<%BANNER%>

UFPKY NEH LSTA SLAF



The Florida sentinel
ALL ISSUES CITATION SEARCH THUMBNAILS MAP IT! PAGE IMAGE ZOOMABLE
Full Citation
STANDARD VIEW MARC VIEW
Permanent Link: http://ufdc.ufl.edu/UF00079923/00137
 Material Information
Title: The Florida sentinel
Uniform Title: Florida sentinel (Tallahassee, Fla.)
Alternate Title: Sentinel
Physical Description: v. : ill. (chiefly advertisements) ; 59 cm.
Language: English
Publisher: Knowles, Clisby & Smith
Place of Publication: Tallahassee Fla.
Creation Date: June 6, 1854
Publication Date: -1866
Frequency: triweekly[ -1866]
weekly[ former <1841-1863>]
three times a week
regular
 Subjects
Subjects / Keywords: Newspapers -- Tallahassee (Fla.)   ( lcsh )
Newspapers -- Leon County (Fla.)   ( lcsh )
Genre: newspaper   ( marcgt )
newspaper   ( sobekcm )
Spatial Coverage: United States -- Florida -- Leon -- Tallahassee
Coordinates: 30.451667 x -84.268533 ( Place of Publication )
 Notes
Dates or Sequential Designation: -v. 1, no. 88 (May 19, 1866).
Numbering Peculiarities: Suspended 1863-1865.
Numbering Peculiarities: Numbering begins anew in 1865.
Numbering Peculiarities: Issues for May 21, 1841-Mar. 9, 1858 called also: whole no. 78-947.
General Note: "Whig" <1842>.
General Note: "In God is our trust" <1856>.
General Note: Editor: J. Clisby, <1843>.
General Note: Publishers: Knowles, Clisby & Smith, 1841; J. Knowles, 1841-1843; J. Clisby, 1843-<1848>; Benjamin F. Allen, <1856-1858>; Edwin A. Hart, <1860-1863>; Hart & Shober, <1866>; W.A. Shober, 1866; Shober & Oliver, 1866.
General Note: Description based on: Vol. 2, no. 26 (May 21, 1841).
Funding: Funded by NEH in support of the National Digital Newspaper Project (NDNP), NEH Award Number: PJ-50006-05
 Record Information
Source Institution: University of Florida
Holding Location: University of Florida
Rights Management: All rights reserved. Board of Trustees of the University of Florida
Resource Identifier: aleph - 002061077
oclc - 08807470
notis - AKP9173
lccn - sn 82014066
System ID: UF00079923:00137
 Related Items
Preceded by: Quincy sentinel
Succeeded by: Florida tri-weekly sentinel

Full Text
!: ::1 ,t :





r t rt\Jlt X \\a))fliiflC1'' .





.

BY BENJAMIN F, ALLEN '

1 ; '' .. TALLAHASSEE. JUNK; I 0 1 Kil. MRICHtD
:- : -: \'OIX1m \V\ NO.) M.-WHULI; : i\0.731.

PROEESSIOIA1; tiAJHJ ;'. NEBRASKA AND KANSAS From rte; --- .- -. -. - -_ --.

_- ___- -=. ventfut !history short. they but crowded had learned pages of their e. *Itemity.. ruled limo hour. The South ,11.1'1'' '1.'rt. their tight! Isthie the compicl wetire extended beyoml. 1 die ImuU of existing Mat.,.
CHABLM: w. uowninvBIECHETT 8PFEOH i OF temperamteeand inu thing ; the North: and there :
T aiBCHSTT I now so When rrmtonri; .
to tinder the
.. .. wisdom Mutual( concession fir the i IOD'lhi,1 earnestly nhor..1 IlIi"llIin, an rome mi per }
&: DOWNING, HON. A. E;. MAXWELL eral good became the law of their action gui 1 r."I..llh. compromise A to slat re, indignantly warned Iio tl"IIII't Is tins vision I i of the, common Uovrrnment, Congress ,
beat
OF that each desired. could be Ilt..fifh n a aa toplid the compact& In which south has rrcrive.I cnn do as it pleasf,-make what. laws its discretion
AHORSE AT LAU L AGENTS FOR CLAIMS.\ FI.OBtlA, hot attainotl and) ( any one suppose. alter rcviow ing the her share of the and has now thinks liest-ailnut or exclude slavery
It they ron.ill'r.lion. ,
saw no but ,
TUB loi[ .E or HRPRKKC'XTATtllC: : : : .J nafety In the endurance of history of that, l struggle, can the, only to let the :' suits its
receive here a< high Can thin true
WASHINGTON CITY. iln 1.III.m.1 judgment ,
supposed which
et dwindled
.
Jay Irt, is;, |I. J ( with the to naught compared from >IAs.RIu..ls, upHWp| that II. \\h.it\tasilt I 'the "|, ofprrnri Mr. (hairman I If so, the argument. I
-- evil of I"I.fllHn WOI'
greater future
of The' IIooso being in Committee of the the a to aeeomplnh I would l been willing lo go further .t Kwi, IK ; | it right run 'thus: "Hiutlurn Mates hate the p '
the and
attention pnwccution high fmui"
Will give prompt to I noble end to whieh and bet rlh.uII..r
Whole ou the Mate. of the I'nion- their cflorts ,1.t tOld rl/l in I limn common It'rri already I not bo Ilk.n' the Constituthn, to own and r
Claims for Bonnlf land, Extra fay, Back pay, Mr M.\\\\ 1..1.1. aMJ, : Mr. Cbnirman-4., I cat grievances n ere dirl'cle.t11 partial and Mo. or', anv, shoulll aC'uin111! the future 1&the I II away from her wilhouMiolatm every |pledge grow a property. The' opinion' of northern ne

PENSIONS &.C. rising first after the. extraordinai 4rproceed.: grievance ; and were there merged forth the the common. I lad/ ,' : given no a vast ".rioyln upon which she const riled I"> Im-omu a part states, ihnt to exercise this right U wrong F

logs of our late iitlings, and jollovMng, as I II I vigorous, and came pureoalutary Ihe norlh\\"e". Lit nl tvulhdlamling ? ( 1.I of the otifederaoy. She might, keep what cannot alfect, it, l lueeause they,. have'agree'th Id
Uefor Congress and the Several IVpartmenti. do in >pntilotie spirit ate,') d"lro of her liberal purposes tho now found, hers but units leave '
next succession to the gentleman from I[ being and substance \1' not she would I now it to be a local and domestic question.
la8SlIcholett8l, [(1lr .lTimi" ,] vho aonllj ,gave That to the union tin vformed. I hrrselfpngftjeel in a conlroerM. alxMit the assign and part/ will what \n,11 I be her at Th.I .so Mates &together can acquire{ and bold s
spirit pervades siuliiHpi .
; the halaneeof
------ I / power, in Iti. ". cbarfreithat future !
--- anti eloquently! addreMed the committee on Constitution \hrh some day' OOllt.tfulu the j".licl of now Territories, wrl in lime aieto become
under
All ttiintii tutrmled t* their tan, wilt tit speedily UrdneiJajr. InsLl. find tho cmb.irrnvmient II I teaches! what, which we Assemble and bv erniittiiin| her to enter into such I compact' Nut nlotll a olll..tfufl"olljh.i Mates also I'acl t boar her, share of the

*.*dfalhfully ttlindtd ,.. which would/Miurall attend an effort to act, we .houlJ do in our day : I the bans of rr| rest'ntation she would ol.tain then to hear even southern genilmmi raiding Ilr"n81, and, if necessary., furnish her, quota

_____ __ n" ,_ engage attention
REFERENCES ] disci-i"n. much In. poet and! condemn and revere alike the privileges of all men of he( contest, and .11 I lino: said,IrA\1 its s.icivliiesa. Sir, thin, iSonth received rl'\llro nnth. tin ; and every. olwcies| if proHy| slavesincluiled

lt .. t: M....., It .el) T t. Tessa n.v t.Ea..A n. rrensod'? P thaDS it were better and tnl'lrepro.l..ut not where we hano right tojudge thing \ A J i..I''d' by both in I due Ilop| 111. save the consent. of tho' North t to almn can be taxed, to enable tlO dovernmeut .
8 R MALLOSV, 1 tin thfltjhne of ao I title; experience[ in" tti," it 1..1. that if 11. future on her aggression "I'.n 'Missouri and & to d'f'n.IIIHIIn'htn.| iht'm. 'Ilie clt ,
Kfceara : upon
S S i ( BxALtwoon' ooutrovortiei of the day gtttf to our America mat complicated<< rtimil I ", .L....1..t ..s..0 ..1 .. ...11 .h..t..w.L ..c.o.I .. ;.one of ll. *. h. ,-on.l rlirliU I tWoand
I
& Co., N. Y grave as nivot'lf, but admirable. 'tt.ips I.
A. E MtxwiLt// DKaroi of
thould system "OI''rnllll'lIt Ity which hold: h"II.1 I( '" time manic high mothers. as has, been abiimldntly,. show by other ran there their lion,es, earning u
Itrpriientalirit .I iMeetn. Jlnonn' & PIT say Nothing upon the exciting! qnegtion, the powers common to all wore madtt to live i and .al" foilH l 'ar nce, taught ly an' et ,I never have been nliMrved gen but with them their properly. Hut inasmuch .
,
11:. C. CutLL F/. "n, New) } rttidn \\liiclilimleen connected with limit bill to I L. II'll'n.ull,1 A
J O & J. A Cn", f'goternnients' for Nebraska:- nioni/e with those reserved to each. Time ample so instructive and |wlrioticlti patriotism of the *< Lwwhom thn holding of slave i is conll\'nlllt by noithrrn
organize
O YALI San. 8I1nd..." OhoFritneitct and I chl'lf conflicting Miss which had to bo .reconciltd io ..\i.I.n timv mind' from t'lo. history we htvealways limn I ready I'rln .\' sentlnunt a* a eilRmoagiinst ,
I Ivanaaa. tho will :
C-J' j M KoLaaonK & NIL. jli rlnpg ofmyMatocnnbe :: were, consolidation on iho one hand,I of that I limp, whatever' may. have: been the; In throw thtmselvtsin the trtach. humanity, the\vrulJ. ".. ahull rot t.
I I .ox, Nee 1'o. as forcibly expioacd 1 by my' innjlo totes I|I and i the. sovereignty of the Halts on the <,tb. filling or the fact A Jour ir' two bl.ftt (I Mr ('hllrlan.' such was ihe ( permit il in those. 't'.i.ni.s.I alih' ,ingh southern .
a.hlnpton, D. C., faroh 28, 1854. D byjfij word 1 may utter in her Lt'half.j er, a general with 'o'Jlac.o '
jurisdiction when the
independent mien ortlmanre of 17S7 w na a lop what I I. called a Compact AII I suulinleutiadiltorrntamid I finds corrobora.
--
S :-W.:-- BAKER erhaps' the sense continued of injury and which I f..eIorlIlujnrl''egltn. local inns.lielions. And .ir. these were re.cnnri :! 11.1)) thai lie greatly mismtJerstmnde the |poai i ,id'rllli"la "hiIl:|>a*.tdhttueeu the I'lrlin.COl. tutu Li the protvctiuu girds by the conqart

