936.0 5132.0 4964.0 5516.0 5432.0 5664.0 makes 6600.0 5543.0 no 6476.0 noenemies 5732.0 enemies 4276.0 4692.0 4580.0 5076.0 attained 4976.0 5768.0 6072.0 standingseldom 5968.0 6076.0 standing -728.0 standIngseldom 5960.0 seldom reached 4028.0 4884.0 4784.0 b 5084.0 5184.0 Congressmen 4980.0 6404.0 unti6308.0 untithey untilthey 6736.0 6188.0 6191.0 they 3880.0 4356.0 had 4280.0 4744.0 6220.0 many years 5208.0 5392.0 ears 6064.0 service 5984.0 serviceFor -600.0 6664.0 serviceIOFor 3608.0 6411.0 For IOFor4008.0 4564.0 sake 5092.0 or4944.0 5252.0 5660.0 6396.0 6240.0 6512.0 Isgreatly isgreatly 3388.0 3416.0 6636.0 6644.0 greatly 6652.0 4036.0 4460.0 4324.0 regretted 5708.0 5572.0 6176.0 6048.0 Floridawill 3336.0 6860.0 6868.0 3836.0 6864.0 probably 3732.0 lose 5112.0 both 5008.0 her 5476.0 older 6899.0 rep 6380.0 xmlns:ns6 ID16 8992 3456 3356 7088 ns6:type 3384.0 7088.0 7096.0 resentatlves resentaUvesresentatives4464.0 4836.0 7092.0 House 5100.0 7124.0 7100.0 onaccount 6028.0 onaccountof -968.0 account accoun-664.0 accounof accountof 7312.0 7324.0 3748.0 7320.0 3584.0 868.0 4196.0 Senatorial 4020.0 5236.0 contest 5064.0 7316.0 5844.0 6516.0 6344.0 thepeople -272.0 3324.0 7539.0 7548.0 3968.0 fail fall5048.0 5568.0 7552.0 return 5720.0 MrClark 6504.0 3412.0 7767.0 3976.0 3884.0 7808.0 4176.0 big 4804.0 vote 4708.0 5156.0 6056.0 still stllstfllstllfurther stfllfurther 6720.0 stillfurther 7992.0 7995.0 further Increase 4860.0 Influence 6520.0 6392.0 theHouse 6784.0 3408.0 8228.0 HouseHe -536.0 HouseHC 3040.0 3688.0 8444.0 8452.0 HC4080.0 8448.0 4512.0 Introduced IntToduced4364.0 8456.0 two 5416.0 6008.0 8483.0 ery5864.0 innt 6524.0 Im 6728.0 Important important 3404.0 8668.0 8676.0 portant 4144.0 bills 4048.0 4600.0 this 4500.0 5024.0 8672.0 session 4916.0 5780.0 5624.0 6144.0 passing 6036.0 passingof -632.0 3400.0 8895.0 8904.0 3696.0 8900.0 3564.0 4332.0 4208.0 4620.0 5256.0 would 5116.0 5880.0 make mnke5748.0 6452.0 him 6324.0 himfamous 9120.0 9123.0 famous 4272.0 4016.0 4704.0 bill bfll4596.0 9128.0 5436.0 sale 9131.0 thePhilippine 9348.0 Philippine 4436.0 Islands 5200.0 9351.0 wfll724.0 5676.0 6548.0 9388.0 reo6400.0 receive -220.0 reocelvevery 6716.0 9424.0 9572.0 9576.0 ceive celvevery 3852.0 9608.0 -376.0 4404.0 1fttle5152.0 9587.0 support 4992.0 9579.0 althoughthere -736.0 6744.0 9800.0 3980.0 9831.0 4396.0 likely 4260.0 9808.0 he5164.0 5628.0 9804.0 times 5484.0 6216.0 during duringthe -552.0 10028.0 10032.0 next 10036.0 ten 4120.0 4560.0 10059.0 rears5108.0 5016.0 deCeat5900.0 6596.0 10040.0 oioithat ofthat 6732.0 10248.0 10252.0 3824.0 3736.0 4192.0 4100.0 4588.0 4496.0 4776.0 regrettedThe 5644.0 regrettedIOThe 3572.0 10476.0 IOThe4088.0 refund 3988.0 4728.0 10484.0 cotton 4632.0 10492.0 tax 5244.0 5684.0 10488.0 ought 5940.0 topass 6748.0 10699.0 10736.0 pass 3900.0 10704.0 4524.0 4432.0 10740.0 mean 5680.0 10707.0 much 6228.0 10715.0 6116.0 6384.0 6492.0 3356.0 10927.0 4064.0 4752.0 10932.0 South 10940.0 5232.0 5752.0 10935.0 those 6128.0 thosemany 11152.0 11184.0 4044.0 millions 4912.0 11155.0 4720.0 5260.0 6020.0 11163.0 5836.0 returnedwhich -720.0 returnedI -792.0 11312.0 3352.0 11372.0 11380.0 4528.0 11384.0 paid 4920.0 out 5400.0 ht5804.0 Illegal Illegaltaxes illegaltaxes 11608.0 taxes taxesREASONABLE 3820.0 3396.0 12092.0 REASONABLE 4844.0 12100.0 PASSENGER 12104.0 RATES 5980.0 RATESWhen 12532.0 When 12535.0 Legislature 4484.0 5744.0 12543.0 5896.0 6580.0 6432.0 3348.0 12736.0 12760.0 4532.0 4416.0 12768.0 2cent 4796.0 passengerrafe passengerralepassengerratepassengerrafebill passengerralebillpassengerratebill-1216.0 3344.0 12983.0 3804.0 12988.0 3648.0 railroad 13028.0 managers 12996.0 declared declaredIt 6724.0 13211.0 3612.0 13243.0 3496.0 13216.0 ruinous 3932.0 4800.0 13219.0 apd 13224.0 confiscatory conflscatory6440.0 13227.0 Butthe 6444.0 But nut-284.0 -288.0 nutthe 13436.0 3724.0 13440.0 official 3640.0 13452.0 returns 4288.0 13444.0 4996.0 5328.0 13448.0 railroads railroadsIn 13660.0 3524.0 13663.0 3888.0 13668.0 Cor4768.0 13704.0 5324.0 5588.0 13672.0 ending 6328.0 13676.0 June 13888.0 13891.0 30 3704.0 3544.0 4216.0 13927.0 figured 13896.0 5380.0 5276.0 13899.0 Rail Raft6672.0 Raftroad 6668.0 6688.0 13967.0 14116.0 road Commission 14119.0 shows 5612.0 14156.0 5800.0 substantialincrease 5700.0 substantial substantialIncrease -912.0 14339.0 14376.0 over 4072.0 4932.0 14347.0 preceding 4856.0 5828.0 14379.0 14384.0 Thisincrease 6348.0 This -368.0 ThisIncrease 14564.0 increase 14567.0 4444.0 due 4328.0 4852.0 14580.0 5124.0 14572.0 elimination 6560.0 14575.0 offree ofCree 14792.0 free Cree3828.0 14824.0 passes 3692.0 4504.0 14795.0 4376.0 excursion 4792.0 5876.0 14808.0 6284.0 andthe 6700.0 3308.0 15016.0 natural 3616.0 15020.0 growth 4308.0 4968.0 15055.0 passenger Ilassenger5204.0 traffic 6108.0 trafficThe 15244.0 3788.0 result 4388.0 15252.0 oC5696.0 15247.0 how however 6656.0 15312.0 15467.0 15500.0 ever 3876.0 4124.0 15480.0 4012.0 15508.0 n4700.0 15472.0 fair fnlrcriterion crltellon15475.0 15504.0 6172.0 someother 15692.0 other 15695.0 States because 5408.0 5656.0 15700.0 5528.0 5916.0 traversed traversedby trn 6156.0 versed 6132.0 versedbr -532.0 15915.0 15920.0 brinterstate interstnte3552.0 4636.0 15923.0 Cram5384.0 East last5904.0 15928.0 xmlns:ns7 ID17 14568 3440 3268 16140 ns7:type 16140.0 West 3872.0 16156.0 must 16143.0 Incrmse16159.0 rturns5996.0 returnsfor rturnsCor 16367.0 Cor16403.0 trafflc16372.0 5072.0 also nlno16408.0 moredensely 6268.0 morl-412.0 6680.0 morldensel 16592.0 densely densel4140.0 populated 16595.0 4952.0 5716.0 5556.0 16623.0 manyothers 6676.0 16628.0 manothers 6576.0 16815.0 16820.0 ranking 3864.0 higher hgher4780.0 6320.0 New 6100.0 NewYork -360.0 16848.0 -212.0 ewYork 3328.0 17040.0 17043.0 York 17080.0 4204.0 Pennsylvania Pennsrhanlaperhaps Ilthapswithits withIts 17268.0 17276.0 its welltodo 4552.0 17271.0 farming fnrmlng4452.0 5312.0 population Ilopuintion5212.0 populationIt IlopuintionIt-868.0 3532.0 17539.0 3656.0 4440.0 seem 4284.0 4848.0 5472.0 thointerstateCommerce 5868.0 Interstate Intlrstat-812.0 InterstateCommerce -816.0 6684.0 IntlrstatCommerce 17567.0 6584.0 17759.0 Commerce COUlmls -1016.0 5424.0 lon 5600.0 could figureout 6204.0 figure ngurlngurlout 17987.0 18003.0 17995.0 cost per 4468.0 mile 5352.0 passengertraffic IJI1sspngt6552.0 rtraffic 18207.0 18212.0 5368.0 bo5160.0 used ulwd5552.0 6592.0 astandard 18428.0 18435.0 standard 4200.0 18440.0 fixing 18431.0 5012.0 5504.0 18448.0 5388.0 5920.0 6304.0 eachState eachStat 18656.0 18664.0 Stat18700.0 18695.0 3768.0 4136.0 18659.0 4556.0 hnshasdone hnsdone 18879.0 18887.0 done 18892.0 5464.0 Fair fulr18884.0 planIlia 6296.0 de dlder6196.0 demands dlmands dermands 18947.0 19104.0 19112.0 mands 4816.0 19107.0 shall 6192.0 6480.0 6368.0 allowed 6620.0 19175.0 19332.0 19340.0 lowed 19348.0 4168.0 19335.0 charge reasonable relsonahle4736.0 19343.0 rat8thatwill 19555.0 19560.0 provide prolde3636.0 4472.0 Calr4368.0 Interest 4764.0 19568.0 terest 19592.0 actual ac atual 6528.0 19623.0 19783.0 tual 3740.0 19820.0 money Invested vested19787.0 5492.0 19799.0 5776.0 19815.0 onwatered onatere onWatered 2840.0 3320.0 20007.0 20012.0 watered 20023.0 atere -524.0 stock 5440.0 expected eXllectedexpectedTHE eXllectedTHE 20491.0 20499.0 FARMERS 4000.0 INSTITUTE INSTITUTEThe -1032.0 3504.0 20935.0 proposed 20948.0 farmers fnrm -652.0 Institute InAtltutInstitutewhich -688.0 6612.0 InAtltutwhich institutewhich 21163.0 21171.0 21200.0 convene 4268.0 5240.0 21168.0 city cltr5840.0 forthree 6288.0 6428.0 CorCorthree 21388.0 21396.0 days das3756.0 beginning 4344.0 21391.0 February Fellruar6532.0 Fl6408.0 Flis 5Is 21611.0 21619.0 3580.0 destined 21635.0 21651.0 proeoCgratpractical 6004.0 6140.0 practi pfactl-516.0 6608.0 21679.0 3316.0 21824.0 cal cat21843.0 value 21863.0 21839.0 agricultural 5936.0 interest interestsinterestof interestsof21860.0 teres teresthe -392.0 6496.0 3312.0 22060.0 22075.0 3476.0 22068.0 4824.0 6124.0 6012.0 shouldbe -520.0 22283.0 22296.0 3500.0 attended 22291.0 5088.0 frum6448.0 6336.0 allsections 6648.0 allsectlolls sections sectlollssectionsSince -672.0 sectlollsSince 22747.0 Since 3952.0 4184.0 4676.0 4568.0 learned leamldSec Secrotary Secr Secretary 6704.0 22875.0 22959.0 rotary retary3492.0 tarr 22980.0 Agriculture AgrlculureAgriculure22963.0 Wilson 1Vilson6332.0 hlhehere hlhere 23183.0 23199.0 here 3792.0 3676.0 address 4988.0 23191.0 tlw5376.0 meeting rneeting23224.0 nHf -668.0 tlng 5668.0 thOwthoseinterested thOwInterested 23403.0 interested 4156.0 23416.0 fCt14812.0 5344.0 23411.0 5456.0 fIlcrlalspecialduty fIlcrlalduty 3304.0 23631.0 23652.0 duty 3808.0 23667.0 4092.0 23679.0 come 4664.0 23639.0 listen IIstEn5688.0 23659.0 5972.0 23636.0 thothp6364.0 val mIvaluable 6588.0 mIuable 23699.0 23851.0 23872.0 uable suggestions along 4896.0 agriculturallines -976.0 6632.0 24079.0 24095.0 lines 4244.0 24092.0 llarned5396.0 24084.0 gentleman glntlcmanlmfhasto lmfto 6604.0 24328.0 3560.0 offer 3460.0 offerIt 3488.0 24531.0 24547.0 3712.0 24575.0 may 24583.0 ma 24535.0 generally 24580.0 gent 5148.0 ral1 known butthe hilthiltthe 24751.0 24771.0 last 960.0 glslaturcIegislature3940.0 -960.0 24763.0 oC980.0 24759.0 thlK5308.0 thl 5608.0 Stl1tfmade madlmadean -416.0 madlan 24979.0 25027.0 24995.0 annual 4348.0 24992.0 appropriation allprollrlaUon24987.0 oC250n 5250113FOo25011.0 nayear near 25204.0 25247.0 25255.0 3816.0 25220.0 Cor4188.0 25215.0 holding 25212.0 oC5216.0 25207.0 these 6088.0 ItiRti 1r1J11tItiRtitutes 1r1J11ttutes 25236.0 ath 0.0 athtutee 25427.0 tutes tutee3896.0 25479.0 25467.0 4320.0 25443.0 held 25431.0 undl5420.0 -116.0 direcdirection dlrt dlrttJon 6460.0 threetlon 25491.0 25663.0 tion tJontlon25671.0 oC25667.0 3860.0 4304.0 25659.0 experimental pprlnHmtal25703.0 -1100.0 station tntlonSevoral 6060.0 Sev Several Sernl 6388.0 25719.0 25875.0 25891.0 oral eralernl25895.0 oCtluse th8eth 25931.0 se institutes instituter4456.0 25903.0 -788.0 tltuhlI1 haf5372.0 5856.0 25923.0 alreadybeen already Alr 6244.0 Rdy 6292.0 Rdybeen 26099.0 26107.0 hlld3672.0 4240.0 26123.0 4492.0 26119.0 various nrI01l826111.0 SeoctiOIUsections5988.0 26104.0 6248.0 FlorIda 6252.0 Flor 26167.0 26319.0 26332.0 ida 26343.0 hut3540.0 26347.0 1s26335.0 Intended 11Ilndtl5448.0 26327.0 mnkomftktblithisthe tblitbe 26543.0 tbe3624.0 26568.0 central fentrnlinstitute Inltltute26560.0 26579.0 aOiitvnknble vxhnblevnknbleand vxhnbleandIoablr Ioablrand 26763.0 26783.0 useCul26791.0 oC26779.0 1114924.0 26775.0 26799.0 5956.0 26767.0 tbJ6168.0 end 6260.0 endth endthe ndthl 27003.0 thl27040.0 -12.0 27032.0 promoters llromotlrs27043.0 27055.0 worktnNAVAL working worktnarworktn-568.0 workingNAVAL worktnarNAVAL 3904.0 NAVAL 4740.0 ARMAMENTS ARMAMENTSThe -1240.0 27935.0 27943.0 British nrltJihnaTal naralnaval5300.0 autaoritle autnorttltautlioritits5136.0 autaoritlesaid 6212.0 27967.0 arld aresaid 28163.0 said ld 28183.0 3984.0 28171.0 preparing 4172.0 28203.0 pre 28215.0 Irlng mringplane lmnaplanstor5636.0 28195.0 28191.0 war warship 6412.0 arship 28223.0 3280.0 28375.0 28383.0 ship 3680.0 28388.0 50 o028423.0 4228.0 28415.0 cent 28411.0 greater f1eAUr5348.0 tbftbtDrNd IrredDrNdnaugbt Irrednaught dnaught 3252.0 28607.0 naught naugbt28647.0 28615.0 wltb28655.0 a28611.0 displacement dlnplaoementt11hhm -1108.0 6024.0 5860.0 28627.0 nt JO28823.0 28835.0 000 28855.0 tons tODS28843.0 naval nanddesigner dOIIJDrfIdesignersbare WlVthavebareproposed WlVtpropo haveproposed 29051.0 29055.0 29091.0 propo 29079.0 4400.0 29059.0 build 29096.0 warnhlpwauhlp10000 fOnotI00010000tons fOnottons I000tons 29264.0 29307.0 29283.0 whlebwhicb29279.0 wiltCOlt12004WOOO t20000MoA5468.0 t20000MoAWhen 12004WOOOWhen -888.0 29271.0 OIOO1iO -716.0 OIOO1iOWhen 3276.0 29508.0 3760.0 29503.0 29500.0 rivalry r1all7Corsir IIvsizesirand -304.0 IIvand sizeand 29707.0 29731.0 3632.0 number 29763.0 num fcf btof4576.0 29723.0 wwship wArshlptwarshIpt29755.0 29747.0 ease eae29744.0 what 6356.0 buttt butt 30495.0 -2116.0 3780.0 30575.0 30627.0 xmlns:ns8 ID18 14452 3496 6836 1636 ns8:type 6884.0 1676.0 6968.0 w 6912.0 6972.0 7076.0 7120.0 lll 7268.0 7404.0 satisfy satlsfr8076.0 craving 7952.0 cr -620.0 8696.0 ln 8240.0 8824.0 8592.0 8880.0 9052.0 9172.0 preparations 9484.0 9612.0 prepara 10244.0 IIIt 9884.0 Ira 9824.0 IraUons 6880.0 tions Uons7664.0 1872.0 7384.0 7924.0 7820.0 8272.0 1884.0 cndenttt8184.0 8864.0 8760.0 9368.0 impoverish Impotwlsh9264.0 Impotwlshthe impoverishthe-920.0 10288.0 6888.0 2124.0 6976.0 6900.0 7448.0 IJeople7232.0 8200.0 ot atof8560.0 8348.0 8968.0 countries OlI1tlllS8752.0 9944.0 tltntstrive 9736.0 9948.0 tltnt tttnt-344.0 10292.0 tttntstrive strive 7560.0 7452.0 7884.0 supremacy suprnH1c7784.0 8928.0 2344.0 fur8768.0 9260.0 thllt9160.0 9788.0 9688.0 10024.0 notonly 9920.0 noton 6964.0 only 7180.0 7156.0 7216.0 7520.0 7288.0 7956.0 vast 8492.0 outlay 8308.0 ou 8996.0 8764.0 la 8736.0 9192.0 8888.0 building 9420.0 buildingthese -676.0 10284.0 hull htH 9900.0 htHthese theso7524.0 enormous enornious2808.0 wr8856.0 engine nglntengines9652.0 hut9492.0 9912.0 theconstant 10280.0 constant 7804.0 expense eXIJense7692.0 8580.0 3007.0 8468.0 8844.0 keeping 8732.0 9604.0 thorn thtlntheta9488.0 10128.0 10004.0 inrepair 10272.0 Inrcpnlr repair rcpnlr3216.0 7476.0 7936.0 7844.0 8168.0 commission 8084.0 9360.0 3243.0 I9132.0 9364.0 Experience qhrltI1llxperletiee9432.0 Experienceshows -916.0 xperletieeshows 9508.0 qhrltI1llshows 7636.0 thaf8112.0 7996.0 8412.0 about nuout8264.0 9016.0 3472.0 ttn8868.0 9520.0 9856.0 3508.0 aliIourfinest 10276.0 aliIfinest finest 7512.0 warships warhlps7424.0 8344.0 8584.0 8500.0 8756.0 few 8664.0 3700.0 9032.0 9124.0 8872.0 9224.0 lars 9568.0 ago 10012.0 nrtart9928.0 arenow nrtnow artnow 10228.0 10240.0 6960.0 3883.0 now 7388.0 hut7300.0 7748.0 fit 7656.0 Cor7896.0 8320.0 3908.0 scrapheap sCraphlalscrapheapThe sCraphlalThe-876.0 9544.0 7148.0 4108.0 7624.0 limitation Ihljltatlol18436.0 4116.0 itation 7824.0 8588.0 018892.0 laud land8744.0 anti9236.0 9832.0 nnvalmnl9680.0 nnvalarmaments 10268.0 mnlarmaments navalarmaments 6956.0 armaments 8064.0 8372.0 4352.0 something sOUllthlng9396.0 9232.0 9812.0 world wOIl9648.0 worldmust 10188.0 10232.0 10220.0 lII 6952.0 7464.0 4599.0 soon 7368.0 agree 7832.0 ngr 8392.0 8216.0 8204.0 8488.0 9024.0 9356.0 9256.0 Ls9460.0 sense 9692.0 senseless 9816.0 wn 10152.0 tless -48.0 10200.0 less 7536.0 7988.0 pgoplt7880.0 -548.0 oPl 8644.0 8428.0 8976.0 9336.0 9340.0 creation rentlon9392.0 9384.0 10124.0 9408.0 7416.0 7292.0 8024.0 IB7900.0 8276.0 5020.0 really rEall useless 8656.0 uselessDELIBERATION 9468.0 DELIBERATION 8816.0 IMPOSSIBLE IMPOSSIBLEIt -1140.0 9956.0 7136.0 5952.0 7400.0 7260.0 he7708.0 8252.0 6000.0 8068.0 8532.0 long 8884.0 9456.0 expensive eXlltnslt9312.0 expensivetrip eXlltnslttrip 6948.0 6175.0 trip 7372.0 7252.0 7732.0 DlmocratsDtmocrats7608.0 8624.0 9644.0 Kast9512.0 10000.0 totake take 6419.0 7304.0 7648.0 attend atttnd8268.0 Denver Dener8528.0 9316.0 convention omtntlon9220.0 conventionespecially -900.0 10216.0 9404.0 omtntloneSJleclnll 6944.0 eSJleclnll7868.0 7768.0 8128.0 8032.0 raflroads8396.0 9344.0 6647.0 9728.0 9548.0 va 9528.0 given givennotice 10264.0 gl 9960.0 10080.0 6696.0 ennotice 6928.0 6856.0 notice 7572.0 7444.0 8020.0 6907.0 1107892.0 reduced 8212.0 6872.0 fares flre8992.0 wfll9536.0 10084.0 6883.0 blbeconceded blconceded 6936.0 conceded nut7700.0 8356.0 8248.0 8920.0 8804.0 7108.0 atttnd9252.0 tl1l9888.0 theconvention tl1lconentIon 10236.0 6932.0 924.0 conentIon7964.0 7360.0 7856.0 8256.0 delegates 9168.0 9044.0 9636.0 7336.0 gain 9412.0 10116.0 7340.0 9976.0 incomposure Incomposure 7564.0 composure 7932.0 8788.0 8688.0 9308.0 9208.0 9560.0 cash 10068.0 bythe bthe -92.0 10160.0 7756.0 absent absencoabsence7192.0 8080.0 7775.0 8364.0 8244.0 noisy 8632.0 enthusiasts enthuslast9184.0 enthusiastswho -952.0 10260.0 enthuslastwho 7984.0 7392.0 7916.0 8484.0 8036.0 8352.0 9036.0 8011.0 conventions conntfons8908.0 10168.0 8048.0 abeer 8176.0 beer 8220.0 garden 8260.0 mor7948.0 9060.0 8956.0 9152.0 8231.0 deliberative dellberathdeliberativeassembly 10324.0 8328.0 Inssemblr -8.0 10332.0 10328.0 6916.0 8384.0 assembly nssemblrWith 1Vith7696.0 8460.0 8820.0 thousand 9684.0 8496.0 SIH 8475.0 specta 9908.0 spectators 9964.0 ctn 10320.0 8604.0 6920.0 tors 7356.0 howling howllll7248.0 8684.0 8012.0 8716.0 8360.0 8472.0 therthewfavorite 9768.0 8692.0 candi candlcandidate candldate 8887.0 7412.0 nothing nothln8136.0 8044.0 8572.0 8944.0 8916.0 speaker says sas9416.0 9968.0 8952.0 ran can9872.0 ranbe canbe 7080.0 br7620.0 anyone 8052.0 I1ono 8628.0 fifty fiCt feet 9436.0 himand him1nd himtnd 1ndtnd7352.0 7208.0 7736.0 9372.0 7604.0 8092.0 ot9367.0 gesture 9140.0 9008.0 9272.0 equal 9676.0 equalto Imparting ip1IRrtlng7068.0 9584.0 ideas 7968.0 ideasGovernor IdeasGoernor 10067.0 Governor GoernorBroward llroward7860.0 hns10083.0 appointed appolnhtIappointedW appolnhtIVappointed1V10287.0 1VV 7256.0 10295.0 J 7528.0 10300.0 Brran8192.0 10303.0 brilliant 10340.0 young roung9916.0 attorney attorne 10208.0 10384.0 6904.0 10523.0 torney torne 7440.0 10528.0 7344.0 7876.0 laeksonville10531.0 10572.0 9400.0 10536.0 9864.0 hiscampaign 10748.0 campaign 7776.0 10788.0 manager 10756.0 8812.0 8728.0 9064.0 10767.0 guberna gubernngubernntonal 10184.0 9516.0 gubernatorial gubernatorlal 10204.0 10836.0 10972.0 tonal torialtorlal7488.0 10980.0 Campalgn7348.0 10988.0 8860.0 succeed 8680.0 9504.0 10048.0 Inlnlamented 10180.0 Inmented lnmented 11060.0 6896.0 11200.0 mented 7640.0 Senator 7500.0 Sella -636.0 tor 8408.0 11208.0 Mallory 9324.0 9732.0 BrnnBryanwas -492.0 10224.0 Brnnwas 6892.0 11423.0 11452.0 alreadr11468.0 7928.0 8332.0 11436.0 avowed 8224.0 11472.0 8964.0 8540.0 owed 8424.0 9076.0 11444.0 Cor9896.0 forthe Corthe 11648.0 7280.0 11651.0 offic7152.0 11659.0 8296.0 8164.0 8700.0 death 8564.0 9284.0 11667.0 oC9148.0 9448.0 SenatorMallory SenatorInllorr Senator1lallory 11871.0 Inllorr1lallory11884.0 8016.0 7828.0 8576.0 8464.0 11887.0 place Illace9248.0 11928.0 con canconsiderably 10172.0 cansiderabl consitierably 12096.0 siderably siderablsitierably12107.0 earlier tarller12112.0 8404.0 9616.0 12120.0 fondest fondesthopes -604.0 fondesthoes 12324.0 hopes hoes12328.0 anticipated antllfJJted8640.0 12336.0 9068.0 12340.0 8960.0 9704.0 12348.0 oC12343.0 theGulf 12459.0 12548.0 Gulf 12556.0 Coast 7240.0 12560.0 7836.0 8932.0 12595.0 8740.0 9332.0 12579.0 9756.0 12564.0 likelyto like liketo 10060.0 6876.0 12776.0 12784.0 relish rellsh7036.0 7796.0 12779.0 8188.0 12787.0 fact 8512.0 9540.0 12792.0 Atlantic AtlnntlcAtlanticCoast AtlnntlcConst 12852.0 12999.0 Const7484.0 13004.0 13007.0 13012.0 lnited9108.0 13020.0 9772.0 Sena Seua9624.0 Senators 10164.0 Seuators 13091.0 13232.0 Rnd7196.0 13235.0 wll17652.0 13272.0 BO 80sodemonstrate 8376.0 9672.0 13256.0 9552.0 theprimary theprlmnry primary prlmnry13460.0 ht7540.0 1908 7780.0 13468.0 lOS 7940.0 Ve We8840.0 13495.0 13471.0 9100.0 13463.0 9352.0 opln opin9712.0 oplnon 10156.0 13503.0 011 opinion -192.0 9996.0 10020.0 Inion ion 13712.0 7228.0 13684.0 GOlrnor8548.0 13691.0 8432.0 13696.0 mnde9656.0 madea mndea-448.0 13940.0 7040.0 mistake 13908.0 fr ii8040.0 making 7888.0 13920.0 appointment nppointm9012.0 appointmentand ntanti 14127.0 anti14132.0 7600.0 8152.0 14140.0 8544.0 Brynn9164.0 9048.0 14148.0 14184.0 10008.0 ajolltical apolltlCal apolitical 14355.0 jollticalpolltlCal8416.0 14360.0 8304.0 14368.0 accepting 8568.0 9592.0 9480.0 14407.0 9852.0 ap allapointment allpolntment ointment polntmentpointment14583.0 lion Hon7712.0 14588.0 John 8284.0 14591.0 Stockton 14596.0 whobuilt 6852.0 14800.0 built 7380.0 14835.0 tip7244.0 8100.0 present IlIesent7864.0 8912.0 14819.0 crowd 9596.0 9940.0 thl9740.0 thelolitlcal thlJloll thepolitical 15028.0 lolitlcalJloll 7172.0 tlCul 7144.0 7688.0 15031.0 saddle ndd 15036.0 15071.0 8108.0 9040.0 15052.0 8924.0 9304.0 15039.0 hn 15084.0 15044.0 bln9668.0 beenoverlooked blnovprlookld overlooked ovprlookld15264.0 hy8312.0 15260.0 15268.0 tlw9828.0 theleople tlwIIopl 15483.0 leopleIIopl7516.0 15519.0 see IHl8316.0 15491.0 tnat 8784.0 15496.0 8652.0 9176.0 10052.0 INisIHewarded 10176.0 INrewardecl isrewarded 6836.0 15708.0 rewarded ewardedrewardeclhtIflOS8524.0 hy8380.0 8852.0 placing 15716.0 hirn15719.0 Inho Intho Inthe ho thothe15931.0 15963.0 gu 8324.0 IHrna torlal chair xmlns:ns9 ID19 14228 3464 6756 16411 ns9:type 7012.0 16411.0 TI116455.0 7456.0 ahw7332.0 16419.0 ot16416.0 farm 8172.0 16452.0 crops crOIlS9240.0 16460.0 9848.0 goo goto 6832.0 16639.0 16647.0 16676.0 o 6984.0 7140.0 16652.0 HUJlflUlt8180.0 animals InlrllnlHamiinialsh9720.0 16644.0 milchmunchmuchgreater milchgrlatlr munchgreater 16859.0 16880.0 grlatlrthall16864.0 7920.0 consumed onHlIllllclcousumet9444.0 16872.0 9628.0 lIIallluau9524.0 manAll 10104.0 lIIallAll luauAll 10100.0 17083.0 All 17087.0 017064.0 7724.0 wheat nquarter flInrtlr8420.0 9204.0 17095.0 thp17111.0 oatH ontRoatsoatsonetenth 10112.0 oatHtietenth ontRonetenth 6820.0 17311.0 onetenth tietenth7684.0 17316.0 01corn COIII8600.0 9020.0 9500.0 barley harttybarleyhe harttythebarleythe6824.0 he7204.0 rye rYf7428.0 7460.0 7628.0 buckwheat bu -884.0 8876.0 17580.0 8292.0 kwhtlIt 9056.0 17544.0 rice rkt9892.0 9724.0 thepotatoes 17764.0 17775.0 potatoes potntOlHnod8004.0 tobacco tohnlcn8720.0 nilbelong IJeloll17783.0 thecrops 10148.0 the1OIIH thecrofts 1OIIHcrofts7472.0 ntllianttilt7760.0 17992.0 portions IIrtlollot9700.0 CrOKcropsdestined 10144.0 18027.0 CrOKdt cropsInsoleI InsoleI18215.0 dt -700.0 18252.0 stlrllf1 6996.0 7508.0 7912.0 human humallInunau18220.0 consumption ronlmmptlonfIllriteThesum 9860.0 fIllsum ritestun 10120.0 18472.0 sum stun7272.0 total 18443.0 alm valtlf9116.0 or9004.0 tlUHt18475.0 anonDecember 10136.0 onDlcemhfr anDecember Dlcemhfr18667.0 1107 HIOi1907itSasllguretlfI lIrcli 8940.0 9744.0 9880.0 theDepartment 9640.0 thothoDepartment theIfIartnHlIt Department IfIartnHlItoCAgrkulturpAgrlculturt9200.0 18920.0 waN WUHwasJI079 9496.0 JI079Oo0000 1079 IOiI1079OuoOOO 10044.0 18895.0 IOiIouoOOO OuoOOO Oo00007680.0 ruemIlle19115.0 oranimal I1nhnal9748.0 feed telcl9588.0 feedstuffs telclsturrs stuffs sturrs7264.0 Just JUHt8096.0 twice thntrequired nfulrfrI8984.0 IIrbyman IIrmau mau7308.0 19595.0 21fln000non 1f10OOOooo2190000000including Indillilninelnding8704.0 mOtltnunstmostof 10132.0 mOtltoC nunstof 19779.0 oCprincipal prlncljl8156.0 CrOIMotUw19804.0 current cllrnntcurrentyear cllrnntcar 20040.0 yearK yearE7168.0 car carE 20311.0 u 6992.0 20447.0 20452.0 K1VErwin Krwln8236.0 20455.0 Lake LakfLak8388.0 20487.0 City CltyCltr9532.0 119376.0 wflIwellknown 10072.0 wflIkllowu wellknotyt 20672.0 20675.0 kllowuknotyttraveling troweling20699.0 tra -752.0 cllll salesman NallIInllsaltsntnu8060.0 9144.0 IiitIlllatest InltHtlatestto InltHtto20895.0 20919.0 7072.0 20899.0 brctak lft1kbrttk7668.0 Illtopolitics JlolltkHMe IffIle9320.0 u11Ilithe11ancandidate 11Candhlate acandidate 21055.0 6796.0 21119.0 21123.0 Candhlate8116.0 mt1rOlulcommissioner comrnIRHhulfr8776.0 commissionerMr comrnIRHhulfrIr-1152.0 10076.0 21155.0 mnlsslouir mnlsslouir11r -796.0 21287.0 21347.0 21352.0 11r7024.0 ErwlnRaid sakiild 8476.0 21363.0 21375.0 vory popular flollulnr9292.0 popularwherever flollulnrwhrttr 21567.0 21575.0 wherever whrttr21572.0 knowlI7580.0 8368.0 audnull8792.0 hlHfriends CrlNlllH21599.0 airy BjiyBjiyhe 21603.0 1111 1111h airyhe 21740.0 21800.0 7056.0 21803.0 IR21811.0 1110teverj 21832.0 flr eer8772.0 21795.0 vhere 9328.0 IflHo9844.0 hnH9760.0 hasnot hnHnot 21955.0 22047.0 22020.0 heretofore htrftoforl7052.0 8088.0 indulge 8000.0 indulKetiln Irlflul -940.0 8620.0 22015.0 thlexcitinggame 9452.0 exciting fXltllIJ-660.0 fXltllIJgame 22180.0 game 22251.0 oC22247.0 older22243.0 ofllflIfklll peeking aeeklmig hilt9228.0 IK 114is9476.0 22275.0 10056.0 9992.0 x xIllIcted xpetted 22311.0 22464.0 22471.0 petted pectedIllIcted22467.0 7596.0 22503.0 7976.0 11l jJrolpence8596.0 tr formidable CorrnHnhllforinidnhleformidablecandidate CorrnHnhllcalldhlnhStnrkf forinidnhlecandidateStarke -840.0 22687.0 22695.0 calldhlnhStnrkf candidateStarkeStarke Telegraph 1IlfgrnlhlegrnphTelegraphThe 1IlfgrnlhTtw-844.0 22700.0 legrnphThe 23167.0 Ttw23179.0 probability lrohatJlJltprobablllty7284.0 hisUmtlimitttlrfthen23172.0 VIIIIJfIbefti 10108.0 IJfIIII beIn 23395.0 fti IIIIn7044.0 23408.0 thf6924.0 23400.0 neighborhood nehhlwrhoolloCsixteen alxteonhtcunmultI ctunlleuudlctunlldates euudldatftoi multIdates 23620.0 dates datftoitorsheriff slurltrsherlffIII23628.0 8440.0 8948.0 county rnutitynUllt ihethenext ihenext IIIwxt 9952.0 23843.0 23880.0 Iwxtelection INlIon8144.0 23856.0 Jllstlust8612.0 why wh uii8832.0 thlH this23848.0 pnrtlru Ilnrtlruiutrtlcupnrtlrular Ilnrtlrulariutrtlcular24067.0 7128.0 orneaflle7004.0 24075.0 ilhouldhfiiU 8552.0 to8980.0 unucht24111.0 9556.0 24071.0 Hiupht lMulhtsJKhtHiuphtafter -540.0 10096.0 lMulhtnCtt sJKhtafter 24291.0 24311.0 nCtt 7176.0 7048.0 24307.0 liIy24339.0 24303.0 quandry Iluundrrquantlry24299.0 Ih hnwhll IIfII IIfIIIliforllwd beeninformed 10088.0 wnInformed 10092.0 24515.0 Informed Iliforllwd24527.0 hy24559.0 ellplUali24523.0 8828.0 lio 110hili9276.0 9380.0 heUJhldheUJtno hldln heldthe 24699.0 tno7032.0 24756.0 position Ioiltlonposltiomi24787.0 rp 9000.0 24748.0 1snolneC 24735.0 murli IntiIlltnurhmurliremuneration IntiIllr tnurhreraatnerntion 24963.0 24984.0 remuneration rnUlHrttolireraatnerntion25015.0 -1136.0 25019.0 nft 24971.0 nlpr25007.0 paying 11IIUgpnytngdej dfJlutlf deputk24968.0 utltt utlttand 10016.0 xand 25199.0 811117160.0 otblrotherAB 25239.0 25231.0 czpenwes czpenwesAa IIfItf IIfItftJll 25708.0 AB Aa25692.0 tJll25684.0 ItPfMibliraf HpJmLlIranItepublien8636.0 National NltUonaJConven CODfonConvention -596.0 CODfontloll C mv ntion 25743.0 tloll25951.0 11l25920.0 lee7840.0 blld25911.0 Juno JunJuneItch 16thih 9080.0 Isprobe prohaIJtobprohablf IJtobbl 26039.0 blf bl 11tbat26143.0 Cotifrpoii ConcrHConrreas26135.0 8724.0 lx beadjourn JJouff1sdjournI26127.0 Mthe 1thf 9936.0 9984.0 Ithe -16.0 3244.0 26371.0 thfRepublican ruhlltaJl7028.0 1t -936.0 8104.0 fei 26416.0 7496.0 uhtlcau 26355.0 Iadr lradt26395.0 26392.0 ni re8836.0 9300.0 Jun JUDJim MThat ITbat 26576.0 26595.0 That TbltTbat26587.0 wouM Waif4atllt Inn meta26623.0 iiH tbatfe hw few9296.0 Ifanythe 9776.0 t9932.0 fItheJretJldnt rthe 26804.0 26815.0 theJretJldnt lresWrnts PreM 26827.0 7672.0 rerotnmendtttkn recommend rConsmlndAt-1380.0 tl 26847.0 26839.0 jfi 9428.0 26835.0 9792.0 IIllllha Hh IIlHt 27023.0 27048.0 lHt hapuactitt IDactPt1euactedinto hllO27027.0 lax 8616.0 27035.0 bat5f Sp27075.0 9268.0 akr kT krfau Cahfaunont Cahnon tinnuns 27251.0 27303.0 nuns nont27307.0 non 7200.0 7328.0 27268.0 plan raanprsn27259.0 27263.0 rmssing Mlng unxthp 27279.0 sppr 9244.0 27284.0 27255.0 aIrIr1 aIrIr1Uon irla qr1aqr1atiop irlatlojt 27471.0 27504.0 tlojt Uontiop27487.0 bllli27483.0 ami27479.0 tyro Utf1l27515.0 goinjt oinxoin 8972.0 bunt 27507.0 jt 27520.0 9464.0 willte willb3 111bt 27707.0 27735.0 te btb3adopted sdoptdadoptedA sdoptdA27715.0 IdO tflfJ 27727.0 jA 27931.0 28160.0 28187.0 28179.0 yeareAr 8800.0 28147.0 tb lbOM 28175.0 peo 9784.0 IOfJI l1Kb 9924.0 ttRaht tf tfRakiKb 28359.0 Raht RakiKb 7188.0 1Kb 28380.0 X SNtoc vot01Jd 8516.0 doat28403.0 28399.0 9472.0 ash 9660.0 Inrtntf nami nabel 28579.0 abel amirtntf7220.0 28599.0 tabUbE aathilnbrUbl 28595.0 hr4 28639.0 28632.0 28591.0 dlfpo dl 9104.0 dIspesary Iary 28619.0 28624.0 9764.0 TL TtTbTLUtt 9980.0 TtlAur Tblatter 28807.0 28839.0 latter lAurUtt 28868.0 tHi IMIDeeesms28819.0 baY HAVCbareprmra prox fOfO uitMti unutfmuitMtifactory -584.0 unutfmactnry 29028.0 29063.0 factory actnrytOlt 29083.0 r1 7544.0 29047.0 hoTrfar torfor29067.0 29031.0 trM1f tthethevot 9820.0 thotr 29247.0 29299.0 vot otr 7000.0 29311.0 Jgt29323.0 thldIM1 8708.0 29291.0 srt 8608.0 9088.0 MJ of9600.0 ftb 9696.0 burl burlners JJ 9876.0 -20.0 29471.0 29539.0 29535.0 ners 7112.0 ttit 7752.0 29559.0 29531.0 29519.0 R ltjrihr29479.0 ff ffrfrjfM jfMby tr11uthst tr11uthstby -896.0 IflJfj IflJfjby -512.0 3464.0 29643.0 29727.0 a6940.0 29711.0 malII uaJrrit7212.0 ajaj 7816.0 29736.0 rtxv 7588.0 v nf 29703.0 rA 29667.0 II11t 30263.0 30487.0 30519.0 30551.0 11t 8288.0 30547.0 xmlns:ns10 ID20 14436 3564 10320 1672 ns10:type 10716.0 XMAS IN 11256.0 11696.0 BONNIE 11560.0 12552.0 MELROSE 12424.0 MELROSEA 10360.0 10444.0 Delightful CellghtfulCelightful10556.0 11624.0 Xmas 11500.0 Tree 12084.0 12728.0 Attended 12572.0 13608.0 13492.0 byj 13788.0 byFine 3520.0 10356.0 2284.0 IFine 10376.0 11340.0 Program ProgramOther 12060.0 12260.0 Other 12744.0 12888.0 Notes Notesj 13352.0 NotesJlelrose 13852.0 13876.0 10352.0 I10624.0 Melrose Jlelrose10372.0 10720.0 11284.0 10876.0 1roSt 10752.0 11432.0 Dec Dlc11248.0 11868.0 2611.0 23 11728.0 11996.0 iTl1e 12028.0 12276.0 12596.0 12688.0 shipments shlpnllnts13636.0 13552.0 oforanges 13796.0 oforall 10432.0 2868.0 oranges orall 11092.0 10920.0 lS 10792.0 11180.0 11656.0 11568.0 11748.0 1IIO 12316.0 12236.0 12132.0 12396.0 arl12740.0 12664.0 finish nnlshfinished nnlshell13740.0 ell10744.0 fur10612.0 11096.0 3060.0 11480.0 11252.0 12268.0 12644.0 12524.0 13152.0 lIumlltr13024.0 numbert -640.0 13792.0 numberof lIumlltroC13872.0 13848.0 10428.0 oC10700.0 boxes boxls10588.0 11280.0 snippet shlpItshippeti11168.0 12036.0 amounting 11920.0 13068.0 12944.0 13332.0 about2FOt 3536.0 10336.0 2500 2FOt10364.0 3516.0 10820.0 11544.0 11396.0 11804.0 11704.0 12404.0 12288.0 12652.0 Coward Cowarll12500.0 13400.0 shiplied 13292.0 13404.0 sl1ll13736.0 shipped sl1llItd 13688.0 lied pedItd 1ilIO lFoO10856.0 10976.0 11196.0 11032.0 00 11012.0 11604.0 11692.0 rest 11864.0 st 12008.0 being blllIg3744.0 13396.0 front13296.0 fronthullvidual 13776.0 13844.0 Iindividual iJuneblooming 13868.0 individual hullvidual11356.0 Ilurths12164.0 Quite 11936.0 12708.0 12620.0 12900.0 12796.0 13628.0 oC13544.0 ofJuneblooming 13784.0 oC1l1tt Juneblooming 10460.0 4195.0 1l1tt -1180.0 11640.0 10868.0 1I loom 11796.0 fruit 12608.0 12452.0 13124.0 01112924.0 tho the13320.0 thotrees thoUtl theIrte 4439.0 trees IrtetreesI IrteIUtl 13836.0 10608.0 4680.0 tW 10944.0 11040.0 arrivals urrivals11788.0 11944.0 12540.0 12440.0 12864.0 12772.0 13212.0 season Reason13128.0 seasonare 13764.0 Reasonart seasonart 10416.0 are11108.0 Williams 1Villiarns12012.0 4876.0 12472.0 wife 12308.0 12980.0 12824.0 Lima 13140.0 LimaOhio 13716.0 LimaUhio 13832.0 OhluUhioaull10796.0 11336.0 Rev 11228.0 11812.0 11660.0 11880.0 12140.0 I12360.0 Eck 12200.0 12780.0 12676.0 13056.0 Chicago 12948.0 Chicagowhich 13720.0 Ij 5307.0 jwbkh11056.0 10900.0 11328.0 11088.0 11736.0 forerunner 11584.0 12656.0 13112.0 quite qulto12964.0 5364.0 13532.0 ahouse ahuu alouse 5532.0 house lousehuu 10884.0 11016.0 party llilrty11428.0 11836.0 Bay Day11716.0 5551.0 View 12148.0 12820.0 cottage 12696.0 cottageMr 5764.0 5772.0 K E11508.0 5779.0 Mullen 11364.0 11712.0 llIen 12064.0 12536.0 13376.0 5787.0 13268.0 froma fromn13760.0 10412.0 n10620.0 visit Islr11080.0 6015.0 10960.0 11344.0 Tampa TtlIItIatnpa11232.0 12156.0 Her HeHo11896.0 12480.0 12580.0 6040.0 12448.0 13172.0 Crlonds13052.0 friendsregret 13756.0 CrlondsI 6224.0 regret rtgfttu10916.0 11264.0 StlI1trhtr11516.0 11972.0 11876.0 12224.0 such 12116.0 poor 12604.0 13184.0 health healthRev healthHev healthllev 10604.0 Hevllev11084.0 Kck lrkEck10908.0 hold 12388.0 services 13200.0 13368.0 theLutheran 13748.0 theLuthl 6655.0 Lutheran Luthl 10912.0 rnn 10864.0 11288.0 church chunh11948.0 6708.0 t1txt11844.0 12416.0 Sunday Sundn12304.0 SundayAmong 13044.0 SundnAmong 12940.0 10600.0 6891.0 Among 11292.0 thoSt11176.0 lurr Ihrhrr11732.0 12544.0 13036.0 holidays holldnys12920.0 holidaysare holldnysI-712.0 10404.0 7116.0 artMiss tfsslflss10664.0 Minnie hank11164.0 11456.0 lnnlt 11852.0 11980.0 7135.0 lee Lt12432.0 7143.0 Hartrldge Hnrtrl ise 12956.0 13392.0 Leo Lee13264.0 LeeC LeoeLeoC13700.0 10408.0 e10348.0 P 10516.0 10992.0 Huffman Huttmnlllluffman10804.0 llrss7363.0 12196.0 12372.0 7376.0 12408.0 12488.0 12668.0 Oeteen Osteen13244.0 andCale 13732.0 andralt andalt Cale ralt10532.0 alt 10760.0 10904.0 FrukFrarik11536.0 nnd11400.0 7584.0 Had Hnd11828.0 12384.0 7592.0 Yearwood urwoodtarwood12232.0 Stet 13204.0 Stetson StetSoil son SUIISoilN Morris Morrisi 12056.0 Morris11tss 11592.0 iorrl iorrlI 11964.0 8071.0 10596.0 118311tss10344.0 Flora Plora10956.0 11800.0 lorlls11596.0 11I1Hrotumcd12800.0 returnedrota8163.0 8323.0 trulII10472.0 rota 10784.0 npleasant pllnsnnt11988.0 12444.0 lt 12752.0 ot13116.0 several 12904.0 severalmonths 13728.0 severalI mOllths11004.0 frllluts12212.0 htAtlautn12352.0 13156.0 Savan Savannah 13680.0 13692.0 8567.0 nah 10812.0 mill10692.0 JatkonlIIlJacksonvilleRev JatkonlIIlIhJacksonvillellev-1040.0 10584.0 llev10888.0 11424.0 Hedrlck Hldrlckliedrlck11528.0 preached preaihedIrtallwd13472.0 8947.0 hW hidhWfirst 8955.0 hfirst 13564.0 hidfirst 10824.0 9188.0 sermon Strmol11440.0 11756.0 Trinity 11668.0 12428.0 churh13084.0 Uti12992.0 13364.0 13260.0 Sundn 10400.0 day dn 10844.0 evening lvtnln10580.0 11644.0 11488.0 12292.0 appreciative nppreclntire9427.0 alllfl 12764.0 12732.0 12872.0 lntlp 13476.0 auaudience ant anthence 10392.0 thence diencedllnlI11244.0 10924.0 IIldrlkHendrick11476.0 11908.0 9620.0 replaces rtlllntHMrHyatt 13248.0 IrH 9823.0 Hyatt 9847.0 ntt 10524.0 9836.0 972.0 11764.0 temporarily tlmporarlly11628.0 lu13148.0 13016.0 chargeof 13708.0 char charat 13516.0 10051.0 at10636.0 Cedar Cldar10540.0 Keys 11116.0 Kl 11664.0 tI 11408.0 10064.0 churchWe -556.0 churchrt church1e10568.0 1e10316.0 rt ret 11552.0 hear henlthnthint12172.0 12716.0 MIls MlnstinsIXKMM Imn13088.0 IXKMMJackson ImnJacksoll eon 13656.0 13600.0 aJackson 10504.0 Jackson Jacksoll10512.0 11036.0 suffering surrtrlnsttffering12264.0 10520.0 frum10560.0 ao10539.0 Miscvss bHCStlhscess12952.0 Miscvssin 10576.0 bHCStlin hscessiii10380.0 iii10660.0 10728.0 tilt11052.0 head 11420.0 10772.0 11236.0 11224.0 She 11952.0 10780.0 11956.0 12124.0 left llft10764.0 yestertfy yesterttylshr 13336.0 13048.0 10791.0 13032.0 13096.0 Ly 13484.0 rorrortht 10951.0 tht10996.0 10632.0 hospital 11540.0 11412.0 St 11700.0 12176.0 Augustine AUgIlHthHAugustlne11992.0 wlllrnwhereher wlllrnhr hr10776.0 mnnr10648.0 11348.0 11187.0 friluds11212.0 hope hOllt11195.0 she HIll12968.0 12836.0 13108.0 find hHIfluidfindspeedy fluidspeedy hHIHlltld 1092.0 speedy Hlltldrelief rtlIlt10936.0 reliefThe rtlIltThe 10552.0 11632.0 11635.0 ChrlHtmas10872.0 11904.0 tree trtl12220.0 tilt12464.0 12808.0 hall hnllhalllast hnlllaHt 11856.0 laHt11860.0 night 10668.0 11316.0 11900.0 nn12040.0 unqualified 11924.0 11903.0 un 12252.0 12228.0 uallfld 13076.0 11911.0 success successin HUC 11916.0 13344.0 e88 e88In 12080.0 12123.0 lIr 11028.0 way wa 12088.0 hail12131.0 13228.0 12136.0 lvrneverso 13340.0 lvrso tastefully taHtlCul112320.0 decorated dlorntltlalecoratet13328.0 lrlotreewith 10848.0 10724.0 11148.0 runny12576.0 JUan 11708.0 gifts glft11492.0 candles candllis12076.0 12551.0 12856.0 12587.0 Iut Gilt glit13208.0 glittering gilttering 13664.0 12619.0 tering tlrlll 10860.0 10968.0 ornaments ornauncntsornam 11512.0 12804.0 nts 12016.0 12771.0 presented Ilr8lutld12932.0 a12816.0 beautiful 13132.0 beauti hllUtlhllUtlful13644.0 ful 10708.0 sight 12991.0 Till11832.0 waa12128.0 crowded cruWtd13540.0 totne totile totae tile tnetae13251.0 doors doorNeven etn12412.0 liumdh1K13259.0 room roombeing roombein bein 13455.0 It13479.0 n11072.0 premium prorulull111260.0 HeY KevRev12108.0 12828.0 HSistrunk Sis S1813640.0 S18tnmk trunk tnmkcalled call1d11600.0 tho12000.0 nutllN1cl13196.0 ordtrorderand 13648.0 ordtrand 11120.0 Collowlngprogram Irogrnm11892.0 12812.0 13932.0 wnsfinely filHly13120.0 finelyrendered filHlyrendlrld 14111.0 rendered rendlrldrenderedSong rendlrldSong 14344.0 Song SongPrayer SongPra Prayer PrayerResponsive Pra PrayerItesponsive 14604.0 lr lrUClipOnlihl 956.0 Responsive UClipOnlihlItesponsivereading rendingrendingRecitation 12192.0 11564.0 readingRecitation 14827.0 tllng 11688.0 tllngRlcltatlon Recitation Rlcltatlon11680.0 Glad Glud12208.0 Tidings 12048.0 12248.0 rldlnglinIIiAlo ridlugsrlrssiorldlnglinIIiAloPrice ridlugsrlrssioPrice-1432.0 13144.0 HoBHlo HoBHloPrice 15239.0 Price t1 t1Hlcltntlon 13280.0 aHecitatlon 13584.0 15255.0 CRecitation HlcltntlonHecitatlon11676.0 Gifts GlH11360.0 lift JIvinoNnnnie 11984.0 JIvinoNnnniePrice -1476.0 Jllvlno J1hhw-1472.0 Vnnnlo VnnnloPrice 13312.0 nnlo nnloPrlrt 15687.0 PrlrtPriceRecitation PrlrtItfrltntlnll PriceReeltatlmt 10496.0 15836.0 ItfrltntlnllReeltatlmtLet Ilt11976.0 12052.0 hf Hells nt1I14IlellsRing lUngOut Ont13240.0 On 13592.0 13828.0 xmlns:ns11 ID21 14420 3476 10212 16136 ns11:type 16136.0 Their flairThf 16175.0 10640.0 Joy loY10880.0 toyNeva 11124.0 Neva fn Huslmnd IhlHhulIIIIlushandMela NldaIdn 13288.0 16148.0 flirt BlrtHlrtBlrtSong 13588.0 HlrtRongflrry flirtSnag 16364.0 Snag1196.0 Rongflrry 10896.0 11188.0 Merry 1lerryNinas XmnNNinns12376.0 Bells I1f1IIhellsBellsRecitation I1f1IIHtltntlonntrtti hellsitecituttionCits 16587.0 Htltntlonntrtti itecituttionCits-852.0 JlftH 12160.0 16603.0 0111King lilacKingRecitation 111I 111IHfCltntfouI1or lilacHeel 16812.0 HfCltntfouI1or Heel -1436.0 tatioal 11752.0 16851.0 Ihotho12512.0 ChrsthrttChlil Chl1ChlilSake Chl1Rnk hild hildSake 13624.0 10296.0 17035.0 Sake RnkSakeSong 10696.0 SakeSangIVavt 17260.0 SOllgWIIl SangIVavtWave 17263.0 Your YOllrfour11636.0 Branch I1rnnrhfMHrrtnchrs12144.0 BranchKicltatlnn Hrrtnchrstt 12844.0 10480.0 17488.0 Kicltatlnn 17504.0 17531.0 tlnnTh1 eitatiouIho17528.0 -1236.0 10800.0 tn XMHIH Nnuts12204.0 17523.0 fIIati 12168.0 17491.0 Guests OllllftluestsGuestsRecitation 12712.0 luestsltetItatIon1hig 13192.0 IftfIltntlonHllIg 17707.0 17712.0 tfIltntlonHllIg ltetItatIon1hig-1532.0 11320.0 12516.0 lh1tin17715.0 1ItIIH17756.0 rurfurforXmnH 13620.0 rurXII1 furXrnnsVVeaithi 17932.0 17935.0 XmnH XII1 XrnnsVVeaithi 10680.0 17979.0 Jo -944.0 11044.0 Wealthy Wtlllr -696.0 11548.0 tnrwoUlIYeartondYeartondRecitathut 12660.0 11848.0 YearwoodRecitation tnrwoUlIHtcltn 18160.0 18168.0 RecitathutHtcltn 10984.0 11576.0 Dorothys Ixrrothy18163.0 Ikllot -784.0 12456.0 XIIII1MXuinsClft GiftClftTeresa ClftI 1468.0 18388.0 Teresa 18391.0 I18423.0 TtjH resa1eartrnnd 1eartrnndAn Year wood woodAn wul wulAll 18603.0 18616.0 An All18611.0 uneyjted 18648.0 1I111t -924.0 uneya ted 11816.0 18624.0 treat rrlll12312.0 18640.0 watvatannounced IInllllIl1fflInnnounrcd12612.0 announcedfor IInllllIl1fflIrornnnounrcdfor13596.0 18827.0 18839.0 ror18831.0 Wednesday WllInllHIIIY1Vednesdny18836.0 nhlItnamely nUlUfh18860.0 n12912.0 18863.0 fireworks fire fir firwurkH 13464.0 13580.0 19052.0 19060.0 works wurkH19055.0 display cllHplnyfunilHhed tllrllltlhfdfamishedhy12380.0 thltinkindHess kind kltHlkindIUHH kltHl1IfoS 19272.0 19319.0 Hess IUHH1IfoS19288.0 10628.0 11144.0 1119275.0 Pearsull IfnrllllllitnrsulI12484.0 19283.0 Wentileld WlthldSVestfieldWentileldN WlthldJWlthldhWlthldSeaSVestfieldBea19511.0 10548.0 10396.0 11612.0 19747.0 19951.0 19956.0 Sea BeaInland 1landisland11392.0 Cotton 12020.0 CottonSavannah CottonSIInllnllh 10448.0 20208.0 20211.0 SIInllnllh20216.0 hi 20248.0 Deceinjier IJfltIIIJIrDecemibr2R lflKury lflKuryIn -860.0 RInrl RInrlIn 13488.0 1urly 1urlyIn 20428.0 20444.0 20439.0 10852.0 20479.0 20436.0 week wNk20431.0 tllIrIhen20460.0 wan wnltwnd20468.0 n12684.0 Iulflgtxdgooddemand IulfldfmulIl gtxddemand 20655.0 20663.0 demand dfmulIl20667.0 fancy ranT20659.0 nllIl12504.0 Iftlrfklr12936.0 1IlIulIlIlrlotnanddemandfor 1IlIulIlIlforrlotnandfor20883.0 20887.0 theoibor olllrother10832.0 grades grulhiH12216.0 Fancy FftncyFlutl 20916.0 wnKwas12584.0 firm ilrnifirmand ilrniand 21103.0 21108.0 alldOw10544.0 11008.0 21111.0 oth 21147.0 11324.0 grlulM12256.0 21139.0 tmy IUI etshilttutquotadons 12960.0 quota flllutn13536.0 quotatlonx 21328.0 21336.0 dons tlonxtl0I1Iremained rfllllnlnffIreutalntrlpractically IlrlLcthIII111532.0 unchanged unchrtngedunchrtngediatterly unchangedLatterly 12848.0 21367.0 lmflftftJ lmflftftJflattfrl 21551.0 21556.0 Latterly flattfrliatterly11064.0 thotw11448.0 market IIInrkl21583.0 wits21588.0 nH quiet fulft13316.0 hutbutfancy 13576.0 hutrnl 21775.0 21787.0 rnl 111iM10456.0 11112.0 21779.0 IIIIII21784.0 request requrtIlIIIIant21808.0 vir vtr12972.0 virscarce vtrscnree -108.0 orwnrt 13496.0 21999.0 22044.0 scarce scnreewnrt 22007.0 Mont Mmlt1nst11652.0 22003.0 sales nalenHnllM22036.0 12508.0 12868.0 rurrorforeltcn rorIltll fort 22220.0 22235.0 eltcn elgnIltll accountH IHJUlltMrternunts11720.0 22228.0 American AIJlfrlrllllAnierlcaa22223.0 inlllx 111I1IMatllls13188.0 lraIhaveen 13572.0 lraIJWfl1l havebeen 13520.0 22448.0 22459.0 JWfl1l22491.0 10616.0 22451.0 slot xlowIIIi1Iilu fllllllJ22487.0 12356.0 llHlr12520.0 12568.0 22456.0 require rJlllnrequlrerequirementx rJlllnrnfulJ4 requlrerrunts 13480.0 22671.0 mentx rnfulJ4rrunts22679.0 owing fJwlrlJauntsmainly IIInlllly22692.0 11968.0 22676.0 tll perHlHtcmw prHIKltIwCperHlHtcmwof prHIKltIwCot22715.0 rslslemico 12756.0 rslslemicoof 22891.0 22904.0 ot22907.0 Inconvenient IJlcflllvflIlf1llImiconvenlent0iia 22896.0 financial nlllwlal22936.0 litI condltlotiK ondltllullccondItlonscondltlotiKMfinwhlle -864.0 condItlons1learis ondltllullcMfflllwhilt 23115.0 23132.0 1learis 23123.0 Mfinwhlle Mfflllwhilt10768.0 11160.0 11024.0 Ii 11332.0 23127.0 11744.0 Miinill 11111111Mrnnll12368.0 projHirtloti JwJIJrtloflpnlstrtlnn12184.0 13408.0 utofhigh 13568.0 uthl111 ofhi 23339.0 23351.0 high hl11110592.0 23355.0 10388.0 grade rlUIt1IgrntlMIH11240.0 fllIl rapidly ruJlldlydoploted cfIIIrtwldeplotdoplotedTh cfIIIrtwlTh13508.0 13428.0 23343.0 dThe 23563.0 23575.0 Th 23571.0 rfJlIowlll11768.0 prkMprirs23603.0 am arebaaed lJlllffflIttsed23607.0 IUonfactor onfnetnr 13420.0 IU1tllorK 23791.0 23807.0 factor 1tllorKfnetnr23799.0 quotation quntntlntiM10816.0 lolutJOII IUII23823.0 IIr revl reisd reisdweekly 23827.0 23831.0 13456.0 13512.0 Jweekly 24019.0 24024.0 weekly wItkJr24055.0 OilFrldu JrlflnIriduu11100.0 FrlduFancy 24051.0 11776.0 sIIIUI sFancy 3132.0 24239.0 24252.0 24279.0 24244.0 tJrlrlnllVloridn2J 2924255.0 13040.0 Q3013176.0 111J Q30Fsncy 30Fancy 24459.0 24475.0 Fsncy10732.0 24467.0 Owglu Ceurgluix24471.0 GI rJlnll 24463.0 2S f2 f2Kttni ft qt29 29Ittra 24479.0 24683.0 24695.0 Kttni Ittra10684.0 24715.0 trJl chulcorhllk11304.0 24740.0 11296.0 11460.0 fJeurgltiM OfllJrIruLleorglas24687.0 21 rl24691.0 tltntrt tfChoice 13348.0 2r 2rbnl 24908.0 24919.0 Choice ltntrt bnl flft rhfas 24951.0 24943.0 runt 24911.0 luulFlnH FIttt11872.0 JKg 20Iz 20K O OI 25128.0 25144.0 Iz 25139.0 25175.0 flMO hloilmivtins OttHqft sad HIHlKndFlaK PhlltFlits12672.0 25136.0 17 IiI7QIIR QIIRIute 18 18Flno 1Ftnp 25359.0 25372.0 Flno Ftnp25380.0 Iute 25367.0 Oftn GaM01 11172.0 25395.0 25364.0 tend HulfiK 11464.0 11572.0 Fla8 Flit 11960.0 InII 11820.0 16 1G16fiV 1GC 12748.0 Ijl 25575.0 25600.0 C25619.0 tJUUJtut nunuam11048.0 25587.0 fiV 10948.0 25595.0 Ct 25591.0 low 25611.0 MIK IIU25583.0 Ruitl 25579.0 Fiats FlMatIt ff5 ff5T 13372.0 25603.0 13164.0 113160.0 26063.0 26088.0 26083.0 tarter larr1larJt26096.0 IeirIt touring tOIHIIV11888.0 Cfll12296.0 12648.0 26072.0 hv bnt1J 12928.0 boon tJlftnbemboonr tJlftntbemr13548.0 26287.0 26307.0 26311.0 126299.0 Tainiii TILlIIJTannin26295.0 liar lUyUtyHotel fluttlHolIteffortf 13556.0 tefp26527.0 26535.0 10308.0 26539.0 t11020.0 tir Ijrtrif 11484.0 Ihl UaKUiKtN KlHJtlHKueeMKUiKtNALACHUA KlHJtlHTnr 26959.0 26983.0 Tnr 10928.0 AlAUA 0ALACHUA 13236.0 27807.0 ALACHUA FLORIDA FLORIDAit FLORIDAt28351.0 28355.0 Ho riDgrow Rrady AradyRadyTake TlkoTakeMeats TlkoMeats 28716.0 28719.0 Meats 28799.0 an11724.0 Cold CGldStorage StorageMcjU StorageMCltsStorageMeats13384.0 29475.0 McjUMCltsHandled HnndlerfWlth12420.0 29487.0 Best BtatCar GiroClro13060.0 Giroby Clroby Carby 2156.0 10212.0 29699.0 Experienced Jcporfenced10672.0 Man AanAanr 10712.0 30511.0 xmlns:ns12 ID25 14140 3576 14476 1460 ns12:type 16160.0 F 16288.0 16516.0 1A 15380.0 14992.0 4591.0 17167.0 14628.0 15191.0 Full dull14932.0 15856.0 Qts15672.0 15952.0 Itsexpress 16324.0 1j 16320.0 1940.0 15551.0 32O 14972.0 17623.0 rexpress 17711.0 17456.0 7531.0 ItdPf8SS 14608.0 8087.0 express dPf8SS15576.0 Prepaid 15463.0 PrepaidiS Prepaidrhia-824.0 16400.0 14508.0 8803.0 rhia 14752.0 8808.0 iS 14960.0 8811.0 15176.0 hiRlt 15096.0 15180.0 hiphgrrade hiRhgrnde15528.0 16076.0 ride 15760.0 16232.0 cop 16072.0 co 16580.0 14512.0 Jier 14716.0 9031.0 14796.0 8988.0 dintilled distillldistilled15376.0 9039.0 15512.0 15404.0 15412.0 15643.0 Rye 15648.0 15976.0 15888.0 16087.0 Whia WhlsVhlsWhlsClY 16512.0 16152.0 Vhlstry 14516.0 key 14559.0 9207.0 try ClY14812.0 14912.0 15188.0 absoluto absolute15980.0 purity 15876.0 purityaged 16500.0 15984.0 9343.0 aged 14900.0 15352.0 mellow mullowtntl1owmullowand 16576.0 tntl1owand mellowand 9519.0 15112.0 tipo 15116.0 fi fl15279.0 9564.0 io 15204.0 flavor UIVor16228.0 16444.0 16380.0 ispositively Isposltiv positively posltiv 15320.0 ly 15064.0 15392.0 the15724.0 best 15652.0 16120.0 valuovnluovaluelor valuofor vnluofor lor14892.0 the14764.0 15292.0 monoy15164.0 9923.0 15828.0 16312.0 the16176.0 thomarket themarket today 15120.0 todayBHt 15639.0 toda todaUWJITtD todayINIAN1E0 14504.0 UWJITtD INIAN1E0nbn ON6EI15228.0 15676.0 PIlE PUE16008.0 rn 11915964.0 16344.0 ANI Ii16300.0 ANIUI 16572.0 IiIili 14760.0 10547.0 BHt UIIili115396.0 JIM IMK15340.0 15664.0 10555.0 JB15432.0 15996.0 OH15872.0 1111W 16280.0 1111We 17784.0 yWe 17844.0 14780.0 14896.0 hIp hlpship14856.0 15216.0 10775.0 direct dlroct15656.0 15612.0 15816.0 coniumors conumore15784.0 coniumorsand 16528.0 conumoreaM tonsuin 16447.0 gturd 14496.0 aMturd14831.0 thus thui14748.0 10943.0 lUI 15136.0 15220.0 10919.0 give ctvoKlvo15572.0 ciutoincra cuatoanencustoutere15808.0 ciutoincraUn cuatoanenthecustouteretheUnboaofH bonoflt14724.0 boD 15283.0 15148.0 ftt 15056.0 ot15636.0 15532.0 15772.0 15956.0 reUll 15852.0 retaUora retallars16316.0 retaUoraJlro retallarsproflt 11087.0 rproflt 11179.0 proflt Jlro 14864.0 14816.0 Evory Evorr15040.0 IJvorybottlsltguersn 15444.0 IJvorybottlsltguersnteed -1464.0 16504.0 15488.0 bottUI bottl 15932.0 15900.0 JIllWn JIllWnteed 16508.0 15936.0 16032.0 ffuarn 15999.0 teed ietd11323.0 14776.0 15128.0 11315.0 RV Rhghe 15516.0 Mtlafaotlon tlalaatloneattsfectlon15416.0 16424.0 oryour 0Jour oryourmoncy 14488.0 11475.0 yourmoncy 14492.0 your Jour14844.0 14804.0 mone 15344.0 15196.0 bo15596.0 15896.0 refundedWrite 15812.0 refunded retundldretundldWrite 14480.0 11583.0 Write Writtorfur15224.0 complete romplotecomplote15144.0 prict15832.0 16352.0 lilt uleRut16264.0 liltand uleand Rutand 14476.0 14756.0 orda14712.0 15160.0 11711.0 blank blunkblanksblanksd 15616.0 blunkI blankQts 15536.0 d14636.0 Qts 14568.0 15076.0 125 l2515560.0 11932.0 12 15796.0 Oft Qti11940.0 Qt 16252.0 IM IMAttShtpminti 16564.0 LIAll 16340.0 16384.0 NAtISAlpments 14772.0 AttShtpminti AtISAlpments-1012.0 SAlItnMnt 15011.0 Mad MaJMadeMadIn MaJIMaden16248.0 15008.0 15140.0 Plain 111Cases 15524.0 CasesNM -408.0 15580.0 Ca cSIN 15696.0 ti SIN NM14744.0 14700.0 14916.0 CI u15304.0 rni 15032.0 rniAISAMUf 15308.0 rlt rltA 15452.0 A14696.0 SAMUELS AISAMUfSAMUELSCO 15520.0 lSCIatt1IG0g8 14968.0 CO COCtlttiHOgl COChttiltO021 14536.0 13607.0 CtlttiHOgl ChttiltO021CIatt1IG0g8CtlttiHOglTHMUII 15408.0 13612.0 CIatt1IG0g8INIISSi1 14540.0 ChttiltO021T 14640.0 13880.0 THMUII INIISSi114644.0 13883.0 15368.0 MISSI 15288.0 15272.0 17864.0 Sri 17895.0 17832.0 15527.0 xmlns:ns13 ID34 12064 4856 13692 18296 ns13:type 18296.0 Notice Notlco15108.0 18312.0 15004.0 15364.0 18304.0 Tax 15256.0 TIIPAyor TIIPAyoru 18367.0 15748.0 Payers Payeri15720.0 PayeriW Payers1So16308.0 13944.0 18559.0 1So 13948.0 14124.0 14104.0 14320.0 wlll14736.0 18564.0 110be14612.0 18575.0 rtt15124.0 15296.0 thothinCollollig15556.0 16568.0 jilaoon 111100plaonnjilaoonon plaonnOH17104.0 111100lfl 18735.0 18819.0 OH13800.0 lfl 14048.0 18787.0 daten14252.0 18795.0 14128.0 18803.0 set 14348.0 14672.0 14919.0 18792.0 ojipoHlte ljlllOl4ltflnpposlttorfur16060.0 thu lhu16428.0 18824.0 purpose amrpoGpurposeof amrpoGIamrpoGoC17096.0 Isof 17768.0 18987.0 19007.0 oCcollecting collectltiKcullccUu13900.0 19023.0 tuxes axvHtILXt11i14788.0 15371.0 19012.0 duo duu15740.0 16020.0 19028.0 tux16356.0 roll rol11 16719.0 19015.0 1007 IM16796.0 1007and 16899.0 e1 e1nlld 17688.0 uand 17795.0 nlld14192.0 makliiK rrmkillinuikhng14028.0 14944.0 19248.0 aHHeHHtncnt IlKtllIl4l11tmtasseMMtnent16044.0 19240.0 at15904.0 19243.0 property proportv16200.0 propertyfor proportvfur-732.0 IJrop 16828.0 lt1 16732.0 lt1for 19459.0 fur14120.0 ItiOH UOS1tt0Y1tt0YAhtchtailoudny 14452.0 ItiOHAlachua UOSAluchunMolldny 14164.0 13928.0 19676.0 AluchunMolldny Ahtchtailoudny-1512.0 15624.0 19715.0 19723.0 15884.0 19720.0 IIIin16188.0 19684.0 Rnd16016.0 16616.0 Tun 16492.0 Tunduy 16948.0 16620.0 TUMH TUMTUMHday TUMlIu 19896.0 19907.0 duylIu Ilec13924.0 JJl noth loth10th19904.0 hillt14980.0 HHt UKt31st111071tillleford 16012.0 11107 10071007Wlllefdrd 111071II1rord 3096.0 20124.0 Wlllefdrd 1II1rord1tilllefordWednuNilny rdIlUlUIIlYVednusthty20132.0 January JAliunry14948.0 16792.0 20127.0 lot ash16688.0 lot1UOH 17028.0 20135.0 16856.0 20355.0 1UOH 14081UOHHell 14084.0 IOH IOHlIull1hurMfln 17592.0 1Itull 17668.0 20555.0 20568.0 Hell Itull1192.0 lIull1hurMfln 14436.0 ThurHilny 7hursdny20575.0 RIIIJamid15864.0 20571.0 Friday rItJny15684.0 20628.0 16412.0 20579.0 Janu JnDU17020.0 JnDUnry 17036.0 20639.0 imy 17792.0 1964.0 20775.0 20832.0 ary nrymy20799.0 2nd 14000.0 14212.0 III 14392.0 RIHJ14924.0 3rd ltd20804.0 tJOH100X15172.0 1UOHArchor 100XArcherMaalny tJOHArdlOr 15688.0 ArcherMaalny 13916.0 Archor ArdlOr-1404.0 14684.0 21019.0 feJlllluy21024.0 Jnllllnr15324.0 Cth litbGth19011908Newbcrry 17076.0 1908wlwrryIIIJKdny 1901ewbcrryluesday 21244.0 Newbcrry 14052.0 wlwrryIIIJKdny ewbcrryluesday14728.0 TueHday lldrind15628.0 16048.0 WodneudayWcdnelldnrWodneudayJanuary 17016.0 WcdnelldnrJ WednesdayJanuary 21464.0 21467.0 14388.0 21488.0 llllnry 7th 7thi21472.0 nlHl15248.0 8th Nth15668.0 1JOH JtJOHIUOlJtJOHlrtlutouThurHda IUOlTrentonThursday 1JOHTronton 21691.0 Tronton lrtlutouThurHda TrentonThursday14768.0 Thur 15564.0 15168.0 JnnuaryJnnunry16756.0 Dtli OthDtb16520.0 OthJ90R 17012.0 21915.0 J90R10081908Wlleox 14068.0 22131.0 22136.0 Wlleox WllcClxJrIIJny VllcnxFriday14468.0 22139.0 JllllllnryJtutunry16168.0 10th JOth16672.0 1008 1D0816496.0 1D08Halruo 17008.0 1008lIQ 1008I 22359.0 Halruo laturlIQ 14440.0 14296.0 22391.0 Jft MUlllnyJnllunryJnnunryKith 1llh13th16084.0 16664.0 lD08100i1008JllarklTuuHdax lD08Jlltu1ITuellulny 100i11IatWTuusday 22576.0 22584.0 JllarklTuuHdax Jlltu1ITuellulny11IatWTuusday22587.0 JunuAry16183.0 Hth 14th11th16080.0 16660.0 nOB1008ijiC nOBJaCqIlKuWdllmIlIIY 1008LuICrigMseWednasdny 22752.0 JaCqIlKuWdllmIlIIY LuICrigMseWednasdny22807.0 ijiC -1932.0 15848.0 22847.0 HHe 14248.0 WfMlii Ndny 22812.0 nllftrind16488.0 Thurs TtiurTbuThursduty Ttiurday Tbuflny 16916.0 23027.0 23039.0 flnyduty14136.0 23035.0 Jnnuary14004.0 JCth lGth16th23031.0 15236.0 15440.0 15632.0 15744.0 Ifith lfithlfth16212.0 16064.0 1008WaldoFriday 1008WnlJoJ4rldny 1008WnlauFrldny 2980.0 23251.0 WaldoFriday WnlJoJ4rldnyWnlauFrldny23256.0 Jnnultry23259.0 16472.0 IDOL16296.0 1908ftochell 16876.0 1908HfctlflIu IDOLHnchtllaSunday 3124.0 23476.0 HnchtllaSunday ftochell HfctlflIu-1560.0 15459.0 23528.0 14624.0 14820.0 23479.0 ICllldny15735.0 JnllIJnrrJnnunry23484.0 20190H 16824.0 20th 20th190X tk 17656.0 lCnmpvlIIuTu 23707.0 108 190H190X108Jarnpvlllu 14056.0 190HCnllllIIIuTllfJllflny 14060.0 23927.0 CnllllIIIuTllfJllflny CnmpvlIIuTu -1744.0 Jarnpvlllu -1196.0 Tuonday 23967.0 15200.0 tsdny JIUIU 23956.0 fY 16220.0 21nt HattHatt1u0X 17024.0 16680.0 16944.0 16840.0 t1JOH 24151.0 111011u0X11101Omnlet 1u0XOrange 24155.0 1JOHOrango 13884.0 24371.0 24375.0 Orange OrangoOmnletIIHshu UIJbtJWodnoltdar IlrlghttsWodnasdnyWodno -964.0 16144.0 dnjr 16600.0 Jan JanaJanary Jannry 16903.0 Janaary 24599.0 24631.0 nry22nd 2nd14336.0 14520.0 14664.0 190H 1HIH190X190HMolrono 14996.0 24603.0 1HIHMulrOlloThundoy 190XMEdrosuThursday 24824.0 Molrono MulrOlloThundoy MEdrosuThursdayThuriday J1Duary16656.0 24832.0 23rd 23r223rd190H 17032.0 23r 23r2190X 16924.0 24867.0 16960.0 16964.0 25047.0 1011190X190XllawthornFrlday 13892.0 25267.0 Hawtbonj UawthomFrldny llawthornFrlday14936.0 25271.0 rrlday 15476.0 15704.0 aqd apd25299.0 ape 16244.0 25280.0 Saturday BoturdQI15960.0 SaturdayJanuary BoturdQIJlUwnrr 25495.0 JlUwnrr25499.0 24th 2Hhami IUlIl14828.0 25548.0 2ith zrth2ttti15844.0 100K lOOR25503.0 100KMlcanopy 25507.0 lOORSi 08 08M 25555.0 Mlcanopy hlnJllYlcnnopySi-800.0 14888.0 Tunndfty JuCIIlClay1unsdAy25731.0 28th 28thlM 28thl1tH 28thIJ 25944.0 lM l1tHlMKvUmton l1tHYlrtttm IJ KvUmton YlrtttmFvlnstori14928.0 WwJuo WtCluolJdl1Y WMaesday16328.0 26180.0 January2Utlt 16332.0 JI1IIUOrJanuary20th JI1IIUOr9th 9th2Utlt14216.0 IOL1008Inland 14592.0 14548.0 IOLIsland 14260.0 26400.0 08tRul 26611.0 Island14040.0 tRul 14396.0 14620.0 Oro OrCUoThundAY GrgyoThuredny26660.0 -1088.0 Thursday 16376.0 26627.0 January30th JonuaryJonuary30th 30th 26843.0 lOOg nosIUOilIUOillligh 14552.0 14220.0 lOOgHlKh 26888.0 14264.0 27067.0 HlKh 111111lligh27071.0 Hprlnj Hrlnru Hprlnktrruoday -1060.0 27083.0 c1ay 27079.0 lindWed Wednoiwlay Wednaday WednnKtay 17816.0 27111.0 Tl 27295.0 noiwlay nadaynnKtayFotiruary27331.0 rul1ry 15360.0 4th ftndSlh lUIitit144a16396.0 1008W 16936.0 27352.0 7W4u 17876.0 W4u 14276.0 27528.0 oarnoutly oamlJwUy14168.0 27555.0 carne tly 14739.0 27547.0 roquont fUtlIOt27567.0 rognoi 27523.0 01116236.0 16648.0 27559.0 prop proparty 16752.0 rC1 rC1IIrt1 27596.0 27751.0 27759.0 arty ertyIIrt127779.0 owner owners14908.0 14784.0 15332.0 27756.0 atall 15208.0 27795.0 27787.0 nil tholmolre tholnolthalrsoires15731.0 16784.0 ofthU ofthl ofthug 27963.0 thug thU14020.0 14112.0 27971.0 opportunity 27984.0 or15103.0 15448.0 27979.0 jmylriK Iinyingpnying16095.0 nod16003.0 16484.0 27995.0 rotarof9tOrD16392.0 rotaroIng f9tOrDIn returning 13976.0 14080.0 13856.0 taxwi taXtJtItAXO15276.0 nit 15468.0 15584.0 28207.0 thuroby UlIJflbythurnbysave xavo28243.0 16700.0 vo 16807.0 28199.0 tbw tbatbatime 17079.0 16811.0 tbwtlmo thtlmo 16972.0 tlmo time14096.0 14676.0 28464.0 OXIXJDHO UXVHhcIuzpinM28427.0 rtlulrfld28443.0 16172.0 28431.0 makmokomaka 17072.0 maken 16976.0 28643.0 28683.0 n28687.0 trls13744.0 28659.0 14228.0 14600.0 thrr14964.0 28675.0 court genet28651.0 houietltJue15400.0 houieYOUM tltJueYoura houseYours 28875.0 Yours YOUMYoura28895.0 14680.0 15048.0 28907.0 serve xervo14952.0 rv 15484.0 15592.0 faithfully tnlthfully15384.0 faithfullyw tnlthfullyW29099.0 29107.0 UDICKINSON nICKJN80N1iCKJNSOYDICKINSONTax nICKJN80NTax1iCKJNSOYTax-1080.0 29332.0 Collector 15992.0 CollectorWILUS 16852.0 CollectorVILUS CollectorWILLIE 29547.0 WILLIE WILUSVILUS29551.0 15788.0 COLSON COLSONTax COLSONi-776.0 LS 16552.0 NTax 29775.0 16104.0 29779.0 Alrseseai 16388.0 29923.0 18452.0 30283.0