persisted ill, ed. Looking/ the formation of a con (ion of the outli wimp bilnttssho would If I run not in the. 1 i"I\I'rel"lIh..I.11 frl which alone u derived any '"Ihorillio I '(. ;

.A m m ST .A ;LW9GMONTICELLO.3 from unmistakablo hostility to southern aillvepolillIlId istont Union as the. paramount consideration) hate bun willing l I.> ronoclu more than ".f fiumlciliu' an usurpation til" autll'rit.v. sup" *'n I Ne llu ir cnmuntondoutahL' Ilio ahsur

which filling is intensified by as above all other ambition as sinking to |plainly appears\ tipou limo. f,ice of the compirt and i is ol'I"IM'd lo t"l c<>n>|.romUes and the dity of such an argumt nt I.i parent| though l ,I
refection-from' the bosom of my cOlslilul'nry.my veriet-t insignificance all minor tlilltrinets. And it would) I have Lt'11 strange indeed ifthe fuml.iMHiilal, |,rmrih| .* upon| wbiih. the lliir. it ,tilts 1 It' ilimatl'l,) from the positions thai '
prompt me to say things, though: far ihe [,atnota of those times had. I tho innnhood :North, fighting. so amenity and gomnxly: tern Stntes basil their Union. 'Ilien the re will bo grall".1 f ,

JEFFERSON COUNTY, FLORIDA. from my dente or intl'nlion. which will! provoke to lay their partialities and prcjudieca, and all against an Al'lr..hplI'd| | |preponderating inlln .Inchon i contains was inimptrly|, |,licud The I that subject, arises from eon. ;I r r I

March (I., lliU -IT. f rather than conciliate our niitngom 'IMicse suggestions, I confess, have tendtdstrongly altar, and the fortune llunce to catch tent to 1"8'1 uureoordtd here tho of the lo that ol'llon.-
oV. any victory h"forl us to rtmove "nfore j'
MARTIN 1' ten! R. n. M r>AVin Li
/ to keep me from pnrliripnllng in 'the sacred Incentc which, as it was infnmd since and/ now alleged to hove 1"11 won in it, "U but an etltrt: bring the (inverimiintlurk If (mat authority. were clear and undoubted,
DOBY & DAVIDSON this debate Hut, sir, at the hnzad of I>I'lik. I'through their bosoms, mingling with ai|l'ira. the. rnnrtsKion of the power claimed, fur toil* true apl'err' audio li. authority (the. n the ((I&'at( would simi'ly ho one between t

ATTORNEYS AT LAW ing untdviatdly: I cannot remtin nltogethersili I(lions ""r liberty, refreshed. and rt'hn'lgoratl'll Con"rl' Sir, she hind I no Iholll.II'11' sin.h over tlomestle alluirs where It ", .longs, the poking] olnlons.|. A* II js now' ', tho

QUr\CY[ FLORIDA. '"' I.:very impulse of ing native every them for their great work. Then was the It victory WM won ? 1tm' ,. I Ihll Hut 1 11".1 not atop hero Nile these South. thinks situ but moral perceptions not .

practice In the Mi;j.1 I II. Circuit of Finn;,'li, ,atFection of my heart' every sentiment' of/.day \lctorylor' republicanism then, mho. mutual trust smut belieflhit they, hail airangedt ricas are of ihtmstlve to jimlily ,inferior to those of her ""'Lht.t 1 brethren. j

I WILL.1..1 I the r... tpro their of Writ r'I iri hvi .1.-.4. ,
All buainei entruitoU lo earo will recelye .1 nijilji.nnl| her lofty sniiit of that day Not extinct, I trust' 1 but hope !lingering, in her, I broom ofsiirit ilorjnjlii! ti\l. they are sun. oiled bv others whbhclso theirs. of close and I profound! resn. upon' .\ J
link wlucli \\1 i ,
prompt ailrntim" A.. I'idt[peiuloneo, and every biiitla me I sadly | Him. 4 T.nji MUM.* B-... mew.- ... .' '_. .. 'M I -. "h1 "
I December. 27, 1833WALKER: to the Constitution and the, Union of my I upon it. and it has tomrlimes lurlll'J.o fit oilier hope whirl, looked to tho gradual;; 1 upon lonie lionoral nn'mbt.rs, and to rtuptct& for her'colcliolal'l'; they. do; l>uf, .
-- -- -- ---- country' appeals{ to me to give what active full} IIi to thnke' the hopes/ of (hit mom san eliucllol o"II"ty-al exlintli'n n not lobe whith I III.k a few menu'ale attention. beaidt, shu leel. 11111I 1, and .,'

&, CALL, aid I can, fit "Uo though it 1)0, ill rescuingour I' gume, and rouse from their listless Indilftr elFiOted by any ft, or of the C'OU'IUIov'tnm"I.hulby If we except, a few whose erratic and iinprailicallo unlol Imj the. "Kr.tnllt they, hate mutually f'

ATTORNEYS> AT LAW\ Government from jinths, of error and I core the most suj'me. But sir, I am turn ( l tho unlrainmellud |,re.ftrrnco notions I leave 11"1 wilhont t"l entirtd illio. M"I, whntcvtr your n| imons or l

TALI.UIASSEE FIOKIDYDWID danger; doing; off from the |Id"1" / I wUhid to pre and act of each Stale where ilex. circle: of safe adtisors. all ,," 'n here, if line on stub <|,utstions, tins agririnent confers f I I'
s. WALKER and MILK. C\LIhave lit fore liking up the main question lion. suit i.I..1. I am not mixlKkin, are agreed that the Mite no anthoniy on cither to enforce them, ,

f) thenuefvea in the practice of their ever, the astounding character of our recent 1'hose thirteen Stttes, Incited by the, overruling I i, Ih"n.! that the frnm rs of the, luvo/ f right' to usu their own dinrretion, about 1 but 1. on the contrary, rl.'tVe that authotity L J

Profession, and will give their j joint ottentiun to proceedings would seem to require some desire I ha\o indicated moved by pur' Constitutiiui, Bering the jealousies end, ambi. slavery, and tint time people), of tint" Territories, to 1,1 fXi'rclmd In the country Mil by tho I .
buuneet entrusted to them in the Court. of the rema.k. It is due to the Glendmof this bill pones so generous and noble). lengntd them lions views whieh | rtvailel, 'telling iho noctssity win.. ('mining a constitution ,preparatory to 1'1'011.' | to bo directly. illicitd. ,

M.djl* Circait and in ,the in Court the Wei-tern holiKn CrxuitofHorda ,Mar tn- and to the country that it should be known stives tog,'thcr upon tho terms prescribed in to remove all fear of these, and al the a"nllMil1(, into the Inlon I! hato the same I i.111 that shivery I U wrong, and should t ;

na and. Apalachicola: }'eb. 2'1, t.BARI they are not responsil, \ for that waste of the Constitution. means by whldi they could! olwrnle, ," *,te light I His, comes of iho rsatncoof ttlf then.fore bu arrtnttd by Congressmen Ily goes

-- public tune and that/ obstruction of publicim :Not to mention other particulars I ask attcniion ing that no I Union could I Im formed "r "". government, all linils nf n,> rational ills further than is Irttendtd, or bus no forte al
I It & Mciv I r. K, iitesf, i-o apparent upon our Journnl to limo flit,, that these terms gi\e "wcu tallied wllicL did I not tl'cogll/l the piinrij I pitu The corner.Mono of our Au'erirnnfmurvr all ll Implies. tho rt' |Mintibiily[ of the d'entral : '

ATTORNEYS AT LAW ninth is already bringing to us the indignation rity. and protection tosonthtrii men with their of "11.alil!, widely w ithhi! Id from COlljrt'Me mast& bo withdrawn Ufore any ililler ) OO\rllcllt for dumeslio et lie, and the

TALLAHASSEE AND QL1.NCY, FLOUIIU : of an incensed ptflte l | llieirs was property in slave, as well as to northern men the to inttrfure with lint "' cut |'rinrij"lo can bo limited or mniiilainedIlie power t to dui| with them lo draw a die t

TILL practice In the Middle I and V, .trrn Cir a }|plain _iuty! feeling that a discussion w ith w hatever property tiny m",do hold. Under llnl,t they not done so Ihtir labor would hove |1"01,10| (mare/ not yielded I their right "f tmction bttween'l'rrriloriea and'States, does .
VV cuitaof Florida I and in the Counties of Dec alur nliitli. had gone on fur more than three that Constitution they started afresh"upon ended in failure, mid the glory. of their achiiv Muvlt.iIIIIy.11 t will not Iti I. their |prldt, not avoid this,| so far A the, adtocatt for pro lit ,

and Th,m Qa months was sufficient for a full exposition of (th* career which was to d"t..rmillo thotks',in> mint m burning lha fetter of flrt'111 drpiun| I I"'IMI. and,I their tlory Hut |if t that diluting alavtry lure are rOlc"rlt'd. because t
lJOLt.l1nKEIt.! A. N. MciVER, the whole siilj<'ct, and finding tint the ordersof of our race in the :New \\01'.1.) I I 1'1.:' Matt dunce would I have been swall" In the. i iLjhl, Involving alt d"es thu right to lice I hey or many of then,, .rurnektly as any, 1
TaUatimnre/ Qainry the Homo would soon nntu .t.i .. ... KH* iu guvrru luliicin.l. .iTair in its own shame of their incnptcity,. to govern' them und''r I regulutitns and laws of their own avow their a.II'rencI to Ihe tloctune that (thoMOlu ;..

January 10, 1854- ', _--= of the bill, if the discussion were continued, way, establish such relations!: of society as it Ik e* choler, be eh.nit.d by the. arliun If S'"ngrva.r | |, i,f Tef il.it shave. the right to rtgul h i.
---- .
u- = -: they ,proposed that" it ahoul} I be clost at an linve these with the freeim .ite tin ir duniestio relations by. tin'ir own .
R. JOHN P. DUVAL might 111111 moot conducive to the wilfiro" of l.tt us stow great men they are no hunger they ltioulillliemstltes (, !
DTALLAHASSEE eaiii Ia stitla i is nut trup lliat lite effort( was its people[, and a.le'il| arid I enfirce' ruhs. for their wm k ilthed, though not without the t 'liiey are ought, under snlijectun <1 rt.tl"n. It I III true, they. nlfir an interfe.rence ,\I
,
FLORIDA one to debate From the first they the. control of [persons and property suited to .n.1 I gratitude l whieh. should I over l > a |1"ller fiinign 10 them, and must! with that right but they' always tak
Office at the Court-Houic avowed a willingness t.) hive: the dvbntt' lit own condition and llimcelint: ma far **, \'eD'ulol our imiilnnof them, anti) go forward' look to another will than Ihiirottn' goo.I care to find some pretext| in the \I."t> r }f-

t Feb a, mt_. ______ gone to any reasonablu time, if it could J they .laid territory In common, not embraced thirty years in the Llalory I i t Otttio pnopto '"I Sow, ,1 hot, i I. ll. Mi.auuri r..'.i.Hoo' ItU which mho mind' will! Luc plie 1 absorbed as tSS:!
without interfeinij, with pretionsorders wiihiii the boundaries of any Mate, they, f mD!.LL!I, _. II1 .-.LfII'u- lf o and without leaving the bill undis Lore the. impufeition! of any terms defining theCovenrnenf \\ bat a see no do we ....'! I Hire( Slates' elavery.hall. /, I'o/omrr prohibited| which they. but too .nc"o..lil.Ii.l". from thilreonstilntiits m : '.

WM.-* ROBERTSON- & J. W FPFES posed of Hut how were they met? Hy a ,. : Nuichshould! prevail or nguU;: again the antttgonism .two" n thusirtl. north of ::11''" :10'' huppoio the rentrii lion the Inronsiktincy they practice
DUS located In TalluhaMee end anociotvdtbemwlvc ptremf,.tory rejection of the offer from some ting the relations of l persons and their lights\ because of slavery, I I. arousvd, anal I they err had I been that spiiiluous li'l"na'] kliou'd' !I." Vhk them if they admit' the right of the po,|,lanfthe .'

together In the practice of Medicinecfllr' of the opponent of the L.II.1. often as it of property therein!. and only (provided for arrayed sgainut each other in hot and I angry) forever rol.iil..1orll of :.ill* :'ID') wilLni I 'lerritorus to gottiru thonat'Ive., and ;
their Profr.ional! Service to the public was repeated it received the. same haughty the managtmt.nt! of that territory like other' strife On one snlo the lesson ofthopnst every ole lit Iha tI.l. would I haw been they will answer you yes ; btcnuae looking t I
tW'OhIee over the, Store. or Memn Baton & courtesy; until even one of those who was {propeity t of the I'lutedtites' 1111.1 I that ,it I are nnhetded, 'Iho memory. of the ptril an inriingemeiit of right of the ( lo the homo tribunal they dare not contro J'

"IJI i m. Rveidt'no Church* of Dr.W n..rl..n M[. r'. POntRTSON: *'the niir*
v Jan the tpUonpal 17.. ':li.( u8m J. W. EPPES. that a course so unreasonable would render taking an equal |place, with the other membersof \been snatchi from the gra.p property| in slaves, are 1,1 to lie determined right Hut ask U"I" if th,1 coma peola| 9
the objector liable to the charge of be ing a the Confederacy, it would' I stand forth pan and through which aUo the COIlilutiul! ] : ali regulated' by the same authority. the. auihority shall bo |M.rmilted to do a they. ],lease about ; J

DENTISTRY.B "factiimtt ," and other of then deemed it oflied with full powers of sovereignty like been thrown ovrr them .1. mantle lo hi le, of the 1 people governing/ lht'pusclvescod shiviry/ ,., they will answer you no. Hut time I ,: r

R. LEU IS'give* notice lo his fr Office tnils inJ lo pit-hi duo to tbemselxc to duel;uni any factious mo. themselves, and could' d.> and undo make and ay, to sinoiliir,jeiilouxUs and ambitious pre (ongrcsa Irc"II' a presumptuous Intur answer will be given mud I ouch burning ap- Il

rfiidenee ron in thit the h*build ha* removed, known bit a* the uWvauHOIK live* or purpose| unnnk", au it independent will might suggesL trnmons had fa.led away. Power not granted meddler when I atttniplslo,, Lo curb Iha author ptaUIn Il.I.1 of I"r.ecutt f"low..iIAe. I i I' ito I,

adjoining the l dwelling of Ur Taylor, kit, as to tho fact whether there ws fac Up to that time, however, it was to Lethe Wa claimed for t'undress, mod I the tie 1 ily. Dillt maka time al..lpt II or.llin. such glowing .1'1 LtOl1 every. lal" rlll& I
where 'he* may beToundat alt timea prepared, teserv lion or not in l the course adopted to defeat common domain of all and I submit inniid vehemently urgtd that a Mala shoulleome I log t.l. l.or tull'rohjli.j"l.r| .U..rrv t li"'I' end smash rouMiig dentine Mltu j
(thoi who may need 1 bi 1. .irrtice Hi the will of tho majority, I am willing to leave that nowhere is any power' given to enable into the Union shorn. of a sacred right anlliud can e.ell coneliauin' the s slavery that the c.lt..lielill I will 1 I
term will b* Ciih or when called for the country to det.niini4 upon[' the fl'cord.- Congress to thwart the hope and purpo of which belonged to every other-ihp right. lo ihat it did I am, unablo lu semi. To I say that. be I I..in" Ilia fvrmi'nt thereby' scittd, andone ,1 fl 1

Any. B referenceaeanbe. Gold Plat cot gives to 'if tirna' neereuryN for D'Dd Hut whateier\ its dl'ci.ion on this point, I 111m our fathers to form a fraternal and perpetual I regulate for herself her domestio .fr"if and it wu legi>l itinr, for lerrilorii not yet ripe furlunutn enough to (,restive the calmness .
sort by mail at H.C3ct.p dot. very sure It would here little\ dilhculty in union by'dcnylng to the ciluens! of one class matitutions. for HUtes, duce not avoid the o""cl..ioll.I Ite' 11 Ids rt'anon, would bu smo t induced !