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN00034\ocr\0486b.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:20668
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.3245
splitwords:0
ScansoftOCREngine Character Count:16443
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:19631
Abbyy6OCREngine Character Count:17928
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;17928;5818;41.2752;71.0576
language:en
ScansoftOCREngine Predicted Accuracy:46.12%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:7209
ScansoftOCREngine Character Error Ratio:0.6363
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;19631;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:71.06%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:71.06%
ImgPrep Component Range:19657,20668
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;16443;10463;0.622757;46.1249
noPunctuation:1
ImgPrep Component Count Low Estimate:19657
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 20.0 ID4 24.0 ID5 10.0 ID7 31.0 ID8 22.0 ID9 17.0 ID10 14.0 ID11 11.0 ID12 13.0 ID13 7.0 ID14 9.0 ID15 12.0 ID17 25.0 ID18 23.0 ID19 26.0 ID20 47.0 ID23 16.0 ID24 19.0 ID26 60.0 ID27 38.0 ID28 15.0 ID29 34.0 ID30 32.0 ID31 45.0 ID32 35.0 ID33 18.0 ID34 29.0 ID36 21.0 ID37 5.0 ID38 8.0 ID41 54.0 ID44 6.0 Layout Page ID1 HEIGHT 31600 WIDTH 18840 PHYSICAL_IMG_NR 9 PRINTED_IMG_NR 6 PROCESSING PrintSpace 29920.0 18824.0 HPOS 0.0 VPOS 1112.0 PC 0.71059996 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1240 11484 900 1112 ns1:type simple language en TextLine 128.0 56.0 7408.0 String CONTENT 1 WC 0.8095238 1THE SP -56.0 7464.0 428.0 11484.0 900.0 1924.0 STYLEREFS 260.0 116.0 2092.0 fi 0.82539684 ALTERNATIVE G272.0 648.0 5632.0 1928.0 THE 4616.0 1016.0 5848.0 1936.0 HE -432.0 6280.0 292.0 2112.0 6384.0 GAINESVILLE GAIN1SYILLE108.0 6276.0 276.0 584.0 8656.0 1960.0 SUN 160.0 8496.0 1704.0 9464.0 1972.0 DECEMBER 0.95238096 DECEJIBERDECE1IBER224.0 9240.0 256.0 312.0 11272.0 1996.0 SO 104.0 11168.0 300.0 220.0 11448.0 2000.0 Ot -136.0 11584.0 252.0 416.0 f11 -220.0 11668.0 280.0 592.0 11792.0 190T 1907-72.0 11864.0 304.0 11924.0 O -460.0 12384.0 xmlns:ns2 ID6 28096 3692 0 2492 ns2:type 680.0 2448.0 872.0 2492.0 SSSTITUTE MERSINSTnUTESSSTITUTETO MERSINSTnUTETO-2448.0 3320.0 396.0 76.0 936.0 2768.0 r -2384.0 504.0 2148.0 1168.0 2632.0 ERSMNST1TUTE 156.0 1012.0 ERSMNST1TUTETD -2148.0 3316.0 488.0 2528.0 1152.0 3220.0 408.0 320.0 3300.0 TO 0.96825397 TD444.0 1648.0 3232.0 BEHEID 176.0 1472.0 1652.0 3280.0 BE RE-1164.0 2816.0 420.0 676.0 2136.0 3236.0 HELD HEED172.0 1964.0 412.0 688.0 2992.0 HERE 180.0 2812.0 HEREtrally HEREtlnlly-688.0 3680.0 328.0 2916.0 764.0 4080.0 236.0 484.0 4172.0 trally tlnlly728.0 1396.0 4112.0 Located LocateJ148.0 1248.0 192.0 296.0 2372.0 4096.0 the 248.0 2124.0 196.0 2808.0 Institute 140.0 2668.0 InstituteWill -872.0 InstitutevIm 2188.0 4444.0 212.0 376.0 4512.0 Will vIm184.0 188.0 1372.0 4500.0 be 96.0 1276.0 200.0 432.0 1656.0 4468.0 Well 1560.0 908.0 2180.0 Attended 92.0 2088.0 AttendedV1INENT -908.0 3088.0 AttendedSPEAKERS AttendedMI 244.0 2868.0 800.0 4992.0 168.0 5108.0 MI 672.0 824.0 5059.0 V1INENT -144.0 968.0 240.0 1256.0 NT -240.0 1496.0 1024.0 1608.0 5019.0 SPEAKERS 112.0 136.0 2752.0 5012.0 120.0 144.0 544.0 3124.0 COME 2996.0 COME3ng COMEong-544.0 3668.0 COMEWhom 216.0 2616.0 1048.0 5488.0 496.0 5576.0 Whom Wliont1660.0 5524.0 1544.0 5519.0 124.0 1988.0 132.0 268.0 2404.0 5516.0 2296.0 152.0 2792.0 Honorable 2672.0 Honorablery 3664.0 Honorableecretary 692.0 5627.0 3ng 09ong09ecretary -244.0 2908.0 704.0 5760.0 608.0 5864.0 ecretary 5868.0 ry 1312.0 1444.0 5812.0 of 964.0 1720.0 5788.0 Agriculture Agrculture1592.0 2864.0 5763.0 and 2684.0 308.0 3304.0 Con 3164.0 Conressman -308.0 3612.0 2960.0 6020.0 604.0 6132.0 ressman 436.0 1452.0 6064.0 Clark 1296.0 6044.0 ClarkMeeting -436.0 1888.0 Meeting -672.0 2764.0 2924.0 Destined DestinedProve -728.0 3652.0 Destinedprove 208.0 1856.0 6312.0 424.0 6396.0 Prove 1304.0 6352.0 80.0 1224.0 1540.0 6331.0 Great 88.0 588.0 2068.0 Benefit 1976.0 Benefitwo Benefitt-588.0 2656.0 2948.0 708.0 6615.0 6728.0 wo 36.0 6740.0 t -188.0 896.0 820.0 744.0 6655.0 months t110ltths72.0 1628.0 6672.0 ago 1552.0 1196.0 arrangements arrallgentents1904.0 3260.0 6632.0 were 3172.0 wereuade -396.0 3656.0 6636.0 wereg 2920.0 696.0 6831.0 6967.0 11 6960.0 g -32.0 776.0 920.0 6892.0 uade Iiladei1ade100.0 6880.0 for 1332.0 624.0 1788.0 6852.0 holding hpldlng1676.0 2524.0 a 2412.0 164.0 596.0 2736.0 largely large3452.0 6844.0 at 3332.0 ati -164.0 3616.0 atded 228.0 664.0 7060.0 7140.0 ded 844.0 i 1100.0 7124.0 farmers 7084.0 State 1724.0 2608.0 meeting 2400.0 332.0 7096.0 mee -692.0 ng 2940.0 3496.0 7068.0 atille 3660.0 atnf atacs 2976.0 7288.0 nf acs -148.0 828.0 7347.0 file illel11e904.0 556.0 1424.0 7316.0 During 1252.0 2064.0 7304.0 84.0 1980.0 620.0 2420.0 2332.0 340.0 7328.0 men -620.0 3040.0 2788.0 ths 28.0 2760.0 3128.0 3376.0 Iso soIsoDeccmber -280.0 sober -236.0 3520.0 7319.0 o ohtr -92.0 2880.0 7508.0 232.0 7608.0 htr ber804.0 1108.0 7548.0 December Deccmber960.0 2016.0 7528.0 1912.0 700.0 2424.0 7523.0 January Januarr2312.0 368.0 3240.0 insti instlfnstlinstiregressed -368.0 3608.0 instls fnstls2936.0 716.0 7736.0 7856.0 s 7772.0 progressed regressed772.0 1892.0 7764.0 in fa1792.0 2176.0 7744.0 various 2040.0 counties 2800.0 countiesthe countiesthl-716.0 660.0 7960.0 8040.0 thl400.0 984.0 8028.0 860.0 1500.0 8035.0 as 1384.0 352.0 7988.0 they 1668.0 2268.0 8004.0 2144.0 500.0 2784.0 7964.0 called calle2664.0 3412.0 3284.0 forth forIh fortit 2884.0 8192.0 8272.0 th Ihtit8304.0 > 1080.0 8248.0 farnwIs1848.0 8216.0 1700.0 8204.0 2004.0 632.0 2556.0 2408.0 3344.0 8224.0 see sec3188.0 seeAs -256.0 3600.0 seel 2932.0 8412.0 8536.0 l 8532.0 19 -24.0 992.0 8476.0 As 756.0 1284.0 8492.0 1176.0 988.0 1488.0 8428.0 culmination 1368.0 2596.0 8424.0 or2476.0 448.0 2876.0 8415.0 these 3444.0 3324.0 init -152.0 3596.0 intutt intut 3028.0 616.0 8640.0 8732.0 tutt tut888.0 8744.0 52.0 836.0 916.0 8748.0 < 948.0 1064.0 8704.0 it 68.0 8720.0 V 1412.0 8712.0 1352.0 1696.0 8708.0 1584.0 8664.0 happy 11a1l11Y344.0 2512.0 8648.0 idea 2392.0 2972.0 8652.0 to 2856.0 388.0 3256.0 have 3136.0 haveliars -388.0 3644.0 1m haveIarc -192.0 3448.0 3560.0 8680.0 e -84.0 eIan 3076.0 564.0 8824.0 288.0 liars 264.0 8943.0 Ian Iarc852.0 996.0 8920.0 K tVI -120.0 1116.0 1272.0 8888.0 attended 1028.0 2132.0 8872.0 central 760.0 8868.0 institute instituter2728.0 institutewill Institutelet-760.0 3640.0 instituterlet 3000.0 644.0 9096.0 9156.0 let 9131.0 will 808.0 9176.0 tt -276.0 1240.0 1096.0 III ill48.0 1388.0 9108.0 held 1564.0 2192.0 2036.0 2488.0 9100.0 this 2336.0 324.0 city 3404.0 3264.0 forJn foref foree9323.0 9420.0 ef ee868.0 9372.0 Jn In768.0 aas -156.0 1140.0 9408.0 s-60.0 1200.0 752.0 1340.0 9347.0 February 9356.0 Fl -752.0 9391.0 -8.0 1508.0 brual 1536.0 2184.0 9384.0 9335.0 5 j-76.0 2264.0 9328.0 G 2572.0 2484.0 7 7t 3048.0 2952.0 9576.0 9652.0 9636.0 HIP the736.0 111 1040.0 9619.0 first filstbrat204.0 880.0 9591.0 suggestion 1460.0 2552.0 2444.0 2716.0 3552.0 an -88.0 atr ar 9816.0 9908.0 n 64.0 9884.0 + 652.0 668.0 tr -28.0 9896.0 -48.0 9856.0 I11128.0 9840.0 2032.0 1808.0 572.0 2520.0 9820.0 matter natter2292.0 3328.0 was 3092.0 wasto -312.0 9844.0 wasl wasat1 2984.0 656.0 10032.0 10088.0 at1 732.0 10135.0 -104.0 10072.0 d tl10079.0 1060.0 508.0 10064.0 Mayor Iaror1308.0 10044.0 Thomas 1920.0 10039.0 2688.0 3196.0 other otl1lrotherr otl1lrftotherrt-444.0 1968.0 1620.0 10260.0 10272.0 citizens rltlzens2364.0 10264.0 2244.0 944.0 2644.0 Gainesville Galllesvll1lGatuesville2532.0 Gainesvillevth Galllesvll1lthGatuesvillet-944.0 3588.0 924.0 10295.0 10351.0 612.0 10340.0 636.0 10344.0 ft rt792.0 10356.0 v h740.0 560.0 ntative utntlnutatiV848.0 2964.0 10487.0 10592.0 10516.0 vth oth1076.0 1220.0 1408.0 10508.0 their accustomed 1796.0 3160.0 vigor vigol2956.0 vigorU vigork-428.0 vigolkh 10708.0 10768.0 k 10760.0 kh U -68.0 540.0 10752.0 maturmaUlI1716.0 ui UIIup1636.0 10732.0 1896.0 2232.0 once 2704.0 10715.0 2620.0 532.0 3096.0 united 3004.0 10712.0 unitedar unitedtounitedart-532.0 3628.0 580.0 10940.0 11011.0 10999.0 art -132.0 712.0 10984.0 10959.0 make lIIalte1884.0 10944.0 1768.0 2308.0 3104.0 10976.0 2988.0 10971.0 sue suc3200.0 suepS -268.0 3584.0 suces 492.0 11236.0 pS pSfo1 -200.0 11336.0 fo1 11428.0 01 es-196.0 11447.0 11452.0 -52.0 952.0 11404.0 speakers tlJPilkt932.0 1588.0 1784.0 11436.0 rs 11396.0 724.0 11391.0 National atlonal2060.0 3032.0 11400.0 reputao reputta2904.0 3036.0 reputa leputareputt-540.0 3576.0 11616.0 11684.0 a11680.0 0t 0928.0 1044.0 11635.0 being IHlngbehlg796.0 11623.0 secured spcured1476.0 2272.0 11628.0 complete 2432.0 3372.0 thern thear 4.0 3688.0 11663.0 Io -4.0 3692.0 3068.0 11836.0 11907.0 -64.0 720.0 11900.0 rn -36.0 rt -80.0 1000.0 1244.0 11856.0 The Tht628.0 1664.0 11851.0 1548.0 11844.0 2680.0 Gainesvillee Gainesvillert-948.0 3208.0 11952.0 12128.0 re reur 552.0 12135.0 12148.0 12015.0 fig 876.0 1180.0 12076.0 everything plrythlns12067.0 possible 2056.0 IlOssl -680.0 2828.0 le 2564.0 452.0 3176.0 makeMtors -452.0 makerhors 3684.0 Ir 12287.0 12351.0 ur urlay -128.0 576.0 12323.0 rhors 12332.0 Mtors itors-420.0 12292.0 comfortable omfortable2536.0 during 404.0 3224.0 tholrtheire tholrttheiray-404.0 468.0 12515.0 12552.0 lay 12576.0 ay 12560.0 tn780.0 iG 12571.0 40.0 12583.0 t1104.0 44.0 1068.0 1208.0 12527.0 1612.0 12520.0 making 2340.0 them 2220.0 392.0 2872.0 wish 3392.0 foroftunlty fornt 12747.0 12804.0 nt 12756.0 oftunlty ortUl1ltyIortnlity1596.0 12759.0 1512.0 512.0 1824.0 return 1744.0 12752.0 returnG returni-512.0 13008.0 13027.0 13064.0 832.0 sille 856.0 h iIIl Ill -212.0 1344.0 13052.0 13043.0 tvas2140.0 chosen 1908.0 because 2712.0 becauseIf becauseebecausef3620.0 3212.0 13207.0 If 480.0 13252.0 f -44.0 524.0 13336.0 840.0 13308.0 1120.0 13231.0 cpnt1a1location 1684.0 13228.0 enabling 2584.0 enablingfrom enablingr-736.0 3060.0 13456.0 13508.0 1088.0 13463.0 from 464.0 all 1456.0 2208.0 parts pnrts284.0 2912.0 2636.0 3356.0 3072.0 the3tu thetilt thetat 13679.0 13703.0 tilt 3tutat13712.0 i1 -40.0 13684.0 reach reaeh892.0 13719.0 1228.0 13724.0 ch 1264.0 1672.0 2044.0 meeUng372.0 2844.0 with 2724.0 3352.0 3216.0 thensnible -260.0 thea 3508.0 theeast 3632.0 3120.0 13900.0 13951.0 ea 13935.0 east 13911.0 nsnible Insslblisslblt1448.0 884.0 1572.0 annoyance al1l0rancettmoyance2720.0 13904.0 2456.0 wide 3044.0 widecitizens 3564.0 wideWai wide1h3080.0 476.0 14127.0 14176.0 Wai 14184.0 1h 14200.0 912.0 14139.0 hltizrns14144.0 1ft -608.0 1520.0 IZI 14167.0 ns 14132.0 1868.0 Gainesvlllual ali ala3556.0 14172.0 IIli1h 3100.0 14355.0 14404.0 14400.0 14360.0 tile iiliIli1htlIPirvisitors lsitOlS1776.0 2676.0 feel foelfcel3116.0 under 1IHlel2968.0 underasM4 -488.0 3604.0 underas 3168.0 1IHlelas 14580.0 14608.0 asM4 14623.0 14632.0 14627.0 obligations obllgatiaas972.0 ohllga -888.0 1860.0 1468.0 14587.0 lion 1440.0 1764.0 therm2832.0 14583.0 2692.0 3204.0 thelltheirhospitality thellar theirZtr14803.0 14840.0 Ztr864.0 hospitality hIJltallljhospitalityfart hIJltallljfaet-864.0 14808.0 hi 1268.0 iitullty 1124.0 3012.0 15024.0 15036.0 fart faetfort600.0 316.0 15028.0 that 1740.0 15031.0 University 2168.0 3428.0 ofFl -160.0 ofIr ofand 3192.0 15252.0 15256.0 516.0 15312.0 15287.0 15296.0 115259.0 31HI1328.0 tilt1232.0 980.0 Experiment xllmlmenti7xperimeut1576.0 -980.0 2652.0 2740.0 Station 1032.0 1708.0 3440.0 ofFlorida ofjolnrld ofFlortht 15475.0 Florida jolnrldFlortht15512.0 art1156.0 15516.0 1148.0 located 15488.0 1840.0 2152.0 15479.0 thus2080.0 2544.0 15484.0 place 2468.0 makes makest makesSt3592.0 15688.0 St 15711.0 536.0 tf15756.0 15759.0 15704.0 nclal prlnlrctulinterest 11ltpn -632.0 1864.0 15716.0 st 15707.0 attraction 3436.0 totil toII top 384.0 15923.0 til II p15927.0 15956.0 tWns 15960.0 zoiis -324.0 Zl -296.0 1212.0 -12.0 15963.0 15932.0 tho the2100.0 15935.0 1944.0 2744.0 especially pelallrespeciallym pelallrhespeciallyh-848.0 15967.0 3148.0 16139.0 16155.0 110 ho16183.0 m Isiimiged fllflgedcaltgeI16152.0 iu in1004.0 2576.0 agricultural agrlultumlagriculturalFrank agrlultumlFrankagriculturaliur-1004.0 3580.0 16399.0 16404.0 iur 16423.0 16643.0 Frank 16648.0 1320.0 2028.0 Gets 16652.0 Busy 2396.0 Busyr BusyIhlBusyrr2928.0 16892.0 rr 16927.0 956.0 16932.0 x 16904.0 HH Ihl1111energy el1llgjetlerg2276.0 16899.0 2696.0 16908.0 urgent Ulglnl3368.0 16936.0 so 3252.0 soi -168.0 3536.0 soh soIt 17103.0 Ih Ihlo 17124.0 It17155.0 a17159.0 17127.0 uf1380.0 Hon 11011iIon1260.0 1880.0 Franlt456.0 2500.0 2380.0 memi metnIt3132.0 mem metn3528.0 Ihn 17347.0 17375.0 It17371.0 568.0 17380.0 nuress ollre5317383.0 tJn rtti 1144.0 1728.0 who wlle17352.0 Is 2048.0 always alwarsawake waiteawakeiiiHiTinent awaken waiteIttltNnllnl 17568.0 lo 17596.0 17587.0 17575.0 iiiHiTinent IttltNnllnlInttrrulnt17580.0 mul1780.0 2288.0 Interest 2164.0 2944.0 17572.0 theFlorida the1lorlda theII 17800.0 17819.0 17831.0 Ili 1lorlda1316.0 rida -320.0 thorfe thocthoehl940.0 2640.0 attendance attpl1danceattelldauce2540.0 attendanceitltutlon -940.0 attpl1danceutltutiOll 2592.0 18023.0 18063.0 itltutlon utltutiOlltitution-20.0 1828.0 18059.0 -284.0 1876.0 2228.0 18028.0 thl2624.0 pleas IIleaspleasiiurmg -424.0 IIleastarl1l pleasIs 18251.0 18260.0 iiurmg tarl1l -604.0 18279.0 arutg 18284.0 address addresRby hj336.0 3184.0 18255.0 IIOll3024.0 lioni IIOllflionr-336.0 18471.0 18504.0 18500.0 r1188.0 tf1336.0 1492.0 18476.0 A -960.0 2452.0 Ilcllll1le 2600.0 Wilson 14IIson3396.0 18507.0 asn astI-180.0 asdJr 3180.0 18687.0 dJr 1052.0 18739.0 tI 18732.0 1132.0 1428.0 18695.0 its Lts18699.0 accepted IWClltedCOliCoifConimitation COliilltallull Coifimitation -316.0 3516.0 18920.0 788.0 imitation illtallull18927.0 His 360.0 18924.0 visit 2588.0 18960.0 upon Ullon3056.0 uponill 3568.0 UllonI 19131.0 19195.0 1204.0 19180.0 ul 19175.0 w 1568.0 19143.0 ill dl1516.0 1812.0 jio 110no472.0 2096.0 19147.0 doubt donbt460.0 prove love2568.0 3228.0 19155.0 3480.0 19183.0 naaluo aHI 19363.0 19368.0 HI19419.0 1092.0 value aluoyaluu1288.0 19375.0 19371.0 2160.0 fal11IfrSfarmrs3308.0 ofT 3572.0 19579.0 19603.0 T 19628.0 19595.0 standpoint FtandpointFlalldllolnt1680.0 19600.0 19591.0 practl Iractipractluiltiri -484.0 3512.0 IractiI practlri19807.0 19831.0 ri 19828.0 uiltiri uiltirii -552.0 liar liarna 2604.0 20035.0 20072.0 20067.0 na z is -116.0 1640.0 copy 1732.0 COI -376.0 20048.0 lho2848.0 20044.0 letter IttfrletterintjrftHsnian lettert 3624.0 20088.0 j +2612.0 20260.0 20300.0 976.0 C 20276.0 -100.0 1400.0 20291.0 ingre 1404.0 intjrftHsnian 20304.0 -936.0 rsnH11 1528.0 snap 20271.0 C18rlt2460.0 I1l 20279.0 20267.0 ther 20295.0 20483.0 20504.0 20515.0 tIIHIlf20492.0 elate datodate1712.0 2384.0 20495.0 Dcremtwl2548.0 Decembertf DcremtwlIrDecember1r-852.0 20640.0 20967.0 20987.0 tf Ir1rArlcul1Ule2772.0 20975.0 WuslihiR 1Vaslilug2560.0 WuslihiRD 1Vaslilugi-744.0 Wa 3140.0 llin llinI -264.0 816.0 21184.0 21227.0 1008.0 D 1-112.0 21199.0 1056.0 21191.0 C1C1tvir C1ar 21407.0 tvir 1ar21415.0 MV Mr-140.0 21419.0 Secretary SecrtarSecretaryYotn -808.0 21424.0 You Yoll3108.0 willr willJ-300.0 21635.0 21668.0 J 1172.0 thitIhll1036.0 1604.0 21647.0 ht21675.0 company cmpnn1748.0 cotitlt 21679.0 fly 2328.0 356.0 21651.0 CunConi ConIIICunt3504.0 21860.0 21895.0 21907.0 -16.0 S 21928.0 aii 21867.0 UIHlLIlI -172.0 -696.0 Icrn 1524.0 21900.0 21903.0 u1932.0 2108.0 21863.0 ullod11110121884.0 tn21915.0 MH Ht2980.0 3272.0 you yellyellt -288.0 21912.0 ou ouji 22088.0 22111.0 ji 22131.0 t22119.0 sint 1348.0 hIt -184.0 1532.0 22107.0 ty2020.0 22091.0 tender tntor22128.0 1I1l in3360.0 22100.0 In Ini Inrn 22311.0 22351.0 22323.0 22344.0 IM 11111432.0 IrofI 348.0 1436.0 Irof Prof-348.0 22315.0 1p 22320.0 H 112024.0 2440.0 Holfjs Holfillolfhdlreet dlletdlreetKp -496.0 dlletI dig 22339.0 et etl 2756.0 22527.0 22543.0 Kp -304.0 1480.0 22564.0 548.0 22536.0 riinent rhueut22539.0 Stallonthlthatheof thlof thaaf -216.0 22752.0 af22755.0 Plorldnhlorlda22783.0 22764.0 jahu1oilIIe2436.0 Gainesvilleuttind 22767.0 jahu1oilIIe1 Gainesviller22975.0 22980.0 uttind tttnd364.0 23015.0 it23020.0 22987.0 Invention ronventlonconventimi22991.0 22996.0 farm farmh farmIItld farmheld 23196.0 IItld-328.0 Id 23240.0 23215.0 1816.0 23207.0 Gaimi 1820.0 GhuJIYl1le-360.0 23212.0 vlllc Fla 1laIa 23252.0 on 011oniiid 3548.0 011ltd onnil 3544.0 23419.0 iiid ltdnil23423.0 1216.0 23440.0 23428.0 day 1I1lldays-776.0 23475.0 hrllul 3384.0 23447.0 Ar 3500.0 -96.0 23919.0 23923.0 1136.0 23944.0 MW alwnew23928.0 lnder tnllor2316.0 ndcr 1832.0 23951.0 jOIl23931.0 form forulformaHIM formIlId forulj1 24135.0 24139.0 j1 24160.0 aHIM 24163.0 IlId24147.0 l24195.0 1844.0 24191.0 e24175.0 ray 2304.0 24144.0 thnt24167.0 not only onlyHolf -352.0 3540.0 24187.0 onlybut 3416.0 -108.0 3524.0 IHeM 2732.0 24343.0 HeM Holf24355.0 hut but1804.0 24367.0 tltu24371.0 entire nUnfarming fanningfanningn farmingilfarmingn-664.0 24575.0 24611.0 ilut24623.0 1356.0 24583.0 24599.0 te 24615.0 1736.0 1852.0 24587.0 24604.0 t8te 2284.0 24595.0 24592.0 IB 18is3292.0 IBirons 18rIJIII isirutiM 24799.0 irons rIJIIIirutiM1420.0 24803.0 uftuning bIngbtitl24848.0 2216.0 24851.0 QII24839.0 accept ACCtllt3296.0 24823.0 tilltheIh tillI 25280.0 25319.0 125315.0 IxTMno brkne25296.0 mown Vnotritblo1u1760.0 25311.0 pretty prfU25339.0 gen RtnRtnrotixtiout -292.0 25343.0 gent 25348.0 Tl TlI 25503.0 25512.0 t25535.0 rotixtiout OUXlloutrou 1360.0 hJllt 25519.0 Uic440.0 25527.0 2780.0 thin thlllthis3112.0 thini thlllIthisp25731.0 25771.0 25787.0 ii 1192.0 25768.0 25743.0 1644.0 25735.0 he1940.0 25747.0 tendered Itndorcl2796.0 25779.0 rou25756.0 alldslidslidIIprs 3244.0 andl alld1IIH 25955.0 25979.0 1IIH 528.0 IIprs 25984.0 25991.0 rtj rshav hlvhitVA2120.0 25967.0 tnken tnkontaktn2700.0 25975.0 It 26003.0 up 3248.0 nudandrfa nudf 26160.0 3 26167.0 rfa rf 1292.0 26191.0 26188.0 unanimity utanttnity26195.0 26231.0 nrn arIRr 26203.0 inn Ity 3456.0 26415.0 26419.0 y 26427.0 26435.0 your 1416.0 Ullr 1692.0 1772.0 26444.0 ac 26432.0 epUnc CPlllAncteptance1948.0 380.0 26455.0 yourujH -380.0 yourtlon 3276.0 our ourt 2156.0 26627.0 26659.0 26655.0 ujH tlon 1324.0 26676.0 1504.0 Uie-252.0 1956.0 26643.0 convention CfHlNIUoncrmventiouconventionH CfHlNIUonHt-920.0 crmventiouattrM 26892.0 26907.0 attrM 1556.0 Ht 26920.0 26927.0 -124.0 rl or26895.0 J1 -600.0 26899.0 F 26904.0 flda irlda26935.0 26939.0 are AftarP2196.0 3016.0 26947.0 ex f6XcxcxInfllltgent exlv f6XI 27091.0 lv 27103.0 Intelligent IntlltgNtInfllltgent2128.0 27119.0 rI1992.0 claa 2260.0 27159.0 Bi 27131.0 people IfOOrl11IOtle2824.0 peoplev IOtlesir27303.0 27347.0 27352.0 sir27327.0 fully folly27343.0 nrjvlh hI1 adtbld2248.0 or2776.0 tlU27375.0 great greatwhich greatw rent renttlCh 27539.0 which tlChhtrh27559.0 -456.0 1392.0 27579.0 jOUyoa27555.0 ha -384.0 27568.0 don lnndone27575.0 theirf -416.0 27744.0 27755.0 iurr lnr Iu 1300.0 27799.0 ymt27807.0 Otl 27779.0 27835.0 27791.0 ir 2012.0 IKMII 2416.0 27827.0 u 2504.0 27803.0 Itat27787.0 thtttl 3156.0 ho hffd trtlhffdt trtli-392.0 27971.0 27995.0 27999.0 812.0 iKpnrtniont JJlftftmff1t28011.0 vpsrtnllnt -856.0 28007.0 Apiculture Agriculturelcultur -648.0 28023.0 Re noIk28019.0 Rewitlj nooQ1rKRnt Ikronr 28215.0 ronr 28223.0 oQ1rKRnt 28232.0 rsant 28227.0 witljwltb28267.0 2236.0 28272.0 2660.0 28239.0 work ork 28247.0 andthat AndIt andIi28395.0 Ii28408.0 whirr -228.0 28420.0 28471.0 28479.0 28488.0 28459.0 748.0 28455.0 thorough tborough28495.0 famY tymrsym famtym-332.0 symwith 28643.0 28655.0 Y r28671.0 overythlniflrythln2224.0 28683.0 tends tendM28704.0 3460.0 28723.0 arment afntEnt atment 3020.0 28843.0 28875.0 rment fntEnttment28880.0 28891.0 lhl28908.0 condition dtUon 3288.0 thptheltaral thernltnral IrultQraJ 29067.0 rultQraJ rnltnralltaral 29103.0 classo clarsetrb 2172.0 29124.0 29127.0 Insist Inlsttngist3348.0 29163.0 onfwnlni onV 29139.0 29239.0 29275.0 V29315.0 fwnlniT fwnlni tOmlnlotQinK-448.0 otQinK7Pr -492.0 IT 29447.0 520.0 29495.0 7Pr 640.0 29507.0 bfT 29547.0 29563.0 tare29584.0 erc pxr29587.0 Zei edlngljr tdingy29567.0 lnltb 29579.0 anxloua IUlxlouanxlountoTOU toCtit toct 29720.0 ct Ctit -204.0 29747.0 29735.0 29763.0 Tea TOUrou1072.0 29751.0 la to29791.0 Pen perwpercoa1632.0 29815.0 oa -208.0 29803.0 29795.0 listen IIltenpaten29811.0 29835.0 anfrom anr 29891.0 29967.0 29979.0 fU 1376.0 30004.0 rom 30023.0 rou30011.0 IA30047.0 2348.0 30015.0 2888.0 30055.0 name nametJ -472.0 3484.0 30019.0 IJon 30127.0 tnerT 30199.0 tJ 30211.0 iCMJ 30223.0 30195.0 W thla 1624.0 30220.0 30231.0 dtaJc 30235.0 Jon 2324.0 30271.0 2892.0 30239.0 desire dNlredeSlredNlretie 30415.0 tie xmlns:ns3 ID16 14460 3508 3720 4640 ns3:type 4540.0 4640.0 6436.0 4940.0 4860.0 iTILE -232.0 6668.0 3816.0 5852.0 TlfETILE4464.0 UREST SUREST4320.0 5600.0 WAY 5472.0 6360.0 6216.0 TOFOOL 6680.0 5856.0 4384.0 6296.0 FOOL 5168.0 6304.0 5032.0 5480.0 PICKPOCKET 5328.0 PICKPOCKETIs -1720.0 7200.0 3808.0 6848.0 4244.0 4012.0 4680.0 6916.0 carry 4448.0 5468.0 5240.0 1280.0 5816.0 checkbookDont 5568.0 5820.0 checkbook chuckbookchllckbook-1276.0 chuckbookDont -1280.0 7100.0 chllckbookDont 3800.0 7160.0 Dont 4724.0 7228.0 cany4460.0 5592.0 5280.0 6432.0 7164.0 6112.0 6584.0 wad pact6468.0 pactaroundl -572.0 7156.0 6588.0 wadaround -568.0 7016.0 3792.0 7476.0 784.0 around aroundl4676.0 4576.0 5252.0 7540.0 5160.0 yonit yoult-412.0 5664.0 5944.0 6100.0 6240.0 may Il1ny6088.0 6856.0 7500.0 got getbet6704.0 gotlost -340.0 7196.0 getlost betlost 7788.0 lost 4408.0 or 4188.0 4852.0 stolen 4628.0 5872.0 Bank 5504.0 7852.0 6476.0 yourmoney -516.0 7188.0 youroney yourLoney 3388.0 3784.0 8103.0 8168.0 money oneyLoneyaudl4548.0 5144.0 check 5048.0 5880.0 5780.0 8136.0 out 6028.0 6576.0 8171.0 us6480.0 6888.0 8176.0 6788.0 required 7080.0 7108.0 3788.0 quired Nothing otllingN -932.0 5792.0 5908.0 like 5052.0 6428.0 8420.0 paying 6320.0 payingyour 7180.0 8483.0 3780.0 8724.0 8792.0 4400.0 bills 4308.0 4968.0 8727.0 4856.0 5380.0 5236.0 6024.0 6608.0 gives giyes6452.0 givesyou -560.0 7168.0 giyesyou 9023.0 4200.0 4292.0 9104.0 9039.0 receipt 5364.0 every eyery6076.0 9044.0 time tiIne5968.0 timeOpen -480.0 6556.0 tiIneOpe 9076.0 4052.0 9352.0 Open Ope4740.0 9388.0 annccoiuit 4636.0 -1244.0 5984.0 account HCCOllJ1t5000.0 6160.0 6816.0 9428.0 us u5usit 7036.0 u5it 9664.0 9668.0 4124.0 3948.0 4720.0 teach 4528.0 9736.0 yon5296.0 economy 5884.0 economyhelp -992.0 7224.0 9848.0 3380.0 9983.0 help 4428.0 4272.0 5088.0 credit 5892.0 9988.0 5704.0 6408.0 10016.0 protect protectyour 3768.0 10360.0 funds 4296.0 5084.0 against 4984.0 5956.0 10300.0 robbery robLeryrobberyThe 6820.0 10624.0 iI 10692.0 10780.0 3400.0 3760.0 Dutton Button10956.0 Dank5952.0 BankGAINESVILLE DankGAINESVILLE4288.0 11583.0 5736.0 FLORIDA 5588.0 FLORIDApeople 11588.0 FLORIDAe FLORIDAIleOIle FLORIDAPeople 5224.0 3776.0 12048.0 IleOIle4392.0 12088.0 4664.0 12052.0 opportunity OllllOltunltr4588.0 5732.0 12064.0 5652.0 5964.0 meet 5888.0 6500.0 6376.0 12055.0 hsar htiarlltlar6652.0 lltlaraucl 7104.0 6732.0 hsarand -372.0 3764.0 12276.0 12280.0 aucl4148.0 4060.0 4380.0 know Imow4304.0 4944.0 tho4820.0 gentleman gentlenlau5212.0 6236.0 12283.0 whom Wh01116784.0 thpj6712.0 theyhold -364.0 7148.0 theyltohi 12499.0 hold ltohi4252.0 4128.0 4508.0 12503.0 such 4996.0 high 4880.0 esteem esteCm5348.0 esteemTrusting -584.0 6052.0 esteCmTIusting 12708.0 12728.0 Trusting TIusting4892.0 12764.0 4788.0 5208.0 early larlr12731.0 5620.0 6144.0 12771.0 n6344.0 fnvoratilo favoraflle6244.0 favorafllereply -796.0 6348.0 fnvoratiloreply -792.0 12736.0 fa 6520.0 roraTII 6496.0 roraTIIreply 12952.0 reply 4436.0 12956.0 4692.0 bog hog4492.0 5180.0 4980.0 5528.0 subscribe subscrihe5332.0 6532.0 12959.0 myself 6332.0 myselfYours 7092.0 12996.0 6664.0 Helf HelfYours 13179.0 Yours 4352.0 13191.0 most 4260.0 4832.0 13184.0 truly 4748.0 684.0 5464.0 13188.0 FRANK ItANK-684.0 6148.0 HA 5536.0 6012.0 5844.0 CLARK CIJAHKCLARKMember -660.0 6900.0 CIJAHKlell1her 5196.0 13407.0 13412.0 Member lell1her5876.0 CongressFurther 6124.0 6220.0 Congress Congless-764.0 6984.0 ConglessFUIthm 3144.0 3932.0 13632.0 Further FUIthmparticulars 4600.0 5700.0 13636.0 5608.0 5960.0 5860.0 6372.0 13639.0 Inslltutl6272.0 Institutewith -704.0 7076.0 Inslltutlwith -676.0 7048.0 3756.0 13855.0 4220.0 13895.0 n4120.0 13892.0 program IIloglam5264.0 13860.0 twill5112.0 he be5560.0 5940.0 given ghln6504.0 later latellaterFather 6896.0 latelFi1th -356.0 6860.0 4312.0 14392.0 Father Fi1th 4872.0 4812.0 14423.0 4688.0 4964.0 rrJ arIJ5056.0 rd 5352.0 Sci Sc15456.0 c 5636.0 Crcntattdol 5740.0 Cremated CrrmtCrcntattd6536.0 CrematedNoith -800.0 6540.0 6460.0 cl clHth 3984.0 14596.0 Noith 14636.0 ol Hth 4256.0 4456.0 4836.0 tor 4716.0 4920.0 es 5092.0 14599.0 5784.0 Dor Di5372.0 6004.0 14639.0 271c 6036.0 271cpOI 7128.0 -700.0 Tsvc TwcTsvcpeople -344.0 Twcpeople pOI 4332.0 14852.0 4484.0 14843.0 WNltere5016.0 burned burncd4864.0 14824.0 14812.0 death tJeathdNlIh6620.0 14820.0 uldaltcl6472.0 7056.0 14848.0 IIu6908.0 athhd IIthird utlthd 15012.0 third thhdtlthd15019.0 fatally fntalyfataly4192.0 hurt 4840.0 5432.0 hi5308.0 5696.0 15059.0 lire 11ICttre5776.0 hlch wltlch6180.0 6444.0 hlt 6780.0 6696.0 6644.0 6912.0 titdetiestroyed -176.0 7088.0 titstlo deshoyed 7052.0 7044.0 15064.0 15235.0 15240.0 stroyed shoyed15244.0 stlo -616.0 4396.0 4224.0 ed 4104.0 4488.0 15268.0 4672.0 general Kcnetnlcnernl4568.0 5376.0 stoic sINOstore5284.0 endntl 6176.0 6268.0 nparuneni npnl111lfnlnparunenihouse -844.0 7112.0 npnl111lfnlbouse apart 6720.0 iimci iimcihouse 15444.0 15448.0 house bouse4364.0 15451.0 4264.0 4624.0 4524.0 B I34704.0 5176.0 Cliriler UtlltIurrierllr 15456.0 NVuJnes 1VellneNVuJnesday -644.0 1Vellneday 6616.0 clul 6968.0 15624.0 3336.0 15660.0 15664.0 JayMichael lIchH14064.0 5040.0 Veltrle lltliCVeltrie4888.0 15692.0 age fifty flftr6104.0 6800.0 15667.0 win whwhc6568.0 winlived whlived whclived 15836.0 15871.0 lived 15908.0 ocr 01orer4176.0 4768.0 15876.0 4656.0 5128.0 15888.0 toro storo5020.0 5544.0 5388.0 10 nndJoseph JO 6392.0 iOllh 15880.0 h1 h1sou 7028.0 hit libhitson 16087.0 16120.0 sou son4248.0 abed 4036.0 ag Ilg4784.0 thirteen thirlueulhhluCI15688.0 wcrWert6084.0 16111.0 tt6808.0 udeath 7144.0 16179.0 l7020.0 ldeath Ideath 3772.0 16296.0 16519.0 16575.0 tCough 2240.0 4928.0 16671.0 Thats 5580.0 16676.0 Itl ICough 5896.0 16744.0 7152.0 16824.0 3908.0 Cough yourself jourselfInto 5232.0 5752.0 16972.0 5648.0 fit flt16939.0 6484.0 spasms Blmsms6380.0 spasmsand ijand iand 3724.0 4160.0 then 4016.0 wonder 5400.0 why 5276.0 17188.0 17192.0 dont 6832.0 17167.0 get Slt6708.0 getwell 17204.0 iwell 17324.0 7172.0 Iwell 3732.0 well 4544.0 17411.0 4644.0 17415.0 wlllonh5248.0 5808.0 17392.0 try 6048.0 bottle bott16932.0 or6824.0 ofBallards iBallards 3740.0 17603.0 Ballards 4752.0 17599.0 Horehound Syrup 5676.0 17608.0 6448.0 6172.0 17636.0 rul yourcough 17640.0 olir olircough 17523.0 jcough 7176.0 17795.0 17828.0 cough 4328.0 17824.0 4228.0 4632.0 5008.0 17864.0 4924.0 5064.0 5220.0 thing 5116.0 5748.0 6008.0 17835.0 past IltstItIs 6724.0 6972.0 17991.0 18047.0 18051.0 3952.0 18087.0 3860.0 4144.0 positive 4048.0 4904.0 18084.0 cure 4804.0 5268.0 Coughs Cougl15604.0 6316.0 lulhllU InfhlenInfhlenza -564.0 18108.0 7032.0 jza 18263.0 18307.0 za 4056.0 18272.0 Bronchitis 3896.0 aud4936.0 5448.0 5340.0 5772.0 Pulmonary Pulmonarr5656.0 18276.0 dls dtsdlseases 7040.0 jeases 18492.0 18532.0 eases 18495.0 One 4180.0 4816.0 4728.0 5300.0 convince 6524.0 youat Uat jat 3720.0 18683.0 18727.0 3964.0 18751.0 jour3880.0 4432.0 18720.0 druggists 25c 5744.0 50c jOc6248.0 18723.0 100 Sold Soldby 18816.0 18936.0 18943.0 3912.0 4088.0 4204.0 M 4660.0 Johnson xmlns:ns4 ID21 13316 3536 7232 2616 ns4:type WEDDING 8780.0 AT 8660.0 FAIRBANKS 9032.0 FAIRBANKSTwo FAIRBANKSwoFAIRBANKSrwo-1104.0 7360.0 Two rwo7488.0 7708.0 7812.0 Popular 8540.0 Young 8456.0 People 9808.0 Joined 9716.0 10432.0 To 10336.0 Together 10636.0 10652.0 7900.0 3340.0 gether 8436.0 8844.0 Christmas ChriGtmas9796.0 3364.0 Day 9688.0 DayFairbanks 10096.0 DayPahbnu 7536.0 Fairbanks Pahbnu8396.0 8488.0 wat8900.0 till8804.0 9236.0 scene 8C0tW9148.0 9780.0 9692.0 10012.0 9932.0 10192.0 hnpII10040.0 happyoccasion 10676.0 hnpIIocca 10584.0 7356.0 3820.0 occasion 3848.0 occa -708.0 8064.0 7828.0 loll 7716.0 8144.0 nn3824.0 8324.0 3840.0 afternoon aftlIuonnatternoon9276.0 10276.0 3852.0 10140.0 10460.0 3855.0 Ll10384.0 10640.0 LlIng 10612.0 3928.0 7364.0 4044.0 ing 7728.0 7620.0 8088.0 4084.0 nu 8092.0 marriage 8280.0 UH1I1 -768.0 8860.0 8352.0 Triage 8548.0 8672.0 8856.0 8964.0 uf llfof8764.0 9232.0 1v9124.0 9296.0 9448.0 9564.0 9400.0 IL9608.0 9832.0 llhiekwelson 9836.0 Wackwel Hlncltlllhiekwel10632.0 10756.0 son sou7752.0 7636.0 8024.0 4280.0 Mr r7916.0 8120.0 8296.0 8404.0 4275.0 8220.0 8828.0 4284.0 Mrs 8700.0 1111 9140.0 9288.0 9136.0 9544.0 11IL9364.0 II1lteklVelwell lUackwell HlnckwttII1lteklVel10580.0 lUackwellwell Hlnckwttwell-804.0 4496.0 7840.0 known kuown7700.0 8508.0 4504.0 Hud8380.0 8944.0 popular IIo1nllPoatlar8808.0 9700.0 4519.0 IwnphPaple10396.0 4532.0 ant anian110224.0 aniMiss 10680.0 an1lIs anthiss 7368.0 4712.0 Miss hiss7460.0 lIs 4732.0 7656.0 8148.0 L7980.0 8408.0 llardee 1InrdeelIn 9028.0 ldl 9188.0 4735.0 1108992.0 9444.0 9556.0 4772.0 ceremony clrtl110nj9228.0 ceremonylug 10352.0 10468.0 bo boing 10644.0 10552.0 Ilug 10764.0 4948.0 lug ing4951.0 performed IIErfIIml4976.0 Item -860.0 8612.0 armed 8468.0 8528.0 4956.0 8800.0 4960.0 Rev Hev8840.0 9080.0 9244.0 9592.0 19640.0 9828.0 119992.0 10180.0 Hilton IIt1ll1l1fliltuuHiltonof IIt1ll1l1offliltuuof-508.0 10688.0 7644.0 Hriini Hattl7516.0 HUIIIJlI -440.0 8084.0 8152.0 5216.0 alt8328.0 8500.0 assisted nssistl9036.0 9168.0 9092.0 5184.0 9300.0 5188.0 b 9492.0 9612.0 5192.0 Judge JudgtJtuige10220.0 Q GU10100.0 10512.0 5200.0 10328.0 MColmnu MColnuul 10600.0 5204.0 10628.0 IColman 7352.0 5404.0 Colmnu ColmanColnuul8096.0 5408.0 8344.0 GaillESvllhGainesvilleThis 9284.0 GaillESvllhThis GainesvilleThis3152.0 5624.0 This 8076.0 5668.0 7908.0 Indeed IlIllld9252.0 It9088.0 9500.0 5640.0 beautiful btantHul9336.0 10392.0 5655.0 sail10240.0 sailgraceful andgraceful 5684.0 10548.0 lit 10528.0 litgrclful 7348.0 graceful grclful8140.0 wedding 8036.0 9084.0 5871.0 8848.0 9648.0 9456.0 9740.0 contracting 9596.0 contractingparties -956.0 10696.0 onltnlin onltnlinPn1tlt8 -748.0 6080.0 parties Pn1tlt88020.0 rune 1mH7936.0 8520.0 9112.0 6092.0 1I1akl9024.0 6087.0 th119548.0 10104.0 solemn SOhll111soleinn10028.0 SOhll111IlledgC soleinnpledge 6308.0 pledge IlledgC7896.0 8448.0 8164.0 8128.0 Wtll8348.0 9160.0 joined jOhlld9020.0 6324.0 hy9676.0 10168.0 James 10020.0 JamesUlackwell -528.0 10208.0 lt 10380.0 6356.0 mites l1ltS10348.0 l1ltSBlaclll1 mites1lackwell 6535.0 Ulackwell Blaclll11lackwell8312.0 nnd8768.0 6544.0 bliss9152.0 6580.0 8972.0 Cora 9416.0 ora 9672.0 6547.0 Wlttstock lvittstockWlttstockand lvittstockand-812.0 Itt -624.0 toek 10184.0 toeknnd 7340.0 6764.0 nnd7768.0 1V7836.0 7948.0 8104.0 6772.0 IJE8368.0 6768.0 Doardman nOlIdmanloudutan9344.0 turd9764.0 lIishissLlllie Ll1l1tIllltt10136.0 LlllieM Ll1l1t1M 7256.0 6988.0 6992.0 1M 11117320.0 7456.0 7592.0 Hlaekwell Hladilllillttcktvell6995.0 attendants nttlIHIlnt9936.0 Togtil1TogetiterTogethertlie Togtil1ITogetiterparty 7344.0 7211.0 tlie7239.0 party IIIUly7600.0 7220.0 proceeded lrOclldtct9396.0 7232.0 9220.0 9720.0 parlorwhere 9972.0 parlor IJaIlol10648.0 IJaIlolwhtre 7252.0 7440.0 where whtre7276.0 8000.0 7448.0 tliethl7848.0 8392.0 ccrcmony9368.0 7480.0 9216.0 pptCmmlIIlerforittrtlperformedIn pptCmmlIIinIlerforittrtlI7240.0 7668.0 7680.0 7244.0 Iin 7272.0 fu7484.0 tll7972.0 7704.0 presence pIIsenccitrtsence7671.0 or9064.0 8968.0 9260.0 large llgt9792.0 7676.0 number Htlmbl9684.0 7711.0 10424.0 10532.0 7684.0 oroffriends orfllends Ifriends 7868.0 friends fllends7920.0 7512.0 he7652.0 7928.0 brute hlitlpbride8124.0 looked 10okltI9072.0 IIllltyPrttty8976.0 8131.0 1119572.0 her hlI9800.0 10244.0 gown 10164.0 gowni 8347.0 7324.0 7564.0 cream elealllcreamt8156.0 8356.0 silk lIk 8588.0 while whill9132.0 till9472.0 8387.0 groom gruont10084.0 wuswtts10472.0 8372.0 attired 10476.0 8576.0 tired thld7824.0 8579.0 1118056.0 tlie111l1084.0 conventional ventfonnl8616.0 can con-1084.0 9480.0 8904.0 nUourd 9580.0 8584.0 black hladblackOf hladOf 9964.0 Of tin tIlltit7712.0 8232.0 attendantsI8048.0 9272.0 8807.0 9452.0 Itss 9712.0 Iss 9860.0 Mttstock 11ittstock11ittstockwas 10672.0 Mttstockwas 10048.0 8812.0 Ittslor Ittslorus -520.0 10568.0 9056.0 9063.0 7640.0 7732.0 dresed dlt drs 8072.0 8268.0 8460.0 8600.0 9316.0 9212.0 l1k 9756.0 whit9900.0 hlll 10196.0 10292.0 ilISHhiss10156.0 MissHlaekwfll hissIIhtk IIhtk Hlaekwfll 7780.0 Bt 7596.0 9292.0 7696.0 Iwtl1 9264.0 ll 7924.0 9255.0 lookltIwl19348.0 ht9600.0 hr9488.0 9968.0 dress dlpss9872.0 10504.0 9267.0 or10404.0 ofwhite 10668.0 white hitl 7776.0 8196.0 8464.0 9483.0 Ihe8928.0 gentlemen entltmln9940.0 9516.0 WlI10456.0 9496.0 10616.0 9560.0 7312.0 9708.0 littliehe9732.0 customary custol11arr9432.0 blackrile 9324.0 9436.0 hlakblackTho 7496.0 9931.0 rile ThoIheptrlor 11101 decorations dccortllions8440.0 9971.0 WI 10148.0 10296.0 verylaudsonir 10024.0 very YtIr10660.0 veryiandsoint YtIrandsollIt 10159.0 iandsoint andsollItlaudsonir8340.0 8116.0 8952.0 9192.0 scheme fhtmpseltetuc9956.0 0110256.0 ever vrr10112.0 evergreens 10620.0 vrrgreens 10236.0 7308.0 10419.0 greens gllIIS8012.0 10428.0 7864.0 10391.0 md t11d8188.0 colored colmedcoloretl8300.0 papers paIHIs10092.0 10408.0 thehallway thehallttay 10436.0 ht hthalla hallway hallahallttayWIS7952.0 n8388.0 lurgl8596.0 9268.0 holly holl tree 11119568.0 10647.0 10120.0 10400.0 withits 10440.0 itli itliits 10619.0 hI 10835.0 10844.0 10856.0 tH 7336.0 7588.0 10839.0 hta -732.0 8320.0 7888.0 10872.0 7860.0 8068.0 10848.0 ful rod lldredberries hlrrllsulldturd9724.0 ot dec dredecoration 10604.0 111Olatloll 10464.0 dreorationsnlhleulatI 7300.0 11064.0 11067.0 oration OlatlollorationsnlhleulatI -592.0 7892.0 emblematic Il11hlnHt-880.0 8948.0 8924.0 9048.0 9128.0 9012.0 tht11100.0 season 9628.0 seasonAfter 10252.0 seasonAftcrthe 11112.0 10248.0 11104.0 Oll 9924.0 OllAftt 11292.0 11295.0 After AfttAftcrthe 11299.0 tlie tlw8256.0 happrcollide roupltcouplehad 9484.0 9960.0 reeelxed lIIph11recelledreeelxedthe lIIph11tho recelledtilt3432.0 11487.0 11515.0 thotiltcongratulations ontratutatioIlHconlratultttious7556.0 11520.0 lnd11111best Illsthest9864.0 wishes wlIIItH9768.0 10496.0 11536.0 of10416.0 atthose 011 011thos ofthose 7296.0 11743.0 those thos11755.0 present IIIIent7740.0 8624.0 9000.0 11759.0 paltlUItyprucVc8d10500.0 11764.0 1010376.0 tothe 10till 11944.0 11968.0 till11972.0 diningroom tlllIlll -996.0 lIaing 12004.0 Noom roonl 8816.0 htIt thltIi cake 9604.0 9920.0 ak WIIH tunsWIIHcuI tunseat 12008.0 ascut 12123.0 12208.0 cut cuIeat12203.0 Ufu 7532.0 after aftlI12231.0 8100.0 8212.0 12196.0 tvhlchdinner 1111111112228.0 WS9376.0 9584.0 9536.0 9912.0 nerved servedservedand 10452.0 9916.0 nervedand -536.0 7280.0 12416.0 12419.0 12424.0 7576.0 12456.0 1I1ayachytruthfully he9504.0 said snid9624.0 lill thlHwanwtit10232.0 wtitone 10332.0 wasone wanonl 12644.0 12684.0 one onl12648.0 7572.0 7944.0 tlio thotlto8316.0 12656.0 8832.0 elaborate 1Inho1ttelahortttespreads 9620.0 10480.0 10372.0 ofpood ofgOOf ofgood 12872.0 good pood12907.0 gOOf 7660.0 7624.0 things thlllgs12904.0 pr 8896.0 12876.0 served lItdiutill10200.0 coun county 12940.0 13095.0 13099.0 ty hose ThohO1IIuo8336.0 13132.0 nrolln 8820.0 9476.0 festive flsUroboard IlIlaldboardmade IlIlaldmalle 2200.0 13320.0 made malle7832.0 13352.0 merry nurry7720.0 13355.0 IIltrr 8444.0 13324.0 8228.0 hour houlhourThe houlfhl hour1he 9440.0 7492.0 13548.0 fhl1he7904.0 13583.0 jjroomglUom8572.0 1813555.0 twentyone ttVentylnttWlnt 9760.0 13580.0 onl 9304.0 9892.0 13571.0 years yarofage ofngl 7260.0 13775.0 13808.0 nglHIIIIIlad7552.0 8180.0 13811.0 13804.0 young oulIg8260.0 man I11l1nnlttn13780.0 9412.0 excellent lxellIllItexrellIlt9728.0 excellentclmractir lxellIllItchnlaIII exrellIltehttlact 3312.0 7264.0 13996.0 clmractir chnlaIIIehttlact14036.0 14000.0 antibusiness husll1lt1iiuallllcatlons II11I111l1mtlollsiiuallllcatlonsHe II11I111l1mtlollsIII-1120.0 10576.0 qutt1Iheat bits 10212.0 bitsIle 14219.0 14224.0 He IIIIlehas 7912.0 several tral 14256.0 14259.0 IIlH 9772.0 been IINII10288.0 con COIleonconnected 10564.0 14264.0 COIlIltpil eonnected -272.0 10560.0 10588.0 14296.0 14444.0 14447.0 nected Iltpil7800.0 14451.0 wi 8108.0 8080.0 8360.0 thlAlaehna AlalhlllAlachua9508.0 Naval Nn -476.0 9984.0 14488.0 9952.0 9876.0 14456.0 Stores RlullSStaresStoresCompany RlullSC01l1pall StaresComlpany 7248.0 14667.0 Company C01l1pallComlpany14672.0 nml81118516.0 also lhm8432.0 8932.0 8852.0 9256.0 14676.0 TaIlHHJantosr9976.0 Itlaek lIIalIIllack9980.0 Illackw 10108.0 Itlaekwell 14892.0 14928.0 7400.0 ell 1117748.0 14895.0 mercantile nUIantllnicreantil8788.0 14899.0 firm 01111lit9120.0 9784.0 14932.0 wayhorn horllhornIn horllIn15120.0 15124.0 South SO1th7396.0 Carolina ClIolinaCarolinaThe ClIolinaIll Carolinashe7432.0 15343.0 she7472.0 7756.0 bride brldo11111108384.0 8276.0 8608.0 15380.0 lHl1ltlful8692.0 9656.0 roullg15348.0 lady ladyof 15568.0 15571.0 15584.0 seventeen 7404.0 nndnod8864.0 8752.0 15608.0 8996.0 native nathpuativc9172.0 SouthCarolina SouthCa 15791.0 C1l01lna15796.0 Ca -712.0 7956.0 rollna 7444.0 IIIRoxmlns:ns5 ID22 2916 3356 16016 ns5:type 7428.0 16016.0 Friend FIIIIIIIoFriends16019.0 16031.0 hnIiieIInpJ1couple o1pllnubile10008.0 depart drpnrt11111 16092.0 3268.0 16240.0 16244.0 uftrr IIftlIuftlr16272.0 pleasant Illlmmlltaletsant8980.0 nttI1I1101l9944.0 tvlahingthen 9948.0 wlnhlng whillingtvlahing-636.0 wlnhlngthem -640.0 whillingt 16460.0 1If1lIthen16476.0 -408.0 7724.0 16500.0 7268.0 16463.0 long 7808.0 life lift1If 8592.0 16467.0 happiness happincMSIlIqlJlintlitl111111pro propirlty 10448.0 P 10268.0 10216.0 rus ruspreps 10536.0 16512.0 11A 16688.0 preps pirlty9468.0 16695.0 llFalrbaIIks 9904.0 9788.0 16692.0 SriCST SriCSTFairbanks itI 10128.0 HT 10036.0 HTFalrhallks -224.0 7416.0 FalrhallksFalrbaIIks16911.0 Iveem -828.0 9008.0 16915.0 L7 2727CASTOR L7CASTOR iCASTORA 17331.0 CASTOR CASTORACASTORFor CASTORAFor-3028.0 IA IAFor 17803.0 For Infants InfantaInfanhCliiMren Chi1llcnChilrenCliiMrenThe Chi1llcnThe Chilrenthe 18068.0 18072.0 Kind 7616.0 YauHave HavsNara8560.0 9200.0 Alwjs AhtJ11SAItliishuuhlldoart Buugiil HuugilthuuhlBuugiilBoara HuugiltHlJars10540.0 18528.0 Boara HlJarsldoart8044.0 18523.0 thethenuttIb 8308.0 9632.0 18547.0 18652.0 kI 9312.0 rt1gnuttl 18767.0 18788.0 t1gnuttl 18791.0 nuttIb 8236.0 18779.0 ut uJ10364.0 xmlns:ns6 ID25 11272 6608 4004 19439 ns6:type 7544.0 19448.0 04 04YOU 7612.0 19439.0 19764.0 YOU 19767.0 AR 5552.0 ARTo 19783.0 ARE -1128.0 7504.0 19776.0 INVITEDTo INVFFEDrINVITED INVFFED-2332.0 4100.0 20835.0 20872.0 5336.0 20863.0 Viit 20907.0 llt 5932.0 5928.0 20891.0 Our 6188.0 hll 6260.0 20936.0 tll 20884.0 20903.0 tlll 20955.0 6980.0 20947.0 6828.0 6940.0 20931.0 iv nml llld7672.0 20867.0 pcr pcrLine IIIlILitH l1i1U 21131.0 21135.0 Line LitH1i1U5708.0 21140.0 of5556.0 iiiniX 7136.0 Diisivtin ltl1 itil1g tilig7384.0 ofi1fnfDRY ofDRY i1fDRY 4004.0 21588.0 21619.0 DRY 21611.0 GOODS 5368.0 NOTIONS 5152.0 6388.0 CLOTHING SHOES HATS NECKWEAR NECKWEARGROCERIES -1060.0 5644.0 21931.0 GROCERIES 6948.0 HARDWARE ETC ETCW 8568.0 ETCVI ETCf 22388.0 22391.0 VIprnillNc 5412.0 22468.0 6656.0 22456.0 ynll 6404.0 22459.0 YII vOll Inlili I1hl7820.0 22475.0 AtUlllicill AtUlllicilland -1048.0 9184.0 22656.0 anti22663.0 Ioufst 5440.0 IO11c -740.0 22691.0 6136.0 6552.0 1ric 6200.0 4008.0 23172.0 23179.0 IIIGDOJSI BIG -4340.0 DOlT 8776.0 23175.0 CO OO0wCOHIGH OOHJG1I-1432.0 5324.0 23740.0 HIGH HJG1I111116256.0 SIMMXCS 23743.0 Sl1tl -1152.0 6424.0 6840.0 23752.0 6464.0 HIX Ns 7064.0 FLORIDAATTENTION -1176.0 FL HI PbIJ 111ATTENTIONFARMERS 7424.0 24515.0 bIJ bIJA 24815.0 24820.0 ATTENTION lrENTION24831.0 -2816.0 7008.0 4196.0 ATTENTIONFARMERS ATTENTIONFARMERSPure -5644.0 2320.0 7520.0 FARMERS AHlERS-2320.0 FARMERSPure AHlERSPure6204.0 4040.0 25751.0 Pure 4696.0 25759.0 Genuine Peruvian 5492.0 25763.0 Guano 6492.0 Fresh 7992.0 8416.0 Islands Along 9616.0 Alongthe 2072.0 6096.0 26115.0 26120.0 Cjastsof astsof6400.0 CJasts -1012.0 7580.0 7392.0 6688.0 26123.0 Peru71V Peru PeruTWO PeruT 1616.0 26751.0 26756.0 71V 6252.0 TWO 6596.0 26763.0 7000.0 26759.0 CIt CItCIIINtIIA 7116.0 26771.0 7208.0 1iA 7212.0 7664.0 ICuanntM 27068.0 CuanntM 27080.0 iuatantr 7024.0 27071.0 laatdr laatdrtrip111 -548.0 lniO lniOinAlJE 4208.0 27227.0 CIIINtIIA trip1115292.0 iRADK inAlJErtA1i5104.0 27231.0 iRADKi -596.0 Uifii Ittfi2820.0 9144.0 lU 27244.0 27239.0 JI JIPr 4024.0 27451.0 27463.0 27475.0 4184.0 no 27488.0 4360.0 IO 4212.0 27455.0 IVr Prir27460.0 lnt 4868.0 27467.0 Vni 5140.0 Vnit 27479.0 6292.0 AvailAWu Av 6612.0 ilWo llflLle6508.0 TtlrAcW HK 8008.0 Add AddAtfimvni 8016.0 17 127483.0 Iir hrIhr9880.0 9812.0 27528.0 rii 9996.0 27523.0 nIi 27495.0 iimo 10228.0 4028.0 27631.0 27659.0 27651.0 Ii 27636.0 71 4356.0 4440.0 TIT 1rTITL1 4700.0 27676.0 rut Atfimvni Aliltnnia27671.0 Jrt mo 27655.0 PD 27639.0 I27687.0 9888.0 iM4t rttIfPIr 10172.0 6212.0 27772.0 27819.0 L1 227815.0 2 4108.0 Pr PIr4580.0 27852.0 CV 27839.0 tut 27863.0 5124.0 ttt 4916.0 27812.0 iI4a4i lMlt 27847.0 9320.0 wjvr Irr27843.0 IIIutCoeUortiner IIICoeMortiner 10152.0 1t 1tCoe 28164.0 Coe 4908.0 CoeUortiner CoeMortiner28167.0 Mortiner -1064.0 6512.0 6660.0 Co Charleston 8784.0 28175.0 8556.0 9164.0 CiTFR Ctl 4420.0 28651.0 tl 4564.0 28664.0 4848.0 4952.0 UUUX1 DIItET5768.0 nUtoHTER iMPORTIRiTFR -524.0 6796.0 6956.0 7012.0 Nitr llrat Itrau7976.0 8132.0 28659.0 Irla 8332.0 28711.0 HMuriati 8552.0 Sltn Lat 10052.0 28667.0 hJ iIJhJIJfiatf iIJMnriatc 5356.0 4020.0 28867.0 28871.0 Muriati IJfiatfMnriatcIfPotaJ Potah5060.0 28903.0 otai Kainit halnttamlt 6328.0 28919.0 alll1I -652.0 6572.0 6692.0 Tli Th6976.0 28939.0 28931.0 IJ IhJo Iitii4later 28927.0 8472.0 7804.0 28923.0 IJk 7844.0 hate 8244.0 orstinlj 28883.0 lhtru 8668.0 28887.0 laootlJf1r lay4tudr 4368.0 29135.0 stinlj ootlJf1r4tudr4896.0 29183.0 4824.0 Fnv 5172.0 Fn 29187.0 Itmik HOliKHlxk6140.0 ruHotn 1ltxntIfHIIIII 6864.0 M1zsri Mix 7568.0 frVrtihwrx rulwnIFrrtihr29192.0 8688.0 29143.0 Plant IluatPlantrtii 29155.0 29219.0 9392.0 29152.0 Iut IrulwIrulw3Itit 9804.0 IutJtrn 29351.0 Jtrn 3Itit29403.0 rtii 29383.0 containing oontA 29368.0 ninK 29355.0 aJiubU talttab5756.0 29359.0 JuAb inf 6108.0 mfnnatJJf1 tnrnnrtatiu6592.0 29415.0 6640.0 29391.0 nnati 29431.0 7072.0 29408.0 area an1iUJ 7784.0 htG hinrrnt lltrnnt29395.0 InuL 29443.0 8604.0 29379.0 nuuU nuu1Ao429439.0 9196.0 fIrI 29419.0 29375.0 llfinit llfinitcrnpp Ltf lfl 29399.0 rest restcmixftuG 29427.0 Icropfne 29571.0 cropfne cmixftuG29619.0 crnpp -904.0 frw 29575.0 tlp-248.0 29627.0 5392.0 Irking IrkingFor 6116.0 kin kifJkinFor kifJFor 4372.0 29831.0 29843.0 information nlomutt1lntnlormation29887.0 au29839.0 nixing rn6184.0 xing 6152.0 jng applying PpI1ingplj Jig 7132.0 29879.0 term 7880.0 29896.0 nra pnow 29868.0 prk 8636.0 29875.0 ttcetcwrtc wrtefTit 29951.0 29907.0 29851.0 mall ral 29903.0 onL 30143.0 L 5512.0 30583.0 30647.0 5572.0 30623.0 7968.0 30627.0 7184.0 xmlns:ns7 ID35 13240 3456 10768 2656 ns7:type 11188.0 11364.0 11348.0 17131NnHS 11576.0 11600.0 SJCi -1108.0 12160.0 E 12372.0 SS 12352.0 12856.0 G13296.0 Yirh4 xaats13032.0 Yirh4D 13880.0 xaatslli 10884.0 10888.0 lli 11056.0 11216.0 11384.0 ROUT 1OllTliO11T11148.0 11904.0 VOWER3 r0WERr711ERS12176.0 VOWER3UliNTIST 13196.0 r0WERDl r711ERSLE 13084.0 LE 12092.0 UliNTIST 12340.0 UliNTISTOJllnc -840.0 12932.0 Dl 12376.0 S1 12268.0 12504.0 1IT 12584.0 1ITOl1nc 12864.0 12688.0 1Otlltlc 12896.0 11152.0 3991.0 OJllnc Ol1ncOtlltlc11708.0 11940.0 3996.0 Miller toIHh11852.0 12344.0 12468.0 12408.0 12380.0 12564.0 haw IhtV11t 12900.0 12984.0 lzObdnta 12988.0 -836.0 13824.0 KMiice 13104.0 13124.0 xQldn 13040.0 xQldnil1t -500.0 13624.0 10912.0 4343.0 Miice itieeil1t 11300.0 11220.0 11360.0 4348.0 Phone PlioiiePholl11956.0 No Ka11884.0 218 H31912172.0 12716.0 Kehli 12544.0 13224.0 12720.0 Ileaideuon 12888.0 13024.0 fthuo1lo 13572.0 nc 13844.0 13492.0 13476.0 Ko tio13536.0 Kor KotKoB 13968.0 1rp 14016.0 lie lier rp 10928.0 4979.0 11060.0 11268.0 niiELMS EIlISIELLISJR 12168.0 JRATTOUNKVATLAW 4988.0 UI 12360.0 11088.0 5164.0 411524.0 ATTOUNKVATLAW ATTOUNKVATLAWK -1956.0 13480.0 r11 11568.0 11656.0 l11 11728.0 11808.0 CU1ir 11880.0 12032.0 HN 12288.0 12488.0 12448.0 5564.0 IL 12600.0 13144.0 hc114 13316.0 13432.0 10836.0 5996.0 GAStv1I1g 10840.0 6007.0 trs1u -1036.0 11876.0 11660.0 11652.0 11692.0 11800.0 6016.0 FtOKID FroKltIFtOKIDFUANK -656.0 14164.0 14092.0 FroKltIP1tAiti 13720.0 6056.0 ORIO FUANK P1tAitinUI 11528.0 6643.0 CIAIW CLAIUCI -556.0 12084.0 11872.0 11688.0 TUGS lIIOST1iOS12016.0 13152.0 6648.0 IV13400.0 13404.0 FIKLWNCS IBhlJtti13440.0 FIKLWNCSCliAUK -780.0 1mLU1 13448.0 6700.0 13948.0 13520.0 IBhlJttiCIIA1 13472.0 14096.0 llC 11096.0 CIIA1 CliAUK -612.0 11712.0 12020.0 11304.0 7004.0 rA 11256.0 11648.0 7007.0 11608.0 Ftx 12256.0 raCLBhNG raCLBhNGLawyers -1328.0 13912.0 LDINO 12836.0 LDINOIu11yers -876.0 13908.0 13036.0 LD Li 13760.0 13644.0 12040.0 7415.0 Lawyers Iu11yersIu11yersPravtici 12920.0 12044.0 LawyersPractice Practice PruotlcoPravtici11724.0 8199.0 11112060.0 nll12460.0 8208.0 Courts COI1ls12264.0 13232.0 13000.0 13876.0 iiiit 11113688.0 iiiitFederal 14116.0 1111o atd 14120.0 atdFcdor8l 14160.0 12248.0 Federal Fcdor8lFederalOnices -628.0 1o Fcdor8lOaices 12320.0 8551.0 cto1l 12844.0 8544.0 12768.0 Im 11080.0 Onices Oaices11196.0 9248.0 11560.0 11496.0 R 11312.0 over OCIOVt11992.0 iiuliu 11932.0 1I 12364.0 tinllnxl1 12108.0 12680.0 12240.0 9280.0 IIl 12220.0 12412.0 siiii 12396.0 lilt 12744.0 Nut Nat12772.0 13284.0 13072.0 111l8INhSVHlJ 13436.0 13356.0 tl13512.0 IInnk IltakeIInnkU Iltakeuttst5t1tLl 10808.0 l8INhSVHlJ uttst5t1tLll8INhSVHlJJ -1180.0 11988.0 9523.0 9520.0 10904.0 11128.0 11264.0 11160.0 9539.0 13552.0 9532.0 LHUM 1d11tIUALHUMJ 14152.0 1d11tIUAe1 2516.0 11232.0 e111752.0 12368.0 IATTOX 11848.0 IATTOXCivil -1380.0 13748.0 112484.0 12664.0 11IO 12536.0 11IOCivil -824.0 13488.0 12824.0 13120.0 10051.0 rCivil 11040.0 Civil 11592.0 Engineer 11464.0 12568.0 10443.0 13048.0 Surveyor 12892.0 SurveyorDMALKK -868.0 13916.0 SurveyorIIil1F11 14212.0 10663.0 14220.0 11156.0 10828.0 DMALKK IIil1F11HEl IX ishtAL 12116.0 12428.0 12916.0 KAI EI13088.0 ISTATi ISTATrSIAIIrSIAIIPrompt 13752.0 13092.0 ISTATiPromfit ISTATPrompt 13756.0 11008.0 14204.0 IOllll 3084.0 10988.0 11095.0 Prompt Promfit11776.0 AttentiiMi atlrlItin11596.0 11123.0 Atic -788.0 ntlIt 12096.0 12724.0 11132.0 to13004.0 11107.0 nil11116.0 lul 13208.0 IHIHI 13588.0 IHIHIOiHoi 13828.0 13704.0 rllit rllitMice 14004.0 14024.0 10804.0 11280.0 OiHoi OllllMice11412.0 ilimtdoir IIi burst 11548.0 11328.0 11748.0 11640.0 11283.0 lIullr dorNorili Non 12832.0 11320.0 nrl 12660.0 12964.0 tlf of13076.0 13116.0 13244.0 11288.0 Thniclur Ihrnrllhr13292.0 14008.0 13504.0 11323.0 rllt1r 13460.0 rllt1romlt -504.0 14088.0 11344.0 rtoilict 14136.0 rotllre 11456.0 oilict omltotllre11492.0 11459.0 l11224.0 11468.0 U11475.0 11824.0 lox 11744.0 11504.0 OJ oxSlit I9tItJ 12612.0 12808.0 11471.0 iiiincHViiif iitiIesvt12780.0 13560.0 13840.0 Khi 111113640.0 KhiLhGAL 14084.0 1111v 1111LEGAL 14080.0 llLEGAL 13984.0 11820.0 11736.0 11799.0 LEGAL LhGAL11975.0 ADVERTISEMENTS 12151.0 10788.0 12296.0 12140.0 12311.0 12640.0 12299.0 12180.0 12304.0 12712.0 WNiiTIlK 13168.0 13696.0 12388.0 l3424.0 10796.0 12492.0 NiiTIlK NtTllt10916.0 12496.0 0111 11416.0 OK IIFUl11352.0 AIMMlATlDX AIIIII 13108.0 12472.0 t1TIO 12440.0 12512.0 12980.0 1IIlt 1um13620.0 13788.0 TAX IXTAXI 14128.0 10920.0 12675.0 111111 10924.0 10980.0 11016.0 11036.0 12679.0 KKI 11140.0 11252.0 UNDKH l1mltt1NnhitSKCTKIN 11984.0 SI 5112812.0 12452.0 IIO 1IU12700.0 v12692.0 12691.0 ilIIF lK UVUIAJTKU tII1t11ItUIAJTKUS -784.0 14140.0 12855.0 12867.0 12879.0 10960.0 11120.0 11296.0 LAWS 111Vs11788.0 12860.0 ws 11324.0 IIItil12152.0 FIOHIII hIAI111lhIAI111lNntlee 12156.0 KK 12252.0 FIOHIIInlhw nlhw Nntlee13080.0 bh11700.0 13083.0 hart llUlltMIInrh11604.0 UlMMI ahtllihn12800.0 Illilt IhatIhnt12676.0 13180.0 13264.0 13380.0 Jo lallMiil Ciuutl13111.0 lallMiilNiT 14052.0 14048.0 Ciuutlptrrhuser 13604.0 13680.0 13123.0 Inll Inll11urlhlltUr 14064.0 13128.0 10784.0 13216.0 11urlhlltUr ptrrhuser13243.0 NiT 11612.0 13247.0 11948.0 13219.0 Tux Tilt12548.0 12212.0 rlliliiiti CIIlIIhlIhrrlltRitr13924.0 int JII13532.0 JIIhHlt Intttatrtl 13928.0 intI 10772.0 hHlt ttatrtl11332.0 13367.0 11172.0 13360.0 11380.0 lit11544.0 nil Hhltlr13364.0 dIy13388.0 0July JulvJul13248.0 13028.0 13288.0 13528.0 Ihas D13856.0 13376.0 14028.0 13888.0 11ll IIIVN has11068.0 Illrd Ilrd5111 vain oillhlllftlll 11572.0 13487.0 ccrtltlcntn ertltlntn13503.0 lIt III12392.0 tnv trtt12672.0 13016.0 13500.0 oillic utlteo13020.0 IIllh 13556.0 iimlIIlItl13272.0 Inis Ini13792.0 Inisiiniiliitpplliiilliit 1111IIIlhl Initttudr 10776.0 IIIlhl tttudriiniiliitpplliiilliit 11144.0 11208.0 13623.0 al11ltlIU np1llratln11996.0 fur tor12124.0 13651.0 IIr 12324.0 tux tllJttax12604.0 deed lUcil1IItlln 12936.0 13648.0 13628.0 IHSIII Ivvu13700.0 III13663.0 13816.0 n14032.0 IIlItlIIIIUt neodaner uliIHf lItlIIIIUteodaner11440.0 wllhllUV Ithlnuwll 11704.0 11732.0 hili 13764.0 Slllll Sold13768.0 Oil 12580.0 hlllnilltlnh ertlllnuteuenur ertlllnuteuenurLhc -1492.0 ITlltltllll -1400.0 13452.0 llllllllil lllllllliltlu 13540.0 IIIIIIU IIIIIIUtilt 13883.0 tluLhcfulowlnu uIIIluatuIntrhtt10996.0 drhrribrd il 12036.0 Millui 13920.0 iiroporiv IIWI1l1UruprU13368.0 13907.0 sltunio ltlllllllltttnn13932.0 up13936.0 ufAl 14192.0 IIIAI upAI 14019.0 AI Altihuii lthua11124.0 hlll1 11424.0 14040.0 Moutiiv ealIllUt 12024.0 11w 11816.0 14031.0 iiiilitit 12328.0 IUD 12632.0 tnwit IwltlurrltlurrltFnmlfSwl 12636.0 tnwitSrM Iwltr 14163.0 SrM FnmlfSwl 11012.0 14179.0 -820.0 11832.0 11076.0 11472.0 Sv lolSwiibee 12012.0 -972.0 IIriw 12216.0 hw 12420.0 12508.0 I12828.0 12912.0 tV 13240.0 Tr 13328.0 13596.0 llsU llsUIs 13988.0 U14292.0 11048.0 uIIIHrc 11108.0 IIIHrclIt 11192.0 14315.0 ucrtyI14 tiorcH ucrtytiorcHTl 10896.0 10932.0 I1411092.0 14460.0 11072.0 Mtiu l1III11488.0 11552.0 14428.0 ittul 111111IInttIvliiiissiKsoil 11840.0 Ih11ot hrluu-1032.0 tighl 14435.0 vvet 12592.0 IIItau tin11111113156.0 13568.0 14440.0 due iluit13468.0 IIII 13976.0 ofIhr 13980.0 ofnfHie 14472.0 IItill 14056.0 14559.0 till HieIhrIsstmruM 1lIlIn1OIsvuanor10992.0 14564.0 of14568.0 suli urti12000.0 lIh 12272.0 14571.0 iMnllUitto IHrtlllllIl1errt111rute14576.0 lalilliit 13204.0 13256.0 UK the13544.0 nuurt nuurtnua 14104.0 niinc 1111111tlrofKitiii 14108.0 tlrHIIII 14688.0 Kitiii HIIIInua11184.0 h11284.0 14691.0 IJpveltube 11212.0 Iltisrv IJpvelIltisrvttilrss 10908.0 tube ttilrss14831.0 Mtlit11136.0 14827.0 ocrtllliMito nhlllnlllt1ntnetrtllleatnslmll 11111hlinllhi1 hihrredeemed roilittiirdWlttIIII114871.0 itv 1111as13848.0 14968.0 14972.0 III10law 1111Jima14979.0 lux12164.0 14996.0 tx 11980.0 lord deedchr wlIIllIt 12480.0 13236.0 lll lime 13112.0 15000.0 iio 13332.0 tliiMoiin lIWIClI1It4ereoa13940.0 15003.0 tillun13884.0 15096.0 Anli xUhtth ins ilitv11408.0 11672.0 15104.0 litorliinuary IIIIIIIIHJanuary11812.0 15108.0 12784.0 1115115.0 UMJ 1111U1tUMJUltncsi 13220.0 U1t1Yltti 15223.0 1Yltti Ultncsi 11180.0 two 11564.0 my 11376.0 tII nllUliil l1hllilfnkIIII12432.0 MMiiiturc h1Ituturr15263.0 12528.0 12816.0 12792.0 12968.0 12944.0 13192.0 15247.0 ami11111113060.0 tual olllunlUu LIIIIIllu13800.0 15364.0 Ittliilny Ilolh 15367.0 11676.0 15371.0 urorUetHinlirr DltIllIllIrIecnihrr12608.0 12760.0 15376.0 I15383.0 II1tinII CS 15503.0 15507.0 WIKVOKS 11llNIs13608.0 IS 13796.0 15627.0 xl 11260.0 Clirl 11368.0 hra lrrk15632.0 Clivnlt CIIlIIItClrrult11632.0 15636.0 Piniri rflllriCnnrl12184.0 12848.0 15643.0 lachiiu hllIlIlIinhua13372.0 CII13312.0 15655.0 lrldtry 13708.0 Kla lrldKlaM 13812.0 15651.0 IIs 12056.0 15768.0 tt12516.0 15784.0 12400.0 15772.0 CIIKVKS lllvU9J15787.0 xmlns:ns8 ID39 3132 3424 10724 16176 ns8:type 10744.0 16176.0 Norlm Nrlti11308.0 11540.0 OJttF 11756.0 AlIUCATION AIIIC1lnAIIII -1144.0 13100.0 12628.0 11II 1MU 1tJlt11tH13740.0 13600.0 TDKIl 11I1 s1 s1lKIU 13944.0 10868.0 16352.0 DKIl lKIU16355.0 1I1 1t1 UNDKU t111lat11420.0 IIJlm SKiVIOV SlatIIU16359.0 -724.0 12788.0 12868.0 16371.0 NIWul12928.0 MlAlTKK 1J11llaMlAlTKKLAWS -720.0 13416.0 1J11llall 13420.0 16364.0 1NI 1952.0 16531.0 16547.0 11000.0 16540.0 NI 16552.0 LA11S11032.0 16535.0 11664.0 16544.0 11460.0 ilOKNuitce 16556.0 11860.0 1tcJHtINullI 1tcJHtI L0111IAL0111IANnue 16756.0 Nuitce NullINnue16760.0 licrchv barbvhNI un 1l1l1Iulttn16768.0 Lhlll12532.0 16763.0 It1116775.0 13068.0 Watitnti WIllII1Io11untntWatitntiiuriliiih WIllII1IoIurtI11 11untntpurrhur 10740.0 16887.0 16920.0 IurtI11 purrhur iuriliiih fIII11976.0 1ux9ux1rtlnrdU rillUii frlllltlI13176.0 16896.0 So NIlull lulldinid IIIdlll11 lulldntrd 10728.0 17028.0 17031.0 dinid dlll11dntrd11240.0 liltthenl lr1ird11768.0 dirt dity11624.0 01lulu lulv12620.0 17040.0 uh 12972.0 17035.0 U17044.0 1itM 1tp17059.0 17047.0 IIHH hHIIHHtiled IIIIh1 hHIIItd 10736.0 17164.0 tiled IIh1IIItdMild hold11020.0 11480.0 icrtltliitti rrrtitlruth11432.0 rLllhUL III12924.0 inv uo13268.0 17171.0 union unit0011 13652.0 17195.0 non amiamilits 14072.0 nonbar 13964.0 111hI 17288.0 17300.0 bar lits10964.0 17291.0 inado rnnlc10892.0 17319.0 11176.0 11316.0 17296.0 itliilUiUlun illgdtrutlult17303.0 lor12696.0 17315.0 liuIIx drod drrd17335.0 13300.0 hilu17307.0 ISMIC13960.0 13896.0 InHnrdaaer 14012.0 iHiiirduiHc 17427.0 17432.0 HiiirduiHc ItflnllllHIHnrdaaerwlili Willi17451.0 ILII 11760.0 Inn 12192.0 12232.0 17455.0 Siild SHid12976.0 iMrtlllnuio rrthlnatrllllnlll -576.0 13732.0 13836.0 17467.0 IMI IMIIn uuhurr 17559.0 hurr iiios 11200.0 17563.0 tlii lIlIrhrollnwliikf IlIltowlllllti 12200.0 wlnu diMrllird drrlhdprupcri IrolrhiruprrLt13784.0 situ ILu13672.0 situntid ILuMIIII Itu Ituut 17692.0 17704.0 ntid 17699.0 MIIII 17716.0 Aliiiltua AlarhunIlIhUIIIlUIIU 11868.0 iMinty ruuutr-464.0 17695.0 Kmrldii wrillnrldu 13136.0 luvli luwlLLItILluvliiriH LItILusers 10968.0 17856.0 users iriHItl11028.0 17840.0 NO Sn11516.0 17852.0 1iiriior urtltrrOrnertlr nt12284.0 if Fe12796.0 17843.0 12908.0 ntSn Sr13384.0 I1heHld 13776.0 17847.0 Sco ScoTp 17875.0 oo 17871.0 10952.0 17960.0 17964.0 Tp 17976.0 It17967.0 JJ JJTininld 11928.0 10860.0 18091.0 Tininld 1heHld18096.0 lhllllII 11004.0 11512.0 loud lulidlulnr 1lnhrtri18100.0 Hwrrrd 12236.0 12300.0 18127.0 HSMSCI 12852.0 18115.0 nt13056.0 18112.0 Uir iiduly dntr18119.0 IIr13736.0 ufitc 14060.0 IIrI rair 18232.0 18235.0 air itc18244.0 10800.0 ls 10832.0 IArllatlR iianitq hiioli uh11804.0 l111 IcrtllltMito lcnllltlIlUIIIHtt 18239.0 IIIlutito 13172.0 13304.0 lio 13348.0 18267.0 13524.0 namcuf unuicuinamcufInUnuvvii UIIUlC unuicuiInknnwti ul1lIkllllW 18363.0 InUnuvvii 1lIkllllWInknnwtiInknnwti1nlrrhrul 18387.0 IIt 18392.0 rIliltshMilI 10876.0 IliltshMilI 1nlrrhrulcrtllllcnir IHllIl1llIlrrttlllruti12588.0 hall sliullhlIlIIH ht18511.0 riilciMiKil rtdIIIItllI13044.0 rtdIIIItllIIflnllnv 13872.0 18535.0 IIIinoordlni IIIrnrIlnR 18627.0 oordlni IflnllnvrnrIlnR18643.0 to11356.0 18655.0 18631.0 late IHWtax ltx12132.0 18659.0 18636.0 dcrd dr 18640.0 12840.0 InMm lIoI4uIMilttirrruu 18647.0 Uirrion LlltnonullunultinMill ullIII unIll 18763.0 tinMill Ill11276.0 2th tPthdity11636.0 18772.0 IIInrliinuarv JnnnttlrrlIlIun 18776.0 12404.0 11ItIH 1oiIIHWlliion 1oiIIII 10880.0 18899.0 Wlliion Ivit twn 18931.0 Ins18911.0 untiMui ntellIlIrtlrlnl18903.0 tUiuitnrf tjlfIIIIIHrtMfatire18915.0 iind an1fill real 13260.0 13612.0 13728.0 13832.0 iuu LIIIibisiuuUir LIIIh ibisIhr 10724.0 19032.0 19039.0 Ihr10792.0 19035.0 IMh Ihthdnt 11044.0 lh -400.0 ilay IIratIhWIIIIr 19044.0 ii0 Utlhtt 12204.0 intor 19051.0 I19047.0 f1 trrf1S trrs 13280.0 19164.0 19168.0 It11WIllNi 1VIINef1 19171.0 mNI 13716.0 13576.0 13656.0 19192.0 14124.0 19223.0 xmlns:ns9 ID40 11027 3528 10616 19312 ns9:type 19312.0 19323.0 19328.0 19319.0 AlMilmi 1Itbu13344.0 19316.0 Kiniiy 12028.0 19427.0 19431.0 iiy hr12120.0 19436.0 iiirvis iiJIIi412572.0 LIII 19443.0 IIILILacrrlt 13676.0 cNOTItK 13772.0 19455.0 InTln NOTItK nTlnacrrlt19835.0 fore irI12356.0 12464.0 19840.0 tmlCATIn mlCATIntul 1rtier 1rtierLund 13444.0 19959.0 2508.0 20007.0 Lund 1ullfl20023.0 tul lllH UIalitnt1I1t1hlh t1v14r12652.0 20027.0 iilM 20060.0 20039.0 lr Ithut 13668.0 ISIIIIIIIN aNnlmtrr 20032.0 12348.0 20143.0 SIIIIIIIN Nnlmtrr20156.0 31 13396.0 20168.0 lliSlit tlotrtn 13428.0 20283.0 lotrtn 20288.0 t20344.0 IlIrII hrn11960.0 hr Nlt 12112.0 20316.0 thut IhutSbii tihrIpIJIIIrtt IJIIIrttIoill 20339.0 13592.0 inl lnlt1 t1uZ 13992.0 VSuil 10720.0 20415.0 20431.0 Suil 20443.0 Ioill uZ20452.0 20447.0 20424.0 20427.0 11392.0 AlnIrurl 11644.0 12104.0 itll 11964.0 jit riurldd 1101141IrlnrklnIIHV1114113392.0 Illtnl IIltltttOt 20464.0 1111antintif 1111I anl20548.0 20567.0 tif l20579.0 20555.0 ullili hilihhs11204.0 11556.0 Intention hurnlluu20572.0 tu totusk itmlttJHk20588.0 20560.0 final rinitl13096.0 lnli 20563.0 OHMCHI OHMCHIIfunf net 20575.0 yraI yraII 20652.0 20703.0 10716.0 20687.0 Ifunf 10656.0 20711.0 Uhf 10748.0 20683.0 ln IIIUs20708.0 iiil uiiJrt 11620.0 IIor 20727.0 ort lil hl20731.0 dulin rlHltn12312.0 20691.0 vl tar 12960.0 Ilnntrrtnil Ilnntrrtnilntrr liuiiit 20715.0 iMn 20724.0 13972.0 20696.0 lKntr 20811.0 20819.0 Kntr roll 10824.0 ntrr tn NIL 11120856.0 IIMrf aIMrltIM 20828.0 innrtr 11111inadJune 13200.0 20823.0 j913164.0 20832.0 Wtin 1Of 1Oflur lc 20851.0 rtIur 20816.0 20964.0 lurIur20952.0 Ihrhr10900.0 Nw 20980.0 20959.0 11828.0 ntNr 14 H11Srolliin tirUunVH 20971.0 4 TS Twlldl 1uwtblpTwlldlto 1uwtblpI-668.0 14068.0 21079.0 21103.0 I21091.0 Knnr Itnner21083.0 hUll ix 110IH11500.0 mid 1111and21088.0 thai hilLthat12500.0 mild rukl13160.0 ltl 21100.0 truiif IKUUt21095.0 wlllir wllh wllhr 21215.0 lir hr21243.0 21219.0 miido Iaude11244.0 11508.0 21224.0 licforr krrurriLc Itltl Itnultr Kl 21252.0 13424.0 Iticilrcr ItticeltrIticilrcrHi ItticeltrHtIhtcl 21344.0 21367.0 Hi 141Ht21356.0 iialncovlllc Inbtlll11784.0 21351.0 KluYlu21379.0 12188.0 Jnnuiirt JnnutatJUI 13012.0 Ifi 1ft1612740.0 21372.0 OHe 21375.0 1HI tiair 10852.0 21483.0 HIair21508.0 imtiinx natnntltlll 21492.0 Hit Lllrlire21487.0 riluMMMr tuwlur12556.0 12624.0 21499.0 vtitiii 12072.0 wIttrr 12748.0 21523.0 21527.0 21536.0 itJtIIrll IrllISI1IIJI 21520.0 rtnt rtntIlls 21532.0 21515.0 np npHi 21543.0 21640.0 Illsiuiillniioii roullnuunISI1IIJI 21623.0 riililrrido trd4rnnr21628.0 Srlllh 21631.0 uIHlnItri 12524.0 21644.0 uH UIIII 12732.0 u1 itiiltlvntUHi 1IlthUUftaultftatlttnitiiltlvntUHiur 1IlthUUfttiltaultftatlttnor21752.0 21767.0 or10936.0 tiltthehUltl lanrl21755.0 21759.0 21776.0 ttJ 21764.0 vu ttvuJ 21879.0 IjICIOIH Ituwr11720.0 IsKinil FItl118421887.0 21891.0 WiUtri 21919.0 ili 10700.0 22015.0 22043.0 i22020.0 UMoi WtluuWIi 22023.0 Nlinf ail22027.0 22031.0 nifi nInrh22051.0 Kn laKnt lat1 22151.0 22175.0 I22159.0 I10864.0 IIINKV IIISIIutnv22168.0 22156.0 cltLIIK cltLIIKNOTJiK tLIJI LHII12820.0 ttrtlrtr ttrtlrtrNu1it 13864.0 22551.0 NOTJiK NUJIINu1it11936.0 Hilt 1UIt22555.0 Ft IlMMCATloS IlMMCATloSLum Pt nr1ct 22560.0 rtu1 rtu1LMaHt 22775.0 Lum LMaHt11780.0 IIIHI 22787.0 Oflln If11rn22795.0 IHit22792.0 hlllnf11t 22811.0 22815.0 v1it 1111v1itNovninbtir Via ViaSUYtIJ ViatiururnbrU 22915.0 Novninbtir SUYtIJtiururnbrU22923.0 ll7 111ll7Notloc 111N iii iiiSutler 23043.0 Notloc Sutler23051.0 10948.0 11388.0 23048.0 liirulir Imrrht6tehrjUrMlhtit Jltrsthat23055.0 JhN tim Jnm 13140.0 JptlntloHnle JptlntloHnleof -1216.0 23076.0 IWI 23099.0 23067.0 Uof 13852.0 111lit 10704.0 23184.0 litTIM YinMf WU23191.0 tlutll Imt lunMl IJIi1 natl notice Ur 13464.0 hfc SteIIIinlitirniliin 14020.0 IIIkIlt intetUua 23311.0 irniliin tetUua23327.0 kIlt III23320.0 millI tnpkr23339.0 ini 11920.0 12244.0 23323.0 nnai nlllu81101ilrernMr IltefrtirrrnsrKouf Iu1IN1MtInhupIM IIIinwjit IIIII4JIIIIL 23468.0 wjit hupIM23459.0 II4JIIIIL rIIIIlittilkIN 23451.0 ciolfii 23456.0 vU titIluutcntiMl IIIJUlcu1tluulrtrsutIutrl Iutrlu ntr ntrNu tlto 23479.0 23571.0 Nu Su23616.0 23579.0 SIJW XItJ11476.0 23583.0 iiiudi 1141uw1r11912.0 IJH Itrr23595.0 Ylt 23592.0 23587.0 lur 23611.0 ttirtillS 23599.0 itof itofNw IItit oftitI ofw 23707.0 23712.0 Sw11024.0 23719.0 ll23727.0 hm fr23755.0 23715.0 likhli7 bhlp23724.0 KMlhUJItrr lUlitfr 12992.0 23747.0 Sft tftJt23731.0 uH4 uH4inwt ItLfllo 23735.0 s4 23780.0 23851.0 23863.0 inwt LflloIhrtiHI 23876.0 MIW It4wllorut ifoiif Iruuf23855.0 wlI23867.0 br bemilrmade23888.0 iirui Irllthnfutr 13148.0 23860.0 Lb llnrfU ItnMlllnrfUinr 23891.0 23900.0 rMr 23956.0 23999.0 inr U1tMr23984.0 atoll alul23975.0 Itoirurr 23996.0 Julnn j1alnJIj lhlntlaelllf Ita 24015.0 UJiua23987.0 Jab JufrJufru JabI24115.0 24179.0 24151.0 11vYIiIf24119.0 24132.0 Vf VfHe r11a 24127.0 24243.0 lie11a24271.0 nmi flllrII baur24252.0 tbrtbrI 24247.0 fIlIWlltw nauwlnirwILnrrr IU 24275.0 13664.0 24280.0 prate pratetd 24383.0 td 24395.0 ulUUII rottuuurel4rrerr 11141 24407.0 glen 12100.0 lf1o 12776.0 24399.0 Jlft4 an424403.0 ruUr4itut ruUr4itutof -772.0 jUr jUrlul 24519.0 24524.0 24527.0 10972.0 fr 24543.0 luMd IlAlt1514rU ratrUti ratr 24660.0 r24651.0 IIU24644.0 rbiiiu 1WutrbiiiuV 24647.0 11248.0 24679.0 Colr uth1Iey24655.0 24663.0 rlpnMrt1 rlpnMrt1tt ia 24780.0 24787.0 11084.0 d24783.0 24808.0 n12080.0 ail uMft uMftHKKUY 24791.0 utWrltf Wtlt12436.0 IraIrat 24916.0 24923.0 iol 11696.0 HKKUY 1111111J ICt 24927.0 f24939.0 24919.0 LWJlII LI911112704.0 MM MMXOTlllt UJt ltutUJtI 24944.0 iar iarttTtC 25235.0 3464.0 25351.0 XOTlllt XOTllltIo XOTU ttTtCIliiatndltnINttalnI 12616.0 25555.0 25567.0 liiatndltnINttalnI 25580.0 -1692.0 ftl 25563.0 jlt 25587.0 ilat 25571.0 IcIlrthl4 INttibi425611.0 lj 13484.0 atut atuti dI 25691.0 25719.0 25703.0 AU 25695.0 lerwltl lIa Harpphurn 25707.0 Ihulltil -468.0 25711.0 AKtlall 25723.0 wtat 1580.0 25824.0 25847.0 tat25859.0 25864.0 25836.0 11340.0 11444.0 V11716.0 25827.0 KNiHkr WIJIkI WIJIkINIt 12068.0 25843.0 tatsa tatsaUm 25959.0 NiHkr NIt 25972.0 Um 25963.0 >bwrbr herrlrttflirati trlrentW U25987.0 JwtuwU26000.0 rtiur cn 13616.0 26019.0 25995.0 13744.0 aI inir 26092.0 26155.0 26111.0 nthr 10812.0 26139.0 26127.0 26095.0 Hun IIU26108.0 N4 Iwttgflnul 1t11l4t111ock rtfc 41Hr Ji rrAioU4 26143.0 1lhh nIttntlaLritrtr 26235.0 AioU4 IttntlaLritrtr lhh 26247.0 nLrll trtt 11740.0 26259.0 wa HIua26243.0 Ibf LIIS 12308.0 Ib Hr Ihr12224.0 26251.0 Slnp4al i4a 26263.0 lJ 26239.0 hl26268.0 26275.0 26364.0 26367.0 26379.0 26375.0 26387.0 iUA 26383.0 26371.0 UWllMAMH 1111h11WllMAMHtiutni fIJIU Jot 13584.0 1i 1iI 13660.0 26395.0 11I 10820.0 26507.0 26512.0 26515.0 tAttNtIIIiI111 A4NwuIritA4NwuIritI -1040.0 26527.0 tiutni tiutniBI 27011.0 27015.0 27435.0 27599.0 11888.0 27619.0 12136.0 27664.0 IJJI5 2256.0 27399.0 27983.0 27716.0 27719.0 4r 4r4RARdaiArlt31 27875.0 27988.0 JJI5 27892.0 ISIf 28207.0 28251.0 BI ttPrr 28235.0 SIf 28255.0 1VMM 13868.0 28312.0 28340.0 VMM 28347.0 4RARdaiArlt31 4RARdaiArlt31Isar 28343.0 ANu -896.0 A4Kil4 urs 12668.0 28355.0 11892.0 fttL UTCTt IsarttL 28467.0 28463.0 28448.0 Vr 28483.0 Iurort 1484.0 1f 28511.0 28587.0 28575.0 kOri 28583.0 fI 28579.0 11532.0 rw28591.0 28603.0 28563.0 28571.0 12948.0 28539.0 28543.0 13692.0 IrtneruT urort 28679.0 rtneruT flrtCrry icnv 28675.0 co OOllllDI GOriottuAU GOriottuAUata iiot 12316.0 28692.0 Ai fIt9 28639.0 vi 1464.0 28791.0 ata It9 28795.0 28803.0 28807.0 28827.0 eiMNrr1 28895.0 29003.0 29007.0 tw 17t1 29027.0 ftf 2212.0 29119.0 29131.0 iMNrr1 Itaaaa eU 29227.0 29247.0 taaaa 12884.0 wIj ariQ1Stwr 29232.0 29363.0 1160.0 29340.0 SWIFT -1160.0 f4i 29675.0 29343.0 29623.0 f41 ce 29671.0 riQ1Stwr 29807.0 Scv 29819.0 xmlns:ns10 ID42 13436 3988 14224 2480 ns10:type 2480.0 ISISEMEh1TS 18143.0 14592.0 15424.0 ADVER1ISEMENTSADVERTISEMENTSCOMMISSIONERS -1972.0 17396.0 ADVER1ISEMENTSCOM ADVERB 16308.0 ISEMEh1TS 16232.0 ISEMEh1TSr -1088.0 14776.0 15544.0 14832.0 rCOMMISSIONERS 15604.0 14856.0 COMMISSIONERS COM -1588.0 16444.0 ISSIONERS 16640.0 SALE GALEGALEImler 17116.0 SALEllIlll 18103.0 tladle 18151.0 14544.0 3395.0 ladle Imler14692.0 llIlll 15056.0 15164.0 3420.0 anI ult15027.0 nll 15631.0 3468.0 15340.0 15668.0 15684.0 uant IIlntrttutt15824.0 16412.0 16668.0 3472.0 it16568.0 16856.0 docreo dtHI1dereo16747.0 17504.0 orofj 17656.0 18088.0 Rs Rsit 18195.0 14288.0 thp14432.0 14620.0 14760.0 HunIIon14616.0 15320.0 I15560.0 15600.0 15860.0 Vllls Wilid111113lulu16288.0 IlI 16960.0 16876.0 16751.0 17100.0 17399.0 theCircuit 17256.0 17403.0 thtthtlhUit 14356.0 Circuit lhUitCourt CIIIItCturt14920.0 15656.0 3832.0 15800.0 15936.0 3815.0 IMV 15736.0 16184.0 16076.0 16148.0 15968.0 16331.0 Kighth liluhth1111hth17000.0 3804.0 Judicial JudlcliJ1tlllcialJudicialCircuit 17648.0 17024.0 1tlllcialtitcult 17027.0 JudlcliJI 14260.0 3972.0 14352.0 tilulttitcult15044.0 3956.0 15160.0 3976.0 15204.0 15336.0 3960.0 Kloiiii llutakl15184.0 Fit -580.0 15916.0 16088.0 wade MiadoIado15539.0 16644.0 3980.0 Ind811116524.0 17060.0 render rendered 17244.0 lIdtr 17228.0 lIdtrId Itd 14348.0 Id14532.0 uu outhttit4136.0 15460.0 4152.0 t4139.0 dnx dt15852.0 16248.0 4156.0 November venlher15679.0 16659.0 1111111 17080.0 17232.0 17052.0 17268.0 17328.0 17491.0 1IltiT 17532.0 111h IltiT 1111111h 14696.0 14887.0 wherein WhIilltvhcrin4336.0 Iun15548.0 15708.0 Lniev 16003.0 16375.0 4340.0 Vouch trlittch17128.0 ei lLet16948.0 17416.0 alInlntn 17284.0 17420.0 1117556.0 alminors 11ml1ltJl4 minors ml1ltJl4Inlntn14868.0 15128.0 4491.0 fir15308.0 15464.0 tlulr tillllthtIV15211.0 16000.0 15856.0 16084.0 16032.0 16496.0 Tiend 16132.0 16776.0 nd 17180.0 1I17508.0 l17292.0 IIJreknian 17543.0 Il lllrckittan IJreknian llrckittan4667.0 Iltlut 14992.0 15264.0 l11ttonuiLi conlpin15528.0 16324.0 15780.0 15760.0 15992.0 pl 15900.0 16604.0 16124.0 unrltimid16628.0 HarHlr17176.0 Harriet Hlrlill liarriot 17616.0 14344.0 4843.0 riot rietlill14796.0 1114648.0 15167.0 Crouch lrt1lthrouclt14960.0 15944.0 15748.0 15948.0 16072.0 16268.0 15988.0 16900.0 ttt16344.0 17351.0 4883.0 17064.0 andwherein and1thereht 17436.0 17456.0 1111WhlIthl WhlIthl1thereht15220.0 5028.0 lhl15020.0 IIl1thIuudcl15472.0 kn knpointed 16471.0 16400.0 5087.0 16264.0 16588.0 5068.0 16515.0 5096.0 tore oro5100.0 alalliOlutttl pointed liOlutttl110111 14964.0 14724.0 hl Illay15416.0 CommlKsionei tettuittsaioatr15276.0 CommlKsioneipublic -1168.0 16584.0 5244.0 16816.0 16872.0 17075.0 sell 16952.0 17259.0 17360.0 17488.0 5256.0 atheroin 17660.0 atIlu1lll atIttthlir 5384.0 public Ilu1lllIttthlir5411.0 outcry 14864.0 nut l1llc15351.0 5428.0 15388.0 15788.0 5396.0 tho15480.0 16044.0 16216.0 5436.0 Prltrt 15940.0 16220.0 5439.0 prip 16792.0 pripafter 16580.0 5416.0 heroin IIrolnhlreinheroinI IIrolnn17591.0 hlreinafter 5587.0 14424.0 5612.0 debt 14924.0 desulbed 15712.0 15300.0 15072.0 rlhttl 15420.0 hltI tit16340.0 uintssUuiers 16440.0 16372.0 16420.0 16488.0 16780.0 q 117240.0 Com 17056.0 Comthe ontmisshnrrs 17355.0 om ontomI1t intssUuiers misshnrrsI1t 15248.0 14656.0 sllltltI 14548.0 15440.0 wtlt15868.0 5796.0 lll1onday 16060.0 16212.0 Mutiiay Mutiiayl 16843.0 16416.0 aity 16336.0 5803.0 16839.0 16708.0 16592.0 17020.0 tin16736.0 Gill lithtititGillLEGAL 17652.0 lithhl tititclity 14340.0 clity14640.0 14780.0 of14528.0 15076.0 5936.0 14940.0 15112.0 lantcu 15280.0 5967.0 I1UU 15752.0 Apublic 16056.0 16104.0 5948.0 I16304.0 16348.0 I16576.0 l9 16379.0 16712.0 16696.0 16616.0 16828.0 16716.0 Sthe srl 17084.0 17344.0 17320.0 17196.0 5972.0 tittitPahllc 3868.0 Pahllc6143.0 14560.0 14664.0 14644.0 14948.0 6128.0 ant14752.0 IIll 15196.0 15156.0 lII 15132.0 cry cly15396.0 6120.0 before befonhtfull15520.0 befondoor 16252.0 thi16108.0 16504.0 16600.0 16452.0 lItllt onrt17160.0 Igoe 17263.0 17464.0 17564.0 6183.0 17468.0 17612.0 17644.0 1IlmH 6115.0 sdour 18212.0 6291.0 door IlmHdour14880.0 111lit14720.0 15188.0 15016.0 15596.0 6300.0 City CitrorSalne l1ailltltlnt16964.0 viMe llthe16808.0 6336.0 hiliiinAlachua 17635.0 hiAIIHll1ta liiAlluhna Alachua AIIHll1taAlluhna15144.0 count tittt15288.0 I1I1t 15588.0 llorlda hloihIt16239.0 Ilia 16188.0 tliu IlIoLLlhtlrortam 11Itillutrtnnlrortamlot utrtnnlIt11Itillht lot htIttract trart15360.0 piece 15136.0 PI 15776.0 15976.0 0115491.0 16312.0 pa palId 16795.0 16360.0 6711.0 reel lutrl16388.0 16956.0 17008.0 17112.0 land lallll17088.0 landsituated lallllsltUllh1 landsltunttnl 14336.0 6836.0 situated sltUllh1sltunttnllying lxlnglyl1lo15672.0 amI15580.0 16080.0 htIng15959.0 tllln 16532.0 ht16772.0 16880.0 till16724.0 6887.0 coon connC01lllconnty 17600.0 C01lllty coonty 3704.0 14624.0 oe14492.0 14916.0 Alaelmn 1IthullAtucinia15764.0 Stntl16320.0 lit16196.0 16611.0 1IOIlIlnIIorldn16480.0 7035.0 11111anti17184.0 anduarflcularly 1111111ltkulally 17968.0 aIIeutfculnn 18040.0 uarflcularly 11ltkulallyIIeutfculnn15620.0 lI1on7204.0 distinguished disttngulshed16160.0 distinguishedaiul -1100.0 dl til1mll11t til1mll11tjfnd 18095.0 tiful 7372.0 aiul jfndiful14816.0 7376.0 described IItslrllllddcscrthcd111116128.0 15955.0 helm hlllIL16164.0 7387.0 Ittt 16536.0 lilltinNorth oorth16996.0 NorthHalf NorthI 17215.0 oorthIialf Half Iialftali14704.0 14372.0 7563.0 14900.0 7560.0 15060.0 of15648.0 Lot 1011111111111nunthrr16048.0 17016.0 Twenty lteentyTwentysix lteentysix14327.0 six 14420.0 14788.0 14452.0 7739.0 15228.0 Matkey MIHIlr1l8ckey15972.0 anil7779.0 nl1l Hudson 1111111111Ilatlson17152.0 7751.0 Tract flntTractanil Tractlluui flnt11U1I1 3408.0 14240.0 11U1I1 lluui14324.0 anil 14756.0 enntainliiK ltll1lallllnJcontUtnlnltwenty ttrnty15644.0 7932.0 Jog 16572.0 16636.0 16935.0 acres IIrllM17500.0 7927.0 ut17376.0 oflantl utland ofland 14332.0 lantlmore 1III1Itmunetll15612.0 less 15504.0 15844.0 16064.0 111Inlhl16672.0 highest hkiestIit 16799.0 8112.0 nnlltilltillhtst andbest nnllbll 3872.0 8284.0 bllhtst14800.0 bidder hidliIbbltlcr14660.0 therefor tlltIdu15332.0 tht 16140.0 15732.0 8292.0 rcfur 111ftr16136.0 cash etllra 16832.0 8288.0 Said SnhSaidsale Snhn 18160.0 isate 14320.0 sale sate8495.0 14652.0 14516.0 14480.0 belni IHIIIJohetag14607.0 15384.0 niatle1llluill15236.0 fIllfer16408.0 16720.0 purpose IUllII17280.0 8511.0 17332.0 ofpartition ofnnd ofPartinn partition Partinn15172.0 nndtimid15048.0 division 11IItllolIthereof tlttIInfthcrtf17348.0 nlld17236.0 andamong nlldnI1W11 andttlnoug 14312.0 among nI1W11ttlnoug14976.0 tltt14876.0 respective resPertIvheirs hlI1hillsInterested J11hrIIHhdInteresttal16684.0 InterestedIn J11hrIIHhdInInteresttalfu-816.0 fuproportion Proport111115452.0 15816.0 9004.0 tllIIIthalrshare hiltshnrly9079.0 16836.0 16804.0 16812.0 lIlInter Intlrlitter17108.0 InterOHt Intlrt litterit14316.0 9180.0 9199.0 OHt ittlUMYill hlIdutltelrln14552.0 tlUMYillThis 15272.0 tltelrlnIhi 14728.0 14496.0 14252.0 Ihi9403.0 14836.0 9360.0 ind adlIardti15863.0 9363.0 ur15728.0 16168.0 16028.0 rrllhol Pr1111116280.0 Itemuhr 16992.0 17480.0 1ipei 17484.0 17539.0 1V ipei15964.0 O9551.0 iiU 16368.0 16528.0 CANNON CANNONM 16788.0 ON ONn nU1HAMPTON iiAJtPIONHAMPTONJ iiAJtPIONJ17460.0 IPlON 16624.0 IPlONJ 15952.0 9903.0 ADKINS AlKiNSADKINStomnilssloncrH AlIKI AlKiNStununlsslouers tomnilssloncrHBIDS tununlsslouerst31DS-1264.0 tomnilssloncrH IInlllllsolollCrHtununlsslouersIInlllllsolollCrHBIDS -1140.0 1364.0 10511.0 BIDS t31DSWANTED 15696.0 WANTEDarc WANTEDhhly 10727.0 hhly 14500.0 14792.0 14768.0 arc 14860.0 10771.0 15408.0 wanted WI1I1I1II15080.0 wnIti 15848.0 16143.0 10743.0 h16228.0 tilttin16864.0 Hoard t1ulLrd1Lutrdor17340.0 ofunty orunt 17940.0 tu111y 17992.0 10903.0 10931.0 unty u111yunt 15116.0 10919.0 Cnuiiilv 15892.0 15819.0 16040.0 ilIH 16392.0 ItfAlnchunllaeltuaAlachuafor Alnchun11ty 17944.0 t1t11ty 14376.0 11ty 1t11ty15004.0 11115368.0 15232.0 15928.0 16020.0 lftol leeH Ivey16292.0 litroad rOlHt17132.0 roadovereers 17624.0 rOlHtI roadOVI 14280.0 OVI 14284.0 11311.0 overeers 14772.0 15224.0 furHie15808.0 15592.0 15911.0 ruMtlng unsuiug16680.0 year YIILIfear16560.0 17276.0 tilde UlduUitlsUldumust 17631.0 Uitls1l1lst tildemust must 1l1lst14684.0 15152.0 hllok1 14912.0 hatI 15536.0 16156.0 16224.0 CUrK lhII16664.0 lurk nrthe17252.0 tho1iretllt tho1llIult theirtiIt 1iretllt 1llIultirtiIt14956.0 Vonrt 14872.0 15200.0 15576.0 iml 1111115812.0 ltI 11675.0 16464.0 11651.0 km 16492.0 16944.0 Monday Mn1ltlll Mondays MondaysI itn 111111823.0 II14764.0 llKs 11827.0 15552.0 ihoMonrd Itotrtlreserves remrvesltIPrlN17372.0 11811.0 thornlit 17628.0 thoI thorirht rnlit rirht12039.0 Jht 10rej 1lJkl rl14i 15532.0 15392.0 15496.0 12027.0 any nllYitltyIII1111lids lldn16508.0 Lltl Lltl11 16848.0 Hono lintOhy by14508.0 12175.0 onJvr n1ilrlittillIhrlIulIlllIlonrdthisl thisdthisnth 12367.0 Lnd 14388.0 nth 14484.0 tla 15092.0 IrIMenber Ierttbrr16008.0 12391.0 15984.0 llj I9il716436.0 I9il7I 16728.0 16563.0 07 16548.0 07j 15832.0 12543.0 15872.0 I12540.0 DAMIIKU PAIIIlnItr1111I111tDAMIIKUCliu PAIIIlnChn17211.0 17808.0 Z Zhli 17904.0 3052.0 14540.0 Cliu Chnhli 12719.0 limed15628.0 County tnnntlIl1nl CoinmlHslonura 16099.0 CoinmlHslonuraAtiet -1272.0 C1I1l motit1 16852.0 IiS 16884.0 16983.0 stuilora stuiloratII 12743.0 17336.0 17316.0 rIl 17412.0 rIlAII 14476.0 Atiet AII tII14712.0 814952.0 11WIKNffiSr -964.0 12895.0 ff 16328.0 FA 16384.0 13r Clerk lINkIerkClerkBIDS lINkBIDS 16979.0 IerkBIDS WANTEDAt WANTEDr1 WANTEDr1At 16912.0 VAt 14467.0 At tIt noxt 1I1xlmxtregular lIJllllurtyululineetlufl lIIlpIlug16204.0 13559.0 uletingof ntofHonrd 17368.0 hQ tbqtbqIlaltrd hQIInllld 13731.0 Honrd IInllldIlaltrdorof15100.0 13759.0 tnnnly15428.0 15676.0 Comnilnnnners Clll1ll1l1tlntnllrununlsnlnuersKd hOblioKdheld 17620.0 hObhthl 17844.0 13735.0 ihhl 17896.0 hthlhhl14736.0 1111ouTne IanInrbuy15896.0 IhtheTti it4tiny day16620.0 dl1 17004.0 or17272.0 Jan JnnJannary Janinry 17816.0 14272.0 14099.0 14148.0 nary 111111inry14839.0 14123.0 riis IIIS11oshlel btdM14156.0 14111.0 trlllIIIreceived tlcllvldtogforhire forhl1 Lhire 17876.0 14275.0 hire hl1 III14936.0 eon 14299.0 lIllkh otitlul15208.0 hiI 14339.0 15720.0 fIIfirenoilng ImaelagIIIHIIII CII 17136.0 17364.0 All AUA1117104.0 Allbid AUhlth A11hid 14463.0 bid hlthhidshould ylauld14504.0 15399.0 sealed imalI15524.0 tolllIl 14468.0 111111addreHflod lultJrmuiodnddresnedaddreHflodto lultJrmuiodtonddresnedI14268.0 14707.0 14416.0 14655.0 111I15176.0 14651.0 Vnnnet 11ttngtlIlI 14695.0 otuttylIllt 16700.0 Cllrk17144.0 andmust and1II1lMt andankh 1II1lMtankhIIIIIIhand hlllld15192.0 IanIle 16740.0 1008 1UON190816632.0 Auyii 17072.0 Auy1III1ld Auy Any14988.0 desired 1III1ldtslrd15007.0 Information IlIflll1lIitOIlInfurnlaltoil15047.0 ran1111heohtnlnudh obtain obtainfrom nhtnlnoch ohtnlnudnhtnlnochfllIlII 17688.0 15183.0 fllIlIIniil 15195.0 ltI1blur15292.0 15052.0 rlrht rlhhtlIJ tfl reject rejoct15191.0 ICIjL 15219.0 16784.0 15216.0 BnyBnynil 17424.0 OC OCall 15291.0 Mall 14248.0 nilbids bllh1bi15t14908.0 15404.0 reserved reservedj 15476.0 tl1ed tl1edJ 15432.0 1688.0 15543.0 15547.0 nUnAMPifm ilAMlIitlRnAMPifmChn ilAMlIitlRChnfJR fJRr 15719.0 Chn 15763.0 14716.0 15723.0 1I00lIIIIlOBrdConniv 15740.0 omntlCommlHHlouorB lI1lmltu4InuafConlnllyelouarAt17768.0 17860.0 17812.0 15899.0 xmlns:ns11 ID43 15112 4668 14156 15920 ns11:type 15920.0 WIKNfKS WIKNfKSMilI -892.0 17784.0 tUII1 17832.0 14668.0 16195.0 16284.0 MilI UII1IIl1KOK ttOIlUlt16380.0 IMVdltlv IMVdltlvlii t111 16116.0 tlttIt tlttItin IIK 17696.0 j1In 14244.0 lii16599.0 ihr menu Ii1Ilit15284.0 IMuri ioiillt16587.0 Kinhtli tiIitblhlh Julloiil ludleltl1lroultlrelllrrCircuitV 17792.0 16679.0 rI Aitrhen Inin 16735.0 ImuiM 1nntt16723.0 Pi15640.0 Intli 1tillniery 1tillnieryitulr 1IImlftr rv 17156.0 rvKIIC 17512.0 16855.0 KIIC 111111itulrHiohv IIIuhthu 16859.0 16847.0 John JubaHunt Huntof lIkIOl01er Iii -1076.0 U1 Unler 16988.0 Unlerof 17780.0 16995.0 IIr14708.0 1iitilliitiliin 1hlltlllIulIIokltentlon14628.0 IIIInii16991.0 fin furtorlUxnror IInnirlUxnrorIt IInnirItIItllC IItllCIt 17207.0 14584.0 iipiicHrliv HptIIprllttIKrll 15412.0 17216.0 IIullliliixlt bttkhtlt17235.0 IIhl 15980.0 17239.0 16356.0 nii upprlldtI1 iimUi1 16607.0 10tlm thltIltntlmhill 14232.0 17343.0 hill 111Illid tllrl14604.0 14884.0 ItlItsIle17359.0 nlt 15652.0 Muted Iuthilt IhllldullJotirij Jotln14228.0 17476.0 14436.0 llnxliM Ul1xh17479.0 iIa irt 14600.0 17483.0 tii 15068.0 IhIcii IPiNitHii ltllliiut15700.0 t16095.0 IiiItnUlyd imutcilU IIIulIII17447.0 IMrrhplrntnf 17495.0 IVvlosUlciit IVrlohIIll1r 17615.0 losUlciit rlohIIll1rrrhplrntnfOIK Liu17627.0 15324.0 17619.0 stntr SIniltInt 15840.0 oMlorliln I9nrhlnt Inrlll Ihiit lhlllshuthn hittm tmliitMi hail hailhu 17752.0 17708.0 17744.0 17748.0 liitMi hu17767.0 IUaisle 14784.0 15088.0 17772.0 17751.0 far lorfir iiiifi woruIrtlniii trillthan15828.0 16484.0 lity IrttilnVH IlnVdnyv17763.0 nn nntt nnttrt 17584.0 17444.0 17524.0 ttrtaAhM trtaAhM 17908.0 14408.0 i1llitf 17880.0 lidthlInlir Ocl1OmerrIlllllliJHlllltl ullllhIiihllaalltrn17123.0 1X111 nlt41ntldnlt41tOIltIII ntldi ntldrnurrKlu icutiiKit 17520.0 17899.0 14216.0 18004.0 18011.0 rnurrKlu tOIltIII h1u 18019.0 18035.0 eI 15556.0 Ihat 15804.0 rrtinr 18016.0 of18032.0 IlrUftU prIUrt16968.0 prIUrtrnnnnt 17440.0 1IIIIII 18140.0 18159.0 cutiiKit rnnnnt14396.0 18167.0 IIIIII 18155.0 Iii18152.0 Hindi lIuhnudr18164.0 Html npoulirti hlnhntint and18147.0 llimix Ihntn17248.0 lenoprrnn 17576.0 noI tInlllli 17775.0 18303.0 18300.0 Inlllli prrnnIMOII III18291.0 t14828.0 hllhitSHtr 15328.0 tntp litatIUiriilii IorldnIflotl 16235.0 18288.0 L1ntirrrlim mennill UrapOMiipociui po1pornn 18399.0 18427.0 Miipociui o1pornn18439.0 18431.0 mi 11118408.0 wliiin hnin15572.0 18403.0 iilril15356.0 18411.0 r1 18415.0 siiil old1rflrd iirftriUrt hlht1ff1t18420.0 lpl ml 11lbUit 18539.0 18579.0 18575.0 118572.0 18556.0 hf I1rrh 18584.0 IIf 18551.0 18591.0 18587.0 18560.0 UIlliiur lliiurr 18544.0 Ihnturcltrdur Ilurrttlrertlurluht Ilurrttlrertlurluhtthlt -1360.0 18671.0 thlt411 rrbtrnt 110111111 15792.0 18704.0 luut Ur18676.0 16456.0 18680.0 16764.0 17048.0 fe 17208.0 IJcfQt hntQt18803.0 18819.0 118844.0 18847.0 14740.0 18823.0 18828.0 titto18835.0 uitvr 18859.0 l15771.0 18807.0 Mill ItlllIilil18840.0 IIo18812.0 Illtilt01a 16924.0 Illtilt01ahed iicil nlIII 18939.0 18952.0 icil hedlii hiino4uur 14680.0 18955.0 tniii 101 18971.0 IMIII 18967.0 1111aUIIrnrInfore fort MnmUv 1ltitalaYMuratl Ibft IbftliiniiKt L1I IhL1Ith Ihashdnrl 14208.0 19072.0 19079.0 ashdnrl 19084.0 14904.0 Iln 19087.0 liiniiKt hllllll1iuunart15744.0 16036.0 19091.0 16300.0 luH 16256.0 W19075.0 nilirrvrUa hrrwlu1nlhrrwlru19100.0 tU thtUnf 17472.0 theallIAI Ibis Ibistttititatinlat 19208.0 eallIAI tttititatinlat 19215.0 15040.0 19211.0 litkiidl YutdhllillHail Mllba tMtilUcil lIIII1Iiktii19232.0 111004 111004btalll COO COOMitt ODe 19295.0 17560.0 19340.0 19344.0 tIIIIt 19347.0 Mitt btalll llV IIkllhIHIIHlL 14744.0 iVM -976.0 tlfllHlHIlt IIflIHIHhttlfllHlHIltIt IIflIHIHhtIt19351.0 dIt 17664.0 19471.0 19479.0 1fullcr hi19483.0 1I1r thr19476.0 iinlcriit nrirradUnit LhlllIhu119492.0 trUnrdrr ItIIrl 19507.0 nr 19520.0 lrr 16703.0 IraIttIhlinil pttot uttbMuttbMIlrhd 19607.0 Ihlinil Ilrhd19635.0 ununI 19643.0 R19612.0 Hiik 19640.0 15924.0 19619.0 tut19624.0 four fuurevmNrutltl11 evmNrutltl11Hl 19739.0 19772.0 MHl 19751.0 ock 51 15008.0 19743.0 Ilti Pte19755.0 19748.0 tiltir 11Uvlll lnrvfhvlli tan ttiinHitIHl grwrptllte 16655.0 grwrptllteInbl 17388.0 17304.0 19875.0 19884.0 Inbl 19919.0 hh 19924.0 14536.0 19908.0 19879.0 IHl I1 Inllll 15372.0 lOlllllt ltIltlllh19899.0 rIIIIt 15904.0 Ullll thil19891.0 StlltC 9ttttStlltCh 9ttttl LIH 14368.0 20004.0 14448.0 20016.0 b1 20011.0 20020.0 CIIhe hid 1It thine 16024.0 20131.0 20175.0 e14896.0 20140.0 KWIUWUKSrieri 1lI1u1K -1208.0 vs 4I ru 20147.0 tri trilir tr1nUnurt tr1nUnurtII 16976.0 PUro 1Ilf 17764.0 20264.0 IlftIIIVS I17140.0 OU0A 20407.0 20412.0 trot triii120436.0 rniY 20440.0 IIJ 15119.0 IIriifltliml 1111111111sdilnnlsdilnnlISnl iifltlimlIhPnl 1111111111Stonl 20511.0 20535.0 IhPnl StonlISnlS1i20539.0 n20544.0 t1IU VllistJKS 15616.0 tiIKSIrkIronltCAut14 tiIKSIrkIronltCAut14nr -1992.0 20551.0 -1848.0 16112.0 Crle rV Clroulti ClroultiMV Iroul CfIfL 1752.0 20675.0 lItnr16180.0 fiirvKH 16208.0 16432.0 yeH ItUif 17148.0 OUOIf 2388.0 20804.0 20807.0 ItMASON MiJNMASUNhulr SlrSulrfuroinclt cIIInluugdI16283.0 oincltllllI 21248.0 llllIIUtt 15564.0 21259.0 UIt UItIn 21255.0 IoIWY VUIIi21339.0 yfn 17676.0 21471.0 fntbt tb21475.0 rrtrcult rUfOUt1tult21480.0 Ctwrt IYI tsirtIUlit ISltllltJbUIIitItl JulIitiiuJowiui 21455.0 Ciroull 17119.0 trouhi 21607.0 AIMnhua 21616.0 hIIH Jowiui UnutlttHIlt KhirlU ehutlaittiani nlltflltiunnnryut tiunnnryutIrlt iry rUrI 14612.0 21739.0 21748.0 Irlt UrI Urlrli21771.0 21743.0 UiHi I4iNhniK tllllRelate16316.0 16916.0 Urdu OrrtorOrdarQfQfII 17548.0 21872.0 ItfoirT rr21924.0 rTlf 21968.0 Pty 22036.0 22055.0 22079.0 14520.0 22060.0 rppvltkr 22083.0 lf liHr 22063.0 22067.0 rfk1i ai22071.0 airy uli ltJtheil tbbUt bUtI bit bitnl 22191.0 22199.0 22203.0 22196.0 22208.0 Ihr 22227.0 N22212.0 41 iir JItIf1tr 11tw1aarJItIf1trI 11tw1aart22360.0 22332.0 IIlieu 22375.0 22327.0 ilii drr22363.0 22347.0 Itnl IwntIh1fIlI 15996.0 thcioi 16172.0 22355.0 illnIilnrt isIniti 14511 iti 1122463.0 1522496.0 lhrhiitf 1totr15436.0 uut 16051.0 Knrtilii nrbin 22471.0 22499.0 hitItohnulivril hbIIh 17384.0 hIn51 22599.0 22607.0 In51 14384.0 22619.0 IIh 22604.0 ah ulivril 22611.0 22623.0 tlluINr 22628.0 dsri thsuhilt Mitilu ilur IIIIJ 1878 PO 110POI 110pre 22719.0 pre 22736.0 22731.0 lItta 22759.0 ttil lbl22740.0 Un1at22724.0 IMCHM Itiraiitlill IIIunH 16820.0 Iol iieellrx nHill 22863.0 22867.0 eellrx Hill 22891.0 huw tuatr 22900.0 22872.0 tlwt22883.0 22879.0 iT Ilitlirlltu IruerlllirlltuIt IruerlliNt22888.0 CM CMMl iNt22999.0 23036.0 14588.0 inrNlrU 14747.0 Hirnl lflfl 23027.0 uin 23031.0 23003.0 hMi hliiI Ina23008.0 Past 111thflfP therilIH Ift 1llrn 23111.0 23151.0 llrn 23127.0 IH23135.0 tln Ih15304.0 23147.0 iMtK IKt15583.0 23159.0 lorlitit hultIIr1dM23144.0 i1UI23132.0 Iho err erra Uj UjMmN jtIl 23247.0 23295.0 23280.0 autirgn4 tIl 14699.0 23292.0 MmN 23299.0 23287.0 rib 15140.0 23275.0 AiKiu Ahml 23264.0 wnjil vruti23259.0 16276.0 23255.0 hind 16448.0 nM IAh1nMI dul atf atfIt 14236.0 23395.0 23411.0 23403.0 Hh4 23407.0 14844.0 14984.0 airs 23431.0 ftllr23435.0 oi 16200.0 IwratyObis iwnotf wHr23416.0 OilIt 16928.0 17092.0 yyIl 23519.0 23531.0 Il14364.0 23539.0 Itrt14300.0 23559.0 14464.0 23536.0 tlli tbrrrfurd 23564.0 -756.0 23555.0 14944.0 15500.0 r4 lint IIIlthl23548.0 rlldgiii rlldgiiitrMin51i 23527.0 MI4II MI4IIIt 23551.0 44 ltu 23635.0 23667.0 Ic 23663.0 rwliui trMin51irwliuim rwliuiIn23679.0 23695.0 23675.0 I23672.0 bIrret hcrntrvroriuir roriuirCoiiiftliit rev 23659.0 raA raAaig rOfllrlNl 23823.0 aigear 23811.0 Lit Iu23815.0 23795.0 IUt IOtnplAIil IOtnplAIilIt 23783.0 Coiiiftliit CoiiiftliitIc 23787.0 UIIIII 23799.0 2840.0 23939.0 IIIt23935.0 apt I23963.0 23947.0 rJrlfG hre 54Htlt 54thh 24052.0 24076.0 tlt thh 24067.0 14732.0 15084.0 24071.0 d24055.0 gar 16191.0 24083.0 Arthrrwtlr 24203.0 rthrrwtlr thw 24200.0 Illt 24207.0 litofu litIe Ofbe 24268.0 24339.0 24360.0 Ie Iattnh llItth uhrr 24336.0 24331.0 24320.0 atiI 24363.0 Aefen494 Aefen494it 16428.0 24323.0 tlee 24439.0 24459.0 it24471.0 14572.0 24499.0 24503.0 24475.0 Irr 24491.0 roo 24463.0 115141 IIjItinier PrWr17012.0 lM lMfuur IHS ltd17220.0 24479.0 ptlfr ptlfrUblri 24484.0 24467.0 iTt 24607.0 Ublri 24639.0 24632.0 14804.0 mIer Guur fuur annuLif annuLifr onw nllwrtt 3064.0 24712.0 24747.0 wrtt 24740.0 24731.0 24743.0 24763.0 24715.0 rrrf tolUO newsia newsiaIi 24855.0 24888.0 24871.0 ald tIr t144 24867.0 i7tatq i7tatqf1lla Gtc Gtcr 24987.0 24991.0 Tt f1lla 24999.0 UA 25027.0 15180.0 25015.0 v4111101 O7 O7K TH 25120.0 25123.0 KIIIIill WINjV W1I NUt44 25183.0 125251.0 25275.0 I25271.0 ter 25268.0 aOiurl ours 25259.0 Atm AtmM Atanul 25287.0 25263.0 euCoM Co1M 25291.0 25283.0 IfJI IfJIIt dII 25387.0 25391.0 ItIIu25399.0 CIIttW1ILii CIIttW1ILiiA 16260.0 16396.0 25395.0 25472.0 25404.0 CJ 17036.0 CJI 25531.0 I14512.0 25547.0 25559.0 25524.0 Curl ur4llNI ur4llNIhrI 111f ni niwihTciKH 25607.0 25660.0 25675.0 hrI 25683.0 25671.0 wihTciKH WMluV425648.0 11Il 25651.0 IfV MtirU Cllfrleeek25655.0 rirniH lrMlILIrrullCooteContiIh25796.0 MCtSI rHKVKJi nlJw4VKH 16868.0 DO 25799.0 17224.0 25808.0 0If 0II 25923.0 25935.0 IIIffft4 25947.0 hrlrIUrrrrpll hrlrIUrrrrpllMrro -1268.0 hftlftt 25932.0 25951.0 rrtpl 16596.0 iHi 26012.0 tNrrra 17516.0 26319.0 Nrrra Mrro26324.0 ruc IrU26327.0 lI11t1IATtON lI -1156.0 26331.0 TJ4 TJ4A14 26460.0 26543.0 tallt 26551.0 A14 26555.0 kt 26575.0 ae 26568.0 NInln itllneMrlllrl ltUl 26559.0 11NClntobr 26563.0 Vie 26679.0 NClntobr iuteenbnr26695.0 ZlrYrl ZlrYrlt 2860.0 26811.0 26831.0 26824.0 26843.0 HUfrriy krrrlv26847.0 26819.0 irlvnn iltnfl26827.0 IbaJIhat26815.0 holed 4olrtl4olrtlf 0110 26835.0 I26839.0 26943.0 26979.0 itur1t Vjr1ca26983.0 26951.0 rtr 26963.0 bad 26995.0 26975.0 26955.0 Nk Nf4 26987.0 nottof nnttodtdo nfMofii nfr MI27083.0 27127.0 27115.0 27108.0 M27099.0 tImmc Iria51t27111.0 pima tttr ero 27123.0 27087.0 lrtgof1 trpof JJt14168.0 27207.0 27256.0 t127223.0 tk 27219.0 die Hrxnttfad ItnmttItIlnmt 27235.0 JKMf JKMfAMirllofHw ttR ttRitNlra4rut itNlra4rut 27367.0 t27359.0 tc 27355.0 fOrtheWi1e 27363.0 lUbe 27379.0 27392.0 AMirllofHw 14308.0 fw 27503.0 14524.0 ItC of4w 27491.0 11Hirtlm Hirtlm4Me Mllrtlfm 4wtbrnIfTope Tnl127608.0 Rails H4114Me 27611.0 litPop5 aM rx1 15344.0 U4t 27623.0 Mb uldskiproof trwjfoof 27627.0 wlflwilliM tietiethl 2748.0 27747.0 27759.0 iM fnre 14276.0 Uethllteukterard iftfUter ICukter27763.0 aDd od 27751.0 1tItreefret 00irer 27767.0 tUf tUfYtJ1 27775.0 atrtpi lrUH 2116.0 rUH YtJ1rtpiNa 27911.0 UltIns27880.0 27907.0 riu rtuar 127895.0 ivoh 11111IiIklivohH 11111UIiIklIan 27991.0 U28043.0 28039.0 Ik 14556.0 uHtctrt loa Utr following rolllttnlrrollnwlrtlfwlwceir w1iAMcCKfUl 28059.0 28047.0 28063.0 28068.0 28143.0 28155.0 ph 28159.0 28179.0 conUAurni ItUtoUNftcaaUnuourc rotlldt 15316.0 CIdtIlGII dei 28183.0 sloe oe 28187.0 ttpopUPOIIaC14 aod a0d28171.0 diitUi dutdrltrdiitUitH 4tuttJ 28283.0 28287.0 91tbc tbnUnd buld28291.0 VU YIIvizVUJ vizJ28380.0 28423.0 M28415.0 Kleta UteklIftokrl28403.0 Yldtikber Hct 28427.0 ber nel 28435.0 28439.0 Kowl Yow1fYow100 28475.0 17200.0 28547.0 28556.0 Ward 28559.0 firIiJell Itoll1M1inI V1orn V1ornoct VIorlltr 28687.0 oct d14196.0 IfKNKY iltNlCYtllY 28695.0 8 8U CUUI1U1re C1IUqulteir 28772.0 iA 18820.0 18792.0 29091.0 29107.0 INIHTItATOKH t14lNISTIIA7ORIt29099.0 -1444.0 KOTK fOTtrorOKCHA1U3C orCHARGE 29211.0 29279.0 CHARGE CHA1U3CCHA1U3CKotUie 18740.0 fi4otlre 18784.0 29499.0 KotUie i4otlre29535.0 15032.0 29503.0 bervbr batnbridreo ids9tt29516.0 29531.0 29527.0 alter oathlUi Itsfter 2896.0 29643.0 29647.0 kfier sfterlb tha flf dot tnjbHetuoo Wbgastba29659.0 of29655.0 Usbsdtif hkr 29663.0 a6tfttrr a6tfttrrto 29771.0 29775.0 AdmtaUtmtrlx Adsnlntittattls29787.0 Ite stnentile tttt 29799.0 M18696.0 ts tstots 18808.0 29911.0 tots 14188.0 29943.0 itf detoserd 29936.0 UU 29923.0 aid aari 1n 15884.0 29955.0 29931.0 n4 29939.0 MCouatr farnesc 30051.0 Yl8 30059.0 atau 30083.0 30091.0 30067.0 KMoo 30180.0 30207.0 Moo Couatr Coitatr30187.0 Jt4e as111gefew fedpw pwN 30215.0 30311.0 30343.0 30323.0 euCA AdmiefaUa 30351.0 30319.0 IIV4 30359.0 30459.0 Mmw XA XAAQ 30587.0 AQ 30591.0 ofY 30667.0 30599.0 1s 30739.0 30815.0 16891.0 30819.0 18220.0 iiVI 30927.0 VI 30935.0