Noemberll.1853. ., coming to the conclusion that gentlemen who of States, the puvtleges In that domain I per \ill any. man of thi* day assert that when cause there no such Hut lo '\11"| '' thai they thcmsilves did lot per. I
---c-.4 were unable' to decide how to vote on a milled to those of another, class. Does not the (Moplo of a territory. are forming a con even if there had 'been, it would .ti remain I '
TlJNNO. PINCKNEY &. COFACTORS motion to adjourn or to have a call of the know that a proposition to dulu litution, the Congress of the United Matei uljl1.lilld. 1"'UII) ( <>ngressiai authority !. lad. me not be "Iunll'relod. I speak of
one
AND COMMISSION MERCHANTSFor House and therefore asked to be excused, gate every such a pc war woul>1|have been rejectedat ran interjiose and dictate the provision they Jak law in derogation of the j'nvilX this, ,'I.i,for the pi'nplo of the IVrntorit s Iu I

Florida and Sonlbcrn Georgia FroJart, would Kansas bill* though ducuision khould lout have created still necessity. ( fur this, and' the. sovereignty of the peopleof the common Terrilori. who sdisil, It In word, but w"uI p act lea My
a more urgent
COMMERCIAL WHARVES, till their constituent summoned them home. those Invocations for the assistance of Ilea the new.horn Mate woul I be. I,uta mockery,. I 'i be wen, then that unltn-s gentlemen dinyll. My. own view I. |'oMliou uf 1
Charleston South Carolina, The friend of the I lull take this consola the deliberations of -her equality' with other Mates but un empty prepared repudiate" time djclrme/ of those ( .nll") recngnlxtalhcir. |n,wtrs to, "utho I I

CITMeatra. Waovti and D C. M IL OTallahaaiee .lion from the extraordinary course pursuedby the en. convention and its blessings, upon| in a 'r'lfIbour by numeetthetowera limo rights, fiI and M.If governing |,owrr lu the, |1'1.1"| 1 % and the here 11011I"110 rights l I and iLJiU, of pager| '
8. D. Taoist*, Madison, MCNIOSNT.t it* opponent They find in it a tacit proposed / complete, undoubtedly by ti. Con. ductrme that the 'lal..r indi (K-iiJeut in I ly. whiib gone there, as lights' ni.II"1
UanoRn, Newport will. act II Produce oar Aeaur deuigncdform and) admission that all the history, the logic and the illustrious I IranklmlW debates cf that convention dilution. and sutured a..core strgnglc and I the management of their doimslie affairs, by. the sanction and protection of the ; ,
) malt advance on by sir, the
are prepared. te the eloquence winch have bern bulled against show that there was warm struggle between llirm to which I 1l.ve, alluded, a* threat they. are obliged to admit that the Musouri tutiun of the I I"il.d: I.t. not to abrogate 4

October I J, 1833. ly it from -en.telbamLer::: : and from this the then commonly railed, citing to defeat the formation of our I'mon' r.lrlclill wa wrongly. lmpost l If dl\.1 ll.el. 11..1.1 dlrl. cannot be done
._ uottmern or as
.. -- -- -- Hall and all the |protean and righteous indig. eastern Mates and tile southern, as to the inlluence \hit became of l"fl right. In the mind of j to this conclusion, what I I. their duly. 'lo until they set ti" sovereign capacity which

"WALTERS & WALKER nation of thousand of clergymen! leave the .slavery should exercise in the Gov th >se who were for retuning' admission to ket'p it there I '1'011,1,1,I i standing I a monurneal call into bting a new bute. (1.lo\t\ with I

peo|,lo'j,et unenm inced that the measure i I. a ernmen', I with the gentleman. from MitfSouri until she came without 1'.Vrl. thereby of the error and Injustice of a prior all the powers b longing to the 01"*._ l
FACTORS AND COMMISSION of More must be said agree the I 'lliut would be the Hut 1 cannot pau'e to this and
COTTON monster Iniquity : Massachusetts, [Mr Urn**,] who last iJ denying to her i people prmlige to Congress not to act argue pinl.
MERCHANTS.AISO more done. 'I'he people must be |plied with i dressed time committee, that struggle did ex ju.Ige fur lhenuwlves what should I be her II.t.ralolil |Itt of .tale.m.n. nor lo exhibit the liberal have only sal.I hut( much to .ila'
other indueemrut to wake from their and contemned and Christian whU.lt ailmmed mispprehtension.'
still bu to lifter with him f iJisrrgsrdid spirit i I. not to t
i i Ut but I must
lethargy May I not express the twl..iCthat permitted it anti I I have contrdlwd the action ofCongri confess a fault or retrace course of error My. r"k. momtnt ago show, that by
Agent* for the Pioneer Line; of PacLeU, between such labor I is iu vain and that what remains las as to to the the ground upon which be drew'existed from itI I 'J coul, .. would have rol into the I arn sure if they would fluw.out lo their duo Hi. IILLod certain geullrmen )j'u.tify Iu<

CIUILESTOX AND MEWrotT. to be said or done will be no more successful I do not condulona reading of the Lint" of Union
]SOlCI1I5o' Wharf than that already said and done. that tune,fn.I. the my struggle was settled ry by. a ridden her sovereignty unaseulaUxT.If and expres, they. could not hesitate in their cause it Is wronl. (hey can justify interferencewith )
tSTOV, S. C. The )bill in its relation to the question of of the object of the in its it In .. They will notekno\l.
the Northwealern Territory I AM position of parties, now support[ bl .a.
U. \\ALfaa compromise ,
(iio give
E. WIUMOT 'natris, t "d.ll.n this but it ls nevertheless
.. seek to declare the Missouii r* tric time ol I II"r( edge tb.
.
U. T. WAUISSAugult slavery, to the .. States, and the slave ret lam, every, shade ofopioion in the ing upon question( .. & &0.
lion of 1b2O inoierative and %oid Wha'i. rp'lltin nnfortune Is their and one see no terrors the Union ;
,
pnju. they
16, 1853. IfIMPORTERS | stint choice to the southern 'Ilu are none but extreme Abli. p.jtJict tL .
8.
there in this to rouse the strong and indignant former was regarded and treated .alreaay. tiouist who will deny to the |ievpl/ dice of those they .i ,permit In the behold yawning before Uuwi
-V. & f-E.-ADGER-: protect gentUiiuen on ibis fleer Tbe I concluded and fixedand the strvgg'e.' reUtvd i'tateuor of the lemloriu when them to examine and treat this question a dark and horrid abyss iuto which all nest I

proposition is a sunqle one. It has no star that retrained to Ute right to adopt what fortitl they would any other involving Uie right of go when Ilie first step (ur".r is taktn.. In
to questions yet O'
OFill.1aJrW ttus or extravagact fvaturea. It does no aim made !L It'tl.- Slaw. in reference tola, rt'lul. all recetgiJxwi, sanctioned, and guaran Ibe one, they confide I, imive spirit I

: &:ftgjJ 'll ::1 lli: Y!pGUNS tojnterfero with any roan' right or privileges.Iffujikrs vention What was al thai the time eoiupromiw f I think I can il &point eon to other they (Plcase duui..tie* rvlotious. llii I.lh.duo.trine I INH proiwrty! I by. the Couttitudou.: Yet I will not cease of the Hwuib for .equi ecrnce ; in the other, J.

I no diitnwtwo by which one t tit ten different one from that which messpnitt.J of nun.intervention to all agree to reason w ith them, 'lliere i G | ('for the they knot, that when the ro emitee., Us lint
&C. M atlfnaud to advantige superior to those of | a very the from M4** It is the pnineipi. which .Itcl tke lriunJi| of truth .l "a* Its wilt blow will bring giwbiutf ( such w.I.r ofbitterness :.
to by .part lua Oppl.ut
No. 54 East Bay, near the Pod Office' aiK tUrB It imposes uo limitation upon the clfuactts. Honthern geut".1 slavesvtuMitl (rein the deneral (:loveriuiunit, peiimt you to press it | discord, and dca:h,, .willditsolate ::
&WAjliJt3r'O' : < >1 1, S. 9. I liberty of.111 Uunrun being It does not even 114" cJ.inw th' of of \ "bun Let u* look at this question M aa uriginal tie fair and proud| 1 rrpuUM( w b'vb U now
December 6. 1 11$3. Jtm_. __ of l. adtion. Its b luelu M In tl.n'ai< persons aMMy, oCti opponent 1 S.bra.k the Lope and lie glory. of our western world.n .
claim the fecce positive based the xs bill & legar- one, \\ by should w* forbid to go to tlio
upon wllb'a b tt b e'ct 11& WA I .% <| ibis is which gives them cours e Iu i
U to wipe from tile .W
FllASEll &THOMSOX, whole! purporffeod design tio ment Nertb. dod when t' do' ma. to 1"-| .w Territories with our property I IWauaeto time i but makes thorn back .
statute.\book s-f fuacUiient wWeh was pal...! d Ibis beesiiMi they urged il wwuld Missouri Oi' taking a place ,. tbe i, pion i i ir he-W situ |n-orly| 'It, In youropinlon wiJ"'HY. .t.r
!FA T@M 1.1t without aiHUorit/'aml: wbub, while! it put tU opfMm a prejiorxjorsiiee a to southern iufluetM'e I people didnutSrstaboleshslivery. I Why, wrongy Tha '".1 .t be sulliriettl fro abodes of reeulut freemen, I
: wbon
give alike Loriolanua to
COMMISSION[ MERCHANTS "ban of xeltutun ofkn one sfttion of tINt Coo in eouoeir* of the I'ufaw, .kieb would) de, air, .known only I to be repudiated fur you au federacy |.laeed )\1W bands of hoe other u the eijol'iMum( between the two see' \e here, however. UM fuundnlion of by which we, a* .yourselvee, ., p own rr', they I
Adgei'i North Wharf.CIIARLESTON jtd of iuvidwus ptf. '1 llluk of this a el br left to determine what mall or shall not I'l .
w mmwd of 1140* Northern
boat. 'b.l. that to prevail, 11I'' the aH t( eow|>ro L .Afsmrt I tie gaW .
: h. C. 1PCMPHIt. ,. that < of ixtfioUtion was to U* men ewkie to iniym teewt Missouri I |property w ithin time jurisJietioii our '..JI' But r+Uj i Peeenbtie. I8W .., 'lliirteen sovereign StaU. *. &bwUpMiileut< of lavstioMmg seam, Invited there by the grew .biel few now 1m41 they. .up t live Stales; and iWWore, wUlever be Tu MgM Iwo, see ivies,! r- :

I ___ ---.- --- -- each other and of tie world agreed to unite I t"r r e& ..ad fertility of the soil, and l lest i.iMMe, anti abaadu t i. time effort fur a eon. Uoliu. il G i -tL Load lu which There I fu but OM class of men )earing the
Charter Oak Lift Insurance Company, themselves. surfer a ecumtsfl (joverorotmtlimy time far dinUnt thv woitM acquire tW toleration, prolrtUtwl slavery. nt. you ., .ult. 'lite same
boldiiou (In the what wtmtjdo
to
w. one they
.. .. ixjlttiealeomwwoilM a o d c.
bad all ttte prnie of .r. right and came
.
Ibe
lluoee
r..I
\RTrORD.CQfcV; of to
or larger pfeyorvwn i, Jo"1 UO. Vi. iy uurp autbuniy a pwe ia the and what U a. jiMtfnJ
I 1APITU. ISUO.'WO' atl paid a and iatettej mat *, they. had jtaMuie, they' had. I' er.gg*IUIIMMI, ewe to |Imropdrty( e"*rai'J in this Clr. other, and I t1 *.I ihone.
and eMfc -.1 am'"'' >u> mod| exureiw Tbe wbi b It
/ vnJaubied tecumiea. aid approved fcjr ike clashing intrt, "t was an att.Yorti..ahttween rosily to tra | saerol compact which ) override oWi.gklHMU .
it...lf I've": Iks'' fiery lurnance .r t 'ibl lugellier UM guaranties. that! right fraMically a m1
81>> C.lllpI.l.r.( virus peculiar to lime sections, out 5{ lie l II 'n"tut j jealutikly (htaWs, eog .t and which Us
fh* .. :'f:. bad a hoes ippooted' Agent of lima" Hw"lut'on. tlirougfc wliieli. ihcv trtutioo, of sIsverT Iuwlnl bash already d.. Ifai
p
the hen I ofwllite tb *
fur thie Stale prepcrrJ N ts.um I Anliao
al.eaejroe.euthewuetf U' .r.l' .bad just ptwed.. did i.ot serve lit .fitsatUem into ruin, n'u' ft It threat.ned. to dunhme nobly |o >wld cuutfrauii, by 1'lt Irouyly or clearly un In .a t 4y I I" as aupui4>u. OM w lice
perioni .
term, Pot,net will j* ,,0<'0.1. both 011 be LI'Jai' a iIlKIe.u.illd..d and.l b'miog n.ou nation I toi..".iti,n and llu ri-fiutili, .' -'Ui" sloth.tU"1 .u agreed stot tl |I"..Ur iiMiit, | very. properly wbtoli It wOI b bi.may rise lo assert thr < ,
ail Joint 9io k nnclc)i I',it i u. ilit-ir, sttJriiij iliry badariiflti) ivm1: I arch ; wliieb bsntt ut llu"'o I"h. a d ". I.. S /. It i.oXG1.t.Y -4fe \ ,.. I ( nLdnpw" I : ..il 1 trudtstce 1'1 aulnilUed dial ties doc triad Cauuol U: tt .
rd / I)554 L a ,...m'l.u' I I .11 Sal vr.JI.J..l'' 1 ( I (I". .ll.I l i t 1'r "i; 0'' 16. mud' ,fI( ", ,I ol BU '.!j ,I".t. .sell i .
l'

.
.
.
_w, =-, --- -
J! ,
1 h .



.

.

r

-
L.- -
.I j herarlC: Air I 1 II". / I 'J r '* ."".I".t n,'hi I, m T'i,, j p.m.trm,-s HI from lli':ti 1 .111'; rain, ,I c,>n cl I' / g
r
of oi ihorn h"mrdo. t "" >. 1'' 11., '" tll) "rt (; i I Id.i! wl el In'i i .' 1,01; jjurrs nnd' :on 1.1 a 't".II rent rarer JHu I l-y Ilrl 1/011. .
,. 'I' { drawn from hrr nHi ",.<..r ,: hid taro U. rout ,d I Iflluni rh .; ; !: sunshine b by p 1".1
(\b"lillunf.f't Oihiwl.' l ''I u tin; "ii. I 'I" ,1,11'! 'II.ow i i I'"' .I..h"i d.linn I / 'HIM wi'lp.re-1 r p"I.nnt i Ino. I.f any .. Iitl poismoti
them part r.fih wiyioihi, !p. ''III.' 11.1; aL'' j'I .' up.n IL"( elm.k.l ol Its coup I r. .ecfll and quiet! scene, ,hero no mark aofn < I'M' andherselbeW! rl.I""III"| .r r a esp.i 'the cart rtnllw.nd| all auto r 8Uh" st.lltmir 'I he 'In'e ol ihe
cm 'do ligitimiirJy' ti,irrd ihe mine, tray {Hthry I Mi, ('hirm1n.lhi. cry lo u' lo keep (ho l ,''". dl-pl.) Hlelf.. ; """r. Ibo I busy,r deedofuicidi' joars Ubr may b dean'td In. single night h) most healthy slat., and retire' than .

but GJlnw iheir nw n coiir'>-, yet 'ln.H' .liolito'l" I li'ih;,'!' rte It tn''iiy. from the lipv.ante of walk ofin<'narenoldi.turbeff, "y the shout,s I repeal that the South has never uff:red lo | the p.'lung. >,the 0"fm and violence <,.tempest ibai I la llt in proba.bl

that they do not in.-an In pn there, nor snflcrthemselves gentlemen' has very much the' unapt of of vengeance ; wherewmionled Industry will I touch any right which ."Il interfere with' the ,! .I He pith| hi* flml and tries agar;...! pefiaf* bo s I a peculiarity the nervous

lo 1 I.* carried there. lift, mn remind ...re prrtcnw I owe loorWKh re.pwl lo not lore "il* ihojw and Its field 'I IU.." ihe nrogreisor Hthtliiy of country. If I th I| very aett year will ",'ar aim with a rfeb bervrsl on.,11' o the' rr.o bitten, which makes ilresult

Ihcm that history abounds li hMaae* ,11 hen, lo say th, I!I. m""pretence lint i it li 1 xckoninil shift lead In ilrlfrQ borne*, j| conduct r the North ha* been different, I if. sad high Thee b, h.1 are per *. fatuity, or nl. Hydrophobia is one of

where well meaning men "by Cflmmhlinfflltblrro a '..n way wfckh must strike ev- .f..hrr afir awl where the freedom they, ha* attempted a control of property nol within, the .f b n harvest Urn with him. Theat most terrible' of all maladies, ,I, one Oflbo"ieuu

i, tare bernforCMl lllIhllhe l mo ldnn.rr- etJ th! Suppo- yet flint l (ihoso gentlemen mij" y, rl.r.inl o only lit ,the prudent oxhecks, i I her jtirMretion, and! from 11.1! stone ha* arisenJdanfrer ,* M other porssiits have their perbJ o'P' which hare bafU-d the skill and sci.

OUt esceiec: of error an,I ihe wihVrt) abnniin.ation when th" father of compromise rdlaahimxlfprnpnsrrltkatthnenmr.mhntilyxbk 9 is 1111.1 more salisfaclo. lhal mI1Ar.t the onward course of when theeare-wort 1""lat.n weary

of mi-rnl'" and! annrchyMr I.1 ( h Ihrm.I.lmpl.ll all harmony) the American people! will she no yet, al. retough ire for t .. wllhoal dfttrment 1 pn"bustess coca of the meet 'learned physicians, and has

) : Chairman, shivery ran 1 lie restricted( pa.d< | ft fhmiM repeal ll, oils. railing which beautifies and en tablet li"I p. th the { 1 bo crossed, pause"and reilent In quest of a Hut pass.thne and _.d. been set down I one of/ the"Ills lo which hu

by Congress trr a'm it Is wrong, St win, alt b lining the proposition 'fpIIUlin/ e I Wi no Ibis het mure attractive picture 1-i! pause and' return, satisfied lo exert all Not 1 with the printer-there b Ho rest-np ma flh+ Is heir to" for which here( [i. no
the I br abated" 1.11It now in ill and saved ho whoinilsfiermo, the former her oat energies and her accomplish-- shine
name: propriety, .rough healing wings II. fi" "ml proud holiday' for hint 0 cold, nip 0 tkk remedy. The following ( 'loharo
exist,*. Neither can 'be nWwI'll""' rli'regard, Union In another creiurfawlhl{ pr1 ThA" (' satisfies me that there I I. } mesh (In maintaining "nla'v.ncng' ,coin be b compelled to strangle
ing the highest right, and if auch 'be the aim oil) ilifR-rence, as to sitcrednens lhalnd r.f..rr"I.I h. opposition a feeling Irreconcila.) ,1,i mo interests, IW"fr. dignity, honor o.el.paper And this b sir he hst along.H of sub- a Instances, and

it wrniW be mow manly to strike aloncn e!I Iho flr. which we now r"'rII re- safely of the Union t and ihough I the whole' Republic, I I. this for which whose tates lu* dilRrent their' faces, In every case proved .ucceur.

y the Constitution whKh proterl It. Ibis ieal, Is, former ban ]r the bill ihould nol paw, and ,the pretext il t I I' speak. I Ill Ids w tech will restore peace s 9dbacarcrr and.rb. cater ,.suit. dmvrtnt. shade "T.kl of th root Allacamprne ono

stealthy inning, of ilitehc* along which l I. 'to vir lolal"l! the latter, never until ll* r".I-, furnishe lx now w hr.wn.y..t that leelmg this which{ will, leave a more ands h mae 1 the.1 every dow ass ounco and a cut It fn.lheh( boil it in one

s move the ",rn lo attack the r.h..I.IIIC'/C.e I / any r ) say that, In a wi borsl forth in 1ta til. to wreak h : furu.* JI. We a
" war U declared doe* mil 'In-porno the honor ol' party disregards a solemn compact, th"r I Is f.1 ofdcsitniriion: upon our beauti-, p I ."peoa.lbt iblt Ibrll morning fust! ig, and eat food
frank, fearles, and hightoned antagonist/ additional obligations on the Ole, I It lo 111 j'rp" will bo verified Iho sad /fore. It turned much warmer and the nun ihi till 4 o'clock (In the slut moon It should n bo
c"I. 1.n I tntintl."IX
I Ciivo; in open war or give IK r..r.1! I Direct t (it lur.nan8up :- boding of Carollna'i, greet but loo t Jfloriba; << (Olondiy morning appeared fir the first lime, from j J Jwlfnd taken every other morning ; the two last dos.s .