PAGE 1

ACHRISTMASCOLLISIONWeekMondayPfRlSHfDIECE11BER3UGAINESVILLEThursdayPublishedx-rWFLORIDADOLLABMONDAYBARBERGODWIN-SUlldarIAfterI-rtnlioceONSPfRTwicefOG1-pImmcdlntflyafttrACCIDENTCHILDRENGhrtttmHUSBANDXXVIIWednesdaySuperintendentREGULARRailwayFireEntertainmentInjuredFamilyPOLICEOrientalAliltinu-mervhantCAMDENsuperintendentHungarian1PennsylvaniaentertainmentPersonsAlbanPennsylvaniaQuarterarTel-ttitresaccommodationBIRMINGHAMImmediatelyPOWERtwentyHhreollftteheoaubbeoul-IntornattohtBirminghamaetaF-irednalngsi-lxteensym-pathizingJ5Mendelssohnsdutltrvyl-ShotBurnedWatertownacuommodatlcextinguishedQuoon-tXxraB1000UUU-MuchdepartmentsBirminghamsufficientlypariMits-tfihatBirminghamandnnJ-IrobAblr13111250BostonWednesdayEntiresplinters-ThecompromiseprohibitionWednesdayONEplenxnntlyMaliciouslyintelligenceyarncompletelyenterprisesapproachedInvestigateLepldationproprietorsinformationwreckageu-quarrvJtsidetermmlprohibitionap-propriateHungarianam-isiulrrolsUBsemblluKJacksonville1007MaceleimydispositionAttempt-edadminis-teredVOLsays-BecausecombinationElopementtelescopedcninttltngpreventinga-contolntnccautiouslyDYNAMITEMacclpiiuycafeatropfcRestaurantsThreeeightysixeharcodThursdayPoisone-FinehvtffllatureMJns-cotnerycounty-wkLoDozenChristmasChtlBtrnaBCelebrationAuxiliarydostroyejExplodedChtbtinM2SRcl-1erCuriouslythoroughtrimmingabsolutely28rThreoaffectionateaffec-tionateThurdayTownsendotllclatlugDeathregulationplanneddispersedtruthfullycHobratlouwithdrawnKilledaftwaCKmolopomontdifficultiesChristmasTkur4ayafternooaProhibitioneoarch-ThoDenoeumentemployeelnatulUJpowerlessIa-WlkthtktSuddenlywholesalePembertoncomplaintPombertonbuildingsdiscoveredThursdayprominentpillagingcharmingSensationalwreckagelocomotiveIndignantDecemberfortunateThursdayafter-rteataWeddingnaturallylynaniltoThursdayWIFENEARBethrothalattemptuneasinesstrimmingOregoniawholesaledynamiteshootingThroufhbreakingPromptlyDestructivehandsomeexplosionImporantwholesaleSALOONSneighborheadwayBlowingf-ywterdarawombly1500lynchingtreasuryon-CtartciassembledJtncttsioascenpofprosperoustuunlcaUonestimatedappearedviolentlydaughterbreweryKtskrUlerestaurantexceptionGalbralthHundredsMassThroughregardedengineerOrientalsrestaurantdisperseordinance28HFlvoAbbevillelliv-slontryconsistedbreweryFatallypreceledbaggageCrematedNearcampodpleasantRldoroblectrcula1consistedWoundedwholesaleaddroaseOieverolyJackfcborostcrataryUNSAFEshoutingrun-knownsoutheastColumbiaexplodedrailwaydaughterMeirltimnChicagooppositeInjuringtrouble-MrwrockuccRearEndctaidultHelpersfollowerschargedtogetherportlymorningPROVEDseventeenRaidGoodmanreceiptsttt4le-aw1tprisonerroaminggroundTbursJaFranklmweddingGoodmanbusinessPleasantslippersbe-trothaltHuullnghospitalSkatingi-fiaoneabuslnetathroughElevatedhospitalCastletonTHKKKrelativesAIUni-Heburted-Ureachedrm-AudrllfJammedROBBEDDuringPOCKETassistantAbsoluteroughlysmashedharmlesschildrencom1lovo-idtfliGoodmanBrudloyovenlngAndrewsAbbevilleGeorgiapassingwarningmemberproceedCitlcagtclosingstructuresmashedsmasheddUpaopropdrtyAtlanticwhiskytryphloadamagebusinessdistancebusinesspassingCofnutntwhiskyTrinitychangeWindowcollisionHfiuhertstrikingDusanuskatingdrownedsmashedavailabletanoogalookingltttfposition48216afterutxmPortlandoccurredwreckedInvolverGeorgeRaleighQuuatlotithroughquickly4UreodAilrirfYolandeMobntructureDvputycollisionwhiskywhiskycon-veyedae-wpoNOSThoItiHauisbargaincuttingvictimstakingRutlandThievesFiremenbntwwnyflFILLEDpreyedtrarislyelevatedbtrdslmtcatupodCollisionChildrenrowedregularoccurredunifiedAtlanticbecauseOamdenwhiskywoundedAtlanticturnedelevatedthroughv-GohroffftoAleachildrenoecurre4AtlantaQuietlyspecialanotherwhiskyordi-naryMorKanlicenseswreckedCooperHnglltxhSDantowelfurcactbrotherpopularcleanedcrueltyChinesedrovneproRHHaknockedAaccidentReportrun-ningcoachesMorganWlnonacapitalInjuredStan-leyAtlantaCamdenminingpermitTillerypeoplewhiskyhli4Leosburbrigadecltvirlybabieswidow-atFriendsPeoplehntatwhetherhavingnnshtyUnrulyGYPSYsaloonsTiringrospectfiremenar-monttwInjuredbecauserailroadaccidentYoungknownFingerfatallyUldrcnwaitingwreokedcaughtAngrycenterfiremenpresencefriendsImRgidfortuneWarderwithoutEdwardwipingmotihorMorganfachorThesefd-warttsrailroadblml-tboJerseydeclineandpinnednegroessaloonsnumberconcheshlraaGodwinpersonskillingchurchpansymnrrlodreachedcouplepayingAtlantafatallywithoutcountyPembertwentyEffect-IndifficultpersonsdaintydealersmarriedbridgeamountseveralhousewhitesFridayBuggyriilif-upoisonfallingMayorCausedBecameYorkManvlivCLOSEwindowJournalmomentgentlechiefsmiburbnlmkenBranchexpressSeverallunJIIfatallynegroesgloveslIunnJuntort-4ftthGeorgeperfectLargeoclockGodwinthrownfurthertwentypoliceamounttaurantGodwinoxprcepersonsparlorhousesmuzzleRancherAndrlffSeveraltivcaniesaloonsbellepr4PhilippeopleburnedMarketAllklnfriendsfriendspocketalmosthousess4rvedAttackcarriedlovelyLOVERQueenservicerabbitsCoun-tyArrivalBuffaloparlorpersonspoliceBoene-4fapoisonamountDlfficuliVnamescooledCAMPfortuneAdklnexpressfinvlnupoliceGod-winHunornearbyPearsInvltodhousesUUKSOhororsaloonsseveraloclock44servicepoliceAdMnstaurantFatherhousesRescuemissedglovesitesslonoercmnnfC-otKhtfoundventurefinallycertainstationdenoeuRabiesfrontsIndoedCHIEFTracksbrakesQuoonarrivalWoodscitizenJarredOccursAlsophousesstationstrainsalmostCUrlliquorcausedbeforedinnerthrownhll-OXKsta-tiontowardsa-loonsCentertru-alepulitdsuburbattackotherswinterQueentuKlugfriendsBarberriotersgatloughostsKnowngivenbeforetnhesvaluedflttslBricks2SAnAuilrlffplay-edUUIotVRamosTeeterstationstationuluuldbeforeanothebehindaffairsporchmightbareltenderCanineBarbernSghtrestedliraslookedleasquadCOC-IUcanineknownacceptthirtystrucknoticepatchcitizenreaeooares-cueraktUt4fatherJiutstothurfarmurresult-fDomtkrp4JribbonBoyswouldprettyularlUClerk-JpersonauAMRlbuyfuturorabbithandshousewhichprettytrainsrubbedThosofatheramountSOONratifyshopsunttroPoliceTherecitysSHOTlocateprounaidlililnjtttjTlaurounderdlslusHouseschoolUponThreewhichAddedPersonridingMateWITHmouthtrackscltydharpyaboutIIIkuwhoseVskMhouwhouseBulletbridalSmithreulljquirkpistoltherebeingrearedwhereParlorSHOThoueoCatchI-IcenhcsBullethoardbeforewreckfatherpistolwhichdozengabwhichrstoodMarySmithTherewhichtableskithDregclosedMarchKa-ibutnnpetmilescalledbadlyPoliceyardsextentWhilegreatQuitebadlyTncywhiteWHOCattleOrion1GlenndeathtrainswhichIVheoNJtheifSmithcallwladdedplocutrainswreckmatchothergoingsixtywherecrowdWIthBodynightlllghtplacewhichzst-heTheywatchTntrsearlyhousochaseDoraKilledkilledtrainsLOSTboyslargeaboutdoorsClarkDorisdovesSomeeventsAboutoalJslcrowdunderurgednightmatterbusysttf-tCaissuedThesesourcelimoquietcitiesrestednightcto-offcoraglv-enthat-ItClarkTheirnouna0lf-IvlargeClarkctlnKpartyfourladlesznaBronxnodeunderstoneswouldwhiteshoesotherhomeuibttkllHnhouseThereyoungW-anbodyClarkpartyWAShouseRomeagedunderyoungactonundermUUvlDeathKingisaiiRotherwhitenlxuthomebattyouteref-fectIhrewhiteMttlestreetCentsyoungJohnKingresulthousepartymoretut-dineftectexactcitiesdoorsD000theytakenyourthreeTVantheseFatalItaiicInvescircleLaterdownlenda-1terDockampthreethreeDeathwhenthreewhlloknowttijchtktitttIlexsaboutunderyearsreturnRatesFromInertstoryruinsMllesFINEJohnthouqueentfTctroyalafterwontKingunderdoubttheredeaththosenitblackpartySucharrestmnrteagedtrhlalgivetheyPrattthickandstreetmilesgirlsHeadknowagedtheirhomotrenddroveWHhKIdvilkohelpwhenwomanboysrumpwhenRhoultxyaldealStealkeptparkmadewhllototroacheffecteverydogsraveaoCIJhhotsdeadpaidtoctarBIRDwhenclockdresstheremanyponddownrescuefromIVickquailcampmadekeptaNtMissdownbridedresswhenthoyasedtheirJohnforcemilesGoeswhntkingdownThattangtheynrrcKtand-sboysSusierightmadeafteclosesinceyearswhatthlniwinotrainpondCitymanystreetEdnaltunnaboutroomStickNtidshortthorncouldtherecarryeffecttheirgiftshavefromKatesweetCitythereMlkohtiiRpondMatskauwJohnleastspoutthoustttanworkNextciderSometliosorearsNonatheirtlmlrtreattheiruntilpArktholrfromafterflllodtimidfromfromhavetrainChatdontworkcampU0WostyearsyearsBothbeenfrontThisChiefawaytrainJuneyearsJohnfrontbeentheyMissbendslblowontCityHuhlittleDoradrewlittlefromhtttttex-actCitybagettostowneretheirdonewhattraintrainfrontcrlefrostcitycausebeerwithtimebandkegstrainlatchParkwaterrruntyboenMistPoorhurltraintotebeerstateCityleshandlocaltrainvoiletimeawayonlybeencoifsrantsctrlilrtsldonebothfrontBeenthanwithfrontfromhateuixxloulycampQpvladyLokilepttwifektlcvMotnookHADthatboonfrombeenmarkwithfrflmfarmQratneckr1tghootfrombeentlreIDOGwithfeelsilYULTheWaswithinteruntilsamertoithatbeerbeencountawayWasFirewithherecomegreatfrombluetallcityDaywentbeenyeareachCamArilsTVeHalluponna-lqr-andMimjustcitywithwithbeenamtMissIthonftlthwentwentThodiedut1withmentablefourtrneecityShothereThewifewithGusThofacetookfromtSlaFireopenornorthatbuslbutthancausetiescitycametakerletMiirhimtheshotboylaywell1907scenebeentourmureverybuttookthatearnShotthisthatladdatebrOkThedaywithcvttjThofirstfourwontshotbestfcfAwamobThoWowsniffsneverSimwIDwithTheInto1111somethatTheIntohereTwoThoveryDeclatecitymorodogriOtsomeThe821SumThoTheThoFiresaidsaidThosameHomomaythinTheThethatwhotionwifeAwellmoretltpfirstlitherendhalfJustAndwilltIthaDechadverytakeOilsThosaidwhowilddogthatwerewereduetUyhimweretwomasshadthewillerewerewhoHershotandIntoTheIntoIntolacedaymostwhodryThemouncauselOUrworowereTtetallThelatecoathodfactsafewilllIoGverygirlwereDeogirlIiwereIntobestfatedrybuyyettakeutrA-fOnethrKMIThoThewhatrantbullDoowillandgirlworewereweretoldlastDecThethislateTheIntowasposhotthatsaidThftshotgypsofwillthisshutHenantihImwillandHexhadNlrteuralMrsThowayfootelsewerewerewastalewhoThewillhadhadICEendtirewouuanyandandandandDeethisDoclefthitAndAHbboyroHantiij-wiJusweowerenearbowIntohItwerewerehadandwillamitheduMODwereandhimbullSheandwilltickwereveryDecwereworowerehasAJuandwerenounandJananteandaminodlinesilkthox7willIOUwillandlossandRevandhadFifeandtwoandhadInjcthetheoverthathudandDocAliuandandandtartandtheandnodantionceandMrsandtornl1iHfogevenwereClusandmindriotandantitroulawandanyandnndDecandsuitthewZuandandanyhadlKcwattpoifcevenhertheIMandHasandandandwillAlaandhadwerewereDoerifeandtwoDocanysIRantetenttooverandleftthetrolwillandLeesNtratesituandandhimandsilkandntulthethethethoJimandandandandIVcthethethewerefogandtheandandherhasandhadhadandbutfiremturfiNflroandandandflueandagotwobarantinndandandthethethothethebutwurot-onI-xjracarsandwayandanddencointhotholoftherthethothethotheandanyandamiDecandthethobutthethethewasthethehytlnyoatihistheandthethethethofireherthothothethethethothohasthesadandandnotFulthothethocapthethethenessanyIKcarsnotthefilehistheKnitthothothegypuseseHathetonthethothohatthethetheoverwereandJ30forouttwobutthesorethetonthethethethofirenotlivehonthethethothothethothethelerthetheaJetthethethethethewasunrithebutbuttheandoutboafiretheoldthethethethethethothethethethethothetheoutfewthethethethethethetitsoutagooatuw4thethenowrearthoUtethetheoutWothothethethethethothethethethothothebutthethothetimeIdathewasthothothethethexrtthetonhis21yesthethetheIHnwaswasthothethethetheagothothethothemanmanthathetheHelegthewadidandrtlwthowmwaswastonthethothemenurythethethetheherearadhUTOforthethetintheSontwosixHeHewaswasw-edthothethoforthenotcrynettnothewasforoldhtsadmantwowaswasonopeaJC1theKXtheredtheMraUtoonotdidtotBoopbywasahish1ronowasrspthethewastoninstthowassixonoof1stforhlnIceofIslauot-ItwnHwaswasbyAllbywaswtttll1theBitbyhlKtheonewashisAntadtatIceforforwaawaswasnonwaswaswasInwattheniononohimtIttheforhisMrwaswasoneerowasMrhitWItlwtentantrhriFTrifftheiltiHewaswasHehlHOaonebybytenoneBYcdwaswaiontKBIcestunMrnorbyallDrdcbybybyWL5onoaresixgnuuntofortunClattatLHsononebearohocaritkforstarWiMrbyAsconwasfornoscuoSowinHoVstewonorehUOaareoffrannotlatwasseeallbotur01tieoft1I1beWnxibetocurcarVttheraeyhobecarupqcueOfbobehet-ontMbouphohelaantpaheiMhiofallINbertreshe4e3upupofnilbeCAlhebeedTebuftt-Ibo1tWofofofhebopcofHrtiown=ofgouptutroinofofofofofofofofofWofbeheoftarsofoflaoaofofInofofofoftoofofofofgoiofoftotoofofatofofoforofofofofaitofedt20ofInofofofInItofofofinoftoofofofAlonMofof1nofofflfDofofofonInofinadKofofInofofofofofoftowto11Inof27to1nofWofofofttit2Sofofofat21ofwn00on1VonittieSrtoof44lu24totoatofofwuofofatof2Sofatofofof2019tototooaItIntoInInInstInonIn10ofJS10ofthtoaitoatOKofofatlato28ofinofona3InbtInIninInas<ijancjp4efaB1>j0r11n>Cisj1>Il>j=axIr>rIMr1<1fjtJi>trrJJfcItjtc+fIiiIIs+1iIltitrlt+hIj>1ttHstIiIIrit>t>rIw1It+rjtlttI1>0tIiIIt>tiIt<>IIiiiiiiti

xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN00034\ocr\0482a.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:13891
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.213
splitwords:0
ScansoftOCREngine Character Count:14107
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:16316
Abbyy6OCREngine Character Count:16381
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;16381;3489;41.4531;84.4411
language:en
ScansoftOCREngine Predicted Accuracy:65.86%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:6025
ScansoftOCREngine Character Error Ratio:0.4066
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;16316;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:84.44%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:84.44%
ImgPrep Component Range:11524,13891
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;14107;5736;0.779188;65.8586
noPunctuation:1
ImgPrep Component Count Low Estimate:11524
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 10.0 ID4 17.0 ID5 21.0 ID6 22.0 ID7 23.0 ID9 18.0 ID10 16.0 ID11 3.0 ID12 12.0 ID13 11.0 ID17 9.0 ID22 13.0 ID24 19.0 ID25 6.0 ID26 43.0 ID27 27.0 Layout Page ID1 HEIGHT 30632 WIDTH 17960 PHYSICAL_IMG_NR 1 PRINTED_IMG_NR [1] PROCESSING PrintSpace 29628.0 17748.0 HPOS 28.0 VPOS 784.0 PC 0.84440005 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 4424 17724 52 784 ns1:type simple language en TextLine 204.0 1332.0 52.0 String STYLEREFS 132.0 188.0 820.0 CONTENT M WC 0.82539684 140.0 80.0 96.0 0.8095238 SP -144.0 240.0 108.0 44.0 1120.0 880.0 t 944.0 176.0 124.0 72.0 1312.0 844.0 148.0 1164.0 92.0 112.0 904.0 992.0 Ef Eft -112.0 1016.0 884.0 1092.0 32.0 88.0 68.0 696.0 1100.0 C 476.0 220.0 60.0 48.0 1024.0 1112.0 x 260.0 764.0 xrW -48.0 1072.0 736.0 1224.0 6 6r -72.0 808.0 616.0 7864.0 1180.0 628.0 rW 40.0 7916.0 1436.0 7196.0 720.0 56.0 24.0 3308.0 2472.0 < 116.0 2284.0 152.0 2628.0 r 84.0 36.0 2400.0 2660.0 2208.0 192.0 16488.0 2744.0 0 0t 16560.0 408.0 13472.0 4223.0 100.0 4312.0 292.0 1580.0 6040.0 4248.0 Published 5800.0 756.0 Publi -1580.0 7620.0 276.0 7404.0 4252.0 d 608.0 6796.0 300.0 936.0 7704.0 Twice 7556.0 164.0 8760.0 4360.0 a 120.0 8640.0 892.0 9024.0 4264.0 Week 0.95238096 8924.0 372.0 2424.0 9028.0 4259.0 WeekMonday 0.96825397 -888.0 9916.0 1212.0 10236.0 Monday -1216.0 11452.0 296.0 524.0 11600.0 4244.0 and 11448.0 364.0 1384.0 12280.0 Thursday 156.0 12124.0 ThursdayGAINESVILLE -1384.0 13664.0 708.0 4236.0 Thur 1380.0 ThursdayVOL -708.0 12988.0 280.0 13524.0 4308.0 y -136.0 13660.0 yH -140.0 yVOL 9292.0 2864.0 4675.0 136.0 4692.0 104.0 4104.0 1104.0 3000.0 8.0 6716.0 4760.0 H 2512.0 4204.0 216.0 10464.0 4688.0 3692.0 6772.0 11040.0 360.0 10680.0 12044.0 948.0 11096.0 16436.0 1340.0 4847.0 268.0 532.0 4916.0 VOL 916.0 2084.0 4924.0 XXVII ALTERNATIVE XXGII212.0 1872.0 368.0 3272.0 4932.0 NO 272.0 252.0 308.0 3860.0 4936.0 44 414I3640.0 2044.0 5428.0 4908.0 GAINESVILLE 1260.0 4168.0 520.0 4928.0 liAI -2044.0 7472.0 860.0 5500.0 xAINE -448.0 5948.0 248.0 6204.0 E -156.0 6360.0 724.0 6744.0 4904.0 lLLE 1LLE388.0 6356.0 1344.0 7696.0 4919.0 FLORIDA FLORllA228.0 7468.0 264.0 760.0 9268.0 MONI 9040.0 1256.0 9272.0 MONDAY -756.0 10028.0 412.0 lIO -1256.0 10528.0 348.0 9936.0 4944.0 nA 9684.0 172.0 10356.0 Y 10284.0 244.0 4940.0 I -172.0 2080.0 10764.0 IECE11BER3U DECE3IBEIHUIIECiE1IIIERiu10472.0 556.0 13096.0 4900.0 1007 lOOiliii12844.0 568.0 15080.0 4860.0 ONE OBE1428.0 13652.0 160.0 4868.0 O -568.0 15648.0 288.0 1196.0 15816.0 DOLLAB IOJJ1ARDOLLAE576.0 15240.0 76.0 17216.0 5012.0 J 17012.0 316.0 17475.0 4892.0 yfl 17287.0 4948.0 -300.0 17776.0 xmlns:ns2 ID8 24540 4572 28 5628 ns2:type 4496.0 5628.0 5720.0 1240.0 J5 1028.0 552.0 528.0 1704.0 PfR 1512.0 544.0 2448.0 5636.0 ONS 2232.0 1368.0 3232.0 PfRlSHfD 2992.0 PfRlSHfDEntire -1368.0 4600.0 6272.0 440.0 4004.0 596.0 6475.0 x7 6544.0 f 592.0 6600.0 Entire 432.0 900.0 304.0 660.0 2032.0 6611.0 Family 1924.0 684.0 2816.0 6620.0 Burned 2692.0 224.0 168.0 3684.0 6636.0 to 184.0 3500.0 4072.0 6608.0 Dead DcatbDeath3852.0 DcatbI DeathIn-528.0 488.0 4076.0 DeadNear -524.0 2596.0 1272.0 6988.0 7044.0 In -52.0 1324.0 448.0 2012.0 Near 636.0 1376.0 632.0 2572.0 6991.0 Boston 2460.0 3392.0 MassIHUSBAND 3204.0 472.0 3396.0 Mass Iass-472.0 3868.0 MassHUSBAND 380.0 3488.0 IassiV -380.0 320.0 3332.0 7579.0 i 1084.0 IHUSBAND -32.0 1292.0 232.0 1320.0 7615.0 HUSBAND USBAND-1024.0 2344.0 2556.0 7624.0 WIFE 208.0 2348.0 3276.0 7628.0 3 3112.0 3496.0 CHILDREN CHILDRENono CHILDRENHCHILDRENf-1092.0 4588.0 344.0 796.0 7795.0 iV 144.0 1304.0 7920.0 1336.0 7923.0 1152.0 4472.0 200.0 8244.0 312.0 8131.0 aid 500.0 180.0 1276.0 8203.0 feeene ilcene908.0 460.0 0feeene -500.0 1776.0 0.0 8275.0 ono 20.0 1492.0 1888.0 8248.0 of 2152.0 the tho328.0 2508.0 Fir FlroFire2404.0 352.0 2956.0 8236.0 Wag WaaWas2836.0 604.0 3420.0 8239.0 Several 424.0 4152.0 Miles MiloMlles128.0 4024.0 MilesFrom -424.0 4576.0 340.0 MiloFrom 748.0 8303.0 3084.0 1484.0 8511.0 8524.0 From 2048.0 8519.0 1908.0 th -252.0 2300.0 2428.0 Center 2204.0 3100.0 2980.0 8516.0 3256.0 tho-160.0 3552.0 336.0 3772.0 City 4288.0 4108.0 andUpon -280.0 4568.0 andII andiands 4388.0 8700.0 s 8940.0 -80.0 8860.0 h 8804.0 II 452.0 404.0 8791.0 Upon 1316.0 256.0 tho1896.0 580.0 2408.0 Arrival 2288.0 3128.0 2988.0 3408.0 8788.0 3280.0 680.0 3796.0 Firemen 3660.0 676.0 Firemeni Firementhe-680.0 4476.0 FI -676.0 4132.0 8820.0 men 3948.0 ment -344.0 2888.0 1244.0 9048.0 9107.0 -8.0 1252.0 1468.0 9076.0 1628.0 496.0 1828.0 9071.0 House HoueeHoule1724.0 2416.0 Was 2324.0 2860.0 2764.0 3056.0 Mats MallMaas2944.0 3548.0 3460.0 3784.0 9063.0 Fire Flro3696.0 FireBo -348.0 FlroBolton FireA 624.0 9271.0 A 3092.0 1460.0 9404.0 9408.0 Bolton Aoatoa1464.0 Bo -564.0 2028.0 9412.0 ton 1684.0 2188.0 Deo Dec780.0 2616.0 28HFlvo 28tLvo2500.0 -780.0 3212.0 9440.0 vo 2780.0 9436.0 persons penwaflpertaDS64.0 4180.0 9428.0 were 4096.0 wereturned -372.0 4552.0 werefOI wereturneb 3240.0 1264.0 9612.0 9616.0 turned turneb1504.0 9651.0 fOI -356.0 1860.0 1980.0 9628.0 1760.0 2252.0 death 2136.0 2840.0 in la2712.0 3108.0 9656.0 3004.0 3328.0 9620.0 flro tlrofiro3216.0 480.0 3728.0 which whioh3608.0 4332.0 4208.0 dfW 4412.0 de depreyed 4504.0 4424.0 9640.0 Q QYd -76.0 4500.0 3284.0 1268.0 9816.0 9844.0 preyed 9856.0 fW -620.0 1892.0 1560.0 9864.0 > 1616.0 9867.0 4.0 1612.0 Yd -92.0 1708.0 1804.0 -88.0 2016.0 9831.0 2412.0 9828.0 houw hotL -476.0 2784.0 2704.0 3008.0 9823.0 2884.0 392.0 3296.0 9820.0 John 3172.0 3812.0 Clark CllLrk3688.0 4396.0 at atiWfttwtown atWatertown 3180.0 10020.0 924.0 Watertown iWfttwtown10072.0 2200.0 572.0 10036.0 miburb auburbxuburb2516.0 3380.0 early elLrly3200.0 536.0 3920.0 Friday 3788.0 Fridayry -536.0 4456.0 3924.0 Fridayvery -532.0 196.0 10224.0 10244.0 1424.0 10288.0 1352.0 very 1608.0 ry -168.0 1832.0 10247.0 member 10252.0 2792.0 tho the2720.0 3132.0 Cluk3060.0 512.0 3648.0 10239.0 family tamJlyfatally3580.0 10268.0 m 4160.0 mt met4380.0 mtI -316.0 mtth metieabh 4492.0 -60.0 t4ftth 1232.0 10391.0 1248.0 10452.0 4ftth ieabh10463.0 -164.0 1824.0 10460.0 101976.0 2432.0 Ramos flaxnegtlamea2336.0 flaxnegThe tlameaThe 10604.0 1136.0 1448.0 10668.0 The 396.0 1840.0 10671.0 dad dead1768.0 1844.0 10684.0 -392.0 2236.0 10676.0 ac1 1936.0 2312.0 10704.0 aro 2224.0 aroJohn -272.0 2584.0 1444.0 10871.0 10876.0 1916.0 10884.0 ClnakClack1836.0 10879.0 his h1a2368.0 fci -248.0 2760.0 2848.0 wife wlto2684.0 3196.0 their tholr3556.0 4112.0 three thre4036.0 threUldrcn -432.0 4544.0 428.0 threer 4460.0 11076.0 11128.0 11087.0 Uldrcn lldren1524.0 11092.0 -420.0 1944.0 1572.0 11132.0 1Tcn 400.0 2116.0 11084.0 376.0 aged 3148.0 11 3036.0 Philip PWl1p1liillp3304.0 4164.0 aod asOO3976.0 asOOand -376.0 4540.0 11112.0 ago agoIs -288.0 4452.0 1868.0 11300.0 11308.0 4 Is -120.0 284.0 1400.0 Doris Dorta1796.0 2528.0 11304.0 3028.0 2 2916.0 2The 11503.0 11516.0 516.0 11508.0 flame damesnames1764.0 hod 436.0 2808.0 11520.0 made madomada2736.0 416.0 3320.0 great 3244.0 3800.0 headway 3736.0 headwayrhen -736.0 4536.0 he d1way 4000.0 d1wayden 3268.0 11716.0 464.0 den rhenlea1812.0 11720.0 Qrat flnt1696.0 2248.0 11724.0 discovered dtscovorod2148.0 dill -884.0 564.0 2568.0 ovorod 3252.0 by 3544.0 11752.0 3440.0 740.0 3760.0 neighbor notghborneighborportly -740.0 no notghborrhorUy -196.0 3956.0 4124.0 bbor bborehort1y 2000.0 1228.0 11928.0 portly ehort1yrhorUy1952.0 after nfter11939.0 2352.0 11932.0 oclock 2544.0 oclockThe 3228.0 12132.0 324.0 12147.0 1852.0 12144.0 house 12175.0 was 2328.0 2852.0 12140.0 about 3404.0 3312.0 3576.0 12136.0 miles mhos3476.0 384.0 from 4040.0 fromh -384.0 fromhe fromthe 12332.0 12355.0 12376.0 -96.0 1648.0 12360.0 oent 1532.0 center oenter1996.0 2100.0 12388.0 -68.0 2168.0 2292.0 ot12352.0 tbotho2456.0 2976.0 town 2844.0 3512.0 12344.0 end Bnlleats3384.0 3944.0 12347.0 3816.0 4284.0 tlhatJhe4136.0 tlhaHmo -244.0 4528.0 tJheIt1mo 3720.0 12544.0 12596.0 12560.0 Hmo It1molimo420.0 804.0 1732.0 12563.0 1624.0 12568.0 firemen OrowfnIlrown2636.0 12604.0 n 2724.0 644.0 reached rlDc11E1d3612.0 12555.0 tho468.0 3988.0 12588.0 Boene soneaoeneBoene4fa -468.0 soneh aoener12704.0 1220.0 12768.0 4fa 12771.0 Wte 1308.0 -208.0 1516.0 h9uee1412.0 2180.0 12763.0 lad badhad2576.0 boen boon2468.0 3052.0 burned almost 3620.0 4280.0 tothe 4532.0 2880.0 12935.0 12951.0 12976.0 12971.0 ground groundTho -572.0 groundo round -464.0 12984.0 1392.0 1420.0 13184.0 332.0 13200.0 Tho 1552.0 ho -200.0 1752.0 1664.0 13236.0 o 1820.0 13195.0 firomen2548.0 13228.0 wore2452.0 13192.0 able ablo2932.0 3464.0 3368.0 716.0 13187.0 totocnte 3676.0 locate 1ccate-504.0 4276.0 thej 4176.0 thoUIOthoftoAlea UIOeo 1188.0 13315.0 4372.0 13372.0 j 540.0 13384.0 ftoAlea tf9odea1068.0 13400.0 eo -540.0 1536.0 Joa 1452.0 1900.0 13412.0 13408.0 2072.0 tl1 -268.0 2600.0 13403.0 father falhor2356.0 2672.0 13416.0 nl -440.0 hor 2804.0 3236.0 anll3672.0 two tJwotvo3528.0 13395.0 boys boyrs3968.0 boystut -360.0 4484.0 boyrsut 356.0 boysbut 3836.0 700.0 13575.0 13611.0 but tut800.0 1364.0 13620.0 ut 1592.0 t110ho13616.0 motihor motJhormotttor13624.0 nnll2520.0 2972.0 little UttlomUe2876.0 3436.0 girl 3360.0 3804.0 13644.0 wore worowero3708.0 not 4192.0 notfound -260.0 nottound 13772.0 492.0 13824.0 found toundtlournuntil unW1720.0 2260.0 the2172.0 2608.0 13819.0 ruins rulesot3020.0 3344.0 the3264.0 houso 3604.0 4232.0 had 11M4148.0 hadcooled 4520.0 11MJcd 14032.0 cooled 236.0 1528.0 Jcd -236.0 912.0 sufficiently lIutrlclenll14044.0 548.0 3220.0 permit lIcrmil3088.0 3884.0 14068.0 3768.0 4120.0 14060.0 more morethorough -408.0 14227.0 744.0 thorough 14244.0 eoarch aonrchsoarcheoarchTho -544.0 aonrchflho soarchfrho 2800.0 1416.0 14452.0 flhofrho14456.0 houeo houBohouso1736.0 14488.0 WUII2308.0 valued valucdnl3780.0 D000 50003592.0 D000QYPSV -436.0 4216.0 5000GYPSY 3960.0 QO -256.0 QOV 2664.0 14859.0 V 1792.0 14871.0 GYPSY QYPSVGVPSV1356.0 2504.0 CAMP 752.0 3176.0 14879.0 ROBBED 3048.0 ROBBEDDuring -752.0 3928.0 ROBBEDOurlng ROBBEDOuring -744.0 3300.0 15287.0 During OurlngOuring856.0 15295.0 Bethrothal Bothrothal1800.0 Celebration Catebration2748.0 OiIlebrationThlevcD -948.0 OiIlebrationThlevcDSteal -1684.0 Thieves Thlevee-660.0 ThievesSteal 2796.0 15424.0 F 2124.0 15500.0 Steal 2632.0 15503.0 Large LarUo2524.0 3192.0 15508.0 SumJ 3096.0 Sum -340.0 3536.0 SumWow Sumow 588.0 15696.0 15711.0 688.0 15763.0 + 672.0 15708.0 1408.0 15724.0 Wow fow1568.0 15736.0 ow -220.0 1788.0 1876.0 15700.0 York Yarle2268.0 2420.0 Doe DocD 2708.0 15744.0 2536.0 15716.0 2SAn -576.0 3424.0 2S 2920.0 All An3524.0 unttro lIlIlIloenuregyp gyps4012.0 gypey -336.0 4516.0 gypsr -292.0 rp -228.0 3376.0 15811.0 15940.0 ey 8 15944.0 camp carnllcnrn 15916.0 U la1884.0 -128.0 2276.0 15924.0 under undfr1I111t13044.0 15932.0 nrrcKt 11eHtnrreHl3732.0 15919.0 frontfromJduj 15952.0 rom -304.0 4268.0 hn the-40.0 thekith 4340.0 hn1d11l -176.0 4580.0 16112.0 kith Jduj1d11l1688.0 16124.0 down 2244.0 16160.0 on 0112108.0 2540.0 16127.0 complaint 01ll1In1nlOnpltAnt3448.0 16132.0 or3340.0 3704.0 Iho3600.0 16163.0 queen quocnI1l1tllIqueenof 4512.0 quocnof I1l1tllIof 4508.0 3316.0 1204.0 16324.0 16327.0 another anothor16368.0 canijiloa III 16371.0 16340.0 who W -320.0 3208.0 16376.0 10 2996.0 620.0 SICCUHCS 111111111ac 3616.0 uses 3508.0 16343.0 tlioso hOtilthHtliosotinder 16351.0 thHunder -28.0 hOtilundor 4428.0 3288.0 16540.0 484.0 tinder undorunder16559.0 arrest arrost1716.0 or16543.0 having havlllH3336.0 16551.0 robbed NbbuIIrubbed3992.0 lu 3872.0 her 111116584.0 1192.0 16679.0 16743.0 18 16740.0 48216 -216.0 8210 8210Dora 1520.0 16748.0 21 16751.0 fj 16704.0 1Dora -64.0 2176.0 16959.0 Dora 1920.0 Pears Peares1816.0 plar -556.0 2476.0 17000.0 2588.0 b Is2812.0 16995.0 ait 2668.0 16992.0 1111100 gneon-180.0 16967.0 3664.0 3864.0 16964.0 band hlllld3752.0 orofHungarian orUlungarlnn ofQlungarian 1216.0 17159.0 888.0 Hungarian UlungarlnnQlungarian17172.0 tryphloa tolloH7IHL0a2104.0 2856.0 17180.0 catupod lJIIlIvodcutupud17211.0 3820.0 17175.0 tholh 3996.0 3964.0 4144.0 17208.0 cto 4240.0 ctoof -284.0 4440.0 4376.0 oof 17372.0 17375.0 thoUIOcity 1740.0 elt -296.0 17416.0 17383.0 tho2436.0 Bronx Bmtxilrmt2768.0 17388.0 Jus OUilux4100.0 Stan HlnnftanStanley Hlnntoy ftanby 4480.0 17447.0 17583.0 toy leyby1588.0 Sa1480.0 king klnvklnyc17591.0 tit vf vt-100.0 2532.0 17624.0 hand hnnt2612.0 17599.0 orHnglltxh 11uJlhithliuglIlt3352.0 4184.0 17627.0 iyp4068.0 iyplot 4468.0 gypettos 1712.0 1208.0 17788.0 elol ettoslot 1656.0 17796.0 campod m1odcpmprd2380.0 17807.0 nearby neatghynearbyQuoon 17832.0 neatghyQtl t1 -352.0 t1QUo -212.0 3080.0 17983.0 18007.0 Quoon QUo 1928.0 Qtl 1744.0 Ml 1640.0 18040.0 2088.0 18004.0 Dom DoraMDotas732.0 18012.0 daughter dauKhterdaurhtor18019.0 King 1lllS3936.0 KingChis -388.0 KingGus 18160.0 18207.0 Gus ChisGul18248.0 son fion1808.0 2008.0 -188.0 2196.0 18212.0 have havohllo2928.0 18220.0 long lonltangboon 3588.0 18256.0 3764.0 3896.0 IIIlovo lo1Iovn18223.0 lovoidtfli -324.0 lo1w1tih -328.0 Iovn1I 18415.0 idtfli w1tih18420.0 1I -232.0 1756.0 18423.0 each wich2264.0 outer otlierotlltr2112.0 18431.0 nnllIt 18459.0 WQlI 18464.0 va 3848.0 as 504.0 finally Onlllfinally4Ureod OnlllIt finallyagreod -400.0 4404.0 896.0 18628.0 4Ureod agreod1020.0 18631.0 bnUn 1780.0 1948.0 bntwwn bntm112296.0 18679.0 18667.0 18636.0 tholrUwlr18639.0 royal roynl3164.0 18672.0 rO 3596.0 1t1 3480.0 18651.0 parentsghat 3724.0 3900.0 pariMits JlllrllItAparents-604.0 pariMitstfihat -608.0 JlllrllItAat 3364.0 1140.0 18795.0 tfihat ghat18847.0 18831.0 thoy UIO tho2040.0 508.0 18844.0 uluuld shtuld18851.0 Ith -508.0 2364.0 18892.0 l 2332.0 uld 2832.0 bo bn3144.0 mnrrlod utnrried3012.0 18880.0 111ft -624.0 nht Queen QllflCIIQueenDora QllflCIIora queenra19039.0 19080.0 ora 1644.0 1476.0 ra 1632.0 1728.0 19047.0 paying pltlt19064.0 19055.0 Hint King2648.0 2640.0 lua 2716.0 19059.0 Oils OIUIus2936.0 3484.0 K 3568.0 500 -56.0 3624.0 19116.0 -204.0 3656.0 00 3632.0 3912.0 19072.0 toblml btn4060.0 blmltbo -36.0 Ia2o 1000.0 1200.0 19244.0 tbo lLboa2o1604.0 19252.0 bargain barRaln1508.0 bargainBo barRalnSo-596.0 bar 1968.0 19255.0 nlll nlllSo 3160.0 19396.0 19463.0 So Bo19504.0 2156.0 19471.0 Tu T 19468.0 Tntrs -124.0 2280.0 2340.0 19499.0 IIrI 2644.0 19475.0 2560.0 19524.0 +lny iny2680.0 3072.0 night nlRhl2924.0 3492.0 ht tll 19480.0 Clus GuHClusRVO 011111 -20.0 Irave 4572.0 19624.0 19676.0 19691.0 rave 19699.0 RVO V6 1620.0 19707.0 19683.0 party lJarl2316.0 cHobratlou lohtlolcrlubrutfoa2564.0 19715.0 -916.0 tlr940.0 nlOtbo3840.0 be bp4188.0 beirothal -184.0 bptroth betrothal 3292.0 19876.0 584.0 troth irothaltrothal1668.0 ai 19887.0 19919.0 an -276.0 2604.0 Invltod luvttod19923.0 2984.0 2952.0 19896.0 all nlJnil3068.0 3740.0 19891.0 3628.0 QIWl13892.0 QuoontXxraB -512.0 Qtu 19927.0 nDorae 19987.0 20079.0 tXxraB DorLSDorae20084.0 followers rtllloeratolIower20127.0 2776.0 20104.0 20099.0 hl82912.0 3412.0 20131.0 elIIIOne 3832.0 Onelirl Onectrl One1r1 20267.0 20284.0 ctrl lirl1328.0 20287.0 1r1 20328.0 waa20295.0 loft IMt20312.0 20303.0 watch wutrh20315.0 3152.0 20348.0 20307.0 nilthoHungarian1 Ilungarlan3520.0 Hungarian1TUp 864.0 Ilungarlanamp 788.0 3716.0 hlllHrlnn -788.0 20456.0 -16.0 20503.0 456.0 20528.0 amp U11lp20531.0 TUp 1676.0 2068.0 DlrlnRTiring20515.0 thoUwovenlng orl1lnevenhtg3940.0 20551.0 4020.0 manand 4172.0 man 111111-332.0 111111ad 20715.0 ad 20744.0 woman womnnwmmitncallwl callcat20755.0 2896.0 111 20719.0 2700.0 20736.0 -152.0 3136.0 3372.0 20728.0 IIIltherump anti20759.0 1111 toare -148.0 20855.0 Ithe 4584.0 3168.0 20916.0 20947.0 are 1456.0 tlmlr tlolrthnlr20927.0 fortune rorlllllo2140.0 20931.0 told 20944.0 IIlhl20936.0 whllo whilewhilethe whllothe 21011.0 21116.0 21124.0 drlKlrl21163.0 1864.0 2096.0 21131.0 busy 2228.0 has 21167.0 lIs 21135.0 with dth21139.0 tholr their3184.0 21152.0 fortunosfortllnult3680.0 fortunostvme fortllnulteotl4564.0 21327.0 21360.0 sniffs tvmeeotl 21368.0 one allf1564.0 sIR nlR11fi2464.0 21343.0 HIe2360.0 21355.0 tent tflIt21352.0 behind luhlnd111hl1h13104.0 3856.0 hor3904.0 21388.0 WI anll4092.0 andtnado andnode 4488.0 Iwado 21543.0 node tnadowado1784.0 21576.0 way liar21579.0 2212.0 21551.0 thoUl 21563.0 txyal rwallornllnlUHlr 3428.0 652.0 21568.0 trotHUry -584.0 4128.0 trou -648.0 4196.0 21591.0 ury 21596.0 11u4220.0 acontolntnc 11bac 3880.0 21671.0 tI 21740.0 bag bac852.0 21748.0 contolntnc rottalntncontalnn21755.0 QuwnQIIln21763.0 liras 1tras3124.0 21796.0 rlLa 21771.0 savings nalngsnalngsilxteen savingsof 3972.0 nIII 4436.0 21804.0 1IIhI 21948.0 21951.0 21956.0 560.0 21959.0 ilxteen stxteenIhI -560.0 2052.0 21992.0 1880.0 21999.0 21995.0 yarn yarnr yivro -552.0 lM 4556.0 IHOT 4560.0 -24.0 ISHOT 832.0 22367.0 22375.0 SHOT HOT2020.0 22379.0 BY 1932.0 BIRMINGHAM 2900.0 22383.0 NGHAM 22392.0 CHIEF CHIEFlAndrlff -580.0 CHIEFAnd CHIEFAndrfft 22531.0 22780.0 lAndrlff Andrfft22783.0 And 1600.0 22795.0 riff 1576.0 612.0 1984.0 Became Bteme2740.0 22799.0 Unruly 3444.0 22803.0 nnd3888.0 22808.0 Bit theFinger theInger 2484.0 22996.0 Finger Inger23003.0 or2144.0 2492.0 23007.0 tlw tltr2392.0 -240.0 2732.0 23011.0 Chief 23031.0 Police PolleePoliceBirmingham PolleenlrmlnlluulI PoliceIltrmtnghatn 23196.0 Birmingham nlrmlnlluulIIltrmtnghatn23203.0 Aliu AlIIA1tt23211.0 Ht lt23219.0 23247.0 tv 3248.0 3636.0 JS 2SS 23239.0 23215.0 hit hlofhltrhlofof -308.0 hltrof hitof 23399.0 1544.0 Pollctt2160.0 23407.0 Jiutst Juuea2164.0 23411.0 23443.0 AlUtI 23419.0 Meirltimn Itrtutan2892.0 -712.0 2960.0 23423.0 filII 23455.0 mnn shot hhutshut23427.0 nnJ4064.0 andt nnJIrobAblr andVrobablr 23612.0 ttbnblr IrobAblrVrobablr23635.0 -720.0 23643.0 fatally 1348.0 tlltU 2620.0 23627.0 wounded 23655.0 WO 3472.0 3040.0 23659.0 23663.0 3700.0 23631.0 Manvliv 11tloMnctttuManvlivlan Mnctttuta-628.0 23727.0 23807.0 lan -192.0 1556.0 ta 23820.0 Jim Jha23823.0 Amlrlff AndrHT2756.0 23831.0 riFT 2496.0 23827.0 wltth23863.0 w 3388.0 htle 23867.0 rm rmAudrllf 23835.0 lIIII 692.0 resiMIng 3776.0 3876.0 23839.0 t1I1 -312.0 4300.0 arsNt 4088.0 4304.0 ar arIMt 24035.0 IMt sNt3076.0 24195.0 24223.0 Audrllf ullrlITAudrllt24267.0 WIII wnH24272.0 wn 668.0 24247.0 unified urrtatrd24275.0 IUI -668.0 trll 3452.0 3468.0 24287.0 24279.0 24243.0 tillriilif Iilllrtittrtriilifu Iilllrn-396.0 24372.0 24459.0 1n 964.0 24463.0 -104.0 24467.0 u na24444.0 trhlal trhlRltrtta1652.0 24495.0 2240.0 24455.0 ofTtIIII tfTct2388.0 24500.0 -412.0 2828.0 freit 2440.0 24480.0 24451.0 anti ami24483.0 lUll 3516.0 24487.0 3828.0 thr4200.0 wayto ttn ttnto 4408.0 1to 4364.0 24491.0 24639.0 24647.0 tltn1912.0 24659.0 stttan 24667.0 -404.0 2064.0 24680.0 2024.0 24683.0 111I 2132.0 24695.0 -116.0 2444.0 24655.0 Auilrlff IrlfTlndrlftivcanie Iwcn hecn24691.0 24663.0 titiruiv titiruivAud -520.0 24688.0 IIl1ru unri4352.0 rnet rand 1236.0 24847.0 24852.0 Audnet hl hihts 24863.0 tlreI 2184.0 rfri 2552.0 24896.0 24880.0 24911.0 io tolet24891.0 ewnpo evKaptN 24899.0 -12.0 tIt 24883.0 Rot tatot 4116.0 24875.0 tillthechiefs tillchlcC 25047.0 chiefs chlcC25055.0 nnpet ftnptlCnKet25075.0 IIIto2772.0 25063.0 hi 1thI1ltUU 2908.0 h1r -820.0 25104.0 3116.0 mouth outh3808.0 25071.0 lililnj hlllnbtttnF25079.0 Itattempt Itevro1T Itw 25227.0 704.0 25255.0 evro1T ieveroly772.0 25259.0 25263.0 C2 2304.0 25299.0 25279.0 25276.0 dc 2820.0 25271.0 drew 25304.0 rtW 3540.0 hlK hhipistol llIItol444.0 llIItoland -444.0 3584.0 836.0 25467.0 25520.0 tnd25471.0 attempt ltHnpttoatlontptI-808.0 25495.0 I25523.0 25487.0 vilko 2868.0 tke 3064.0 Ik 25479.0 25484.0 prisoner Ir116OUNprlsuutr3560.0 prisonerAndrlff 4420.0 Ir116OUNW1b prlsuutrwZu3188.0 1280.0 25663.0 W1b wZu25707.0 Andrlff AndrltrAndriff25712.0 2372.0 25687.0 t25699.0 jn3712.0 25679.0 tat tbt25684.0 k kto 4048.0 str tru truale 4368.0 25720.0 uR 25828.0 25847.0 1T 25867.0 ale rho816.0 25871.0 1672.0 -264.0 ll1shlplstttl25923.0 tt 3140.0 25900.0 dl 25895.0 eharcod dlrharged-132.0 dChar -864.0 eharcodtall 25947.0 4008.0 4272.0 25911.0 ttJall 25892.0 tha thatall 26075.0 tall tJallpassing pUtilnspateing26087.0 through thnagl2320.0 thft -612.0 26100.0 Ailrirf AIMlrrAtdrITtrtnook nisjkDeok3916.0 nookdrl 4052.0 nisjkir Deokctaidult 1432.0 26280.0 26311.0 drl 656.0 ctaidult Aiplnt -456.0 1992.0 26315.0 parn 2036.0 lunJII lunJIIFather 26295.0 11t1 -224.0 11t1Father 26427.0 26603.0 26607.0 Father Killed KllirdKllyd26619.0 26660.0 26624.0 Son 5i5iw SonBuffalo SDubIo -84.0 26796.0 26807.0 Buffalo DubIonttmtlu1300.0 26803.0 X1IHn ltrtL 26843.0 v vGohroff 26824.0 harpy harpySohroft -492.0 arl -452.0 arl8obrotf 4344.0 27007.0 27011.0 Gohroff 8obrotfSohroft27047.0 1856.0 27015.0 aoCIJ agvtiHit27043.0 rears 27051.0 tArs rHnll 27083.0 27079.0 27075.0 ir irFather -108.0 4260.0 27032.0 ulotIntornatlo ulIntornattoht 27212.0 980.0 Intornatlo Intornattoht27215.0 l27219.0 HnllIInll27223.0 JC1 JC1a G3 3792.0 27259.0 t6eG 27271.0 trnee trneeyes -496.0 27423.0 27456.0 yes 6eG27448.0 street 2120.0 2060.0 27459.0 IIIku ssk Kxu ou 27427.0 sad 27467.0 27435.0 hntat 3744.0 27475.0 3984.0 nut al a1a1ter 4336.0 alJeT lley 27631.0 JeT leyter27667.0 waa ttaa27675.0 2128.0 27639.0 hot tthotshot27635.0 Knit HttdandItiHauis 1lUItturtsuty2872.0 27663.0 27643.0 ktlcv kt 4328.0 27683.0 na4212.0 onThurday onThuma1 naI 27836.0 27843.0 Thurday Thuma1turdday27847.0 -764.0 afterutxm Itttrtuuaftrrntou792.0 brLH bl bt4256.0 27883.0 onCtartci uGtM 4348.0 u0arieoa 3324.0 28043.0 28047.0 Ctartci arieoaGtM 28083.0 es OK DJ28055.0 agttt 28095.0 28087.0 28051.0 20 2696.0 3024.0 tMiir 2656.0 3400.0 28059.0 frr tfT Sr 28063.0 it 3932.0 itd 4392.0 28067.0 ItsItsNtid uquarrvJtsi 1176.0 28251.0 28316.0 Ntid 28259.0 bacHwu 2488.0 28255.0 bt 28295.0 2256.0 952.0 cninttltng MUthln -692.0 3156.0 httttt 28267.0 ue ififquarrult1 28287.0 1ad 4320.0 28452.0 28463.0 28455.0 quarrvJtsi quarrult128491.0 Quar -776.0 wlIbhU bti28459.0 wltentul tudutl 28467.0 WIttUho 4524.0 WIKId tttMld 28503.0 28663.0 KId tMld28671.0 1584.0 28667.0 struck etritek28679.0 truc 28699.0 Itr when whcnbtn situ oalJsl C3UJC3UJc -488.0 oalJslher -484.0 C3U C3Uher 28859.0 28911.0 c1284.0 28899.0 Ib 28868.0 hor28904.0 non aon10028891.0 28895.0 proun proleIrot 28871.0 blrHe HtIlecame earncametote -428.0 earnitttb 4296.0 mf mftat 4292.0 29067.0 29184.0 29087.0 tote itttbtSla 29079.0 Ut 1988.0 29107.0 room rtxxn29112.0 2396.0 2480.0 29083.0 afldbotebot29076.0 htaflitlu4032.0 29115.0 raNt ataking 4444.0 29139.0 29279.0 29287.0 aNt itwt29327.0 taking tlklnr29295.0 eftect ctfectrrt 29284.0 kllHn kUling ktUInS3748.0 him 29323.0 aTte aa 29492.0 29531.0 1388.0 29507.0 Nl 1660.0 lI11ru11 lnatulUJ29499.0 Tte T1eJh 29528.0 ion Fen2940.0 na nalq aas AI 29495.0 arTelt arTelttitres 4080.0 rT 4324.0 6t 4228.0 6t1Jttl 29687.0 29700.0 1Jttl titres hc 1t 29736.0 bUl ilYULlq tQ29703.0 c1f a0lfa0lfIv 30047.0 Iv xmlns:ns3 ID14 6188 3444 4660 5520 ns3:type 5084.0 5580.0 872.0 5588.0 SALOONS 6056.0 TO 5956.0 6388.0 CLOSE 6296.0 7096.0 SOON 7000.0 SOONAbsolute 7600.0 SOONAbeolute 4660.0 5520.0 4740.0 6004.0 Absolute Abeolute5568.0 Prohibition 5448.0 Goes Gocs6476.0 7124.0 6008.0 Into 6992.0 7560.0 Effect 7440.0 EffectIn -480.0 8040.0 5368.0 6212.0 6220.0 5624.0 6216.0 Georgia 5508.0 6348.0 6252.0 6236.0 6640.0 Jan 6528.0 7088.0 6224.0 1st 6916.0 1stAtlanta 7316.0 1stAtlant3 6420.0 6424.0 Atlanta Atlant35700.0 Doc 1oc5512.0 6188.0 5996.0 Wednesday 28Vednosday28WewDesda -1316.0 7504.0 7612.0 6428.0 there therewill 8044.0 thereUt therewU1 4744.0 6628.0 will wU14880.0 5032.0 5180.0 6632.0 5488.0 closed clQsll5356.0 6112.0 5980.0 6412.0 Atlanlo6276.0 7176.0 7056.0 7780.0 thestate 7644.0 7784.0 8036.0 thefltato thealato 4732.0 6840.0 6855.0 state fltatoalato5200.0 prohibition 5132.0 6192.0 law Jaw6100.0 6564.0 eightysix clgbtslxelghtys1x7460.0 6844.0 whisky wblskY7368.0 whiskyaloons wblskYaloonH whiskysaloons 7048.0 7052.0 saloons aloonsaloonH1060.0 5504.0 twentyHhreo twcntytbreotwentythreo5320.0 7060.0 beer 7376.0 saloonstwenty 7156.0 7380.0 -616.0 7996.0 saloonstwentyone saloonswontono 4728.0 7260.0 7268.0 twentyone wontonotwenty -880.0 5608.0 5328.0 7288.0 5264.0 824.0 5740.0 wholesale 6872.0 7271.0 liquor houses hbusos7356.0 housesand hbusosand 7564.0 7684.0 7299.0 uaos 8032.0 uaosand 7464.0 5120.0 7488.0 5004.0 wholcsale5396.0 6324.0 6880.0 7479.0 6780.0 housesOf housesor7436.0 7672.0 7680.0 Of orthese those7676.0 5600.0 6240.0 7720.0 6148.0 6604.0 7687.0 sixty 6504.0 sixtyone 51toOno7004.0 7723.0 7352.0 7452.0 -588.0 4720.0 7892.0 7895.0 5420.0 for tor5308.0 5780.0 white 5656.0 6352.0 7900.0 people peoplo7904.0 6888.0 7416.0 7908.0 7296.0 twentylive twentyfJ7988.0 twentyfive 8100.0 8103.0 live fivefJ 5000.0 8136.0 4808.0 5128.0 negroes uogroes828.0 6368.0 8124.0 seventeen 6140.0 8144.0 80Vfiln -828.0 6852.0 teen 6828.0 7336.0 8108.0 7804.0 sa ea7692.0 ealoons 7992.0 saloolls 8308.0 8311.0 loons loolls5228.0 tor5124.0 5560.0 8344.0 5464.0 whites hltoshltes5688.0 5684.0 8380.0 6108.0 8324.0 6612.0 8320.0 six 6508.0 81 6948.0 tor6732.0 640.0 7300.0 8352.0 7188.0 negroesWHh -640.0 7940.0 negroesWith 4888.0 WHh Withtim5288.0 5748.0 8528.0 aalooDs5652.0 8536.0 6364.0 7220.0 wholesalo6936.0 wholesalehouses 8028.0 wholesalohouscs 4708.0 8724.0 houscs5444.0 8772.0 one5252.0 5876.0 8740.0 brewery browory5732.0 6708.0 6556.0 7152.0 8780.0 go 8752.0 out 7340.0 8744.0 ofbuslnoss 7728.0 7868.0 ofbusiness ofbuslDOSS 4712.0 business buslDOSSbuslnoss8956.0 As M5400.0 6092.0 5960.0 6384.0 8952.0 what 6912.0 wJll6784.0 7212.0 7640.0 done 7520.0 donewith 8024.0 9092.0 9152.0 5068.0 5140.0 9156.0 the5060.0 5496.0 5416.0 6260.0 9164.0 186176.0 6472.0 9168.0 6392.0 6820.0 9171.0 yet 7168.0 9135.0 known knbwn7084.0 9160.0 kn 7484.0 9192.0 7364.0 7848.0 9188.0 a3 as7708.0 astho 7852.0 a3tho atho 7948.0 4700.0 9368.0 928.0 5116.0 9372.0 proprietors proprlotors4964.0 600.0 decline 6044.0 6944.0 9379.0 6792.0 7252.0 give givo7104.0 7764.0 9384.0 7608.0 outany 4696.0 9576.0 9608.0 any 976.0 5100.0 information IntormnUon4996.0 informationAVlth -976.0 6076.0 IntormnUonWIth informationWith 4872.0 9780.0 WIth AVlth5476.0 9788.0 thq5304.0 5480.0 5896.0 9792.0 closing 6672.0 6996.0 9795.0 ttetho6832.0 7428.0 whiskyhouses 7264.0 7432.0 8020.0 -592.0 whl 7824.0 kY kYhousos 10000.0 housos5364.0 wiUcome como5648.0 10003.0 6184.0 10008.0 cutting cutUng6532.0 7328.0 tlown7228.0 7856.0 ot7760.0 ofthe otthe 10208.0 5108.0 10211.0 citys 4960.0 10219.0 receipts 5536.0 c1pts 5752.0 6492.0 trom10216.0 licenses lIcenscs7860.0 10424.0 5076.0 10432.0 amount 5792.0 ot5692.0 6084.0 10427.0 13111250 1131112505964.0 the7024.0 7576.0 exact exactamount 10440.0 10548.0 10644.0 10635.0 ot5612.0 5540.0 6180.0 6568.0 paid 6488.0 6984.0 10640.0 6908.0 7392.0 7648.0 citytreasury citytroa citytroanury 8016.0 10843.0 treasury troanurytroa 5380.0 10848.0 trom6020.0 that 5884.0 6468.0 source 60urcoeourco7140.0 10852.0 last 7020.0 year yoar7448.0 yearIt yoarIt-368.0 7928.0 11056.0 5112.0 11060.0 estimated cslhnatod5244.0 6164.0 lhe11064.0 omount7756.0 ofcapital 11264.0 capital 5240.0 6028.0 11272.0 5880.0 11268.0 been 6312.0 Inves Invesld invesed7716.0 Inthe 8008.0 infile 8072.0 11207.0 11472.0 11480.0 file5868.0 buslneta buslflcbusibeic5712.0 6760.0 6588.0 11476.0 7876.0 is 7712.0 7932.0 11512.0 xmlns:ns4 ID15 18396 3384 4652 11711 ns4:type 11711.0 1000UUUMuch 6764.0 1000000Much 7552.0 4876.0 11896.0 Much 5404.0 11903.0 or5316.0 5664.0 this 5572.0 11908.0 1tIt5984.0 11900.0 Ie6244.0 6584.0 said aald6480.0 7112.0 w11J7516.0 bo7408.0 7812.0 inrested 7968.0 InTeled Indated 12104.0 12108.0 rested Teleddated5208.0 5532.0 12111.0 tholho5452.0 12116.0 5788.0 ctt 6172.0 6256.0 6068.0 other 7016.0 enterprises enterprlscs6932.0 enterprisesSome enterprlscsBomo-940.0 7956.0 12316.0 Some Bomo12319.0 wJl15136.0 5736.0 be5584.0 withdrawn wllhdrawn5920.0 othorothercities othorClUC9 otherelUes 12524.0 cities ClUC9elUes12535.0 several Soveralsovoral5484.0 6284.0 12527.0 6452.0 6924.0 12532.0 6816.0 7604.0 deal deals7508.0 dealsera 8004.0 dealera dealers 7952.0 12735.0 era ers12743.0 havo12776.0 IIlVO given 6036.0 notice nollce5936.0 12748.0 6536.0 7064.0 they thBy6972.0 12740.0 would 7420.0 wouldcarry 8000.0 wouldoarry 4684.0 12956.0 12979.0 carry oarry5224.0 00tltp 5544.0 5796.0 5916.0 12987.0 same sainebuslne6344.0 12992.0 7100.0 7280.0 12960.0 10Chattanooga Chat ChutChuttanooga Chattnnoogn 13164.0 tanooga tnnoogn1040.0 Jacksonville Inclesony1l1oJaclteoavlllo6572.0 13172.0 othorotbor6864.0 citiesThe 7388.0 ctttoscitiesTho ctttosTho 4852.0 The13376.0 wiping 5172.0 5928.0 5832.0 6292.0 6196.0 the6456.0 6812.0 7616.0 busl busibuslness buslneSH busifloss 13584.0 ness neSHfloss5144.0 13588.0 al15460.0 13608.0 5340.0 alone 6116.0 time 6596.0 w11l7008.0 cause 6884.0 7580.0 Quite qultoQuitea qultoa-416.0 4680.0 13788.0 13828.0 change challgo4776.0 5564.0 13796.0 5456.0 5812.0 one5708.0 13808.0 rospect respect6920.0 13800.0 or7192.0 thecltyd elticltyscltydbusiness eltibUt cltysbusiness 14000.0 bUt -688.0 5372.0 -4.0 4956.0 14011.0 1noss 4968.0 5468.0 14004.0 affairs atralrs6308.0 This 5988.0 14040.0 6680.0 fas vyas7092.0 7180.0 14016.0 7660.0 14036.0 acertain acertrlln 14216.0 certain certrllnextent extenl5248.0 5992.0 14252.0 once 5888.0 14219.0 before bofore7128.0 Ful 7548.0 Fulton 7944.0 14280.0 14424.0 14427.0 5064.0 14435.0 county 5728.0 wont went14432.0 dry 6128.0 6656.0 7256.0 local 7748.0 14460.0 op Ope7632.0 option Opetlon 14632.0 tion tlon14635.0 4988.0 thon thou6484.0 wine wlnowino14640.0 nouseslouResandtho 7984.0 andthe 14843.0 14848.0 tho5020.0 wholmmlewholusnio5808.0 whIsk deltrs6372.0 7248.0 whose whORe7844.0 11lt7752.0 IIcenhcs 11CCnH lteefNe5 4672.0 15056.0 15087.0 cenhcs eefNe5CCnH 5332.0 15092.0 ran over 5592.0 kept kOllt6088.0 6684.0 open opon7216.0 15059.0 ror7572.0 15084.0 Homo aomowmo7444.0 aomotime wmotime Homotime 15264.0 5176.0 15272.0 nfttr5040.0 5716.0 prohlhltlon6788.0 15284.0 went 6624.0 7332.0 15267.0 Illto7788.0 efeffect ofteet 15328.0 15472.0 15475.0 feet fectteet5344.0 Next 4972.0 960.0 5844.0 WedllUstlll11ednesdaythe6804.0 7276.0 7172.0 clt 7688.0 w1I17480.0 willuo 7980.0 willbe 1488.0 15683.0 4664.0 15719.0 uo 4856.0 4780.0 absolutely nhsolutelyalsOlutely15688.0 dryHAD 16104.0 16116.0 HAD 5436.0 16107.0 DYNAMITE 6560.0 IN 6848.0 POCKET 6736.0 POCKETStick -772.0 16515.0 16528.0 Stick 5216.0 Exploded 5088.0 Blowing Boys BOYI16523.0 Body BodyThrough 7976.0 16728.0 Through Parlor Window WindowBirmingham -684.0 Window1UrllllI Windowilirntingham 16939.0 1004.0 ilirntingham1UrllllI -1004.0 5860.0 16944.0 ltum 6136.0 AJu AluMu6740.0 Dec Doc7292.0 SDan 7360.0 SDanBrudlo SDanBrudluy Dan DanBrudloy 17147.0 Brudloy BrudloBrudluy17156.0 165296.0 5644.0 G 17183.0 years 5828.0 tmrs 6168.0 17152.0 old 6160.0 won 1011Hun6496.0 7028.0 widow widowat 7596.0 IdH IdHal 17355.0 al17360.0 Pratt Prntt4828.0 Clt 5412.0 17400.0 ILmining suburb 6uhuru7816.0 or of7652.0 ormrllllnlhllII ofBirtuinghatn 4668.0 17563.0 1008.0 17572.0 mrllllnlhllIIBirtuinghatn5864.0 died 5676.0 Thur8liJaThurt1aymorning mOII1I1Imorningaa morningusmOII1I1IaD 7964.0 17763.0 17816.0 aDus4840.0 5148.0 result roaultrog ult 5376.0 17783.0 5976.0 17819.0 u5872.0 ChtlBtrnaB Cht1l1tma1IClu1itmas6064.0 7144.0 part17775.0 glv glvon 7924.0 glven 7972.0 1on 17916.0 18032.0 enlitat4848.0 5196.0 17991.0 Mlko IIIOMike5092.0 648.0 Dusanu DIInnljDt 6336.0 6012.0 18024.0 ans 5848.0 6448.0 h01l1e7012.0 Wcdllliday1VodnsdayWednesdaynight 1Vodnsdaynight-952.0 18079.0 18199.0 18204.0 rte Tio110boy buyIJO 6200.0 6332.0 carried cnrrludcnrrled18232.0 plocu 1loru7808.0 oflynanilto of1nruulto ofilynantito 18407.0 lynanilto 1nruultoilynantitohln hIHhI coat cod18412.0 pocket l4clwtlwlcket6460.0 pocketWhile lwlcket1Vhllu 1Whl1u 18615.0 18620.0 While Whl1u1Vhllu18656.0 0115764.0 th05632.0 6144.0 porch 6016.0 Ill7032.0 Jarred Jarredand 7960.0 jarredand 18839.0 tho4952.0 18836.0 5616.0 dynamite 6304.0 5640.0 18867.0 namltu Ilnl1ltluexploded XlllJtlltI18864.0 t1110 -44.0 7724.0 1110bo tie totieboys 7792.0 toboys 4676.0 19036.0 19044.0 5080.0 5204.0 right rlhlleg 5952.0 6096.0 19075.0 wu 5756.0 US as19052.0 torn 6400.0 off oftnnd7732.0 hisbody hislHuh 19247.0 body lHuh5164.0 19283.0 wai ttu5044.0 19288.0 Ui thrown IhrowlI6288.0 violently Iuhntly6156.0 7116.0 throughwlntl -636.0 7884.0 19267.0 awindow awludAw 19447.0 window wludAwwlntl 5284.0 19496.0 5048.0 19460.0 illtllthe19455.0 parlor plflolwhere whcrotlINu6836.0 19452.0 thethocuostfl theghosts 19552.0 4656.0 19663.0 19688.0 ghosts cuostfl1I041 5188.0 woro WfUweroassembled asstmbloil5836.0 nst -852.0 19711.0 tmuhll 8torI118torI11bonl 7344.0 Severalboys 19812.0 19884.0 bonl5104.0 nnd and5028.0 gIrl glrlngirls5384.0 19907.0 woro6052.0 oro knocked knoelwd19871.0 ami andamiothur andothure 20040.0 20087.0 othur othorllothurewuro wurtwurr5168.0 5820.0 batty badyluul 20076.0 nlmken takeu6104.0 20120.0 tnktn 20112.0 up III7384.0 theoxplo51on theoxpluslnrt 20299.0 explosion oxplo51onoxpluslnrtnnd111115432.0 6072.0 20292.0 5892.0 6436.0 buy6688.0 7312.0 strikingchum 7132.0 striking strikingthorn 7400.0 trlk1n trlk1ntholll 20495.0 20507.0 thorn tholllchum20511.0 hlH lilH5324.0 20500.0 lllght IIIghl1bht5680.0 6228.0 Thu6940.0 liouso1IOUO20523.0 7532.0 waswrecked waslull wasbadly 4652.0 badly 4768.0 20723.0 lull 4748.0 wrecked HtIHdtrreclcedtrreclcedLepldation 5256.0 HtIHdLeoldation 5388.0 Leoldation Lepldation6408.0 21160.0 6724.0 Rates Ratte6592.0 RatesKalokh Rattennlll RatesRaleigh 21307.0 Ilo 3120.0 4836.0 21339.0 Raleigh Kalokhnnlll nN 6264.0 21335.0 lkc6444.0 21371.0 6316.0 e 6904.0 VskM ukltAskelMasaato asto 21468.0 lothe4820.0 proRHHa 21583.0 IU 6024.0 prt 5472.0 5552.0 21588.0 5604.0 grets rt or21540.0 railroad rallrOQd21555.0 rate rat 21535.0 ilti UUI21511.0 jgatlou Igatiuu 21768.0 gatlou gutlougatiuu5160.0 21791.0 fI 5704.0 thothQtrend llClItIor6512.0 events ontlevonts21743.0 lend lend1leadlend1Injc leadup 21784.0 ItnK 21899.0 21976.0 Injc tnK5016.0 III4912.0 21979.0 5576.0 21967.0 the932.0 5944.0 UBsemblluK ussembilugn8H -932.0 6876.0 mbllul 6248.0 or21984.0 IOU gougunsgunsoral 7912.0 22012.0 Ijural Iural 22164.0 22179.0 ural oral22175.0 awombly aautnbly22215.0 nJ -732.0 5852.0 ol1bl 5272.0 22167.0 In6328.0 special 8lHch1itesslon 1lt5stonaesslon6892.0 toratify toratIC ratify ratIC 22400.0 tlhethe5276.0 22431.0 tHuullng llHlInIKnding5300.0 compromise lOI1l1ronthcuutprornise7588.0 OA1ornur 7592.0 Qpv OA1i7800.0 jornor iornor 22580.0 22628.0 ornor ornur5236.0 22591.0 Glenn QlenuO1llIl15096.0 5856.0 22587.0 81ld22583.0 Thun la 6800.0 7284.0 hewas hewatt 22655.0 IWU 22788.0 22836.0 WUwattnxi lUIH 776.0 tuptrtlttg 5360.0 22847.0 5440.0 ctlnK 22844.0 ahnoltniittost5696.0 22819.0 22823.0 22791.0 tick tack6808.0 7700.0 thathuthaclock thucll theclock 22963.0 clock cll 23016.0 5184.0 23024.0 tumark mnrkarrival ILrrlul6960.0 22999.0 6856.0 7224.0 the7568.0 23019.0 com corncornmunltFntlon 7896.0 com1 com1tuunlcaUon -460.0 commUII 23155.0 23224.0 tuunlcaUon mUII -904.0 munltFntlon 5268.0 23227.0 Uun fJrtor23207.0 whllhtthich5908.0 he23243.0 7040.0 iswaiting wnltlnwnlUncwnltlnbefore wnlUncbtColO 7840.0 waitingbrforo btColObrforotuKlug lalllllgtakingImporant lIulolmtItuiarmuttacton lcUonaction7424.0 23415.0 IIIthematter thnuittor thlUulttr 23648.0 matter nuittorlUulttrHo lie5784.0 23640.0 mUUvl lhllIlhttIt6900.0 1dont con toncony7496.0 23651.0 conhldor tonhllr conycider cider hldorhllrIhNl23848.0 5816.0 5932.0 23843.0 reullj rtally23876.0 23884.0 UU 6520.0 doubt dAUut6700.0 abolltaboutlu abolltIllaboutthe 24039.0 24051.0 Ill24084.0 24047.0 1tlmhHII arwauihltug5008.0 5912.0 24103.0 24115.0 24075.0 24079.0 htiiR uttl 6580.0 hvtffllature kqtelature24043.0 hlatur 7636.0 1111ThuThouuly 1111oul Thuonly 24251.0 24259.0 only uulyoul 24264.0 Quuatloti QUWtI1quustloutalIs24255.0 just 6652.0 wtten 6752.0 7068.0 hon 1ID7204.0 tliothooa O1lU oatuoatuwtll uwill 24427.0 wtll4812.0 bu bo5336.0 Ito issued IsMitM24472.0 tlf1 5824.0 nod aiulfr6664.0 6552.0 lmt hnt7148.0 date datlfIShot fShot 24675.0 fI2728.0 5292.0 24827.0 Shot 24843.0 5968.0 24831.0 Death Cuth6540.0 24835.0 Buggy 6676.0 Buggyv BuggyCofnutnt IOhll1l 25019.0 Cofnutnt 4976.0 25027.0 Ohll1l 5596.0 25032.0 Ga25060.0 Der25035.0 6928.0 25039.0 Hen 1lonUnaFd KdKda fdwartts 25232.0 25235.0 wartts 5156.0 nJI 5408.0 UUKSO itusv1Hu count toun5744.0 coutttr 6860.0 728.0 25251.0 Aliltinu AlalllIIAlabamaAliltinumervhant -728.0 712.0 AlalllIIJntrdlnl Alabamamrrvhnnt 7888.0 25435.0 mervhant Jntrdlnlmrrvhnntunto tal 25443.0 thotsbut6516.0 25448.0 I1d 25451.0 ktittt lr1 br25455.0 llivs llivslontry nt ntth lcue 25648.0 25675.0 cue 4772.0 lontry nntrrltntry25692.0 25656.0 farmur fUl1Iorfnnnur5804.0 25659.0 orcountcountythe countlh countywkLo 25843.0 wkLo 25851.0 25864.0 tar25879.0 25903.0 tno tw weroriding rUllntrldtn7164.0 buy bunry7308.0 bunryfrom buyfrom buyfrnm 26059.0 frnmllftteheoaubbeo Ilatcbecauhbt5056.0 lICl -1248.0 26067.0 Juhb 6404.0 26111.0 6432.0 IVheo tchrn7544.0 26072.0 Ala 7136.0 Alatbty Ala11u Ia IaWlkthtkt 26263.0 11u Wlkthtkt 26267.0 tbty 26299.0 ti 26275.0 ttijcht ttlJht26283.0 26272.0 There TUt 6440.0 lwrl 26308.0 rc wortcre 6980.0 talwtt wtt1ttb 26287.0 lt lttu 1l1iH 7828.0 26495.0 1ttb 26499.0 l1iH 26507.0 tu tit26480.0 tbet11 5840.0 26483.0 trarisly tr trh ptod 6704.0 IM andnd Ut26519.0 c 26516.0 CO COCIU r1 7772.0 ka kacu 7872.0 ecau 26679.0 26707.0 cu CIUcauouly uulyoI 5516.0 26683.0 ba26688.0 cvttj 26735.0 6124.0 26699.0 mtur IUtturt6616.0 vl 6748.0 They Iher7656.0 hadbeen hadctln hadbarn 26879.0 barn4788.0 26911.0 ctln 5052.0 26919.0 er Cf26923.0 5668.0 26939.0 26891.0 6000.0 6120.0 flttsl fItttttsfItttttsDestructe 26899.0 26896.0 Ud jDestructive 26991.0 ICutruct 27303.0 Destructive CutructDestructe27331.0 6060.0 27307.0 Fife Fire27323.0 Oit6380.0 Abbeville AbbeylllAbbevilleAbbeville AbbeylllAbbetlJt AbbevilleAbbevill -672.0 7412.0 27491.0 27495.0 AbbetlJtAbbevillCla Ca6032.0 27535.0 27503.0 IVc 127507.0 SS STho 2SThe27511.0 7500.0 27520.0 wortworxtwortftro wontfiN worxtftru 27703.0 27711.0 fiN ftroftru27707.0 tblnAHb AW5672.0 tbinI rle vtileHas 6648.0 6768.0 bll427723.0 tor27747.0 reusyearsoecurre4 reusOcurrllt yearsoeeurrrl 27911.0 27915.0 oecurre4 Ocurrlltoeeurrrl5492.0 here ttN5940.0 Tkur4ay Thuri4y6280.0 N4 27919.0 nit alcatulbt27923.0 TbieTbiewill TI 7768.0 TheIO 28111.0 28131.0 IO 4724.0 wiU4832.0 28115.0 1U uout28151.0 28127.0 28147.0 28119.0 J30 noi30QO0 KX toO7208.0 28135.0 28123.0 ThetaIrt TheUte Th Thut1 28319.0 28343.0 ut1 taIrt4736.0 28363.0 28352.0 N1lt 28335.0 propdrty 28355.0 5660.0 5768.0 kauw OWQ 28359.0 28327.0 Ute uCtJeeUteShot 7272.0 28323.0 ltttf 1afstttlterltttflu 1afstttlterhurl 28527.0 hurl boa 28560.0 5556.0 kegs 28563.0 W1 28531.0 dutltrvyl dutltrvylShot -800.0 28575.0 -700.0 6320.0 28543.0 tN 28535.0 1Shot 28940.0 28955.0 28943.0 CuthAbout 28951.0 28947.0 Cents CfntaCentsKMI CfntaRll CentsItur 29135.0 KMI RllItur29187.0 Oa Ut29159.0 29171.0 IK a29155.0 Vs As29163.0 Llaof resultf 7936.0 wt 29339.0 29343.0 f29375.0 dUpao dtepJedlepae4992.0 29371.0 ator29383.0 6152.0 29367.0 ten tea6396.0 29379.0 29363.0 tot etrnttents29351.0 Sim S1m6896.0 Smith eolith7320.0 Smitha eolitha7664.0 ltn 29547.0 29595.0 29583.0 ne net29587.0 29571.0 ro TO5424.0 furcact ftcnaeetU fcora kasti29551.0 l1 6756.0 29591.0 wu29559.0 UUIotV ktlletk7736.0 29599.0 oaaftwaCKm oaChtbtinM oaCb11MtRt 29755.0 ChtbtinM Cb11MtRtaftwaCKm aftrrao4ttafttra -796.0 UJ lift lit6976.0 29791.0 r929787.0 attack tn tnI 7740.0 29947.0 30063.0 xmlns:ns5 ID16 6084 3324 8172 5620 ns5:type 3224.0 5620.0 2056.0 COLLISION COLLISIONINCOLLISIONINThree -2056.0 10304.0 10064.0 10560.0 10112.0 10976.0 fOG 10728.0 fOGTbree 8224.0 Three Tbree8880.0 Persons 8768.0 9736.0 Killcd10564.0 10792.0 10948.0 Dozen DozenInjured -548.0 11496.0 9488.0 Injured InjuredACCIDENT 10160.0 10516.0 8216.0 ACCIDENT 9416.0 NEAR 9308.0 10044.0 CAMDEN 9972.0 11104.0 NJ N110944.0 N1Fatal 11416.0 11108.0 NJFatal 11352.0 11224.0 JFatal 8204.0 Fatal 8712.0 8252.0 RearEnd 8624.0 Rear -748.0 9460.0 8260.0 End 9096.0 9544.0 8256.0 Collision 10316.0 8264.0 Occurs 10968.0 8296.0 10892.0 11232.0 11144.0 theElevated 8376.0 Elevated 8544.0 Tracks Tr1cks8547.0 9748.0 10048.0 8540.0 tho9976.0 1096.0 10384.0 Pennsylvania 10292.0 PennsylvaniaRailway -1096.0 PennsylvaniaRailwayFire Railway RailwayFire 9244.0 8832.0 9568.0 9664.0 Added 10260.0 8844.0 10508.0 8840.0 10416.0 10868.0 8835.0 Dlfficul 10760.0 Dlfficulties 11428.0 8364.0 ties 8756.0 8664.0 9012.0 9112.0 Rescue 8912.0 RescueOamden 9580.0 RescueCamden 8356.0 Oamden Camden9228.0 9443.0 9540.0 9451.0 9348.0 9624.0 9964.0 DrcDfC10544.0 9456.0 10256.0 28rThreo 10712.0 28rThreopersons 10928.0 9464.0 10996.0 ThreoThreepersons Threo1013On8 8172.0 9680.0 1013On88932.0 9692.0 wore9432.0 killed 9328.0 10004.0 9672.0 anl9896.0 10400.0 9700.0 moro more10920.0 than 10816.0 11392.0 11276.0 adozen adozon 8188.0 9859.0 dozen dozonothers otbers8656.0 9400.0 9908.0 9276.0 9876.0 Injllred9796.0 10612.0 9884.0 In10496.0 9912.0 10772.0 rear yearrearend 11432.0 yearend 8184.0 8604.0 10075.0 collision colUslon8476.0 10120.0 9288.0 9752.0 10084.0 10140.0 10092.0 elevated Ilevatedlevated10964.0 tracks 10824.0 tracksof tracksthe 8176.0 10283.0 8460.0 tho8340.0 1128.0 8836.0 PennsIanla8720.0 10096.0 10340.0 10132.0 10296.0 railway 10200.0 10168.0 till 10700.0 10324.0 10300.0 lway 10360.0 10388.0 10332.0 10836.0 short 10924.0 shortdistance 8180.0 10491.0 distance dlstanco8964.0 10504.0 teom8868.0 10512.0 9808.0 station statlon9716.0 10364.0 10724.0 10620.0 11120.0 cityThe 11024.0 11124.0 cllY11424.0 cllYrhe 10708.0 rhe8596.0 10744.0 cars 8500.0 9036.0 8936.0 9504.0 10752.0 so 9424.0 10720.0 10328.0 smashed amashed11036.0 thatIt 10916.0 wUIw118300.0 be8680.0 9052.0 10935.0 noun howshou 10188.0 betore10904.0 10932.0 11244.0 ex ox11156.0 oxact act 8532.0 11136.0 number 8424.0 11140.0 or11176.0 person persJIipersons10276.0 11148.0 caught cauht10156.0 11220.0 thewreck 11344.0 11348.0 wreck 8816.0 wl118676.0 9256.0 ke9104.0 9352.0 11387.0 Known tlnownInown11359.0 10100.0 10988.0 11356.0 added m1dod10860.0 addedto m1dodto11460.0 11556.0 8436.0 the8332.0 8796.0 difficulties dJfficult1es8696.0 11567.0 9660.0 10032.0 11572.0 9920.0 10396.0 work 10280.0 10908.0 11564.0 10804.0 11180.0 res 11068.0 11623.0 xmlns:ns6 ID18 11792 3484 8048 ns6:type 11792.0 cuo cuecuoTho cueTho8444.0 8336.0 11972.0 8732.0 11980.0 trains tralnslnolCil 9216.0 11983.0 Involved Involver12019.0 wero11992.0 10420.0 oxprce oxprcoxprese10736.0 oxprcefrom 11464.0 oxprcfrom oxpresefrom 11296.0 3260.0 8160.0 12180.0 8692.0 12188.0 Atlantic 8556.0 9492.0 12196.0 9364.0 Cll 9840.0 12200.0 ad9728.0 10248.0 10796.0 Pember Iember10656.0 Pemberton Iemberton11420.0 8164.0 12399.0 12408.0 accommodation nccommodatlon8420.0 12412.0 train 9984.0 These ThCeThesetrains ThCetrwns 12607.0 trwns12648.0 wore8652.0 9300.0 12620.0 due 9720.0 9592.0 12624.0 9868.0 664.0 10380.0 Camden 12632.0 sta stay11044.0 sta110n stayLion 12688.0 8148.0 12812.0 Lion tion110n8568.0 12828.0 8468.0 8808.0 12824.0 821 8728.0 9148.0 8992.0 12860.0 9508.0 9324.0 9960.0 12835.0 Thore12864.0 10448.0 10912.0 ncry11012.0 verythick -364.0 11204.0 cryt11lck 3032.0 8156.0 13028.0 thick t11lck8628.0 13036.0 fog roG8572.0 whon8884.0 13040.0 9360.0 13043.0 accident acctlent9688.0 acc11 13076.0 13059.0 10204.0 10480.0 occurred occurredTho 11188.0 occurredNlo 8328.0 13240.0 Nlo13276.0 express 9500.0 13248.0 10024.0 13284.0 9892.0 13256.0 maJomnlu10320.0 11004.0 10880.0 at11192.0 oftwo attw oftaro 13448.0 13456.0 taro8456.0 8560.0 baggage hasgage9312.0 13488.0 9224.0 13492.0 ore ON9652.0 13500.0 10124.0 10212.0 13459.0 pallolcar enrr1r10716.0 11164.0 13480.0 nndandthree nndI 8056.0 13711.0 8080.0 thr 8584.0 8684.0 coaches 8400.0 13675.0 9316.0 13672.0 tho9708.0 13667.0 acuommodatlc nccommodatlaccominodatk11256.0 11312.0 11368.0 13700.0 nttrain nI 13868.0 ttrain 13991.0 trnln13875.0 consisted consJstcd9560.0 13891.0 ot9848.0 13916.0 10052.0 13880.0 combination comb1nallon11200.0 13911.0 cur curand 14052.0 14083.0 14080.0 tour four14091.0 conohesconches8872.0 coachesBoth -632.0 9596.0 9600.0 8052.0 14188.0 14296.0 Both 8852.0 14299.0 trams9564.0 14312.0 9764.0 14304.0 9888.0 10152.0 1ld 10352.0 10592.0 14335.0 10740.0 10992.0 run running 11400.0 runnlng 14371.0 14499.0 ning nlng848.0 14507.0 cautiously cautlousl14548.0 14512.0 10372.0 approached 10272.0 approachedj approachedthe11444.0 14648.0 14687.0 8076.0 14712.0 the14715.0 MaMontatJon8408.0 9524.0 14720.0 rho9128.0 9996.0 engineer ellglneeror11196.0 rho11032.0 thoPomberton rhoPemberton 8048.0 8152.0 14923.0 Pomberton POIIIIllrIOnPemberton9180.0 14928.0 lraln14931.0 because 9556.0 10492.0 14943.0 ot10780.0 tho10660.0 14936.0 fogj 11408.0 fo fodtd fogdid 15123.0 15136.0 did dtd8068.0 8484.0 15148.0 8388.0 15175.0 see B 9088.0 8904.0 9004.0 15180.0 15139.0 the9536.0 15144.0 lraln10536.0 11332.0 ItI itIs 3356.0 15339.0 15344.0 18064.0 8404.0 15347.0 Bald8272.0 15352.0 9472.0 9804.0 15383.0 WHSclose upon 10628.0 11284.0 ItHe itHe 11404.0 8140.0 15552.0 15555.0 Jammed 8372.0 15560.0 the9140.0 brakes 9528.0 15567.0 dawn10940.0 15564.0 10756.0 11320.0 itwas 11324.0 Itwas ItWILlI 15796.0 WILlI8548.0 15772.0 too 8896.0 late lateTho 9200.0 lateThe 15783.0 8316.0 15971.0 The15976.0 16007.0 9208.0 15983.0 together togther9740.0 10652.0 15980.0 wllh11116.0 16016.0 conRldoroble 11396.0 confJdornblo conslderubie 16176.0 Rldoroble fJdornbloslderubie16188.0 force rorce8888.0 16191.0 9952.0 16196.0 tender or11184.0 thethoPemberton 11440.0 thoPemborton thePemberton 16363.0 16387.0 Pemborton9184.0 16396.0 9032.0 telescoped telclcopedthoflrst1 10568.0 thoflrst1car 11528.0 16404.0 thou 10980.0 16407.0 first nrstfirstcar 11436.0 16604.0 16631.0 er8480.0 16612.0 8396.0 KB itAIts8644.0 9044.0 trnlnkilling ldUlngkiUing16607.0 10164.0 10800.0 16643.0 personsand 16648.0 r90nS 10844.0 11504.0 Itand 11524.0 Innll 16812.0 16815.0 nnll8520.0 Injuring 16828.0 9520.0 least four tour10696.0 10336.0 11100.0 16856.0 renrrearcar renrrnr 17023.0 17056.0 rnr8496.0 17028.0 or8392.0 8660.0 Atlnntlc9020.0 9928.0 17059.0 10264.0 17064.0 et 11016.0 10688.0 ros waswreoked 17203.0 17236.0 wreoked wrecked9120.0 1herhowreckage wrocknlowrockago9448.0 10408.0 Immediately Immedlatel920.0 Immedlatellooc -1020.0 immediatelytcxtlt -920.0 11328.0 17439.0 17444.0 took looctcxtltfire 8848.0 locomotive locomothelocomntive10784.0 17455.0 17452.0 thethopollco thopo1ro thepolice 8128.0 17652.0 police pollcopo1ro8736.0 17655.0 8612.0 9016.0 1036.0 17660.0 departments dopurtment8dopnrtmenta9420.0 10732.0 10596.0 11020.0 Cam 11376.0 17863.0 17896.0 wero8412.0 called caltfd17868.0 service serviceThe 18068.0 18071.0 Thofact 18087.0 9144.0 9572.0 18076.0 9924.0 col1Lslonoccurrd10608.0 occurredon occurrdtho-716.0 18279.0 18320.0 18284.0 the8312.0 olevltted18292.0 ntructure Itrurttlrcatructuremnrte mniiemnde18287.0 the11052.0 thowork thowor theworl 18492.0 18495.0 worl18520.0 wor orot8976.0 rescue rfECUe9636.0 difficult liUncult18528.0 rer11000.0 rescuera re 11384.0 reclJCrarould rercueri 8132.0 18703.0 18728.0 cuera cueri18708.0 clJCrarould 8704.0 could 9124.0 9284.0 18712.0 roach raehreach9532.0 the10116.0 structure 10532.0 structurefixmi structurefrmn structurefrom 18908.0 18911.0 fixmifrmnthe8504.0 8972.0 18923.0 Klreetlretbill9452.0 9944.0 9824.0 10348.0 18928.0 18947.0 11172.0 18916.0 thewrk 19119.0 wrk19128.0 frflm trlmtr11m8620.0 9212.0 19124.0 tbestl1t1on9468.0 10232.0 19131.0 thefoot 11260.0 ofMarket ofMAIlt 19327.0 Market MAIlt8668.0 19339.0 19336.0 19344.0 9264.0 streetAll 19367.0 flt 9080.0 11484.0 19391.0 2220.0 19532.0 19535.0 19539.0 available 19571.0 8856.0 II1I1 19575.0 le 9248.0 help hllhrIprrom9852.0 10476.0 file thot11010856.0 19544.0 Sf 11412.0 Uon 11080.0 19747.0 19760.0 nnd19783.0 mln1n9336.0 NIt Miethernllrol1d9584.0 yards 10636.0 nr1s 10984.0 19755.0 Iltlllantiantishops amishops 19955.0 shops IIhoPI8716.0 19991.0 9220.0 proceed prcfsedproESed9968.0 19960.0 enlce19996.0 sen 10776.0 1cu 19963.0 nnllt20163.0 20168.0 U1eInJurflc8384.0 20195.0 wtre9100.0 9724.0 quickly Qutckltaken takontron1treat10900.0 fromunder tron1lnc111r treatunder 20371.0 20379.0 lnc111r20376.0 tho8588.0 20407.0 mass 8944.0 or9444.0 9812.0 wrrckngoRDIatml10600.0 11088.0 20412.0 eonveyed ooneon11360.0 conveyed 11364.0 20443.0 20579.0 20592.0 veyed efd20587.0 thoUIO20584.0 Cooper hospital hOflopltnl10648.0 11160.0 11048.0 theWost theWo the1Vcat 20787.0 20800.0 Wost 1VcatWo 8488.0 20816.0 8632.0 20792.0 Jersey JprstrhOWItI1hospitalThe hOWItI1The9904.0 21000.0 21008.0 flronro21036.0 waR1048.0 9512.0 extinguished extntIIIoh10484.0 21003.0 hoforororo 11292.0 Itreached ItrfOachol 21203.0 21219.0 rfOachol8864.0 21216.0 thtvictims VICtlPlf21211.0 pinned plundpiuned10580.0 thethowrockucc thorockuJc thew 21424.0 wrockucc rockuJcrttckucewrockuccLOVER 21455.0 rockuJcLOVER rttckuceLOVER 21776.0 LOVER FILLED 8748.0 9632.0 WITH BIRD 10808.0 SHOTSensational 10812.0 SHOTBeniatlonal SHOT8onutlonal 22184.0 22192.0 Sensational Beniatlonal8onutlonalDenoeument Cenoeument9060.0 Attempt AttemptsAttempted Attemptsed22259.0 ed 22403.0 Elopement 9940.0 Albanvu AlbanvuLeosbur -652.0 Alb Alban I1tbur ILeosbur 22595.0 22600.0 Leosbur 1tburGa8960.0 lKc Doc9320.0 10392.0 22603.0 HWAdMns WAdldns WAdkins 8112.0 22811.0 AdMns AdldnsAdkins22839.0 768.0 employee employetD1ilo -768.0 9988.0 or10220.0 thu10144.0 10572.0 Ix Lee 10768.0 Coun XIunCounty 11340.0 22816.0 XIunt 8120.0 ty 8268.0 Journal 8168.0 23047.0 wu9668.0 flllod nllodfilledbtrdslmt bfrdilltotbtrdshntbtrdslmtIn bfrdilltotInbtrdshntinfront rront8876.0 8764.0 9376.0 9480.0 homo hOHlthune9280.0 10016.0 23255.0 0nDvputy Dtputy10172.0 l1tlIt 23232.0 Clerk ClrrkClerkJ 11388.0 23363.0 IJ 23432.0 23435.0 8428.0 1V8196.0 8812.0 Morgan MUrItM23463.0 prominent prouInent9744.0 23460.0 I1fUU -836.0 Ir1tD 10240.0 10664.0 23451.0 23440.0 citizen 11072.0 11n xmlns:ns7 ID19 6716 3312 8092 23695 ns7:type 23695.0 rrunty rruntyThe 9304.0 23851.0 shouting 8608.0 shov -696.0 hltlu 9108.0 iluf 9548.0 23879.0 cnmeC11I110104.0 IU23871.0 te 10428.0 23887.0 23859.0 denoeu Itnooudenoeument Itnooumnt 24056.0 24067.0 mnt24064.0 24087.0 nn840.0 olopomont oloptunetit9204.0 llopn 1It 24071.0 planned 11Itnntllb11Itnntllbr -892.0 trMr tr11380.0 byMr Mr 8284.0 24303.0 Adkln Adkinsltk 24300.0 InllMist Mlw9484.0 10068.0 Nona 9784.0 10192.0 01 MorKan JlnrganMorKanIt JlnrganItIor anIt 8292.0 buhttt8980.0 nltbNncltvirly clttarty9732.0 rtoi 10436.0 d1101oJ devulopjd1101oJwheLhrr devulopjtrhether 10960.0 lo 24516.0 CAl CAlwhether whether wheLhrrtrhether8900.0 8776.0 Ih fRthfr9872.0 24711.0 9760.0 thl10040.0 brother 10404.0 ofxhe oftbe 8104.0 xhetbe24916.0 young oungOlInl24919.0 24888.0 lady ttlIshooting booUnbShctlnshootingJtut 10936.0 ShctlnJust booUnbJllit -516.0 10832.0 24939.0 8288.0 25091.0 25096.0 Just JtutJllit8708.0 25135.0 4sIr 9176.0 Allkln AdkinslKln 9948.0 drove dro 25132.0 10672.0 25119.0 frost frontfrostof frontofrr 25143.0 tor 25307.0 orthebou hot25332.0 10148.0 25335.0 wa 25340.0 25347.0 +10556.0 25312.0 ilrtsl l1rt4lfiret10444.0 25327.0 itTV 11372.0 ItIm 25507.0 25543.0 TV 8232.0 25512.0 preceled 25540.0 Im prcc 1td 1led25531.0 25515.0 warning warnlnjIrnlng10624.0 25555.0 cry cr 25527.0 fromfrrbtnfrontMim frrbtnMiis 1088.0 25715.0 Mim Miis8276.0 8592.0 MurRnnlorJnMorganThn 9196.0 MurRnnThft -600.0 lorJnThft 25920.0 Thft Thnfhothuteffe 9704.0 fT 10136.0 10012.0 25959.0 9900.0 25939.0 25928.0 25935.0 tae t1ethe10956.0 face faceneck facen 25943.0 26123.0 26128.0 neck 26155.0 8576.0 IndRhoul MOl1tr ahouIlr26131.0 ler or10060.0 26139.0 AIUni AtkinAIUniHe AtkinIle 10228.0 26143.0 hu hulit 26331.0 litIle26347.0 return rlturn26367.0 9388.0 26336.0 tbo9252.0 26339.0 nr 10076.0 26351.0 wit wlfi26383.0 10500.0 26387.0 26355.0 rill rlfl10576.0 riOt 10888.0 26363.0 batbathis butbb buthis 8116.0 26535.0 bbhhots libhlsttts26571.0 weo weu26575.0 9332.0 26539.0 without 26559.0 ltrleteffectTvo ltrletTwo effectTwo 8672.0 26935.0 Two TvoChildren Chlldrtn26951.0 Cremated CrematedJackfcboro CrematedJacktburo 26963.0 mttd mttdJlclsboro 27127.0 27131.0 Jackfcboro JlclsboroJacktburo11111 Tt 27171.0 9516.0 27147.0 Doo DooRome 27168.0 27183.0 Thohome Thobowt 27327.0 home bowtRome27335.0 ot8552.0 8784.0 27343.0 Tillery Tllkry27367.0 to27376.0 ml1es27384.0 fromthij fromthia fromthis thijthia27539.0 place 11C27575.0 1U8920.0 27543.0 dostroyej dOltrordostroyed27567.0 br27579.0 flr 27595.0 ttUy 27592.0 Thunt TlauroThuntd Tlaurotlay 27751.0 tUy tlay8472.0 27756.0 tl1d27767.0 tW1twvlchildren oMldronldron 9860.0 27803.0 27775.0 bor10488.0 27792.0 amiILR110840.0 27800.0 otofam ere eTeeTeand ereand 27951.0 27959.0 am8508.0 27987.0 8688.0 27955.0 ot8916.0 27979.0 to28000.0 yeArl9676.0 28015.0 10692.0 we 28027.0 burtedU bttraedWburted urae4bttraed28011.0 urae4to 28159.0 28172.0 toW28187.0 tthtictith28175.0 Tncy 28180.0 blr bad28191.0 bexsabN128195.0 left laft16ftlaftla 16ftin 28211.0 aJet eto into8360.0 thohouso8616.0 28371.0 9172.0 9552.0 28383.0 iholbeihoFired 28411.0 aeta aetaFired -664.0 10368.0 28416.0 La LaFlrfd 28611.0 IUU1f 28763.0 Fired Flrfd28771.0 Thr Throufh ThVIh28779.0 eugtt 28791.0 Head HeadKtskrUle HeadAraatrtl1e KtskrUle UU1fAraatrtl1e9240.0 28967.0 TVan Traa29004.0 28971.0 29012.0 28991.0 IAfter 8RitesIAfterIrtnlioce -792.0 8RitesIrltt Attt Attte 8096.0 29127.0 29167.0 Irltt Irtnlioce 8432.0 29131.0 6oae 8948.0 29207.0 9072.0 Motabet29179.0 hbkts29191.0 vifostrifevifoa 29203.0 CUrl Charie29251.0 11216.0 ifiaonea 11288.0 ttnea tnea fiaonea29407.0 leu1Uk lsultttUs29387.0 ularlU 29399.0 amt aoi9880.0 29427.0 hyt 29420.0 ttt4le ttt4leaw1t 29415.0 1i11 1i111O 11252.0 8092.0 aw1t 1O 8440.0 29607.0 zna 29611.0 9132.0 ktUt4 9136.0 ktU towel NtIt 29619.0 p11240.0 29659.0 29651.0 29775.0 hli4 tkrp4J 29795.0 9056.0 29819.0 ero 10376.0 29811.0 30019.0 8368.0 30360.0 xmlns:ns8 ID20 18132 3320 11536 5556 ns8:type 12372.0 LOST 12848.0 FINE 13060.0 13736.0 DOG DOGSome 14088.0 11648.0 6048.0 12276.0 Person 12072.0 Maliciously 12816.0 14136.0 PoisonedFine 13932.0 PoisoneFine 14852.0 2624.0 11920.0 6231.0 6267.0 Fine 12380.0 Canine 12264.0 12932.0 13296.0 13560.0 13396.0 GoodmanFriends Goodman 14544.0 GoodmanFllends 11816.0 Friends Fllends6524.0 12436.0 12784.0 12684.0 12888.0 13292.0 13144.0 14128.0 14028.0 14492.0 sym srmsync14388.0 sympathizing 14820.0 srmI syncpathizing 11636.0 6719.0 6755.0 pathizing nthlzlllg12392.0 11684.0 11672.0 12500.0 6747.0 hint12852.0 13512.0 13968.0 6728.0 loss 13864.0 14364.0 14260.0 hIsfille 14528.0 14676.0 tiflue 14772.0 11640.0 flue fille12016.0 bull huH12556.0 Bullet Buffet12308.0 13260.0 13032.0 13820.0 10lllesome13728.0 14316.0 l1erson14220.0 personhad 14856.0 l1ersonhad 12000.0 11912.0 12320.0 7199.0 cruelty cruclt12248.0 12972.0 12892.0 poison polson13120.0 13780.0 13708.0 Thursdo13956.0 ThursdayBullet 14816.0 Thursdonullet 11692.0 11904.0 nulletlullet11756.0 12612.0 7456.0 12912.0 fineline13128.0 13680.0 dog clog13552.0 14116.0 13952.0 14408.0 waregarded 14768.0 wasregarded regarded 12512.0 12840.0 12680.0 13092.0 harmless 12924.0 harl11l ss 13564.0 13976.0 14428.0 affec attec14256.0 affectionate 14812.0 affectlollate attectionate tionate tlollate7880.0 canine 13012.0 wI 13364.0 13212.0 13180.0 13496.0 afore13888.0 ordi ordl14356.0 ordinary 14804.0 ordlItnlY nary ItnlY12112.0 intelligence hJttl1Igence11996.0 13312.0 13648.0 8088.0 13536.0 beets13904.0 14500.0 kep14384.0 keptup kepup 14796.0 14780.0 11632.0 since 11820.0 12424.0 12324.0 12772.0 12672.0 or13716.0 ordinancpreveuting 14048.0 ordinance ordinanc14756.0 ordinancepreventing -804.0 ordInanceuocnllng 8339.0 876.0 8555.0 preventing uocnllngpreveuting12608.0 hull12508.0 13008.0 dogs 12904.0 13476.0 13940.0 roaming lOamlllg13840.0 14696.0 ntImge 14600.0 alarge 14776.0 14800.0 8755.0 large Imge12164.0 tvith0ut12040.0 12900.0 n13108.0 muzzle 13872.0 hut13668.0 14240.0 even 14120.0 14740.0 If 14608.0 Ifthe ithe 11628.0 11968.0 8999.0 11880.0 12336.0 hud bud12712.0 heen12616.0 13168.0 9007.0 13080.0 8996.0 largc13320.0 13936.0 14200.0 14108.0 14584.0 noof 14588.0 notof 14792.0 11624.0 9215.0 11916.0 n11784.0 disposition dlillOslllon13176.0 13024.0 14392.0 causeany 14248.0 14396.0 14844.0 causeam amuneasiness IIneaslneis12880.0 13264.0 13540.0 9479.0 13924.0 9476.0 13836.0 Iy 14340.0 gentland 14344.0 gentle gentl14752.0 gentleand gentleI 11544.0 9587.0 11620.0 an1956.0 affectlonllte13072.0 12948.0 13440.0 lias13352.0 13784.0 never ner13704.0 14300.0 caused 14224.0 causedany 14840.0 causedan 9931.0 12004.0 trouble trouhle11804.0 troubleMr trouhleTr12584.0 11808.0 10128.0 Tr 12028.0 12208.0 Goodmallnaturally natural113984.0 feels fels13848.0 ver 14348.0 versore 14748.0 eryverysore eryore 11712.0 10344.0 sore ore12232.0 toward 12048.0 12896.0 10347.0 13136.0 13760.0 14160.0 adminis allrlllnisadntinisadntinistered 14164.0 administered allrlllnislored 14808.0 tered loredlho12032.0 12476.0 IlolHOII12980.0 well welt13288.0 might 14620.0 ue14524.0 beBARBER ueBARBERGODWIN beBARBERGODWIN 1692.0 12364.0 BARBERGODWINSunday 12368.0 BARBER -1688.0 14056.0 BARBERGODWIN BARBERGODWINSUlldar 13316.0 GODWIN GODWINSunday 11800.0 Sunday SUlldar12600.0 12400.0 2212884.0 13148.0 13444.0 11423.0 1907 IDO13776.0 pretty 14208.0 prettyhomo 14760.0 11552.0 yhome 11616.0 homo12176.0 12052.0 12464.0 Mrs Jrs12328.0 12552.0 11652.0 Its 12760.0 12928.0 13004.0 13436.0 Godwin Codvvin14468.0 thscene 14592.0 thescene thetcell 14764.0 11872.0 scene tcell12172.0 12064.0 n12644.0 quiet Iuhtinlet12520.0 13156.0 11875.0 hut13044.0 13532.0 11888.0 wedding 14012.0 weddingi weddingwhen 11536.0 12088.0 wllln12168.0 12096.0 JI12091.0 Edward Kdward12592.0 12127.0 12564.0 Id 12796.0 13088.0 12100.0 Barber Ihuher13636.0 14104.0 Miss lIssHiss14568.0 11i14472.0 WInona 14788.0 11inoun 14636.0 Vi Vinoun 11612.0 nonaEdna KdnaJodna12580.0 Gollwln12496.0 13272.0 12363.0 13388.0 12327.0 married 14496.0 Rev Itev14352.0 RevAndrews HAnlllws ItevAndt 14664.0 Andrews AnlllwsAndt 12571.0 etvs 11984.0 12428.0 12540.0 otllclatlug olllcllltillgofllcitttingofllcitttingPromptly Promptly Protl1ptl12548.0 12788.0 12936.0 13724.0 12779.0 13592.0 14284.0 strains strain14196.0 straInso strainof12820.0 11596.0 13015.0 1184.0 11840.0 Mendelssohns 1ndeI8Iohl13MendelssuhnsWedding cddlng1Vedding13860.0 13000.0 March Iarch14464.0 play played playcd1la 14688.0 11608.0 13204.0 cd11704.0 11924.0 12236.0 1188MIS12736.0 13215.0 Susie Suslo13220.0 Teeter 1eetel13160.0 tTw13259.0 oungyour14232.0 youngcouple youroulle 13267.0 g 14728.0 13423.0 couple oulle11696.0 13428.0 01111 12128.0 appeared JIlaIcl113467.0 12968.0 12340.0 13464.0 anllanti13528.0 13439.0 iuthc14132.0 13484.0 presence presenc14020.0 presenceof -704.0 14836.0 11604.0 13647.0 11884.0 13683.0 11760.0 few fete12516.0 13656.0 relatives 13340.0 13216.0 13768.0 friends fl111I1813628.0 14448.0 wermade wer14736.0 weremade 14832.0 13719.0 14680.0 Ie 14660.0 IenHull nHull12160.0 mallntau12036.0 alld12480.0 13020.0 rife wlfi13064.0 rifeMr 13308.0 Ifl 13927.0 11796.0 14096.0 12192.0 Ihn Halbpl14140.0 12636.0 14111.0 14144.0 13344.0 prosperous 11108111011814155.0 Ollllgsoonyoungman soonman 14444.0 Ollllgmall 14724.0 14744.0 14163.0 14324.0 mall11936.0 12296.0 14327.0 Macclpiiuy lacclPIlIlYM11cclennyIInd13612.0 tits13964.0 looking hIs bishitbisbest 14828.0 hIshust hithest 14540.0 best husthestIII14543.0 12668.0 14551.0 regulation IgulatlontegulattOf12452.0 14560.0 black blarkhlark14571.0 suit Hlllt14612.0 ant anttvhlte 14579.0 andwhite 14824.0 1111whltl 14759.0 whltltvhlte12148.0 tll14771.0 allil12348.0 12872.0 12764.0 14779.0 bride 14784.0 looked look 14228.0 14152.0 14332.0 14815.0 sweet swpetsweetf sweetLswpetchall11ln 14984.0 15015.0 11668.0 11828.0 charming chall11ln11744.0 15000.0 III15036.0 13068.0 dainty dalutr15008.0 dress IIIHSItrCSS13580.0 14156.0 15020.0 whitnet whitwhitenet 15064.0 11592.0 15216.0 15223.0 15244.0 11860.0 15248.0 15251.0 12076.0 12260.0 silk Hllk12312.0 12952.0 15220.0 15228.0 lace 111113892.0 15239.0 nndan113756.0 ribbon llhhon111101ribbontrimming llhhonhhnmlng Itrintnting trimming hhnmlngtrintnting12536.0 15439.0 whlttthite15480.0 13104.0 15447.0 slippers 81111J1P1815464.0 IInd13740.0 gloves HloeHgloveglovesHer HloeHH glovesi15652.0 Her fler11788.0 15660.0 poinsaway goll -908.0 12940.0 going 12528.0 away 12468.0 15672.0 13424.0 waR14084.0 Hlovely lonly14168.0 lovelyblue lonlyblue level levelblue 15732.0 15868.0 blue 15880.0 voile culls11940.0 0111 12484.0 15888.0 wllh12440.0 15896.0 12996.0 15908.0 tllmmlngtrinmhtg14564.0 tutshoes 14360.0 tan tuttanshoes tanHhoPA 15955.0 16091.0 shoes HhoPA111111glops12448.0 16119.0 Inllhat hlt16148.0 14288.0 16140.0 match mlltchmlltchlllllr matchTheir 11772.0 16315.0 Their lllllrgifts 12224.0 lfls 12804.0 WIChandsome hanlsone14204.0 14484.0 14596.0 16399.0 ap at14476.0 appropriate apMls atpropriate 16440.0 14732.0 propriate propriatedfiss 11776.0 Mlsdfiss12272.0 16767.0 Wlnona 1Vinoua12456.0 16772.0 1110111 16784.0 13252.0 16820.0 16792.0 dallghtpldatrgltter13336.0 14180.0 14576.0 thptholate thplall tlr tlrlate 11584.0 16980.0 lall11964.0 16984.0 11892.0 112240.0 17011.0 1111coin13460.0 17047.0 17031.0 reared IcalldlWlr14336.0 hereSlu lWlrRhl hereShe 17200.0 She SluRhl11852.0 17252.0 wns17247.0 118 12284.0 17223.0 assistant slsllllt13100.0 13196.0 17231.0 fachor aelter17244.0 17272.0 13244.0 alhI 13332.0 13764.0 Ii13992.0 tllC17259.0 God GfIIGqd14368.0 GfIIwill Gqdwln 17336.0 11588.0 17427.0 win willwln17431.0 school Hcltool11864.0 tills12492.0 winter Inter12916.0 httpl 17472.0 nnd14124.0 17508.0 14532.0 17519.0 Ollfont14416.0 oneof Ollfof ontof 17647.0 11876.0 Ilexs HIxs11736.0 Rex 12304.0 17688.0 most 17680.0 popular popnlll13696.0 17719.0 youllg17704.0 hulks Jallhsladleshulksand Jallhsnnll ladlesanti 17871.0 nnllanti12008.0 17876.0 17879.0 bl12288.0 12732.0 17891.0 missed mlsslllmiSSeI13404.0 17907.0 hr13268.0 hel14092.0 17924.0 circle 13972.0 1Irll 14536.0 17940.0 offrltiuls of11tIIt1s 17976.0 ofriends 11580.0 18091.0 frltiuls11tIIt1sfriendsinunedinttlyltfter frltiulsImmcdlntflyafttr 11tIIt1sImn 11764.0 18312.0 Immcdlntflyafttr inunedinttlyltfterImn -1492.0 12184.0 18363.0 12068.0 dlnI 18335.0 rtlr 12676.0 13348.0 18348.0 13600.0 18392.0 13688.0 oercmnn rllrnnllcereutrnt18379.0 thCthebridal thChrltlal thhrldal 14704.0 11576.0 18531.0 bridal hrltlalhrldal18564.0 IHUl18551.0 llft18595.0 011ou18571.0 tlllthe18584.0 2413604.0 13944.0 13908.0 18592.0 18607.0 14236.0 14656.0 Ltrain 18603.0 Italil 14700.0 18751.0 talil18759.0 11956.0 12256.0 18772.0 Maceleimy Jlacclenny12220.0 12404.0 18775.0 larcllm 13304.0 18787.0 tholrthll118808.0 futuro future14328.0 18820.0 itottletimid honHitottlehomeamid honHIImld 18975.0 amid IImldtimid18983.0 thl11960.0 18995.0 1H 12780.0 19011.0 tnhes lIIhRvtIHhts19000.0 19023.0 theif 19031.0 14064.0 14008.0 lr 19083.0 many IIHnrmaul maulfriends 14692.0 19195.0 frhntls19260.0 It14272.0 19275.0 14320.0 TrpHex THx IItex 11748.0 19419.0 Hex HxItex19432.0 December 1UlhllIeeexnber12212.0 12244.0 2Pleasant 13112.0 27 27Pleasant 1960.0 Pleasant 19899.0 Day Cay19915.0 Woods WoodsMr WoodsIrWoodstiri 11844.0 alldmind12576.0 20140.0 IIH11lrs20151.0 i13420.0 20159.0 13812.0 20176.0 Alsop 20204.0 withabout 14436.0 20243.0 Inhout 20335.0 nhout20351.0 thirty lhlrt 20364.0 oC1111120392.0 frllmlls20451.0 spout 11ntspeuIhrbtllla 20556.0 Christmas 11688.0 hrbtllla 20564.0 12012.0 tntas day lay20620.0 12660.0 13056.0 20595.0 plenxnntly lhntlnnl1pleasantl20651.0 al20644.0 tholr20783.0 farm flllIII12120.0 20795.0 nlxut ahulltn1Hut12716.0 20808.0 throothrrl20836.0 nnd13132.0 20875.0 13556.0 20847.0 half hair20872.0 IIII1lsatticmilessoutheast IIII1lsSOli atticsoutheast southeast 21039.0 SOli 21024.0 11812.0 Iltast 21027.0 12692.0 21031.0 thoOw21047.0 cltjcltjIt cityIell 13300.0 ellIt 21232.0 21252.0 21267.0 wiiswns21247.0 Indoed 111111111hultott21299.0 n13324.0 21275.0 pleasant pllnsalltplenstutt13188.0 21347.0 14400.0 14556.0 21319.0 14308.0 forthose fort 21443.0 those hOtllhose21460.0 whn21491.0 12216.0 lto 21496.0 21499.0 woroWPIP21527.0 110 so13152.0 fortunate rOIhtnntpfortttntttelit14504.0 bothen litt hthere 21668.0 then hrtthere21683.0 ThoIhl21699.0 dinner 11111112504.0 13208.0 21732.0 rnslslpd21751.0 14100.0 14292.0 every VPI VPIlhlll 21891.0 thlni lhlllthtlot21915.0 uixxl goollgotxl21940.0 tulat eat13508.0 Mate ThiroThtI22004.0 wtrowtrweregreat 22031.0 nagroat ngrtll 22148.0 groatgrtll12092.0 22159.0 auntyilia 22151.0 rabbits Iabbllltabblts12416.0 doves dovoHdmtI22203.0 quail IlIalialll1amisiulrrols alll11i111l11rls 22248.0 ua uasquurels 22343.0 siulrrols 1i111l11rlssquurels22356.0 ImRgid Iwtggthng 12744.0 tt1 12628.0 12836.0 rl 22420.0 may 13632.0 22408.0 1t22423.0 truthfully lruthfullytruthfullywild lruthfullysnldtruthfullySaid11540.0 22559.0 wild snldSaid22575.0 ftlth althMitltIlllfile22619.0 exception lxrlll1ol1esreptlon22631.0 13996.0 22672.0 aile13884.0 22647.0 lltthIIttlp14268.0 lltthaccident IIttlplHcltlt1I1 littleaccldcnt lHcltlt1I1accldcntthltttho22831.0 tin 13516.0 22875.0 wm waspcrft perfect 14480.0 perfectHfiuhert 14672.0 22899.0 ct ctItrntbrrt 22967.0 IWt 11548.0 Hfiuhert nmhtrlItrntbrrt23067.0 mid nudnod23096.0 inter lahrtattr23091.0 htulhsd13576.0 23143.0 13752.0 23111.0 falling fallhlg23168.0 OUI23271.0 Wt1Vt12056.0 23283.0 23288.0 know kuuwkilo 12752.0 23307.0 whnt hnl 23324.0 23360.0 was23347.0 aboulaboutIhre 23391.0 iTh 23491.0 23496.0 Ihre 23540.0 23507.0 hr23515.0 23527.0 Hall IIaB12652.0 13328.0 23576.0 now iloR23559.0 hoot shontPhnnt13520.0 IIlIn14148.0 23579.0 14520.0 14440.0 14616.0 23595.0 23548.0 23623.0 xmlns:ns9 ID21 6524 3412 11408 23727 ns9:type thoUtt12444.0 23740.0 bend bpndht11tbendisaiiR bpndH 23743.0 1Itaiic 1052.0 11708.0 23935.0 Itaiic 11868.0 23971.0 UhC 11824.0 23959.0 isaiiR ItIIgIan 24003.0 24007.0 put tb 24059.0 gnu KunKIII114276.0 14508.0 tll1 tll1n tnaway 24092.0 1lThere 12060.0 24183.0 24203.0 24200.0 pansy IhtolllIoG 1kMlIoGhrr 1kMThere 24375.0 24383.0 hrr 24395.0 tit24439.0 po gtrs12856.0 24423.0 Dock Ducktake 13432.0 liltthetintake 24527.0 tun tuntake 14516.0 UI1 UI1tlk 24619.0 tlk24627.0 U12720.0 24635.0 quirk qultkquickquirkThat qultkThat quickThat 24819.0 That 24855.0 rabbit 24903.0 13368.0 13568.0 nnshty tuuighttlli 24935.0 tii itk 14420.0 khU 25043.0 Awa 25088.0 12488.0 12724.0 25111.0 uur 25099.0 25107.0 lOUr lIunn Ituuuy968.0 25168.0 un13960.0 hUfront 1125175.0 twfront 25204.0 11front 25283.0 25296.0 les Igs25291.0 25319.0 determml detcrmurddt -924.0 25359.0 hrnul 25379.0 ht14176.0 14412.0 Nthe hIt hItth 12300.0 tourtowlet boItowleti boIIbow leptt lepttCatch 25787.0 Catch Catcb12204.0 25727.0 25748.0 IVick I1ck25784.0 ettrh 12908.0 25807.0 13712.0 25792.0 hIm htm25820.0 fcf htakt htake Uketakt25992.0 25964.0 12384.0 26007.0 stunstunlit 26015.0 UI 13124.0 26107.0 I26159.0 lttlit12080.0 26172.0 Is26175.0 Rhotshot26200.0 lais1t1o26211.0 inst26255.0 26231.0 tut tutdin 26259.0 13856.0 14024.0 llr llrean 26416.0 din ean26423.0 runl runknown 26471.0 26591.0 26667.0 Such S1K126639.0 26616.0 chase ba 12640.0 26671.0 12472.0 26655.0 th26675.0 26719.0 126727.0 t13920.0 26747.0 star 26760.0 26647.0 26832.0 kDonknowknownlHir kDonI nPoor 2192.0 Poor lHir27063.0 ltunn Ilunn27068.0 tunny 27107.0 lalllh1 iauld12920.0 12944.0 27091.0 13140.0 27099.0 27115.0 latch 27143.0 27163.0 13692.0 27123.0 27159.0 27155.0 hll hllOXK 27204.0 14580.0 27179.0 Iua 27283.0 OXK ua27291.0 12356.0 12756.0 27299.0 WHO titIl27315.0 HO WAS 27339.0 AS 13748.0 27348.0 TH THRabies THKKK TfnloTHKKKBr 3016.0 Rabies Bablu27739.0 Br Branch 27759.0 nch 27771.0 Entertainment EntertahuclltEntertairmlent1172.0 EntertainmentThe EntertairmlentThr-1176.0 11664.0 27964.0 ThrTb 27995.0 auAMRl amnttal12800.0 14264.0 28099.0 tblMttle 1lttltItttleHelpers lletpersHtI rs 28235.0 28263.0 luti lalIM uibttJf 13732.0 28291.0 28307.0 trrv 28311.0 28399.0 28419.0 11732.0 11532.0 28439.0 11700.0 28407.0 Juntor Junkx11740.0 28447.0 28443.0 Auxiliary AKxIllarjrAuUiftr12156.0 28524.0 13876.0 13980.0 Huh HoUHoly13912.0 28624.0 Trinity TrinitrTrinH28643.0 church 28703.0 28683.0 Loki WKlIItk11032.0 28735.0 28747.0 lntny 28775.0 fywterdar tur 11468.0 28851.0 ywterdar edlterday28855.0 hrda 28879.0 afternooa uttcrnooDntternooa28976.0 o28959.0 28979.0 13852.0 13816.0 13948.0 fc 11644.0 29063.0 Tho1168.0 29103.0 entertainment eatertahunentent -1168.0 812.0 nalnmtnt w4 was29195.0 wed 29239.0 tM 13792.0 tMof 29227.0 7 29212.0 29320.0 ld 29291.0 aU all12084.0 29299.0 29315.0 babies 29359.0 thlthea du cku29411.0 hdt 29463.0 29435.0 r1tg 14628.0 29467.0 14604.0 29543.0 t12268.0 ILChrttn Ghrtttm 29647.0 trt 29751.0 29763.0 JUaT tttj11488.0 pr4 29783.0 q 29823.0 13640.0 29851.0 Iff 29843.0 s4rved 14076.0 29887.0 14192.0 29859.0 aft afterrteata 14716.0 29899.0 rft 2824.0 30067.0 30159.0 ft 30091.0 90lI rteataxmlns:ns10 ID23 24775 2904 14848 5568 ns10:type ACHRISTMAS 15592.0 CHRISTM 17276.0 CHRISTMMob -1344.0 16936.0 17560.0 15032.0 Mob 15532.0 6575.0 15420.0 15992.0 1500 16692.0 Raid 16472.0 andan 17099.0 17256.0 ard17515.0 17592.0 ftan Wan 6968.0 16068.0 Oriental 15948.0 16960.0 Quarter 16844.0 QuarterREGULAR 15040.0 988.0 REGULAR POLICE 16028.0 POWER POWERl16904.0 POWERlReport POWERReport 17596.0 15028.0 Report 15572.0 16232.0 8280.0 16072.0 16320.0 Cattle 16344.0 17140.0 Rancher Racl1er16976.0 RancherBeen 17643.0 Racl1erBeen 15204.0 Been Fatally 15588.0 Wounded 16292.0 17304.0 17144.0 17364.0 Ra 17500.0 Rarant 17708.0 R Rrant 15192.0 8824.0 rant Caused 16424.0 Angry 16267.0 17079.0 MOD MObMb16931.0 8863.0 toAttack 17580.0 15184.0 Attack AttackPortland AttackPorUand Portland PorUandDreg OTegOreg16532.0 Dpatch 17603.0 apatch 17668.0 17628.0 ij ija ijriji17736.0 ijwi 15012.0 9659.0 patch 15616.0 15460.0 15920.0 16352.0 Oregonia OregollllOregont16180.0 Oregoniabridge Oregollllbridge 15004.0 bridge 15680.0 9903.0 says sas15528.0 saysBecause 16044.0 sasDecauso 15188.0 10088.0 Because Decauso13ecauso15964.0 15860.0 belle belieubelieve16336.0 belieuInent 17008.0 17540.0 10147.0 alnent aInert Inert Inentlnent15428.0 16168.0 11ad16596.0 10308.0 beeuJeeu16480.0 iChinese 17108.0 rChlrese 17552.0 17568.0 ef efChinese Chinese Chlrese15808.0 10524.0 restaurant 15656.0 16928.0 10527.0 1V 16688.0 17092.0 1ed 17408.0 tars IntlJtarsed 17632.0 17412.0 IntlJeel 10735.0 eel15296.0 nDd15720.0 16416.0 16916.0 U16796.0 0late 17576.0 10788.0 Gqlate Gate 14996.0 15060.0 ate 15308.0 nSght n1ghlnighi16280.0 nighiRestaurants 16400.0 nSghtRestaurants n1ghlRestaurants 15176.0 1012.0 Restaurants nndanti16824.0 lau lausmashed 17052.0 lauImasbed Imasbed16228.0 doors 16676.0 16848.0 17068.0 16988.0 il16940.0 11415.0 utire 17072.0 17548.0 11395.0 act17608.0 adtire 17696.0 tire tare15396.0 fronts trQnts15288.0 16004.0 otbuildings bundlngsbuildingbuildingsto 17036.0 11639.0 rto 11803.0 15236.0 splinters 15156.0 splintersThe 15956.0 12011.0 regular rogular15492.0 16272.0 pollee16840.0 16764.0 17227.0 16996.0 ipowerless 17424.0 own ownpowerts 17648.0 17600.0 apowers 12227.0 powerless powers 15800.0 12263.0 15540.0 16392.0 16264.0 16600.0 briga 16484.0 brigade brigadepollceJnad 17192.0 brl 16816.0 apoHce 17112.0 17376.0 12252.0 17420.0 12247.0 17504.0 17415.0 npolice powerts pollceJnad 12435.0 poHceIud tad15476.0 16024.0 bo16632.0 calk callicoifs16504.0 16636.0 calktho 12463.0 itho 17528.0 wi wiat 17692.0 17620.0 the15348.0 12656.0 riot 15256.0 riotA 15632.0 15580.0 12663.0 15468.0 tA 15172.0 12879.0 story 15300.0 15960.0 15832.0 16408.0 ctrcula1 ctrculajclrcula17132.0 12887.0 d17196.0 17148.0 JSmith 17460.0 17564.0 atSmIth atSmith 15692.0 15904.0 13079.0 15780.0 16236.0 ca 16908.0 cahad 17188.0 17116.0 13131.0 r13143.0 17428.0 13115.0 rahad 2676.0 13287.0 15432.0 15280.0 13295.0 fatall wouu wounwouutaurant 17044.0 16768.0 13331.0 oun a17480.0 0taUlallt 17532.0 13503.0 taurant taUlalltCuriously Curlousl16911.0 13544.0 emonSmith 17119.0 13539.0 ns nsi 17700.0 oDBmlth 17636.0 oSmith Bmlth15568.0 nor hoc15911.0 15836.0 anj 16208.0 16287.0 13755.0 16220.0 16672.0 else 16588.0 13739.0 ha habut Kai Kaibut 17307.0 17280.0 13919.0 13939.0 15388.0 13963.0 ercn15891.0 tho15760.0 16276.0 16475.0 1ce 16776.0 wethe 17039.0 1IS 1ISthe 17588.0 utli 2580.0 15368.0 tale 15864.0 16164.0 16696.0 14147.0 Orion1 01111OrlonOrion1rested 17184.0 14199.0 aWrested arested 1p 17752.0 14355.0 charged 15488.0 withAn 14391.0 mllp muremllpAn 15164.0 An 15484.0 Indignant 16360.0 mob mobtho 16788.0 gab gatw14599.0 o0lho othe tholho15364.0 reslaurant16332.0 tIlWtherelynching 17160.0 17267.0 14823.0 17300.0 17380.0 a17340.0 J3nchlng 17440.0 alynching lynching 3nchlnglynchingSuddenly 14987.0 3nchlngSuddenly 15203.0 Suddenly 16036.0 some sornosornowhIch twhich tttir p 17495.0 swhich 17640.0 il ili 17712.0 15411.0 tron16520.0 fronta frontt17024.0 17320.0 15452.0 15444.0 Jl 17352.0 Jla 15619.0 15655.0 15636.0 moment 15639.0 tho15828.0 crowd 16871.0 15667.0 wastrol 17164.0 clnltrol 17663.0 14992.0 15839.0 trol trot15604.0 15844.0 Bricks Drlcks15268.0 16224.0 16628.0 stones stonlsstonesand 17136.0 17240.0 15875.0 Wr Wrand 17404.0 17524.0 15872.0 14988.0 16047.0 16052.0 16055.0 15804.0 16063.0 door916172.0 hadin hadIn 17096.0 17296.0 16080.0 flfD flfDlu 16255.0 lu16260.0 the15140.0 16268.0 tables 15556.0 16271.0 dlslus dlsilisdlslussmashed 16683.0 fish 17084.0 5 17292.0 t17435.0 16307.0 16291.0 17488.0 17520.0 dtdesmashed dtsmashed 17672.0 16476.0 smashedThe smashed1he 15168.0 16687.0 1he15624.0 16695.0 Columbia Columbla16700.0 16972.0 Al AiAlrants Arants 17448.0 16715.0 arants 17512.0 16879.0 rants 15544.0 15408.0 16048.0 16903.0 completely completedLater df roHLattr roH oyttoyttLater 17095.0 Later Lattr15608.0 17123.0 squad 15776.0 17120.0 16680.0 moun moonmounpea 17312.0 ipoifc poifcICE 17103.0 poi papoipeand papea 17303.0 17347.0 pea 17324.0 peand 15276.0 red 15524.0 17331.0 and16099.0 16464.0 crod16952.0 BHundreds 17124.0 rti rtilIundrerts 17676.0 15160.0 Hundreds lIundrerts16056.0 17547.0 or17544.0 rioters Moters17019.0 tn16891.0 mthe utrA utrAf 17384.0 17316.0 14872.0 f17735.0 14892.0 15332.0 scenpof sceneot15224.0 17780.0 scen 16020.0 17755.0 15676.0 pillaging p11laglng17747.0 16851.0 1away Tnwa 2592.0 14980.0 17963.0 17979.0 nwa 15384.0 17968.0 opposite tbo16316.0 16732.0 16536.0 Aril ArlArilsArilthey a17356.0 IDtltC athey 14976.0 18163.0 tltC 15316.0 18168.0 cleaned 18187.0 18179.0 anothe anothetaurant 18191.0 18176.0 ttallrant 14972.0 18359.0 tallrant18395.0 18387.0 roughly rouhly16128.0 roughlyOrientals hen 0H1henOrientals jOrlpntals Orientals Orlpntals15856.0 16312.0 worowarecap cap116712.0 cap1Mayor capMayor RP RPIarol 18792.0 Mayor Iarol18811.0 Galbralth Galbraith16864.0 18815.0 andTownscnd andTonlt1l1 17344.0 1Townsend 17612.0 Townsend TownscndTonlt1l119019.0 both bathaddroaseO addrot3PttadireHSeaddroaseOurged ri rt17032.0 riurgeJ 18987.0 rturged 19227.0 urged urgeJ19236.0 15416.0 19239.0 disperse 19263.0 arsiblo alarslblo alsible 19424.0 slblo siblesiblo19444.0 damage 15340.0 16564.0 beeu16460.0 d16924.0 JQuietly JQU1et1y 17556.0 ttquietly 14964.0 19640.0 Quietly QU1et1y15612.0 19652.0 dispersed disIHrsed15515.0 disIHrsedICE dispersedICE-784.0 20059.0 ICE 15928.0 PROVED 16804.0 UNSAFE 16708.0 UNSAFEThree 14948.0 20479.0 Young People 20487.0 rowed crowedDrowedcrowedSkating DrowedSkating rowedSkating 2216.0 20692.0 Skating 20751.0 near noarhoarCastleton 16500.0 stleton Vt VtRutland VtRutlnnd 15108.0 20887.0 20908.0 Rutland Rutlnnd20923.0 1t15752.0 Doe16108.0 2V 20919.0 20903.0 TVe nfTLCCt16968.0 nfdmn TLCCtdrowncI 1drovne 14952.0 21103.0 drovne dmndrowncI15768.0 15628.0 16572.0 barel barely16432.0 barelame eFcasame eHa eFcaeHaoame 14944.0 ameoame15456.0 fate 16896.0 thethin 17260.0 hthin 1th1n 21532.0 thin th1n21547.0 Ice 15988.0 21560.0 skating kaUng16076.0 pon pond ponJponJton pondton Iton 1124.0 15292.0 ThursdayKate Thursdayt1h ursday 15504.0 ursdayale 15120.0 21927.0 Kate Irate21987.0 15684.0 Mary rarr16240.0 16668.0 George GeorglGeorgeunder GeorglUI1 17616.0 22220.0 15124.0 22200.0 22223.0 soars22187.0 oaror 22228.0 age17220.0 22411.0 15996.0 16556.0 22415.0 venture onturCventureafo 17176.0 venturesafe caft 22567.0 afosafe15400.0 15252.0 16008.0 The15620.0 22611.0 brOk brnkbrnkwont adfInt 17623.0 awnt fIntwnt15304.0 22827.0 16495.0 16836.0 watt watwnt16752.0 22852.0 rrpeople pMJplc15584.0 23027.0 15448.0 23071.0 wore15900.0 16552.0 23075.0 23044.0 ante ano3n116736.0 antetits 16868.0 23063.0 anotlio 3n1tile tile tliotitsponJ15812.0 23268.0 16212.0 23263.0 16616.0 16492.0 theirMX 17004.0 theirsix rix MX six23476.0 15152.0 23479.0 15840.0 17104.0 23447.0 17168.0 14932.0 thofurther urthr15984.0 23671.0 breaking 16831.0 23668.0 17264.0 23679.0 e17204.0 23684.0 17332.0 1Inds 14920.0 14924.0 hands Indsnndshoard hurdheard15404.0 15972.0 16620.0 crle criezcrl 16888.0 23920.0 23899.0 Itaed Jd 15024.0 15096.0 finvlnu Aftlnllsnving24095.0 al116012.0 16452.0 thT16716.0 thrClark thClark thTClark 15436.0 chlldrtnchlldnn15356.0 16200.0 24308.0 being be1n 24331.0 unc uncpulitd 16720.0 un unpulitHl unpulitd 24336.0 pulitd pulitHl24536.0 24503.0 ollt15600.0 15664.0 24539.0 or24511.0 24531.0 water wllter16388.0 waterThoso wllterTh050 waterTltoso 15104.0 Thoso Th050Tltoso24724.0 drowned 15596.0 dron 24731.0 16580.0 24755.0 werttverewereased 24759.0 wertaff1 tvereagel 16948.0 14916.0 ased aff1agel24924.0 24927.0 rrorermrge16384.0 Hunor HnntrHnncr16296.0 HunorIda HnntrIda HnncrIda Ida 25124.0 Franklm Frnnknranktln25155.0 dPark 25139.0 24 24Park 16808.0 tPark 25576.0 25595.0 Park 15876.0 Superintendent 15788.0 DDec DChi 25579.0 el elChicago 15072.0 Chi Chicago 15336.0 23 25803.0 2SRc 2SRcl1er 25815.0 16760.0 Jle Rder 16900.0 lUer Uer l1erder26043.0 hup superintendent 15728.0 26019.0 rlntendent rntndent26011.0 U0 U0ary 17395.0 11IJaik 11and 14884.0 aik26244.0 stcratary 16040.0 ary 15756.0 ot15931.0 26236.0 16300.0 16656.0 26223.0 parkTbursJa 16444.0 park pakpaknght Ii Iirh 14888.0 26372.0 26408.0 TbursJa 26411.0 rh 15128.0 26431.0 11rsJ 26467.0 26447.0 nghtnsht26439.0 afte atttafter26455.0 Ifnrarmonttw fC fCotKht otKht eaghtmonttw moatbsICOIH 15792.0 MrCitlcagt 26643.0 Wi WWCAtcAI 26627.0 Jto 26791.0 zs zsthe JpArk CAtcAI Citlcagt26907.0 15644.0 26875.0 26883.0 accept IIcceptsccept26863.0 tbe26871.0 pc pcprk 17076.0 14876.0 27055.0 pArk prk15376.0 27071.0 htJune Junl15520.0 16244.0 19 191H 191Htbe 16448.0 Kthe 27263.0 tbe27295.0 aaioWQ position pa paoati paasst 27471.0 27487.0 oati DIUasst27484.0 0U15748.0 here16412.0 be16248.0 hefoor 16756.0 WL5 RasWL5eMir Rasfour eMir foorfour15208.0 27719.0 Nlrs 15884.0 aso2I HcHeDr 27699.0 11D 27879.0 Dr 15076.0 27891.0 JohcJoanWarder WanlwWILNer27943.0 aInvcmUsale nos nostartt 17128.0 27927.0 notart 14868.0 tart tartt 15320.0 17048.0 28275.0 28375.0 Tc TeInvestigate InvcmUsaleInvetigaeMJns Mlnettne16428.0 MJnscotnery ettneMoarcomery 28431.0 sttf sttftCa 28603.0 28635.0 Moarcomery tCa cotnery som 28751.0 28660.0 A1t28647.0 Dee Dcr16548.0 DcrIs 28651.0 i1s 16800.0 17348.0 Iis 28619.0 14864.0 28796.0 28839.0 1s28875.0 28883.0 Jtncttsioa JtCUlioStoncasston28863.0 16524.0 herehoror 28823.0 Whoor 29027.0 29040.0 horor hoor29095.0 litatYolande Yoluule16723.0 29059.0 st stor heor 29051.0 eor 29303.0 xrdrstood cd ndt16252.0 rstood tstood16364.0 16256.0 hate 17088.0 Ixjra 29255.0 Mae tetelnape 17368.0 aewpo 17327.0 rtl rtlof lrt wpo lnape29515.0 29511.0 29487.0 1372.0 15360.0 4e 29519.0 xjra 15548.0 15784.0 thtthatof 16663.0 29675.0 xrt 29695.0 15740.0 29731.0 reaeooa taaoatyo tor17016.0 eotoa toIUrohf eoa 29863.0 29911.0 cafeatropfc IUrohfcatuarol29963.0 29915.0 isitr 29903.0 rsp 17212.0 otIt 30083.0 30127.0 toctar 14956.0 30147.0 15852.0 30155.0 15848.0 30116.0 wID 16652.0 30107.0 hlraa 30135.0 30279.0



PAGE 1

ProsperityHappinessiNCOMPANY2-0HEATERSDAYS365HYDECompanyTHECONGRESSMANandHydeGWWconductingGAINESVILLEmerchandiseWishHeatershighclassPatronsThecontinuanceMerchandisecordiallyGainesvilleCLARK-IStogetherComppatronageManyACTIVEHardwareGalwaysmethodsduringWoodbusinessDECElII3CONDENSED-FromPossibleTheirPhonesandfro-luitimiPossiblePhonesofferedItheEachBABYSSTILLCoal-IfBurnfootraili1-triiLowestSMITHliberalorationsconstantma1-luavythankfluI-ilnposRefunded-theOneRepresentativesandXMASBothGovernmentBothmeritreguluttbedroomForTerpsichoreancomplimentaryofcorporationswithBairdrofferdttre4ne-rrytrstnickelsprofessionalIsPriceCOUNTYHavingCOMPLIMENTOurWeCosfreaaquartersRESOLUTIONGIFTluitAc-WestsnPRESENTSformttdooImmediatelyUpappreciationyourCongressmanCongressmanTHEpastbt-dftrUalDlyearCollectedcorporationsBestdeterminationsurroundingshcAtingResolvedprosperity-totvlguAttaa-Umisfortune-Thecorporationscorporat-jtaittaTerritorythatOilpeculiaritycomplimentSUNGovernmentparticipated4omp1ishandopportunityarrangementsCotton-HEftipmprUtkcorporationsIrgairnbnutGainesvillestwentyseenparticipantsaimappreciatespossibleGovernmentfamousTerritoryaud-TemtocompllshedanticipatedtrlmmlnpjGovernmentextin-guishedFollowingGainesvilleGainesvillesMargaretiHirtUulursApplicationApplicationFORheaterwillSaturdaysVYJalmost1907handsomestwIl-McClellanadvantageJacksonvilleanythingoftrustappreciateparticularssatisfactionProvidingWet1Krwnrequestedpe-rpn4CongresspublishedtheeverybodytauwtxettrrtTerritorysupportedpersonsjwhtchdisorderlytatesrantiGainesvillethestatementmunicltnlhappinessuThfrdAGainesvilleIV-AKthisdkaorderlymaterializemanifestedwellknownbisectedtheenjoyableajbountDongreintroducedubdemtixxiGainesvilleutterclevernessfollowingrequiredyouabandonedotllrlntlnenjoyableThursdayHawthornfollowingreceivingaggrega-tionCompanySCHOOLSirhe-ckertGaines-villeatabuntcommitteeNEWSHORATIOhlliltloufollowingnominatedFOSKETTarrnlpnHJofinvestingsympathyIFUtbAforearliestTerritoryCompanyrailnw-dnproceedssuccessfulcertainlydaughterCongressTerrltmyFunctionsArredondoCooirSecretaryrPQufItdan-nouncedsamedaughterninrXhiiuuiImmediateunderstoodpossiblelilfil11detailedafterwarddoorsIndulgedresolutioncriticallysummonedFlaaccidentalresolutionSundaysChristmasSundayswrappingfollow-ingcollectedCongresscompletesuccessfulveenttltrtocandidateiKTsonaljwheromorningAdjutairtheSundaysStonewallSundaysl1otrtlctTerritorythenwrnberpleasurecotnlict-waseriouslystatementSuccessfulUoulwureLht-tUro4IllegallystandingiliatmedVoderrecentlyTreasurystatementsucceededStundiscussedpossibleFridaysafternooncollectedengagedcollectedcollectedfrightfulLaCrossestatementmeantimerepairerHPopularoithetvoptAiadTuesdaystatementafternoonSntwnlnvconditionMGREWmitersAttentionDeceasedshowingCollectedcollectedTheSunshowingplorableInstanceNevnansafternoonjMMrlbleburningpossiblepotttlObcollectedMayorsfol-lowedengagedpossibleatcmentDeceaseddeceasedcollectedMondayhammockReceivedChris-tianapportionreason-ablefcottonKoettelleCITYmorningworkingportionscele-brateSat-urdaybusinessPythianlateHdpjeKnightscollectedcollectedBURNEDMatedSpringspopularttountphprovidecollectedgasesstatementprettiestUoulwarehatethIrbilKnightsupstairsdraftTaxesmorningtithoradeceasedPassedcollectedrapllityStatesaadtoooccurredbeautifulPensionseveningOysterscomingfowlextended1urnrefurfflfncollectedregardedCarnivalAlachuaeLatsneil-adiffinntstatementcollecteddeservedcollectedIiatliiKCountyUajitlstthroughorches-tracollectedPythiasDelightIndulgeoccurredattended51vicinityoccurredaccidentvisorJump-IngTrentonburningafter-noonchargeneed-lesspersonamusicianAlachuabusiness1ipropertyCarnivalWithMurraynamelycomingStoreceivedchusettshoilva-pttdtycomingpropertyinterestsSundayInstanceburningANDdetailedreferredpassingfinancialcottonyourdirectedReNUhdetailedMan-agerPartkuCitizenotterFridaythanbecausehtatementonehalfcoloredon-ollklalherebyhorriblectbtNrdsoundedmemberfromwishesGrowerscustomerSecondanutiunlChangemtetlcCes5-funhandleddescendwat-lklllIdetailedduringperfectDistrictDEATHheatsayingGOODEalwaysRefundfltorydevotedRogersignitedwhamduringdetailedFellowsmentiongreaterwantMoneyYounginterestwildcatFridayGardnerHunntMrduringcountedFridaywithoutBoringerrtsnemembercitizensalwaysFoskettthereonwelfarepeoplePeoplewidelyFellowsprovedreturn-edInlmcdpurposeDANCEAlachuafrottjperiodbecamelastiiiKpoundFentullassistpersonspermitInterestKnightll-tTchargeSTATEreachedasaFridayUnitedseveralSecondFourthbrothevenngseveralfathersfuneralmonthstattedrespectFoskettoclockofpersonsclothessuccess-IsofpersonsiurtxrrlodgespublicamountthereonSchoolsfederalfuneralschoolsfavtriFloridapersonstatesStateshhowiniIn-StateschoolsUnitedBaileyschixlsexpectmorn-ingprosperAdventchargefriendske4pMpr1mtchurchFurtherAwaycoalHcaUnitedburnedspreadDAVISUnitedUlllncamountandmotheramountpersonsreItaedUnitedamountfriendsdegreeleviedfollowsoysterhallpoundebekabresidedchurchtrotxtcounts-tlthusbtrfurtherburnedchurchFxettiramountamountFri-daybottmutualchurchguests-JtOObenefitappearMarchcorjmraWaldoJOLLYfactQueenWaldoVeiHHi80RobertweHagueourburnedoclockIndeedPA-tftliBeevdeMateextendternoonInitedwheremoneyUnitedservedvirtueanystylesCenterrelieveFrankcountygoodsiodltrislandbeingSheriffStatesawakecontestTnltedWaldoknownbeforeillnessghhiKbusl-iffQueenenergybillingclaimsnightiwovWstouTuttedColfHXnArksupperocloctotesmoremouthDailyronageWaldosecondWaldoCullenISnerlffCivilunderleviedplaceturnedhearthd4taswgllrecentfrombeingwherehealthwhichsuppergivensvirtueoldeptamountamountMrtssapianoMarchnativecountybeforeeffctsActswhichStateownedWaldoDallyHydeladiesscreamsLadylodttNorangectbfWaldocottonTheretftPwhichDailyyoumoneyGoodeNorthmoneycottoneightStateswhotnhonorhaywhichwhichAmountStatesStatesDallyamountwhichStatescatmirlywhomhousewhichwhichStatesGoodethegiveswherewholeHydeladleshandslargoIXUlydancoyoungPROFreasonsbeingladiesladleswherewhichMountdancoWrrttwhichwhichpricesocialOcalaLwhichcottonSouthTlvyItateladlesI-lortaxeswhomGroveunderJollyDailyirJthhouse6AJotnrundermusicwhichgreatyoungruttiervirtuewouldbeingHornevirtuemusicfirmsJollykilledJeenhomebeingsuccesskilledJollyFromburstsionshow-xyoungreallzwhichClarkHighLovleCampbeanOcnla1-tlonnTexasHickstIllorderComataboutabouttaxeshencewluivJollygetLadydeathhrandcottonthreenmouutHicksyoungMHljtemoneyfailedthoseFromBurlyqueenwhrvmadesectheardcottongoodchasetlonfeeachTexashnitnamescentsfirmsweekbad-lygreatthineilitKingtidalFrothFrontdoubtismadewhileeachhoursnamesStateaboutaboutabouttheyMISSmadewhengoodbodywhenotherNewsKrrtUaffairuponSteveoperitakesladlefirmsHellehomethereFromdaystheStategoodwomauforcuttondressWithdaysgooddayscvtugoodWarCourtshowUitfivpartytheirwhenclosearcheverytartsincestairsShotsothermadewhenhigheachaleshowllrmslUokMadeNoonStatePromtttllladyJulyJulyitthreeissuessinnfromwhencouldfirmsshowwhengootlyearsyearsRhighthemarchaunteveryyearsfinedthemqualthestladystoretbrirfromJulytaxesbowHunttitbilloutfirmseachAftermeetiruodsuchThisMaKefromThatyearseverysuchfrombeengiveF-iuult-O0fagountWithyearsHADeachThistKlOFvotesfromhimpastfrommostworkafterTlwUiketheirhavethreeeachbnthoulimnf-vllleClaxtteMisstrodlikediieonfromforeacheachhonetwhVoteMisshandJulytunerbeenlocalontaxesFirstfrom9451JusteachpasteacheachtwiMRSrentsfromFinehavehaveI1tobeennreachBeenUOitownUnittsalcjnnosendeachfrombeenfrontdoneetchwenttimesuchbrr-vlaterHirbyfromProftrmcJNOwhoLolabeencityfrommosttrouteachtimehuntThistimesuchMissMlthtotiutcentspaytimendherecitydatepast1862bestwbotietatelogThistownaid1908said1864dealtheheldcoatsfourtatdiedcitywelleachlowsmostyearProfsuchIncitytrotstheandyearThisCProfthisFORSttIthatOneyear1NhpartdealhelddealgoesdaywiththatthatmemcourthaswellwellThethatverythistatetnrttalsowereandISGfimostsaidthatyearhaltTheThethattiledandWand18bOandandThevoteI1galsoTheweltLIsametliaIMHTdentyearerwmTheThethesaidThewho230TaxMidt1tlOddwhoThelsG2mtllwell4lUandandImUwonSunYousalecentkettOddthatDocmostIOMIthatwellwhocameantithisthlamiAecitmtraSunthatthisfactsaidJsameand1S60andandthistheSunOdtlMrsstillthisfindtheOneMrsthisThototoThetileandfeelandandSunthewillsomeThepatroomThefersaidTerandandandandatdandhaddueEnidwereMhotheandthiswillandtowhoittheandandak-dhullandandthisnndandlastacidpunsandMrslateRevandnndthehadantiWillSunBIGFoMrsfirspanAIDandandIUandwillandwillthewillandandandhadtheSunUrkbigIrsIsandandandwillTinIcyhadtaxtaxtbrandwillJanwitSunthetitlMrsfewActfullhashasthethetheandaddHellwillbilltheatteftwelikeandandHaspieSunthisthebytheandandhashasherureaiokandnndandandandtheArt-IhasActsheduethehasslipherandhnlherandandandandthefulltowthethethesureBillthethetheHEthethethethetersandandandfullKinsariFenthethetwo7theverlWOhaspershebuttheherherendOldandfewthethethethebutfirebutherthenowanybilltheVhashaswrreSidandtheherhasthethethetheherthebutwillbythelirethethetheFlaherCatofofthethethethethethethetitsthesave170thehistheorthe365thethethetheandthethethethethetheherthethethethethethetheagoandthebitwf-FItaythethobutovctatjprethebuttipCltwothethethebutsadthethtthothethetwoityActUuthethefireperthethethethethetheredfcthethethethethethethethethewontCtheSmthethethethethethethethethehxiUt-vthethethebywasperUUtthetheOFthethetheoWf1ltAirtheclMBywasottwosailthetheTOthethethetherepMuwaswaswasagoforneefortitewasouthlhisofwaset-inmatkh-raidHerJtintforbywastheWRwasrugtaxwasforHeforol-dIwitswaswas1stallfurforhisletwaswasSAWwasonetlltXrforthemlforforlribybyoneonemr-rbyMonfurhisoneforforforby1abytaxwasforbywasOnMrforonendtenby4furforforhecon11tO4lvalloneNoMrtincanuptoobySoby>allteatall-icatitswasa-i1RoneAPIsuearefurmsaretarttoare>foiorabvadbyofANMlheallowthiUbeWhetriWDrdebebecorhaallofAncorbeofithenoiIBhebeofbot1beupunibebeofheofofof13etof6fboofofofofof42ofofofofofgaldlIIiM1ofofofofofofofofofIoftoofaAoftfJfinofofofofoftoontoofheofofofatWnrinrAofofofinofC7ofofofofofUofofofoftotoofofofofofofofofofof10tooftoofatofofMrrt-InoftoatInofMinofofofofofofofof13atofofofofofvmsevKoiitillinItofofininonononofuj-InofofofofthInInofUofofattototoofonMtIneaInInInotintotonfofofofattototooftoonanantotoIntaSBIninIninInIsefononinInIninonnvanonacattolaonolInInInInInhiInAInIndoforlrInastototOonatItoantoorAIn1InAofttTIZhatasastotototoolInillIsIsastxXIGorfUatilla-rttoustotas1toacasarorastoijHfrAisluAuIttoitasfaso1-ytoatIsIsasIsLInIfassoHStotieIsIstOle-IH40fcICiTIsolAyGitIt1-ONetFgi-h>VttUALFitHIt2iAFDitrt01iooroYNyVafCJ111Srrtit11auJp551sItIOajIartrIKIIITI7atarr2Jt0caJ71eaJaOaaa>atiaaaaaaaaaMai6raaaaaAaanaSaJCfineaaanaaaAanaaRnotSt1a>nIcVA>ryII-ilijvoaaJIIaU1jIpASrt1I>tcIfq11yrRrtariIaIt1r1IfwtIoJt>tiII1I1I7tl+AI11+I+rlpillItiI+>rII+++FIIIIIrITe4IIIIulI<1



PAGE 1

CITYAND-QOUNTYCONDENSEIGAINESVILLECHRISTMASTREASURESNATIONALJi-frTpWILSONotbtrfjcrflFIRSTBANKUptoDateChildrensFaci1ifiandGAINESVILLEFLAnexcelledNOWMethodsInspectionSALEirMRSJiluMliucivcdliyladiesCOODSDECEMBERBaskiU-SCKKtiNSD-IWeDRESSBENNETCoatsSFRAMES-GOLDPLATEDFancyONPECANTREES13000000GoodsOfferStokes-CampvilleReportersvlrmttandTbetockInvitesAPara-LphsincomeJackson-Companybox-MANICURINGmasLostsubscriptions-bythrI1-Wh1leftol-TTiniinousplainlySURPLUSliermanantlyproportionChamborlalnNHJacksonville-wasyesterday-Missspirialaroompanledregular1UiktKSTiltSyesterday-MrsBASKETSencouragingtteIknoWtsBitskoUIdWnr-tOntlIUIIIyesterday-MrsafTnntuilHCAPITALyehtenliiy-MIHexperlenccdprosporlTHEBasketsthqlvhoyesterday-MrsYourWilmingtonSaturdaysyesterday-forbookkeeperGath-eredyetatnrda-dimsBasketsptirclmHftilvariouspricesmarkedJacksonvilleFORhimDrdepartmentHtutlonorythelVauutTRAVELINGJacksonvilleanticipatesTjrsdaySUNHappenedgoodsWashingtonalf1teflrpricesFernandlnaInterestUNITEDMimlt-iMilllonitWednesdayyesterdayJacksonvilleWauburg-l1907pro-gressiveyesterdayMarcionnylinmNniuotitconsiderableprominenttransactingprominentgrownup-andunderstoodBauknlghtMrs-IhlstetuCUSHIONSphosphateChristmatithlaughteralthyinformationyesterdayyesterdayyesterdayGainesvilleinmpleiidcomprlrfoHprominentMonteochaGainesvilletipyeHturdayGuaranteedKUCJSNewberryvaluesSubscribersdelightfulGainesvillerelatives-Mrsyesterdaydisposi-tionvigoryesterdayStandinotropo-IUGainesvillebIISItprofitablethreyst-UIIIIIlIlIllIlliIphysiciancomfortableyesterdayKERCHIEFformerlyyesterdayyesterdayOuryesterdayyesterdayyesterdayMlcanopyatrlcklandspectacleWoodGeneralemployedprofoMHlonStricklandanywlieiiyesterdayphohphMIeanopyAlexanderThursdayyesterdayNewberryNewberrypostofficejconulnobettertlicCleunyWacahnotaWacahootaHugsconnecteddruggistsCRAHVMyesterdayle-pml31heFla-FriendsSmallbonementarde-lightfulKonulno-fcunderstoodButnrncrllnnecessitiesycHtirdayprosperousSAUCERSspendingWeIxjvyvlllSmallbonoblacksmithCharUHioiistimulatesflU-WfInlldtainalihattendingfrontthOlpP-HHVMlcanopyyesterdayIorlonRSONALCompanyiliIlghtiMOFMlcanopyG-IwtckngeyeMerdavMwimonudMIctinopyshoppingWatermanCoinoNOVELTYsmartingNECKTIEMargaretexpectedHawthornconnectednaturallyMlwinujiynofliUlChristmasChristmasTAYUhandsomeSHAVINGyes-terdaytonlay-MlhstockMcCollumdecoratedSaubdlrsWorkpluatmutVSplentifuldtalnCyrsterttycharmingmerchantrruIrUMcGinnespleasantNowborncondition-Jprosperoustogetherpresentscarriers-WdaughteiPICTUREPontexpectedSOCIALYounCollectorUttrcncIdesirableyester-dayFridayspleasantSHAVINGyesterdayMIRRORSWindsor-JhammockpleaxnntSmalltiotipleasingformerlynppeaninrUlchmonildaughteryw-terdnyFlorjdurtdisposedLangdonSquirrelordinaryhammockMcLaurlnBoulwareVwlvitrtuNengagedgivatengagedgratifiedformerlyrelUPLUtlor-vaueMathewsIwintMiSCrawfordreadinessDicfcinaotiFontainelllandliiKCLOCKSro-maimlorgratefulHotilwareCraw-fordCaptainChrist-masLaxativebuildingdeliveryKllzabothMlaiidltiKfriends-inSaunuersIonrgform-erlyHawthornenjoyedgeneralbeautifulSaundorHreturnedrelativesHiuindcrnpropertycontainloodwlnCOLLARfstrnlayArkaiiHawreturnedofMrt-HrowuenjoyedslabpropertyrelativesuuderbltregularLockhartPLATESvvelcouitHSTANDSwelcomeloadingCoiiipitnStrayedtyphoidAlabamaldstasrd-1orelativesconditionrelativequantityAlaoltuaUnchulliestablishWindsoroperatorfoUitwithoutrittirnedCadillacFoloyHSpringJMi-rrtthrelativesunderbltFletcherHaddockparentsMrsjKdwardslvrnnifllUmlwaroKnitllMtiI0dwanlhrecentlyretiringprluomakingilinmginnwelcomerelatlvfMhUllneurtayH-MrnBOWLSChicagopropfitytradingbrandedHolKhUbusinessFlorencereturnedholsteinloadingGauldenlaxativeFruitchildrenbusinessbusinessLITTLEWhulkurRamseyFonnellAlabamaswallowcarriersrelativesinchPnuntluEugeneWindsorsixiriwhere-heswallowreturnedalwaystUocUyCap-tainAlachuaOrlandoParadlmTOILEThavingInstitutegettingLassiterMelroseLassiterJohnsonrapidlysioslniHliiiHHoporntoInokxondiseasesJacksonrela-tivesprinted1I1csonvllloGauldenAlachuaalwaysJackftonNewberrreturnedetroiKrcountryHappenlaxativeJoliiiNonchildrenIlampeyInlirentHimrtiitsf6hliiAlachuaalne8lIIlRuckledrecoverywhereTaylorthoy-havpartiesparentsoxpoctfFaliynnCrrelluTaylornumorounITEMSPersonsharuhlltradingFlowersalwaysTlinnumQ41tutradingleadingadditionrunythsKmmettFelaskaSeagleAWpeoplemark-edrodncodIlautorQuint1candleshavingKlncaidyw1thyottait500ProwlttFANCYfriendsOTHERCumberGavelablendsuaICminettQulnrrInrltMinor-addrlTaylorarrivalPiiuUUilinterestInterestwetHouofnuiriorouxAmongnotnlllobusi-nessenabledwifiherhavingfriendsopfatnaP1FloridafamilyHettyout-wardLtitnberWhitingItchliiKJNQIcLum-berRewardcoloredIm-proveBOXESElmoroMoodyirritatearrivedFrliMidKDOLLSOratmwdnltlronBOXESliarliorioixlwinhoneyJfmotherhodssFrletidMfarmerttIllamprMilanfrom-4UayesterfamilymissionGLOVEfarmerspriersStaglofriendsCsslarosroiulUMentorBOXESFANCYGENTSenjoysformertrad-ingBALLSspringElmorefarmersfriendsHagueMoluarbusi-nessarrivedundlIidlIulgenialbortuorfamilyfamilyfriendscountyfriendstheldUnitedspendCallresultsaccountwillVanrainierJordanarrivedfrfiidagain-JyestervisitorsfriendsBOXESWatersdiningfindprinvallaystutchfriendsCountyMewsarMeltonagain-Lreturn-Aaccount30InduectiitlySpringsectionfamilyWrKfIflSyrupChrist-aRainesannualSheriffWentonniotbcrChittyfatallyxePI4WeeksfriendsMinnieexpectfriendWaldospendIYDEpointHaguefriendsDoWlttGeigerDailytlnitfNutcountymotherBradDORYAHDAllyVernonspendsectionspendDailyterdiyTorodnrighthenthose-boguestsccllontparentHarryMartinMauncyouremainJobtiChittynroutosectionwinterspendrelathjectlonor-aslnessofMcRaeWhitepoundcitizenvisitornamedIllnessnad-ahopedArnowtustltessHempAsJsaysPeelerva-riflioto-KrtMtChristHaKiiewlck-laBrownMayonhav-ingringagainSuttondesirebatingcountyMaysWaldoHattlojnvtrmoneyPorterArcherPorterMasonslopeoxpocwhereamongregrethourJudgehomoCLudecitizenamongwhereOunrdoraimextrapoint1JlnrsseffectsHabitQuitospentIMMClmoneypieceDrownWaldoIHlIIIIII1IMtjtyspentvisitoramongIMIUfatherpertorwhichspentstoresThereCRAIForrestruewhoreStateswhereTOYStMjjjslutMUGSwhere1i4vroutesnumercfatherweekswherowagonatfcoyplsrBlackmoutminesThosehfiTQfriendhonorhazelspenthomoWaldostatesSarahamongPierceFromwhichSmithfropjvis-itorcalkedwherelrticanwherewhichFiiiihappealwhereOlivergUllNorthfollowplacenhortlrablnWellsPromlsJttiOcalaFutchrogresroutesupperwherethospentroutepointClarkothertrickswhuruaboutstoresnavalguestmilesguestraisesOrlnodrugTAMJosiecoldsyoungSETSCUPSfromSETShoursotherguestnavalwhiteUlnndwhichlungguestanopyaxalnHalveCUFFrideFutchsisterTheyAWhatFrantierssisterroutenavalFolkshopHallestoresIxingBealewhileaffairINttlthomoproVOabouttrnnMavlnltabiMitallyShortpecanSETShomomuchKsteeHillsspentHtiiiiiKOrmaDyalboonhomeshotUOHSETSseasononlyCltrnHallehomehomeamongJJslafranlldhaveHighwherePalmmadeofficetownhomodayshoursGILTothergnulandspentFruitthreeReesetillDyalMinorstatesTexasgooddaystradeestatelenrnyranddaysivllleSnppCUmurthdaysWellsdaysrundsthreeulwanCEOwinMrs-HONKJohnwtl-InyearsMissmanyStnrIfycolllcomothAliceLakeruraltheirfeverforgladUaytruckMayinoththeyolllcolittlebriefhomeamongSorivRunsgladthreeOurIlaUrmanytheytherePriceheredaystit-INtMissuntilNelllonlyANDSheriaftttrWhittimegameMsstheyLEEcornlearnfolksMisstheirjlissbavL-EMUMibrdpastulnagladafterallIieILgladwovebackthenthemtro-ljlocalaPopeKilnshaveRoodhumeirjpotstheirbackLulucolLjherebackToldt-nolriAuireesvisitsemenHninJackIx-ZUTJSMayfromthoNehuntfromtbirfromThatForthavebeenfromfromlivesMayhaveladygladmostiMntMissHrunla-thespentANDherovisitmostsuchtramtgonedonedoessendfromboonauntpastgladwirecityfromfromfarmsendwithANDbothwithmallMlMhavebriefCitytimesuchwithgoneaverGalnhutpropafterb4UhuntgladgladcallfrontgladpartgladMayboon1lahMissMlsabeenItosacitycitycbuacityntingcityherevisithornbaronlyallCntoRedforkyourmostMssfromwithCurtcitylfcitycitycitywillbeenburntwithherecitycityfrommostWhowithhavethatthatwhofcftnnbeycityvisitwithrialtforkroadbtfticitycitycityhersvisitnerdfindcitycitycityvillecitybeenfront9cityfromverywiththatMissvisitwhowhobestcitycitywircbincitycityvisitbrieftreescitycityvisitvUSunwinboywhomostvisitwhobythatcitydayaldo3misherecitytculthatlUlltinttststBIGvlNltinnSwhowhothatFortyearIblmwithwholuanWalthatcropcoldShtathan=whowhowellthatherevisititemswithwellMabcitythiscitycitydaisUHtbraceownscitycityThutownSunthatalsowhoKklnwhocitydaycityHtythuscityMrswillThethatitOrwhowhosalebustrahantinextthisthatcuriaecityplaytorKHillthatwoooitftithatThewhoptrHturnowthatthistinyJetherateandwhovlnlquitsaidHellMrsboyourMrsWinyestwhothiswillandcitycityandcitydayfirmthisandcornonextfirstAndfreethatwho00hUmtimingrltytreeAlanthatandthushimJ4rMIHcalfKInINKMrsHilltrueThorltyfewhasfromMurruunthisandwillandandbutHillthisthisandtheMrsMmMrsMrsHillsooctlinMrsTilldirtnearTAXandandwithwereandandSunandandwilluinlandandhimMmMrsHundaysereMrsGeoMrsHerSunnailTheandandandandthisawlwillandwillSunMrswillandnlllfbigmynaMrsMrsMrMrthisMmandrealHillwillanywereonceMrsitu18andandraftingrltimomantiSanandundtillandhimwereGcoweretheHIllrlergetMrsHerMrsMTHwillMrHalandanddaufewandanilstudandForrindlefttutufluethisMmHeribftiiliwonfewandfinewillandstubandandrandandIcuhasthathaswereForMrsnearwereMrs1111cureIU-nwillandfewandandandandHashasfewhashasjmiandPINandherweretryhasfinehenTartheor-inanysiltandhaswildHlnandandandsheherarthasandandlugKhasandthefeWyeshasherleaswornhashaslugfewLizthetheamithetheworewerebutinthebutbutshesoonanytworoutwerethetheandliarhaslaxherfuryhissthoHt-VbanthethethetheTinheronatwoanythethuthethelimlugthethethohishersheilr-JthethehutsIH-InthethethuthethohasfewthesadwasnowthnthelllntilltwoparhertheshethethethethehewthothetilltheandIShewothethe1wtwountotheleftthelifothetIllthebutnewmanwasluuFinherfewsheMrthethethethethethethethetillthethethethetwowasrnMbutthetin1thothetillonwIllthethethehisihetheforthethetheJsorbintowhiswasMiufIlgothethethobutthetheHIMherhertiltthethehereyehishisnowbutomcherIHMKthethistillthenilmirtheMrtoJuliohishisforto-WrawandSwasIrtlhistheMPforhistoofwaswanwarroflbythotheforiltheMrHrforgetbinritewasfornuttkoyesnutMeMrMrhiMHejflof-orwasWforfrsfurMrtwomartlatoowststfiIhishisMrforhishishisrugforforr-atJunnottheMeof-aMrwasHoMrMrdishhisMrwaswasfurCjtanonecowoneoneHeGacanwarsMrforMrMrHIUVhisMrwaswauwasWillwitsonebyMrforHoMrforMrbyhlnwasnidwanwasfurhofor4blilsforonebiteertlitarewniUKTleaohisforMrwasnowDrCoareearurltearIcEvaxwascanMrIn-ntocrrarearesousitijtOftofheforTnbyallotoneallarearesunheHoDrDrseeWact1th1nniarearebeNnheDrareforwontwoCaIrshon-torysWi-elYIthe111sonheboilltolayseenvbeatdoareL-oJDrheSiWseeAbeboWDrtyoilWJOlae=WWupsItWdeWofotigtlIanAtdaillboWarclavSoofbotinegeofor-fyuboylrWtartinhroiofofatofofWofMrofofofgfthofofofofofofofofWenofofofofonnohwWofofItyinininofofiRiinofofMroftoofofofofoftoofofofofofofofWatMrsontinofinPiIniuIninIntoofofoftoofofRtcAofofofoftoofoforof1ireofofofofAtcofofofWonnnNinWininininIniuofis0toolofofofoftoofofofatofofofofofofononatMrainInofInInofHorIntoofofofofotoftotooftooftoofthtLOILtoofofattoononIninInininInin4cofinininInMInononenenonNinofinMIntototoillojtotoIIWofontoofonorininInInHinInIsItInInHinInIstoKortctoofontooftoenonononasmiweotInofMItMInInNInIsisinisInMIljInInIrllitMItSasthisonontooxoftoWtorsltoInIninomtoInUIntrInInIsIttooftototomontoihnrtoororasisMEIsIsisisis01toInHRIHIHisNinisisPTNHIshtgauon4ofnterentorrttotorclintoMTIMIMTtinIsTlalaIx011111isIM0IsKerrasorTRInAHLDIKatNTVIGitKatoEratJreIrisAAInBtcnInHImaJ0totc-tivMHKtxRRInhisIHG0orItTatisttoLHIJCCCinTTItFMIIKKtotnItItdrNtFAnCLLL1CCJIMHU+niLAOnFHPSFHQS8dr-fWtoHHAHptnfIInCHitIrhh1111hCAtaIffHIFJrstt-trJringInLhIFvmwtt1=yhhItItlibcdJJt>nJJerttFJJaauaHaaIrt>fitaaaaanJJaJiaaaaaa1aIutKoVaaaaanaaaauIfaaaaAadAnagaaaanwIarMIlaIImJdaanaaaannaaIJanaienSltanna1atrtsnaiaIvjrfraIIsJI11v1JI>alII-iI>rnar+IIwrtiIww-I>I+tfIoil1ti1IIVi>117V>>1OJF4ti>IrIt++I11mtIt1nlIi+IvIIiIlff>iIIiIiIjiII+tiIidt=fIa<+tItaIiw>rif+vz00



PAGE 1

DAYSshProsperityHappinessCOMPANYO-HEATERS365HYDECompanyTHEiCONGRESSMANandHydeWconductingGAINESVILLEmerchandiseWishDECEMBERHeatershighclassPatronsThecontinuanceMerchandisecordiallytogetherGainesvillepatronageManyACTIVEGHardwarealwaysmethodsWoodduringbusinessCLARKPhonesPossibleTheirPhonesPossibleofferedConstructiontheCompy301907EachWBABYSSTILLCONDENSEDiinpossiliBurnLowestliberalftliilM-MjxnuftctHrtnKSMITHconstantCoalS1Hthankfreight-alHwtrtsaeutOneXMASRepresentativesandPriceBothBothmeritbedroomGovernmentOfregularTerpsichoreanpossiblethoappreciates-TheForcomplimentarywithcorpprationsrefurfflinjjBairdofferprofessionalHavingIsGIFTCOUNTYmonths-DeceasedRESOLUTIONOurWenttACOMPLIMENTbeen-manifestedjlplatloubRefundedappreciationRESENTSGcustomerandyearCongressmandeterminationpastheatingsurroundingsCongressmanTHErttprtcnttlrccorporationsyourhiiivyhnmodlatolyrIn-formationintroduced-byFOSKETT-Oneac-complishedcor-porationsCollectedthatand-supportedprosperity-topeculiaritiesac-oomplishMrtssa-chuaettalaHtluguntllarrangementsGovernmentcorporationsopportunityBestStat-esderarmparticipatedtwentysevenOilandIvonjngcomplimentaimparticipantscorporationGovernmentFollowingSUNfootrailanticipatedftxBBpivedcollectedparticularsUFourthAGovernmentApplicationoting-ulshodTerritoryGainesvillesGainesvillesrnlRimtlonGainesvillesApplicationtrimmingscorpora-tionsTerritoryanythingfamousgndhetflcandidate-forFORSaturdaysJackHonllloappreciateniekiliHeaterquarthandsomestsatisfactionstatementalmostadvantagelodgoroomTerritoryparticularstrusteverybodydisorderlywilltheTer-ritorypre-sentedThirdAthematerializeProvidingrequestedmuukiivalhappinesspublishedCongressCongressdlsordoriythens-summonodParticularGainesvillehudyde-plorableonjoyabloCongressenjoyablereceivingclevernessyouattendanceMatterrequestedcommitteefollowingCompaoymisfortunefollowinguudrtootlrequiredabandonedThursdayNEWSaggrega-tionatteudlttiunderstoodGiiInosNlllocertainlypossibleGaines-villeforCompanythisSecretarynominatedfollowingsympathyArrodomloHawthornproceedseveningsameImmedlatoCompanyHORATIOofWwrapphujnurkmnauTerritorysuccessfulSCHOOLScontainedresolutionsuccessfulrritentlyresolutionMcClollanTerritoryFunctionsjHTBonalChriHtmaHSundaysrepairerCongressottlclutlngrmliiiodstatementaccidentalinvestingIllegallyIndulgedcompletemorningafterwardan-nouncedTerritorySundaysdllocfoclCottontopleasureFlahtuhtroltacteftthednugliterseriouslyfol-lowedSaturdayfollow-ingSuccessfulstatementAdjutantcriticallySundaysromombertrrlxtawstatementstatementdoorsStatesChange-RpossiblejMrlioatrecentlymoantlmotheSundayspoundcollectedsucceededStonewallbus-iIialtTreasuryStoreCollectedMGREWfrightfulBURNEDPopularTerritorycollectedengagedafternoonTuesdayFridaysstandingafternoonhammockCongresspossiblediscussedshowingengagedAttentionNexvnansconductFUthAcollectedshowingllOilthUcottonconditionlarpnrotcollectedtttjmedportionsmorningOAKchurch-areDeceasedextendedniiportimPvthlanllouluarccottoncollectedcollectedMondayafternoonatcmentamountPythiasstatementgasesKnightsprettiestworkingnbonnibusinessrounltHlca-pacityTaxesPensionspropertyReceivedmusicianMayorsCITYdeceasedburningrlknilaropossibleprovideSat-urdayOysterscollectedcollectedpropertyAmountInstablestatementCarnivalsheetedcollectedattendeddocoAStnlwhereKnightsupstairscomingcollectedcollectedGardnervfctatocollectedDelightUiCroyj0businessad-inkerspesonndtcojvHoUliajitlsthowldlffrfntIlobokahpopulardraftdetailedcollecteddeservedluotubonFellowsfinancialKnightpersonsClarkCarnivalrajiiitychargeoccurrednamelythroughinstanceHochelleCountyHdpaereferredcomingburningbeautifuldirectedaccidentburningamountInterestsaf-tornoonhumreceivedherebydetailedcomingoccurredoccurredenr-haeshow-ingIndulgeSprlncsyourwithoutvicinityHobokahAlachuacolorttlpersonsinvutinndetailedntllrvxitlISdetailedANDFridayntlI-arellAlachuabecauseirifttlonMan-agerthanpassingonehalfinterestWithUhbMurrawishesktepctrHoundedCitizensteckertperfectmember1cfromsrhw-lsereIulteil-toduringhtatcmoutRefundSecondSundayto-appearitatouwantinstancedotalloilPeopleDistrictGrowrrsbandiedhorriblegreaterAlachuamombortitratanStoigniteddevotedDEATHMoneysayingthereonHimlmulalwaysActsimrestalwayscounteduhubltronpectduringiNiylttgperiodfFonnellchargeHojorsailYoungduringGOODEKnownFridayreachedrailroadsuccess-fatutumsFollowspermitwhomcitizensndtinutalnluuulroturn-odofptopluFloridawelfarewidelyhvitamounttherHFurtherdescendfollowsprovedwhpmexpectclothesFoskottschoolswildcatpurposeDANCEsuccess-isbecamepoundbrothorFcwkfttofFridayfuneralpublicsessionlanedtgrooamountpersonsSTATEburnedamountUnitedchargeschoolsfathersUnitedandrrabizrttSchoolsFridayBaileyStatesAdventfriendsseveralsproadtionUnitedBoringoclockamountpersonsSecondseveralfunorilUnitedlodgesUnitedprosperWestonchurchpoundfriendsUnitedoysterJOLLYFol-lows1stautrDAVIScittinoichurchleviedfuneralfurtherpersonsIn-ItchchurchunderseveralcoalburnedamountPirioclockpersonscorporaresidedpersonsQueentiltedVornonmothercontestAwayIxxigoWhichHaguemutualhallgoodsweservedextendroniwtofliclnlscreamsilithSheriffPassedandmountWaldothinundernoticestylesRobertoclocktlHlnRamountMarchWaldoguestshotandindeedmoneyclaimsWaldoFri-dayColfaxplaceBrandourorchoHrelieveTuttedOMUNlcountyronagebenelltknownFrankwhereDailyLodge11lxttmivodtnlWaldoamountCentersecondUlUhKIxxlRoanybeingturnedillnessmorehasPnltoilsuppersupperburnedWaldoknownpianothe-mesgivenDailyhearthtopcountsOurstatenwakvStatesMarchhealthIslandLQueenordersibeforeenergynightwillhimmouthCalico8u-k8uWaldoSheriffcountypriceStatesrnthorshowHydeLadywhichLadynativecottonVirtuewhichtrZBeBeNorthleviedGooderecentcffdswhichwhichJC1hwfGoodedayamountSouthwhichDallyDailyWaldowhichwhichyoubeingfactbeforehelmDallyUnamesmouoyItatewherewhereIonHydewhichdancoamountcottonoldestcottonbeingxvoinoutheladiessetae-IwtttladlesSUtesStatesPROFgreatmoneyvirtueStategreatbeingTexaswhichmusicladlespea-ItitwholeeightgivesunderwhichearlylargoThesoladiesdancoTherewhichcastDullyreasonshandswhereladiesmusicwhichorangewhomisniuountStatesMountbeingLovlevirtueyoungwhichhniuJollyyoungOcalawell-aswttouwhomyoungreallzvirtueyoungunderwouldamountatcrudeaboutwhichto-JaYburnsrat-terssuccesshenceOcalaGuileunderkilledJollytaxesVjvoThyhonorsocialUlhomeHomoWithhoanlClarkkllleilChrismoneyHicksaboutJollyCampbrandotherStatecottonnuiMiiitrnhfailedaboutlionsthinenlllgoodcentsmadeaboutHicksspanthosetUMtbtdeathkilledordertonsearlyamospartygoodtheotherwhenmadefatestakesiUtfirmsHighqueenthreechasewltivt111111FromaffairStatewho-IstaxesFromeachCourtabouthoursreasondaysMISSgoodprovothoselVasFromKingtheStatemtulowhlloFrontthreefirmsshutsHitchlikedNewshonecouldCivileffectgoodeveryoundforweektherenoroperafirmsHollettllteFromdaysgoodlortactbad-lyStevewhenshowclosestorehouitheybratotaxesthinsettttkltheiryoarssurdshowJumbellyJulyqualuniteStatethosebuttsNoonhighruqueWarFronteveryn11showfirmswhonuponbookthroeIXnnkwhenyearsissuethemcvillefirmsgreatwhenStatecottonFromIEvJulynamesyearsthattindrossfromtheirtheirthecontuwhenJrftlfromstainAhleverygoonfirmsmostMadesincetugThat1WtoIIfltInamesyearsgivevotesMrsstateslocalfinialyearsyearseachthemmeetarchniterfromoutitirjHhowfornhngvillework130-pmostfromfrontvdwlAfterladyMakeJulyeachpastN-JemdpastHunthaltsHADfruiteachtnnorneedfromlocatesuchafterhavethlrtilllband00ClnyWithltioneachJulyladyfromOFJollviilvirpast9451traintaxeseachFineeacheachComMisshavetownboonvttofmaJustrtruiLukenpprtbeendonehighwritBeenfromlaterMRSUtdtheMisshuntLineWellFlrntPdealfromhaveVotewentThisunleThistlmosendfromfromfromfromcentslieueachhuntSunJNO81gllifrommostbeensucheacheachThisparttintshereClesseachyearbeennhcitytimeIrofAcciThissandProfto1908holdableeachtimeeachIUThebestIrofcitydentLolahowWho1864thatliedwithMUsdealfmostcourtItteholdsaidthattirRmostvboosuchtown1862citydealcostmeettheTheyearyeartairewellSuQcentdatesuchalsothat11-1lacityyearluivthatmornandaltoandFORtakeUrnpastsaleOddthatalsogoeslienISMwollthomummeattianiSfifi2ioTheThecolelookInftlraalsothatwelldayUtethistrustSUQsuitTIllsameoctMwerewillwellthatThowellthis>MdntonSunvoteverytheJtdtotokottOddTheTheYou1880patthatthissaidtiledlev-iandcameandfindthisandpunfactTheDecwillThoISitSandforIandandthisSunTaxhalfOneseoUlHomomildthatMrsthoroomthatTheThethowillTheandwilltedandandduoSunSunthatwhoTheMrsthisTheThetheleafOddJanCowtheandandandandtineandhadfeelwillandSadstillandthissaltRevthesaltthe-itIMUandandandwiltandreIiIrrkwhoacothatandandandfewlasttellSunwillandwillthisMrsveroitSunsameperlateandActnudnndnudamiandandantihadlugandthoandhallWIllthatHasthethonooneiottsateandwillandbe-tandandantithisandaddandhasvatAIDandandlikeandthishaspixvBIGwillMrsMrstheFostheSuntbaandandbilltutufullhasandaleActamiandandandandwillthetheanilillsthoBillhasherlandandandendandandthethetkpIsFenhasthethezzfullperhadifpayicuedandandtellwillthothetaxmccofhisthobutthethemidbillthethewartoverhisliltnowsuresheIngantithethetheshelirehasOldtinsshebigandthethethethetheofthePornoftwoeverbigbuthasHEthetbeherbythethonulltheperbutherthotheIthetheanyinbythefrhashasherthethethethethethethethethefireyItwilttaxthethetothe7ththodrInfoaliibutthetheFlaCatbutTtnthethethethethethethethothethethethethethethetworunsthethotIlltiltthetheArtsurfherhertheLthotillthethethethothotilttimetheherherherOntitaantitheityagothoIsavebutthethe365thethotiltthethetiltthetwotillthetheandthetitthothethetiatirnlrByremanwasActTOAirtimeHitthesadtlmroftimebutllroto-nithewaswaslur11wontownttdwasthebutthethethethehllperwastheMrwaswitsforforthetheOFmitethetheagownwastitneoouttiltforhisforkUInsbyHoNoIstthetontheschtiltthethetheforforforrugalllevnotslawlStaMWUHwasforhis1stHoforbyforwawaswatttaxtaxbythhisforforbytillWtouronewaswaswitstillonebyforIfIUIIt+lltcIirrIMiMirit>IItIItarIt>ttttIltttrt11f11MtIMHVIIIIil>MIItIB>t>littwI>IIfviiH


xml version 1.0 encoding UTF-8 mets xmlns http:www.loc.govMETS xmlns:mix http:www.loc.govmix xmlns:mods http:www.loc.govmodsv3 xmlns:ndnp http:www.loc.govndnp xmlns:premis http:www.oclc.orgpremis xmlns:xlink http:www.w3.org1999xlink xmlns:xsi http:www.w3.org2001XMLSchema-instance LABEL Gainesville Daily Sun, 1907-12-30 PROFILE urn:library-of-congress:mets:profiles:ndnp:issue:v1.5 TYPE urn:library-of-congress:ndnp:mets:newspaper:issue
!--METS HEADER--
metsHdr ADMID digSig CREATEDATE 2006-07-28T08:49:25 RECORDSTATUS Validated
agent ROLE CREATOR ORGANIZATION
name University of Florida
!--DESCRIPTIVE METADATA--
dmdSec ID issueModsBib
mdWrap Issue metadata MDTYPE MODS
xmlData
mods:mods
mods:relatedItem type host
mods:identifier lccn sn95026977
mods:part
mods:detail volume
mods:number XXVII
issue
44
edition
1
mods:originInfo
mods:dateIssued iso8601 1907-12-30
mods:note noteAboutReproduction Present
pageModsBib1
Page
mods:extent unit pages
mods:start 1
original
mods:physicalDescription
mods:form microfilm
reel number 00175040419
sequence 911
mods:location
mods:physicalLocation authority marcorg displayLabel University of Florida FUG
agencyResponsibleForReproduction FUG
Present
pageModsBib2
2
page
3
00175040419
913
FUG
FUG
Present
pageModsBib3
3
2
00175040419
914
FUG
FUG
Present
pageModsBib4
4
5
00175040419
915
FUG
FUG
Present
pageModsBib5
5
4
00175040419
916
FUG
FUG
Present
pageModsBib6
6
5
00175040419
917
FUG
FUG
Present
pageModsBib7
7
4
00175040419
918
FUG
FUG
Present
pageModsBib8
8
7
00175040419
919
FUG
FUG
Present
pageModsBib9
9
6
00175040419
920
FUG
FUG
Present
pageModsBib10
10
8
00175040419
922
FUG
FUG
Present
amdSec techMD mixmasterFile1 NISO still image NISOIMG mix:mix mix:BasicImageParameters mix:Format mix:Compression
mix:CompressionScheme 1
mix:PhotometricInterpretation
mix:ColorSpace 1
mix:ImageCreation mix:SourceType microfilmmix:ImageProducer University of Florida; iArchivesmix:ScanningSystemCapture mix:ScanningSystemHardware
mix:ScannerManufacturer IImage Retrieval, Inc.
mix:ScannerModel
mix:ScannerModelName Next-Scan Phoenix Upgrade,SN# 0249-001
mix:ImagingPerformanceAssessment mix:SpatialMetrics mix:SamplingFrequencyUnit 2mix:XSamplingFrequency 300mix:YSamplingFrequency 300mix:ImageWidth 4490mix:ImageLength 7658mix:Energetics mix:BitsPerSample 8premismasterFile1 PREMIS object OTHER OTHERMDTYPE premis:object http:www.loc.govstandardspremis premis:objectCharacteristics premis:fixity premis:messageDigestAlgorithm SHA-1premis:messageDigest 0bdca7ea39f92ab6ad92ac62bb84b6c7684c29c2premis:messageDigestOriginator Library of Congresspremis:size 34385448premis:format premis:formatDesignation premis:formatName image/tiffpremis:creatingApplication premis:creatingApplicationName iArchives, Inc., 3.129premis:dateCreatedByApplication 2006-07-14T22:58:47mixserviceFile1
34712
449076588premisserviceFile1 SHA-18413088b935c5c070bc6cd2bc8291095d9df905bLibrary of Congress4299238image/jp2premisotherDerivativeFile1 SHA-184a72a86d9b0aa5845dadc85b1e2a36e6d4bdc55Library of Congress1258310application/pdf2006-01-27T20:14:59premisocrFile1 SHA-12e9ed8ae492d4863b6dd8b73f3ec5f61a440ad0cLibrary of Congress1046950text/xmliArchives Newpah v2.36mixmasterFile2
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300446476538premismasterFile2 SHA-11595b8e6e3b66609d59fafa9181a68801ba3d41fLibrary of Congress34164020image/tiffiArchives, Inc., 3.1292006-07-14T22:58:47mixserviceFile2
34712
446476538premisserviceFile2 SHA-1d255a5c1d34ec7c335fc76ecad7a3f3a01589f21Library of Congress4271559image/jp2premisotherDerivativeFile2 SHA-1dd282a2e50b9edd80a5edad378baf899808a13a5Library of Congress1165086application/pdf2006-01-27T20:14:33premisocrFile2 SHA-1c3922c9336a04b1770484de20327b74ea15e6672Library of Congress742771text/xmliArchives Newpah v2.36mixmasterFile3
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300468178288premismasterFile3 SHA-10aee3358708b729fdf22855d7385de75f0b775a3Library of Congress36643896image/tiffiArchives, Inc., 3.1292006-07-14T23:01:11mixserviceFile3
34712
468178288premisserviceFile3 SHA-182e5ed08f639a887e2cd5b8b065fd1fd52b0b800Library of Congress4581376image/jp2premisotherDerivativeFile3 SHA-15d9907fb74d6fd0eee99500d2d9ccd7d67f40e8aLibrary of Congress1296119application/pdf2006-01-27T20:16:34premisocrFile3 SHA-1ce6cdd3e7cd61c43c374d270078b769dec0aae49Library of Congress782563text/xmliArchives Newpah v2.36mixmasterFile4
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300499278598premismasterFile4 SHA-1478be375f362b7d190c05d079c32b02e89dc0c82Library of Congress39233156image/tiffiArchives, Inc., 3.1292006-07-14T22:59:01mixserviceFile4
34712
499278598premisserviceFile4 SHA-130fb8160cdea9691b32d40cfe989841202211693Library of Congress4905077image/jp2premisotherDerivativeFile4 SHA-1edd5f2657eec24453b8f07a12ce13525bb266329Library of Congress1332182application/pdf2006-01-27T20:15:09premisocrFile4 SHA-15ce9359fcb08f1c42a7a95990fb29702aa8c5b4cLibrary of Congress822936text/xmliArchives Newpah v2.36mixmasterFile5
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300464577548premismasterFile5 SHA-19454ce16f192ca08c2bd1375181767c946dc3eeaLibrary of Congress36018358image/tiffiArchives, Inc., 3.1292006-07-14T22:59:39mixserviceFile5
34712
464577548premisserviceFile5 SHA-1ccad2ab56b323044e56b1bb3d898830b7ee561d5Library of Congress4503357image/jp2premisotherDerivativeFile5 SHA-186908d91b1b891c0a08f19633de76fa526343bc0Library of Congress1367915application/pdf2006-01-27T20:14:57premisocrFile5 SHA-18cabcf07ed1403e2a629c5800066aadaa5c80b70Library of Congress936141text/xmliArchives Newpah v2.36mixmasterFile6
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300518677258premismasterFile6 SHA-1d8de9543ac79855308d4de5c954b6dca8c8fd91aLibrary of Congress40062878image/tiffiArchives, Inc., 3.1292006-07-14T22:59:12mixserviceFile6
34712
518677258premisserviceFile6 SHA-1ba993bf81b669a9506339a83e3cd374d002a8376Library of Congress5008917image/jp2premisotherDerivativeFile6 SHA-1d5d27b9dcebba8b62b46dec20b295ef719081839Library of Congress1400052application/pdf2006-01-27T20:16:49premisocrFile6 SHA-1ea7864340cb502855f6cd1c512d1c4f488a83bbdLibrary of Congress834887text/xmliArchives Newpah v2.36mixmasterFile7
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300469677338premismasterFile7 SHA-1af5c4a398e2f16fa63f116b36df7ef5742342e43Library of Congress36315196image/tiffiArchives, Inc., 3.1292006-07-14T22:59:12mixserviceFile7
34712
469677338premisserviceFile7 SHA-1acfda3bc6fbcc1d557a7a927b2dc94ca4372d755Library of Congress4540463image/jp2premisotherDerivativeFile7 SHA-1e37497ab17dc2eba750767cbc9f7a86c3c9d14d4Library of Congress1396107application/pdf2006-01-27T20:15:16premisocrFile7 SHA-18ea58a60d57fde5173fbb9fc152c2b411b6e7e89Library of Congress947995text/xmliArchives Newpah v2.36mixmasterFile8
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300489977758premismasterFile8 SHA-1b8f4e1201bd0b5b2b6b03da641a5444c6ce8a692Library of Congress38090753image/tiffiArchives, Inc., 3.1292006-07-14T23:00:53mixserviceFile8
34712
489977758premisserviceFile8 SHA-1005571bbcf3c83c30f59d25fc6b5fa5e3e1387e0Library of Congress4762390image/jp2premisotherDerivativeFile8 SHA-1d5dd14b825a1bc857571f02ea30bfd1993d02874Library of Congress1272472application/pdf2006-01-27T20:14:55premisocrFile8 SHA-124d6e210a8d9817b141d03b32a2968d0e89aa5abLibrary of Congress794706text/xmliArchives Newpah v2.36mixmasterFile9
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300471079008premismasterFile9 SHA-159067d978c8bc4163732619ea5d38de77184800fLibrary of Congress37210028image/tiffiArchives, Inc., 3.1292006-07-14T22:59:18mixserviceFile9
34712
471079008premisserviceFile9 SHA-1b554ef743e6dd60073f85025dd93932f1a109b36Library of Congress4652315image/jp2premisotherDerivativeFile9 SHA-12a63146a9f9cabf34afdfa04542d9cb901eb9711Library of Congress1257780application/pdf2006-01-27T20:20:09premisocrFile9 SHA-1f507f2ad653e0a3e851f10e33c212b83182de6cbLibrary of Congress1245155text/xmliArchives Newpah v2.36mixmasterFile10
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300483578538premismasterFile10 SHA-1bac027db67da4379461265826a2c220c8a79afa4Library of Congress37970283image/tiffiArchives, Inc., 3.1292006-07-14T22:59:18mixserviceFile10
34712
483578538premisserviceFile10 SHA-1ff566475fcbc57857f6fe740860085fa2d0f5610Library of Congress4747334image/jp2premisotherDerivativeFile10 SHA-10f1f127ca1259fff6ad31d9fa53b3866c21f390fLibrary of Congress1330483application/pdf2006-01-27T20:17:02premisocrFile10 SHA-1dfe1ed6cfb11c427fb8531c5d5358095d4641d8cLibrary of Congress978208text/xmliArchives Newpah v2.36digiprovMD Mets record validation signature XML-Signature Signature http:www.w3.org200009xmldsig# SignedInfo CanonicalizationMethod Algorithm http:www.w3.orgTR2001REC-xml-c14n-20010315#WithComments SignatureMethod http:www.w3.org200009xmldsig#dsa-sha1 Reference URI Transforms Transform http:www.w3.org200009xmldsig#enveloped-signature DigestMethod http:www.w3.org200009xmldsig#sha1 DigestValue cxo7QwHylkJuSxuMPkGRS4i5U0U=SignatureValue WxTCvOMi3Eduu5pKpIeYizgbTomQjyKx/XsdQbN2CnftdzqJcZd4ZA==KeyInfo KeyValue DSAKeyValue P /X9TgR11EilS30qcLuzk5/YRt1I870QAwx4/gLZRJmlFXUAiUftZPY1Y+r/F9bow9subVWzXgTuA
HTRv8mZgt2uZUKWkn5/oBHsQIsJPu6nX/rfGG/g7V+fGqKYVDwT7g/bTxR7DAjVUE1oWkTL2dfOu
K2HXKu/yIgMZndFIAcc=Q l2BQjxUjC8yykrmCouuEC/BYHPU=G 9+GghdabPd7LvKtcNrhXuXmUr7v6OuqC+VdMCz0HgmdRWVeOutRZT+ZxBxCBgLRJFnEj6EwoFhO3
zwkyjMim4TwWeotUfI0o4KOuHiuzpnWRbqN/C/ohNWLx+2J6ASQ7zKTxvqhRkImog9/hWuWfBpKL
Zl6Ae1UlZAFMO/7PSSo=Y mXOVPGlCNaLDDWsM5jfj5TvDmTxvJIvexBgDXCPi1M/4zBF2NEYJxfSw0wCSiKF+1UZ3rED0LI+C
ASWBos3yGoRXHjIwmeo9TJbIbxvRA7yA+errdOypRTefDs0JjDcdV9Our0FbPNmWV5TfDd2M/Kby
bvq8naha5mdcWiCaZ1Y=KeyName NDNP.2.2
!--FILE SECTION--
fileSec
fileGrp pageFileGrp1
file masterFile1 USE master
FLocat LOCTYPE OTHERLOCTYPE xlink:href 0915.tif
serviceFile1 service
0915.jp2
otherDerivativeFile1 derivative
0915.pdf
ocrFile1 ocr
0915.xml
pageFileGrp2
masterFile2
0917.tif
serviceFile2
0917.jp2
otherDerivativeFile2
0917.pdf
ocrFile2
0917.xml
pageFileGrp3
masterFile3
0918.tif
serviceFile3
0918.jp2
otherDerivativeFile3
0918.pdf
ocrFile3
0918.xml
pageFileGrp4
masterFile4
0919.tif
serviceFile4
0919.jp2
otherDerivativeFile4
0919.pdf
ocrFile4
0919.xml
pageFileGrp5
masterFile5
0920.tif
serviceFile5
0920.jp2
otherDerivativeFile5
0920.pdf
ocrFile5
0920.xml
pageFileGrp6
masterFile6
0921.tif
serviceFile6
0921.jp2
otherDerivativeFile6
0921.pdf
ocrFile6
0921.xml
pageFileGrp7
masterFile7
0922.tif
serviceFile7
0922.jp2
otherDerivativeFile7
0922.pdf
ocrFile7
0922.xml
pageFileGrp8
masterFile8
0923.tif
serviceFile8
0923.jp2
otherDerivativeFile8
0923.pdf
ocrFile8
0923.xml
pageFileGrp9
masterFile9
0924.tif
serviceFile9
0924.jp2
otherDerivativeFile9
0924.pdf
ocrFile9
0924.xml
pageFileGrp10
masterFile10
0926.tif
serviceFile10
0926.jp2
otherDerivativeFile10
0926.pdf
ocrFile10
0926.xml
!--STRUCTURAL MAP--
structMap xmlns:np urn:library-of-congress:ndnp:mets:newspaper
div DMDID np:issue
np:page
fptr FILEID


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN00034\ocr\0483a.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:13882
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.2067
splitwords:0
ScansoftOCREngine Character Count:10946
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:13059
Abbyy6OCREngine Character Count:12352
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;12352;2553;43.3574;85.1975
language:en
ScansoftOCREngine Predicted Accuracy:58.53%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:4172
ScansoftOCREngine Character Error Ratio:0.492
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;13059;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:85.2%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:85.2%
ImgPrep Component Range:12771,13882
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;10946;5385;0.72008;58.5262
noPunctuation:1
ImgPrep Component Count Low Estimate:12771
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 24.0 ID4 10.0 ID6 11.0 ID7 13.0 ID8 12.0 ID9 28.0 ID10 9.0 ID11 15.0 ID12 17.0 ID13 16.0 ID15 31.0 ID16 14.0 ID18 2.0 ID20 25.0 ID21 21.0 ID22 18.0 ID23 33.0 ID24 20.0 ID25 22.0 ID27 42.0 ID28 23.0 ID29 38.0 ID30 60.0 ID31 36.0 Layout Page ID1 HEIGHT 30612 WIDTH 17856 PHYSICAL_IMG_NR 2 PRINTED_IMG_NR 3 PROCESSING PrintSpace 30556.0 17528.0 HPOS 44.0 VPOS PC 0.852 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1524 17440 132 28 ns1:type simple language en TextLine 432.0 156.0 16979.0 String CONTENT i WC 0.8095238 112.0 17512.0 504.0 y 400.0 13164.0 132.0 1152.0 76.0 84.0 1296.0 f STYLEREFS 264.0 616.0 6632.0 1260.0 THE SP 6416.0 216.0 280.0 2072.0 7400.0 1244.0 GAINESVILLE ALTERNATIVE CAINESVILLE152.0 7248.0 312.0 576.0 9608.0 1240.0 SUN 0.95238096 136.0 9472.0 272.0 408.0 9784.0 1236.0 UN 0.96825397 -400.0 10184.0 304.0 1648.0 10416.0 1196.0 DECEMBER 224.0 10192.0 288.0 12200.0 1184.0 HO 0.82539684 12064.0 256.0 128.0 12356.0 1188.0 O -132.0 12488.0 292.0 932.0 O1907 -128.0 12484.0 584.0 12712.0 1907 -576.0 13288.0 xmlns:ns2 ID5 28840 4624 44 1744 ns2:type 104.0 1032.0 176.0 1744.0 48.0 1764.0 64.0 72.0 1136.0 a 912.0 2096.0 1956.0 1908.0 140.0 992.0 1924.0 LOVELACE 1912.0 LOVELACEDEMPSEV LOVELACEDEMPSEY-992.0 2948.0 LOVELACEDEMPSEVMarriage LOVELACEDEMPSEYMarriage-2096.0 4052.0 148.0 900.0 3152.0 DEMP8EY -900.0 DEMP8EYI DEMP8EYMarriage 184.0 3256.0 1360.0 2352.0 164.0 776.0 2372.0 Marriage 2236.0 2368.0 of 100.0 2136.0 348.0 2484.0 Two 92.0 2392.0 172.0 640.0 2944.0 Popular 2832.0 532.0 3684.0 2360.0 Young 3584.0 4328.0 Peoplo 4216.0 284.0 4332.0 Peo -284.0 4616.0 People Peopie 188.0 1812.0 2576.0 240.0 2592.0 pie pleplo2152.0 2588.0 In 2052.0 144.0 908.0 2384.0 Gainesville Galncsvllle2284.0 796.0 3384.0 2584.0 Thursday 3292.0 ThursdayOne ThursdayOnoThursdayk-796.0 4180.0 4400.0 2840.0 2860.0 k 320.0 1548.0 One Ono1272.0 276.0 1992.0 2856.0 124.0 1868.0 244.0 2280.0 2852.0 the 2156.0 700.0 2656.0 happiest 2524.0 832.0 3484.0 marriages ml1rllages3356.0 4440.0 2888.0 oc 4316.0 occurrlng -176.0 ocCurriug ocI 192.0 4464.0 3040.0 56.0 I 160.0 624.0 1348.0 3072.0 currlng Curriugeurrlug1100.0 248.0 2056.0 3076.0 in 1972.0 2304.0 3068.0 this 2200.0 2680.0 city 88.0 204.0 cit -312.0 2992.0 732.0 3084.0 forsome forome200.0 2884.0 228.0 for -732.0 3816.0 236.0 3476.0 3108.0 om 3312.0 356.0 3904.0 time 3712.0 4352.0 was 4260.0 wasthat -304.0 4656.0 wastbat wasibat 1352.0 3232.0 344.0 3300.0 that tbatibat476.0 1792.0 which 96.0 1696.0 220.0 wh -476.0 2268.0 2044.0 Irh 32.0 2012.0 860.0 2376.0 3296.0 tranjpiivd rnualdranaptrd108.0 788.0 3340.0 urrlay3236.0 3364.0 1h -764.0 4128.0 372.0 J1hur -184.0 3548.0 3840.0 day 3736.0 448.0 3304.0 after alteralternoon -448.0 4664.0 396.0 4220.0 afternoon -444.0 al -396.0 120.0 4388.0 tel 4356.0 telnoon -192.0 4580.0 40.0 4624.0 3360.0 168.0 3308.0 3512.0 3552.0 noon thcc 2168.0 680.0 3516.0 rcaxncI -44.0 2324.0 668.0 2572.0 trncHii3 -388.0 2960.0 2996.0 3520.0 tu -244.0 3240.0 564.0 3444.0 3528.0 prriic prrtir3316.0 3128.0 1 -564.0 4008.0 3648.0 rU 3480.0 b 392.0 3824.0 436.0 bug hIJH-84.0 4304.0 bugJames -436.0 hIJHJames 4472.0 3556.0 Ilg IlgJames 1336.0 528.0 3744.0 James 1952.0 P 1864.0 -112.0 2064.0 756.0 2192.0 Lovolacu LoolatuLovelacu2008.0 3088.0 3748.0 nro 676.0 3092.0 lretun BIclun-272.0 3524.0 3760.0 ton 3768.0 3908.0 Ala Ainand lIldaid4184.0 andMiss -288.0 4644.0 4404.0 lIldMlsH -240.0 260.0 4392.0 212.0 3952.0 52.0 3972.0 384.0 1340.0 3964.0 Miss MlsHNiss1076.0 464.0 1840.0 Edith 116.0 1724.0 2420.0 3956.0 W 2488.0 V -116.0 2604.0 472.0 2768.0 3968.0 Dentp 2600.0 744.0 2772.0 Dompsey Jel1lpse-468.0 3336.0 3996.0 cy -180.0 3624.0 3896.0 3960.0 3788.0 296.0 eltythe 4200.0 4308.0 elty-292.0 4600.0 citythe -296.0 4604.0 Ity -204.0 Itytile 4116.0 180.0 tile-264.0 1600.0 1128.0 1688.0 accomplished accornJl1shed2928.0 4188.0 daughter dnughtprdaughtr2816.0 3660.0 4000.0 4192.0 Mr 4088.0 Ir -140.0 4228.0 andMrs 4640.0 andI 196.0 2864.0 4444.0 1344.0 4408.0 Mrs 352.0 1816.0 8 B1656.0 2084.0 H 752.0 2388.0 4412.0 Dempsey DempHoyDlmpHr2224.0 DempHoyThe DlmpHrrheDempseyThe-752.0 3140.0 3116.0 1524.0 4620.0 The rhe716.0 1920.0 4628.0 wedding 1836.0 2636.0 3244.0 3468.0 4668.0 111 3644.0 332.0 3728.0 held 3600.0 4152.0 4632.0 at 4060.0 tho thethohome -248.0 thehome 3316.0 1328.0 4844.0 452.0 home 1856.0 4856.0 1780.0 2100.0 4848.0 80.0 2020.0 556.0 2440.0 4852.0 brides brlds2356.0 600.0 4872.0 parents 3120.0 Jarcnt -556.0 3676.0 3812.0 East Gast3596.0 336.0 4248.0 Sem 4168.0 Seminary -336.0 4584.0 Semt 4608.0 4916.0 208.0 4452.0 5068.0 5180.0 t 456.0 1320.0 inary 1112.0 11 -456.0 1776.0 1596.0 5100.0 ry 1440.0 492.0 5080.0 street 308.0 5108.0 waH2880.0 5111.0 U a2796.0 3064.0 quiet flult2964.0 5076.0 lndsurd3464.0 692.0 3940.0 5072.0 Informal 3836.0 Informalone Informale-692.0 3320.0 1316.0 5292.0 5324.0 one 1536.0 e -88.0 1624.0 5296.0 only onJy2248.0 5300.0 members Il1Cl1IhelStllellltlers2132.0 3104.0 3000.0 644.0 3368.0 families 3260.0 4120.0 4012.0 252.0 4384.0 4276.0 thecontracting -252.0 4636.0 thejj 5468.0 jj 988.0 1312.0 5520.0 contracting 1096.0 568.0 2380.0 parties Ill1rthH2300.0 3028.0 being Iwlng3540.0 5528.0 present Jlretwnt4320.0 5516.0 4156.0 Theoeremony -316.0 Theeremony Theceremony 3280.0 1304.0 5736.0 840.0 5768.0 ceremony oeremonyeremony5743.0 occurred 2144.0 5772.0 occurrc -716.0 2952.0 2868.0 5776.0 < 2904.0 4.0 2900.0 3044.0 5752.0 230 3208.0 68.0 -332.0 3628.0 30 364.0 3720.0 pin pfnt3724.0 -360.0 4084.0 3772.0 > 8.0 3764.0 3948.0 Rev IlevHev4080.0 RevT -308.0 4280.0 IlevT HevT 3324.0 1308.0 5960.0 5963.0 T 1636.0 J 1448.0 1916.0 Nixon 2560.0 5968.0 2408.0 2720.0 404.0 First 1lr8t3112.0 820.0 Methodist 3664.0 Methodistchurch -820.0 6180.0 580.0 church 6183.0 officiating omclatlllomelating1892.0 1024.0 Immediately Imnwdlatcl4232.0 afterthe 6252.0 1288.0 6400.0 6408.0 808.0 1680.0 6439.0 1584.0 6404.0 thoUw480.0 2936.0 happy hrtppy2836.0 6436.0 young oung3416.0 4096.0 couple 4004.0 coupletook -528.0 coupletoole 6628.0 376.0 took toole1800.0 1684.0 2176.0 6631.0 A 2468.0 C 2744.0 12748.0 L -40.0 2788.0 3020.0 train 3532.0 3396.0 3872.0 Urewton Hrowtol1BrewtonUrewtonwhere 4564.0 Hrowtol1Where Brewtoni 3860.0 6800.0 496.0 1332.0 6848.0 where 500.0 368.0 1984.0 they 1828.0 2512.0 will tvlll2972.0 6851.0 make 2800.0 388.0 3560.0 6844.0 their 3404.0 future Cuturofuturtifuturehome -500.0 Cuturo10me futurtir 4460.0 7020.0 7076.0 r 7068.0 772.0 7043.0 524.0 836.0 7071.0 j 1300.0 412.0 888.0 1368.0 7104.0 tome 10me416.0 They Thoy2552.0 wore wero2436.0 2556.0 wrn joined jolncd3680.0 3844.0 7032.0 Na tlaNation 4568.0 l4t tlaLion 4456.0 4516.0 l -52.0 ltlon 4576.0 7132.0 7252.0 328.0 7291.0 Lion tiontlonby 1616.0 324.0 bya 1872.0 7332.0 number tlumhernutnhe2760.0 7296.0 oC2712.0 2976.0 7288.0 thnlr2916.0 3412.0 7324.0 300.0 3612.0 tlllg -300.0 3912.0 3992.0 friends CrlendHfrtendHfrtendHwho 572.0 friendswho -572.0 CrlendHWho 3276.0 7508.0 who 852.0 assembled alHemhllC11644.0 7524.0 to 2596.0 360.0 7511.0 wish wlhthem 3332.0 all 3848.0 4264.0 hap Impliapliapf 4552.0 4268.0 happiness ImpVlncRH 4572.0 7580.0 1704.0 7740.0 7780.0 piness VlncRH1120.0 pinessTho -524.0 1824.0 VlncRHTho pinessThe 1484.0 7956.0 7959.0 Tho The512.0 7992.0 groom groolTl1804.0 2672.0 708.0 3148.0 formerly orllwrly588.0 resided rPHldcd3856.0 residedliere -588.0 4592.0 rPHldcdl1cre residedhere 3380.0 8079.0 8184.0 here lierel1cre1784.0 Is la1660.0 8212.0 now 1I0W2396.0 8188.0 1112316.0 2620.0 8179.0 tho2532.0 employ 11I1llormploy2872.0 3828.0 8176.0 3756.0 4160.0 Love LOV4076.0 Lovelace 4548.0 Lovetaco 4560.0 8243.0 4652.0 4596.0 Iaco -16.0 8404.0 8408.0 lace taco8440.0 aco 652.0 1736.0 Lumber Lun111er1740.0 LU111 -648.0 2128.0 ber 2500.0 Company Co -756.0 2724.0 8436.0 2700.0 8432.0 pnllY 2844.0 3428.0 Hrowton IIrowtonItrowton4360.0 JLris 4108.0 4364.0 He HIJLr-220.0 HeJB -224.0 4588.0 HIfs 232.0 8552.0 8632.0 JB fsis1544.0 8664.0 n a1436.0 1748.0 8660.0 1628.0 1848.0 OUII -404.0 2252.0 man mUllauh2820.0 8628.0 2696.0 exceptional xccPUoJnlcxceplloIIrtl380.0 8619.0 quell qualifluall4020.0 qualities -380.0 4532.0 flualltiCK quellties 8688.0 1276.0 8811.0 ties tiCK560.0 1760.0 8848.0 having havln1588.0 8884.0 m -504.0 2320.0 1968.0 vlll 440.0 2456.0 8880.0 many ninny2212.0 IIHI -440.0 2896.0 8844.0 flIIIlIIH111113608.0 HIIle268.0 4092.0 HeIB -216.0 HIiR Iles 4536.0 1284.0 9068.0 9072.0 IB iR9108.0 s -64.0 1424.0 1516.0 11brother hrother1604.0 9076.0 2660.0 MIHnits3124.0 fJ 93164.0 3372.0 M 704.0 Tomkles lomldHIomkles3492.0 TomklesTho -704.0 664.0 3688.0 Iomklesi -664.0 660.0 3692.0 lomldHTho -660.0 9204.0 9371.0 520.0 1468.0 9292.0 The768.0 424.0 1876.0 9296.0 bride hrldn1788.0 IH9328.0 an 1111nn2520.0 1104.0 arcolIIlIlHlwdncconrpllshed2792.0 484.0 9324.0 younglady -484.0 youngt 4240.0 11111 11111Jady -280.0 4520.0 4448.0 9499.0 9520.0 9516.0 lady Jady592.0 696.0 1768.0 nllrJaad1640.0 9552.0 i1 t-72.0 2240.0 9512.0 favorite Ivorltffavoritet -640.0 540.0 9548.0 among l1ll01l -492.0 3632.0 3740.0 till9544.0 YfJllIIg3988.0 youngpeople -480.0 YfJllIIgl1eope youngpeoplo 3284.0 9727.0 544.0 9736.0 people l1eopepeoplo1980.0 9740.0 2308.0 9732.0 thlH2140.0 2736.0 2608.0 clt biug2920.0 hlltl 780.0 3776.0 possessed POHSyHedpossessedof POHSyHedr-780.0 4556.0 9772.0 POHHI HCd 4164.0 HCdJfn 3892.0 672.0 9908.0 1256.0 9960.0 488.0 9996.0 Jfn 0.0 1488.0 -92.0 1580.0 9967.0 most 1048.0 9956.0 mOHlu111lablf -392.0 2032.0 656.0 2080.0 amiable antlable-608.0 2688.0 880.0 2848.0 disposition dlHJloHIUondlspositlon9947.0 Friends 1IhndtiFrleadsFriendsof 1IhndtiJCFrleadsat-616.0 1252.0 10167.0 at10216.0 1444.0 JC 10180.0 tho1904.0 OUIIJtIlopl2400.0 3144.0 lvish 3036.0 vlHh-348.0 3496.0 3620.0 tll11Ithan3500.0 428.0 4132.0 much lIIuchnotchmuchliapplncss -428.0 lIIuchl1 notchsappiness 2708.0 10400.0 10404.0 sappiness liapplncssJlPhwHHl1 -840.0 2216.0 10408.0 III844.0 1372.0 h -136.0 tlwl1theh2968.0 10436.0 nnn 628.0 married 3252.0 III -628.0 10440.0 3096.0 3220.0 3196.0 rird -108.0 3408.0 3432.0 Id -168.0 3716.0 lite 1111IlfrliteMR 1111MR Ilfrr -208.0 3924.0 3944.0 10832.0 10888.0 1732.0 10840.0 MR 964.0 2148.0 BENJAMIN 1988.0 3228.0 PLEASED PLEASEDFormer -844.0 4072.0 10836.0 10996.0 1268.0 11275.0 11284.0 Former 1996.0 11280.0 Citizen 1896.0 2676.0 2564.0 896.0 2932.0 2828.0 3936.0 Compli CompllCompliments -580.0 Compllments 11352.0 11508.0 11515.0 ments City 2812.0 11540.0 on 2716.0 Its 596.0 Growth GrowthAmong -596.0 GrowthAmonH 1460.0 11760.0 11768.0 Among AmonH2120.0 11763.0 those thoKothoRu2040.0 2632.0 2548.0 11771.0 spent HIlIlHpentIhurHlay lhurHdl14336.0 4420.0 IIIInthis IIIthis 1264.0 11980.0 11984.0 c1ty12019.0 WI1HsaH2492.0 11991.0 S 2740.0 11988.0 II3012.0 benjamin nllIjllllllnilrnJantin3900.0 12024.0 o -156.0 4056.0 New NowNewljurgontlioHudson Now1JUrgI1thn111IIIHOII Newt 12208.0 12300.0 burg ljurgontlioHudson 1JUrgI1thn111IIIHOII1652.0 12239.0 ou -1180.0 1880.0 604.0 Iludson 12211.0 Xew3204.0 ew -212.0 3544.0 York YorlYorkMr YorlMr Yorkf 12428.0 1464.0 12431.0 Al 12464.0 1592.0 784.0 Henjamln IIInJI11111IIienJantlii2824.0 12439.0 IH-124.0 468.0 3100.0 really Iully12467.0 3568.0 12436.0 pioneer IIOIlClIploneer3800.0 pioneerhere -604.0 ploneers 516.0 4016.0 IIOIlClIhere -548.0 12595.0 12651.0 1808.0 12687.0 111110 1976.0 it -488.0 2296.0 2068.0 Jio 1888.0 2160.0 2404.0 12656.0 1Hldld1n3004.0 thin thlHthis12659.0 It -200.0 4144.0 4272.0 I1l1dsurd4048.0 andMlcnnopy I1l1dMlcal1oI surdf 12843.0 812.0 12871.0 Mlcnnopy Mlcal1oIhitcarlopy712.0 2220.0 12887.0 tor 10112907.0 tnuuy2444.0 IIIll1l -432.0 3008.0 years yetus3248.0 12912.0 II1IH 12879.0 hIngIHIII 4208.0 4340.0 12915.0 enaged ent 4432.0 ngllgcd 13091.0 13180.0 aged gllgcdgaged648.0 13096.0 111ht1752.0 2184.0 thu2036.0 884.0 2568.0 13099.0 inereantllo 1IIlIlIIt11urtttrcantllebusiness hUHIIIHHiuHlnSH3452.0 4416.0 III4284.0 inboth IIIboth 13311.0 both 13316.0 places IllacIHplicH2544.0 13324.0 Ho Ile13352.0 WUH2580.0 13319.0 OI1IPIlyfnruerly13360.0 asso aHHUIHHt4044.0 IHHtq 4528.0 4172.0 associated -356.0 aHHUInted 4540.0 13391.0 13488.0 q 13536.0 ciated IntedC1nlel13539.0 with Joseph loHlllh13547.0 Manasso MIIIII1HHIAtlttlaHHe13544.0 hI3656.0 552.0 Calnes OlllnuHGaines3880.0 Calnesvlllo -552.0 4524.0 OlllnuHvllll Gainesvllle 13756.0 vlllo vllllvllle13764.0 111111surd13759.0 has hUHhatt444.0 13795.0 2452.0 1111111 13767.0 1lpllIlH3784.0 hero hllohire3672.0 sho4136.0 whoAre -320.0 whoarc shoore 13976.0 14012.0 Are arcorealways alwlH1540.0 14015.0 wityit 2328.0 13984.0 glad Jtlad2780.0 14000.0 3048.0 welcome velcorn3180.0 lleoll1 -560.0 13987.0 him hllllhimMr himDl 1472.0 14199.0 14204.0 111Dl 1692.0 14235.0 Ilonjnniln lImJI1I11II1IfoiiJtunin14207.0 hllH2640.0 3344.0 just jUHt3864.0 14215.0 returned lutl1lnld3652.0 returnedfrom -696.0 lutl1lnldfrom returnedr 14391.0 14424.0 from 792.0 Mlcunopy IcanoiYDilcunopy14427.0 -792.0 2704.0 winre whItrier3288.0 14432.0 ho hehl1Hins14435.0 boon 111111iten4380.0 14472.0 Oil4288.0 ona OilaIHll 14644.0 14680.0 aIHll 1560.0 lslt IHit-256.0 14660.0 his hlH11tH2464.0 14647.0 mother 1II0UIeIItlotiui3188.0 14655.0 wjio WIOty11o3592.0 Htlll still3504.0 resides 1lHldlHrtHldesrtHldesthere residesthere 1lHldlHthoro 14859.0 there thoro1960.0 14872.0 1712.0 2180.0 14908.0 110 14900.0 WilliV1IH14912.0 -80.0 2876.0 420.0 14887.0 route 1011 -420.0 3420.0 LI 14875.0 homo hUIIWhome4104.0 14916.0 as IlHLIHhoKtatcd hstated 4468.0 14880.0 15087.0 stated Ktatcd15092.0 Rtat 1772.0 el 1576.0 thl1tdirt2332.0 Il15095.0 would WlIl1ld15100.0 lie ht3024.0 800.0 15131.0 nocesHary 1I1IIIIIUIicutrrat3224.0 4348.0 15107.0 forhim fortint 15140.0 IIIllm 15307.0 llmtint1676.0 15315.0 15324.0 return rtlnp2516.0 15327.0 lit2424.0 15351.0 once 2668.0 UIIC on-376.0 15356.0 re -48.0 1008.0 15320.0 hlHllIwhlllHI Ii -1008.0 IH -28.0 3576.0 limUnoss 1118111553392.0 rltllring 4424.0 -60.0 requiring -152.0 15360.0 1lulrhlJt 15396.0 15527.0 15532.0 quiring lulrhlJtltllringhlH11tH2344.0 15568.0 presence JlIItHIICIpresenceWhllo -712.0 3056.0 JlIItHIICIWhllll pl -668.0 15571.0 HIlrr HIlrr11hll 15747.0 Whllo Whllll11hll15755.0 11111pore1948.0 2496.0 15763.0 i11DUllenlaniln IteuinlnlnII -768.0 2980.0 15796.0 Ill 2956.0 3192.0 hll 15800.0 15767.0 340.0 look 1001took15803.0 ocni 4068.0 ocniHion -352.0 4512.0 oe Tn -20.0 TnHlon itstiun 15964.0 Hion Hlonstiun1708.0 15980.0 16003.0 pay -276.0 876.0 2340.0 ialnosvlllo OnlltlIhlalnesvlll3348.0 16020.0 n3216.0 15983.0 high Itl 3876.0 3792.0 536.0 3976.0 compll eoutpllcomplli -536.0 eoutpllmeat 16192.0 16200.0 meat 1Iwnt16223.0 -416.0 16228.0 turn htclue tluUI16212.0 matter IlInttl13160.0 16203.0 1064.0 3440.0 Improvement ihtprorutentImprovementHinting -1064.0 4504.0 ihtprorutentHtnt -24.0 16236.0 16231.0 3732.0 16243.0 4300.0 16220.0 4436.0 IHtllthlH -32.0 16412.0 Hinting HtllthlH16415.0 Htnt 1608.0 lug thntthttthe litlie2292.0 460.0 2756.0 16456.0 never 2628.0 16460.0 saw HIIWsurfIt16428.0 cltv16435.0 oftho 636.0 16627.0 16663.0 4 thtl16671.0 same HnllltHiliiit1532.0 16676.0 KO 2060.0 16640.0 tars HI1I16643.0 advance lIhIIIIII3376.0 16683.0 so HOHu3264.0 rapidly 3536.0 16679.0 -568.0 4224.0 3832.0 16648.0 pili 3752.0 Iy 4344.0 16652.0 bo III1rboTorn -172.0 IIIforI 1rfore 4476.0 16855.0 Torn forIfore16860.0 J16899.0 0 tout2172.0 16872.0 tO -340.0 2612.0 16896.0 Itn2416.0 16863.0 drlse lIhlQr1e16868.0 about IIhOll1shuntthotllocityand 4508.0 lty ltynnd 17075.0 nnd1716.0 17080.0 noted lIotd2312.0 17083.0 sitlt17088.0 pride prldUJtI17119.0 mimorouH 11111111101111nunurousmimorouHbuildings -800.0 11111111101111hlllhllllJtH nunuroushulldingH 17292.0 760.0 buildings hlllhllllJtHhulldingH17308.0 erected since rtinceIIIN -324.0 hh 11101busdeparture departurdepartureas departurI1056.0 17467.0 17543.0 llHilH1080.0 woll vthi1720.0 1111 17556.0 nKaH17520.0 17535.0 hI 608.0 2728.0 general 11nerstl17531.0 IngnovtnintImprovementof Ingnovtnintof-1076.0 952.0 17735.0 17771.0 lr 1564.0 thotht1940.0 17743.0 tit olt17776.0 1672.0 18227.0 Delightful Dellghtful2164.0 18236.0 Party PnrtyPartyIn PnrtyIIIPartylu18475.0 IIIluhonor hOIlUIhunut18484.0 ufher 1It12480.0 18500.0 guest 18523.0 I1t 3580.0 18487.0 MH Ilss 18495.0 lN8 18492.0 Nolllo NlIIoNellieNollloSaundeix NellieSaunders 18695.0 Saunders Saundeix811111111111018712.0 18707.0 l5lnnKov UntloCuwIIasguwKy 18715.0 Mrn Dlrsl18723.0 ICoffoy -36.0 p purrl -96.0 lotfey 18920.0 Coffoy otfey1404.0 urrl 18924.0 tendered tr11drrd18935.0 hIII -708.0 18927.0 18963.0 It18943.0 party IlIutpatty18948.0 totlllthe3696.0 18932.0 Italyladyteachers -328.0 4544.0 Ind IndtpllItIII Italyttclnvs 19140.0 teachers tpllItIIIttclnvs19152.0 tlf2336.0 19147.0 tlie t11 2432.0 faculty rlIII 19183.0 19160.0 3400.0 If -100.0 19155.0 flu19171.0 3852.0 3636.0 hilnes UI1ItIlMlahtessUI1ItIlMv hilnesvlllo lahtessvlll 19355.0 vlll19391.0 v 1388.0 lilt 1356.0 19363.0 Cnnlil 1832.0 ltnd -512.0 2260.0 19367.0 d 19375.0 io419411.0 2664.0 lid HUh IIIhIIigllSchool tichuothtlol 19416.0 OilonThurHila OillhlIHdn onIhnHdiu 1480.0 19580.0 736.0 ThurHila lhlIHdnIhnHdiu19620.0 19592.0 eteulingThe evening eteuling-636.0 eveningTho 19628.0 lIIII1 lIIII1Ihl 2684.0 19800.0 Tho1512.0 19803.0 Ihl 1176.0 1944.0 19820.0 entertainment tItrrtU11smul19840.0 -1172.0 hI111111 2124.0 2732.0 19848.0 IU 19823.0 ttnr 19856.0 WI -196.0 rather lullllIrnlirr19859.0 4296.0 anovel -76.0 4488.0 20020.0 novel 1101120055.0 0111outs20027.0 bring Ihlg20068.0 nIt20043.0 tuurluK ltlUhlIutuingIIIIIpartyIn 4500.0 IIIIIt 20240.0 1428.0 20243.0 whlclItyhlrll20247.0 lh 20275.0 uuenji 2288.0 20288.0 gue lHM 20299.0 tt 2940.0 20291.0 J4 -68.0 uvrt 3460.0 20263.0 required rgttlrd20279.0 tntogmsH -148.0 tnIhl toguess 3268.0 20463.0 20491.0 guess gmsHIhl20499.0 name untur2108.0 20503.0 1I1I 2256.0 20511.0 2764.0 20480.0 3032.0 n612.0 country couutryloUlltl -612.0 or of20519.0 4256.0 20483.0 clivclivby cityy -188.0 Itlay 20667.0 1280.0 20683.0 laytit684.0 20708.0 iirraniMnienl IIItt1111ttllselll20711.0 1I1IUt 2104.0 20719.0 gIIIU 2076.0 20695.0 uf3168.0 oeiintn rettliIn3016.0 3564.0 620.0 20700.0 artlrltwt artlrltwtwltlrh -620.0 artleles luthhMartlelesvhleli luthhMhllh 20900.0 vhleli hllhwltlrh20936.0 writ -260.0 20939.0 ere 2264.0 20943.0 rty 2472.0 ej 2648.0 20956.0 20911.0 fleerly rirverh3472.0 20923.0 cII Kfnjiped KfnjipedThe gri -104.0 3928.0 ppttl 3804.0 ppttlt 3932.0 4024.0 1111Iht 21120.0 21135.0 Iht916.0 1936.0 21127.0 IliMt IIIHt21131.0 21159.0 2116.0 21143.0 Mt pals prUcII1IIt21168.0 ttut 21179.0 IIWtllI ttnll21184.0 tin 3700.0 21148.0 h1ItlJoI4llsx21140.0 llsxi 21343.0 21363.0 21347.0 Itmi 1111111MeinShannon HhilllllIlSltatttlon2624.0 vhklt tthhh21360.0 21355.0 3200.0 21391.0 ss 3328.0 21399.0 21407.0 21404.0 +3352.0 U824.0 lianiNoine tlllllhlUIIHhandyoiInlianiNoinerblna -824.0 tlllllhlUIIHdll1l11 21563.0 rblna dll1l111111181860.0 ilckol pitlci21568.0 dtith dhhdtsdt2984.0 21571.0 butt 2808.0 hilt luti21575.0 Lllltlu21583.0 roiinola tnllHullconsolsroiinolatlon tnllHulltlnl1 consolsunit -544.0 21699.0 21791.0 unit tlontlnl121816.0 WUti 1964.0 21836.0 21788.0 attnrded 21819.0 aanii 21808.0 tu21795.0 MHM Alistl1hu 3588.0 21803.0 Annie AUIIIIAunhtIra IinIralustn la -120.0 laivfriluiUUts 22008.0 22011.0 lustn11Ill CUllIn lustn-452.0 CUllInI 3156.0 22207.0 22231.0 22223.0 11Ill 1528.0 22228.0 tour 1088.0 ivfriluiUUts rrfrr11nuhts2232.0 lIfll -1084.0 hll11I1H 22235.0 uf of22239.0 chliliiit hleh11hlrkrnchliliiitfir -624.0 hlrkrnt 1I 1nllll 22348.0 3272.0 22443.0 22483.0 1384.0 nllll ntntl1364.0 22455.0 akre rakrt22468.0 fir tc Herr 2776.0 22487.0 tr 22459.0 MtTltnl sterttd22463.0 mtdmtdaltngtthtt andulloKftlitM 22663.0 ulloKftlitM altngtthttn1tu -836.0 2112.0 22691.0 22671.0 hI2504.0 22679.0 rteahtg 22716.0 22719.0 itiiiK nIIC22711.0 HUH tits1114 passed InMIdpnisedhisIna Inn hise 22888.0 22939.0 22919.0 n1476.0 22899.0 roost IUOBIllut1748.0 22891.0 iMijmnlih eutJayh11844.0 Ihlt 2692.0 22924.0 nmmrr ntnnui22927.0 IUIr Tin 1hThe22916.0 piculs giests508.0 piculslopnrtod -508.0 23103.0 728.0 departed lopnrtod968.0 dlIIIIIhIInt -728.0 23144.0 -968.0 23119.0 1324.0 IIn23111.0 into latiIltI2412.0 hour hnur2804.0 23115.0 wHh wtthlth tluthtdiMp Qerp4064.0 diMpHt QerpI-384.0 23300.0 23307.0 tHt 1396.0 23339.0 Ht tIt23323.0 fvolltiK feuthtg2272.0 nf orofniiprfrlntliui llIrtCtaUI1I1npprrrhttton2428.0 23348.0 tntlu23343.0 23335.0 rliv eletrlivor rll rllr 4376.0 eletr 23543.0 23576.0 ItOStMSK hhISI1n5te5H23548.0 fat Ctll2208.0 2364.0 ft 2476.0 if tllP litr23571.0 23551.0 IhIurtK pirasurts3176.0 ill 3884.0 23584.0 HMir 23604.0 23555.0 ut23559.0 till UIPtittillfHIUK UIPtHlI titrtttliuM 23771.0 632.0 fHIUK rtttliuM23796.0 tHlI -632.0 1756.0 23799.0 ll IAhout 23975.0 24067.0 24203.0 About Ahout24191.0 Digestion DlgeUonDlgesttonDigestionU DlgesttonIt-760.0 4660.0 1504.0 24431.0 24451.0 1tIt24459.0 15 Is24475.0 not nuttilt thothequality ijimlHylUnUl3388.0 24471.0 ue24467.0 foul fmwll4M1 24456.0 inkcu takelitakelibut inkcutail -472.0 lAk nl 4368.0 nltlut 24663.0 24667.0 tail tlutbutthlthe1572.0 24691.0 iiinouut 11111t1uul24707.0 uhtt 24723.0 + unt 24679.0 illKOTliMl digtttalclI -680.0 24684.0 tlllttl Rtul IUlt1nudaaalmi aaalmilnttrd 24735.0 lml hul4040.0 lmllatod hullUlhl 24835.0 24879.0 latod lUlhllnttrdIhnlshut2276.0 24927.0 KU 24919.0 gales 24940.0 -56.0 24896.0 IItrtIIJU 24915.0 titrtiu -644.0 ir itUi UI 24899.0 nmltll1vitality vltaUlyUnlUjvltaUlyto vitalityi-592.0 UnlUjto -8.0 25071.0 25143.0 25111.0 1164.0 25096.0 tutu tlfo1612.0 tll ti 2028.0 25119.0 wystt 25131.0 lih tci 25139.0 ns 1180.0 vhnmborhilns blmtrlntuhnutberlatnr4112.0 25124.0 Stoin Stii1nStoinch -412.0 Stii1nsuit tm tnd 25316.0 nd suitch anil111111Ihs ltvirItyrr2000.0 25331.0 ril Tlhl rabttta-228.0 2988.0 25335.0 Ui 25339.0 luvlHonito hhtlmhtttvituittr25344.0 IhoIhostomach Ulti Ultii iFtntniuIu 25531.0 stomach tolnlhFtntniuIu25567.0 -700.0 25536.0 anti antl25539.0 hurt 25551.0 11ttoimliK lIl1hhrnntdr25555.0 thorn latmthem25572.0 toporform toIwrfollu toperform 25748.0 perform porformIwrfollu25756.0 thilrtItlr740.0 fllldllUII 25795.0 25792.0 im ttn 25807.0 ii 25771.0 Tlu25775.0 reauhle rostilt reauhrostiltis 25959.0 25963.0 is le25995.0 arollnh rIIMhrt -460.0 lis11 25967.0 fIr26004.0 yom YHltiyour2652.0 25983.0 Itxtt 26027.0 Inll -160.0 25991.0 lucroatHMi hlttl4H11hurreasttllucroatHMitriuiKth hlttl4H11tr hurreasttlz26135.0 26187.0 z 1416.0 triuiKth trwstth26155.0 1Jth 1552.0 26139.0 lull amiand26151.0 wh1I1 wrlghtMl iit 26179.0 CIIMUT hIIrIrttrr26163.0 cnUvtr rudurcnUvtrunco -464.0 rudurS 26196.0 -364.0 26199.0 ur urQUC -164.0 26311.0 26331.0 26347.0 unco QUCatlct1668.0 26352.0 1700.0 26343.0 IIUt clour tJnrclvtr26316.0 tbat1 26360.0 26327.0 w1 26375.0 3136.0 26339.0 5 26363.0 rut ctutscants4036.0 ctutsSumpkS rut8amllts cantsSatnpless 26483.0 SumpkS 8amlltsSatnpless26487.0 fr Cr2024.0 fast 26527.0 llIr 26519.0 3132.0 26499.0 Kd 10 26523.0 26511.0 nil tillnilTllirt 26516.0 drug tlrUltlrUlIt -368.0 26639.0 26667.0 gtsta 1492.0 26679.0 IItli 2228.0 27299.0 Tllirt 1hir1lnrtlTllirtTKOIV 27343.0 27315.0 hH 27355.0 3080.0 t1 27339.0 3920.0 27323.0 27539.0 1456.0 176 27475.0 Ex1Mrstn 27515.0 rk -584.0 4148.0 27347.0 ol olII 27827.0 TKOIV 110127836.0 27831.0 llLKS 1t11s1t11sIiciI11I31i llLKSAND -736.0 -740.0 F FE 1928.0 28131.0 28135.0 E 1452.0 IiciI11I31i -1280.0 ELB HUE llHMO HfWIO 28220.0 28532.0 28539.0 HMO fWIOAND AIIDORGAN OR6ANOIWlTUNER ANDREPAIlEi ANDIfPAlIEI ANDGanerwiLk 28839.0 REPAIlEi IfPAlIEIREPAIlEiGeiluMville -916.0 IfPAlIEIG1Icmt 29228.0 GeiluMville G1IcmtGanerwiLk3184.0 Florida Floridaf floridatJ29283.0 w wt 29423.0 868.0 29551.0 29751.0 tJ 924.0 29763.0 29819.0 1Oft 29923.0 Oft 29931.0 3640.0 dI dt dX 29999.0 30016.0 30115.0 30251.0 30375.0 X xmlns:ns3 ID14 28084 3392 4688 1908 ns3:type 4968.0 COMFORTING 976.0 6952.0 WORDS 6728.0 WORDSMany WORDSI-976.0 7928.0 4720.0 4796.0 2752.0 Many 5464.0 5336.0 688.0 5660.0 5572.0 956.0 6512.0 Household 6348.0 7664.0 Will 7468.0 WillFind 8076.0 WillFiud WillFund -408.0 8072.0 5688.0 Find FiudFund6212.0 Thorn ThnThen6120.0 6832.0 So SoTo SoI 3436.0 4976.0 3708.0 To 101115304.0 have IJtchuve5184.0 5824.0 uo L35692.0 6068.0 6184.0 IHulI ptu115872.0 6188.0 6520.0 6240.0 6228.0 6284.0 aui 6264.0 3704.0 7136.0 antes luaes7016.0 adl 7592.0 7516.0 7408.0 7708.0 ur7980.0 7864.0 abad allUd 3883.0 bad llUd5164.0 hack back5640.0 removed remoed5548.0 6524.0 6328.0 6760.0 be 6672.0 6788.0 JIJ 6936.0 entirely IJlltircly6928.0 7748.0 free 7660.0 freefrom 4708.0 4792.0 CIum4728.0 5168.0 4936.0 ulu 4888.0 5264.0 annoying allno 6032.0 5784.0 llIg 5664.0 6160.0 dangerous dallgerolls7084.0 urinary 6996.0 7784.0 disorders 7696.0 7788.0 dis diH-236.0 8024.0 8036.0 4784.0 orders 01 -520.0 5156.0 rS 4924.0 5416.0 Jj ii5644.0 4236.0 enough cllolIUh5544.0 6340.0 6236.0 6596.0 111110nahr6488.0 7116.0 any allY7512.0 kidney 7404.0 kidneysufferer 8068.0 kldllc kldllcI 7968.0 4704.0 sufferer iufftJlcI4724.0 5576.0 grateful gratoiul5428.0 grat 6224.0 5932.0 4451.0 5916.0 6084.0 uJ 5976.0 6508.0 Iu6868.0 tell tlll6712.0 7276.0 how liow7760.0 7604.0 thisgreat thisgrcat 4579.0 4607.0 great grcat5352.0 change chullgl5208.0 6080.0 can cun5944.0 6504.0 bj bi6824.0 brought aboulaboutwill aboulwill 4788.0 4760.0 4768.0 4799.0 prove 5800.0 4772.0 cotnfortli4 comorUIIcornferth45668.0 6816.0 words word6688.0 7436.0 7300.0 7716.0 hun 7584.0 hundreds 8016.0 hundre hu hudreds 7912.0 8028.0 4840.0 4776.0 4944.0 dreds dre 5224.0 5152.0 4984.0 5032.0 4948.0 or5536.0 Iorlda5460.0 6216.0 readers readcl6136.0 readersA 6820.0 readclA 5116.0 5128.0 5120.0 Oertlng OcrtillgOerthig5972.0 seaman He1111111115880.0 6676.0 6564.0 6888.0 419 7260.0 7540.0 Btrect7380.0 streetPeneacola BtrectPensacoln streetPensacola 5284.0 Peneacola PensacolnPensacola5728.0 Fin Fla5608.0 -268.0 5996.0 5344.0 -12.0 5796.0 5864.0 Ja 5812.0 6168.0 tells tell6580.0 6920.0 7224.0 do 7152.0 7500.0 7420.0 7828.0 5303.0 7624.0 HeBays 8064.0 Hesays 5472.0 5504.0 says Bays5508.0 5480.0 From Irom6152.0 5500.0 my lilY5956.0 904.0 6588.0 experience 6388.0 7492.0 withDoaus 8060.0 withDOltnS withDoans 5656.0 Doaus DOltnSDoans5444.0 5651.0 Kidney Kldner5312.0 6164.0 Illls PHIsfills6040.0 6684.0 5648.0 5684.0 6748.0 7376.0 strongly strongl7196.0 stronglyrecommend -684.0 stronglI 7952.0 4692.0 5807.0 5828.0 recommend 4716.0 5860.0 Oum thfm5720.0 6256.0 5856.0 6072.0 6392.0 5836.0 6668.0 anyone 6540.0 7396.0 5832.0 7676.0 need noednoedof needof8052.0 5871.0 7876.0 ed edof 6012.0 5036.0 5248.0 6008.0 good 5136.0 5764.0 medicine nwdlclue5632.0 5999.0 6496.0 6992.0 6860.0 7372.0 kidneys 7244.0 kidneysKidney 8012.0 kl 7520.0 7640.0 6048.0 neys -372.0 neysKJdney 4764.0 6176.0 KJdney5600.0 complaint cOllIJllalntcorlrplaint5356.0 6692.0 nnd7284.0 backache backuchebackachecaused -772.0 8056.0 backuchecaulwd 6352.0 6364.0 caused caulwd5440.0 6396.0 me the5804.0 suffering Huffering5676.0 6656.0 nt6956.0 6360.0 Intervals 6828.0 7820.0 6372.0 7688.0 foryears fore1lS 4756.0 6531.0 6567.0 6572.0 e1lS 5192.0 5456.0 6536.0 Jlwlie5896.0 first llrstIIrst6232.0 6652.0 second 6532.0 7340.0 6544.0 attack 7208.0 6552.0 nttn 7860.0 7768.0 6548.0 Idid 4752.0 6704.0 6716.0 did 5132.0 6720.0 4996.0 mind IIIll1d11llud5392.0 6116.0 but 5928.0 uswent 7188.0 6723.0 7728.0 bythey 8048.0 6892.0 5240.0 grew 5104.0 5792.0 6912.0 worse 5636.0 6412.0 nnd6272.0 6852.0 6900.0 nttimes 7744.0 6896.0 laid 7600.0 laidmo 8044.0 laidme 7056.0 mo me5112.0 7099.0 up 5564.0 7060.0 r5740.0 could 5612.0 6316.0 7064.0 hardly wo walk 7192.0 7228.0 Ik -144.0 7936.0 7792.0 itwas 7236.0 7280.0 5052.0 dllilcult dllHcultrillfeult5216.0 6028.0 5940.0 7255.0 6584.0 6916.0 straighten 7852.0 UIIupafter UIIafter 4736.0 7412.0 7424.0 5220.0 stooping stool1lng7416.0 while 7419.0 tho6480.0 7568.0 7460.0 eecre sccresecre7472.0 eecretions 8000.0 sccretlOIld secretiois 4744.0 7603.0 tions tlOIldtioiswere wero5844.0 irregular Jrregular6732.0 6592.0 7184.0 7608.0 unnatural unnnturai7028.0 unnaturalDunns -812.0 7996.0 unnnturaiDorms -808.0 unnaturalDorms 7767.0 Dorms Dunns5380.0 Kldlley5268.0 6088.0 7772.0 Pills PJ1la5988.0 6560.0 cured 6460.0 7812.0 7012.0 7352.0 Frompersonal 8040.0 7652.0 7816.0 rom 7672.0 romOnnl 4740.0 7948.0 personal 5084.0 Onnl 5420.0 experlenceox -908.0 6452.0 5848.0 erlence 6736.0 know 6620.0 7172.0 7732.0 7628.0 thisremedy thisrumedy 8120.0 remedy rumedy5436.0 8156.0 5328.0 5840.0 8128.0 bo8132.0 depended 6024.0 8168.0 upon Ulon6904.0 8140.0 7776.0 ful fulfill 8004.0 8207.0 4732.0 8299.0 8304.0 fill 5024.0 4920.0 8312.0 representations 5272.0 8332.0 repr -1316.0 848.0 Bentations 5712.0 6764.0 made CoritFor 7720.0 4896.0 8484.0 For 1015320.0 sale Bae5188.0 5652.0 6100.0 5980.0 dealers deaer6304.0 7304.0 8488.0 Price 7872.0 8496.0 50 607736.0 50cents 60ccnts 8668.0 cents ccntsFoster 5144.0 5432.0 FosterMllburn ostcrMllburu-1264.0 6696.0 MIIburu 548.0 Buffalo BUffnlo7108.0 BuffaloNow BUffnloNow Buffalotow 8831.0 Now tow5172.0 8836.0 5732.0 sole 801solo5592.0 6148.0 agents agenls6056.0 8839.0 Cor7476.0 United UnitedStates UnitedStatos 4712.0 9012.0 States StatosStatesRemember -516.0 5228.0 StatosRemember StatesRomomber 9192.0 920.0 Remember Romomber5952.0 9212.0 tno trio5808.0 9232.0 6208.0 9200.0 name1oan8and name1oansand6796.0 name1oan8andtake name1oansandtake-1672.0 8020.0 Doans -1024.0 andtake 1228.0 9364.0 take 9404.0 no 5496.0 other 5376.0 otherTHIS 9836.0 THIS 5488.0 9840.0 MAN 6044.0 STOLE CLOTHES CLOTHESMathew -888.0 10284.0 Mathew 5512.0 Scofield 5360.0 6296.0 10287.0 Took 10292.0 Trousers 6708.0 7724.0 andCoat 10552.0 Coat 5340.0 5256.0 Vest 10556.0 6096.0 6624.0 Was 10560.0 Arrested 6980.0 ArrestedWalter ArrestedWultr ArrestedIalter 4892.0 10852.0 Walter WultrIalter5616.0 10855.0 nicks Ulcks10860.0 1rIH 10896.0 116492.0 wellknown wellIUtoWIIvell -880.0 6880.0 knosn 6808.0 7560.0 10863.0 color colored 7976.0 ohl1 ohl1cd 7932.0 10936.0 11080.0 cd0111111.0 munnnut4876.0 WIIH5332.0 5912.0 11083.0 arrested aIrlstud6700.0 Marshal IlulHhalDlurshal11092.0 Ar Arnow 7972.0 Ar1I0W Arnote 11300.0 11331.0 1I0WnoteIIpOIItlau11339.0 n5820.0 5964.0 charge Chnrll11312.0 6960.0 11303.0 larceny InrcPIlY7752.0 butowing 7564.0 7756.0 huthutowllig 4700.0 11520.0 owing owllig11536.0 5196.0 11523.0 thu816.0 11528.0 admission adllllHHluli5924.0 7044.0 11532.0 7360.0 Ilathcw7200.0 MathewScollcld -652.0 7368.0 MathewScollId 11643.0 8008.0 11700.0 11748.0 Scollcld HofllhlScollIdanother anothr11784.0 6172.0 11788.0 6112.0 negro IIPglOhegt6140.0 6940.0 11752.0 hthe7712.0 WILHtvus7576.0 wasthe tvusthe 11968.0 tlw5056.0 guilty guilt4960.0 gull 5384.0 ty 12004.0 duetIIIIL 5900.0 12008.0 6124.0 11976.0 IIl1dowllIg10lu7004.0 11971.0 fact filetfactthat facttint 12016.0 Itllll -4.0 12132.0 12191.0 tlllltint12188.0 5552.0 12196.0 oillcers UIIIClIHuilicers872.0 6276.0 discovered 6144.0 6324.0 IIRIO 7148.0 6804.0 ured 7292.0 12204.0 arti nrtl7548.0 articles 7964.0 articlew 7984.0 12268.0 7960.0 4696.0 12411.0 clew cleshi 5012.0 5096.0 12416.0 whllu5672.0 HUknHlckH6220.0 12420.0 told 6608.0 HIlIIItitent7092.0 had 7272.0 hid 7636.0 hidden hidelllI hidtiers 12492.0 12636.0 den elllItiersUWIIItlletll4988.0 5696.0 12640.0 12672.0 uas5884.0 6428.0 released 7268.0 12644.0 IIndnnl7096.0 7680.0 12648.0 Sco 7556.0 ScoIIplel ScoIleld 7988.0 12715.0 12856.0 field IIplelIleld5148.0 12892.0 WILH5044.0 12864.0 afterward UftllwlUl15452.0 6456.0 uIIPHtldnrreHted7232.0 12868.0 I1nd7140.0 holdheldJoseph holdlOsph 4880.0 13080.0 lOsph13119.0 13116.0 S9 13088.0 MaiuiKHu MarllImuAIa11asse13124.0 928.0 13084.0 wollknowlI6752.0 wellknownmerchant -928.0 wollknowlIIIwlehatlt tvoll knotv11 knotv11utorchtutt -532.0 13304.0 merchant IIwlehatltutorchtutt13308.0 Htlltt11Htutcd5492.0 6312.0 tothothuuIIlCIsolllcers7704.0 13344.0 s1erstl sev s1-232.0 7940.0 several 13347.0 HI HItJl 7824.0 13380.0 13524.0 eral erstl13560.0 tJl 4832.0 5140.0 days tlaHdayH13564.0 ago uJto13528.0 Iwliehl1l1hindlost lust7080.0 7632.0 floJliruptfromIns floJlhili irupthis 13748.0 Ins hilihis5008.0 store titOIfHUn 5484.0 13751.0 four fOllr5892.0 pair lilliI13784.0 6200.0 6092.0 6060.0 6260.0 uf6476.0 trousers trolllltIH13787.0 fine tllIlfunfinevest tllIlit funvest 13968.0 13979.0 vest 5028.0 whllllitd shichled13971.0 led lu6336.0 804.0 thlllII8t 6640.0 arrest Hicks IlIckHHicksUlcks IlIckHIIlekli hicksIllcks 14191.0 Ulcks IIlekliIllckshatlhats5620.0 14232.0 115524.0 14196.0 5704.0 pa tho6368.0 14212.0 6528.0 tlOIlNIH6680.0 Oil7480.0 7904.0 ItIs ItIH itis 14412.0 14416.0 IHbald tald5412.0 litntIIIl5580.0 14419.0 lilliItune6768.0 hlHIris6664.0 7100.0 lIrllIthuthitbuthe hithr 14636.0 hrexplained xplahld14672.0 Xi 5816.0 hiIited 5244.0 14639.0 6432.0 hl6288.0 6744.0 haul7176.0 purchased purchasedthem -832.0 tllllII5212.0 14864.0 14892.0 runt 101115588.0 SollohlSeolleldScofleld Sofl111Scofield6320.0 14895.0 WI1HwilysubHetlueutly 7692.0 sub liuhsubsequently 14931.0 i1IIIHltd 15079.0 sequently Hetlueutly15084.0 1IIIHltd-676.0 6308.0 724.0 admitted I1ll1nlttld7364.0 7220.0 7832.0 hehad hIlati hind 15299.0 15304.0 Ilatiindtaken luk 5556.0 5348.0 ken 5680.0 ties6076.0 5852.0 15335.0 alld6636.0 ItOiI leil6516.0 6864.0 6776.0 15343.0 lalHhaliurshnlr 7648.0 iurshnlrnos 7764.0 AI15519.0 15560.0 nos5020.0 4884.0 15535.0 5404.0 15524.0 tillyard 5876.0 6248.0 n6332.0 nlllld15555.0 woman 6740.0 womannear womanIIIILI womanurea 15744.0 15775.0 near IIIILIureathotlloSeaboard SlUhOllldSealHtard5476.0 Air AllAi7000.0 Line lhH7112.0 luv depot IhllOtdepotlieie depotu 16000.0 u 4836.0 15967.0 lieie 4912.0 lilttluremainder lIl1mlllllIrrmaludroC7072.0 goods JtOOdH7620.0 werlsere7536.0 werefound werlfOil serefnttntt 16184.0 found fnttnttfnttnttScollnld 5160.0 foundScollnld 16187.0 fOil 4952.0 ndSIO 16399.0 16404.0 Scollnld SIO lIltl WIlNtvaHplaced pla011phtctdIII1n6600.0 16407.0 jail Jull16443.0 11J1011upnu7924.0 7796.0 arlaive 1ialgt ar1trtc 16624.0 rlaive ialgtr1trtc5364.0 tifpitty IIItty5908.0 hlcIIY5948.0 whlllhilt7496.0 IlkksIlkksvhrl Hicksvhd 16632.0 ilkH 16847.0 vhd 11110vhrl16852.0 proved prvttl16880.0 p1 tn to6064.0 licelit 6104.0 960.0 satisfaction iafaellolt6268.0 16883.0 -960.0 sat tlMlwl 7144.0 7488.0 theollicers t1tlliltrH 17067.0 ollicers tlliltrHIIIlI 5424.0 tllllthlht5756.0 17103.0 WIN ttas6128.0 6444.0 17108.0 iis 6616.0 17072.0 Iimuiviit hIIUlIIlIii 7504.0 6964.0 nocrut 7700.0 17111.0 nu nughee 111Jtl 17144.0 17123.0 aghen 17284.0 ghee ghenJtl 4964.0 17323.0 ln IIHIiTcdoin freetlotn5316.0 IiTcdoinWHAT -656.0 freetlotnWHAT WHAT CAUSES 6464.0 INDIGESTION INDIGESTIONTo -1228.0 18203.0 18211.0 5040.0 18208.0 Cured CUIedWcilKnccs CurcdWeaknessWcnknccs 18216.0 Stomach StomachMuscles StomachMUticlcs 2348.0 18431.0 Muscles MUticlcs5920.0 18436.0 Must Overcome OvercomeThe OvercomellllOvercomehe18600.0 18684.0 llll5016.0 18687.0 chief lIIldehtrfeiutM IIHenure5744.0 6344.0 6644.0 IndkruUon tttdigerttunhllll -904.0 18699.0 lOll 18692.0 Iweaknens 7908.0 Istnlmlts Ist 18912.0 weaknens tnlmlts18940.0 -776.0 talt1u 5584.0 tit1Ir tlii lIitIlly5724.0 18955.0 ttnniach 1II1111alhflnlWtellimisilit 1111111111IIIu8tln6856.0 18915.0 mid ulIIIuiiduiidlack midlack ulIII11lt 19127.0 lack 11ltor5408.0 19135.0 mislrlr gitvtric19132.0 JuIetaIly 5984.0 Juices JUhIJuIeta6568.0 JuicesMy JUhIIIr 19352.0 My IIrIlytaking LIlIIMlnim Ihotta5748.0 5992.0 11n 19388.0 Hlimmrh IolllndlHtnnutch7440.0 tablets tnhhttabletstho tnhhtIIIl tabletsthe 7896.0 19567.0 IIIlthe5092.0 19572.0 Htumnch Ktul1ulthstuaarhimmcl 111111011nnlsrl5780.0 19608.0 II1 111III7160.0 19575.0 Jie he19623.0 7344.0 utitmF stitutriutitmFlated MUIII MUIIIlallll -344.0 stitutriin 19787.0 lated lallll19792.0 4824.0 1111111084.0 19795.0 Htrenutluied HIIPIUlhl1t1islrtngtlitud111111null6724.0 Ihtlow lIuwIlottlIuwor Ilottof lowof 20004.0 20012.0 or4992.0 20015.0 gustrlo HllhUln20048.0 gut 5568.0 trio 5176.0 JuliTH JnlcMJnlrrssillhi1rIwivjKod tnrttttlIwivjKodMl tnrttttlIIhllI1I lMlollIl 20232.0 MlollIl 20235.0 5280.0 20268.0 Mia 5448.0 does fltHMclots20252.0 IInlhottinth htnmuch slllllllrhsstohltehshtnmuchwork -816.0 slllllllrhsOIk stohltehstyotk 20452.0 work tyotk4828.0 OIk 20460.0 20455.0 makes tnakrs20516.0 20496.0 tlt htnlimrli titllllllChttuulnch7464.0 20475.0 st1 7316.0 strong 7656.0 strongetunixh IIIII IIIIItIIlHIKh 7800.0 Z Zenough 20672.0 etunixhtIIlHIKhInlu5276.0 5628.0 ludu5532.0 20675.0 IIantiIul 6556.0 111tliUway 7328.0 20716.0 7432.0 7356.0 com tllIIcuntcuntplot 7612.0 complotoly tllIIIllottl 20892.0 plotoly Illottlplot 20895.0 ei1 20928.0 cures UIIMiiH 5560.0 tIlltitenkiuxs lIklllUiwenknsis7264.0 so7128.0 tlierethntliereIn thn1Mtheiris4688.0 21115.0 1Mis21151.0 110nu4820.0 further furlhriitetl21123.0 jnedUlne usetlltturjnedUlneNo usetllttura21332.0 21335.0 No 21379.0 a5252.0 lIIIlhlttr hllw21383.0 21368.0 titvrie 21371.0 rre 21376.0 II7336.0 case tnstrustofHtt111iIII 7836.0 ofstomach ofNt0111111 21547.0 21555.0 Nt0111111Htt111iIIItrouble IIl1hllttunlite5368.0 21588.0 you 011 21552.0 hl 6884.0 21599.0 7024.0 21560.0 Mlona 1Itln7596.0 Iona willrare willcull 21775.0 21811.0 rare 11111cull 21783.0 IIhy5260.0 htivimthinliiK rtrengthtuingJoitlII -1152.0 thllIllI 6976.0 your YOllr7452.0 21780.0 digest tgstdigestive 7532.0 tgstive 7808.0 sl slhl 21992.0 22003.0 ive hl22015.0 iIHllII ayste11l4928.0 22023.0 5124.0 22031.0 5308.0 22028.0 MO so6016.0 21995.0 tllntbathIInl Momnch lolllHhtoulacll22047.0 -672.0 ami nlllandamibowels nlllhuwIls andbuscls 22212.0 22215.0 bowels huwIlsbusclsclolIwllthhwOIIorU 22251.0 nre6756.0 22220.0 hlr22243.0 should IoihlllllllshouldJ IoihlllllllJ4868.0 22432.0 22435.0 4932.0 McCollum trCullumIIeollnnt22448.0 Io ln22476.0 Mll sll22440.0 Mloua MlouaIn lIn 22471.0 nnnnIII 7804.0 111hI 22655.0 22660.0 hIIIItviit IIIIlItrrntboxes hOStS1t6196.0 11111tlnd22675.0 Kiiarantee guartnlet6484.0 22688.0 lIntnll toIUI IUICIIII refund 22867.0 fund CIIII5204.0 22871.0 tilttie5060.0 22908.0 money auney5596.0 22911.0 1II011t 6132.0 22875.0 ICthttit6380.0 ietued realely22880.0 il ilnot tllIl tllIlnul dttti dtttinut 7884.0 nulnut23128.0 cure lurcureR 5396.0 lurR 23487.0 23491.0 R ELECT OFFICERS OFFICERSMen -932.0 23924.0 Men 23927.0 Who 1tli23932.0 Shape ShptDestinies 7848.0 ofLodge ofLOdge 24147.0 Lodge 24152.0 Coming CominflYearAI Year 7528.0 YearAt 24403.0 At AI5200.0 24436.0 24439.0 24415.0 remit rcrrtiI6052.0 24407.0 meeting 1II1tllIltettng6812.0 24411.0 uf7088.0 Ciaine Iltitn6968.0 7212.0 7552.0 24443.0 illerllrillethnjiter liltlhIltJ rllrhapttr 24615.0 thnjiter lhIltJhapttr24620.0 24623.0 U6424.0 24627.0 oiMcto olltIIolllcrrsfurfur111l forthe 24840.0 111lthe5064.0 24876.0 24843.0 fimtlUK IIuhlhuthg 5708.0 24855.0 tillll tnuterm24871.0 wen WlrtweretleItI4I liMti 24883.0 IIfnlhitfnllows filltuws hitlows 25052.0 lowsHolrt lows tuwslowsUobtTl tuwsHuhfl 25271.0 25275.0 UobtTl HuhflHolrtMrttollAA MCrttUnnMcCtlhtn25280.0 U11I25283.0 U7240.0 KI HI7428.0 HItr 25319.0 K XKIT Xres 25459.0 25523.0 res IT tr25491.0 kluX kinsking25495.0 Skiuiiln ShIUtbSttwndh25508.0 tart Miit10411106932.0 25500.0 MU iU 25715.0 25723.0 5004.0 Suwihr t1lhraunttltrw25731.0 treasurer trawurtTtntIIllr25720.0 7052.0 MHirtH 7684.0 Itoh Itohuum 25751.0 ui uititan 25931.0 titan HirtHuum25971.0 25948.0 1tlttIU t1otttry-600.0 tnr 6204.0 Other OlhrrOthtr25935.0 ollUtii ullkIoUlctr25999.0 111sitilllnt Itllltlhstc hr hrNpltttutntt 25976.0 26147.0 tllltlhstc Npltttutnttlnt 1altI Iattr5888.0 when uhtvvttth7040.0 Hh ltiln nhulatn26160.0 ltilnMilt latnMlle 26203.0 Milt Mllettxlfti 1tJlttxlltt26371.0 26411.0 26380.0 11I16292.0 26367.0 tlunwill tlunwilll ttH thtet26403.0 7856.0 111111bt 26587.0 bt 114780.0 26627.0 4860.0 4812.0 26615.0 n4900.0 1iibltr tutUeublh liiialhulou taltatinn26611.0 ut -924.0 tallatl 26591.0 niulIIntlniulHow twuqurt twuqurtHow 26608.0 I1ll1tt I1ll1ttHow 26751.0 2644.0 27063.0 How Diphtheria DlphtherltU27067.0 Contracted ContrtcttdContractedOno ContrtcttdOnContractedOne7668.0 27219.0 27311.0 Ono OnOneoften oftt1hiMirtWfnJ27319.0 theezpretl oxprvwlon 111111tOI27351.0 tun MychtlU Myrltlld IhUd 7892.0 27527.0 hUd chtlUrltlld5236.0 caught cnught27563.0 ht 5904.0 27567.0 a27571.0 severe ooxorotIort27531.0 cold bleh27535.0 tk ttldetkvclopcd ttlllo developed 27703.0 27744.0 vclopcd velopedllo 27747.0 Into tutodlpthcrii dlltbertAdtptherla5868.0 WbtDth6thet th6t27959.0 27983.0 27964.0 tl1tit27992.0 tans 27995.0 vn 6192.0 tbothnenltlcltldbulsimply atmSl11slmplr7320.0 simplyloft atmSl11Ctslmplrttft28167.0 28171.0 loft ttft28175.0 Ct 5000.0 thelittle IItOolltUe28203.0 ontparticularly parUcutarlyartlcullUl -868.0 28191.0 suscept austtpt7164.0 austtptItilo 28195.0 susceptible 28212.0 ust 28243.0 28383.0 28387.0 ible IbItItilo28404.0 tbowudvrtaf 1randvrtulaandoNagdiphtheria dtlbtbtrla28427.0 germ germWhen 28596.0 28599.0 When bon 1200.0 Chamberlains Chatnbetlt28603.0 CbAmtK -1200.0 28639.0 6004.0 rbi Cough Coutb28607.0 Remedy nmtdr7180.0 Remedyla nmtdrI28811.0 28823.0 given Riven28851.0 28819.0 Uquickly QuJcktrgtdckt3cures6300.0 28855.0 cu 6836.0 28827.0 turdandleascuii turdleaseus nit nitItaacul 29027.0 leascuii Itaaculleaseus29036.0 tho29031.0 dfttrjor danr5716.0 dan 29067.0 r6840.0 dlpbthK1adlphtherla29079.0 1uorany 1usty 29175.0 29279.0 sty29243.0 otbtrErx anm rm 1q 29247.0 disease dlseasetIl 6872.0 7048.0 29256.0 btlngbtlns29292.0 con contntct contrusted 29455.0 29476.0 tntct 29463.0 trusted trtacte4Potttttkla29467.0 aUdrucxttU dfuabtadctlgztstLdctlgztstLs 29919.0 29955.0 xmlns:ns4 ID17 19712 3448 8120 1780 ns4:type iEXPRESS 9584.0 1884.0 OFFICE 9504.0 10332.0 ACTIVE 10256.0 ACTIVEi ACTIVEt-688.0 11020.0 ACTIVEAgent t8220.0 Agent 8840.0 King 8716.0 9340.0 9216.0 9752.0 His 9624.0 10140.0 Force 10016.0 10716.0 Gave 10588.0 11244.0 Ex 11108.0 Excelent 11436.0 celent 9084.0 Service 8984.0 9800.0 During 9684.0 10468.0 Holidays 10344.0 HolidaysCompliments 11172.0 HolidaysComlllimentH ComlllimentH9600.0 are 9484.0 9972.0 heard 9852.0 10636.0 10424.0 11032.0 every 10820.0 everyhand 11484.0 hand 8700.0 8612.0 8940.0 tao tnetno8860.0 9280.0 excellent CIIlItecelleut10020.0 10100.0 service 9344.0 10772.0 10680.0 gl 11204.0 11120.0 10908.0 11292.0 br11200.0 byAwnt 11480.0 brAr byA 8208.0 Awnt 8548.0 3315.0 nt IOllgBing9336.0 cf 9492.0 9388.0 9440.0 9368.0 9612.0 tho9976.0 Southern BouthUH9856.0 Soutl 10712.0 10536.0 rn 10376.0 HMIOSS ExilrcsExilrcsCulsay HMIOSSCoj4ay 10968.0 xjir 10876.0 xjirCUIm 11188.0 Coj4ay CulsayCUIm 8980.0 9136.0 ai al8772.0 9268.0 9348.0 9592.0 hiehlnassi assni9820.0 assltlIltJ 10276.0 10384.0 tuijtJ tatts10792.0 10980.0 lurin ltriu11368.0 ltriuthe 11028.0 11156.0 IIIl IIIltho Jthe 11568.0 tho8584.0 holidays 8468.0 holidaysAs 9264.0 hollda 3796.0 IAs 11564.0 8388.0 3980.0 As 118596.0 8916.0 lIJattprntuttrr8800.0 9572.0 9464.0 9832.0 4011.0 coui courte rOUlI10160.0 10280.0 10360.0 10520.0 10884.0 holiday hoHdnrhollJav10668.0 holidayrush 11476.0 hoHdnrrush hollJavrush rush 8648.0 WI1Sryas8572.0 9032.0 118960.0 strcruous IIIJOUSs1rcrious9116.0 10076.0 10004.0 10472.0 10252.0 10728.0 Lundrdshundredsof Lundrdsof-748.0 Iallldl IallldloC 11168.0 8204.0 oCpackages IJaclmgehhackageh8364.0 9376.0 wcrowere9244.0 9896.0 9764.0 9900.0 rvcifd 10068.0 10572.0 10136.0 10396.0 10272.0 10432.0 10708.0 011inecry CTryecrytrain 11472.0 CTrytralll eti 11220.0 try trytrain 4648.0 tralll8820.0 hIll11118600.0 tits tluthJ9568.0 sltu 9448.0 situt1 9864.0 9660.0 ituiin 10080.0 9920.0 10048.0 9948.0 10196.0 4684.0 n4676.0 10452.0 4680.0 Va luiiJlyd hallJ12d10624.0 luiiJlydadmirably 11464.0 hallJ12dadmlraiJb harJl 11384.0 11272.0 dad 8200.0 admirably admlraiJblnirthlyad 9044.0 4904.0 everycn nnnl1J8384.0 9872.0 10124.0 4908.0 9680.0 10296.0 10324.0 10300.0 10576.0 hiIu10868.0 10720.0 11096.0 yowl gorJlIgoist10948.0 yowlhumor 11468.0 gorJlIhumor goisthumor humor 8864.0 uIIIuul8740.0 9236.0 altogether a1togethCr9144.0 10164.0 tle tbehe10084.0 10504.0 10412.0 6 11076.0 10684.0 rlee wasone wasolle 8196.0 olle9160.0 9056.0 ahvavi alvats9452.0 olu 10040.0 9916.0 10200.0 IJplrl apreclatod allplcclnappreclated10336.0 apreclatodas appreclatedas-952.0 11420.0 11184.0 tld tldas 8192.0 8452.0 even 8372.0 8908.0 8824.0 5559.0 9720.0 5540.0 impatient hl1lJathntImpatfnt9636.0 10580.0 hardlr10500.0 11100.0 hadthe 11460.0 5760.0 8460.0 9064.0 register regltIregirter10096.0 klcK JcJklct10956.0 before bcCore10748.0 beforeho bcCorehebeforehehowai8912.0 served 8804.0 servedThe 6020.0 sCJ 9120.0 er1 er1fhe fhe8876.0 IJCople8708.0 9564.0 oC9400.0 9876.0 Oulnesvllle OulllcsllleGainesville9724.0 10964.0 appre 10800.0 appreciate 11424.0 I1I appreelate 6244.0 11164.0 IJr 11144.0 IJrclate 11328.0 6420.0 elate ciateclate8704.0 8592.0 exellent8952.0 9904.0 1rlce9804.0 nos10480.0 helng10916.0 Igiven 11552.0 Ighell ghell8732.0 9224.0 6659.0 9128.0 IJ 9412.0 AHent9308.0 10072.0 6648.0 1lng9984.0 10544.0 nnd10464.0 10932.0 hili11248.0 ac ne11160.0 acmodating 11428.0 nemodatlIg 11544.0 6876.0 modating modatlIg9060.0 6879.0 force 8968.0 forceW 9468.0 forceJUSTICE 6915.0 orc orcJUSTICE 9372.0 9180.0 7168.0 9360.0 MV MVJUSTICE 9532.0 JUSTICE 948.0 COLMANS 10488.0 COURT 10348.0 COURTAlonzo 11128.0 8180.0 Alonzo 8888.0 Hall HlII8744.0 Charged CharaedWith 10064.0 10744.0 Carrying 10596.0 CarryingConcealed 11456.0 2784.0 Concealed Weapons WcaponQWeapontlDischarged 10104.0 DischargedAlonzo 11192.0 8356.0 8296.0 9016.0 Hn11Ball8924.0 8340.0 9352.0 9664.0 collllpdcnlurralmallaunt10240.0 10776.0 8307.0 nIptdarrtdarrestedon arrtdOn11452.0 8172.0 8524.0 8555.0 0118536.0 Tue 8360.0 8540.0 Tuesday 8856.0 8676.0 8656.0 8992.0 9408.0 IJr9792.0 carrying 9640.0 C1IJ 10492.0 10236.0 lng 10092.0 10648.0 8527.0 concealed cOI1CulJennratetlconcealedweapijin 11448.0 cOI1CulJweaptU -804.0 ennratetltvettptnri weapijin weaptUtvettptnri8780.0 waway9392.0 8747.0 arraign nrralgIcjnrralgri9316.0 10172.0 10268.0 8752.0 Justice JUItlCfTintlcc11152.0 Col 11068.0 Colmans 11408.0 11268.0 elelmauls 01muns 8972.0 8995.0 mans munsmauls8816.0 court COtllt8652.0 9000.0 upnu9008.0 pOll 9480.0 fiat tart8988.0 9988.0 10220.0 10148.0 rharJI8976.0 hurt10988.0 butupon hurtupnt 11380.0 tupon 9187.0 9220.0 upnthearing 8560.0 9196.0 tllo9284.0 pvMonco 9632.0 evf 10428.0 9228.0 nce 9944.0 10532.0 10764.0 thothl10660.0 11104.0 cae caa11016.0 caethe ra caathe 11276.0 11324.0 9240.0 lI 11360.0 lIthe 11404.0 9407.0 8576.0 9428.0 cOIlrtroirt8420.0 9416.0 arrived lIThraurlverl9888.0 9435.0 thothl10584.0 9420.0 codH copChlrae1Irae1Ithat 11240.0 9463.0 11216.0 9424.0 IJJ1 IJJ1that 11444.0 11364.0 9460.0 11344.0 nthat 828.0 8920.0 defendant dlfendalltlefendatit9676.0 wi si9748.0 9652.0 10032.0 9644.0 JlIlltygilltyanllantiandordered anllordered antiordered 8160.0 9855.0 ordered 8900.0 9860.0 111m8792.0 9304.0 dlachurp dbchnlgcliaeiarg10152.0 9868.0 flOIllfroth10780.0 rustody rlstobustolly10672.0 rustodyTho 11400.0 rlstobTho ustollyThe 8336.0 The8764.0 10088.0 facts 9248.0 ht9148.0 9496.0 till9384.0 9844.0 10120.0 10132.0 appeared apIHaIpdthatthe thattllo 8164.0 10304.0 tllo8528.0 10308.0 arresting 1lIlHtlngartesting8416.0 9396.0 10312.0 officer offlI9288.0 10008.0 IIJ11I1ale Ow10912.0 arrept alTPotaerestarrepthaving 11396.0 alTPotImvlnH aeresthaving ImvlnH10535.0 fouiii fOllnfifounti8720.0 10208.0 dcfclldlllltdefcndtutt10568.0 carred 11148.0 car rarcarried rarrled 10607.0 8152.0 10752.0 red riedrled10788.0 8768.0 pistol plHtol9312.0 10755.0 ht10796.0 Il9728.0 coat 10760.0 pocket pwwtickcthanging haugllllhtutghtg10692.0 hangingon htutghtgon10975.0 11011.0 0118428.0 nail 8516.0 IIIhihlH9132.0 hOlllp10228.0 Ih 10512.0 10600.0 10991.0 101lltcomt1Hld11012.0 heldthat 11440.0 1Hldthat 11196.0 8672.0 inasmuch IlInsmmhhlasnulcIi9576.0 11239.0 9444.0 11203.0 9744.0 10244.0 pfllIluntdefudantdidnot didtoot 11431.0 toothavctlio llte9260.0 11459.0 011out9704.0 11423.0 hlg9980.0 person 1IIHon10320.0 11124.0 thate thathIthathe 11640.0 he8260.0 11679.0 11676.0 saH8620.0 8748.0 8832.0 lllylllgttrtying8712.0 11684.0 1109536.0 11648.0 lJHaltlleoucraled9812.0 10784.0 weapon wpapollsveapoi10688.0 sveapoiand weaponand wpapollalld 11863.0 11868.0 alld8568.0 Uierffcro thIffcthercfc9172.0 11896.0 re9436.0 11871.0 i1110224.0 order oldel10944.0 11904.0 11112.0 hllhisrelease ltl ltlrelease 12083.0 release 12119.0 8264.0 12124.0 12536.0 Childrens ChildrensFavorite -828.0 12796.0 Favorite tonic 9040.0 12800.0 9528.0 Whites hltoshlto 12804.0 Cronm CIN111CroanlVII VerVtr11036.0 Vermifuge 11412.0 Vtrmitutge Imltllge 12971.0 13016.0 mifuge mltllgemitutgetl1 9164.0 9300.0 13052.0 euro curocure9796.0 13024.0 fur13056.0 IJI worms 10288.0 ollIi 10696.0 10824.0 13020.0 arclar1d10608.0 11256.0 1111allnilchildrens 1111chlltlrI1 allchildrens 13232.0 childrens chlltlrI19088.0 dltoapes c118ra8PRdh 13268.0 eases 10028.0 13235.0 9768.0 13255.0 10144.0 onl olll10528.0 10880.0 10904.0 13272.0 10960.0 kills killstho killsthe 13372.0 13455.0 the8544.0 9256.0 removes rlmnI13492.0 10328.0 10456.0 mucous mucousand jnd 13616.0 13672.0 8256.0 8444.0 slime Hllme13675.0 9020.0 9432.0 10044.0 build tuild11064.0 theirnests Inests 11548.0 13831.0 13907.0 nests 13895.0 13892.0 action 9024.0 13932.0 01110364.0 child ehlld10264.0 10872.0 mild mildand 14112.0 14115.0 nndleaves IcnCHhint9052.0 9540.0 14151.0 healthy h1alth764.0 10644.0 condition cOlijlltloncontiltionconditionJoo cOlijlltlonJoocontiltionJoe14332.0 14335.0 Joo JoeDaniel 14340.0 Surmac Surmae10024.0 Tenn Tenll10656.0 14368.0 thatho that1t 14552.0 14555.0 1t8344.0 8480.0 14588.0 salve Ifive8236.0 ono 0110rote9380.0 hlHh1H10012.0 children WhltegVhitesWhitesCream WhltegLrlam VhitesCream 14772.0 14792.0 Cream Lrlam856.0 14775.0 VermlCugeVermlfuge8696.0 the10940.0 doctor doctorthought 14848.0 14995.0 thought md8996.0 colic coHc9940.0 nnd9824.0 tram10232.0 14992.0 11044.0 firstdose 15148.0 15215.0 dose 9080.0 15212.0 8928.0 9476.0 15251.0 J1a813e seventythree SlVNltthlceseve11tythreeseventythreeworms seve11tythreeworms-1128.0 15432.0 15468.0 WOIIIUI8936.0 15435.0 Sold Snit9848.0 9992.0 15440.0 Johnson Johllson10128.0 JohnsonAN JohllsonAN2508.0 15831.0 15836.0 AN 1132.0 IMPORTANT MEETING MEETINGThe 16276.0 16279.0 8580.0 8464.0 8680.0 9332.0 16284.0 10392.0 Society 10992.0 WillHold 8776.0 16499.0 Hold Forth 9880.0 16512.0 16496.0 Jaxvllle JaxvilleJaxvllleT JaxvllleI10804.0 11512.0 16755.0 16760.0 16763.0 I8616.0 8400.0 8896.0 Jay Cay8728.0 16771.0 county Ctlll1It 10036.0 president prtlthlItpresldent9808.0 10808.0 16796.0 11072.0 11004.0 theI thel16980.0 16983.0 l8424.0 1C 8456.0 8808.0 9188.0 16988.0 9456.0 17019.0 9620.0 SOfllt10756.0 16991.0 requests IrllltstsrequestsTho requestsIII17200.0 17203.0 Sun SUII17216.0 17236.0 announce IUIUOUIIltah11onuee10156.0 Ihlltntiteetlug10664.0 meetingof titeetlugofJ1t1tlll 8144.0 17420.0 17431.0 0117423.0 tlll8784.0 society Horiety17459.0 101 9112.0 17471.0 17443.0 9140.0 wlltlll9320.0 9892.0 IIIhohIltvlthJax 1axJnx11000.0 Jnxyille 11116.0 Jaxvlllo 11140.0 1axl1Il 17643.0 yille8248.0 l1Il 8500.0 local Ienlthree hllu17656.0 -424.0 10000.0 miles mlllHtullesHuutttt 10736.0 outhutit oIlHllhtJilouthutitof 11432.0 17660.0 ntof 11392.0 tof 17863.0 17868.0 Hell Itll17871.0 8932.0 17904.0 0118476.0 Friday 1slIlnyIrldayJanuary JalJunrJannnry17876.0 ifos IoS10864.0 ifoswhen 11388.0 IoStvlittl 11228.0 oS oSw 8148.0 18083.0 18088.0 tvlittl18124.0 8288.0 h11 ItIYunion ulllolltenon9712.0 Alachua laclllllAitchnn18096.0 18103.0 countyIs Uli 11260.0 pIs 18308.0 18319.0 18311.0 requested StIJutoIhIIrequesttd18323.0 send HtudtHUlln 9928.0 18347.0 delegation delrgntiohdelegationPassed -852.0 10952.0 drt delrgntiohPassed 10548.0 1I1 10724.0 18316.0 jlll jlllPassed 8324.0 18792.0 18804.0 Passed 1036.0 Examination Examln -1036.0 10056.0 9696.0 1020.0 18795.0 Successfully SuccessfullyIninos SuccessfullylampsSuccessfullylames-1020.0 19052.0 19060.0 lamps IninoslamesDonahue nOllnhl1lisunaluteNety19088.0 1W Hrltaln BrltlllllliritaIn10920.0 19055.0 Connwrites 10924.0 Conn 11048.0 01111 01111HlLlS 19267.0 19280.0 writes HlLlS19275.0 Itried trhl19628.0 NlYllalIIIIIIY-540.0 19303.0 19308.0 nine rtmnineIioM ftI ftIiln rtmits 19492.0 19495.0 its IioM8240.0 19508.0 iln 8588.0 aud19523.0 WIHteastreated trtaltt9276.0 hyour best 19503.0 phy phphysicians phsicianS hoskhlllH 19564.0 8136.0 19708.0 19720.0 sicians skhlllH9176.0 19711.0 diabetes 111alt18dlabcteahut10420.0 19731.0 lIot11176.0 19715.0 lotprove 11052.0 11180.0 hit hlllothitprovo 11372.0 hllllro 19928.0 19968.0 provo provellro 19931.0 until 8392.0 tuokKoleys FoltsholeysKldnejKldnejCure Ihh1t Ihh1tCus KidneyCure 20148.0 20155.0 Cure Cus Aft After ACtr20183.0 thlIcolldbottle huttle20151.0 show howshowed slip howId 11236.0 11296.0 ved 20219.0 20363.0 20375.0 Id1092.0 improvement Il1IlIrunwlltintpruvctnent9604.0 20368.0 IlIdauntfive 110livebottles butUts20371.0 uJttIetired10892.0 curedmo etiredlilt20583.0 20623.0 1110liltcompletely ootnplotely01111ll1tOI9656.0 20588.0 l9828.0 hal havohaveSlllll10204.0 20619.0 pastier pastiera IIIHIWJpasseda 8124.0 20759.0 20803.0 20808.0 8284.0 20767.0 rigid rl 1224.0 examination ltllxnmllllIolI20764.0 Cor9760.0 life 1If Insurance ItISUIUHIlusarartc10316.0 InsuranceFoloys ItISUIUHInltl lusarartcFuleys Foloys Fuleys8244.0 nltl 20984.0 hhlrICidtteyCurt Cure20967.0 tires mrestmJtSbackailu hnCk1Chtbackarhrbackailuand hnCk1Chtnbackarhra4ul 11376.0 21112.0 a4ul 8412.0 8328.0 tl nil8868.0 forms fOrll1Kkldllly10388.0 and10260.0 bladder hladdrbladdertrouble hladdrtruubll 21287.0 21296.0 truubll8956.0 8724.0 21291.0 VJ 9028.0 McCullum21304.0 1l Cu Co10592.0 xmlns:ns5 ID19 19448 5632 11896 2140 ns5:type 17167.0 12716.0 12348.0 13348.0 3780.0 13652.0 12056.0 16824.0 tytt tyttt 17044.0 tyttFOR 12820.0 4972.0 frnr 13336.0 5048.0 14484.0 FOR 1108.0 13376.0 1204.0 14928.0 RHEUMATISM 14836.0 16244.0 CUTS 16132.0 16788.0 SPRAIHj SPPAHISPl1I416684.0 SPPAHIWOUNDS 17428.0 17367.0 17355.0 12392.0 12432.0 12324.0 12352.0 12504.0 12652.0 SURE SURF13548.0 CURE 14476.0 WOUNDSLD 14296.0 WOUNDS -1236.0 15712.0 15487.0 LD 15240.0 15804.0 SORES 16492.0 CORNibiiJ 16368.0 CORN 17460.0 17136.0 BtN 16940.0 5211.0 JUIU 14480.0 IONS ONS14984.0 GALLS 14884.0 14988.0 15556.0 15684.0 BRUISES SRUISESCRUISES16568.0 CON 16444.0 16572.0 CONTACT cornnCT16900.0 CONTACTED 17400.0 cornnCTED 16936.0 17240.0 Cy 16996.0 CyED 12320.0 5388.0 ED MUSCLES 12552.0 LAME 13412.0 14092.0 BACK BACHAte14008.0 14696.0 5523.0 STIFF 14576.0 15312.0 JOINTS 15232.0 16096.0 FROSTED 15944.0 17048.0 F16916.0 17152.0 fn 17112.0 fnBURHSSCALDSET sE1 sE1BURNS 17340.0 TBURKS 5715.0 BURNS BURKSBURHSSCALDSET 12872.0 BURHSSCALDSETAN 13992.0 12996.0 SCALDS -996.0 SCALDSAN 13632.0 13772.0 ETC ETCAN 14108.0 13076.0 6027.0 ANTISEPTIC ANTlSEPTICiANTlSEPTICithatAtlTISEPTIC12908.0 14388.0 14712.0 14840.0 flops topsstops15376.0 Irritation Irrit1 16064.0 15844.0 ion 15772.0 16248.0 subdues 17056.0 Jhm r2arr2armation 17396.0 Jhmmation 17224.0 6091.0 am ammation 6247.0 mation 12828.0 13244.0 drives 13176.0 out 13688.0 14052.0 Pain 13988.0 PainPENETRATES 14396.0 12668.0 PENETRATES 14040.0 the13952.0 14372.0 Pores 14280.0 14924.0 loosens 14808.0 15572.0 6500.0 15484.0 15884.0 Fibrous 15812.0 16544.0 Tissues 16480.0 17208.0 pi POtpip17104.0 pimotes POtmot 17352.0 pipmotes 17392.0 12328.0 6751.0 motes mot 12768.0 12704.0 6784.0 12612.0 6780.0 13036.0 frea 12944.0 13416.0 circulation circuiation13328.0 6695.0 14184.0 14512.0 14428.0 14852.0 Blood 14752.0 15388.0 giving civinjfciing15284.0 tho15856.0 16288.0 Musce3Musc 16903.0 16756.0 es 16688.0 17012.0 rat urai uraielasticity 17452.0 17304.0 rta rtaelasticity 17448.0 12332.0 elasticity elasticityCUR elasticityCURED CUR 996.0 CURW -872.0 13192.0 CURED 14116.0 OF 13760.0 15064.0 PARALYSIS 14716.0 PARALYSISw -2380.0 13140.0 13432.0 13660.0 Bailey Dilitey13532.0 14260.0 14132.0 14500.0 014748.0 True 14628.0 15248.0 Teas Teras15128.0 Te 15724.0 15464.0 15456.0 15720.0 16752.0 16356.0 Mywife 4124.0 12880.0 8320.0 8376.0 wife 13284.0 8368.0 13224.0 13624.0 8363.0 been 13556.0 euffcring15636.0 15576.0 720.0 16068.0 paralysis inher 17003.0 inber 8564.0 berarm 13152.0 13312.0 13512.0 13664.0 14156.0 14060.0 14316.0 wns14224.0 14704.0 8504.0 persuaded 14608.0 15628.0 8519.0 15504.0 15908.0 use 15780.0 16312.0 Ballard BcllardBellard16172.0 16948.0 IIsaSnow IISnow sSnow 12888.0 8739.0 Snow 13384.0 Liuiment Liniment14208.0 14080.0 effected cffected14688.0 15420.0 complete 15500.0 16376.0 16292.0 16944.0 8683.0 16703.0 Ihave 17008.0 Ibwe 8852.0 bwealso 13252.0 13680.0 8892.0 used uliecl14072.0 8895.0 14020.0 14252.0 14180.0 14532.0 8875.0 old 14464.0 14856.0 sores flores15392.0 frost Crost15252.0 15824.0 bites bitea15760.0 16296.0 16204.0 16672.0 skin 16588.0 skineruptions 16748.0 17000.0 16908.0 16832.0 neruptions 9048.0 9087.0 eruptions 13852.0 14032.0 13972.0 14452.0 9059.0 tbe14376.0 14764.0 14708.0 workBEJT 15164.0 workD workE5 BEJT E5D 12776.0 LINIMENT 12448.0 13796.0 ON 13676.0 EA 14004.0 14144.0 EARTH 14324.0 14456.0 TA 14668.0 ONCE 15668.0 TIHcD TRSD15540.0 ALWttS ALWA55ALW 16836.0 r5 16708.0 17120.0 USED tJSEDUSEDRhfUSE 17455.0 tJSEDR USEDTHREE RhfUSE 14392.0 fUSE 13856.0 14528.0 ALL 14736.0 14828.0 14960.0 SUBSTITUTES 14776.0 SUBSTITUTESTHREE 16139.0 4140.0 9648.0 9691.0 THREE 13816.0 SIZES 13716.0 9668.0 25c 2Scu5c9655.0 50c SOC15196.0 15896.0 16580.0 100 KOO16280.0 KOOBALLARD 17032.0 100BALLARD 12344.0 9939.0 1620.0 BALLARD 14056.0 SNOW 13964.0 1664.0 15236.0 15144.0 -1664.0 1148.0 15752.0 JIMENT CO COST 17404.0 14036.0 ST 14400.0 LOUIS 14268.0 15116.0 14980.0 15408.0 15268.0 15652.0 15516.0 ASOLD 15816.0 10663.0 16920.0 fs 14468.0 fsSOLD 10900.0 SOLD 13864.0 14516.0 RECOMMENDED RECOMMENDP16239.0 BY L1Y16116.0 BYw 16504.0 BYN L1Yw 12548.0 12700.0 11267.0 N 13128.0 13596.0 MLcroHnsrsoisr JOHNS01TSaxSfSON14152.0 croHnsrsoisrTHE JOHNS01TIJOHNS01TTHESaxSfSONTHE-2940.0 17372.0 15204.0 12708.0 12632.0 OAINESVILLE15072.0 13511.0 NATIONAL 16527.0 BANK 16327.0 BANKHAS 16532.0 13516.0 13496.0 14352.0 HAS BEEN 13832.0 14584.0 14360.0 MADE 15224.0 15088.0 15472.0 SPECIAL 15336.0 SPECIALUNITED 14371.0 15223.0 UNITED 1208.0 STATES 13584.0 15352.0 15256.0 DEPOSITORY DEPOSITORYPS DEPOSITORYrDEPOSITORYIrj-1936.0 17288.0 12816.0 PS Irj13236.0 13608.0 16384.0 Musinoss 13072.0 -876.0 16451.0 lIoII11 13644.0 14600.0 16396.0 14288.0 16463.0 14744.0 growing g1olug14632.0 15880.0 16487.0 very 15736.0 16008.0 lIT 16344.0 tI 16488.0 sail Inti16168.0 sailfactorily 16828.0 IntifUClolilJ 16584.0 16476.0 tlil tliltill factorily fUClolilJ14488.0 14784.0 16668.0 till15172.0 othelotllc115028.0 ways ciya15728.0 waysPortable 16339.0 ciyaft 16044.0 15Portable 15168.0 18551.0 18631.0 Portable 17184.0 Saj SajMill 17188.0 Sa SaMill 17464.0 18868.0 15608.0 19079.0 Mill Outfit OutfitTho OutfitThe-912.0 17440.0 16536.0 19096.0 16876.0 19168.0 16803.0 17079.0 19107.0 17036.0 fit 17179.0 fit1ho 19511.0 Tho1ho16260.0 19528.0 Brsl UstIfest16120.0 16696.0 mi IIIIIII16600.0 16976.0 Uili latlb16864.0 UiliKNGINES 17384.0 19519.0 Fa 17336.0 latlblxrlsES 17140.0 rib ribE 19864.0 KNGINES lxrlsES-856.0 16004.0 15412.0 19876.0 nIXES 16104.0 19884.0 19879.0 BOil BOIIW1fIBOIIkiiids 16928.0 BOilI BOilklll 16924.0 W1fIktods 1900.0 15152.0 20135.0 kiiids ktodsklll 15584.0 20188.0 Machinery Iachincry15876.0 17028.0 5232.0 20307.0 12280.0 12240.0 20360.0 rry rrr13012.0 12932.0 13048.0 13332.0 20380.0 20396.0 13732.0 20383.0 io 13568.0 20355.0 13868.0 14044.0 14124.0 iliad14496.0 20419.0 1111114404.0 lIIake14760.0 15348.0 20408.0 immediate immcdiate15272.0 16324.0 20424.0 fchipn Ehiptithiplllh noat titIlustratrd 4496.0 Ilustratrd 12848.0 20616.0 13320.0 12916.0 20636.0 13060.0 13296.0 20608.0 13400.0 20639.0 oat cat13636.0 13700.0 13800.0 u13804.0 OK 13888.0 14048.0 t14128.0 14104.0 t14076.0 20644.0 Uc 14536.0 20691.0 t14656.0 14724.0 run14624.0 14812.0 nC Iehave20723.0 jou15548.0 15808.0 20728.0 mone 20680.0 AUdr AIdr16232.0 Idr 16984.0 12624.0 LSPy 21012.0 OOMPA -2396.0 17040.0 21028.0 14972.0 21040.0 MPL 15416.0 11908.0 21319.0 41 12148.0 12032.0 12296.0 21340.0 Illth 12232.0 ith 1th12596.0 936.0 foryth Foryrh1orythSt 21396.0 13604.0 21415.0 21424.0 ATIAMA 16596.0 TIAf 17267.0 xmlns:ns6 ID26 8420 9368 21788 ns6:type 12316.0 ftfg ftfgSACKS 12736.0 22151.0 200 22315.0 SACKSSEED 9936.0 22335.0 SACKS -4752.0 15280.0 1728.0 SEED 15840.0 PEASl 15288.0 PEASlJUST -1648.0 17488.0 15863.0 PEA PEAS-1624.0 1248.0 22519.0 PEAJUST -1564.0 PEASJUST -1248.0 23484.0 JUST 12680.0 23563.0 RECEIVED RECEIVFn12096.0 RECEIVEDl -3352.0 16032.0 12160.0 24776.0 24791.0 12520.0 13256.0 24815.0 IN INEvans 13480.0 24891.0 13996.0 24868.0 13572.0 IIEvans 14096.0 25395.0 Evans 25403.0 Earliest EarliestPhiladelphia 25503.0 Alaska 15536.0 25631.0 16272.0 16144.0 25615.0 Best BesBestNoll 17344.0 Be 25803.0 Philadelphia 25823.0 Phila -1736.0 25831.0 lelphia 25859.0 Extra Extia11488.0 25884.0 Early 11320.0 Noll 12224.0 Noels Nolls13656.0 Exceljior 13504.0 Excel Exce-1208.0 26015.0 26104.0 14344.0 llor 26175.0 26079.0 Premium 16968.0 26047.0 Get GeGetBliss 17360.0 G 17191.0 26260.0 Telephone 12688.0 26391.0 Bliss Bli 26531.0 26416.0 Abundance 13280.0 Eugenia 15000.0 26839.0 McLeans 14136.0 26911.0 Advance AdvanceEYANS -1256.0 8608.0 27627.0 EVANS EYANSVANE27775.0 12384.0 SEEDReliable -2752.0 15632.0 27787.0 Lri1 -2744.0 Lri1Reliable -2740.0 16112.0 27859.0 11008.0 28527.0 Reliable uReliable1408.0 28695.0 Seeds Seed13240.0 SeedsL2lL -1408.0 14888.0 28699.0 SeedI 28651.0 8520.0 1168.0 L2lL 29071.0 29083.0 U29091.0 BOX 9616.0 10168.0 29100.0 29119.0 183 29115.0 18 29123.0 11416.0 29155.0 GAINESVILL13552.0 29267.0 29299.0 FLA 29359.0 PHONE PHOXB14640.0 29363.0 PHONEr 16960.0 17096.0 29347.0 30108.0 30147.0 15080.0