i your baltenei straight ag-tinst! : the "rrl'lh,1, t |>ose you find shape ."ml g nI"m"n"hrn much unheeded sage, Mr. Cslhoun. If lhal: L ?th* clouds bl several I days, I., however, mud l weigh two ounces each. reme-

. now rrstraine'our prnpre or nhold j'our fire this Houlh claim ,the enforcement of day I b to come let ui h"v Its lurid dawn upon J still cfnerty and the weather doc no appear 1 b Mi sty r will haveMie desired .., 'Ih. I

1 ahog! ther. Hay with. the, exlermIniNt whosoleadjoii compactfundamental' in Us character andfar tof ui now ; if not to come, l Ilt l ui have the GOD II ova TiL'iT. fled N'eJSejoio* lo learn that the country b quitebetlthy tntimetrithintrvrnlyfourtuurs T.e after the ac lt

follow, iinwil'ing: as you are to lie .ljlr authority' than any congressional pledge 'lo Ihnl efU'cl, by amrmlljln thus pas-- tnJ'Itih* present time Ib prol; tie good ent.

I !liete ll, that, a compact proliclta wrong In.clm..nl. refusing' "by their voles, to grant sag of(his 1.111 what, wi the Mi*. Tallahassee, Tuesday, June 8,1854. ernp' are quffltaheering., But b this weather long

in itself a wrong mid should' liodestrojedoramended h. Did, any who now express ."hlrr"n"lIhllt sou I rl'alrlfion. that slavery' ncepl where continue we 'snaJljdread the 1 "aenlla moerNpl l(e The New YOlk National Democrat
; (
: ; or else' >ichl' lo In obligation! In ev. nuts .111..ncl Is allullu IK) done lo plight t iho Constitution specifically 1 authorizes,..1 'T : Itollars per annum, paid )In than one a |ftj- 'el, Southern Democrat'c brethren, soma

1 cry particular anil lihout murmurs or moral 1 pd f"ih. so ae upon lh', . reservations. Plain eotennled light cannot > .co.la ak { i I I. not for, run Inc t- islalion. of subscribing | set 4 0 al the end of th.ye.r. Advcrtiwments paragraph :

lie broken j Got; mere opinion's sake The a. them. Sir, when you remember' ti!m<* I can say only' a few words' more, air } bul', One Dollar per square of J! line for Tllrn. and kmantations of Ihe abolition sheets Tho Southern DIQrl'll'l alp conribut. .

greement mint Iw "'lM'in.t"fll..Gr.l opinion II IM astonished lhal we marvel a 'If I. if time permitted although deprecate any and Fifty Cent' for all subseqe In"rliont.- over pawsge o.th.1cb..1hl,ire truly' awl d d touch lathe pres- nt strength of tho
no l"t.
can Inl"fe,... .'nlilam I "surprised that t at the new-born anal.1C"/ r the ,1'Rn.nc. of f partisan view alibis( question, I could show Announcements ) .s, KIT* each .1- and terrimi The Triban.lm. 11 conmon consentto ibolitioni'tn In the Norh. by joining the A'.
t" or.n.lida" ,
grnllrmrnwhohave' declaimed so tloquenllfabout witnessed.I with slavery Dna have assumed! the office chief mounerVand verity ninistration in the coalition with '
compacts which I ll now how effort lo interfere wtyt be paid in .d.n. Religions, Obituary 0 'rle.oi.r.t
faith,' ..shiloh.urb t ,, faith of other nlilralylho of t it* tear Ind .b are eopeon and JisiMssinev_ ..j u t.yi'.* 'o .tiuai ".. the :
pI'fZ"' proneness I ,'ia.lmlt lhat 11.1 bad wi the erroneou views IheCongressagainst anl Notices, not epee vlin I lines, will be I tlona
.
fow. Marriage ; .
forgrl the highest! pledge., This remark, brings nol justify' (with with us, I r... .h..a.; ..J .t.. '' t"- published' frral is. public er. < anon tne Evening 101. (soft shell) and pronounces Nomocracy.. 'Her have by thi, course, sickened -
_.. .._ nI'h': r.t i' t lo l.ril.koh.
..LI.- -,, sum enter snowing, font in turf ue : which ,, party ti'-n, ef estate or li. I of any description wilt ths d"tb warrant Administration. and t eli gii"led a portion of Ibo North
eluding OUT property from the Territories' ware robed. l diflirenl from thai which attaches has alway fought and from which, has proUceedid the advertising Is paid! b It declares that the democratic pr11lh. north b ern mind, which .always stood 1'111." constitutional

necking lo organic. In addillnn In the ordinary laws was fiilendod to confirm lbf i every act of Conjrres, thai threatened glrj.lnli, no only' dead nUD| but al>.hal to die rights of,1.1 South, and have there.
general ronmdcrntions which), would. eirlinitit vtetej y the construction which northern In disturbance of the Union. 'hl li""rl I TIE .TOX-\\\ ;KST FLORIDA) urEnI To this desth-warrant the Journal .. t L y weakened iho power of the old Democrat
0 Comre.'IYt
I from all l new Terrilorl, and which. are asapplicaMa themselves I'I' placed upon (it by their' prne- ,t1..n-I"1 power claimed for Congress 6 y i We obr-rve that the Courier o the S3d rte, -f Strike, but b
to Nebraska ami Kansasasioany lice. '111"0 can be but two opinion on Ihi"hrll.t. the npjiosing party would authorize, almost any |lap name DAVID 8 WALKKB .alh. h nd; per and the Herald seems really 1 b smucrd at p' They h caused hundreds of true fiienJs 'to
t others, it \I. urged that the Minwuil reitrlc. ho( supposition that the t o E cries -" Well, have taken
upon measure, however unjust, which i might suit lor| its editorial column a candidate a.r 0 their numerous contemporaries)! Thi iay you t your bosoms
I r lion form a I bar at lo these which, cannot I be Sooth wllnle'oflu'l"vln' hud! Ito wi akneis the majority to adopt. I Il" I is rot<,f the | This asp, we feel I well Mured was Conge-Ike.II",. Herald w'| t more truth than poetry tells thus jhal the Van Bnrcns and tho Cobrauc.-now let
without llolalion' of fulfil
removed a good and folly to accept a comport by whichho evil ; though I 11m tore) ray there 'rrinJ. out the or consent Mr. WALKM.We they ere not half 1 sorry t* they pretendbbe,- hem lake care ofyau."
that it was compact to "be lI.efl'dlyobllervrd. lost all north ifiO 3U), and lull all southf I ko.l.dg o
with the. main stem their
I that If In iLls. C1 up many ,101' CTII ho. h..at that time in Et .rnp.r only imaginary I b really amusing Two Irivhnicu i going.o
may luggeit ( mailer Mime \ That lo the mercy of fiituro, Congresses ; a their origin teem .. Fo.I wad .Fj'! were fire a cannon -
t i la In the of olboial to through t long of. and .T J
< engaged r
the of dm Nebraska bill be bu.in.- lie .chng.
opponent tlotild l di.chal just l for Hint but, bcin of an economical
her
'city surely, Iding
"( compact ) full view of Ihi and 1 loa I
a
Ilal point take kf
forego pan the which
rilill. IU. W. tssuied friends that he doe seek sorrow sorely tflbcl the
found uttering their fierce denunciation a. ire by not 1 of mind did
.pl turn not wish
they to
M and I leaving In the hand of her ; conclusion. I do wish lo be logo iho ball.
''i painit themselves, we certainly ought not t to stronger" party, lha which might, forco ai approting the no from the ,"dl'rto. o d"ir. nomlnstton, nor sue we authorised I saythst of the New England State No people were ever, fo one of them took an iron kettle in his

complain ; fur It li a common remark, th,rat 'from I her, the other' half.weapon' : If inch were her pu r. ill phases, the question I have S"lte been discussing. h would accept It, if tendered The Couriciexprrvws fore 1 deeply.wronged-even Fanned Ial, one the. '. i catch It In ; and stationing himself in hnd.