PAGE 1

Chil-drenjRIJIJThestwiI1pi-FrCASTIAPAQTADIACXA-CTWRITEiiiktULiDIAMONDNKCRKc-IENQOFSTEVENSHI-GHthe-ThirtyLongWhiskeyExtrabairUlillilYearsTHESignatureM1JGAINESVILLEDECEMBERn-gwOldestBoughtSouthHouseICEa-AgetabkPrcparationfTODA-YGOOf1rOOOOOODJtes800CheetMO-OSSjConvulsionsFevcrishlJerSUsePUBLICGOlIBaitlhSwIzin7-AgebnOpmtntMorpbJneStorageuverysvApefectfemcdyHaveTheCuringBearsNOVELTIES-CUTPHONOGRAPHSKinduptolatixiiiT-NaALTMAYERlargeGAINESVILLEquanti-tiesC-oialchoaAbstractFollowingSILVERWAREpreparedrorRepresentativesMeatsCountyYouArredondorepresentativesFAKMKKUaiSlQMpcbsAlaSFwrMJaeroLsomethingrepresentativesRoomthustoanty-inhairbulbshairfoodSeaboardiEetablUhedMh1t7ZWATCHESPresbyteriansReturnedChamberlainsKailrondJEWELRYFLATAUOf-11VTslmilati-tiogrecommendedOFFICERS-WillmosttalkedofdayOthersentertainmentsHAJSfsMiIgenuineGovernmenttD-CIIPItItIComrniKilonerChamberlainsimmediatelyappreciatingTHECongressmanAnticipatedaodBowelsVICTORIOUS720722724respectivelyInfantsImmediatelySPRINGSColdinFLORIDACHARMSproceedingsjwirtlrularlyplantsrespectivelyChamber-lainslasciviousnessVtlapproprlat-eyCUIKJHA-NliKODAKSinformationCHRISTMASstorekeepershealthycomplimentnUA1IH-INEWexpeditiousWednesdayisUsayGeoSUNFUNCTIONSresponsiblelasciv-iousnessFloridaaIJIrpda-UOftKKNTLTKYTuesday-andDistrictSignatureAyersanticipatedundertake-OnconrtTnlnjcacquainteddispositionMoneydepotInformationnourishRiotenthusiasticfflmitoonlninterestingrecommend1907handleimpor-tingPHKtAJDintroducedCHAINS1HKIAIDELONGSrespectiveGainesvilleEDISONVICTORcommitteeIrnpartlafCo-twxqKcolleaguesplantpartlrularImpressedGainesvilleInstallationremainingappointedEverybodycatnlocuinstallationThursdayEpiscopalGovernmentarraignedof-SARSAPARILLAunderstoodTOILEToduchtlonulrefundingtrafinactedprominentSecond4consolationGainesvilleThursdayIlilverhltybecomingWRITEGainesvilleFCPltFw4testimonialdifferencesfallingoccurringdistributedtppttprescribecontinualrsibtltttGainesvillearraignedYORKJ-OKXIHKChristmascompleteproceedsdruggistslGUlargotflErIOChristmasbrilliancyanythingproposedVigordcclnrhiK1IorTkeepshndhflnCongressheavyprOIIpU-jGLASSMethodistCdruffUthandsomeChristmasanxiouslyapprovaldetermineRefundedW4u4jMeatsCottonXIKKBH-ritt-fXrKfGreenvillehlINTCIicompleteappearanceupendingbronchitisMcClellanMAYORSMrClellanhouseholdHCongressillegalSLEEPProminentStrenuoussecretaryreligiousChristmas1appealedotherwiseChargedGainesvillewhiskerappealedrtlflcd-Tnalclaimed-Itgartrte-14UrhlldrejiirotapUyhoardcollectednohodyxprovideconcealedclaimingcarryingsentencedLossillegallyex-citementmorningFridaysPresidentPEOPLEMASONSessmandtgnretttGoodsIIlaalt1afternoonillegallyap-provalWAREContestedHeavilyinstancespracticenmounjLsecretaryTuesdaygivesscalpmeetingyourselfafternooninterestsThroughGrangerchurchesstatementJoodnwithdrawCushmanpresentChargedparkXrbeautifulJtIWforcollectedbanquetiretllenteveningHoner-ndlllitltlFRemedyapparentobtainedJtemedychargedAbovevxrrhoiMrightfulmeetingJanuarycollectedstatementooointerfereKnowlerafternoonmeasuresattorneybssiaetsensuingSponceriula1WestRemedyeveningNatlonaJpubliclyfaclllUprovidetroughConslivTHEfjrjuilregridironattendedpleaaedpositioneveningattendedclaimanttenderedstatement1tr-eiluacollectedagainstbrrouxcreform-edchargedbuiltBaptistpresentsmakingStateoptnt1KhfntnafkoturvrtrightfulWRAPPCBSundayKenenilattendedSundaymatchedtreasurerIllegallyIVictoryfriendlygorornorremedychildrenattorneychildrenSabbathresultedafflictionreceivedDistrictCloselyevidencepleasedAmericadeferredThenRevenueInstalleddifferentthoughtRifnitinn4-OntroubleschildrenappearscnrtifledJ1ulinKpermitCOURTJ-i4itbJStisentenceISAndonlytreasurycleanTrinityharmfuleveryoneAbstractremedywithoutmeaslesduringiptdllyCommlsFootballAlachuaplentySecondlongestchildrensellingcoouinSchaferGrahamBlufftonroundedreaderschildrengallonbecomepeopleLiquorsessionTuesdavjustsocietyDangerherebytllOotlongherebyelectionwithoutpres-entspeopleopiateJan-uaryenactedamtoanrgrowUnitedmonthsKoleyiitwentHairrlfHiicutELECTpeopleFeedAskingClaimsThanksonesIpublicweaponspassedplayedlongergivewhatbitwcendartergivingCoughevenlyfamilyForClaimsAtfti1LSavehaverrCTrJRn-JIlLnvPound-SrecordsronicbfootballliquorHappygallonchargeamountsbannerpersonsyourconsenttnrmtlonColoredrteIn-sistedmontliHsimplepersonsdegreeWomanofficersFloridabuydoctorsaccuratefcertalnchurchhandleHasCOPrOTfollowsAIIIOIIKbria4spulledpjfrr-toLodgeyellowelectedofllcersF1tUcetUU-wtthingsfromcoughjtueutsofficersworth-AAffectschurchEstellechurchcol-oredpassageIriehow-everserviceclaimClaimsBeingdoredsidlesRobertMcClolrattedCoughchurchschoolCTUJHUUMBMHHAa080U-8fiandSenateseveralearliercountyCLrRFrankcertainknownAndHIF-trshearthRoyalplatterCoughlhltornUklnrfootSimiletimalTOWNcircuitSchoolNightqoartInrwthairpersonslicensesettledVisitordmrnnfamilyfamilygoodscantataStatetUnionbeen-edliberalattackownerswhichnltedinle-byhairmakesSchoolschoolrnulrdo4eynIvxisnAdviceTaxInltwlprettyManyquickcontextStatesfuKhandTEAMrightUlankTlsliyWhenYouStatesPublic1rhdoingknownClarkDallyegressothersgivenantsquartwhichusefulStatesprettylikelyStatesschoolschoolStatesEvansfromeonohonxduringAboutFLAbeingwillpr-teiiUimoreWhenJobeHbeingWhenWetSeastopStateswhichWhenWhen111-IIIWhenhasdrugsbeingundercountEffortFIJIwhichwhichearlylungsHollytiwhichsuccesstGrTheyii1twhichWhenStateswillYouwhomhouseIn-nitvewant-tobeingthemoralWhenwhichCanIliaClausbeingwhichHutchwouldwhichtheownerssuc-cessthowouldCHRY-cshownMadewAsWhenwantandwhichWhenquiteSantagoodsixtybeingFinedI-fafJNorthHomeihoeightheardyoubetterStatesNorthJoliCHandNorthothershineNorthwholesecrettopiclivelandeffectunionTownandandlightreliefFromCourtkingltkst1HomeStateslobeaGalnelegalfailedhomehomeandyougoodHallelvnninBoysHolyCourtTownTownXmasi-FourunionwomanTimeStatesOscarwhenhomoutlShomofurltheremuchyearsheirsWithshowbabyoldertherewhenHoldrerenahomehomeironicbabyFirstandgpostPureoperawomaneverytliTOthoseFromtiltsaveusualshallmanyHighFocrtheyfealiiGamerltthiclerkyearsoUwgoodtheirUndrrMIUMMMHHM1864-UHighJulyThattheirfavorDukeshallteamsmanydaysTreeRWtMiowngoodwhenFirsttheirlaterCourtnowtbfrtrnonandMadecostslittlegameyearsafiTert11ThisnowofilcehavestoresshowclerkFood1276shallFreoRaylittletheirmostheirsthrotyrsteamsyearsfromwithRichboyslifeTHEtbair1G4theirfolksforSamegamecourthavethethesldscloseshallArchtheirpartyshortcourtItlflevygivefilledtbPfrwantshallruralbondparrasnfirmsStatemiltntinrtIrffthotherepreventpaidpaidthernfromnewRobtfuelsTueswrt-rtttJulytheysuchgamenewHolduntilThisfinedtiredpartcomestheEallseveretaxestamecufftaxesjtafterfinedlaterOhiohavepastpastshallHnofHeldFouruponuponThisathytimeHavesuchtimeyearsllumCHUiUSlIrJr11siTHEnessextrawhatfromfromfundlocalrraatcityVklwantwantstatetotallunggetcostswithcostsextramostThisjbelawswith1863FI4rlrtwoucheachPnrwithWoUTatwithdatewithuponCardhavesameThecityfromAbothbothwitharidthatsame18681863withwithfiledbuttewifewithtarysuitsyourhaveTinsdatetimeheldalso1868Initwelluponandsuchyearvainheldwentcourt18641866beenyourveryyourbeenheredayweretakeherethatLawpastFullfrninkindICthtreewetholdthatOoonsuchholdcity1SG2heldhererjuadayfromSoldmonetakeWmmostrfd1S671SG3wifetimewithcotssaidalsocoWmaywithcitysemisomeottonCujtHJUIUvlllek-IsaidruleThecoldwellbestmodcoldIsaleactsISCwellpostsluarBigwhoalsogirlnithvisitwith1SCSfourOUthisthisseemforthisThethatthatoverPILLSthatfirsthallUnisadOFdiergltsafefirstlorebullendtineSuucom-itsameeuro1rjcanarnxalreula121thistownandOilthis1M17Thetreeverytiowillwollandwhocoldtoo1S66andandscoresageTheThewelltreeoiubigandandraidfMlthatwillthisthishimwilltillswhowayThoTheandtreewerethateoinubeetvln-ltandflueandandwillandandandweretrrafactwar-sandwillA-jsweremerthadtollandandhallandandandantfullandthisOBMTAUiblefr-latheshefullandandandfindandandfactSunariaSellandTarattdofofbillLeeyouandthatTlicIf4KoranditeAwillandfcCLUllsaldandyoulikeury-ftheMrandandhadnmlandlinefeelandandhasandandaddForthehasHyandandIngtornurwratand-andanJandandandandfeltandweretheSeclawandandandanteThoCeosizebillandlastandbadandandandtbrrBUItheandlawfhetheTitandandbillpreyandmaycureoftitgethasthetxhadtheyhMadelawhadThandandnaillineandtheSunthetheAytrthecaseOurTarkIt-opeayoufullofherthethehasrindandthethethetherayandiiuraYWie-kyouthethethethethetheandyoutheyouthethetheintwoanythefullWethethethethetillthetheIndthethearetheilisetnittheputoldtwoeverintnishefullthe500caseColthewasproaukpeoyouyouthethethethethethethethothethethethethethethethethethethethenotherthinthethethethehassentthethethethethesetthethethethethethef1-tyoumanwasfterthethethetheColhutWegotthertoldwarewasthetaxtwotdIthefullthetitthethellatheMiltinhisthethe1r1Kdidtheoldagojl4fthetheactonfiTtiltaumtlywartftfunthewasoutwasthetintinrjcTOStdiethehistoHfISythenottheforacttotwasMrAltobillbyfortheaidtJtbytryanonIiattitforforcolsalforactsforbutwaswaswasnottheoffor1stHewasbydudIanhisforIngonethewaswasmwaswasbyKIforSItforhisbinMrCotaxtaxlowdalHeforforforbyforforwastanonebyetcinrfor3forcolonMrtheourareallniltaxlA-etnotforbyoneNoToMdaletof-IitsHeroartryallftITCbyforledth-rwayallitsItsdoonebyiwrIthallairbyemsourareGoMsatyoareTMiVUMHnoffItsbebatruRedoWHUTaMtItsIt1VWraiWboLoad-ntIIdoisMbytoAl1dobeadas-sheIIteniWupapIttrbehego6OofSofgouptosntWbeMtgoofINWofgowofofMgoWmebeoftoofofofoferrgoINof-tofofofatUnreofofofgoinnofatthitgontvrrttobtittoofofofofof41ofofofofUilOit-sofatNeAtfIttOtTWIt-tdinIl1equofofofInXMawofofJeofnanofofofatatewitnoanJloonontainofofofoftoofofof1Lofofatofoftbofprwoontl1ofininofIIIntioftotoatatofhatitbnorefsyinintieMintoonInininIlloftoontooftooftoJiatatatmonononoralinininIn4rasasininInoftoisthtltilltotototototounonoras>IsisofIntotoonistototoonasUiasnsoronInInInInInla4ortnoftatoasonitOasasasorortoisitInUfrInInanoftoaltotoasasANisInIHofinti-InttoCof4IKIK1iAvTItl-NNIstol-etoIHIHNRTItFItrxstUhKitItKIIlrIt0iCtoin1rCAllItbrsAKBSWIt1jsIfirDUdt-e1INjfyJ>ifMYitt1aMIv=5JXa>a1nnaracnatarInaeeisrinna11rt1JxKf>hV>asrrwiII7atfItgrJIIIylhIrt+11ItraIft>Iii1riwsI1>ttajIIefttItj+iiIrnIJ+rV3y>7JJi>aIr+f+>J>f1I1+s1sivI++fli>iir1J04a1IiIpn


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN00034\ocr\0483b.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:11830
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1794
splitwords:0
ScansoftOCREngine Character Count:10857
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:12308
Abbyy6OCREngine Character Count:12248
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;12248;2197;43.1345;88.4749
language:en
ScansoftOCREngine Predicted Accuracy:64.09%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:4515
ScansoftOCREngine Character Error Ratio:0.4272
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;12308;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:88.47%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:88.47%
ImgPrep Component Range:10151,11830
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;10857;4638;0.760431;64.0904
noPunctuation:1
ImgPrep Component Count Low Estimate:10151
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 24.0 ID4 10.0 ID6 35.0 ID7 26.0 ID8 17.0 ID9 14.0 ID10 11.0 ID11 12.0 ID12 9.0 ID13 7.0 ID14 13.0 ID15 8.0 ID17 18.0 ID18 42.0 ID19 25.0 ID20 15.0 ID22 28.0 ID23 21.0 ID25 4.0 ID26 32.0 ID27 16.0 ID28 29.0 ID29 38.0 ID30 43.0 ID31 50.0 ID32 36.0 ID33 23.0 ID35 45.0 ID36 20.0 ID37 69.0 ID38 30.0 ID40 51.0 ID41 33.0 Layout Page ID1 HEIGHT 31312 WIDTH 18724 PHYSICAL_IMG_NR 3 PRINTED_IMG_NR 2 PROCESSING PrintSpace 31032.0 18283.0 HPOS 264.0 VPOS PC 0.8847 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1664 17635 636 8 ns1:type simple language en TextLine 48.0 60.0 17835.0 String CONTENT n WC 0.8095238 72.0 80.0 636.0 g 52.0 18175.0 672.0 a 128.0 17603.0 668.0 736.0 108.0 132.0 756.0 1r 76.0 18123.0 776.0 1 SP 17323.0 800.0 68.0 18191.0 yl 40.0 18151.0 344.0 6856.0 5320.0 1328.0 STYLEREFS 268.0 640.0 1340.0 THE ALTERNATIVE TIE276.0 2088.0 6064.0 GAINESVILLE 0.95238096 104.0 5960.0 260.0 868.0 1336.0 GAIN GAIN1-2088.0 8152.0 1208.0 6940.0 1332.0 SVILLE SVILEE6932.0 592.0 8296.0 SUN BUN148.0 8148.0 336.0 1704.0 9152.0 DECEMBER DECEM1ER8888.0 1164.0 DECEMI -1704.0 10856.0 160.0 10516.0 1356.0 + 200.0 10316.0 224.0 10628.0 R 10596.0 11020.0 1360.0 168.0 10852.0 208.0 136.0 11192.0 ft 11152.0 176.0 11280.0 1388.0 i 0.82539684 -48.0 11328.0 252.0 580.0 11596.0 1344.0 1907 1915248.0 1348.0 -580.0 12176.0 232.0 388.0 11788.0 H7 88.0 11700.0 xmlns:ns2 ID5 28055 2980 264 2088 ns2:type 516.0 1744.0 456.0 488.0 2112.0 NKCRK NKCRKcIENQOF -1336.0 1792.0 420.0 324.0 460.0 2184.0 NK -1332.0 448.0 832.0 960.0 2108.0 UK CLARK784.0 392.0 1136.0 2152.0 E -656.0 408.0 1968.0 IS 700.0 1268.0 ISFRIEND -232.0 2200.0 404.0 2092.0 ISFRIEN 576.0 2416.0 760.0 2632.0 928.0 2696.0 FRIEND FRIEN536.0 1364.0 2672.0 cIENQOF -928.0 1688.0 396.0 140.0 908.0 2740.0 -1216.0 2124.0 416.0 312.0 1808.0 OF 0.96825397 1048.0 424.0 820.0 2228.0 2640.0 PURIIIesslnan 2120.0 432.0 944.0 2232.0 PUBLIC PURIII-816.0 3048.0 PUBLICessman -944.0 3176.0 152.0 3240.0 3112.0 1essman -4.0 3244.0 332.0 3236.0 3284.0 I 1I -8.0 320.0 2764.0 480.0 3440.0 180.0 628.0 3580.0 essman esslnan188.0 436.0 1188.0 3512.0 from 1108.0 1692.0 3460.0 Second 1624.0 768.0 District lstrctDistrc84.0 2332.0 Districtants -768.0 3184.0 156.0 3452.0 D Distrcants -156.0 2572.0 124.0 3576.0 3052.0 iants 2504.0 372.0 3763.0 360.0 3884.0 ants 204.0 596.0 3836.0 Cotton 732.0 196.0 376.0 1504.0 3800.0 Tax Tag1416.0 912.0 1964.0 Returned 1880.0 ReturnedjELONGS -912.0 2876.0 ReturnedELONGS 3768.0 2792.0 384.0 4323.0 4400.0 ELONGS jELONGS244.0 4376.0 TO 1140.0 400.0 1796.0 4348.0 212.0 1584.0 764.0 2412.0 PEOPLE PEOPL216.0 2196.0 PEOPLEa PEOPLa-764.0 272.0 2820.0 356.0 4856.0 5024.0 780.0 508.0 4960.0 Strenuous strcnuouo428.0 144.0 1376.0 4900.0 Effort 1288.0 1944.0 4884.0 Is 1856.0 172.0 468.0 2168.0 4876.0 Being 92.0 2076.0 Made Mad2636.0 MadeHave -436.0 MadHave 2264.0 980.0 5108.0 5208.0 Same 5151.0 Refunded 1404.0 5172.0 -780.0 2364.0 564.0 1800.0 funded 2552.0 5140.0 by 2912.0 5124.0 the thesage -264.0 th thsage 3068.0 164.0 1sage 240.0 2808.0 5247.0 Have 5288.0 2424.0 812.0 Ithern 2728.0 5400.0 Many Manythern -448.0 340.0 5404.0 Man Manthem -340.0 5424.0 316.0 5536.0 sage 836.0 5480.0 of 100.0 1076.0 5452.0 This 984.0 1548.0 5431.0 BUI 116.0 1432.0 1056.0 BillAffects BlllAffects-268.0 1816.0 2024.0 Affects 2604.0 184.0 5736.0 5780.0 thern them484.0 920.0 States StatesFrank -484.0 5740.0 StatesD Statesn236.0 2804.0 364.0 6000.0 6132.0 n664.0 6043.0 Frank 440.0 452.0 6008.0 Clark 1132.0 1128.0 2040.0 Congressman Congressma1788.0 Congressmanthe Congressmatte-1128.0 3168.0 2704.0 6192.0 6312.0 tte552.0 712.0 6259.0 6232.0 1264.0 2116.0 6220.0 is 1984.0 6208.0 continuaking 2248.0 792.0 2336.0 continual continua-732.0 continualoking -792.0 3128.0 continualking 352.0 6424.0 6532.0 king oking380.0 888.0 6500.0 after 120.0 256.0 6468.0 724.0 1776.0 6448.0 interests 1644.0 6431.0 2500.0 2928.0 his 2800.0 hisjtueuts -244.0 3172.0 hislueute hi hituents -148.0 3076.0 2824.0 6656.0 6756.0 jtueuts lueutetuents6711.0 He 892.0 1456.0 6692.0 has 1352.0 896.0 1844.0 introduced 112.0 1732.0 2856.0 6680.0 set sevsevesevmeasures -324.0 3180.0 sevemeasures 3124.0 6684.0 setmeasures 6880.0 6984.0 measures 1192.0 at 1084.0 6920.0 620.0 1824.0 6896.0 present 1708.0 2556.0 sessiougresseone 2444.0 616.0 2560.0 session sessio-504.0 3064.0 sessionDngress4one -616.0 sessionegress 2892.0 7108.0 972.0 7192.0 Dngress4one ugresseone7215.0 egress -908.0 1324.0 one 904.0 1420.0 7144.0 96.0 1684.0 7128.0 1576.0 2052.0 7124.0 most 1948.0 680.0 2564.0 import ImportIimpor2456.0 572.0 importing -680.0 Importelng -572.0 3136.0 496.0 7112.0 imporeing 44.0 3140.0 7164.0 3060.0 7256.0 56.0 2812.0 7332.0 7428.0 ing elngeing7444.0 696.0 948.0 7384.0 bill 1296.0 7387.0 to 1204.0 1540.0 7348.0 provide 1448.0 2260.0 7344.0 for 2588.0 2492.0 2956.0 7360.0 re reoreIng -216.0 reog -176.0 3132.0 r rg -80.0 3036.0 2832.0 7552.0 7664.0 Ing 7688.0 548.0 7635.0 860.0 taxes 772.0 1368.0 7580.0 illegally i11egallY1276.0 744.0 2128.0 7556.0 collected 2032.0 2980.0 2872.0 byCnited -196.0 bynlted b bnlted -92.0 3072.0 2844.0 7775.0 7860.0 nlted Cnited7844.0 1024.0 1488.0 7792.0 Government 2608.0 durinfter 2512.0 568.0 2612.0 during durin-452.0 duringfter duringter-568.0 2760.0 8008.0 8104.0 fter ter752.0 8072.0 676.0 300.0 8084.0 war 992.0 492.0 1492.0 8032.0 which 2068.0 8011.0 bi11284.0 2784.0 been bee2700.0 beened -396.0 304.0 beeed 2748.0 8252.0 8316.0 ed 964.0 8288.0 840.0 876.0 committee 192.0 8268.0 on 2208.0 2852.0 8256.0 2616.0 warbs 8259.0 wars warthe 8264.0 wa 8552.0 bs 8580.0 s 9-52.0 2664.0 512.0 8676.0 228.0 8756.0 8711.0 information 740.0 1952.0 8699.0 1828.0 2236.0 8688.0 readers 3012.0 ofjgun -164.0 8679.0 ofSun 8716.0 c cSun 3092.0 2880.0 296.0 8908.0 348.0 8952.0 jgun 8996.0 Sun 644.0 804.0 8959.0 1156.0 8944.0 648.0 1536.0 appears appear2304.0 8912.0 in 288.0 2584.0 full 2452.0 2996.0 8936.0 as asTS1 -180.0 8940.0 ass asbill aS -96.0 abill 9247.0 TS1 TS1bill -152.0 -100.0 9399.0 220.0 9463.0 9468.0 9436.0 prolde1664.0 9428.0 1564.0 1996.0 9416.0 1896.0 2344.0 refunding refundin2252.0 refundinge refundine-836.0 9628.0 9740.0 e 540.0 9667.0 rightful 9699.0 rl 1120.0 rib 796.0 1tful tful720.0 584.0 1224.0 9679.0 owners Oimers9635.0 their 2468.0 heirs 2992.0 9660.0 o orepresentatives 9656.0 or orrepresentatives -184.0 orrepresentatles 2744.0 9848.0 9883.0 representatives representatles9868.0 1636.0 9856.0 proceeds 3008.0 2904.0 ofotton -168.0 9851.0 9888.0 otton 3100.0 2816.0 10072.0 10160.0 tton10140.0 tax 652.0 1100.0 10099.0 1028.0 10084.0 1752.0 10080.0 2836.0 theStates thed thd -160.0 10300.0 10367.0 d 10364.0 476.0 368.0 10340.0 1044.0 10320.0 1524.0 532.0 2000.0 10308.0 people 1892.0 10303.0 2532.0 theal -260.0 2732.0 10527.0 10588.0 al -36.0 504.0 588.0 10580.0 1160.0 10564.0 In 1064.0 1392.0 10548.0 1736.0 10571.0 years 1840.0 ears -344.0 2276.0 1863 1SC32772.0 1864 1S6a2620.0 18641S66 3116.0 328.0 1S6aISGG 10760.0 10804.0 1S66 1566ISGG872.0 10787.0 1S67 18671567728.0 10780.0 and nnd1196.0 10768.0 1868 1580.0 2180.0 2036.0 2480.0 10784.0 pro prcprofor -272.0 prcfor 10984.0 11035.0 624.0 11023.0 556.0 924.0 11000.0 disposition 856.0 10991.0 such 2044.0 11011.0 2488.0 11004.0 may mar2736.0 maynclalmed -352.0 11008.0 marclaimed ma maclaimed 11239.0 claimed nclalmedclaimedIt nclalmedIt-648.0 1008.0 2648.0 520.0 11424.0 11475.0 It 604.0 11456.0 enacted 1472.0 11448.0 1784.0 11443.0 1660.0 2172.0 11436.0 Senate 2868.0 anel11428.0 anda anele-300.0 11463.0 an ane -188.0 3056.0 2924.0 11652.0 11800.0 11740.0 528.0 11699.0 1312.0 11664.0 Representatives HepresentatlesRelresentatlves11660.0 2084.0 Uni 2712.0 UniStates Unitats itatls 11888.0 11924.0 11940.0 tats tatls-348.0 828.0 11912.0 748.0 11900.0 America 11892.0 1740.0 Congress 2944.0 asled 2948.0 11964.0 iled 12131.0 12143.0 led ledbat -200.0 12148.0 ledat Iat 12332.0 12376.0 bat 12379.0 -132.0 560.0 12364.0 t1w968.0 12344.0 proceedings proreedings880.0 2028.0 12340.0 1936.0 12335.0 2536.0 2976.0 12355.0 onn 3164.0 12360.0 orn -136.0 308.0 12551.0 12640.0 > 12627.0 12576.0 Illegally Ulqallrtlltgally716.0 12568.0 1124.0 2020.0 12564.0 1924.0 2496.0 2408.0 2840.0 12583.0 pea peolIeo2752.0 peothe -284.0 12588.0 lIeof peaf2796.0 12775.0 12819.0 f 12812.0 thp412.0 12796.0 several seeralsperal1460.0 2060.0 12787.0 2312.0 12784.0 2216.0 2656.0 Union Unione Uniontie-508.0 12996.0 13043.0 tie 13087.0 -76.0 13028.0 1756.0 13016.0 1552.0 13008.0 1916.0 2592.0 United Unitec2384.0 UnitedBS UnitedsUnitecs3160.0 13227.0 13296.0 BS -60.0 13259.0 1200.0 13247.0 1060.0 444.0 1588.0 13271.0 1452.0 2224.0 13232.0 18611S62568.0 1864U 1861N t -40.0 t1c7 2720.0 13448.0 13492.0 N 632.0 13475.0 U 13480.0 isn 708.0 1rj 1c7-228.0 13468.0 1228.0 1748.0 13463.0 18G81SGS13455.0 under 2096.0 2864.0 andrlrtw 13452.0 andIrtllt 13460.0 andIrtu 13679.0 13716.0 rlrtw Irtllt13720.0 Irtu -332.0 13752.0 13704.0 nt1180.0 13691.0 1020.0 13696.0 acts 1424.0 13684.0 2396.0 Congressrnulrd -772.0 Congressh 2776.0 13900.0 13927.0 h 612.0 13920.0 rnulrd 13959.0 rlt -564.0 1176.0 -144.0 nried 864.0 13956.0 l -312.0 956.0 lld 64.0 1300.0 13907.0 2008.0 levy 292.0 2464.0 13903.0 2352.0 2884.0 col coI2756.0 colof coIn coln14124.0 14188.0 14156.0 Jf472.0 14143.0 14151.0 1760.0 14131.0 anelwblch2056.0 2828.0 said 2684.0 saidacts saidts saidcts 14352.0 14391.0 ctsts -120.0 600.0 14404.0 ware Irf 1072.0 14399.0 -116.0 14411.0 -32.0 14364.0 passed 14355.0 July 1724.0 2320.0 14360.0 1st 1SG2 18621SG2TMi 18627th 1SG2tit 14571.0 14595.0 TMi 7th608.0 14600.0 tit 1G4 940.0 14591.0 04 -220.0 1280.0 G 14588.0 1412.0 Tul 1836.0 14583.0 ICth 13th1632.0 2176.0 2016.0 2324.0 14580.0 1866 186C2860.0 2668.0 andb andn-296.0 3156.0 14787.0 14819.0 nl nt14848.0 14816.0 1M17 14824.0 1-320.0 1068.0 G7 14804.0 respectively respectlely14796.0 shall slmll14799.0 be lxbetd beIItd lxdud 15020.0 15040.0 dud IItdtd 15060.0 15032.0 1912.0 them15023.0 theirr theirfirthemr-408.0 464.0 15244.0 15296.0 fir 15323.0 15268.0 dal -124.0 1272.0 1152.0 15256.0 presentatives15291.0 rIIJI -1272.0 15308.0 1212.0 15300.0 1252.0 sntatives 1568.0 15259.0 tctolend toend tcettd 15463.0 15472.0 lend end15492.0 ettd tt tl1 816.0 15536.0 +-24.0 15531.0 848.0 15487.0 Court Cflurt15480.0 Claims tlalms1640.0 2376.0 2288.0 hereby herch544.0 15475.0 herebyi herebytaherchI -544.0 15696.0 15743.0 15716.0 ta 15703.0 nith StithItlt complete 1728.0 15699.0 furl jurisjurhjurisDU jurhnfurlU-392.0 15920.0 15964.0 DU U-68.0 15952.0 10 to-84.0 15927.0 luar hllr1148.0 ir 1292.0 15944.0 15939.0 try 1436.0 1908.0 1764.0 determine 2204.0 determinefealii -848.0 determinelain determinelair16119.0 fealii 16143.0 lain lair16148.0 that 1316.0 16183.0 blfiled flied2428.0 2848.0 16140.0 this 2708.0 thisIt thislf16364.0 lf16372.0 sald aldatd16391.0 court 1648.0 16387.0 1960.0 16367.0 prescribe prescribe1thefr -256.0 thefnr thebir 16588.0 16592.0 fr fnrbirfrla -192.0 824.0 16632.0 inn 524.0 16595.0 slmllll1812.0 16600.0 952.0 2212.0 expeditious eXIedltfousexpeditioustl eXIedltfoustillexpeditiousd-952.0 16811.0 16819.0 till 16856.0 u -28.0 16824.0 tl 1004.0 16851.0 1052.0 16848.0 nt 1032.0 persons pflsonsclaiming 1972.0 2988.0 asr asIast 2780.0 17040.0 17067.0 17047.0 17096.0 17075.0 rs -56.0 hHrshllrslegal 2064.0 2676.0 17072.0 repre reprem repreIrepreV-440.0 932.0 17263.0 17303.0 m rtV17312.0 -104.0 1116.0 Y V17268.0 have 1184.0 lIa -372.0 17300.0 ye till2292.0 17276.0 platter yiatterlJIattCI2140.0 ofs ofIofheard 2652.0 17484.0 17524.0 17492.0 1j 17519.0 884.0 17559.0 17551.0 iptdlly iluudily1876.0 17487.0 heard 2340.0 ad udadnit 3108.0 uda adaadtudImmcdl 17735.0 17932.0 17956.0 1016.0 17939.0 nit 17944.0 1040.0 1544.0 Immediately 17936.0 Immcdl -1028.0 2192.0 1tel 17964.0 upon ullonneonuponin ullonjllneona-400.0 280.0 18160.0 la lalo -128.0 18168.0 jll18200.0 1476.0 18195.0 1668.0 law 1556.0 tillCommls ConunisCommlsrial CommlsrConunist-664.0 18376.0 18396.0 18387.0 rat rial18416.0 -308.0 1236.0 Revenue ReCI1IHHlmll2188.0 18411.0 com comit coma-328.0 18603.0 18620.0 18627.0 it 1232.0 1408.0 18615.0 fr111904.0 18607.0 thl2284.0 records 2164.0 ofI ofu2908.0 18784.0 lo 18843.0 18828.0 4 I18868.0 II Mti 1256.0 18839.0 1380.0 inr -20.0 1304.0 11 18831.0 nmounjL 1988.0 18871.0 -632.0 anno monn -236.0 ii offrom ofJ ofI2360.0 19052.0 J I19055.0 IollleofiTount ofar oft 1956.0 19280.0 19312.0 ar 19320.0 -112.0 19300.0 count iTount-488.0 1832.0 1468.0 01lI 1772.0 1940.0 19283.0 2220.0 2100.0 2600.0 19291.0 2476.0 2968.0 oni onfonn19499.0 19507.0 660.0 19519.0 704.0 19504.0 if 1080.0 -248.0 19531.0 1860.0 19536.0 el1rs 1SG3 1563ISC lSG18611861anI -336.0 Iand 1104.0 19720.0 7 1244.0 19723.0 anI19728.0 1SCS SGSISGS1012.0 reSIectlcl1680.0 respectivelyI reSIectlclIrespectivelyt1-1012.0 3120.0 19944.0 t1 1168.0 lre 19976.0 iv It1512.0 1604.0 19947.0 thin thntho19983.0 same 1864.0 19951.0 h2380.0 posts postsV -356.0 possl lIosfllposslf lIosfllth20148.0 V 1372.0 20172.0 1528.0 20167.0 20204.0 -640.0 20207.0 1928.0 rsons 2072.0 20175.0 firmsfrimn firms -416.0 firmsfrnin firmsfroll 1284.0 20396.0 20399.0 frnin frollfrimnwhom 1656.0 collectedt col1Cchdcollectedamounts col1Cchdamounts 20600.0 20635.0 amounts aulounts2372.0 20619.0 20651.0 am -288.0 2660.0 shal1shalls shallJ-388.0 shal1tll shallsal 20807.0 20839.0 20892.0 sal tll1712.0 20895.0 -172.0 1884.0 20843.0 1888.0 2692.0 ofilce olllceofilcefull -432.0 0111 olllcefull 2920.0 20880.0 < 3040.0 3000.0 lflin -64.0 3104.0 1652.0 21059.0 flin21064.0 comlllet1768.0 21067.0 andi -292.0 21283.0 21332.0 1520.0 21288.0 Iwith 1852.0 2404.0 2300.0 -252.0 21323.0 clerk clprkclerkClaims -420.0 clprkIalnts 21507.0 Ialnts21511.0 2716.0 21524.0 state slahstateible -404.0 slahIbl stateIble 3088.0 1596.0 21727.0 21796.0 1600.0 ible Ibl 1976.0 21731.0 all 2484.0 21764.0 2400.0 personsrfd -636.0 21767.0 personstld personstad21951.0 rfd 1516.0 tad tld21988.0 ns axIl 2144.0 au21979.0 accurate Itccnrnteaccuratea -716.0 Itccnrnteollnt accurateouut 1384.0 22180.0 22199.0 22204.0 HJUIU ollntouutdue flue1992.0 du 2392.0 22215.0 peo peoStates -280.0 peotatcR peostates 22396.0 22411.0 tatcR 22403.0 2268.0 Init 2528.0 Cnltd LnItd2964.0 Cnltdit LnItdt-540.0 22408.0 dnt 22555.0 22635.0 -88.0 22615.0 illegal Illcgai2012.0 22644.0 2628.0 taxesTat taxat taxest 23039.0 23043.0 Tat 23075.0 23064.0 23067.0 1616.0 1720.0 ComrniKiloner ComrnltllonerComrnisslonerofH1240.0 23283.0 23320.0 H slutll23315.0 23291.0 23327.0 sameth -424.0 sameh samerh 1804.0 23507.0 rh th1428.0 Ual23516.0 okrkc1lrk23519.0 2472.0 tho2768.0 thoi thertht 23735.0 23772.0 trcnrtifled nlft11crtthed23764.0 Cr 1676.0 0.0 23752.0 statement stnternln1716.0 statementi -828.0 23759.0 23956.0 23988.0 isidles soaioii24020.0 lon 23983.0 two 2544.0 23968.0 2388.0 23963.0 hitsthisof -304.0 hitsinch -240.0 24167.0 24211.0 1608.0 or24187.0 ouch 111hinch24204.0 stntlnlutstatementr stntlnlutr-832.0 24403.0 24428.0 t1J 24411.0 Inltwl rnltpdCnltetlInltwli rnltpdtCnltetlI24619.0 24647.0 therelyhtflhy2240.0 24631.0 approprlat npllroprlntnppropriatapproprlatey npllroprlntfynppropriatcy-864.0 24848.0 24875.0 ey fycy24851.0 tho the692.0 treasury trensurytrPflsur2356.0 trensurynot treasurynot-692.0 trPflsurIi 25071.0 25099.0 25108.0 Ii 1320.0 25087.0 not otherwise 25115.0 ap alrni 3004.0 aplual 25123.0 25291.0 25319.0 -44.0 rjua lual qual25307.0 25300.0 thl2280.0 total lotntotaltid -368.0 1tld 1920.0 1248.0 25511.0 25516.0 aid tldtid25531.0 sUtteUlnt1848.0 soften 2548.0 25548.0 tnt 2936.0 25523.0 forthp forrl for1r1K 1672.0 1444.0 25735.0 1r1K 1500.0 25767.0 1612.0 1572.0 thplhf2104.0 25775.0 semi25779.0 25747.0 2436.0 25743.0 fulli fullr1fullnid 25951.0 dored nid25983.0 -552.0 25956.0 r1 25995.0 red 1780.0 25963.0 2508.0 25968.0 CourtirotapUy CourtllOID Courtttpthy 1592.0 26187.0 irotapUy ttpthy26211.0 llOID -744.0 -316.0 Ur 2448.0 paid rtald26219.0 2788.0 26239.0 thr thpthp4ocur thera 26411.0 26427.0 26431.0 ra M 4ocur 1700.0 26435.0 urw urer2132.0 26415.0 ottbo2368.0 tb tnirrant tni entnirraat Irraftt 26624.0 26635.0 rraat rrafttrrantdmrnn d1Iondr -528.0 26663.0 2244.0 26659.0 twn 2624.0 26667.0 thof thpthpor ther 1696.0 26843.0 26875.0 or1932.0 26851.0 each lachsuchclaimant clattnuntclaimantCourt 3152.0 claimantourt clattnuntCourt 27067.0 ourtClaim ClaimsClttlmLClaimtimal -608.0 ClaimsImltDL ClttlmLtrmstattr 27319.0 27339.0 timal ImltDLtrmstattrball2136.0 bP bt27371.0 2888.0 27335.0 atalav -140.0 atIVe 27543.0 27607.0 av die IVe-204.0 27580.0 yrs ywrYHrI27551.0 2644.0 froman -380.0 from3t 27555.0 fromact -376.0 27771.0 27779.0 3tactbrrouxc beoatt27811.0 27775.0 lawtbair lawtbelt lawtbalr 27987.0 tbair tbelttbalr27991.0 claim rlaJacitisnts2080.0 28003.0 abltaadandta abltC aadtt1220.0 28207.0 28268.0 28271.0 28239.0 C ttits28215.0 28236.0 trra trtatltaurr tltaurrr 28255.0 ury urruryf urrtP 28427.0 tP 28443.0 28463.0 dtgnrettt dlflW -720.0 2516.0 28435.0 UI 28455.0 lt 2460.0 28447.0 SUItMlStatiSUItMln Statesw-524.0 28651.0 28679.0 w 28683.0 28659.0 Oattb28699.0 28667.0 rtlflcd tfrtUhdtrtttiadtfrtUhdTnalrfenQ -668.0 3148.0 trtttiadrnal rtlflcdTnal -492.0 28875.0 Tnal rnalTnalrfenQ -364.0 28915.0 rr 2680.0 rerena 28923.0 jo 28892.0 colrL3 colru -224.0 01 01tls 29103.0 29115.0 ru tlsrL3andhall 2316.0 29119.0 J1ulinK J1ulinKhan nding -464.0 ndingnail 29312.0 hall hannail2048.0 29359.0 ontlT 29335.0 jbe 29371.0 wrtr wrtrttt 29376.0 rIh 29535.0 29567.0 tlT Ihttt29579.0 gorornor Rorornont1820.0 2348.0 29587.0 ornorl 29563.0 ofto ofpaid 29755.0 29771.0 It1d2580.0 29779.0 IJ 2440.0 29783.0 29975.0 29995.0 30063.0 -12.0 1628.0 1980.0 29983.0 Sratlll Statet1900.0 30032.0 2596.0 30015.0 30039.0 30003.0 -72.0 2900.0 3016.0 30000.0 Jd xmlns:ns3 ID16 28616 3372 3296 2052 ns3:type 4496.0 3208.0 3456.0 2328.0 M1J 4692.0 flair 4512.0 4696.0 2296.0 bair -1292.0 5988.0 5152.0 T if5984.0 5312.0 2520.0 air 5360.0 6168.0 iSJisFeed -496.0 6664.0 6276.0 6536.0 6352.0 5 6328.0 5Exa 6476.0 6600.0 3216.0 3448.0 3084.0 Extra Exa5148.0 3096.0 Long 4984.0 Longaumt 6480.0 Lon -1328.0 3328.0 6176.0 Ito 4072.0 3860.0 3928.0 4196.0 3892.0 4140.0 5004.0 I4 4272.0 5260.0 3871.0 aumt 5120.0 5696.0 3876.0 5660.0 5908.0 arnxa 5764.0 arnxaFeed 6432.0 6080.0 3864.0 Q QPeed 3488.0 4080.0 4120.0 Feed Peed4096.0 4164.0 your 3956.0 4716.0 4104.0 hair 4576.0 nourish nourLh5112.0 4144.0 -748.0 6172.0 5676.0 4088.0 uri 5516.0 6068.0 5944.0 6304.0 4084.0 irirgive 6416.0 itgive 2972.0 3484.0 4352.0 4396.0 give 4032.0 4384.0 4280.0 4372.0 something 4152.0 5432.0 4404.0 5300.0 5728.0 live 5608.0 4355.0 li 6076.0 5832.0 onThen 6456.0 3044.0 4620.0 4656.0 Then 4148.0 4004.0 4388.0 4640.0 will 4264.0 4864.0 4680.0 stop 4744.0 5388.0 4624.0 falling fullingfailing6184.0 5992.0 andwill 4667.0 anc ancwill 6488.0 4888.0 4920.0 4040.0 4964.0 grow grJWgrew3848.0 4720.0 4908.0 long 4532.0 5328.0 5892.0 heavy hClY5680.0 heavyAyers 6464.0 4892.0 hClYAyers 3492.0 5192.0 Ayers 4240.0 5180.0 Hair 4780.0 5168.0 Vigor 4708.0 5460.0 5336.0 5724.0 5160.0 5604.0 6104.0 only 6020.0 onlygenuine -428.0 5436.0 5463.0 genuine 996.0 4448.0 hairfood -996.0 5444.0 5016.0 food 4848.0 5644.0 5476.0 you 5472.0 can carcanbuy carbuy 3496.0 5692.0 buy 4124.0 3868.0 500.0 4380.0 5720.0 gives 5756.0 new 4880.0 5544.0 5699.0 life 5952.0 5848.0 6248.0 tht6128.0 thehairbulbs 6540.0 thehair ththairbulbs 5996.0 hairbulbs 6004.0 -1016.0 3980.0 bulbs 3888.0 5972.0 You save 5268.0 what wha5884.0 whathair -468.0 6544.0 whahair 6247.0 6268.0 4000.0 3896.0 4484.0 6252.0 4368.0 5128.0 4940.0 5600.0 get more 5880.0 moretoo 6280.0 6495.0 6580.0 too 6527.0 And 3788.0 4664.0 4500.0 4928.0 6512.0 keeps 4788.0 6504.0 t1e6040.0 scalp scalt5904.0 scalpclean -500.0 scaltclean 6788.0 6812.0 clean 4136.0 6800.0 4008.0 healthy 4488.0 healthyTho healthyThe5344.0 3724.0 7068.0 7104.0 Tho The4076.0 7100.0 beet best4028.0 4464.0 7087.0 kind 4416.0 7075.0 4836.0 5092.0 7119.0 5044.0 5228.0 testimonial teatimonialtetimontal5184.0 testimonialSold tetimontalSold-932.0 6160.0 2420.0 3732.0 7232.0 7259.0 Sold 3764.0 4336.0 7252.0 4232.0 4684.0 7276.0 over 4580.0 7280.0 ov 5056.0 4976.0 4868.0 5156.0 sixty rsitp5716.0 5588.0 yearsby 6152.0 yearsAladO yearsMade 7463.0 7532.0 4472.0 7524.0 4432.0 7520.0 byJOA7fr 4824.0 O Q4752.0 4992.0 Aytr Aer4916.0 7516.0 Co 5648.0 7512.0 Loa 5524.0 5652.0 LaWl LJ 6052.0 Il1 en5812.0 6200.0 7495.0 klt 6096.0 Mt MtA110 6264.0 6396.0 tAlto tAlso 7624.0 7628.0 Alto A110Also4816.0 ntnafkoturvrt rUllutaotureo4764.0 7632.0 taannt -968.0 5784.0 5212.0 5216.0 5296.0 ott 5244.0 5520.0 7648.0 rere 5468.0 otofSARSAPARILLA otSARSrAmLLA ofSARS 5248.0 7772.0 SARS 5252.0 SARSAPARILLA SARSrAmLLA5568.0 SARSAPARILLAPILLS 6204.0 SARSrAmLLAlJerS 7780.0 tr -604.0 5744.0 ARILLA ARILLAr1ts -456.0 1000.0 3432.0 AladO 7956.0 PILLS rlsr1tsr1tst 5620.0 PILLSCHRY rlsCIf 2308.0 4160.0 7932.0 8096.0 lJerS 4324.0 4256.0 8092.0 jc -916.0 8128.0 CHRY cilRr4652.0 CHRYc 5752.0 CHRYStates CIf 8132.0 5408.0 5828.0 8124.0 rrCTrJRn rrtraR5664.0 rrCTrJRnJIl 6400.0 L LStates 8364.0 8408.0 JIl 4748.0 8376.0 jl4f 4592.0 8367.0 5020.0 5564.0 5464.0 tStates 5628.0 3344.0 3324.0 8819.0 8832.0 3976.0 4364.0 become 4276.0 5080.0 8856.0 5000.0 8828.0 part 8824.0 5596.0 5928.0 5840.0 6272.0 rural 6188.0 ruralschool rut 6668.0 rutschool 6516.0 9048.0 9052.0 school 3936.0 fund 3852.0 4392.0 4308.0 4556.0 respective 4904.0 5936.0 StatesSec 5940.0 -520.0 6460.0 3600.0 9271.0 9284.0 Sec 9276.0 6That 4156.0 4796.0 act shal1take 6180.0 takeeffect takeaffect tal taleffect 6520.0 3340.0 9495.0 9507.0 effect affectimmediately 3784.0 9532.0 4980.0 9500.0 its 6028.0 9536.0 passaand 6032.0 passage passa6484.0 passageand 3356.0 3312.0 9711.0 9731.0 3696.0 9724.0 approval approml3604.0 4516.0 4424.0 5116.0 President 5028.0 6016.0 9760.0 6196.0 uponits upc upcIts 3348.0 3316.0 9947.0 9959.0 3636.0 9952.0 becoming 3516.0 9984.0 4440.0 4768.0 4648.0 5176.0 without 5824.0 6436.0 9988.0 op6316.0 6628.0 opproval aproval 6640.0 10020.0 10180.0 proval 3692.0 10624.0 MASONS 4588.0 ELECT 4476.0 5308.0 OFFICERS OFFICERSWill -956.0 11064.0 11072.0 Will Hold 3656.0 4320.0 11067.0 Public 4184.0 4968.0 Installation 4840.0 5924.0 6332.0 Jan January 6616.0 JanuaryBlg Ja JauaryBig 6508.0 6632.0 11140.0 3756.0 11291.0 11335.0 uary 11296.0 uaryBlg uaryBig4128.0 4332.0 Big 4596.0 4688.0 Time 976.0 5204.0 AnticipatedGainesville Anticipated -972.0 AnticipatedGalnesvflle 11556.0 11559.0 Gainesville Galnesvflle4528.0 Lodge 4428.0 No 41 915368.0 F 5956.0 andDL 6388.0 6496.0 A AM 6620.0 3352.0 11780.0 DL3688.0 11792.0 held 3508.0 4176.0 11824.0 4036.0 11796.0 4268.0 4936.0 11784.0 interesting 4800.0 meeting nieetir5856.0 meetingWednesday -672.0 nieetirWednesday -676.0 12008.0 12011.0 Wednesday 656.0 evening 4284.0 12028.0 5448.0 ofllcers ofUcersoBiceiofllcersfor ofUcersforoBiceifor 3320.0 12236.0 12252.0 3660.0 12239.0 3548.0 ensuing 3920.0 4792.0 12268.0 year rear5272.0 were elected 5672.0 electedfollows -588.0 6372.0 6492.0 12264.0 asfollows 12468.0 follows followsR followsn-592.0 3908.0 12684.0 12699.0 n3760.0 12696.0 3612.0 4016.0 12688.0 Schafer 3880.0 4804.0 W 4660.0 12691.0 1L -108.0 5264.0 5500.0 5576.0 5688.0 6092.0 Pound Pouts5948.0 PoundS 6612.0 PoutsS 3288.0 12908.0 12924.0 S 12920.0 3412.0 3680.0 3796.0 Lee 4524.0 12912.0 Graham 5380.0 6140.0 MCushman 6608.0 1Cushman 3296.0 13131.0 13140.0 Cushman 4292.0 13151.0 treasurer 13136.0 Robert 5068.0 6036.0 McClcIan McClol cCle1McClcMcClolIan 6136.0 -476.0 cCle1Inn 13360.0 13376.0 Ian Inn3700.0 secretary secrctar13364.0 The 4480.0 Th remaining 4924.0 6056.0 ofllcerare 5976.0 6060.0 officers ofllcersofllcerofllcersare officersI-600.0 6660.0 3304.0 13583.0 13632.0 are 13603.0 3568.0 13595.0 3856.0 appointed Ipllolnted5240.0 13600.0 13620.0 13588.0 later datAnd 6256.0 date datdateand -360.0 3336.0 13804.0 13819.0 3740.0 13816.0 early 3596.0 4300.0 684.0 Jamtnr5396.0 13812.0 5640.0 5508.0 5900.0 13839.0 propose 5768.0 proposeto 6548.0 proposed lrOllOsed-644.0 proposedto lrOllOsedto6648.0 14028.0 14055.0 14043.0 hold 3988.0 14079.0 14040.0 union 14032.0 public installation 5220.0 6260.0 andbanquet andhanquet 14067.0 anbanquet 14251.0 14276.0 banquet hanquet4108.0 14303.0 3972.0 14264.0 5064.0 4972.0 5324.0 14256.0 5224.0 Royal 5580.0 Ro 5896.0 Arch Archdegree 6652.0 Archde arc arcdegree 14475.0 14500.0 degree de 3608.0 14527.0 ree 3992.0 14487.0 wfllalso 4296.0 bo be4756.0 14484.0 Installed 5072.0 5916.0 6344.0 6212.0 thistime 14480.0 thistJ ttnl ttnllime -208.0 6552.0 14720.0 time limetimeThe 3676.0 tJ limeThe 3420.0 3444.0 14755.0 n1l n1l1he 3628.0 14927.0 14939.0 1he3924.0 election 3812.0 14936.0 at4568.0 Robt RohtMcClellan cCIll1an5356.0 14956.0 6356.0 assecretary 14959.0 asseeretar nSecretary 6556.0 15151.0 15180.0 seeretar4228.0 15172.0 15160.0 15156.0 sleeting15187.0 was wus6240.0 quite qultlquit6100.0 quitea qultla-412.0 quitt 15376.0 15431.0 3396.0 3504.0 15387.0 compliment cumplttnent4628.0 15419.0 ns4912.0 15384.0 5256.0 past IIBt15379.0 twentroars 5968.0 twent twentytwentyyears twentyoars 3308.0 15595.0 15647.0 yoarsroars3904.0 15612.0 he 3748.0 4236.0 15603.0 filled fiHed15600.0 responsible rsilonsibleresponsibl5532.0 responsibleposition 6644.0 rsilonsiblelOsitlon responsibltusition 15819.0 15839.0 position lOsitlontusition15831.0 being bllng15828.0 tll 4948.0 longest 4844.0 5788.0 15824.0 III6048.0 service sprvlceservicserviceof sprvlceofservicf 16040.0 16064.0 3556.0 16092.0 any 16096.0 3952.0 secret 3744.0 cret 4452.0 4544.0 16052.0 society soclltr16079.0 man 16047.0 III5932.0 16043.0 thl5820.0 6288.0 city cityMr 6592.0 cityfir 6384.0 Itr 6560.0 Itrr 3280.0 16268.0 16288.0 Mr fir3472.0 16320.0 3540.0 16276.0 MrClellan fClel1anMcClellan16271.0 makes makea4560.0 5392.0 16303.0 ugood ooll 6164.0 16295.0 seem HecroHecrfHecrotary 6596.0 Hecrftnrr seemary 16487.0 16519.0 tary tnrrary16504.0 nllll3644.0 4212.0 xis16495.0 colleagues ollpagues5584.0 appreciating npprll1tlngapitreeIatin5428.0 appreciatingthis npprll1tlngthlliapitreeIatinhis-1052.0 6636.0 3332.0 16711.0 16731.0 thllihis3728.0 fact fat4188.0 16723.0 4600.0 16735.0 16728.0 consent COIIHtlIt16720.0 him towithdraw tRithdraw 16951.0 16956.0 withdrawTOWN withdraw Rithdraw-760.0 4092.0 RithdrawTOWN 17335.0 17355.0 TOWN 17347.0 TEAM 4248.0 5040.0 VICTORIOUS VICTORIOUSClosely -1176.0 6216.0 17340.0 VICTORIOUSlosery 17784.0 17804.0 Closely losery17796.0 Contested 4988.0 Football 4852.0 5792.0 17787.0 Game Re Recults 6588.0 Reults Resuits 3584.0 18011.0 18032.0 cults ultssuits18023.0 3968.0 18020.0 Victory 4204.0 5364.0 Town Boys BoysTho 6324.0 BoysTh Boysihe 18263.0 18291.0 ihe3808.0 3964.0 18280.0 anxiously xlously3708.0 anxlolll -784.0 18320.0 4552.0 4612.0 ly 18271.0 anticipated allllcllmtdfootball footbul5836.0 footballgamo -624.0 18268.0 foot footbultame 6340.0 6572.0 hallanw 18484.0 18548.0 tame gamo18551.0 anw 3752.0 3916.0 18516.0 bitwcen hetwcerthlt 4180.0 18539.0 wn 18495.0 5164.0 18499.0 5008.0 18492.0 nudturdHigh IIIghiiiglHighSchool -384.0 IIIghSchool iiigl3chuol 18711.0 18740.0 School 3chuol18752.0 teams teamt4732.0 18715.0 4520.0 18720.0 tinsIIIPIItilltinthemosttalkedof tillmMtlalkedof tinnosttalked 18892.0 18956.0 mosttalkedof mMtlalkedof3372.0 nosttalked -1124.0 18951.0 topic 18947.0 fa 18979.0 5236.0 5420.0 18936.0 tlw5772.0 Ilist5668.0 throt thrfp6112.0 throtor thrfpor lire liretr 19155.0 19224.0 tr3620.0 19192.0 four 19183.0 days dnYR4636.0 19207.0 wus4456.0 tts 5084.0 19163.0 pulled IlUllldDulled4944.0 19168.0 off ofr19195.0 titheal 6236.0 tit6584.0 thelocal 19175.0 IIf IIflocal 3268.0 19387.0 19411.0 local heal19408.0 gridiron grldlroll4548.0 19435.0 4832.0 19391.0 Christmas ChrlstrlHu4724.0 808.0 5776.0 afternoon aftlrllonafternoonand aftlrllonandafternoontad-808.0 19612.0 19639.0 tad3720.0 19667.0 19627.0 woll wflllwell19615.0 attended 4468.0 19635.0 att mdll tilt tin1theafttrnoonafternoorafternoonbeing -800.0 afttrnoonlJeln afternooriehng 19823.0 19868.0 iehnglJeln 3840.0 19895.0 Iiit3652.0 19871.0 pretty jlrftty3932.0 19880.0 Olllout5096.0 19839.0 5412.0 5492.0 19848.0 context ont8tlikely 6084.0 likelywas IIkl Ilkel19828.0 IIklwas 6528.0 Ilkelvas 20047.0 20123.0 vas20099.0 Ilrtty3632.0 4344.0 20108.0 4216.0 20111.0 4604.0 20064.0 both huthbutte5052.0 20084.0 tnnmll4956.0 20052.0 played plared5540.0 6156.0 goodball gout goutcall 6576.0 6452.0 oll ollhall 20271.0 20312.0 ball hallcall20300.0 20303.0 -444.0 20335.0 ln 4316.0 4712.0 20283.0 evenly 5348.0 20276.0 matched matchllthose thostthosewho thosts 20307.0 1who 20511.0 20539.0 who 20568.0 -276.0 3648.0 tto 20519.0 understood UJHIIfdood20527.0 undr -904.0 4672.0 4252.0 4340.0 20543.0 4808.0 thl4584.0 5188.0 20536.0 game gur1lwlr5624.0 6148.0 ver 6108.0 verntltuslastlc very veryenthusiastic 6368.0 frfnthuslaRtic 20723.0 20752.0 enthusiastic fnthuslaRticntltuslastlc20775.0 01120735.0 hoth20731.0 slds sides5104.0 20764.0 5636.0 wniwasnohodyx wnithodys OM OMtlfJhcIK 20947.0 20979.0 nohodyx tlfJhcIKthodys21008.0 gam4244.0 nJ1H 20959.0 mill until4536.0 21000.0 20983.0 4760.0 20956.0 20995.0 close closcloseThe closThl closeihe 5844.0 3500.0 21163.0 21207.0 Thlihe21199.0 boys 21204.0 hO 4304.0 21236.0 K put lntt21219.0 up UII5132.0 21215.0 21183.0 line nn 21212.0 no 5864.0 anf 6380.0 tl1lthtthescore tl1lorf thtcore 6604.0 21376.0 21463.0 score coreorf 3900.0 21428.0 belnxtwin 21419.0 Ti r0 4564.0 4700.0 21435.0 4996.0 5060.0 21411.0 21403.0 favor 21431.0 21399.0 orthltittheTown thlTown titown 21615.0 21656.0 21688.0 own 21664.0 team tftUJ1vain21639.0 4260.0 4704.0 21667.0 wan waMwas4616.0 5100.0 5012.0 5276.0 5808.0 fu1till5712.0 21619.0 6404.0 21647.0 exdternent 6320.0 6408.0 ex Oxexcitement OxcltfUlllIt 21679.0 21851.0 21883.0 citement cltfUlllItdternent21875.0 but hut21855.0 friendly frUndlyfrhndl4436.0 nndrind5876.0 21871.0 everyone fnonHtveryoneveryonefelt fnonHftveryonelt 22071.0 22103.0 felt elt22111.0 22096.0 22087.0 they 4024.0 22128.0 4408.0 22123.0 y 4608.0 22084.0 had hUll22099.0 got 5456.0 thrlr5964.0 mone mOJ1IyH nuneytmOJ1IyHworth nuneytt 6564.0 sworth 22323.0 worth worthA 22688.0 22735.0 3384.0 22764.0 3436.0 22731.0 Home 22720.0 M3de4068.0 22711.0 Happy 5504.0 22703.0 Chamber Chamberlains -756.0 22691.0 Chamber131ns 22752.0 22951.0 22983.0 lains 131ns4572.0 22976.0 Cough 22963.0 Remedy wtAbout wAbout 23011.0 rAbout 23204.0 23251.0 About 23256.0 4460.0 23227.0 months 5144.0 23263.0 ago 5512.0 our 5868.0 23215.0 baby 23219.0 hab girl girlhad girlad 23428.0 23479.0 3416.0 23467.0 measles flwaslJ4508.0 23455.0 hkhwtriclr23499.0 -472.0 5196.0 23443.0 settled wttlnd6364.0 her herlungs 23431.0 hf herungs 6568.0 23463.0 rlung 23663.0 23703.0 lungs lung3392.0 23740.0 ungs 23691.0 nnl23711.0 4504.0 23683.0 last InJoit23667.0 resulted rrsutd5556.0 23699.0 5804.0 23688.0 severe llrosevereattack -536.0 severettack llroattack 23880.0 23919.0 attack ttack23915.0 ur3828.0 23903.0 bronchitis hronchltlshrmichitis23887.0 We Ve5860.0 bad6336.0 twodoctor 23883.0 twodoctors twoactors 3260.0 24091.0 24147.0 doctor doctorsactors24140.0 huthit4820.0 24116.0 relief nlIlrellcf4676.0 24143.0 waR wnswasohtaindveryhody obtained ohtahHdohtaind-700.0 obtainedEverybody -704.0 ohtahHd1nod 24315.0 24364.0 Everybody 1nodveryhody24344.0 thought 24351.0 thou ht 5076.0 24383.0 24335.0 fhe 24339.0 flh hie 24376.0 24323.0 would woull6072.0 dl dieeat Iwent 3300.0 24536.0 24603.0 went 24607.0 eat 3832.0 24600.0 24575.0 eight elKht24571.0 different dlfrnnltllfterentstores BtoreflIItorcH24559.0 find flnlfinda flnlertnln findn 24764.0 3544.0 24803.0 fcertaln ertnlntertaln24791.0 remedy rpU1fd24771.0 24767.0 5560.0 hndhfln 6044.0 hndhflnrecommended -860.0 btn btnecommended 24796.0 nrecommended 24988.0 25015.0 recommended ecommended25032.0 25043.0 me ml4784.0 25000.0 failed fnlltd24991.0 getsetIt getwhen 25207.0 25259.0 25251.0 when 3424.0 wh 25287.0 25280.0 onp25239.0 4444.0 25227.0 25215.0 storekeepers jitorekofiporalorokHIrs6296.0 Insisted Inlisted 25263.0 25420.0 25475.0 listed sisted150125463.0 thut25459.0 14224.0 25479.0 tn4360.0 25435.0 ChAmhfrlalnsChanberlninsCoughJtemedy -512.0 CoughItentcd Coughemedy 25599.0 25651.0 Jtemedy Itentcdemedy25639.0 25635.0 did 4312.0 25663.0 itO fco25619.0 nml nndnrtd25644.0 Ollf25607.0 hnh batve IsbInnitve 6624.0 Islulvc 3264.0 25835.0 nitve lulvcatve25823.0 3712.0 25807.0 well W1will25799.0 Uxiay 25819.0 tJo 5548.0 25791.0 UsayGeo Cleo 1V1Vpencr WSponcer WSpllacr 26015.0 Sponcer Spllacr26043.0 pencr -560.0 3984.0 4112.0 Holly 11011lolly26007.0 25988.0 Spiiugn Sp11ngrSIt -628.0 4932.0 iUSlI 25975.0 5656.0 25971.0 5528.0 Kor POfIror5760.0 inle IIIltale6224.0 inleby IIIltb aley 26183.0 26195.0 3404.0 788.0 druffUt drullbtAdrugtitsdrullbtACard drugtitsCard-788.0 druffUtCard 26559.0 26583.0 Card 26571.0 flfThanks 26563.0 ThanksMr ThankslrlThanks1tr26759.0 26811.0 1tr3592.0 lrl 3960.0 26803.0 4064.0 26799.0 F26796.0 fk26784.0 Und dndLand26775.0 autlAad26771.0 family tamU6348.0 26764.0 lthrough I1I1trough IIthrouJh 26971.0 27032.0 through throuJhtroughTbfTb27019.0 8unttun4828.0 5232.0 27003.0 publicly publflyubllI pjfrr Pxpsrpjfrrto ti Pxpsrt 6292.0 27223.0 27280.0 1027295.0 3468.0 27255.0 Utrtbetr3464.0 27259.0 27247.0 frpwt frcudd27283.0 Mil 4740.0 27239.0 tbflr tbPfr27236.0 lb 27231.0 heart h4lhearth5872.0 27251.0 aIJIrpda alprrrtaaIJIrpdaUOft -708.0 27271.0 27243.0 6444.0 latfott 27440.0 27479.0 tfott UOft27511.0 27484.0 4012.0 27495.0 rai tut4168.0 27463.0 rDIth athy 4812.0 27459.0 shown hownshorntitcm thffD27472.0 27443.0 Int intb Intbfrtr 27659.0 27695.0 27699.0 tbfrtr 27739.0 3716.0 27707.0 3640.0 27735.0 tPrn 27667.0 rpfnt err 27727.0 4200.0 27691.0 affliction atJIktJonaMfUon27671.0 Afadariatofor Ulank IltankIltanksent Ulankth -460.0 3196.0 27819.0 27927.0 27956.0 sent 27931.0 3736.0 27924.0 lb4060.0 27951.0 tan 4668.0 27943.0 27892.0 beautiful boauMful27911.0 -736.0 5352.0 27895.0 uurul 1IorT 1IorTF1tUce 27887.0 ik 1Ioikto 1IoUU 6244.0 28344.0 UU F1tUce 28408.0 28379.0 28359.0 Our OUt28351.0 Cujt CUltmera CusemcraCUltmeraIU Cusemcrav-876.0 28371.0 mert mertar 3552.0 28592.0 28627.0 v 28663.0 IU28615.0 pleaaed pleaAl4dpletnr 28635.0 tn toamtoanr a1WOQAt4atuaooae9thatHnof thatrO thato4eyn 28811.0 28847.0 rO 3428.0 o4eyn 3520.0 3684.0 28883.0 Hnof JfncaIfnaPr 28828.0 attd AItartd28831.0 Tar 28823.0 feJr6012.0 cough COUlCbacottgbacoughcoid COUlCbaI cottgbaWs-480.0 29023.0 29064.0 coW coidWs 3820.0 29067.0 anJ auJuJ29075.0 lung lunphlDI29051.0 trouble trtUbltroubles29059.0 29027.0 a8fhd aUertd5888.0 a8fhdi aUertdr-652.0 29043.0 afiTert dby 29251.0 29295.0 29319.0 29280.0 tbetJte29275.0 NatlonaJ aUouJNaUtxaalPnr Pnrt1nrv5304.0 29259.0 Food rorJodFailaDd5700.0 cuff DrvxJruJDrvxLaw 29255.0 JruJLaw cuffax 29471.0 29507.0 Law ax 29539.0 a8asi29511.0 29503.0 coouin CODlJnlcoolalnrt29523.0 29491.0 opiate opiatei5852.0 latH oUw otbrr6116.0 oUwharmfuJ oOa otbrrutnful 29495.0 rharmful 29643.0 29679.0 harmful harmfuJutnful29683.0 drugs dntedruJl29671.0 4540.0 29699.0 we 29647.0 recommend 29691.0 rOmm Itt ita Itas 29819.0 29899.0 29895.0 3400.0 3816.0 29860.0 safe aaTewe29847.0 rwmtdy29887.0 dy tor4896.0 29831.0 children chHdreocblidreaandadulu 29823.0 andadulta andiula1 30011.0 30035.0 adulu adulta688.0 iula1 3824.0 30027.0 VG McColfcra MCColhim30023.0 fcC llum 30615.0 xmlns:ns4 ID21 28684 3568 6676 1984 ns4:type 7300.0 CHRISTMAS 8540.0 FUNCTIONS 8420.0 FUNCTIONSXmas FUNCTIONSt9664.0 6844.0 Xmas 7400.0 2432.0 Tree 7876.0 8120.0 North 8012.0 936.0 8700.0 G31nesville8596.0 9732.0 Tues Tue9636.0 Tuesday 10132.0 TuesdayOthers TuedayOthers 10044.0 2932.0 7016.0 day 1036.0 dayOthers 7292.0 7500.0 Others 8052.0 Held 8592.0 Thursday 8520.0 9496.0 Night 9404.0 NightFrom 9944.0 6840.0 2916.0 From 7412.0 Fridays Frl 8088.0 2960.0 7656.0 7852.0 8220.0 Dally DaflrDaily8784.0 Suu Sun8660.0 SuuChristmas 9100.0 SunChristmas 7020.0 3144.0 8064.0 entertainments entertalnments7868.0 9568.0 9368.0 9920.0 9728.0 tti 10048.0 9924.0 thechurches 10184.0 thechurch 6676.0 3368.0 churches church7700.0 wre7584.0 8192.0 3380.0 deferred deferre8820.0 8860.0 9016.0 ns9312.0 3419.0 n9200.0 9504.0 rule rulo9948.0 9832.0 forone fc fcone 10052.0 7200.0 7120.0 da 7488.0 7616.0 IIndnud7380.0 7988.0 7896.0 some 8732.0 instances 8648.0 9612.0 longer longrlonge9528.0 longerThe longrThe longeThe 7272.0 unlol17152.0 Sunday Sundu7728.0 8584.0 8468.0 9332.0 9116.0 9692.0 Nort9488.0 NorthGainesville 10172.0 NortGatnesvill 9836.0 orth 10060.0 orthGalnesvlll 4052.0 GalnesvlllGatnesvill4056.0 7760.0 8332.0 8208.0 8892.0 tree 8736.0 9396.0 9228.0 9700.0 NortNorthGainesvill NortGainesville 9840.0 orthGalnesIlI GainesvillGalnesIlI7904.0 7704.0 8360.0 8212.0 8600.0 8452.0 9044.0 earlier earlfpr8788.0 9800.0 how hot9608.0 however 10120.0 hotever 10152.0 10056.0 10240.0 10176.0 1ewr 10244.0 ever ewr7328.0 7196.0 7744.0 4527.0 event vent7928.0 ent 8196.0 8280.0 occurring 9188.0 9096.0 9480.0 Tuesdal 9384.0 9484.0 Tuesdav Tl1esdaTuesda10064.0 Tuesdavevening 10156.0 Tl1esdaevening 4736.0 6700.0 7492.0 7880.0 8480.0 4731.0 8336.0 8960.0 attlnded9884.0 9696.0 andmany andnmu anmany many nmu 7424.0 handsome 7176.0 8384.0 useful 8684.0 presentwere 9340.0 presents presentpresentswere presentsWert10188.0 5183.0 5215.0 Wert7356.0 distributed 8528.0 When 8260.0 9148.0 9024.0 comes 10032.0 9912.0 tdoing 10036.0 todoing doing 7448.0 things thf1gsthitgs7288.0 right 7948.0 lIeopllpeopleof lIeopllof-532.0 5440.0 peop peopof 6836.0 5632.0 7116.0 orth6996.0 7724.0 5635.0 ualnesville7592.0 8768.0 5667.0 9260.0 there 9040.0 9440.0 erc 9376.0 9820.0 withthe wit witthe 7184.0 goods 7092.0 7960.0 They 8388.0 do 8284.0 5871.0 8672.0 9128.0 permit 9036.0 9792.0 theirreligious thereligious 6087.0 religious 7636.0 111dntd7560.0 8004.0 other 7916.0 8532.0 little differences tointerfere 1Interfere 6308.0 interfere 7672.0 7572.0 7808.0 6323.0 Ith 8016.0 8112.0 making 8840.0 anything anrthing8744.0 9688.0 9600.0 9876.0 suc 9776.0 success su sucess 6376.0 cess 7180.0 7848.0 7756.0 undertake 8200.0 undertakeOn -872.0 9160.0 6760.0 6772.0 On 7336.0 6768.0 Thurda7240.0 8216.0 9136.0 6763.0 Sabbatschool 9408.0 Sabbath SabbatSabbathschool -684.0 Sabbathfcrool fcrool7472.0 7036.0 7004.0 7748.0 7000.0 First 7992.0 8644.0 6992.0 Methodist ethodlst8524.0 9616.0 church churcchurchheld churcheld 7212.0 7496.0 party paity7376.0 IHI 7776.0 ty 8028.0 8292.0 7220.0 8564.0 7224.0 9252.0 whit9580.0 whichthe whitthe 3408.0 7440.0 7732.0 7452.0 folks 7612.0 8236.0 8668.0 7476.0 9256.0 older 9132.0 9808.0 ones oneoneshad onesI onehad 7608.0 7667.0 7248.0 7456.0 big 7832.0 7676.0 tlmo7712.0 8348.0 8188.0 8852.0 plenty 8728.0 9508.0 9392.0 9784.0 7696.0 pres pre9668.0 10136.0 preents 7912.0 ents 7936.0 7040.0 7920.0 etcIn etc 7600.0 7596.0 7308.0 7172.0 enlng7568.0 8119.0 8976.0 8792.0 9584.0 Baptist Rapti9400.0 Baptistchurch Raptichurch 6832.0 8340.0 7544.0 8352.0 tendered 7388.0 8355.0 tllId 8000.0 7888.0 8412.0 tho8344.0 8680.0 9672.0 at9524.0 9980.0 Its ItsSunday itsSundnr ItSunday 10088.0 8576.0 Sundnr7564.0 8hool8180.0 8612.0 8504.0 8571.0 oldtime oldtlme8380.0 old -688.0 9192.0 8816.0 8748.0 9316.0 ChristmaChristmastree Christmast8568.0 Christmatree 8796.0 8807.0 7312.0 7156.0 7588.0 8804.0 7468.0 Santa Clans ClnusClaus8664.0 9812.0 verymuch vermuch 9023.0 9028.0 much 7392.0 9032.0 7268.0 evidence Pldence7536.0 9104.0 9860.0 wawasgiven wasglen wagiven 6828.0 9244.0 given glen9268.0 thl7504.0 9288.0 opera 7840.0 8444.0 house 8368.0 8932.0 9280.0 9356.0 wollwet9756.0 wellattended wollattended wetattended 10168.0 6824.0 7684.0 nlll8060.0 9512.0 n7972.0 8248.0 8160.0 8980.0 8884.0 9232.0 every 9124.0 9796.0 witHoly 10024.0 way wayHoly wayHoh 7008.0 9704.0 Holy Hoh9708.0 Trinity 7396.0 Episcopal Ellscopal9168.0 wll9748.0 willhold wllhold 9927.0 9936.0 844.0 9932.0 8616.0 9940.0 treo9072.0 9964.0 8948.0 9412.0 Tuesda9264.0 Tuesdayand Tuesdaand 6816.0 10148.0 10151.0 Presbyterians Prsbyterlnns8924.0 9360.0 givla 9824.0 glegivl10100.0 givea glea10380.0 10419.0 10396.0 cantata cnntnta6900.0 10384.0 dateIN 8356.0 8456.0 10819.0 10828.0 IN 8048.0 10824.0 MAYORS 9000.0 COURT 8904.0 COURTColored 9680.0 11264.0 11276.0 Colored Woman 8396.0 11271.0 Charged 8204.0 9240.0 With 9804.0 11268.0 SellIng Sell 10112.0 10108.0 11495.0 11500.0 Liquor 7508.0 Heavily 9180.0 Fined FinedCharged FinedCIHuglt 11755.0 11764.0 CIHuglt7796.0 11760.0 7680.0 selling sellfng8140.0 liquor 9520.0 vitlnouwithouta vitlnoua10164.0 6808.0 11979.0 12023.0 11991.0 license lfcemw7788.0 11988.0 IInd8240.0 11984.0 against 8864.0 9464.0 laws 10004.0 atofAlachua atAlachua 12020.0 oAlachua 10092.0 12204.0 12215.0 Alachua 7540.0 12232.0 county 12212.0 Estelle 12207.0 Knowler 8776.0 9716.0 12244.0 9592.0 9880.0 colored colortll 6804.0 12431.0 12443.0 ored ortll12472.0 woman 7160.0 12436.0 7820.0 8320.0 12440.0 8536.0 8448.0 known 8872.0 thiathiscity thiacltr 9916.0 hit hitcity 12659.0 12667.0 cltrWIl812664.0 arraigned fiJlnlgned7576.0 8628.0 8496.0 8900.0 cfty12672.0 courtTuesday 9720.0 10116.0 courtfulsda 12880.0 12895.0 fulsda 12888.0 morning llIornlng8472.0 8308.0 she 9444.0 12883.0 received receledreceivedthe receledthe10144.0 13116.0 13119.0 7216.0 usual u8ual7064.0 7800.0 13124.0 sentence 7640.0 wutence500 seutence6008812.0 500 9076.0 9224.0 costs eOHtscostsThrough eOHtsThrou 13332.0 13344.0 Through 13347.0 Throu hth1 13379.0 7872.0 13352.0 attorney nttolnc7908.0 13340.0 Evans Eans8740.0 Halle HnlleHaileHalleshe Hnllesh Haileshe 13559.0 13571.0 sh 7080.0 13568.0 appealed apIIlahlI6976.0 7976.0 13564.0 8312.0 case cnse8228.0 8808.0 giving bond forher 10128.0 13787.0 13799.0 13828.0 appearance llppamnce7076.0 13792.0 circuit courtThe 14008.0 14023.0 111 7416.0 14052.0 wonuun14048.0 8724.0 14011.0 8516.0 9320.0 nrralgnedarraignedupon -824.0 14232.0 14283.0 11101114247.0 charge rhalgo14244.0 8076.0 1216.0 14239.0 lasciviousness lasclvlousnessInscllomm8sandwas 9684.0 9844.0 andns 14460.0 14507.0 6936.0 7244.0 14472.0 fined flnf1d7900.0 14468.0 14519.0 8020.0 7944.0 7924.0 8144.0 8440.0 14495.0 caso9652.0 casewas casowas 14691.0 14731.0 14696.0 allualedallualedMattis 7652.0 appealedHutch -728.0 apllf -724.0 nlell nlellHuth 8372.0 14907.0 14920.0 Hutch HuthMattisTlsliy TbhrIishy14915.0 charged 9064.0 14912.0 8880.0 lasciv lasrlv9424.0 lasrlv10utrHsH lascivlousness 15140.0 iousness 10utrHsHlousness7660.0 15183.0 waiwayfired7964.0 15143.0 ilO 508968.0 nrHl15175.0 nut 9388.0 eOHts9220.0 costsOscar 9816.0 eOHtsOscar 6980.0 15355.0 Oscar 15372.0 Duke Dukl8056.0 15367.0 tUld7968.0 15364.0 Wm WntVnn8928.0 Granger Grnnglr9772.0 bothcharged 9632.0 hothhothchargell 15580.0 chargell7856.0 lth 7984.0 7952.0 8324.0 15588.0 carrying 15624.0 Cnrr llIg 9300.0 concealed cOllc1l1ldconcealedweapons 10124.0 cOllc1l1ldWtnpOIlR 6792.0 15807.0 15856.0 weapons WtnpOIlR15848.0 WIp8116.0 15812.0 sentenced SllItPIICld9272.0 pay prey9184.0 15843.0 1m 9564.0 a9452.0 Ilseof 11110Ilselineof 11110of 6780.0 16035.0 Ji 16099.0 7284.0 7372.0 lllllanti16060.0 cots8176.0 8044.0 IrheachWhen 8636.0 IrhWhen 16524.0 8184.0 16536.0 8080.0 16527.0 Go HomeFrom 9248.0 3080.0 6964.0 16787.0 16799.0 16792.0 7404.0 Bluffton BlurrtonBluttonInd lndbanner Hannornat1twrbanner1Vhen -620.0 HannorWhen nat1twrWI1ln 17008.0 17015.0 WI1ln1Vhentired 7352.0 17023.0 out 7824.0 go 17011.0 homo Vhen17035.0 youwant 17032.0 10040.0 Uwant 6784.0 17224.0 17251.0 want 7264.0 17236.0 consolation onHolution7188.0 17271.0 17232.0 home 8712.0 ome 01l1017227.0 Wh 9548.0 17256.0 Ol OlWUllt 17452.0 17475.0 WUllt17467.0 fun 7716.0 17495.0 17455.0 honx honzhouue8704.0 Whn8500.0 9304.0 17480.0 ou 17460.0 wantto 17671.0 17708.0 17688.0 show 17684.0 others 8512.0 011 8896.0 9012.0 haereform rpformreformed rpformd10076.0 10096.0 17731.0 6776.0 17892.0 17912.0 6876.0 6956.0 17907.0 homo17903.0 anti17900.0 let lot8272.0 17927.0 8608.0 gltgetacquainted gltacqul1lntld 18111.0 900.0 18128.0 acquainted acqul1lntld18119.0 tho8172.0 8544.0 18143.0 youyant 18140.0 ouunt 18340.0 18364.0 yant6924.0 unt 18344.0 Kl10Wyourself ourslJr7940.0 18347.0 18371.0 8956.0 best hstgohome goborne 18556.0 18575.0 borne18571.0 nntl7228.0 18568.0 18563.0 tlmUw18559.0 tllfreWhln18588.0 youfeel 9752.0 18583.0 OU OUfeel 18775.0 18796.0 feel 18792.0 like llkoIIkolwlng18799.0 extra extrn8068.0 8720.0 liberal IIlIeml8604.0 9372.0 18816.0 borneanti bornehomoand 18996.0 19015.0 anti19008.0 practice Jlrlctlce19043.0 19040.0 8624.0 19003.0 wife umlraid9432.0 rhlldnncblidren9344.0 childrenfirst rhlldnntJrllt cblidrenfirst 19212.0 19239.0 first tJrllt19227.0 1Vhen19259.0 8916.0 19236.0 19215.0 shine uhlno8hlll09068.0 9764.0 9640.0 withextra Ithxtra 19440.0 19475.0 xtra19452.0 brilliancy hrfllluncy7208.0 19480.0 8492.0 19443.0 nrll 9328.0 light 19467.0 UIIupthe UIItho 19656.0 19683.0 tho7168.0 19676.0 whole household housoholdTo 8588.0 19664.0 whlc 9780.0 19691.0 wo wewowould -212.0 wowou wewould 19875.0 19900.0 19936.0 wou 7136.0 Id 7364.0 add udd7804.0 19892.0 whl1I19924.0 8436.0 19927.0 19883.0 19887.0 ha 9112.0 9212.0 ubad Imd9296.0 coldgo 9788.0 cold colclcolclgu 20160.0 gu20119.0 bomeironic6972.0 20116.0 nlld7620.0 takotukeChamllurlnintlChamberlainsCough -1212.0 ChamllurlnintlCOlIlh 20320.0 20339.0 COlIlhHpllwdy7296.0 20332.0 nnd20359.0 20323.0 quick 20355.0 cure clre9352.0 10000.0 111Iscertain 111certuln isertrtln 3028.0 20507.0 20524.0 certain certulnertrtlnFor sale tmluHulo7892.0 8416.0 20516.0 hydruggists drugglutHdruggltltHdrugglutHA druggltltHAdruggistsA20912.0 20927.0 20915.0 Prominent Visitor VlgltorVIltor8632.0 VlgltorAIIIOIIK -576.0 VIltorI VisitorAtaoug 6968.0 21195.0 AIIIOIIK AmJIIAtaoug6720.0 tilLprominent IrofllllllItpronshtmt9176.0 21180.0 lhltorn hiitorHvlslturn9972.0 totills tothtH tothis 21384.0 tills thtHthis21415.0 Illy7088.0 21452.0 7480.0 IH 1MisHon Ionlore21408.0 Ceo teo8392.0 21443.0 tO 21396.0 lobea olIlHJuberi9420.0 wellMiown 10068.0 21387.0 wellno IIfnnO11 3292.0 21612.0 Miown nnO116888.0 21676.0 7320.0 7140.0 21671.0 vii 21644.0 nttor1Il 21627.0 IHGreenville jnlUlIhreIs -740.0 lit 9108.0 oh 9448.0 Ohio 9872.0 Ohiowho 21624.0 Jo JoOhio 21839.0 21863.0 Ohio21860.0 Ishere lWfI7340.0 tor8232.0 21892.0 short wliorthortthtll8836.0 9308.0 hlxhl49768.0 hlxwife hl4wlfl hisAife 22059.0 wlflAife22079.0 22075.0 llIlldrcli8692.0 Jlrs8780.0 22108.0 rHo 22067.0 JoliCH JolI1iJobes111111andrhlldreji 10104.0 111111CllIhlrJI andhlldrep 22288.0 22307.0 rhlldreji CllIhlrJIhlldrep22303.0 hl1lIWl1I22295.0 upending MIIfllItlIlJotspending8432.0 tin ththe22300.0 pant IHUltpastpantf IHUltftpastew 22511.0 22536.0 22568.0 ew 6872.0 6944.0 22527.0 montliH mouthHrnunthetHr22519.0 thotht22516.0 dllhlnlIchlIdrca9516.0 beingof beingttnrks 22759.0 ttnrks 22772.0 Lt 22767.0 IW or22743.0 tiltIlilverhlty Iiiverslty22747.0 tli -868.0 9236.0 Iprtl 8572.0 22740.0 tilltittheGraded tillf tillOn titnesvllI 6736.0 22775.0 22907.0 Mh1t7Z 22927.0 23020.0 IIH nesvllI Ill 22971.0 Graded irndtfrattednud8984.0 22968.0 9292.0 HCllholHchtrdHchtrdTins SchoolThis -548.0 HCllholThl14 6952.0 23187.0 23207.0 Thl14TinsIs7324.0 23195.0 Col 23192.0 JobeH JotHJolstsfirm firHtfirstvisit vlHltIHltfFlorida totllIorlda toInrlda 23399.0 23423.0 Florida IorldaInrldaIf 7740.0 IK IH23411.0 23415.0 23408.0 pleased pleaxedJIatwd9380.0 23403.0 tilltheState tillHtat thetate 23627.0 23659.0 State Htat23671.0 tate 23651.0 11123639.0 Kenenil gnerainlllij1l1rUMUIriinesvilI8708.0 23632.0 IIIInpartlrular IIIIlRrtlrulnr inarticular 23851.0 23871.0 partlrular IlRrtlrulnrarticular23863.0 dcclnrhiK Ifldnrlllgdeclaring8620.0 Galne 23855.0 GnlrlfKIII Cainsvllle9204.0 vllle 9556.0 9552.0 9928.0 litbethe litt lhe 24071.0 24099.0 24128.0 7024.0 24103.0 hI he24096.0 rlfHiicut IftlUtciettncstiretllent rnUhatretti -584.0 24108.0 24084.0 lalllirandnionlmOl4tmod f1tJmodeni rnt f1tJnJ 9908.0 10012.0 1rn 24295.0 eni 6868.0 nJ rn7028.0 town 24319.0 ItH7812.0 8244.0 size I1I7t8036.0 l7e 8548.0 24307.0 8844.0 8964.0 24303.0 IIHH9348.0 24327.0 9140.0 9544.0 vln vINvlnlt vINt 114 114It 24516.0 It24595.0 24551.0 1i 6928.0 7072.0 24548.0 if24587.0 24583.0 24543.0 ire8100.0 24523.0 jwirtlrularly lstrtlrnlarlyIKrtl 1Ilnrly Impressed ImpreHnedImpreHnedwith ImpressedVit-844.0 24527.0 hllllrt l4td l4tdwith 24740.0 24779.0 24784.0 Vit 7132.0 7048.0 tltl24755.0 oduchtlonul OdUChtiouttlJItetttiunttl24752.0 rU1I18640.0 moral niinilmornl9080.0 9712.0 airwhich airhleh airtnlcla 24959.0 hleh tnlcla110124995.0 25003.0 apparent IlJlJlonrfIlaplwarent24979.0 hprher24975.0 lid 24963.0 fuels feolnmlltethntthatbin thnthI thatIN25195.0 25224.0 bin 6884.0 6916.0 fruflnfnrnlly7828.0 could ouldHoldnutsat25199.0 8656.0 25204.0 better hUtr25219.0 HUT Kurrrur9644.0 HUTrounded KurrOUltI rrurotutdwl rounded rOUltIotutdwl25816.0 25848.0 Danger Cnger25831.0 8276.0 Asking AiklngAlldngAdvice AdviceWhen Advicewtarn 6960.0 26071.0 26099.0 wtarn26131.0 rtxn7432.0 ftJ 26096.0 bv8424.0 26128.0 ncf 26083.0 fuKh cfughKh 9088.0 9196.0 26111.0 colt9364.0 Itododot Itonot dotot 26291.0 26347.0 dot nottot26327.0 auk ukask26355.0 fromeono Omtmcomtone26363.0 -712.0 26312.0 shathAt 8988.0 26339.0 ROTM 26300.0 Jood26295.0 9476.0 9828.0 Itan ItU 6764.0 26527.0 26592.0 U26548.0 tliTO lhroHaire26551.0 IIIIs7784.0 26543.0 darter druuurdanger8460.0 26539.0 Uklnr tklnrtakhrrr26555.0 eoinu Jlmosoutaun unj unas 6688.0 26699.0 j 6712.0 kUfnns6716.0 prJfraUon pretrarationpr -960.0 tnrmtlon 7668.0 26747.0 Koleyii foltYtnhy26739.0 Honernd 9560.0 26731.0 Ifonwy HonerIfonwyand 26735.0 IItm IItmtnl 26911.0 26951.0 26991.0 tnl 7056.0 6864.0 nd TBr26975.0 euro curutlcureo26931.0 ronicb oachllrougbe26927.0 coW26956.0 anI 26947.0 prw 9620.0 prwepu IrprteiiUi 9960.0 Irj 27099.0 27111.0 27155.0 teiiUi Tlll1tAepu 27167.0 27119.0 fflmitoonln IlhMlJDOnIAlmetatnonln8488.0 Tlic rbrrb 8920.0 27103.0 Rifnitinn JlwNlnrtgersulnss9572.0 lr Inlaa InIlar 3364.0 27355.0 27347.0 6852.0 6948.0 27307.0 yellow 110 Ilow INrkalf1 parkXr27327.0 pA kag 7752.0 27287.0 ll IthulfJ tfustr27291.0 tio 27275.0 rsibtlttt1V l1batlllM rsibtltttl1batlllMI -924.0 tjU -856.0 tHut tHutJ 27435.0 27491.0 1V27487.0 27475.0 rCJlltJm alrCollumtorn 8304.0 27467.0 CIJCnCoialchoa CIJf CIJAaJchna Cnalchaa 27863.0 3232.0 27919.0 ialchoa AaJchnaalchaaCounty Coouty852.0 Abstract CotwxqK 9588.0 Cof CoI2256.0 28315.0 28363.0 twxqK 8560.0 8484.0 28387.0 Of Of1C 28339.0 tdI tdIrt1 3256.0 28559.0 28603.0 vrrt rt17236.0 28595.0 X 1C1f28599.0 Ooon 7548.0 28619.0 gyga 28580.0 ITC ltir28575.0 28571.0 titWK JI 9020.0 ltkst1 YWie YWiek 28723.0 28779.0 28731.0 lf 6708.0 28735.0 k 28755.0 f4 it7644.0 7996.0 JCKRI 28747.0 equ 28739.0 wI 28911.0 28968.0 7460.0 28971.0 7464.0 28919.0 HAJSfsMiI -1164.0 28939.0 1ro HI lIY8992.0 FI4 FI4I FL 9060.0 28975.0 9216.0 28931.0 iIve 29079.0 29291.0 IveduIUSfjrjuilre duJtenrrJuaire29271.0 Abatract8876.0 29267.0 Abu 29283.0 tract 29263.0 tm bul brutdrIwith rems 29435.0 29452.0 29516.0 ae ems 29459.0 wlUifaclllU facll1UeaClUtJ 8508.0 29455.0 rOffprIrnpartlaf tmpasUag29447.0 Im altla 9008.0 Full FvllFullInformation FvllofoniiuUoa 29463.0 iIctormaUoa 29499.0 29595.0 Information IctormaUoaofoniiuUoa29624.0 conrtTnlnjc conaomJnIC29667.0 aon ern1n 8972.0 29615.0 Vkl bI29619.0 Ia ofofray 29651.0 oi IJUlY 10192.0 29796.0 29891.0 29863.0 ray ujysad aad29811.0 29807.0 land lutda29803.0 tJJ to29843.0 29799.0 Al AIA1Aehua 1088.0 thustoanty thustoantyin -1088.0 9896.0 t1w 29968.0 JUlY 6724.0 AJ1 winbssiaets buiDaabutaeu29979.0 trafinacted tartaacted7864.0 tlU -880.0 prOIIpU 0DU3prOIIpUj 0DU3I30387.0 30407.0 30495.0 30531.0 30583.0 30535.0 30571.0 fl xmlns:ns5 ID24 11084 7880 10660 1812 ns5:type 14704.0 14752.0 17119.0 17107.0 12280.0 13928.0 12316.0 14492.0 14012.0 14660.0 utlS 14528.0 16172.0 2272.0 15088.0 16687.0 IIt 16332.0 16983.0 16855.0 17699.0 17007.0 10668.0 2524.0 11112.0 2540.0 stwiI1piFr 10692.0 3220.0 13936.0 CASTIA 13872.0 14792.0 ST -2364.0 17155.0 STFor 17815.0 14068.0 Por14532.0 Infants 15448.0 3792.0 15360.0 15928.0 ChildrenjRIJIJThe 15836.0 15932.0 Children 16899.0 ChildrenMIUMMMHHM ChildrenThe 14384.0 MIUMMMHHM 15320.0 4011.0 VUMHn 15240.0 1172.0 15780.0 CTUJHUUMBMHHAa0 15736.0 CTUJHUUMBMHHAa0The -1172.0 jRIJIJThe 13912.0 14728.0 4208.0 Kind 14496.0 15616.0 4220.0 16400.0 Nava16176.0 HaveAlways 17159.0 17879.0 4215.0 1jt -16.0 17895.0 10660.0 4772.0 jt 10908.0 AgetabkPrcparationf 10756.0 12968.0 wAs 12944.0 wAss1i1111atin 13328.0 14312.0 Always 15704.0 Bought BoughtBears 16719.0 Sou -1008.0 16459.0 16240.0 1308.0 16619.0 aAgetabkPrcparationf 17983.0 10848.0 slmilati s1i1111atinslmilatitiog 11600.0 11976.0 ToodandB 11492.0 13088.0 ula 12872.0 tiog 11188.0 UaiSlQMpcbs 11144.0 aodBowels 12200.0 13212.0 13176.0 ofHC5S 13392.0 14016.0 Bears 15096.0 theThirty 15608.0 15100.0 theSignature 0Signature 17167.0 1464.0 SignaturePromores SignaturePmmotesDSignature -1460.0 Promores PmmotesD11716.0 DJtes800CheetM 11876.0 DJtes800CheetMOOSS -1636.0 12040.0 estltsitCheerfill -1312.0 estltsitCheerfillmess 13368.0 mess HC5SOOSS6775.0 11248.0 HestConWns aool1estCOntAlnsIcstContdns12824.0 ndttwr Ddttwr12788.0 ndttwrOpmtntMorpbJne 13416.0 13100.0 thcr 13084.0 thcrmiMorphine Of11VT 10832.0 OpmtntMorpbJne OpmmMof1hine11228.0 miMorphine -1036.0 12328.0 wrMJaeroL wrMJaeroLNOT nor mrl 12652.0 12680.0 MIoua1 12764.0 MIoua1NOT 13112.0 taL NOT 11VT11396.0 7204.0 NAHC NARC11336.0 1396.0 NARCOTIC 12120.0 NARCOTICtUJs -1396.0 12792.0 12172.0 OTIC OTICApcrfcct OTICa 10956.0 11128.0 7851.0 11052.0 11232.0 lIBaitlhSwIzin7 11236.0 lIBaitlhSwIzin7Agebn -1568.0 12800.0 tUJs -1244.0 tUJsFa 12136.0 11204.0 Agebn 11260.0 Fa 11588.0 hS 11360.0 hS4Y 11836.0 8023.0 Je 12044.0 11996.0 Ji4itbJSti 6728.0 11256.0 4Y 11380.0 i4itbJSti 11772.0 12012.0 11952.0 tiI 17579.0 17943.0 11216.0 gw 12192.0 16971.0 16887.0 ngw 12292.0 8772.0 12356.0 le 17911.0 11736.0 14984.0 12336.0 16384.0 Use 16599.0 16663.0 -516.0 17179.0 16967.0 16895.0 8tion 17175.0 10892.0 Apcrfcct Apefectfemcdy 11572.0 10896.0 -1404.0 12300.0 11520.0 11616.0 rorCoMIp forConsttps12304.0 forConsttpstion -1024.0 13388.0 12368.0 -1020.0 12676.0 Consliv 12636.0 Conslivlion 13292.0 9591.0 9624.0 tion lionSour 11164.0 11756.0 StomchDianttoea StotnlcbDilUThStoTMcbDiarrhoea11720.0 StomchDianttoeaYonns -1660.0 13424.0 13248.0 eA 13428.0 eAormsconvutsionsFeverish Yonns 9787.0 jConvulsionsFevcrish ormsconvutsionsFeverish11420.0 jConvulsionsFevcrishness -1900.0 13348.0 15328.0 ror 15504.0 15568.0 9864.0 Or 15976.0 16224.0 15972.0 16431.0 16228.0 uver uverTit -940.0 16743.0 16691.0 16995.0 16923.0 rt 17163.0 rtacss 18035.0 10664.0 10016.0 10087.0 ness acss10688.0 ncssandLoSSOFSLEE 11220.0 ncssandLoSSOFSLEEI ncssandLoSSOFSLEEft-2312.0 11272.0 10023.0 -1864.0 mdLOSS 11584.0 11620.0 Loss -596.0 12216.0 10055.0 12624.0 SLEEP SLEEPTnr -660.0 13284.0 10220.0 11092.0 10416.0 Tit Tnr10456.0 11392.0 Simile snbs11928.0 11844.0 12780.0 ofNEW 10392.0 17971.0 10436.0 Vi 18031.0 10488.0 10915.0 NEW 11920.0 10912.0 YORK 12392.0 YORKtXACT 12772.0 12420.0 RK 14432.0 Thirty 14980.0 10635.0 15688.0 15124.0 15056.0 15288.0 Years YearstXACT 16204.0 -948.0 17151.0 16451.0 10632.0 16380.0 16703.0 16647.0 16927.0 16871.0 17759.0 10672.0 17147.0 Vtl 17919.0 10667.0 17999.0 17791.0 17795.0 11087.0 18471.0 10608.0 iNEW 10864.0 11200.0 iiiktULi PAQTADIA 13540.0 PAQTADIACXACT -3216.0 17135.0 11288.0 iTMI 15664.0 17587.0 11708.0 16024.0 17755.0 17667.0 17843.0 11040.0 12084.0 tXACT CXACT11592.0 12075.0 COPrOT CQPYOTCOPYtJT11528.0 12296.0 12067.0 WR 12240.0 12072.0 WRAPPCB 12552.0 PP 13108.0 B Ulillil 17439.0 12175.0 17599.0 17535.0 Jh 17663.0 11908.0 xiii xiiiTNa 18199.0 14260.0 12428.0 TMI TNaOBMTAU 6INYY14488.0 15116.0 aMt 14996.0 15208.0 OMPNT 15440.0 15544.0 MY 15700.0 15804.0 Maw NCW16112.0 roar VOUT16068.0 16475.0 OtT ativ16435.0 15992.0 12716.0 16056.0 17695.0 12647.0 xmlns:ns6 ID34 9616 7620 10256 13028 ns6:type 13764.0 13767.0 12056.0 DIAMOND 14856.0 ICE 14520.0 GO CO0015720.0 GOGAINESVILLE 16727.0 16044.0 00GAINESVILLE 16048.0 COGAINESVillE 12868.0 14304.0 FLA 14092.0 FLAHas 14644.0 FLAlIas FLAllas 14640.0 10648.0 14836.0 14844.0 Has lIasllas11172.0 14839.0 built IUiltoiu l1llohll12260.0 12108.0 12560.0 thiMnost 13532.0 12768.0 14871.0 tllOot illOst12860.0 13644.0 uptolati uptodntt14708.0 14896.0 14756.0 15024.0 15348.0 plants pllut15188.0 15996.0 16539.0 t11CrthoState 16867.0 thotnh t11CrMato 15104.0 Matotnh 12284.0 12760.0 15108.0 1lorih113732.0 nnd1111113528.0 14120.0 hn IHt14584.0 now non14476.0 15228.0 optn OIWI114944.0 optnlarge 15752.0 OIWI1A opt 15644.0 15564.0 IAjrfqw 15676.0 10612.0 15495.0 15499.0 Ajrfqw 15507.0 -1652.0 10916.0 large 10788.0 11748.0 Cold 12476.0 Storage Room 13408.0 14508.0 14300.0 15080.0 Curing 14852.0 16120.0 Meats 15872.0 MeatsI MeatsAndMeatsnlMeatst-752.0 16175.0 10700.0 16180.0 11104.0 10844.0 111handle hnndlIlitll1IP13300.0 llnt411trtt14144.0 15000.0 its14884.0 17827.0 16232.0 15184.0 ytits 17875.0 11480.0 16168.0 16239.0 Ilow16244.0 11916.0 12036.0 prepared pnpnlpd11732.0 15380.0 largo lnrg12988.0 15796.0 16251.0 15896.0 16072.0 quanti qJnutidliunti15852.0 quantities qJnutit16771.0 16791.0 16283.0 17643.0 16863.0 10620.0 16436.0 16443.0 ties tits16472.0 10992.0 10728.0 ip 16448.0 10888.0 11384.0 11948.0 11820.0 16440.0 FAKMKK 12380.0 -1136.0 12524.0 1111 12992.0 12960.0 13208.0 nt13524.0 16507.0 hl1113400.0 np 13944.0 14064.0 plant plnnIlallt13760.0 14552.0 14592.0 located Riot14608.0 IWI 15476.0 ttd an15968.0 11tIho15840.0 I16304.0 16416.0 Sea 16004.0 Seahoard 16555.0 tvtlnbOil 16775.0 tvtiOill1 7148.0 10636.0 hoard iOill1bOil 11024.0 10988.0 11344.0 Kailrond HailJod12480.0 fOlltfont16716.0 12876.0 13192.0 13628.0 Arredondo lIldolldo11Itdnndo13420.0 14904.0 St fit14800.0 15052.0 16740.0 15392.0 just 15092.0 jll 15772.0 West 16208.0 pst 16503.0 16439.0 ofSeaboard oflaoard 17723.0 16831.0 te 17783.0 tHUIDITC 10256.0 16976.0 12840.0 Seaboard laoarddepot 13832.0 depotWRITE 17143.0 17580.0 Iooo 17868.0 ooo oooWRITE 17651.0 18075.0 10284.0 18295.0 HUIDITC WRITE -2244.0 N14624.0 STEVENS STEVENSHIGH -2224.0 16847.0 13888.0 19023.0 19032.0 HIGH 14344.0 19027.0 SPRINGS 14000.0 15520.0 FLORIDA 15292.0 FLORIDAKm1 FLORIDAIlia-804.0 16324.0 16088.0 DFIJI 16192.0 11016.0 FIJI Km1Ilia 11368.0 11496.0 Iii Ili19624.0 Lnv 12208.0 12512.0 Irie 12708.0 Pri 13604.0 19688.0 nn13160.0 13980.0 19620.0 iho tllt13860.0 14444.0 Following 14180.0 llh -1084.0 15528.0 15072.0 Vitig 14908.0 15756.0 Joodn ilditnnly15524.0 JoodnWATCHES 16316.0 ildWATCHES 6672.0 10868.0 20231.0 20244.0 WATCHES WATCHESJEWELRY 12984.0 20239.0 CHAINS CJtAINSCHAINSSILVERWARE 13672.0 15516.0 CHARMS CHARMSNOVELTIES CHARMSJEWELRY 20671.0 20691.0 JEWELRY JEWELRYCUT -900.0 11768.0 13224.0 20683.0 SILVERWARE SILVERWARETOILET 14440.0 NOVELTIES NOVELTIESKODAKS -1044.0 16547.0 NOVELTIESCUT 10876.0 21123.0 21140.0 CUT 11388.0 21135.0 GLASS 11244.0 13444.0 21131.0 TOILET 11980.0 14240.0 21128.0 WARE 14100.0 15460.0 KODAKS 14788.0 KODAKSEDISON -776.0 16236.0 21536.0 EDISON 12820.0 13276.0 21527.0 VICTOR 13132.0 14104.0 PHONOGRAPHS PHOHOGRAPItS13952.0 PHONOGRAPHSOn -1412.0 17583.0 4On 16959.0 21460.0 10600.0 10924.0 Above 11196.0 Goods 12464.0 Can 12612.0 13152.0 22064.0 Save 13048.0 13572.0 Money 14688.0 16216.0 TODAY TODAYGOOf1rOOOOOO 22452.0 GOOf1rOOOOOO xmlns:ns7 ID39 7992 8300 10248 23047 ns7:type 23047.0 23071.0 Oldest 1560.0 12416.0 23055.0 Whiskey 12184.0 14200.0 House 13976.0 16128.0 South SoutbSouthEetablUhed SoutbEtabllahcdSouthIstahlltshrd23796.0 EetablUhed EtabllahcdIstahlltshrdEetablUhedi 13932.0 23799.0 8h milt14168.0 8hp 8hI14452.0 1III 17635.0 13664.0 p 24236.0 24256.0 III 11100.0 12228.0 11704.0 12660.0 24243.0 24247.0 24287.0 OIUUhl13700.0 14280.0 OUIurr 24300.0 14772.0 Hlunltf lllitltlF24280.0 W11UA 15496.0 W11UAPure 24275.0 nUA1IH nUA1IHI 16611.0 13768.0 24491.0 24504.0 Pure IurrIur14248.0 tine tlue14164.0 14620.0 24507.0 14548.0 14960.0 rjc rJtrie14864.0 15468.0 HyHj15212.0 tiie15668.0 Lh 16016.0 24495.0 gallon Kftllon15904.0 16296.0 lion 16623.0 16679.0 24499.0 tSOO tSOOFllur 17087.0 16759.0 80U 8W8WFour 16763.0 24511.0 80U8fi 13676.0 24691.0 Four Fllur24699.0 14860.0 14988.0 15120.0 15220.0 24708.0 ntinrt uutIarttrts 15744.0 16008.0 24683.0 8fi 3bt3btFP 16012.0 8fiBH 8fiI S60 S60I S60X16340.0 13680.0 24831.0 25023.0 15224.0 24863.0 24860.0 FP 15260.0 15352.0 24855.0 XIKKBH XIKKBHri 15356.0 Pit 15788.0 i15748.0 BH is15832.0 15908.0 PHKtAJD PitiaAIDPHKtAJDH PH JoP 16467.0 AI J17307.0 17371.0 IfafJ 17367.0 rFu 17767.0 25151.0 14628.0 fafJ 14976.0 14692.0 25339.0 14668.0 14764.0 HO Fu14732.0 25275.0 15404.0 CUIKJHAN tUMKSCUhEMAYCUIKJHANli tUMKSHCUhEMAYIII16280.0 13788.0 25491.0 25507.0 14316.0 25504.0 ivnaylvnntn 14324.0 -1112.0 15436.0 25555.0 25543.0 nti 14932.0 lvnnin 15632.0 Hy Ry15432.0 15636.0 16284.0 25495.0 Rich nich25499.0 andmilieu 16823.0 aneSandlow aneSH 13948.0 25671.0 25727.0 ri 25691.0 milieu 14036.0 14272.0 low 14512.0 14740.0 14516.0 14776.0 14872.0 ISy 25676.0 ihotht14968.0 tJfnflanllorr25679.0 1276 n162ib16559.0 Focr YoarFogr16388.0 Focrfull Yoarfull 16955.0 Fogrfull 1400.0 25851.0 25875.0 qoart fltUtfrlntirtt25892.0 25855.0 15640.0 alr 15880.0 alrI 15936.0 25867.0 JO UJUJIXIIt JOKXIHK 26039.0 KXIHK IXIItKxiItr3672.0 11536.0 15868.0 15912.0 t4n26023.0 1HKIAID tnEIAID16116.0 1HKIAIDhandle tnEIAIDAn iltiI 16827.0 26027.0 1ID 16715.0 1IDst 12168.0 11860.0 26376.0 st 12144.0 26472.0 x 12220.0 12544.0 26408.0 12404.0 14940.0 26379.0 An 12592.0 Atfti1L 15264.0 15620.0 26383.0 ItI 15728.0 HIF HIFtrs 10496.0 26519.0 trs 11648.0 tGr 10704.0 26575.0 12100.0 13780.0 26612.0 26599.0 IIlaalt1 26647.0 snt 15692.0 26631.0 sy 15652.0 26607.0 whisker wkhr26603.0 1tr 16651.0 1treilua 16903.0 17423.0 17499.0 14268.0 26779.0 26791.0 tUuta eilua26787.0 15064.0 15128.0 15192.0 15556.0 parr YaKIr15252.0 16036.0 r11 rglt15948.0 gartrte 16328.0 gartrte14U 16943.0 urtt urtt1If 12852.0 26847.0 26883.0 13072.0 x2 12940.0 26887.0 13484.0 27007.0 1If 11504.0 12224.0 tir1 12052.0 AlaSF 26963.0 14U 7II 14564.0 14568.0 14596.0 14632.0 26988.0 FCPltFw4 14664.0 15512.0 26959.0 lIY 15456.0 Jr ii1t 16695.0 Jpf 16699.0 16751.0 tD 16879.0 tDCIIPItItI 17139.0 27064.0 ysv 27219.0 pf 14716.0 27359.0 CIIPItItI IUI 15660.0 15340.0 27363.0 mU Itlf ItFItlfOil 16144.0 17719.0 Iu 17751.0 13756.0 27583.0 fiT Hy27592.0 tb14372.0 Eall 14684.0 15132.0 F16156.0 fMl 15724.0 27619.0 27627.0 27631.0 f1 f1t 17123.0 27624.0 12488.0 27679.0 q 12536.0 10900.0 Oil 01111012.0 KKNTLTKY iiKSTGt27675.0 tUU tUUwt 12848.0 12600.0 Olt Uit1 12956.0 27743.0 JU 27747.0 12140.0 13660.0 13924.0 27767.0 J2 14096.0 14140.0 27764.0 27759.0 tx 14216.0 15324.0 tJt rt1tr t1Khf15560.0 27755.0 lla 16575.0 llailkrr4 1h 17547.0 3228.0 10264.0 27936.0 10280.0 ilkrr4 10444.0 27968.0 wt toct10696.0 iiura 10764.0 27939.0 IetM 11440.0 11292.0 LUll 11516.0 27979.0 iBuJ 11728.0 28000.0 11776.0 ili vxrrhoiM 12620.0 holJl hOnrlrdot1adaand doab t1aante 28111.0 28167.0 anteab 10884.0 10792.0 28211.0 28159.0 10840.0 Hf ltf11540.0 28163.0 11636.0 12080.0 28155.0 Raflon 12308.0 non krion12720.0 12808.0 IItJCntrF 13196.0 13144.0 28183.0 CHU 111114656.0 hlINTCIi 14544.0 TnU 15576.0 CLrR CLrRur 16080.0 CtL 28119.0 15900.0 16272.0 tft 1260.0 16491.0 iFour 10944.0 28331.0 28383.0 10952.0 11108.0 11168.0 ur 11408.0 fall talltoll11340.0 11812.0 quart qnnrl11696.0 12452.0 18 asn 12608.0 12844.0 V1 12744.0 13648.0 RWt 14136.0 14392.0 sI 14296.0 WoU nceJl15420.0 28335.0 15532.0 tbrr 15988.0 ttfXrKf XFxIRR 17027.0 916.0 28507.0 liar14964.0 28527.0 14892.0 28539.0 15200.0 28523.0 15316.0 28555.0 15248.0 ete 15412.0 28643.0 fXrKf FxIRR12532.0 28647.0 12372.0 28639.0 irt 28631.0 tflErIO 12932.0 rIr 13596.0 13552.0 kI 15344.0 kW 15204.0 28675.0 15408.0 28688.0 rte 16124.0 16499.0 rJr1 16835.0 lNN 28855.0 28963.0 NN NNWI 16999.0 29083.0 29095.0 WI 10936.0 tandle10940.0 tand 11512.0 11376.0 Ie 29091.0 nil itll11688.0 11th 11864.0 thfl12032.0 Ivxisn 12128.0 29087.0 1nJ 12712.0 12572.0 29131.0 br braa4 bria4s13312.0 4i 13488.0 13556.0 13656.0 13796.0 KI K129140.0 13988.0 29099.0 aa iteA14456.0 4k 14536.0 1rh 29143.0 29147.0 15112.0 If4 15216.0 15888.0 29135.0 tfItt 29111.0 4r 29108.0 1IItt yhyht 16643.0 29127.0 Irfftho 16583.0 Irffthob 10324.0 10288.0 29323.0 10420.0 ant arwi1b41wII11372.0 29307.0 save11300.0 yo 101 11992.0 t12088.0 12180.0 12248.0 29303.0 tIUJ fqut12884.0 Ui Ws12804.0 6O YJliti29315.0 iwr JP 13536.0 tiI 14056.0 14112.0 ref 14388.0 t14308.0 14436.0 1si 14760.0 29299.0 16292.0 It1V 16919.0 16859.0 29331.0 lA 16963.0 lAet 3668.0 29443.0 10376.0 29487.0 et10292.0 10512.0 10948.0 catnlocu eaLllocuecatnloEue10872.0 12016.0 Freo FreFreoTHE 12400.0 Yr 29484.0 apoa gpost12964.0 tpptt LTHE 13824.0 13864.0 tTUE 11032.0 29703.0 TUE29707.0 ALTMAYER 12904.0 29715.0 12752.0 29719.0 FLATAU FIATAU13056.0 14184.0 29727.0 lGU 14676.0 15572.0 I29723.0 10248.0 29951.0 720722724 720 120-1060.0 11308.0 722 10524.0 722124 724 fndarid72 11684.0 121 11944.0 12112.0 Wet Wht12548.0 12644.0 Ray 13052.0 30019.0 ftt Inrwt 13236.0 14524.0 rltthi W4u4j tfj 15792.0 15956.0 16200.0 30007.0 16184.0 16412.0 JtIW 16675.0 IRh 30095.0 17099.0 30147.0 17071.0 Aj Ajr Ajs10592.0 30503.0 30555.0 18155.0 16220.0 30579.0 30611.0 13500.0 12816.0 18443.0 30855.0 fy 30959.0


xml version 1.0 encoding UTF-8
mets TYPE urn:library-of-congress:ndnp:mets:newspaper:issue PROFILE urn:library-of-congress:mets:profiles:ndnp:issue:v1.5 LABEL Gainesville Daily Sun, 1907-12-30
xmlns:mix http:www.loc.govmix xmlns:ndnp http:www.loc.govndnp xmlns:premis http:www.oclc.orgpremis xmlns:mods http:www.loc.govmodsv3 xmlns:xsi http:www.w3.org2001XMLSchema-instance xmlns:xlink http:www.w3.org1999xlink xmlns http:www.loc.govMETS
!--METS HEADER--
metsHdr CREATEDATE 2006-07-28T08:49:25
agent ROLE CREATOR ORGANIZATION
name University of Florida
!--DESCRIPTIVE METADATA--
dmdSec ID issueModsBib
mdWrap MDTYPE MODS Issue metadata
xmlData
mods:mods
mods:relatedItem type host
mods:identifier lccn sn95026977
mods:part
mods:detail volume
mods:number XXVII
issue
44
edition
1
mods:originInfo
mods:dateIssued iso8601 1907-12-30
mods:note noteAboutReproduction Present
pageModsBib1
Page
mods:extent unit pages
mods:start 1
original
mods:physicalDescription
mods:form microfilm
reel number 00175040419
sequence 911
mods:location
mods:physicalLocation authority marcorg displayLabel University of Florida FUG
agencyResponsibleForReproduction FUG
Present
pageModsBib2
2
page
3
00175040419
913
FUG
FUG
Present
pageModsBib3
3
2
00175040419
914
FUG
FUG
Present
pageModsBib4
4
5
00175040419
915
FUG
FUG
Present
pageModsBib5
5
4
00175040419
916
FUG
FUG
Present
pageModsBib6
6
5
00175040419
917
FUG
FUG
Present
pageModsBib7
7
4
00175040419
918
FUG
FUG
Present
pageModsBib8
8
7
00175040419
919
FUG
FUG
Present
pageModsBib9
9
6
00175040419
920
FUG
FUG
Present
pageModsBib10
10
8
00175040419
922
FUG
FUG
Present
!--FILE SECTION--
fileSec
fileGrp pageFileGrp1
file masterFile1 USE master
FLocat LOCTYPE OTHER OTHERLOCTYPE xlink:href 0915.tif
serviceFile1 service
0915.jp2
otherDerivativeFile1 derivative
0915.pdf
ocrFile1 ocr
0915.xml
pageFileGrp2
masterFile2
0917.tif
serviceFile2
0917.jp2
otherDerivativeFile2
0917.pdf
ocrFile2
0917.xml
pageFileGrp3
masterFile3
0918.tif
serviceFile3
0918.jp2
otherDerivativeFile3
0918.pdf
ocrFile3
0918.xml
pageFileGrp4
masterFile4
0919.tif
serviceFile4
0919.jp2
otherDerivativeFile4
0919.pdf
ocrFile4
0919.xml
pageFileGrp5
masterFile5
0920.tif
serviceFile5
0920.jp2
otherDerivativeFile5
0920.pdf
ocrFile5
0920.xml
pageFileGrp6
masterFile6
0921.tif
serviceFile6
0921.jp2
otherDerivativeFile6
0921.pdf
ocrFile6
0921.xml
pageFileGrp7
masterFile7
0922.tif
serviceFile7
0922.jp2
otherDerivativeFile7
0922.pdf
ocrFile7
0922.xml
pageFileGrp8
masterFile8
0923.tif
serviceFile8
0923.jp2
otherDerivativeFile8
0923.pdf
ocrFile8
0923.xml
pageFileGrp9
masterFile9
0924.tif
serviceFile9
0924.jp2
otherDerivativeFile9
0924.pdf
ocrFile9
0924.xml
pageFileGrp10
masterFile10
0926.tif
serviceFile10
0926.jp2
otherDerivativeFile10
0926.pdf
ocrFile10
0926.xml
!--STRUCTURAL MAP--
structMap xmlns:np urn:library-of-congress:ndnp:mets:newspaper
div np:issue DMDID
np:page
fptr FILEID



PAGE 1

kIE-JItiiiiiaQuarts340OYLEReJACKSONVIifltIJ-IWheCoGAINESVILLEIMCornDECEMBERjrl-rallowedtoadvance-thekidneyjxMsonRiIRyetiss-uesFourir-CUAnQoCAE-KRSTATEOfficerNEKSWINEunhealthyReventrecommendcomplaintscomplaintsextraordinary-effectBRIE-LiveperiodicalobtainingorderingPrepaidH-osesFullvegetablepChrletmas1iLQ11ExpressPrepaidExpressmedicinesirregularbackacheheadachepeculiarManyeuddenA-MdmedicinederangementBecausefurnishestjhCRANCcasfndenu-ytiksuperlntendencyFLAJelemmaSoternSuddenrepresentationpainfulmedicineSwampRootCongregationalExpressATLANTAspecifyImprisonmentnamcSwampgoldenperfectOdessaDeathsailmentsSwampRootaccomplishedimprovementjjlahlpmontdelicatetryingbenefitwithoutManycoatumpttaaDevelopmentMullinsheadquartersseveraldisappointedemploymentUinglmmtonCarduiHinghamtonpreparationsCauseCongressmanTHEtroubleentertainingChristmas-TheFsubscriptionorInterruptedStrawberriesLesdistressingbottlesnewspaper-TheWashingtonand-onedollardoubtlessly1895-Wauelmlarequested-byconstipation1907CarduirotcrassloueconstipationcommutationunpleasantAssociation-CCarduirememberanprvclatlonperpetratorESUNpneumoniaLegislatureothersmillionprevailingJacksonvillerrgardtnguniccialistsAskmenialcomplaintscomplaintsRheumatismPetersburgPetersburgImmigrationcompelledwhichLinesthoroughlyrefrtKortitorHfemalePetersburgJacksonvillephe-nomenalstrawberrySteamshiprmmiiiendrdEFPetersburgpainsPetersburgdangerousnourishmentOFpardoningsubjecVinipnifirviitgrounds-willwomenSparkmanabovealtornoon-TwsuffernecessitycourthousecommissionsatisfactionMGkidneysJack-sonvillecommissionAugustineintroducedcompletedespeciallyyearsfiftycentthemselvesvegetabledo-ctorsthreatenedAugustineNeuralgiasufferrequestingwomenpassingautomobileamusementsvegetableobjectingapoplexycelebrationKissimmeepreferredttufulHollonbeckIfiliiOOlM-loveveryCaptainsfoundUaulhhrsHomesteadAsso-ciationHeretoforeassociationreliefWartmannperfectlywritingAssistanceWineHighwaywomenHwiito1fi8JshipmentrailwaysIn-tcrraptl4bts4Hwtsl-imekidneysCompanyprisonerscommit-tedswappingorganizedmailorderdrugnonderfulreliefMeutaraiaCongressCon-tractedextensivedyspep-stagirlsConumrcescaldingpleasantconventioncauterizedCongresscandidateroughingresignedwonderfulBurglarssprainedplantingportotletrestaurantexpectedMtlbyptrectbecausePensacolaWnuchulnclubhouseHIt5l17riiiinturningDecembera-tarnntularnnHInccommittedRyeconventionSaturdayshuttingstrengthafterkidneysbuildingmotorboatsometimetitItblilienroll-menttheirInspectorBollardsSalvationprisonerthroughremedyimprovepirftrtlvfromvhiskerindustryTarantulacapturedColumbiabothholidaysInstantlywhiskeypositivedis-coveryThetonicbuildingbuildingrendingbannnn-HewithSWampAtlanticformallyTeachersWorkmenChrist-masinenclngJanuarypositionpotatoespastimeJanuarywhoShippedelectionescapedSavannahwhiskeyiiuclkiimlpositive1olumhlndiges-tiontheMathewspassengerrecentlyhighestSpeakerconditionGovernorriHolptHpro-motedbedroomLinimentprisonerLinimentidentityNavasotaSprainsalwaysKilmersof-bannunaopeningWilliamslloyntonlOxprossSouthernINopiatepruundsnionAtvcolptsamplepocketsFebru-aryshippedMinudaiitHerbluewhetherSmyrnaChamberCitizensusedparcelsmonunmitEdwardsrailwayregularduringconven-tiongrantedkidneyCom-panythoughtmootingKilmersHusliiensnUo-paManateehealthytakedeclaredthroughJacknoumakinghoweverForsylhinstalledInstitutehtppoUpleasedregularwhetherkidneyDeLandretiringdiv-idenddecepIncrease80000generousInjurieschoicestLflowtomatoesstoreJohnsonbaseballsocietygarutlyCon-tractJanuaryMohawktakingcompanyFlorencebaptHMialwaysshops-ItcirculiupoorofwhopjvventnHrowardcriminalllerblneVillagebnlMtttreatmentmerrygomistakerespiteerectionmistakeopenededitingMusclessentenceLETTERalwaysllrownrdJohnsonfamlaementioncountrysafesus-tainedopenedsickhandled3ttlisIwirrleyoufishingItcvennotttanaaTampathoughelectionreachedFokyst-oolt11DmyjLeagueTampawithoutfishingtroublessellingFloridabecausesaloonsAddressUrcvardTampabeingSOsupplyfarmersBruisesliotveruaranteeBeach-isHasfavoritegreatACoydivision100000himselfrn13htt1TampaChtttinoogWRITEduringcountyfeel-ingBladdercarloadbladdeiutyoneseventyImreimcountyportedWt3feljjngraigh3respecttroublxoxonilputttiRintuitenteredt-bmdlasleepcountyandControlgroundBartowexpressHrldgocountyandNormalbladderdisease100satifrylargerfreightdiseasepreimreover-comescatarrhMarionneededacceptVl4Ut1UdecidedaddressautBannerremainexpressLeRoyWhatssessioniTtmlorangehappyarounderectedseveralspringTurnerFloridapubliccountytn-couitvsuicideseveralandfortuneRecorditescountyorangesfailureStarkeConeyposedsimilarstreetsOrderdiffmonthsmarketFloridausingneurlywheelsdecideinjureandnamedchurchacreagepub-licratherhis-torybenefitassaultCollierandgradelicensebadlybusiestaronadmightV-Ilmsproperscale-toBartowCrtltamramountscribedcorner-ofrebuildoveralmostWorthbushelcigarscountysectionwoundjailorSheriffC-buetnenuittaoM-Markkid-neywithincorrectshousesstringI278monthknownoffer-edPerrydoingktroMapplycausedvaluedbottlerdosedmod-erndwcrtblnrdoingdeathsUnianrefunddinnerLadleswinterEarlynightClyderepeatstandsraisedgrowerspentvoroutlpapersorganstradesHrownHlrtyquartzcatarnatrcdwatchearlydecidedepotpointTradewintermakesbeforenandoBcenlcschoolmoneyyardswritesoacnpoeffectsTherepantsICUtbeingagain51ftkBoardseasonsgivesrex-pressBoardthecommoncalleddancebringArmyrolligivesleachPublicSweetstandspleasamongMiamiprojwrSwumPublicMrMvworthmentsbuaclaMiamibottlelargetitleslr-m1TENenlistIslandtnrlloubunchassistmouthgreatlentilIHIUCWhenOcalawowMmoneytrailerwritesWolfetrainsAdvisoryMaker11111111aboutittoiuwhichSouthhlehroundresortIoneeearlytajniPensatimesbichreliefTheyenvelopeWoodworthrentlinkerOfficerJnlllomadeBittenresortnulnodis-easeTexasneatjonhousewhichOcalasymptomsIequaljTherewore-aThortfreezerais-edyoungwordsplanticstaiforaboutkilledbottleorderhoardhorseaboutWhenmanyHighworksxl1efruitsOcalastockorganforfor15000foundCoastoownysuccessbreakmadeOcnlitcuredyeahsmallprizetruckresultbloodCaptMedicinesutrHDontbittendayswoodHotelPlantwhileothermuchcuredat-tackforforRomeloutspapercitiesmadebreaksmallanklelooksagentLandunionmuchpainurinedaysSnowSouthhouragedHa-ofTheymakeSnowforillsretelltetraresulttakencyStatedoornkeepkeepgmuosortlcrMensninnyoftensexseasoncouldwhileDadoheartAlvinquartIMantstockou-4JreasonampahavePalmdownNyConstgoldheartwhatnegrotheyonlyMotelOldfromgrovenegroseasonparktherelongawayhavedoClaygrovepro-oseoftenIrrrweeknegroiljmsmadeextraweekusualfilrtwhenyearspipetheirtoolVaReveryYorkweekoiirlimitStateseasonhavescarceincoclassTennbondhotelthirdshallcountextrrtnegrogamehaveliverwasteLeondtdkdrugrsecureDayCity3500betshavenegrostatebusylaterhandhavehavedobonapierstarshavedaypostcenthaveoglePlantMrs-Sx11hantilkehaveThiswishfleshliverstrawCityfruitfixedtreeshtwcanfromtimeofliverourttheirbeenjustH-IStkbeenbeenbeenAtrototalLitheholdWillRootsolidbirorearsNewBidsvitaltowntroutfromfrontbeencashNewbeenLinobothGAfpastfromfromfromThisInEastusedstorebotharegaveruuallyeartotalouchCorngaveMpgthatTwoCitythathavebeenaicityTheTheCorrwisemailtruthEcordFrKlwithwithwellThetownmeetLinohcepurheirmostwithtookpunbeencolaholdtakeJotiRooteureatboonIftttTheAthaveColeThothatyouronetruthpiaceSoldyearwithcropheldbestSoldG-1vtfstdintowifeyeartfnImostallalsowellboatrmaythatclueThiscroporsenttellspureTheThoTbctthatcentfigsofrCk1openthatfirstTheu1boilJiThonextboutcantthatThwAimThethatwhocropyearcenttunicthatfirstthistiledrrndayofTheThekindYouthatthatsaysUNItandsaysIlHsameyulesoldiKYOakTheThothat31stfirstyearThowilljailfjcostProfThe10thTheForboytidiescametimettanoCEThecropTIltAndwereIAti-OforcYratecalldaythiswillwayJailral-oCroomownsthisHgsroomlastwilllotssiteAdviceandTbinwhosizeandcouncasesrexeywillnnmrwillandHerwillHorvthiswereT-atthlrwhonUtcostwereandandwaythisthisthisthiswillwillandfinelastandandrisethinI-tttugtrialwereTierandonhimandsitenailfreehall150tiveandandwilland140willcuresandwillTArnailwdrefineandandyourandlastandandIvMorthiswillwillr1randthatKanCputandandandhutwillandwilleverandwillandgetcasesandmdandwillBedhipsoonthisbigmilandImamluganyandtohasandyouhaslifetheandmindthistheTthefineandthisperovernearsoonhaslawhashasandcellandandhastoovertowillAsklasthadLwillhashayntdlacthetho7thoverWIhashitsike000inhadnodnmlcellhastv4overandlaybutdurhaNhashasthethethehitshasthethelaitnailthemidagoDochitsNwererantMJtlfdthehasnearsoonthethetheheryouXthewillyouanymanbuttieatnottheandnowTheandthethethethethetheperfewrule500thebillthethethethehothethethethethetheIIlIryouthecostsoonKilfulltheandbyhashasnownewnowthethothotillthetimethe250overbythethecureplainncacurernuinmannewtimethenewAm400thetiltthothethocasehas200EathethethethefullyMuthotheitiinowacrenotoutthethethethuthethetimethetheorIllsthebillcutethenewnotbybybytimethetheidOthethetheperthotheasWeRCmenthetheminkmenthutheoldWewashisthethe1fifthethecomthethepnperT1ohlJjputaidagonewnewtheperperrestwitstheDeptthetimethehisMrwaswonneyIlthetoforforforfortheWillforhisnunperHOOtheUuuajgasIaecornwitswillwurforforforNonowforforforforforto1wastfI-IwaswnstuyUStheforfort-IllhisforandhisforforbytiterDe-scoophnowtebyforforby1110MrfigforonetrdFretriotlforAforforoneforthe100byCU1nnronethforMryourtJrIupforforcarsendjsallallallSVrunfurtr-UthitnvnuseMtatiaJAbybyallallallarerunmirehitfurrunarebyDrarttinbybyfurgoCoalltinHIIarelyitshorunbyrunVthe0arcThenbytestacara-in101allWCa1stcanbitbetonArttoNiaStVfnilbedebooJheHASDrWambebeirebetytilttroreedaretllldbenousegoLirefrtlt11abotopUknStofWHinei30IhrimuicinonofofofWclofofonStsadofofWira-U43ofofofofofofofatStofofofofonStwillStrvtLofinofofofofofonofoftoofofssofofvofat10tjoftoAtIinyouofofIninistoofofoftoofofofofoftooftooftotoofofofatofurofgoilatIfIstoofChinininoftoatofofof1J4tooftoofdoontototouaninininAIninininInIntoNonantonotooftooftototoonanonanInCoininInInInAIfInisSinInIntoInInusasSt=oftotoofononon0toInInInIIIIninIntoInInMInMtilonanolinminweitotowasnn-Jtotos0orIonItIIIisUtrIntoisMasasMistoattowranasorinrCAIsisInisfsisIfIsryIKlitistotototoaatVIninr-P1IsisItNYonisitIsIsJhtrenn4sMNInAitismUfttItiBOuo0itrtltotoj1uuLitAGtiItaItortitllorisTAtoiHIfItrIsItoto>10stLIfifItI-rKitifiswisCIALill1litherR11Iwinmotorru7ib>isACaJSSItStoAtt>1CaIj1alwtLAlYJat-JIttitIn10G1NhcwT1Mhmixrdrtraaaaf1ft1IufUaaaa1ot61I-Iraaaaaa4n>aaaa11i-reaai-IanaaaKJi-oAIraIaajfsaauaAaIi1aaialft1aIanaIJt>nJrtAtanl>it4cJailIIr9Wt>tItiIietfIItr1rrItsifMKanIreHtr0ttiAJltorrt>1rjtIitrt1>+IIirIIprItD1ItIlf>IiII<1I

xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN00034\ocr\0485a.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:13285
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1933
splitwords:0
ScansoftOCREngine Character Count:11914
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:13945
Abbyy6OCREngine Character Count:13495
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;13495;2609;42.6986;86.8003
language:en
ScansoftOCREngine Predicted Accuracy:67.53%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:4751
ScansoftOCREngine Character Error Ratio:0.3872
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;13945;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:86.8%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:86.8%
ImgPrep Component Range:11868,13285
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;11914;4613;0.790163;67.5265
noPunctuation:1
ImgPrep Component Count Low Estimate:11868
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 10.0 ID4 24.0 ID6 23.0 ID7 31.0 ID8 27.0 ID9 17.0 ID10 16.0 ID11 14.0 ID12 13.0 ID13 12.0 ID14 11.0 ID15 6.0 ID16 9.0 ID18 15.0 ID20 26.0 ID21 63.0 ID22 72.0 ID23 21.0 ID24 49.0 ID25 69.0 ID26 58.0 ID27 33.0 ID28 29.0 ID29 4.0 ID30 25.0 ID31 22.0 ID35 3.0 ID36 19.0 ID38 8.0 Layout Page ID1 HEIGHT 30900 WIDTH 20744 PHYSICAL_IMG_NR 6 PRINTED_IMG_NR 5 PROCESSING PrintSpace 30728.0 20728.0 HPOS 0.0 VPOS 132.0 PC 0.86800003 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1544 19940 612 132 ns1:type simple language en TextLine 60.0 1644.0 String STYLEREFS CONTENT o WC 0.8095238 19168.0 1384.0 324.0 ALTERNATIVE 064.0 20527.0 332.0 S SP 19072.0 1456.0 STHE -24.0 20552.0 52.0 56.0 612.0 772.0 II 424.0 13748.0 2808.0 1080.0 40.0 1320.0 t 112.0 84.0 3244.0 1208.0 lj 396.0 2848.0 276.0 624.0 8680.0 1228.0 THE 5352.0 3328.0 2072.0 9448.0 GAINESVILLE 144.0 9304.0 272.0 576.0 11656.0 1192.0 SUN 136.0 11520.0 316.0 1632.0 12472.0 1124.0 DECEMBER DECEJ1B1m240.0 12232.0 284.0 1064.0 14240.0 301907 0.82539684 14104.0 256.0 248.0 14296.0 1108.0 JO -1008.0 15304.0 68.0 3 -248.0 14544.0 544.0 14760.0 1084.0 1907 0.96825397 14364.0 48.0 16532.0 1424.0 1 356.0 384.0 2776.0 208.0 1468.0 i ti -64.0 2840.0 264.0 3016.0 1412.0 168.0 xmlns:ns2 ID5 28299 6660 0 1804 ns2:type 744.0 4424.0 2232.0 1804.0 2300.0 I 592.0 1880.0 3464.0 CONGRESSMAN UNGRESSMAN1088.0 2376.0 408.0 864.0 5464.0 1948.0 CLARK 120.0 5344.0 CLARKIS CLARKf-864.0 6328.0 608.0 6640.0 1940.0 312.0 iIS -16.0 6656.0 812.0 1196.0 2420.0 304.0 288.0 f 392.0 4128.0 2552.0 IS 2644.0 1484.0 400.0 728.0 4632.0 2532.0 STILL STIES4368.0 416.0 976.0 5600.0 2516.0 ACTIVE 5360.0 ACTIVEIn ACTIVEif-976.0 6576.0 720.0 1056.0 5604.0 2512.0 ACTIVEI -972.0 6644.0 2960.0 6660.0 4836.0 1748.0 3316.0 212.0 180.0 3352.0 if 196.0 228.0 3348.0 In 1316.0 1928.0 188.0 680.0 3660.0 3344.0 Matter 3472.0 4512.0 of 172.0 4340.0 756.0 4840.0 Having 148.0 4692.0 904.0 5680.0 Refunded 5596.0 Refundedthe Refundede-904.0 6584.0 224.0 2868.0 3444.0 3628.0 292.0 3644.0 the 552.0 3820.0 3647.0 Taxes 3736.0 852.0 4464.0 Collected 92.0 4372.0 216.0 5388.0 3688.0 on 5316.0 616.0 5696.0 3632.0 Cotton CottonHE Cottonr-616.0 6312.0 464.0 5200.0 3676.0 104.0 3788.0 e 6632.0 5040.0 1592.0 IHE 4824.0 1732.0 4164.0 96.0 4192.0 r 2976.0 4268.0 1180.0 1796.0 140.0 260.0 3264.0 4212.0 HE 176.0 1000.0 3748.0 PRESENTS 0.95238096 RESENTS3524.0 3872.0 RES -876.0 4748.0 368.0 4380.0 4188.0 NT8 152.0 4228.0 4976.0 4196.0 A 1224.0 5332.0 4176.0 RESOLUTION RE8OLUTION236.0 5096.0 RESOLUTIONf -1224.0 6556.0 RESOLUTIONFollowing RE8OLUTION1c 420.0 4292.0 220.0 4491.0 1c 352.0 5024.0 1608.0 IFollowing 204.0 3308.0 3256.0 4660.0 192.0 816.0 4672.0 Following 4676.0 tho the124.0 4072.0 4596.0 Bill 4460.0 804.0 5016.0 4668.0 Providing 4872.0 5948.0 for 128.0 5820.0 6304.0 6184.0 theRefund -260.0 6564.0 thet 5412.0 1152.0 4924.0 100.0 4987.0 632.0 3424.0 4944.0 Refund 2200.0 4116.0 4056.0 532.0 4388.0 Money 4284.0 5020.0 4932.0 4920.0 668.0 5896.0 Illegally 5792.0 Illegallyat IllegallyaaIllegallyas-668.0 3144.0 3416.0 5164.0 184.0 5248.0 at aaas5184.0 as 88.0 3600.0 108.0 3692.0 5244.0 a -92.0 3784.0 564.0 cotton fcotton60tton4544.0 5211.0 Tax 4436.0 440.0 4968.0 5208.0 From 4856.0 5512.0 5408.0 684.0 5876.0 5196.0 Growrrs Growrre5772.0 Growrrsof Growrrso-684.0 6560.0 Growrrer 6648.0 5384.0 344.0 300.0 5396.0 200.0 992.0 692.0 5475.0 2224.0 -196.0 3612.0 3648.0 5467.0 3500.0 476.0 4000.0 South 80.0 3920.0 Southa Southt-476.0 4476.0 32.0 6248.0 5424.0 w 1772.0 336.0 6624.0 328.0 6296.0 IWith 3672.0 5756.0 76.0 5852.0 428.0 3412.0 With 540.0 2872.0 3996.0 5816.0 156.0 3840.0 4256.0 5780.0 full 160.0 4096.0 1172.0 4688.0 5764.0 determination 4528.0 6028.0 5760.0 to 5860.0 6336.0 ac 6180.0 achis -176.0 6512.0 acplIBh acoomplish 3332.0 3232.0 5984.0 760.0 oomplish 404.0 3588.0 6000.0 plIBh -404.0 3992.0 252.0 5996.0 his bls644.0 4404.0 6032.0 purpose 4324.0 5176.0 5992.0 it5048.0 556.0 5380.0 6016.0 energy 5296.0 6020.0 5988.0 counts 5936.0 countsanything -544.0 countsfor countsi 3324.0 3240.0 6192.0 6203.0 ffgl748.0 3700.0 anything anytbng3488.0 1112.0 4716.0 6220.0 Congressman 268.0 4448.0 512.0 6052.0 6200.0 Frank 5828.0 FrankClark -512.0 Frankt 1376.0 6368.0 4012.0 2548.0 6416.0 44.0 6488.0 472.0 Clark ty1ark640.0 2592.0 3364.0 6451.0 -340.0 3704.0 3528.0 6480.0 rc 3420.0 3844.0 6448.0 4108.0 6443.0 tbe4004.0 580.0 Second 628.0 5160.0 6432.0 District Disttict116.0 5044.0 5924.0 6424.0 has 5788.0 6420.0 folbowed 6300.0 fol tole-204.0 6504.0 followed tole101r 6520.0 -40.0 3572.0 2980.0 6712.0 3216.0 lowed bowed3012.0 101r 3728.0 3640.0 6672.0 d 3540.0 3832.0 6699.0 up uP -200.0 4032.0 4144.0 6667.0 4508.0 bill 4408.0 164.0 4876.0 6652.0 recently 4768.0 880.0 5672.0 introduced 5560.0 introducedby Introducedr-880.0 6552.0 3584.0 6823.0 6968.0 < 3236.0 6888.0 by 3048.0 3544.0 him blmbum3452.0 3984.0 6892.0 3876.0 6884.0 provide 4156.0 5004.0 4896.0 5364.0 6876.0 5252.0 5744.0 6856.0 refurfflinjj refutfttfv5628.0 808.0 5748.0 refutfttfvf -812.0 656.0 refurftlir -808.0 5564.0 7047.0 20.0 7212.0 2920.0 1908.0 1012.0 2968.0 7160.0 2952.0 7124.0 232.0 3000.0 7116.0 Of -100.0 3336.0 3408.0 3476.0 taxes taxeota -440.0 3916.0 3744.0 7144.0 eD 732.0 3988.0 7104.0 collected 4804.0 7136.0 4720.0 5076.0 4996.0 5676.0 7088.0 during 5588.0 theWar thelvll thery 4220.0 2276.0 7308.0 7384.0 ry 7336.0 Civil 780.0 2456.0 3368.0 lvll -264.0 364.0 3724.0 7328.0 War 3636.0 296.0 and 4088.0 4572.0 4472.0 4892.0 7356.0 0524.0 5072.0 7316.0 period 4988.0 5684.0 afterward atterwardafterwarda atterwardI6496.0 afterwardilith 5496.0 1140.0 7535.0 7584.0 + ilith 2016.0 1200.0 3388.0 7560.0 -220.0 3608.0 3516.0 7556.0 h 3436.0 7588.0 B832.0 3880.0 7548.0 resolutionThe 3800.0 3884.0 resolution -828.0 4712.0 resolutionTbeSun -832.0 28.0 6608.0 7632.0 1892.0 1Th -28.0 6636.0 3128.0 7752.0 724.0 7780.0 TbeSun Th -724.0 4136.0 The -224.0 3824.0 Sun 796.0 7767.0 published 5108.0 7764.0 in 7796.0 5256.0 5524.0 recent 5440.0 6136.0 issue 6048.0 issuethe 6540.0 Issue1he1i11l IssueYt 4252.0 2288.0 7948.0 8028.0 Yt 308.0 3188.0 7988.0 ithe676.0 7996.0 1he1i11l -308.0 3496.0 3576.0 tilll Bill-288.0 3864.0 3932.0 3848.0 320.0 4184.0 7999.0 toto 4084.0 480.0 7984.0 which 4504.0 5212.0 8015.0 was 5112.0 672.0 5620.0 7972.0 referred 5528.0 6388.0 7980.0 6292.0 tothecommittee -152.0 tothe -144.0 6532.0 3392.0 8196.0 1256.0 8216.0 thecommittee -1256.0 4488.0 committee 4588.0 8247.0 8204.0 claims 4772.0 5580.0 8200.0 496.0 follow 5868.0 following -496.0 6492.0 followI followIng -628.0 followw 36.0 8260.0 6604.0 8344.0 6544.0 5240.0 1304.0 8420.0 8532.0 8440.0 ing 1860.0 this 4028.0 8436.0 bJ1l1104.0 4428.0 4300.0 448.0 5660.0 5532.0 6236.0 8452.0 pre 6108.0 presented presenfed 8480.0 4320.0 2304.0 8624.0 8696.0 3204.0 senfed 876.0 2328.0 3224.0 8664.0 sented 3768.0 8656.0 tho764.0 8651.0 fonowlng4148.0 5144.0 8643.0 resolutionRegotved 5032.0 828.0 5148.0 5976.0 resolutionftxBBpived 6596.0 620.0 I1ved 8848.0 ftxBBpived Regotved3908.0 8851.0 1ved 4248.0 4456.0 8875.0 That 4244.0 5000.0 8872.0 tho4848.0 5416.0 Secretary Secrotary5264.0 6372.0 8859.0 ot6224.0 oftho -164.0 6536.0 6376.0 otI ofp-160.0 1488.0 9084.0 9168.0 1500.0 9172.0 p -52.0 1552.0 2900.0 9112.0 j 1348.0 3220.0 tbe3024.0 9107.0 -268.0 3296.0 712.0 Treasury 3716.0 9131.0 4344.0 460.0 Bsury 4440.0 9104.0 ot9096.0 4592.0 560.0 9088.0 United 4940.0 9091.0 States 5592.0 bet bef6208.0 6308.0 be -184.0 begndhetfl 9300.0 9320.0 -80.0 3080.0 3212.0 9316.0 3056.0 gndhetfl 600.0 andbe 4048.0 9352.0 3816.0 3912.0 is 568.0 hereby 4864.0 9312.0 directed 5648.0 5536.0 5904.0 9308.0 send 5800.0 6380.0 6272.0 toI totke -228.0 tov 4236.0 9468.0 9495.0 v 9524.0 fr 9548.0 tke3136.0 896.0 9484.0 theRthme 516.0 9528.0 Hdpae 4120.0 H -516.0 4124.0 4044.0 9579.0 9544.0 1352.0 4520.0 9532.0 Representatives RelJrellentativesRepresontathes4412.0 9536.0 nt5872.0 6280.0 6160.0 thejMrlioat -252.0 theorllegt 6592.0 9576.0 Irl1e -20.0 6612.0 3208.0 9748.0 9764.0 jMrlioat orllegtrl1e 3944.0 possible day 4616.0 dl1 -284.0 9760.0 4900.0 5468.0 9751.0 6232.0 Information -140.0 6476.0 Ini Inw 9816.0 1188.0 9932.0 10059.0 2880.0 1624.0 9956.0 formation tormadon3036.0 4168.0 9983.0 namely namolynamelyI namelyc-608.0 4776.0 namolynttA 936.0 10148.0 10191.0 trZ 10207.0 c 1240.0 3460.0 10212.0 1004.0 10196.0 nttA 10223.0 -552.0 3732.0 si 3720.0 452.0 stA -156.0 3888.0 4064.0 -120.0 652.0 10204.0 detailed detallctl4964.0 statement Htntcmentshowing 5796.0 showingthe -676.0 6528.0 5420.0 1176.0 10380.0 10420.0 4 10423.0 1944.0 1264.0 3560.0 10431.0 3480.0 3564.0 Amount 1iJiountwount3656.0 4280.0 10428.0 bf of4384.0 -56.0 10460.0 money 5156.0 collect5068.0 5808.0 5888.0 5980.0 10416.0 th 6176.0 thGovernment -148.0 thin thinGovernment -324.0 6580.0 10520.0 Ii 3484.0 10644.0 10724.0 1032.0 10652.0 Government 3116.0 Gov -1032.0 3616.0 10656.0 rnmen 3532.0 4180.0 10660.0 ot4792.0 4600.0 Uulted6008.0 Su Str508.0 6012.0 SUtes 6260.0 SUtesunder -508.0 6356.0 10671.0 es esunder fi -72.0 fiU1det 4104.0 10864.0 10924.0 504.0 3196.0 10876.0 under U1det688.0 2508.0 3828.0 nnd4272.0 492.0 10872.0 virtue 10868.0 5540.0 5404.0 5940.0 Act 6360.0 6228.0 ofCongress 6524.0 6364.0 ofe 10940.0 4952.0 1568.0 11027.0 11048.0 2404.0 1600.0 776.0 3200.0 11091.0 Congress 2480.0 4068.0 11096.0 3976.0 348.0 July 4224.0 1st lat1862 18G25656.0 11083.0 wbchwhch5500.0 6240.0 11080.0 lev 6132.0 levted 6468.0 280.0 levi 2180.0 11296.0 11312.0 ted led952.0 2248.0 3556.0 11348.0 3456.0 3756.0 11315.0 tax 660.0 4376.0 onehalf onohalt5140.0 5036.0 11344.0 one onlt5304.0 cent Cltnt6256.0 11336.0 per IJer6152.0 perpound IJerun perJound 3176.0 11528.0 536.0 pound Jound3404.0 11571.0 un 3712.0 11576.0 4172.0 11544.0 4036.0 said Hnleluald4684.0 840.0 11536.0 Btlt -840.0 mcnt 5712.0 toshow tof ton 11716.0 11763.0 n 2984.0 11808.0 1528.0 436.0 11752.0 show lhow3140.0 3772.0 11760.0 amount 4800.0 5840.0 11755.0 5688.0 380.0 6144.0 11748.0 each eachvfctato -380.0 eachMa eachtuto 3068.0 11956.0 572.0 vfctato 244.0 11984.0 Ma -408.0 3312.0 11968.0 tuto 3740.0 4152.0 11980.0 Territory Terrltory4040.0 5508.0 11976.0 5300.0 5968.0 Uniteditatou -556.0 Unitednatos 3004.0 12108.0 it 528.0 3192.0 12183.0 itatou ltatesnatos12204.0 where 4860.0 12200.0 4780.0 12228.0 names 5912.0 namesf namesr-536.0 nameslr 12420.0 12428.0 lr 3292.0 rt2568.0 3504.0 3356.0 12452.0 pesonn pqrsonpgrsons3764.0 firms Arms4568.0 nnd5192.0 5848.0 12448.0 corpora corporations -632.0 corporatlon corporabons 12480.0 6588.0 12560.0 IItate 5284.0 1236.0 12588.0 12692.0 3184.0 12644.0 tions tlon1896.0 1288.0 bons -420.0 3604.0 3752.0 12647.0 from troJ1112652.0 whpm whQmwhgm4796.0 12636.0 encheachlUte -368.0 eachstate 12803.0 12863.0 lUte Itatestate12900.0 an alail 3940.0 784.0 12852.0 Terr1tnry5092.0 12868.0 nucl5520.0 the5900.0 12871.0 amountoltacteft amountl 5456.0 13027.0 13056.0 2580.0 13100.0 ty 340.0 3020.0 l -76.0 3096.0 13084.0 eol 101li3Ct -232.0 3272.0 13076.0 oltacteft -472.0 13080.0 13095.0 892.0 13092.0 tromeaoh -396.0 376.0 4584.0 -376.0 4960.0 ot13064.0 Hitch Huch5228.0 13119.0 Huc 5720.0 5632.0 13072.0 636.0 persons per80npersona5724.0 13116.0 personsfma -636.0 6484.0 personar Imsand 1544.0 13251.0 13356.0 13308.0 fma 1700.0 13280.0 msand -236.0 ma 4076.0 13316.0 add3624.0 1052.0 corpprations corp9raUonRcorp9ratlonucorpprationsSecond -1052.0 5220.0 corp9ratlonuk 1364.0 lv -36.0 6620.0 13523.0 13572.0 k 3044.0 13556.0 1660.0 13568.0 3120.0 3440.0 13536.0 360.0 920.0 8ccondA SecondA-600.0 -124.0 4360.0 4420.0 13528.0 -652.0 4620.0 tat1 4884.0 13531.0 6076.0 6024.0 3028.0 13696.0 13760.0 3032.0 -32.0 3064.0 13739.0 tug ingjng13755.0 3896.0 13752.0 aii10untRhount4624.0 13792.0 4552.0 -88.0 548.0 13779.0 concet16344.0 13744.0 bythe -188.0 byh bya 4112.0 2500.0 13960.0 14052.0 13968.0 1044.0 GoyemmentCJovernment3376.0 14011.0 13979.0 ot of13976.0 tho4880.0 5340.0 13971.0 5232.0 StuteHStateHStatesunder ttlender Iander 14184.0 14203.0 anderlender14208.0 4276.0 14200.0 bylrtue 4496.0 4612.0 Virtue 5552.0 14192.0 5952.0 14195.0 5812.0 ototC 5224.0 1392.0 14335.0 14412.0 Y 1556.0 14400.0 1448.0 1752.0 14424.0 1636.0 1800.0 C -772.0 648.0 14456.0 ongross 14420.0 March 1Iar -524.0 4740.0 14416.0 7th 5516.0 1864 18G45320.0 484.0 14408.0 5856.0 whichtevied -484.0 14292.0 500.0 14639.0 levied teviedh14652.0 tnx3924.0 14644.0 14656.0 4680.0 14612.0 Vjvo 4640.0 4756.0 14672.0 Yto ivo4984.0 cents centaccntiIlor6040.0 14631.0 5920.0 poundon poundI1poundt-492.0 4956.0 1664.0 14820.0 14855.0 14823.0 Ion 1400.0 1696.0 14900.0 -208.0 14904.0 I1 -112.0 cottqneottgn14863.0 snldsand4024.0 14844.0 s 5448.0 14868.0 tcment 5444.0 5776.0 Hhow6276.0 14852.0 theamount thestutount Isnount 15076.0 15095.0 snountstutount1020.0 15084.0 collectediucol1ected15108.0 Iu fu4816.0 5152.0 15079.0 onchState StntenndandTerritory -292.0 nndlerrltorr andJ 15279.0 800.0 15292.0 lerrltorrerritoicy15316.0 J -776.0 3288.0 -8.0 ot788.0 15308.0 the4288.0 15303.0 Unltet15504.0 StntltsSlatcH15300.0 IIHIandrhoro IIHIbore andwhere 15508.0 372.0 bore rhoro1076.0 15511.0 possibletho possibltho15527.0 poBslb1 -1076.0 4904.0 15564.0 4400.0 4644.0 tbo 4992.0 15540.0 111nW815524.0 15519.0 010he15551.0 pertons -272.0 perlone 6332.0 tr trn8 15715.0 15764.0 tons lone15783.0 n8 15752.0 firma4452.0 15744.0 15772.0 ant nnt4744.0 1048.0 4916.0 15748.0 corporatlouHcorpornUonK4700.0 444.0 6100.0 Srottt 5964.0 Srotttwhom -444.0 6140.0 tro1rfromwhom tro1rlwhom 3320.0 15952.0 whom lwhom3804.0 15971.0 collocted4628.0 15968.0 4532.0 15963.0 cnch432.0 Stntl5824.0 nndTer 6116.0 -296.0 TerrUorf TerIFltory 16028.0 16171.0 ritory rUorfIFltory16192.0 nd -192.0 16200.0 nmount16184.0 Ol1lctNIsheeted16187.0 tromfrmnfromeach -384.0 tromI tromeach frmneach 3468.0 3148.0 16376.0 16411.0 3164.0 16416.0 such 16443.0 Illra01JRperuous4356.0 5260.0 16408.0 nrll1HflrmH5104.0 5836.0 16403.0 nud and6244.0 16440.0 cor 6124.0 -256.0 6500.0 cor1W 6508.0 16472.0 2800.0 1216.0 16611.0 1W 792.0 16632.0 porations poratlonsporntlonu1776.0 porntlonuThirdA -792.0 4016.0 3228.0 porationsThird -788.0 poratlonsjThlrdA 3132.0 16843.0 872.0 jThlrdA ThirdA16851.0 Third -784.0 16859.0 3972.0 tltnl11d16856.0 HtntlnHntHtntentcnt412.0 6084.0 16848.0 howslmow-412.0 slmowAg 6172.0 howilg 16920.0 17063.0 17076.0 ilgAg3808.0 17088.0 nmountor5120.0 17104.0 mouoy ntouuy4972.0 17107.0 mUIW -532.0 5652.0 lhHtd5556.0 collectedoy collectedby-728.0 lhHtdby 17279.0 17300.0 oy3552.0 17292.0 theGmrnu1lnt17295.0 orthe5312.0 17287.0 tJnltlUnitedStates -548.0 6400.0 17331.0 > 6456.0 6440.0 d8tntes -84.0 17484.0 17519.0 8tntes1784.0 17516.0 umllr4540.0 nnd5008.0 lIy4832.0 lltut17511.0 orat17508.0 till thothethoct tillet 17672.0 Itwblch 6628.0 17727.0 17743.0 ct et17735.0 3960.0 CongroHHCJn -756.0 17764.0 retI 4260.0 or17732.0 lu1 -328.0 5568.0 5488.0 17767.0 13 6164.0 iSfifi 1SfW1S66iSfifiWhich 1S66Which 17943.0 17951.0 Which twblch loItll17996.0 17967.0 tux17956.0 ot4868.0 three thrHOthreo5116.0 5752.0 17959.0 contu clnhceutH17983.0 pun purpunound -336.0 1101 puround 18004.0 18176.0 ound 18212.0 18183.0 mild HnltlHaiti4732.0 5436.0 HtnttlI1lntHtnttIItent5280.0 6404.0 tn6252.0 tohow tnhow 18347.0 18384.0 how 18395.0 the3664.0 18408.0 nmouutnnmnlut4888.0 18392.0 4980.0 01 5608.0 5188.0 18431.0 5372.0 tlll 18387.0 Pilcheachjgtato 6548.0 eachgtate 6616.0 -12.0 18600.0 jgtato 3248.0 18611.0 Itate gtate18616.0 nnd768.0 18619.0 rIttnryT -768.0 5028.0 or836.0 thothePnltoil PulttllPnltoilStates PulttllBtntea tItetI 6064.0 tItetIMates -356.0 2860.0 5480.0 18783.0 BtnteaMates1676.0 1564.0 18835.0 nnd and18832.0 WIlNI4336.0 IIUoUllhltposslldetht18767.0 the1 the1amos -332.0 lIamoll lAmos 19051.0 19064.0 amos amoll4140.0 19056.0 tht19088.0 pcrsous19091.0 -624.0 5132.0 4564.0 19096.0 4608.0 lIW 4948.0 5288.0 fllII1MIlrlns5128.0 111115700.0 19083.0 corfrom corjlplatloub 6348.0 or orraUoUB 19231.0 jlplatloub 588.0 19275.0 raUoUB -584.0 4232.0 train4808.0 19271.0 ro1lcttll6412.0 Inch Inh InItch 19487.0 19495.0 Itch 3448.0 ch -104.0 Stuto4480.0 IUIlI19531.0 ni lIlrltorlerrltory5884.0 19492.0 ulIlthethocollected thoO1nt themount 4308.0 2244.0 19708.0 19895.0 b 19719.0 mount O1nt2312.0 4008.0 19711.0 collctltl19716.0 trulnllchlitMuchHuch6060.0 suchArsons -360.0 MuchrIOnS Huchb 19932.0 19964.0 Arsons persons19959.0 rIOnS -448.0 3904.0 19935.0 OrlUSflrnls4664.0 nlll1nud5084.0 rOrJ1orntlont20003.0 t488.0 6128.0 tFourthA iFourth IUFourthA 3084.0 20143.0 20151.0 UFourthA FourthAFourth -884.0 20156.0 dotalloil 1ttnt11l1detnlled824.0 5204.0 20167.0 tltntluwlltHtatcnuntHhowshowg Hhowg-400.0 tlho tlhoI 20367.0 20407.0 g Ithe20388.0 nmountarnount20379.0 or520.0 UHlIIIYnuutty4828.0 20371.0 fulllJl hI -240.0 6384.0 20375.0 bytbe -172.0 hUte 6464.0 bytie 20584.0 20587.0 Ute tbetie20592.0 GocrnnllnlGovornn20615.0 It 4652.0 20600.0 or4648.0 thl4912.0 5392.0 tilted IultodlUUId5272.0 20595.0 StuhlIStateser StuhlIcr-504.0 Statesder 20803.0 der 20843.0 er cr3760.0 20811.0 nnd4332.0 -180.0 20816.0 lltlI 5292.0 ur5844.0 20819.0 20827.0 lt -136.0 urofCongre 6568.0 urConsress 3268.0 21027.0 CongreConsress21035.0 21032.0 II1lhInrchlSt 15621043.0 5460.0 lij 21091.0 5548.0 5484.0 21040.0 7 5704.0 whldlblch21064.0 6288.0 leva kJtd -128.0 lev11ed 3260.0 21164.0 21240.0 Jtd 11ed21283.0 3520.0 21267.0 tnx21256.0 ur21272.0 two 4936.0 21251.0 anil ntHInudulIlhnlr21288.0 nue -660.0 half 5636.0 lInhJ21215.0 jfer iI21391.0 itef 1380.0 21467.0 21575.0 21499.0 fertef1836.0 1432.0 3548.0 21504.0 au21496.0 cuHOIIcuttuu5124.0 21475.0 salt Inhlsaidhtatcmout ttlltII1UllthtnteInt21515.0 6340.0 ut 6168.0 21491.0 toihow toibow 3276.0 21644.0 ihow ibow21687.0 3696.0 3856.0 21684.0 thu21715.0 IIIIUlllltnmmnuuteotlected21695.0 5736.0 Ilh6044.0 eachi -364.0 eachState Ilhtatu -276.0 3400.0 21855.0 3280.0 21903.0 tatu21908.0 1trrltlllYIerrttury21911.0 or5356.0 6036.0 Iulteil rulhlItultedIulteilto rulhlIitultedatehr 22067.0 tatl9f 22127.0 atehr Brand nod 01114352.0 22132.0 winrewhtIIll1StlllIll5716.0 thotht6056.0 22159.0 1IItlImutes5972.0 namesthe 22164.0 1IItlII mutesthe 1816.0 22248.0 22340.0 tho4020.0 22380.0 3860.0 Illr 4636.0 22383.0 Ulltl 4852.0 22351.0 linnsIlIII1H22348.0 ami auul11 III lorpnmcorporas lorpnmI22415.0 3284.0 22475.0 22567.0 22604.0 I22599.0 rom -316.0 4392.0 hniu tehum4396.0 whllll 716.0 22571.0 u1 5740.0 5572.0 Itl III6212.0 tlheache tlhieachItte 3100.0 22731.0 22744.0 Itte 22807.0 22783.0 Dud22787.0 TorrltorTtIrlhI22823.0 5172.0 mid 11111andtittll 5960.0 22815.0 1HI1tanunutanunuteollected amountdllocfocl -612.0 1HI1ttUocfotl 22923.0 tUocfotl 22992.0 dllocfocl eollected-748.0 23003.0 rroll1fromlt23008.0 tuh4536.0 orlIuch5908.0 23039.0 personsArms IItrl personslane -304.0 23071.0 lonll lonllirma -312.0 3372.0 23167.0 Arms irmalane23219.0 anti1036.0 23232.0 corporation corlornUtHrcorpornttonbcorpornttonbFifthA -1036.0 940.0 23235.0 corporationFifth IFUthA 23435.0 Fifth FUthA FifthA-416.0 3980.0 23443.0 rullnull4728.0 23440.0 nllllunitcomplete cIIIIIIhh23480.0 coin -732.0 phtc 5928.0 dctttlleddctttlleda 5932.0 detailedatcment -648.0 1560.0 23655.0 23775.0 1672.0 ttement 3620.0 atcment -672.0 4132.0 23667.0 mnt 4296.0 shollIshotvtng23659.0 lnlh23663.0 cued23688.0 every tveryeveryale tveryale 3380.0 23868.0 ale 23907.0 23875.0 or3968.0 23891.0 4560.0 23879.0 4468.0 4844.0 theTutted 1nlh1tnttcd23883.0 StUh1IStmts5732.0 23895.0 6352.0 toiy toJaY toIlly 3300.0 24087.0 24119.0 JaY Illyiy tho24103.0 tnxrstn 24127.0 XNI 4208.0 24092.0 thereon thoreonhOrlt24111.0 -620.0 5216.0 5324.0 24095.0 l1llhfthosuldsuldCtB 24131.0 IIn saltActs hIctl -132.0 24287.0 Acts 24319.0 CtB ctl3680.0 3776.0 24316.0 736.0 24311.0 CottKrOfHCunlr -736.0 24359.0 ur5308.0 Idlyhi 5492.0 5864.0 24327.0 IISitS 156224324.0 ISitSarch ISt IStarch 1562arch 24527.0 arch 24531.0 3836.0 24535.0 IMU 1t424540.0 -320.0 IH hll ia 1324543.0 ISM St1ti5368.0 anti ntlI5956.0 ntlIarell antiarch 24567.0 6436.0 iarch 24743.0 arell24755.0 2 11M 24751.0 CT 4556.0 24759.0 glli IIII 24747.0 particulars pnrtllulurl5180.0 elf6324.0 ifl elft6600.0 -44.0 rI 24963.0 24991.0 25015.0 24999.0 -4.0 il oh ch24995.0 sale saloBnll24967.0 24971.0 hht4524.0 tlMutiK 4788.0 25007.0 25003.0 24979.0 Ins ntnouutImoUIHsuit solil101 6104.0 u1l 6088.0 24975.0 toinl toll 6460.0 25179.0 25203.0 ll 25211.0 696.0 25187.0 instance IshUIltlnstatnee604.0 niuount 11II1l1l1tautttntt25192.0 lnluuul dRItUttItnimttd25235.0 25219.0 tt duo tlltlillsduotaxes tlltlI illstaxes 2940.0 25403.0 25416.0 tnXtl825427.0 11II0lltauroutt4100.0 rallllJ rrabizrtt25435.0 ilu 25411.0 25408.0 homfrontonrh nlhenrhonrhi nlhtenrhae 2176.0 25475.0 25619.0 25659.0 ae 25680.0 25727.0 3780.0 place Ilncluflieu omhIh25623.0 sate InltMI 5328.0 25664.0 25631.0 tita tti 25627.0 Ihllon ositlou25683.0 25667.0 ltion orofnco orneo ofnett 2936.0 3668.0 25839.0 25875.0 neo nconett4092.0 3956.0 25843.0 IIItullhlstaurt4240.0 25880.0 w11 wltiv -352.0 re 25851.0 5768.0 ht 25871.0 pixv 10lttupixvB 10B-300.0 2908.0 26055.0 26103.0 B 9unle Nate26091.0 -244.0 26087.0 octM 700.0 4516.0 txeeetitti dt -280.0 5080.0 nlll atol26083.0 nuiMii 26107.0 5624.0 26067.0 cittinoi tltneilcittinoitaxes -588.0 rl 26059.0 tltneiltaxoli 6096.0 6216.0 h11 -392.0 h11tnXCl 2944.0 26271.0 26292.0 tnXCltaxolix111126311.0 UIl 4656.0 26307.0 luiv tleltthI -348.0 5544.0 I5576.0 26279.0 thontpthemes thoof ntpmts 26492.0 26532.0 mts mes3948.0 26500.0 26495.0 thothl4580.0 26524.0 perMMjIhrsUrtrui rtUIiiirntsaid6316.0 eor toreorlions tortlons rtlona 26707.0 26723.0 lions tlonstlona26711.0 Who ho OMUNl owatMI26743.0 ow -528.0 n1 26727.0 ettttkl lXUv 26751.0 hAh 26756.0 26740.0 5832.0 26748.0 nr tar5916.0 iittseselon 26719.0 hM hd iitthdr hd6tttdon 6572.0 lsession 3432.0 26896.0 26939.0 session 6tttdonseselon26935.0 ot26947.0 wttou OtW1lOttolt5168.0 26923.0 oUl Iwldobl5060.0 26951.0 1026955.0 1ft 1n6196.0 6004.0 -48.0 tirR 2812.0 27123.0 27191.0 3304.0 27155.0 tttjmed -96.0 UNI 27171.0 3964.0 27159.0 bt bo27147.0 tine27143.0 therH thlrtktHthlr thlrtktHa -344.0 27179.0 nIn 5612.0 2356.0 3512.0 27492.0 27543.0 4052.0 27503.0 Mayors MayoraCourt Courtlarpnrot -452.0 Courtnrflflt Courtr 27699.0 27707.0 27724.0 larpnrot nrflfltnrintret1828.0 27716.0 Clny Claynnd27748.0 RUt F 1stautr Mnul -456.0 nul 27751.0 6072.0 Jth 5892.0 JC1hwf 6148.0 JC1hwfo liur liurrwl 27735.0 trw 3072.0 27915.0 3536.0 27972.0 0388.0 27931.0 color colorttl 27935.0 rwl 27964.0 xvoinou ouwuwotnatll27959.0 27956.0 wart 5400.0 rt 27923.0 rmliiiod ttrrttiKaed27951.0 IrnIal -796.0 IrnIalthu ttrrttiKaedi rmliiiodtho -700.0 2928.0 28096.0 28179.0 thothu820.0 28147.0 muukiival muuldtJ1mupkIluU4812.0 28171.0 court rour752.0 28139.0 Saturday SfttunUy8fttrtlA5236.0 28167.0 mum IAUMIraurtr6080.0 mumupon IAUMIupon raurtrupon 28355.0 28407.0 upon 4304.0 28367.0 charge chsirgohlrGo28363.0 848.0 dlsordoriy dlsortlttriydl -848.0 ONlrt 28391.0 you txmCOU6092.0 txmarvd COUt yourt 28571.0 28603.0 -60.0 3792.0 28592.0 arvdInd28619.0 were 28623.0 28587.0 fiNd fltiouhalts28579.0 Imtl28599.0 cost casts5640.0 costteckert 28611.0 C6 28576.0 Md Mdteckert 28607.0 twc twcteckert 2956.0 28795.0 28803.0 teckert 28807.0 Murra aiutttty4216.0 28832.0 UlI wn wnltwasalso jilhojilhoa O 28799.0 trrlxtaw trrlxtawa 1844.0 28999.0 29067.0 1820.0 29023.0 chamchargq4704.0 29019.0 or29007.0 disorderly ditorderl29015.0 Ntrl 29011.0 conduct oouhtaaltductconducte -644.0 29047.0 29031.0 te 2792.0 29235.0 29283.0 29275.0 vat lvas708.0 required ufld -428.0 29251.0 29263.0 IMa pay y 5880.0 29267.0 tttine fiatnl ofad ofIi ofd 29415.0 29471.0 ad 29459.0 tboth429451.0 trimming tflmmlntrimmingstrimmingsV 29447.0 M 30063.0 V xmlns:ns3 ID17 28231 3424 6672 ns3:type 6744.0 1864.0 NEWS 7540.0 1936.0 OF 7404.0 7944.0 1924.0 CITY 7816.0 8608.0 1912.0 AND 8472.0 ANDCOUNTY -488.0 10080.0 984.0 ICOUNTY 10092.0 2416.0 7676.0 916.0 2228.0 COUNTY 1332.0 8688.0 CONDENSED 8592.0 CONDENSEDFrom CONDENSEDirom-1332.0 10020.0 1404.0 CONDENSEDI 2388.0 2572.0 6736.0 2652.0 2772.0 irom740.0 7280.0 2760.0 Sundays 7176.0 Sundn -740.0 8020.0 2804.0 7784.0 8112.0 2744.0 Dally Dall 8540.0 2752.0 Da 8640.0 8324.0 SunOn 8948.0 10076.0 1128.0 IOn 3104.0 6904.0 On 704.0 7260.0 Tuesday luPHtlny7128.0 8092.0 evening cvenlng7964.0 8908.0 3008.0 8740.0 9192.0 2988.0 9068.0 9572.0 home hohie9444.0 homeof hohieof-436.0 10008.0 6720.0 3252.0 7016.0 Mrs Mra7108.0 Ira -216.0 7324.0 7504.0 OD7628.0 8108.0 Bailey Daile7920.0 468.0 8808.0 North 8620.0 9416.0 Gaines Galnes9276.0 Gainesville 9964.0 Gainesl1Ie Galnesripe 9972.0 6728.0 ripe villel1Ie7232.0 tbe7076.0 7604.0 ladies ladles7492.0 8192.0 8084.0 8456.0 8348.0 584.0 8832.0 Advent 8720.0 3428.0 Chris ChrlsChristjan 10072.0 Itian 3568.0 itian 10096.0 6724.0 tian tjan7152.0 church 7036.0 7836.0 expect 7712.0 8368.0 8748.0 give 8632.0 9080.0 9496.0 oyster oster9376.0 oystersupper 10012.0 osterRupper 3868.0 supper Rupper7472.0 7276.0 7888.0 proceeds 7732.0 8768.0 3892.0 or8612.0 9072.0 8928.0 9708.0 will 9552.0 willbo willbe 9852.0 J11 J11be 4135.0 bo7012.0 4127.0 devoted 7760.0 7652.0 8388.0 8284.0 9188.0 Functions 8944.0 Functionsgiven -824.0 4316.0 given 7240.0 7508.0 4348.0 7432.0 7832.0 good 8296.0 lndlcs8208.0 4328.0 at8776.0 9004.0 churchare -564.0 4607.0 are 7056.0 4576.0 always nlwars6976.0 7708.0 successful hence 9224.0 9148.0 9396.0 success successis Iia 6716.0 4764.0 ia924.0 6936.0 anticipated 6848.0 7956.0 7860.0 8120.0 8604.0 8508.0 9372.0 Oysters 9152.0 Oysterswill OysterswJ11-640.0 wJ117092.0 7348.0 served 7976.0 7884.0 all styles 8396.0 9020.0 9248.0 9180.0 9412.0 reason 9340.0 reasonable 9976.0 5056.0 6708.0 5235.0 able priceWith 7052.0 7148.0 price 7564.0 pricelith 2528.0 6880.0 5472.0 lith7376.0 7292.0 high 7468.0 1024.0 8004.0 appreciation 7912.0 9028.0 9360.0 9704.0 pat 9616.0 patronage 9968.0 ronage 7352.0 extended 7268.0 8180.0 5707.0 them 8576.0 9220.0 9644.0 5728.0 year 9560.0 yearJust yearjust 6700.0 5944.0 Just 596.0 coming 7020.0 7896.0 5939.0 7756.0 8184.0 5963.0 8048.0 8412.0 close 8268.0 9012.0 8824.0 9476.0 G9332.0 9776.0 W 9596.0 WHyde 9848.0 -116.0 VHyde 6704.0 Hyde 7216.0 Company 7140.0 8064.0 takes tukes868.0 8568.0 advantage advdntage8496.0 9512.0 ot9436.0 9756.0 9672.0 theopportunity 968.0 opportunity 7776.0 7668.0 extend extfmd7924.0 8668.0 best 8556.0 wishes Vlahcsyv1shes9780.0 for3G5 365 3G57068.0 days 6956.0 7440.0 7808.0 happiness lJapplnesBhappinesa7704.0 8736.0 8628.0 860.0 prosperity 9040.0 prosperityto -860.0 I6812.0 6840.0 456.0 7636.0 customer 7476.0 1248.0 6815.0 customerand 8392.0 8580.0 8884.0 9060.0 fact net9208.0 9856.0 6820.0 9692.0 toeverybody tooeryboo toov 6696.0 7031.0 7044.0 everybody oerybooerybody7080.0 ov -852.0 7684.0 6868.0 7744.0 7072.0 7904.0 7992.0 8328.0 comiug8248.0 9032.0 9608.0 Man Ian9392.0 Manager 9960.0 ManagerGnrdner 9700.0 Ianager 7100.0 7252.0 7303.0 ager 1168.0 agerGnrdner 7060.0 664.0 7204.0 Gardner Onrdr1lr7864.0 8008.0 7256.0 7868.0 certainly 8292.0 9336.0 made 9916.0 7287.0 0asuccess 0succees 9992.0 7480.0 7524.0 succees7428.0 7484.0 7696.0 tbe8072.0 business 8920.0 tor8796.0 9272.0 9156.0 yearnow 6680.0 7700.0 now 7720.0 7024.0 7332.0 7740.0 end 7512.0 8016.0 because -664.0 7736.0 cnuse 8756.0 8996.0 reasons 9292.0 reasonshis 10004.0 6872.0 7932.0 7188.0 jHTBonal IWrllonolxrsonalcleverness 7876.0 8916.0 8840.0 9288.0 9212.0 qual quality qualIty 6692.0 8144.0 8155.0 ity ot6908.0 7288.0 8147.0 7656.0 goods 8244.0 lie ile8140.0 8364.0 8444.0 8564.0 8968.0 bandied handled8844.0 9868.0 9612.0 Itgoes 10016.0 ItROe 6684.0 8356.0 8411.0 goes ROe7180.0 without 7048.0 wltho 7804.0 7624.0 7928.0 saying 8596.0 8371.0 that 9052.0 8936.0 9492.0 G 08363.0 WIhdl WIlycie 6688.0 8588.0 IhdlIlycie7112.0 8132.0 8012.0 its 8424.0 8868.0 9696.0 wJl19580.0 willprosper wJl1prosper 9996.0 8812.0 prosper 7388.0 7300.0 same 8816.0 8164.0 8484.0 8904.0 8820.0 9356.0 1908 9268.0 9828.0 astho asthe thopublic 6932.0 9036.0 find 7544.0 8308.0 9076.0 118516.0 pleasure 9660.0 well wellas 9247.0 9296.0 6844.0 satisfaction satlsfnctlon8224.0 9263.0 8080.0 8464.0 9260.0 deal 8896.0 9255.0 storeCOMPLIMENT 9452.0 store 6852.0 9740.0 COMPLIMENT 8236.0 TO 8156.0 8600.0 9743.0 MISS 8492.0 9132.0 GOODE GOODEThis 9772.0 7200.0 10180.0 Popular 10183.0 Young 7844.0 8692.0 Lady 8524.0 9264.0 Received ReceivedFine 2912.0 10404.0 Fine 7344.0 10408.0 Vote 7224.0 7840.0 10439.0 au7724.0 Queen Carnival 8940.0 CarnivalFrom 9768.0 10663.0 Fridays rldays7120.0 8052.0 Daily DallySunA 8924.0 3156.0 10919.0 10932.0 great 7660.0 8128.0 interest 9204.0 been beenmanifested 2280.0 11144.0 8404.0 8272.0 8792.0 11156.0 past 8660.0 9140.0 11175.0 orour 10000.0 11364.0 11404.0 our 11372.0 7600.0 7488.0 7748.0 856.0 8228.0 9196.0 candidate candidatefor 11399.0 co 9488.0 dldnte 9348.0 11584.0 11600.0 6996.0 7608.0 11596.0 11588.0 tbo7768.0 CarnlUl8116.0 9516.0 9844.0 9744.0 toappear 2612.0 11811.0 7612.0 thl8this8032.0 11816.0 city 8332.0 8708.0 week 9420.0 weekThere weekfhero 12035.0 12040.0 There fhero7284.0 hils7168.0 several severnl8892.0 12072.0 young otmgladles9400.0 12256.0 12259.0 6952.0 tho6816.0 12267.0 contest contost7208.0 being bolngnominated 8560.0 nnd9564.0 andsupported 2284.0 12483.0 their tholr7848.0 friends rlonds8408.0 nd9600.0 adinkers 9944.0 2656.0 12700.0 12704.0 I1nd12739.0 allopFriday rldnynight 8552.0 9216.0 when whon9736.0 9648.0 thetlifal thenr1111 thefinial 12911.0 finial tlifalnr11117228.0 12940.0 vote 7028.0 12960.0 WIIH7580.0 12927.0 counted 8096.0 9108.0 12956.0 WfiS9228.0 9752.0 9652.0 announced anpounced 9952.0 12995.0 13148.0 13151.0 nounced pouncedMiss 1111187820.0 8448.0 Lovle LovieGoode 8912.0 9712.0 13184.0 onepf 6928.0 13367.0 1060.0 13372.0 Gainesvilles Galncsllles996.0 handsomest 9200.0 9092.0 9604.0 13380.0 most mostpopular mostlolulnr 13591.0 13596.0 popular lolulnr7456.0 13628.0 ladles ladlooladloD7960.0 had badwon thehonor 13815.0 13820.0 honor MIs87952.0 8636.0 receiving 8460.0 9451 9451This 9940.0 14040.0 This 14071.0 wnsindeed 7460.0 14079.0 0a988.0 8400.0 compliment 14056.0 9388.0 thetholady thelady 14264.0 lady but ono one7448.0 woll welldeserved doservednnd9716.0 onewhich 14483.0 ThoThu7164.0 14491.0 8168.0 14488.0 nnd8044.0 her 8988.0 rlendsfeel feelsure 14707.0 14739.0 sure she Bhosho7032.0 956.0 7516.0 appreciates nll1rcclat7412.0 appreciatesThe -956.0 14747.0 srhe 3152.0 14928.0 14931.0 rhe7248.0 other 7184.0 14963.0 oung7692.0 8336.0 Indiesladiesnlsoreceived reclivedreceivedcomplimentary reclivedCODllllmontnry -696.0 -692.0 6676.0 15152.0 15155.0 complimentary CODllllmontnry15163.0 votes oteH9160.0 IB 18Is9280.0 need needless 9948.0 needleas 15224.0 15359.0 less leas15388.0 6984.0 15376.0 add ndd7664.0 15372.0 they 7576.0 nlso7916.0 884.0 appreciate npllrecJntoreallzlug 9380.0 9500.0 reallz realiz-460.0 realizing reallzlog 15443.0 15596.0 15599.0 log inglugthntthere tlioroUtero15635.0 can cau8360.0 15604.0 bo hIbe8548.0 011115632.0 queen cpicontjlCtncpiconHAD 9860.0 tjlCtnHAD queenHAD 7420.0 16044.0 HAD 16047.0 8160.0 BIG BIQ8036.0 DANCE DANCEThe DANCETh 16480.0 6896.0 People 6992.0 7800.0 8088.0 Waldo 8752.0 Indulged IndulD9384.0 WithDelight 2596.0 16699.0 Delight 7672.0 8068.0 Terpsichorean Terpslchorean9408.0 16704.0 Art ArtTho ArtIhu ArtThu 6860.0 16960.0 Tho IhuThu7304.0 16964.0 guudptoplu IllullIlIpeuplo8340.0 Wnldo1Yaldo9440.0 alwaysnwakv -568.0 nlwn alwaysnwakc 9820.0 16996.0 -68.0 snwnko 17184.0 nwakv nwnkonwakc7416.0 17195.0 thl7568.0 mutual lI1utllul8024.0 9016.0 17187.0 Interests liitertstHIntllPAtH8800.0 orofabout orthmw ofthose 17403.0 17408.0 those thmwabout nllolt7872.0 tlHtn7728.0 participated IlItttlclllntlllpnrticipntcd9640.0 9928.0 17440.0 uadanco u1I1H abig 17624.0 17627.0 big 1I1Hdanco tlnneudaucc7640.0 17640.0 litut7528.0 thuOw7788.0 8288.0 17632.0 town 8804.0 hall hnll8676.0 17659.0 9100.0 9556.0 17656.0 opera OlllrILoperaon OlllrILhOlUIt operabutts 17812.0 17848.0 butts hOlUIt17883.0 011om7648.0 Thursday ThllrlldllY7520.0 Ivonjng evel4ng8856.0 17880.0 OIlJlg 9584.0 17843.0 whonwhtnwhontho -424.0 whtntlw whenthe 6776.0 18064.0 18072.0 thotlwwhole wholo7296.0 hull 18088.0 tuwt7616.0 8352.0 turned 18083.0 tlrtl 8888.0 18080.0 out cole cllucele9540.0 colebrato clluIJruhl celebrnte 18287.0 18295.0 brato IJruhlbrnte18292.0 ChriHtmaH hrINtttluHIlrIHlnItHIIlIdIndulge hlllulgl8416.0 hih19116.0 9424.0 18328.0 II9588.0 gooll9508.0 goodHocial goollIH goodsocial 932.0 18516.0 social Hocial18552.0 -464.0 6828.0 7040.0 time tintstimeTho tI tintsThe 7364.0 7400.0 18547.0 nTlw 18727.0 18735.0 ThoTlwmusic mUlIlc18732.0 7772.0 8504.0 WUH tvas8952.0 18764.0 8956.0 uptodate ulltotlate18743.0 date 9364.0 9864.0 IIIinevery IIIrtllllt 18948.0 18991.0 18967.0 ronpect rtlllltrespect7856.0 18988.0 wa wns7852.0 8152.0 ntl 18959.0 hr8732.0 II8932.0 local locnl9428.0 18951.0 orchoH 01CIHHorchesorchoHtra 01CIHHtrnorchesIra19172.0 19196.0 tratrn19175.0 6924.0 the19180.0 tin1 8320.0 19207.0 wan wits19212.0 8744.0 RO flOsoperfect 11trtl 9472.0 9432.0 19191.0 9724.0 nlllnodandtho nllltilt nodtlo 19395.0 19399.0 tilt thotloIUUAllluusie19431.0 HO gOdlJ1 tltnttho19428.0 aggrega aggrogaaggregation 1I aggrogatlon rtlJn rtlJntlnn 9984.0 19460.0 19587.0 19619.0 tion tlnntlonHounded HUlIIlllltIsounded7004.0 19616.0 like llkolIko8312.0 19652.0 nprofessional JlIOCttlKlnllnlprofesiilaunl9624.0 bandtrain 9628.0 band handbandfrom handtrum 19835.0 19840.0 trumtrain7192.0 JackHonlllo JIckHonl11oJacksonville7084.0 19867.0 ur19872.0 Homo HOUIOsonw9124.0 otlJtlr9024.0 9568.0 cityTho clt cltTIll cityThe 20056.0 20059.0 TIll ThoThe7312.0 tlnncoBanco20091.0 WIBWIIKwoll8220.0 8788.0 attended 20067.0 nttt 9064.0 20096.0 lultd rromfromWaldo rromWuldo fromitldo 20275.0 Wuldo20283.0 itldo 7236.0 20315.0 7680.0 7496.0 7464.0 20280.0 Immedlato ImmttlhtolIIIOellltttesurroundings HurroundlngKtutrrmt1ltllngH8716.0 HurroundlngKand tutrrmt1ltllngHnndsurroundingsand-1104.0 20495.0 20499.0 nnd20504.0 6988.0 ulln11proved 20531.0 IlrUl 20536.0 II20515.0 motJtenjoyable trJOableenjoyableaffair 10024.0 njn -712.0 trJOableaffair 9684.0 nblo nblonfTnlr 20716.0 20723.0 affair nfTnlr20719.0 laHtluguntll hAtlnholnUllastiugtlutll8712.0 lIIII9184.0 the20747.0 morn ntornmornSuccessful mornhi ntornIng 20943.0 Ing 1736.0 21296.0 Successful SuccellfulCat HuntFront Hunt HuntFrom Hunt1Iom 2220.0 21544.0 21560.0 1IomFront21552.0 StutdnsSIIull -744.0 21599.0 Daily8528.0 Sim8428.0 SimAn Suntn 8728.0 21579.0 IIIAll 3076.0 21768.0 21800.0 An Alltn7220.0 21771.0 onjoyablo lnJunblojoyattale21811.0 cm 8172.0 21808.0 nJas7396.0 voll011 liS8784.0 uatafill 9256.0 21803.0 successfat 9504.0 IlI 9912.0 8 8rul 9980.0 21992.0 21995.0 fill rulfatwildcat l1tilUt7828.0 hunt occurred OCCIIrltearly 1luI Slit SutSatSutunlay 22207.0 22211.0 unlay urday111111 22216.0 monilng ttllIlIIIIIsnot -688.0 nhng 8124.0 thupartlc 8380.0 1008.0 8476.0 participants 11I1tllPUIIl48984.0 ipanL -500.0 beingSheriff 10028.0 tln tln1t1lrr 9920.0 beingFaerlIT 22427.0 22439.0 Sheriff 1t1lrrFaerlIT22435.0 17272.0 7716.0 Fonnell Joltltttll1etnell22431.0 ami11119120.0 bishltl9000.0 9460.0 guests guestsI UItltN UItltNI 6756.0 22647.0 22652.0 122655.0 l6784.0 lknilaro 110111111Iloulwarelit8468.0 Texas Toxaa9144.0 8960.0 111 Steve ShlSteveCut 10032.0 Shllul1vlI SteveCalico 22871.0 Cut Calico lul1vlI7008.0 IIf7244.0 22876.0 Hague IIngneHagueTho 7572.0 HU IIngne1ho 7792.0 22907.0 IIt IItTho 23087.0 23092.0 1hohlltt23127.0 WIII wns7892.0 ns -168.0 8060.0 8148.0 23095.0 unite mailotIlUItIlu8900.0 tho9232.0 hammock tuunmokluunnlockhammockon luunnlockon-800.0 23311.0 23348.0 011Nexvnans Newntuts6912.0 23316.0 Lake InkLuke7812.0 ILlllttilt23324.0 party pllrl9732.0 23340.0 sue IUl9620.0 sueivodtnl IUlltlltlltl sueeecded 6732.0 23527.0 23531.0 ivodtnl ltlltlltleecded7372.0 oarlyolrb7880.0 23539.0 iu IIIto23535.0 morning lIIu1lllnntorntugluJum JllnlJJtiitJumIUK JllnlJInfo 9888.0 Jtiittttg 23747.0 23755.0 Info IUKtttg23787.0 u na23751.0 hl 23767.0 cat lItcutAfter AChr23791.0 a8536.0 8704.0 chase dlallur9252.0 aholltaboataboutto aholltt aboattwo 6740.0 23971.0 23984.0 two23999.0 7156.0 niulIlul6920.0 7592.0 24003.0 24011.0 haUleaf7620.0 hour hlUUhours8864.0 tilt8724.0 Wlttwaskilled 10036.0 Wlttklll1 24187.0 killed klll1killedMr klll1II killedllr 24407.0 24411.0 Mr llrllouluarc HlulwatlItulwnrl24427.0 states tnhgthut8644.0 lu hlhe9048.0 Is 9656.0 frumfromlVas frum11111 frometas 24627.0 24631.0 lVas 24664.0 etas 7408.0 ami1111124635.0 rounltHl regartlttl1l -720.0 IrIti1 24659.0 114utrnthor ntttllrfathern9812.0 aKIM nitOtIt agoon 24843.0 24879.0 KIM 24847.0 goon itOtItul jnurkmnau mtrksninuJ1Irk 24883.0 I1II 8240.0 hnthlt24863.0 1rlfT9688.0 Fentell Fen Fennell 6748.0 25060.0 25063.0 nell 11t1Itell25099.0 25103.0 25068.0 hikllhtlthlthi25087.0 lnlmtulo tlllutlnude25095.0 lItleuf9788.0 ofthe 10040.0 ufUIl 25279.0 25284.0 UIl25292.0 prettiest prttlteatt1Ittl 25308.0 shuts thotslihuts8376.0 he be8648.0 25316.0 ever eerslaw snw25319.0 us nsthotheHimlmul thoIlIl1lmll thennmllual 25499.0 Himlmul IlIl1lmllnnmllual25535.0 witskllleil kt1li1kIIkti25503.0 through throllh8520.0 mulcrUlultr9344.0 mulcrat -480.0 Ulultrhlh underitrnh 2524.0 6752.0 25719.0 hlh itrnh25743.0 25759.0 25739.0 grrntgreatWeston rllt 8212.0 25723.0 8256.0 Ibud ndtinuta 25747.0 nnttl 9128.0 25764.0 25772.0 lWelton tWeston 26155.0 Weston Welton26175.0 26160.0 Make Mte26191.0 Change ChangeR ChangeKChangel3112.0 26408.0 6940.0 K R26416.0 26419.0 11lxttm 7552.0 Vi 26431.0 llt 26447.0 7936.0 who 8000.0 26411.0 ba ha26455.0 26443.0 tho26427.0 pantpantfuv 10048.0 pastfow 26439.0 ln 9896.0 tCow 26616.0 26627.0 Cow fowfuvmouth 11wnt1tuttuth26635.0 lien Iwvutit 26679.0 8316.0 rritently 26640.0 ltt 8572.0 dt1I letttly tlHlnR tUlItJffllinF9800.0 26624.0 thottu10060.0 ttullOilthU the1tt 26839.0 26847.0 llOilthU 26875.0 1tt ltku 6900.0 26851.0 orUlUhK blHhllCtttilturIrrk Itrklerkla9136.0 26843.0 tlu tbfreight freightof rrll freightalHwtrtsaeut 9884.0 htftttr 27055.0 27067.0 alHwtrtsaeut 27095.0 ftttr -844.0 27087.0 27063.0 orthotht7968.0 27059.0 nbonni Sratluotrd-760.0 nHtu 8544.0 Air MrLine 1lnllneLinerailroad -372.0 1lnfftUI llneretlrtttt 6764.0 27271.0 27287.0 railroad retlrtttt27283.0 fftUI 7320.0 27319.0 7360.0 27275.0 tutu tuts27299.0 tet crude hldft27327.0 8432.0 8188.0 27311.0 8276.0 trd Hi kU hIrrnlRimtlon rtirlgnntton8980.0 rnlRimtlontht rtirlgnnttonthe-932.0 rH nnUon nnUonttl 6768.0 27507.0 thtttl 27535.0 HUH 27519.0 locate UUIt 27515.0 h27495.0 take takttnk27500.0 oO effect atCt8700.0 27527.0 oatht9840.0 9680.0 1It 1st9892.0 1ItI 1stt27511.0 27755.0 t27759.0 6808.0 27719.0 IU liltIlevi ii 27711.0 teemcc fm8264.0 ruertlied 8772.0 vdwl 9480.0 -108.0 9904.0 Flv 1ItT Ftv 6916.0 27919.0 27983.0 tv 27943.0 ItT1rtvbo W11427967.0 27927.0 U 8100.0 ftlra mhw1110 8672.0 atRood JOdsurd8764.0 9404.0 ntllrvxitl rIirantllrvxitlman 10056.0 UntI UntI1U41 mat mattown 10052.0 man 1U41town28155.0 naU28187.0 Aft 28143.0 vtto wiwwtWwilt wUtSM28183.0 8836.0 tUMtbt IkMabtttottbtprovo lrOOprove9284.0 28175.0 lrOOuhublt 9872.0 acou arahtxtae 28359.0 uhublt rahtxtae28399.0 rpr 28379.0 rttprtcnttlrc 28383.0 nta -580.0 9008.0 fl thtt28387.0 COW cousetaecouu setaeIwttt 2360.0 28615.0 IwtttUhb lutrtwtslutrtwtsIt tH 6960.0 28791.0 28819.0 HItIiuudrtootl d4lhStutdtrtoIdUtAtt1AtNr8880.0 28827.0 WtwtU Wt 11t9668.0 28835.0 28816.0 eiott eiottwill 9796.0 towill 28943.0 wtUUti W7368.0 29043.0 Porn cottCOItQC 29056.0 29027.0 ctte 8136.0 twrit wltkwlUatkp t1MftliilM 11tuuftliilMMjxnuftctHrtnK -572.0 10068.0 11tuutl1udct Fa 9720.0 4itwt 4itwtTinnufaetKrtnlt 29227.0 MjxnuftctHrtnK TinnufaetKrtnlttl1udct -1132.0 rtnl 29231.0 Compaoy Coaapuroatpaay8232.0 babtUttt9832.0 ca car9676.0 clIclt carpeat 9836.0 capacity 29299.0 29455.0 peat pacitylIclt7340.0 book bokkk ktepctr 29483.0 ftil 8584.0 9328.0 29647.0 4t4 9368.0 29971.0 t4 30007.0 xmlns:ns4 ID19 12059 10060 10668 1680 ns4:type 16547.0 1680.0 arm 17432.0 1708.0 17504.0 20591.0 1692.0 L 17488.0 Led 20688.0 20488.0 2236.0 red redsh 20679.0 ed 1120.0 1992.0 2340.0 3088.0 15000.0 DAYS 14464.0 15004.0 DAYSsh -3084.0 20535.0 2787.0 9 20644.0 2628.0 20596.0 sho 20540.0 sh shnoi 1508.0 13984.0 14992.0 14023.0 ofHappiness 15488.0 o0Happiness 15240.0 20676.0 3887.0 20684.0 hIon 1156.0 10700.0 4264.0 Happiness 14604.0 14004.0 16412.0 Prosperity 15731.0 16424.0 ProsperityI ProsperityIs-3260.0 19684.0 20508.0 4747.0 noiOf 19687.0 noi4312.0 20659.0 1or 20696.0 20556.0 orIs 20691.0 13880.0 13684.0 15036.0 5664.0 Wish 14836.0 16880.0 16672.0 OfTHE 17480.0 17240.0 20564.0 dTHE 10044.0 10684.0 6551.0 12300.0 12036.0 13164.0 12740.0 HYDE 13891.0 16428.0 COMPANY COMANY16116.0 COMPANYFor -3272.0 19699.0 1512.0 COM 912.0 18463.0 ANY 17952.0 ANYI ANYFor-1240.0 19704.0 20567.0 81 20640.0 6864.0 13864.0 7411.0 7444.0 18428.0 13924.0 8uk 2120.0 18448.0 8uk8u 20571.0 8u 8uFor 20720.0 12008.0 8039.0 For 12800.0 8104.0 Each 12512.0 13816.0 One Ono14663.0 14384.0 15200.0 Their 14960.0 16264.0 8056.0 Many 15992.0 17087.0 17280.0 Patrons PatronsM PatronsWe18536.0 8131.0 Si 2056.0 SiBoth se seet 964.0 8616.0 16204.0 8611.0 16540.0 8603.0 16248.0 16804.0 fc 16579.0 fct 16896.0 fcWe 16892.0 12679.0 iMMM 12176.0 13351.0 13000.0 13600.0 13480.0 13636.0 et etWe 14936.0 10672.0 We 11380.0 9339.0 cordially 11240.0 thank 12552.0 9471.0 13464.0 14224.0 9331.0 14088.0 14740.0 your 14607.0 liberal 15352.0 1344.0 16603.0 16380.0 18220.0 17947.0 19132.0 thepast 19740.0 acpast rac 10676.0 9951.0 11232.0 9824.0 12832.0 9959.0 we 13428.0 9908.0 trust 13244.0 14248.0 14020.0 14988.0 14768.0 1116.0 15655.0 9792.0 methods 15400.0 17031.0 9784.0 16772.0 1536.0 17560.0 conducting 19364.0 thisbusiness 19748.0 20608.0 tlbusiness 10272.0 10320.0 12024.0 10315.0 together 11788.0 13268.0 with 13136.0 14032.0 10312.0 13888.0 14632.0 10296.0 highclass 14448.0 16124.0 10276.0 merchandise 15919.0 18028.0 offered 17803.0 19323.0 10284.0 18992.0 willmerit -432.0 19755.0 19488.0 Till Tillmerit 10300.0 844.0 nor 20628.0 ormerit 10668.0 10760.0 10824.0 merit 11512.0 10948.0 11384.0 continuance 11668.0 13580.0 10800.0 13452.0 13847.0 14531.0 14404.0 15664.0 10792.0 Our 15208.0 1092.0 10860.0 constant 16256.0 17600.0 10784.0 aim 17468.0 18236.0 10780.0 18111.0 944.0 18524.0 19552.0 19467.0 tooffer -212.0 19763.0 19555.0 11159.0 8t 8toffer 11260.0 offer 11416.0 11276.0 12148.0 11299.0 Best 11852.0 12816.0 11291.0 Possible 12668.0 1516.0 14008.0 11283.0 Merchandise 15720.0 11304.0 15523.0 16151.0 15940.0 16720.0 11272.0 Lowest 16520.0 17791.0 17564.0 19000.0 11264.0 Price Price55Pricer18812.0 19003.0 Price55es 19640.0 711 11779.0 LI LIBoth 10836.0 12391.0 12808.0 Phones 10992.0 12415.0 Both -900.0 11892.0 BothPhones 11680.0 11624.0 12952.0 12380.0 12439.0 11888.0 12964.0 12604.0 13216.0 13436.0 13208.0 13608.0 12504.0 13720.0 13715.0 14888.0 12436.0 14524.0 16183.0 12423.0 15972.0 1016.0 12795.0 18240.0 18768.0 19631.0 19440.0 19391.0 12936.0 20532.0 IE 908.0 19623.0 IEv 20664.0 20703.0 reIE 20559.0 13103.0 111la 20699.0 20635.0 12919.0 12696.0 R 13272.0 la astt 19655.0 13672.0 xmlns:ns5 ID32 16728 3452 10096 14132 ns5:type 2716.0 10436.0 14132.0 14135.0 DEATH 11208.0 11076.0 11580.0 14140.0 PROF 11456.0 FOSKETT 12088.0 FOSKETTOne -896.0 13152.0 14572.0 14580.0 10468.0 1068.0 11044.0 Gainesville10828.0 12320.0 Old 12112.0 Citizens 12591.0 CitizensPassed 13484.0 CitizensPalled 2372.0 10604.0 14796.0 14799.0 Passed PalledAway 11168.0 NoonFrom 12432.0 12556.0 Noon 12976.0 2408.0 10140.0 15055.0 15068.0 888.0 Saturdays 10588.0 11692.0 Dally12244.0 15060.0 SUD12140.0 SunOne 12547.0 SUDOne 10332.0 15287.0 or10964.0 GalucsvJ11eaOainesvilles10880.0 12116.0 oldest 12032.0 nnd12612.0 12984.0 mostwidely 13488.0 mostwldoly 10144.0 15500.0 widely wldoly10768.0 known 10680.0 11408.0 15504.0 citizens 12184.0 Prof 12044.0 12672.0 12540.0 12916.0 12792.0 Fos 13004.0 Foskott FoskoH Foskett 15696.0 kott koHkett10612.0 15728.0 died dlldlied11068.0 lu10952.0 11328.0 11740.0 11636.0 12052.0 12152.0 nbout11948.0 12728.0 12616.0 12904.0 15723.0 oclock 12784.0 oclockFriday 13476.0 13544.0 IPrldny 13548.0 15944.0 15955.0 Prldny10812.0 afternoon atternoon10688.0 11800.0 after nfterniter11620.0 12332.0 15984.0 nn12208.0 12660.0 illness 12524.0 nhll 13196.0 13128.0 15979.0 12996.0 13324.0 orofseveral oretInl 16103.0 IDtlcenstd 10152.0 etInlmonths 1I10nthHmaths10736.0 monthsDeceased 11480.0 mathsDeceased 11484.0 10340.0 16427.0 16435.0 Deceased Dtlcenstd11256.0 16467.0 WUtl11092.0 11712.0 11568.0 11804.0 16432.0 native nUnor12468.0 Mrtssa II1HRaMttssa12768.0 Mttssachusetts 13432.0 12920.0 Mrtssachuaetta 16648.0 16656.0 chuaetta chusetts10244.0 llUH -592.0 10632.0 16667.0 ttJ 10576.0 11008.0 16659.0 11400.0 Im4tmns11820.0 lWln12336.0 16651.0 fu12192.0 thlH12476.0 13048.0 SUUoSuttSUUofor Statefor 10156.0 16867.0 16883.0 ror10512.0 tho10388.0 10900.0 16912.0 pa 10772.0 10904.0 16888.0 lnMt11180.0 11244.0 11368.0 twentyseven twentysevcn11248.0 lWlntYH 16904.0 vtI 12600.0 years larH 13052.0 III13328.0 IIIJSSO 10160.0 17112.0 1880 JSSO17099.0 10500.0 10892.0 17136.0 came camoCmo11432.0 11324.0 11688.0 17091.0 Florida investing Inustlllg13336.0 lit13224.0 Inan litnil 13472.0 17308.0 17360.0 nil10452.0 orange orall 11016.0 10936.0 17379.0 11132.0 17336.0 property IlroltIt10984.0 11960.0 17319.0 III11844.0 12224.0 17316.0 the12104.0 12596.0 17311.0 vicinity 13219.0 ofArrodomlo 13492.0 ofAIrtdollllo ofArredoudo 17532.0 17543.0 Arrodomlo AIrtdolllloArredoudo11200.0 11032.0 11436.0 11684.0 17540.0 HaitI11564.0 12276.0 12012.0 12776.0 JlroJllrtpropertyfailed JlroJllrtrnJ1llI -596.0 failed rnJ1llI10808.0 17775.0 11152.0 17756.0 materialize umttIlnllzIimmaterialize10956.0 12284.0 17783.0 any 12096.0 17788.0 nn 12576.0 financial IIl1allllalfinancialbenellt -704.0 IIl1allllalhlllll1t financialbelletlt 17991.0 benellt hlllll1tbelletlt10884.0 whln10712.0 11444.0 18012.0 WI1Swns11556.0 17972.0 abandoned nliaudOlItII11992.0 13188.0 alldandthe alldthl 18188.0 thl10496.0 18204.0 deceased dlttluwddecemHed10412.0 11332.0 went 11736.0 12056.0 18196.0 Ocala Ocnll12664.0 wlwrt13260.0 18191.0 forseveral forrenrs 10844.0 18455.0 yoarsrenrs10744.0 18419.0 lllhe11284.0 11672.0 18444.0 wnHwas18416.0 engaged cngagld12856.0 18411.0 12752.0 13096.0 busi buslbusltfc busiIialt bu 13400.0 13288.0 lIfltI 18635.0 IfltI IfltI11n tfc 10488.0 18684.0 10344.0 tIeavtng 3092.0 10348.0 18859.0 18872.0 Iialt 10352.0 11n 10848.0 Ieavtng 10640.0 vlll 11000.0 10912.0 18903.0 10888.0 18864.0 Ocalu11004.0 11100.0 Oa 11572.0 Irof 1rorProfFcwkftt IosktFosketI12764.0 12824.0 roturn rttlllllreturn12820.0 roturnod rttlllllIdreturned-520.0 13440.0 od Ided10484.0 19112.0 928.0 OalnuKiVillu GIItWtwtllo10636.0 Guile -928.0 11696.0 cville 11236.0 11876.0 19080.0 nllullt12484.0 eight olghtthhl12348.0 13036.0 19104.0 yoars12908.0 yoarsa yearsago 13140.0 lart lartngo 13448.0 19291.0 19347.0 ago ngo10236.0 10256.0 19352.0 10444.0 10356.0 10292.0 10592.0 19312.0 since wlnco1IhlCl11116.0 19299.0 11720.0 19304.0 tlmotllIt11604.0 he12496.0 19296.0 hnH12388.0 12880.0 resided rosldotlrlHltltt12772.0 rosldotlhoro rlHltltthtrt residedhere 10164.0 19511.0 19536.0 here horohtrt19568.0 a10524.0 10832.0 greater rlntlr11540.0 part Illrl11440.0 11964.0 19523.0 11880.0 19515.0 tIll thothe12124.0 tlmo tlllattm13040.0 bolng12944.0 bolngongagod lltln lltlnlngl1 beingengaged 19732.0 ongagod19784.0 lngl1 10664.0 ld 10544.0 n811160.0 19779.0 011088.0 19743.0 piano pimulo11252.0 Ilia 11784.0 19776.0 no 11860.0 tnnor tlllwrhoner12392.0 12312.0 19771.0 nnt 12676.0 repairer ropalror12635.0 ropalrorHo 13444.0 rtIII repairerHe 13144.0 IIlr IIlrUt 10168.0 19951.0 19972.0 Ho UtHehn8tins10396.0 10840.0 19967.0 boon hlln1lcl110756.0 11316.0 tor11216.0 11640.0 19975.0 thothe11548.0 11I8t12424.0 12328.0 19983.0 12716.0 13060.0 throe thrtIthree12968.0 throeyoars thrtItlrs threeyenrs 20223.0 yoars yenrs10264.0 tlrs 10608.0 10720.0 20191.0 ha10960.0 010852.0 20180.0 condition 20172.0 11924.0 12640.0 would wunltl13228.0 20183.0 not 1I0t13112.0 notponnlt 1I0tlrmlt notpermit 20415.0 permit ponnltlrmlt10708.0 11172.0 20399.0 working wurking11056.0 work 11856.0 11612.0 InK 12016.0 helm bolnghlln 20396.0 12360.0 12848.0 20423.0 very orywr 13200.0 ill13104.0 111health 111IltlHh illhealth 20631.0 health IltlHhhealthDocoasod IltlHhDlclmiwil healthDeceased 20847.0 DocoasodDlclmiwil20876.0 W8uas20871.0 n11652.0 12160.0 20835.0 member mnmbormomhlr12948.0 20832.0 12836.0 13236.0 thnthethnKnights tilt11I1 theKnights 10176.0 21067.0 Knights 21075.0 11I1 htH 21072.0 11204.0 21059.0 Pvthlan PythiasP 11836.0 thhH 11944.0 ntd ar12240.0 12084.0 21051.0 Odd Fellows leJlowMkellows12684.0 Fellowsand 21048.0 leJlowMnnd kellowsamid 21291.0 nndamidbolng10456.0 bn 21323.0 10972.0 11424.0 11524.0 21320.0 11940.0 musician mUHlclnuhs21304.0 etcaccomplished ncOIn 13348.0 etccomnldIHlteI 13456.0 21331.0 21483.0 complished comnldIHlteIcOIn -924.0 21507.0 IllItlh 10492.0 11212.0 21539.0 nKnutdlalrur12404.0 htSlJthesethoselodgofl theselodges htSlJlodglN 10172.0 21719.0 21731.0 lodges lodgofllodglNIIIha10692.0 21723.0 tholrthltHlIle11952.0 21747.0 wnM21744.0 12844.0 tIInnelanmanof tIInnor elanof 21927.0 21955.0 or21947.0 peculiarities pocullarltloslltllInrllhN11632.0 21943.0 hut11468.0 21935.0 whonwh1112568.0 understood uutlorstooil12440.0 uutlorstooilwas understoodwns-912.0 21932.0 IUtItr tnOlI 13043.0 tnOlIwatt wattwns10596.0 wollWl1liked llkod10920.0 llkodTho 11464.0 Ilk Ilkrho 11228.0 likedThe 22372.0 22391.0 Thorhofunoril rllltrLfuneral11452.0 1wbe12136.0 hold IwhlheldSunday SU1llnraf arofaftornoon arhfIloml ofternoon 22583.0 22628.0 tornoon hfIlomlternoonfurther furthorrurthtr11608.0 22596.0 invutinn ulluliounneution12372.0 22591.0 12280.0 12528.0 13192.0 w11w11lilt 22799.0 22836.0 liltbe10516.0 22828.0 iiuuloIUIUlllater latorlahr11884.0 Robert KobortHobrtMcClollan lrCItl1an1cClellanMcClollanwill 12744.0 lrCItl1anwlU 1cClellanwill10184.0 23031.0 23051.0 wlU10568.0 have luivo10472.0 23043.0 rtmrgohar 11592.0 11516.0 11396.0 or11560.0 11936.0 23035.0 thotime11848.0 arrangements nrrangoinontsnrrangoinontsFrom arrangementsIront-1168.0 23063.0 nrrllI tmtlIts tmtlItsrum 23511.0 Iront23564.0 rum 10616.0 23519.0 SunduyHSllndu 23567.0 11224.0 23515.0 Dully Dally11676.0 811nSunTho 12400.0 811nhl SunThe 23715.0 23744.0 Tho23736.0 funeral funoralhllHrnl11492.0 23739.0 or11776.0 23731.0 ProrProf11644.0 12292.0 12128.0 12564.0 23723.0 osktttFbskettFoskotttho Fbskettthe12932.0 oskttttilt 23939.0 23963.0 thothesurf amilInd23955.0 death clonthtlath11488.0 23960.0 11756.0 23952.0 ucllrrt1llocetrred23944.0 Fri IrlIrlday 13320.0 rlth 24007.0 24159.0 24184.0 10552.0 aftornoonutttr1UOII10308.0 11504.0 24168.0 WIll llllo IItLIl11908.0 24176.0 btt 12092.0 IHhiheldthl24163.0 nrltrafterIHHMI nrltrnOIl 24379.0 24435.0 noon IHHMInOIl10716.0 24416.0 10564.0 11012.0 24399.0 2io 11192.0 SO w11352.0 11500.0 11356.0 24387.0 frHt1112064.0 frt 12608.0 m 12760.0 thothl13160.0 Oilil0111113016.0 OililFollows 01111Hntlll OddIolloavs 10188.0 24599.0 24619.0 Follows Iolloavs10988.0 HntlllMotu24611.0 Rev Uov11628.0 Itt 24607.0 11796.0 24603.0 ItH112196.0 12656.0 Hojors Htelrltorers13332.0 oftltI 3168.0 24820.0 24839.0 thotltIFlrnt IIrst10440.0 10704.0 Irtlt 10968.0 11108.0 24836.0 liajitlst Ual1UtUahtlst11832.0 churrh11700.0 12532.0 24823.0 ottlclutlng omrlntlllotticlatlugottlclutlngThe otticlatlugThe-820.0 omrlntlllI 10360.0 25039.0 10820.0 25052.0 dtcojvHoU dtCtttllddeetatsed25047.0 bolng1Ilnt11552.0 12288.0 25076.0 nmombor uHmbtrtnenmberororI 10100.0 25139.0 10128.0 10104.0 25339.0 Hit tho10556.0 25271.0 25276.0 lnl ht8 or25259.0 Pythias lthlnRlythinsanilnnlt12220.0 Odtl0111112624.0 Fol Fel13300.0 25327.0 25495.0 lows 10125527.0 aK10548.0 25483.0 woll25519.0 11320.0 as11532.0 11728.0 25479.0 tholhtHobokah HlbkabItebekah11988.0 dtgroo itllrltdtgreedtgrooof dtgreeofitllrltot 25699.0 25715.0 ot25707.0 tholhl10336.0 10804.0 25711.0 I10696.0 25703.0 11268.0 011120.0 luotubon UtmtrtlutetnbersMount luuntMountVornon Iotn luunternon 13404.0 10192.0 25915.0 25931.0 Vornon 25959.0 lrnon ernon25923.0 IxxlRo 1udRtNo Xoan11732.0 25939.0 12048.0 Knight KtttghtsKn 12464.0 25920.0 12620.0 hts 12500.0 oJ orof12860.0 13240.0 Py Pr13108.0 Pythian Prthhl 25991.0 26028.0 26144.0 thins thianthhl10132.0 26147.0 Center ContorCnhr10584.0 26139.0 Lodge Ixxlgolod 26136.0 11648.0 12164.0 12076.0 26115.0 n11 12296.0 11126131.0 O13028.0 O0I 13284.0 Fand 13392.0 FI 10108.0 26351.0 26363.0 ttdnud26355.0 Colfax CIttX10480.0 Ilobokah 11124.0 26359.0 -708.0 11972.0 1ttbekah tw 11780.0 nh 11664.0 Ixxigo locllbodge12876.0 26392.0 13131.0 13384.0 13204.0 IO 13424.0 26571.0 26583.0 O26579.0 00 O26611.0 nrofir 11340.0 requested roquostod11164.0 26607.0 11508.0 26603.0 1lh 11900.0 It1 26591.0 1012488.0 26587.0 meet mwt12396.0 12980.0 26595.0 it13124.0 thotholodgoroom thhIJlIOOtt thelotigl1motn 26791.0 26795.0 lodgoroom hIJlIOOttlotigl1motn11176.0 26823.0 over11472.0 26827.0 utums uttnIhmttons12308.0 IXnnk lnakItaak11744.0 12896.0 26815.0 nt Jtat26807.0 26799.0 1t 1301tp 130p SOp 27012.0 27051.0 27047.0 nu mooClr10648.0 tho11300.0 27039.0 puria5e 11388.0 itirjH IItrl11812.0 11872.0 27043.0 11932.0 ot12344.0 atteudltti attrttdlug12272.0 27031.0 att dhal 27020.0 tlutlufuneral t1 t1fUltltrni 13340.0 thefurttrrtl 10200.0 27223.0 27231.0 fUltltrnifurttrrtl10896.0 nndInd27228.0 iNiylttg 1N1uJ11184.0 27260.0 Iw 27263.0 11496.0 ytug tholrtblrIx 12364.0 27267.0 27255.0 l12888.0 roniwt rtaptctroniwtto rtaptctto27443.0 27463.0 10424.0 27451.0 tholhodocoAStnl dtJlddecraslal27447.0 brothor brothlfbtothtr12384.0 Theso Thuso12180.0 Thu 12884.0 27484.0 12708.0 27455.0 orders ordorsordtrordorsatv ordersnIordtrnN 27659.0 27703.0 atv nNnI 10580.0 ofliclnl ottichi27667.0 ont 27663.0 nnd10816.0 11376.0 Jld 11916.0 tullattendance attemtancolUndlntl12188.0 lUndlntlr1tquI 27679.0 lMRS 13388.0 Ir Irruque 27883.0 r1tquI ruque10752.0 tMl ttdttdMRS 13532.0 IMR8 2756.0 28299.0 28323.0 MRS MR828320.0 JOLLY BURNED 11928.0 BURNEDFurther IFurther 10216.0 28751.0 28755.0 Further Particular Particulars12004.0 28759.0 28763.0 Sad 12536.0 28771.0 Accident Acci AccIdent 28843.0 28975.0 dent 10732.0 WeilKnown WtUKnownWell -1024.0 Known 12212.0 28979.0 28983.0 LadtLadyTho 13252.0 LadtTbt LadyThe ThoTbtSUQ Sunfew 11308.0 fe dAji4araaco Ingo29247.0 contained contalacdcontaineda contalacdA29271.0 eoo 29475.0 notice 10248.0 noU 10996.0 29467.0 tba tbcf tact oct 12580.0 Mf812508.0 BeBe BeneDCUeBeneJil DCUeI29979.0 30011.0 Jil 11704.0 13172.0 30391.0 0i 13212.0 1160.0 30511.0 30615.0 30603.0 30627.0 12796.0 xmlns:ns6 ID33 11932 3416 13552 14127 ns6:type 13616.0 14127.0 Jolly Joll 14216.0 14168.0 n13912.0 14452.0 14304.0 wellknown 14784.0 14164.0 15384.0 14596.0 ell 14552.0 15536.0 lad 15868.0 16016.0 15760.0 16308.0 Waldohad 16168.0 16832.0 16332.0 13624.0 14351.0 14072.0 14356.0 seriously sprlously14440.0 15484.0 14359.0 burned hurned15332.0 16227.0 16032.0 16635.0 16488.0 thefollowing 13627.0 fruit14396.0 14712.0 10111 15032.0 15228.0 ThoTht15027.0 1Caldo16447.0 14588.0 News Newsgives 16584.0 14620.0 ews ewsgives gives 14156.0 14048.0 14519.0 Ilartlculars14804.0 or15416.0 14807.0 15660.0 16164.0 14828.0 16063.0 16664.0 14812.0 de der16559.0 derplorable 16884.0 deplorable deIllora 16840.0 16844.0 14884.0 15020.0 plorable Illora 14299.0 14060.0 hlo 900.0 14387.0 15024.0 misfortune mlsrOltulIImisfortuneThe mlsrOltulIIThe15288.0 2996.0 13896.0 15243.0 14372.0 15260.0 14932.0 horrible horrlhl15576.0 15252.0 accident nccidontaccldllIt16568.0 thathas 15467.0 14044.0 15472.0 occllrred13900.0 14924.0 14764.0 15212.0 15643.0 15480.0 cltr16088.0 15475.0 15516.0 yoarsyoarswas yearswas 16552.0 lnrs lnrswas 15691.0 13932.0 14480.0 accidental 14336.0 acthlf 15320.0 14964.0 15736.0 14968.0 15015.0 15699.0 ntal 15464.0 burning hllrnlng16232.0 15704.0 ot16092.0 15712.0 MrsIle11e 16384.0 16535.0 16836.0 MrsHolle 16628.0 Irs IrsHplle 2844.0 15912.0 Holle HplleIle11e14144.0 15915.0 14660.0 last 15920.0 irldny14952.0 1Ihh 15588.0 15687.0 15923.0 aftornoonafttrnoon15440.0 aftornoonMrs afttrnoonlrHafternoonMrs-780.0 16468.0 16136.0 lrH14348.0 14211.0 JolI 14744.0 14640.0 16144.0 standing stanlIl1gsttutling15156.0 16147.0 before 15936.0 lI 16172.0 16112.0 16152.0 fJrt 16644.0 16496.0 theflro thellro thefire 13632.0 16356.0 fire flrollro14100.0 horhe114916.0 16392.0 room 10011114716.0 15520.0 16368.0 upstairs lIllstalrs15323.0 16324.0 hlr16464.0 herfathers hlrflthtrs 16580.0 fathers flthtrs14352.0 homo honlthone14255.0 16583.0 whon whtlltvlem15436.0 16588.0 hor15340.0 16591.0 dross tlnssdress15692.0 16280.0 16596.0 becameignited 16283.0 became bccainobCall1l-604.0 bccainoIgnitod 16727.0 16799.0 ignited IgnitodIonlhd16807.0 lIv14196.0 14680.0 14536.0 14920.0 hlllnltlhorning14772.0 16815.0 brand lIrand15552.0 16156.0 16647.0 16823.0 thothethohearth thehearth 16948.0 16972.0 17023.0 hearth Illnrth14268.0 thnt14160.0 14695.0 sproad spralsitread14575.0 15344.0 15232.0 lth 15684.0 15787.0 17039.0 Mich1IhraI 16139.0 16252.0 17047.0 rajiiity ralldlty16456.0 rajiiityboforo ralldltybtfotl 17052.0 iity iitybefore 17247.0 boforobtfotlsho14148.0 14692.0 17252.0 could 14556.0 15272.0 17255.0 descend doscond15124.0 16051.0 17263.0 thothe15900.0 17276.0 stain Msur16296.0 Msurthat 16872.0 stainthat 16524.0 16748.0 17303.0 16660.0 1that 16776.0 17452.0 17471.0 13956.0 clothes clothoslothf814316.0 15080.0 vero WtttIwere14984.0 15836.0 15743.0 17487.0 llro Hrlflre16012.0 17527.0 16371.0 17492.0 ulu whpn16752.0 whpnHhl whenshe 17535.0 16800.0 16784.0 nsho 17691.0 shoHhl13992.0 reached roachod1tlrhfCIhor15008.0 14880.0 14824.0 14940.0 15112.0 17700.0 mother moUlIt14971.0 15828.0 17708.0 lio 16148.0 16239.0 17751.0 1I16315.0 17719.0 st 16508.0 Utd Utdby 17724.0 ttti tttiby 17915.0 13812.0 17920.0 14172.0 King IlnoBing14276.0 wlto15360.0 hoanl hlllheard15896.0 17931.0 mite thothp15796.0 16312.0 screams creams1lItUIIScreams1whllo 16952.0 Iavlnlle 18091.0 18131.0 whllo avlnlle13772.0 14068.0 18139.0 passing Illlsslng14948.0 18144.0 succeeded suocoododICCphtI14792.0 15875.0 18155.0 11115768.0 18163.0 wrapphu wrapldgtvraphhngwrapphua tvraphhnga-752.0 18260.0 18355.0 largo large13656.0 rug rlt 14684.0 18363.0 auott15428.0 18368.0 lurIwr15824.0 18376.0 otin pxtlnexthmexthmguished 16444.0 otingulshod 18452.0 1glll 18535.0 18579.0 gulshod guishedglll 14252.0 hld 13872.0 14376.0 thotimelire iliv111114624.0 15159.0 18587.0 hilt15528.0 too 15412.0 18595.0 late lale18627.0 16340.0 18640.0 16544.0 18643.0 save SI1Csavehor saveher Ihtr 18800.0 horhtr14016.0 18803.0 frightful 14392.0 18811.0 burns IJtrlls15892.0 18856.0 16195.0 18827.0 dlffrfnt 16072.0 dlffrfntportions lifft 16735.0 matportions 19020.0 portions 13688.0 lOItlnn 14308.0 19027.0 horIHr14560.0 15040.0 19031.0 belly bodvhCIbodvMrs 13908.0 19244.0 Irs19247.0 19252.0 Hicks 14128.0 14944.0 burnt15628.0 19263.0 lur hrhtr19267.0 hands haiidhhatHls19283.0 bad hatl16452.0 badly 19463.0 ly 13668.0 19468.0 thoUH14028.0 14512.0 19476.0 moantlmo tnllllllnllnteatntitne15584.0 Dr Hr15335.0 15928.0 Boring HorlugilorlugIas Iassunttnoned 16640.0 Va 16723.0 19544.0 nssummonod 19600.0 19660.0 19692.0 summonod sUtnIllOlH1lsunttnonedhnmodlatoly hlllllCdlltIIntutcdlately14504.0 11111anti15676.0 16100.0 16688.0 19727.0 allpo nlllIhlt 16968.0 allInstable 19908.0 19940.0 po Instable nlblo 14000.0 Ihlt 14368.0 done dnnodonl19927.0 15059.0 19919.0 rellovoMrs 14976.0 relieve rellpp15672.0 15620.0 rs 16068.0 Jollv Joliv16459.0 oll 16564.0 19948.0 whoIs 19980.0 16708.0 hois 13640.0 20127.0 still stili13759.0 20135.0 critically rltlcll1 15044.0 15180.0 20140.0 11115456.0 20148.0 15831.0 15956.0 tholhl16320.0 cffds trrtsaffctscffdsThis trrtsThis affctsrhls 20347.0 rhls14112.0 20352.0 1t413988.0 20355.0 thothp14236.0 20363.0 second socotulsotHl14600.0 htuhtr dangllter15264.0 dau -716.0 16104.0 15784.0 20412.0 15924.0 16107.0 20391.0 20420.0 16348.0 filldandUrn 16876.0 Urn IIsis14096.0 15 D20576.0 14343.0 Ilicks20579.0 huvohlv15379.0 hntlandburnodbllrttl1ns20619.0 allwill 20792.0 20800.0 romomber retnentber13920.0 14116.0 tuptn1Jf 14724.0 14728.0 14751.0 thothesad in115172.0 15592.0 hllrnlllCburnlna15291.0 or16212.0 16503.0 thdr thlr16652.0 thdrtlauUfll1 thlrheautlful 16767.0 20840.0 Irbeautiful 21016.0 beautiful tlauUfll1heautlful14492.0 YOllng15103.0 dnugliter dallJhtfrdnughter14980.0 16004.0 MUs llss15840.0 16364.0 21087.0 21056.0 Lola LnlaIn1a16359.0 Lolaten 16491.0 Lnlaton In1ahn 21243.0 hnten14468.0 21275.0 ato14312.0 14748.0 15048.0 21248.0 tho21259.0 15120.0 15088.0 15460.0 nm 15860.0 houi lI1I1 hou16271.0 t16132.0 16476.0 21280.0 Thy ThyhUl 16808.0 vyhavo vhave 2108.0 21451.0 havohUl21455.0 tho14012.0 Ih 14444.0 sympathy mlnthy15328.0 21471.0 or14508.0 15555.0 21479.0 ail15476.0 allSTATE ailSTATE 2484.0 13996.0 21895.0 STATE AID 1328.0 FORSCHOOLS FORSCHOOLSApplication -1328.0 21916.0 FOR -1324.0 15640.0 21919.0 SCHOOLSApplication SCHOOLS SCHOOLSApplicntlon 22335.0 Application Applicntlon22343.0 Has Been 15128.0 16007.0 22367.0 Made forSchools forI 13552.0 22559.0 Schools 13576.0 14800.0 14700.0 Alachua County CountyFrom CountyJrom CountyFront 2260.0 JromFront14167.0 22819.0 SUlltlnsSuntinys14064.0 hntly14896.0 nal1 SmrSltnSmrApplication Sltnllpl1rllol1 SunAppllcntfun llpl1rllol1Appllcntfun14912.0 fur15296.0 23055.0 Stair15140.0 15863.0 aM nl1ail23076.0 fur for23103.0 tschools 16676.0 23084.0 tb tb1rhools 16816.0 23143.0 23251.0 schools 1rhoolsselnols23259.0 14651.0 AIIhullAlnehun15444.0 23299.0 county OUllt 23287.0 halhas15872.0 16515.0 23303.0 b23343.0 ntiled jflltd 23475.0 tiled flltdmt 13964.0 13836.0 13884.0 whlh14720.0 23488.0 14956.0 14848.0 23491.0 imrest Intotrsthmtrtst16216.0 thltit23559.0 10 peapeaItit 16764.0 23572.0 oplo 16855.0 23691.0 plo 1111Itit23699.0 or13868.0 14272.0 23728.0 ollnt 15191.0 15548.0 23720.0 thfshe23759.0 niiportim npiortttn15856.0 niiportimment 23763.0 lIport 16612.0 illl 16572.0 23919.0 meat mentlttlnt14152.0 ot23923.0 tlmr 23928.0 5choolIIIishs as15648.0 follows rollnsfollowfollowsGiiInosNlllo 16679.0 rollnsclh 16620.0 followGalucsttile 13808.0 24139.0 GiiInosNlllo Galucsttileclh -908.0 14284.0 24179.0 14123.0 14475.0 24143.0 24151.0 15203.0 11aldo15092.0 24155.0 aldn 15816.0 htth24171.0 15948.0 achotl achotl6tH 16756.0 sch hjIH 16576.0 24235.0 N 16616.0 NJem Jem jIH 6tH24363.0 Ilhetteh24367.0 Hawthorn I1lwlburn15740.0 24383.0 Island 1llnl115544.0 24403.0 jrll16224.0 OnHochelle 16600.0 16500.0 24440.0 rot rotlttxhelle 16623.0 24451.0 24575.0 Hochelle Hoditlllttxhelle24588.0 AInchuR14332.0 High 15136.0 15792.0 Sprlncs SprImmSIrl1 16400.0 16336.0 24656.0 seneh 16556.0 SJeach SInlll 24799.0 Inllleneh14180.0 24807.0 UiCroyj0 IIrollIaCror14856.0 24851.0 24815.0 Tr Trtttun Trentonnton SIl16779.0 24891.0 rThis rry rr 25023.0 25055.0 13940.0 SuQ 13784.0 tk 14360.0 25031.0 enclt14228.0 nhI nhThllt 14732.0 13803.0 25239.0 Thllt7hlnpprt 25263.0 1111tIrIAtton apprrnprtatlon14776.0 25295.0 14832.0 irifttlon 15680.0 Hill wiltwillt15960.0 irn 25324.0 Id 16420.0 25331.0 agrt 1aiKri 1Jrftl 25467.0 Kri Jrftl grt13840.0 thine thllllthtntfllr14864.0 25532.0 25516.0 14892.0 25487.0 15176.0 hn 25543.0 15367.0 tdl srhwl 15932.0 srhwlsere 16128.0 15976.0 iH 25564.0 1tr 2932.0 25688.0 sere 13764.0 TI fates faorfnr1 14563.0 25695.0 14704.0 14668.0 14839.0 nll 15115.0 15216.0 thf15423.0 15560.0 tri Iru15951.0 25775.0 25767.0 am15980.0 nttrnu ltrous 1616.0 trnu trous25935.0 runs 25967.0 25947.0 apt aii11125951.0 f25979.0 114628.0 25963.0 14568.0 25975.0 14808.0 25943.0 14876.0 I14908.0 xmlns:ns7 ID34 12144 3708 17020 13871 ns7:type 20068.0 13871.0 14143.0 Attention At 18243.0 17740.0 entlon 17652.0 18412.0 Stonewall Camp Cantp19228.0 CampYou 19772.0 20611.0 14219.0 dYou dr 20711.0 17200.0 You 17592.0 14623.0 17520.0 17916.0 17847.0 18795.0 14591.0 W18719.0 18952.0 19504.0 It19423.0 1ville 19535.0 tvine 20080.0 1vllle 17020.0 ville vlllevineMonday 17372.0 17588.0 Ionda -560.0 18148.0 18044.0 19047.0 Jan 18932.0 14860.0 19344.0 20044.0 19543.0 20048.0 x 20104.0 17040.0 17312.0 17196.0 18135.0 Pensions Penslone17876.0 18995.0 alldacrd18876.0 19411.0 15111.0 19288.0 15116.0 19912.0 I19491.0 rat 19939.0 ratters 20132.0 20031.0 iv Uivters Uters 15311.0 ters 17448.0 17344.0 17784.0 17680.0 18140.0 welfare 18035.0 18860.0 18751.0 19115.0 tbe the19015.0 19376.0 Ct 19532.0 Cthe 19636.0 19599.0 tvbe 20063.0 20019.0 20088.0 20083.0 20632.0 15364.0 20136.0 yhe be17307.0 discussed dlscussld17212.0 15535.0 By Dy18084.0 18636.0 order 18540.0 19179.0 15532.0 ofHORATIO 19335.0 15591.0 cHORATIO 17436.0 15756.0 HORATIO 18399.0 DAVIS 18299.0 19108.0 15759.0 Com Corn18971.0 ComJNO 19464.0 ComJO 15815.0 sJ JNO JONO17696.0 17940.0 MGREW 1GREW18848.0 15988.0 Adjutant Adjutnnl18712.0 AdjutantOalnesNille 19560.0 AdjutnnlGainesville iGainesville 17216.0 OalnesNille18308.0 16211.0 Fla PIa18128.0 18788.0 16219.0 Dec Doc18568.0 19279.0 20 19103.0 20Our 19448.0 20krEFU OHEATERS 16287.0 2896.0 16567.0 16991.0 HEATERS 17988.0 krEFU -2108.0 20095.0 krEFUlll -1828.0 19816.0 2044.0 17524.0 18487.0 18500.0 17712.0 lll 17923.0 17776.0 17888.0 Store 17815.0 18780.0 19152.0 18492.0 II18980.0 19367.0 18560.0 CM CMquart 19567.0 m1lmrtlr mlllaltt1 18756.0 quart lllaltt1lmrtlr 18255.0 18100.0 18824.0 ITS 18296.0 18759.0 fob19032.0 Sto StOYSttov18851.0 StoHeaters 19036.0 StOYHeaters 19147.0 1Heaters 2608.0 17376.0 Heaters 18592.0 Burn BurnOil 2992.0 17152.0 Oil 20099.0 Wood 17536.0 20119.0 18656.0 Coal Coa19540.0 CoalMi CoaIfCoalIf20144.0 2464.0 17175.0 20607.0 Mi 17304.0 17251.0 17368.0 17512.0 17460.0 17615.0 flM 18320.0 17835.0 MM 19564.0 MIf 2704.0 17424.0 20956.0 20963.0 If 17752.0 tiall17580.0 18311.0 want 18132.0 18839.0 19024.0 20987.0 thotw19576.0 20979.0 19360.0 20971.0 11gtt 19787.0 19675.0 21080.0 19752.0 riUt 19868.0 19916.0 20967.0 flt 17143.0 21315.0 iUt gtt17451.0 17688.0 tin tIlltilt18316.0 famous fmnol1sUl 11119444.0 111N 19904.0 19579.0 UlOAK 21307.0 19792.0 Ifor 2672.0 21583.0 OAK 17551.0 21612.0 21671.0 18276.0 18424.0 Your 18920.0 21660.0 I119824.0 llor Ilor 2712.0 17156.0 21879.0 lor 17439.0 17612.0 21967.0 Ill17400.0 17820.0 18003.0 bedroom 17780.0 19455.0 Piri Piriin Pt 19736.0 19664.0 rill 21976.0 1i 19775.0 2604.0 17163.0 22191.0 ill17348.0 22259.0 22251.0 Construction 1ltructiontullruct1Ullr22224.0 andc 18888.0 andcIU 19768.0 aJHlthh1 19728.0 22303.0 clall 2460.0 22499.0 h1lall22515.0 illn17404.0 22551.0 18076.0 22536.0 17568.0 gases 18267.0 22543.0 fronlfromcoal fromcamll 2576.0 coal 1111camll22831.0 17548.0 ha 18167.0 22911.0 more snore18055.0 18904.0 22844.0 heating hcntiimheatin18804.0 hcntiimfact heatingfact-816.0 heatinfatl 2780.0 23124.0 fatl17648.0 23135.0 than lllflrl18199.0 23216.0 Hnv -388.0 18248.0 18472.0 18372.0 18700.0 23159.0 Heater HeatcrIIoater18584.0 111111hll 19680.0 lilt liltllt 19804.0 19900.0 23192.0 1hiiivy 19936.0 2696.0 17160.0 23423.0 hiiivy 17351.0 17771.0 23507.0 17507.0 17960.0 cast 17768.0 cn 18360.0 18172.0 18052.0 23464.0 howl Lowl19223.0 fiudautlandhudy 19608.0 autlilnpos 19819.0 23496.0 tbile 19856.0 2668.0 hudy bile 17444.0 17932.0 almost altno18572.0 23807.0 1072.0 iinpossili iinpossilihum -1072.0 19828.0 ilnpos 23839.0 1npos 19396.0 23779.0 19796.0 23855.0 t2664.0 17168.0 24043.0 hum 24115.0 turn 17800.0 24108.0 18475.0 24123.0 top tl 18807.0 24084.0 19432.0 24079.0 hot huttbuttbuttlltft 19831.0 19435.0 hotdraft huttdlft 2740.0 24356.0 draft dlftlltftdoors dorlOjr24456.0 18375.0 18528.0 24443.0 118895.0 24391.0 regular reguhrebultit18575.0 rebultitllttt -804.0 24475.0 19860.0 24432.0 fhvit fht 2472.0 hvit llttt17571.0 24720.0 17332.0 17872.0 24688.0 niekili nipktlnilvlt18651.0 24712.0 18880.0 24704.0 footrail footrnifootraifootrailBaird footraitell 25019.0 tell 17556.0 t111111 t111111Baird -468.0 18023.0 20248.0 25111.0 25548.0 Baird 17979.0 25575.0 Hardware 19320.0 25591.0 Compy Comps25599.0 20163.0 xmlns:ns8 ID37 3768 6144 14144 26427 ns8:type 20112.0 26675.0 20256.0 15812.0 26831.0 BABYS 16268.0 17844.0 XMAS 17500.0 26891.0 GIFT 18556.0 GIFTM GIFTiGIFTt-576.0 19332.0 27403.0 27487.0 tiat i27575.0 16811.0 27592.0 t17464.0 18079.0 18192.0 27547.0 18816.0 27555.0 look lrnkalii 19135.0 aliir 27643.0 Ahl 15668.0 16820.0 27695.0 4752.0 27851.0 15567.0 27815.0 iilvir 16080.0 27827.0 16236.0 27743.0 ro r16388.0 ctAI27763.0 18108.0 27767.0 18580.0 27787.0 18660.0 18836.0 27783.0 18964.0 27779.0 span tlpoun27811.0 20288.0 27875.0 16943.0 27895.0 16188.0 16999.0 16987.0 17028.0 taire 18008.0 18152.0 ati 27891.0 18512.0 27911.0 1f2Ii 18551.0 18900.0 titratan 18663.0 27947.0 connir 27991.0 28035.0 28031.0 15071.0 28023.0 15800.0 28043.0 15844.0 16000.0 16180.0 28039.0 Ttn 16260.0 28075.0 17339.0 28099.0 17544.0 28055.0 17428.0 17639.0 28119.0 17744.0 Ist 17671.0 18040.0 28123.0 n18792.0 28083.0 ttllte 18612.0 28131.0 19208.0 28127.0 28195.0 15608.0 28191.0 16019.0 16327.0 28223.0 28243.0 16828.0 28235.0 reIi 28275.0 5268.0 14188.0 28228.0 28291.0 18468.0 28267.0 theit 18695.0 28311.0 28315.0 28303.0 16024.0 17456.0 1312.0 ifM 17620.0 28439.0 18264.0 28455.0 17884.0 18499.0 28476.0 yIt 18739.0 28483.0 18772.0 28435.0 28479.0 19203.0 19611.0 i4 28687.0 zz 28716.0 28719.0 15235.0 28692.0 28703.0 IL 17244.0 17879.0 17595.0 18120.0 28595.0 18123.0 18272.0 18672.0 28627.0 S1H 18675.0 51 19100.0 28631.0 N18968.0 Up UpL 20051.0 19880.0 28663.0 pL 29159.0 29167.0 15848.0 29175.0 SMITH 1280.0 16984.0 29223.0 29995.0 11tt 14280.0 30051.0 30135.0 14484.0 30075.0 19008.0 30172.0



PAGE 1

VANERECEIVEDSEEDft-fgSACKSJUSTSEEDEarliest-PhiladelphiaPEASPARALYSIS-wCOGAINESVILLEDEPOSITORYcroHnsrsoisrCOMFORTINGOOMPA200wa-ysPortableAbundanceTelephoneGAINESVILLESTATESGAINESVILLECUREDDECEMBERLSPySeedsMcLeansUNITEDAdvanceEugeniaLOVELACEDEMPSEY-MarriagePremiumNATIONALWORDSLINIMENTBALLARDANTISEPTICPHONEREPAIlEiG-eiluMvilleCUREAlaskaOutfitSUREEarlyCORNibiiJNoelsEvansExcelSNOWExtraRECOMMENDEDPENETRATESfactorilygrowingHMIOS-SCoj4ayllLKSA-NDexceptionalMillBANKRHEUMATISMOFrepresentationsTllir-tTKOIVfirstlucroatHM-itriuiKthCONTACT-ED1907INDIGESTION-ToFLABlissComplimentsBOXaccomplishedseventythreeSUNHouseholdMusinossaccomplishedImprovementlianiNoine-rblnallorChamberlainsImprovementhtivimthinliiKimprovementvhnmborhilnsSuccessfullySPECIALOFFICERS-MenCompli-mentsSUBSTITUTESTHREE176Immediately1907persuadedTHEforce-JUSTICEcontractingexaminationsub-sequentlyapreclatodMcCollumandHtrenutluiedparticularlyMEETING-TheivfriluiUUtscompletedlIIIIIhIIntentertainmentDischargedti-tIlustratrdMachinerydlpthcrii1IMPORTANTexperiencediphtheriacompletelywniiprfrlntliuiTHEdispositionartleles-vhlelidrucxttUMwudvrtafaltogetherexperiencesappinessExaminationBestLThursdayholidays-AsimmediateVermifugehlHllIwhlllHIDigestionDiphtheriamarriagesstraightenarrestedGALLSadmirablyHMOtranjpiivdrecommendwellknownpurchasedATIAMADelightfuleruptionshap-pinessdiphtheriaFloridaIwivjKod-MlORGANdepartureGainesvillesatisfactionThursdayMlcnnopywellknownInformal-oneMlcunopyparalysisManyOulnesvllledelegationCalnes-vlllotllltlhstcRememberoxprvwlonpossessedofficiatingimpatientBENJAMINsufferingbenjaminmodatingTUNERdangerousjnedUlne-NoJOINTSMUSCLESrequestedassembledcomplaintexplainedSIZESGainesvilleirregulardependedHenjamlndefendantCOLMANSaaalmi-lnttrdCLOTHESulloKftlitMIlonjnnilnsuscept-iblecotnfortli4presidentiirraniMnienlMrttollAAThursdaypackagesconditionGetdiscoveredRemedy-laWeaponsutitmF-latedliiialhulouEx1MrstnarraignCompanyde-velopedCO-STsufferingSem-inaryinereantlloannoyingcirculationSumpkSCarryingluvlHonitoSaunderselasticityDompseybuildingsarrestingHolidaysEXPRESSqual-itiesweddingDempseydaughterappre-ciateremainderstoopingPeneacoladlachurpappearedialnosvllloformerlycarryingCRUISESContractednumberhappiestMethodistThurHilaPLEASEDMcCollumchildrenspersonalforythConcealedIrritationdefendantphy-siciansdefendantChildrensillKOTliMlstronglycarryingotherbackacheadmissioniMijmnlihceremonyTuesdayformerlyunnaturalafterwardPopulartrncHii3re-quiringconcealedWcnknccsChargedlustn-11IllLiuimentconcealedLINIMENTenkiuxshun-dredsSouthernasso-ciatedrequiredmerchantbroughtLovolacuKiiaranteeIntervalsOvercomeinasmuchkidneyshundredsInsuranceexcellentOertlngMADEperformhtnmuchSCALDSdis-orderscnUvt-runcoKfnjipedgratefulexcellentceremonyfllldllUIIUierffcrothnjiterthoughtstrcruoushearingforsomemedicineentirelyJanuarymembersSeaboardweaknensquicklyregisterrfleerlyhangingsubduesKidneycurrlngmeetingrvcifddigest-iveDonahuenocesHarytlunwillrequestsreaders-AACTIVEComingMuscleshealthyadmittedremedyTomklesHUEbusinesseecre-tionsFavoriteoccurredgeneralenoughwelcomeTrousersdfttrjorThornlarcenyMloua-Inl5lnnKovpioneerELBShannontenderedCAUSESSocietybackailukidneylarcenyHrowtonchildrenafter-noonvitalitychangequalitystomachteachersouthutitKidneyrustodyArrestedTissuesHlimmrhOFFICEUrewtonSuwihrremovedalwaysYoungSocietyreleasedHtumnchdiabetesMaiuiKHupvMoncourinaryBEENpartiesDestiniesstomachO-ilaIHllarrestedKidneyemployStomachdiseaseJohnsonadvanceeveningfimtlUKManassoreturnedHintingMarshalhtnlimrliarrestedamiabledllilcultMathewAgentpeopleDuringfHIUKpresentFriendspresencerapidlyMIIburutreasurerMarshalKoleysFoloysFibrousfamiliesmeetingweapijinmifugeietuedholidaynIXESrteahtgJosepharrestedsimplyAlachuaIiTcdointwuqurtJosepht1otttry100enoughsocietyKidneyLumberluiiJlydorderedttnniachBURNScompllAmongmarriedhardlypassedFormerNa-tionanotherWhiteschargeKidneyhavingverykidneyfavoriteScofleldCOURTtroublecounty-IsfvolltiKcodHmimorouHcoupleScollnldtrustedituiinchargehavingbrother111MomnchSurmacpeoplechurchScofieldprriicSTIFFcountryPSMusclesprovedBaileysuffererchliliiitimisilitJaxvlllecaughtFloridaJax-vllloMathewScofieldWhitestuurluKpocketFridaykidney50cpeoplefacultyparentsleascuiiALWttScoloredScollcldSORESdealersSkiuiilnLOUIShardlyI-CoffoyBuffaloreleaseloosensItOStMSKplacedrlaiveollicerspassedahvaviarti-clesgivingocni-HionIludsonagentsagedeverycnCoughannouncepassedELECTServicekidneyowingFundtrouserstrousersserviceroiinolafriendsmothermislrlrplacesoillcersarrivedtroubleSTOLEbladderresidedparty-InfriendsSaWHATLAMEcolor-edFloridamation25cCnnlilresidedseveralUnitedMlnimGrowtherectedPeo-pleresidescoloredcountyFosterweaponiIHllIIservicetreatedanyoneJuliTHbridesoillcersfurtherBallardWillStoin-chjoinedhilnesCitizenWaltertleItI4IHrltalnTlhlAlonzoAwnttakingfriendshappyilckolowingLodgereallymoneyguiltySchoolJusticewritesdiMp-HtHObeingshow-edservicesecondbottlesBACKfchipnMlonaandoimliKtabletsUobtTlAgentiiinouutAlonzoinkcuShapebowelsDoanssecondservedreturndoctorDanielmatterJuiceshumorratherANDollUtiimatterPartyStateshid-denJamesPassed1iibltrcausedgivenwhereremovesDoausattackgoodsactionTeasguiltywrlghtoeiintnbeforeoiMctostatedsev-eralbeingMtTltnlshouldaboutbeingpiculsNollloAnnieDormsmakeswhichgivenftleavesCronmpistoltopsNixonCIIMUTmatterstrongbugdepotcar-riedwordsSOLDstreeticelentwherestatedHASamongwinreEARTHTIHcDhomeAmoneygheebeingEdithwhichwhichWhlloTheypersonofficerbeingfuturewriteskiiidsKingBloodgroomvhkltAboutwhichcouldmatterheardimmclhomebringwhichpridenocrutCreamlampsstreetaaniiwhichre-fund4mucousrollnhwouldwhichnicksttxlftisailgiventherenmmrrspentwhilehonorOtherburgCurednicksHicksHicksKingIONSyoungtimesguestyoungFromunionWhenUlcksquietworkotheryoungarrestnotchseamanbottlerostiltdaysyoungthosecuredgoodpattygreatslimeorderPorespinremitTHISfoundprovePricemakefouiiiotherdoesmoteswomanSnowyoungwhichyearshOStSformsKingmademilesgtstashuntknowAUdrFromONCEForcetakenbutthomodrlseYorktheyhomecourtewhilecuredpalsprovowhenmadetheirmadepittynoveltheyITrue18homebridemakeoftenwhenthreewhentbat1negroCiainenotedyoungarrestmakeonlytonicForthmanyyardwhenFirstthornbuildlittleyowlwormsyearswormsladyAfterthemhandwormseveryIhsmindWithyearsJhmtheysevereHUhNew-ttieschildthemchieftheirYorkchildwhenBOilguessthemtheirsincetheirtrainfromrakrtantesninnyTookTenntheirworkANDcentsBEJTuuenjiarreptafterMANtheETCworseafterthemCurtladymeattoutmanyMisskluXPUFORwentConnfromhUdsinceCityhavehighbothdrugeveryhaveIattrlurinfromtookhereneedcourtMlhackworkItmihavefUSEltilnwifethemtheirfactsPillscourtwalkCuregladtriedcolicthemroostuntilLoveboontakeclourtitrtiucourttrainfromtheywithrushnestswithupongrewYearwjiohourtitvriehereonlytimeNowhaveroutegermBrslGavemostuponlowsmaulsdoselocalThetimeEastHe-JBfrothhaveuponbeenneeddoesjustheldskinuponMustwishmildtuijtJhowused111110tooknilcitycitypairHoldklcKtheiracCoatheretimeNewIlllscoldwiththatfromMisssendpairThehirewhowishstorethatthatporeHe-IBcityForuponheldrutfoulHallcuresmostVesth-indfirstSoldwtthplot230NewtuneLineboththatnamewithfntookWhocitysaysTwowithMllekillsneverthatthatthatnllllfirstcure-RtacoTorndtithtellsfieldthatheldUSEDMHMWaslackfreesologalescoldsalecoldthatthatcitylieieeasesJayfourcityThowhothatWillheldthatthatsayswithtillllcurestiresthisthistytt-twollThehurtwhoHallThowhotartthisbestthisThoHowrlivthatthatTheTheThebaldnameandfreaandhowthatwereandeiutMWillINThetintthatTheTheOnoIntothatthathimassihowtartvhdOneItxttandthisHtllllaidlostRevnailyourTinthatIliMtsameitUiunitifosandThocoatMrsTheMyANl-IthesorestourhimandandMHthiscityintotoldthisSunweretarsfactHelltviitandandcityhimworeamitheandrVIIMrnworenitsmidandsurdantiandvestandandwillandandandandandandjailandhadbuthadandsurdwillandandwillandandandwillandwillRtulhatshadnullstyhadandForevenfiveantiandfunantialsolullScoyourwritwereALLIllthninetheJooandandandandlowwillandhindhadnCthissurdandandthehlllloncebadtheHerrsalvethoandandoldAlahUHitsantiandaunteurohasandthethothehadyoullIrfastliveBYanytheSotheFintheinsnearthetrioherwaybutuvrtthethethethetheherHisthetheloftcoathIllthethothethethotailhutincluebutthethepaynrothethothethethetinthehindMythewasHMirrarethemanwasthotheMllMRthetitsthethethethethethetelltlethonowthetheVJbutlifeItohthethetilttututhetheAllthethethothethothethethethenotthethethethethethe1nownowIristheagothetiltthebythethethethe419thethetitthehurthismantitanallthetitthethewaswascomtllPthodidthemanHehisewasUctilltherustmUllcureColcanyouthefordidthewasforKynottitdidthetheforuraihiswasWtllIhistheliteANnotconwaswaswasWINtnoforbynutwaswasthotheMytliiwasWUtihishishistliowastlienotorenowhishhMrwaswilytanswaswaywasliltwastryledforbybyMrleilonearmtitscanei1notttnrcrotettutHoInshisfurforbyfulbymytonwasforNooutsHoMrrryforistheforoneMrcanthesurfrunforNobyforTotllIlforforbybyalllOllallCodonotrmtaoItsMiaTooftorforArcanofcanbyliltnildhdoCubyourJieWnotoatArusefirfathitallkdoheKIbenilfilldohIEuoHK-ITarettnupheheONIrahemoItsExlothohemehehouphohebeheratKdFaIomeofbeWWhoofbehebemopihoAtittHthllauiatboUofAofof50liebjribgutbeAtofofatofatthoftciofofofufnftoofnutoofofofofofofNofofd-XofatatII1hrofofofofofofofofofofofofofofatintotooftocfofofofofJofofoftoofofofofofofofnoasTInIntoisInththtooftoofofofofsswianinoninHIninInInasinofStofattoofnoonnooforofasorOKInInInInInIiiInOIntoInvnasonontotortintoontototooutooftnofattoontoofonononIIIhIIninMittototoocanansoonIIorInInInonsittototuasenAIsIIJasItattoratofsorIsillJjIsis41MLIsTItitIsqmiS1CMItIsinTenItitIDiIllsoIIMArlM11it1CIrEMMPAItfJitIfCIsSAUIIPAaPsoIi1lUetiUALioAMa8AUItCHFaiV1ACIIJrEI1iItfSl4tIbeRItSItlaaIkIayJJnIaaaaiItIasaaaaaaaajaaJa>aafvInnaUaaaIaanaaaaaaIna>aaaIaaaalL5Iaati1ItaituI>aII0y1w-taAfuI>tttftiI1JcHzj>jjtI1iItOftMViItaIaI4I4SftJr3csk1ItIrI1i+IWrtiii4Ii+ttI>>ltI<II