those who have been the greali. sinners can ( ".e and agreement, thus North does well i insiliring My upon remarks have been confined t lo the opinion that the lion K. C Ceal LL, cradle, hN by Congressional fraud perfidy, bee.n.uldenly iflho loaded piece ho exclaimed lo iho other,

preach against sin with greatest rfl'ccl. 1 II to manage her Interest, fur conduct, Ito general In reference/ to amendments could not Unite the Whig party In his .upprt In converted Into t grave o lbry. It b alIIhit wrm stoocf behind holding a lighted torch,-

lias "been prated here, again and again, thin "I, like that would undoubtedly' hate proved herIncompctcnl or provisos question., ill. proper for mo to say this opinion the Courier Is mistaken. M,. I. billion the abolition ppr weep over the full 0 1onh it ofT gently, Jemmy"
eYl'ry. lance vf action by Congress .!nce to them not only the strong man the butt liberty, and spread of .
manage hrr.lr that x kiln I rrfi.r the Clayton 'len.I"Ilt I In.anJ o Wbll"rt1. Jar u. Seatieel.Ma. .
the date of the.Missouri compromise Involving!R; I conclude this branch wllcve him lo be the strongest be.
on subject 4 81at
the Uadger proviso out of tho bill, I shall ma Mr. EDITOR Allow
. adherence thereto, northern with tae( the We know that he been Mawel' Speech :- me, it'you plcae
1"11 some that, the nL. 'lo the bill the of .
on Core
)|"Cll"l not make conditions oflhesupport pl. .ing. W.
th, Sentinel with
b honorablo hare (hem. thee necessity present ti. 'e.def o the ho use, of a sinall in valuable
piceplions arrayed g aol faith l i. untenable.' I am rend to il. ly leading Whigs In dinTrent parts oft Ih! or paco jour pa
selves against III binding //Crco. ll I. been give become candidate. Vi be here ith. speech, oar Representative on the XaLr."a and ,.u.L..
Hating considered Ibo main reason tape| n Itrcurrngegnin( lo the gentleman from MasfeltomlM State t t not w 6lmeebill. .11waaam..rt..O- "" i.r 'e t net to.1ha at tentur..t. r .p.rtrd
proved, again and again_ thai whenever, th whlc l the Ilili rt ma out come evl I Icno e that fie js the chore '' (ha actor [ Court 'I 'to the o >eralion of
= rkQuhu being shorter and the |
uw u.nur, J1.Upr : c mss I Yd : 'n.IMtclflMorWin'S. \ : "I \ j ""go tan ever*Belnnng iuMr o mlr. 1 pilt ont
1)030:) the compromise hai not no restrained the principle" but IWlrn. of consequences.,I Il ji|IIH| Olle hlllrlJ year thin flirt f!' r\J' has never given his own afi become than the majority o Ibo 100 ."eeh.delivered o of their recent acts, a"iU.io beg of thorn a re.
eTorts( of northernegression. Not content, look lo the eflecl/ the oflhe Ill the candidate. Il 1iwaoathecamesubjmtlliespenhhingadhaulend ( consideration and ofaho
; on public rind fort wits marl loess Union, and Is no sudden de"rmin.tion, o repeal .ale. To
with the restrictions Iml"a.l. and not willing mssnge[ of the bill raider than to il* proper r that, thirty.thrco }ear after I hit tho Mi.IOlri h expressed a wish to ret Ire prior to the csnvara or squnn s about I w'Il with our view's as any of t hnunwroa act I refer to I known as tho "hog law; by
to he( ,! to cili-i :
regard lollh..r ., Senile-men tell that {fit bo productions have been
merit u* pas* restriction was adnptrdandjnsl, lrlythrte 52. Ihe reason he ..iglle then, Is the reason we compelled to read] which the hogs pro banished from
yens I fro from ottaek subjert lo no ftilurelimitation I ed til agitation of Ibe slavery question, will i year nth'r that the President of the UnitedStates ,hich he assigns now. I says It behooves him to on the, subject. M e have never expressed any great I Is I believe our sheet'
many, and often a ma <>rlr! of nor lb. that in
| I
I. .I. and may lead lo Irain from this after his tdinlratiou for bill but after the univeralyomilld
I G'"rf.lyllerla proclaimed Capital that the lok private possesses t large I. ) proportion was
ern men line, have b..n ("nllnvri"1" npluainthis | : of UII""* diallrou. beyond all former pncc.drill. disturbing question) of slat'cry wit finally settled Joining Interest In Middle afail.Florida 1.which suflerei made, apparently .I sort 0 grnluiul. ofllrmglo( cities, without' proper cont"lence. for the removal
ai a fn.lly. 'h..al things are pros Such piediction have been be. but ,, the South, there were consideration from the of all
streets filth
; of his and Impelledns yards ,
ed from the "eord. of Congrest, and thong l.lr howllah..IIt pl..iIJ fancy, by reason lung continued a'ne tt W.oh.Ilgloa. ilbi"b ant
thus effort was mash "yllll. grain. men fronOhioMr. lore, but our country moires..nllll.OII'asihough which '"kOllhlle as .iglillall coincdcncel. Should he however consent lo ran, fee' I mueh.1 we deplored its introduction, t givet and putrescont m iltors, thcao animals are efficient
had been ,
no .IJn. .e. m w hen ho comes to rememlr comp ro. wrured that Mr WALUS would 1 our humble support and .tUlgl.for Its adopliol.- and the
lall,1 they hate not been andeannot aol his name icarvcngcra, advantage la thinrespectcounterLalnncealldjrctioaalotbem
funk Io/uhl prejudices may for a limo engender I. I mine to ill"1 and which pmiL We rejoice tt i its passage, w* hail l it
IIIII"I.d t
to In '
bus wlcllh" with b.UI
luccesslilly ( and while I I b brought competition for t I
'nlr''l'r'd j and .
p fury, high wrought *' I shut the, I. re-slavery but because
shall pa l.y way, 1..11 not good fortune lo find a nomination triumph the country
not the I safilipeak
repent (III"ICI. imny ) ciao swsif the multitude, linl where the nitre in he( mnn'. charmed cycle, had will recede intoastnteof 1",1 ant Con- And, I think It will' "0 also' concede! soon
of it as conclusively) showing That until g.nt Nor do 9"e know of any one abut seeking t Bom- Iranq.ily.
1 now the lIRolrlln. hi* neierhocn' re.gardnd I right Iy settle Is,,liiero ilflKplle ru"lc. (eflorls'nlflctiol of will agilalors uliinmlo.and, : a character an.) pur|>o"o totally, d lH-rent' fromIbo nation.. We believe from the bent l I(Information in ourpion.II"L grew will now enter upon Its "legitimate bus ness.The ([when our streets .hl L almost' baricajcd
two proceeding aci+. Sir aka of bill hich paused the House L walci.'melon
by lb endowed, with grouping Mr wss the pain e y peach skins &c.,) if note
a any the, fear ofll'rlol.lo, the' Il CUKL Is I looked to by th'
contrary. ran hose
sanctity superior{ to thus of other ordinary leg' not I Iul prove so In this n. 'There Is a I hi.loricallle. in the modo ,he chose, f inslend Whig. all parts of the Stt., as their candidate which had previously passed the Sonata,'ilh It now, that their oprrtticms would prove bcac.ficial .
islntive mMO" lias iho, al. el presenting' lamr mind Ihe august i Clnjton amendment stricken ant We should ha''
regulations. hy inuudnnss and sliirduieii in (he American rs Jut! he has not consented for there. to our own lonn.Tlin .
march of
i ways cast her vole* In utter of It T_ i ono great principlo through a scriesof pone k.t ..". stated' We have called I been glad had, this! amtndmrotbetn retained, '|
Sir, the diMr"l"nl, lil.1 which we mar hope' wi'I.I,1 i against epoch, presented tho first nmltlie last as ret upon to 11Ilhi. il did, the right. of_ .. + lmilng .eaon nr iho ,..-11.1 will go a
.
heli A
ciplnnntion is .
much. Jr all
honl.t .1,1
reason
111 all l assaults of e I'il-breweri" kings. fraternally reaching, trove Ibo tulii of time .1. ".. naturalised cltixens is true naturalitntion; tar Ii so much apprehended all in our
it a she held all oilier laws by
mlijetl lo I
.
the Courier and
r"pll I llu.p.,1 by (In nu
bo copied
admitted that
; or r'lltlllion at he( pleasure vf iho body I mint al rt8"nlho signs that separated Ih..l, to join together i in 1 the Central Organ of the Democrato part by of 1.1 route the right to vote The right to vole b climate, I i. fast approaching, and, without entering .

, it. are u"6aor."I, Tho conrie events tine exiinguiphingth* ticiousliloof' the two inter, party, r"l.otthe strictly' a State regulation, and It may free or qua:. into a discussion of the question:whelh.
true of the \\ b
. he Nebraska bill wa. brought, into' big Nor are w
Congress, I vemnjf.. And I do not doubt but that the hero "ntmeal prty.
ificd
wa In conended ) the according to tha the Legislature of each filth is
1b. ofe by gentle prone that notwithstanding. the boasted, pad 6 oflhe ilf Wtlwr mod t say that Mr de.ira or would .i o er a cnmo or prevention disease (iholatter
gentleman' closing bo foundrxloaiMng
scene w SiatB The of the .
the
frol M..adl'l.'t., [Mr.alUy] "hP 'icilion' of 1850, hero( i I. I ... .atld..* for iho He is prcie gonrlD.lll organtuition opinion in
unhealthyentliuenl by
an
some
-" photo v iliui been Lilaturo. I'enle
.li may laint
in .. ; of
reply lo ( geulli'iin ('i'or ieorglu, [Mr. : lav. tided Territories, moo ere Informed, lias, in tin. r.gar
among the norl'rl "hichr".I.I. draw n from on vomit'r portico certainly by up'ienc. a to yellow fever at ) for the sake of
he ro/I" I Ili.lalung. particular been Il.I. com.
thai
Mephens Mr
1 irregular Pearce of .
.dril..d LI.llall the corr..clh'u. which If efl(lieu nt a..ii useful' member be lieve My .lled
the ollo"'d proper and that, if tin* ."nt to him, he will affirm we ael''j fort, let ui have the
1
of Missouri when the only
a
compromise bemuse she \a u"wllll lo per- el 1 would f. in believe this give no II it | speak nol by authority' I only' speak what ""didat for Atwnibljniun. than a candidate fo Con I I I Senate for eoncurcnce, that in 1808 Congress confined aflord.

from lit slavery Maine south Mr ol 30 30 and" .rltl.mnll' run indication' of Ito sober thought cf Ihd maforily. i I believe, and what the history of a true man gels I the right o suffrage In thej MmiMippi Terri 1Q Already, hare I seen the other but less ef.
[ W.b"urn 1 when 'I The sound of Abolition ry, to oili.n. of the tinted suites( who Relent
J
the of the Missouri trumpets, aim ever faithful, ever steadfast, aid ever devoted .,property l'ie'll of cities anJ towns, buzzard
i rri"cll. compromise Wi the fury of have stunned 1 The WeatherCropsHealth.The I batten. The right euflrage confined tocitiuns
the rut f Irll.8ollpror. aim" lo hip Cairo (country Icache me lo believe.Mr .. performing by their I slower time work
While .
slavery tint have t"'n and process,
Ib"8
Irregular In
enprlclous. Territories
misled) quit of
might in their minds have the Non h many | .ld 111e given by clerjzy. Chairman: there is lo bo now or in t the kliseuuriArknnra1,11'r' of cleansing onr !.
i".tilld men, who ought to ) grave and truthful, hIt fidureeomerndoftkirdnt TI.arlnl"Man.1 vegitation' bak.ard. en.in. Iowa, Cud and New This restric .trell
1.io. Of evils
controversy. two
in disregarding the ("II'r.o a* lo lerritorKHith s \\ e had April', lo thie time there by I means, let us have the
the desk
J I prostituted .lcr..1 lo the .11..I.io. another, itmuslend. fo.t "I up liunwukltoulofth.bilLorganieingtdeTteriwrln or least. .
of the line I Ole way The
k what COMMISIAIBC.Tremeudoui
!, a< 1Iy .
been
fu lllhl'yltn. of deceptive' and clamor. That the very /ll. warm weather The latter jaysof Ong+,Wonhington and Mmcsiitg.
i 101. her /for n if il nelinl polilft cannot always hear the shock of ns c According; the
sacred disregarding i, w ere la"l.b..d. people might better satisfied if Ihe convulsion a* produceVhyshouMll May, bo".r, were quite seuooabla and the pros prescntbill; which passed the House and has since been Riot-United States
by lime fitihful i
I a lo
ance ol' w hich compact both bound ol.er". present question bud lo been raised, am J l la.t' To lienefil or raise the slave ? No one p lot the hu.bnde..were truly ch eing. nut(II adapted by the Senate, alliens who I have, Jut arrl. Shot Dead; Ma.hal
parties were er
I I which by thai they would have preferredhat/ we shoult who rend history and rejranl; can alIhi extraordinary change suddenly occurso In the ved In the country, have the 1 right t, tnd decide Military tailed out-MdiLut in arm-fti'ot
err principle appeals I In llct.
J dull' anal! honor, Integrity* Iu lei lha Missouri restriction' remain ultour"e". I day ,beline thai this will b .- temperature f the weather The month o June'twas '; the delicate question o slavery,u no slavery o "h1011
I"'ull require ole Is for this would hove uhwj la under such .timlluk"Z.
suit rd
t pling to show thai' wild Is inviolable' yel 1 very probable lo prevent the .rr.lol whet gentlemen are nivpiees .JUI.re1 : Congress after many )'.ar of angry d.ulol hav. BOSTON, May 20.-Immense excitement
l I.e constant IT. .iolll..1 without aflerling may i itscharaeler. t heir known aversion ''o.JaY' Hut whenihey pleased lo call an still Why, sir, though i sver before Ippap1 .iilih. memory Oi. old finally onclul.that they no power to eon prevailed in Ihls clly ihi*
on accountof
'Jhishowever, I It Sure Ilea have learned, & learn, thai .,accuried a* lb lepor, you h. given i' est eiluena, only t.ilk o gentlemen welting' he j lirl. a Important qUl'tul 1 purely in Amur the arrest of J' lrn., the etcning alleged fugitive'
"fhot" t Ihe In the restriction( I I. streets in
removing not In the bouse hold, and wraped np their cloaks at a
season
right* when I Ithe lean
w ho justify past violations of the allc-il compact r"rIOI. Ih.r re o., should hav been pleased had been slave. The call for a meeting in
and at the same time present it ';us now lo propngnle slave), not louse Iho powers "f main no privilege lo curtail these, while they m Thermometer usually runs up 1 00 For ..cal 1 11 left t the dec union American eiurea.-WUn i born attracted hundred more than ."eui
Congres* to extend slavery, nol lo confer .nl; are these the days the Sun apparently retreated behind the clouds 11 1"1. co.Jd get
a* pure and thing to touched by n u Inro.oked..1 are objncls, j and naturalised However, the bill re-nsserts thegreang the building The
i b peculnr: favor South but lo cone nn ostensibly' to be this bitter ala vuuulu. Now th I principal speakers
} .acrll'gi. h holr! Ula"lho gained by controversy. .scarcely .hot" meeni I Southern pnnoljU of thi were Wendell Phillips, 'Iheodoro
and mlablUh i..lril" and Con. Fir, il should be closed now. These of this strange phenomenon f Ws have looked in lolill".nton. rpal. e Parker
Now sir, It I that' the law shall plcylhal vain Missouri 1 compromise, had the effect Inil. th e and Francis W. lro. The tenor of the
prepare gre. usurp United Slates before them boundlessprospect for its in our Time 1
t no 0 peo h. a .lull 'I I
to the admission .chang Albany South th. speeches
tory Cre' question .
I Union 0 ohla.rr.la reference whkt
pie lo character of in. "I lufoDmalorIenun.cing
ofllolrliniolbe d.t.rlln.lh. own of influence and)lpole,, to be usedlor the 3 1"t..only eighty north this, > t the ,
I was never regarded ( as solutions 0 mil. 0 .k They here heretofore Th It. chie Fugitive ono which
J i Ire' they cannot but approve and II ;; the (improvement and elevation of of the Themometxr at 94, tad here dI'' a, Lw I
stsnding
or sanctity than other l law.. I'111..d ,lam, ihe act W hen they have learned thaIhe ,I' and while they are marching on with 'Iride.Ilhat lan.; sitting blh. tire. hi. common. romtrk that. "dip I I merit, tnd these ea.id.rloa.llpUed us to give / should resistance.no be Al obeyed, ad counselling upon
established about
principle, n policy' II object I b allow citizen th. our half past: nine o'clock, a
.lmlly t loollb.rn have bounded' from .
ocean lo pas are supposed to know .npp
drew planting thing but think motion
Of.n. every we to
an arbitrary line to mark the lame prmledges north of 1 30iu. which i I. I ; adjourn to the Cored II< use .190'.
of Lllla.rie 301 everywhere along their course the art* hey are more GvyuunUya\erwwthaaweuherw' ', I C3 We have block .
slavery, "which satisfied n.hb! party. now to ." south of t always believed "b.le'ermay lo morrow inoruing:, when the einiina-

I am unwilling to impute such flagrajit ill. That lill..low..o. w ill see lhal there .U In thi t* and iltzalion.nl'r, i I.ie..I,1 It almost rmemlies t Impiou of a ,""riorel. I b At any rale, this remarkable chang In th* cant der ,' h"V been bit motives, that Prelim'c ut lion of Durns I hikes place "'carried by ac
honesty to lb" North at can I* dodciiod 'Irci no t Croak drown which we tre w holly unable tot ex- ]Pierce clamation. Immediately 'thereafter
a justice aude< iialiiy which erred in making ibo a
person
,
her counsel If her of the rrillel.lt ] oUlb lo have them lamed back to upend their 110 M : the tlinanae mod even the i fre.oi ,1 .bel rushed Into the hall
"lula *
UI.I.I..fnr mea la prevail, they cannot but give. their in Intestine and pain, i faction{ tho basis of his Administration. exclaiming, I There's( a
i sectional
wal broils T W We
ry content bnrselvvr 'I
sure were d.rernl. .1.1101 ""' by he qui'llng tbe.ru. with slat- j cold of negroei in Court Hnimo'
advocate the compromise: served! to approbation, to rid the of thidangers To the honor of the South, Id ma say, lhal l la lug the faat without tltempting to give the eao.W. .*,_ :'I' 'Ihink the course pursued by 1". I'lllmore, wa the Court House, where Burn I I. confined attacking'

relieve our country In dangerous crisis, "i which surround the country I fully appreciating the demand of high de<.. have heard it explained, however In t variety *the true policy, and I iu this respect bit con Thin announcement caused the immediate
o
admitted. Thai it has since been .luerYI'IUliol' tiny, the ha* raised the voice ofsU ifs ways; but the eiplanations I rush of
b ever lok. This can never be June cease. nl"e were beyond our comprehension duel contrails most favorably nub that of 2,000 lo 3,000 cicitej people to the
'ol.n act in our history of more than uto act upon il, til'ongr..t. Constitution I but in wlfJefras-rterer Imagine eomrlaintLut we will are at tempt, to rt'pallbeln. Nor' Gene Court House 8<]uare. An attempt Was at
r.II'ierle. According' the
evidenc
t nut importance will be admitted. That t 1 plainly requires fel'p. Do the people with! I I Ilo to resist injustice Ad "... A* will wn presume t speeultl! upon th probable effect ofGov. IVole, in .nc. made 'lo break open the Court IIouso[

j Inspired a certain degree of veneration, w have no more slavery agitation f This i I. I was *aid L) the eloquent gentleman fat m o Ibe chang*npoa Ibe crops Out l few da)* sinoei h spite of the, prayers and: door on the east side, which owing to there

also b admitted. but' shy 1 Nol 1..1 what they profess in all parts of 11.1 Union, || li'1UII(Mr. Carutherr.he haonly' asked however, we eould but observe t marked contrast be- entreaties of Seward and Li* gang to cps strong fastenings failed. The leading rioters
'
for error In human action was .ululilull the weexcludubolilionist* proper. Lei u* tic III j alone could ant< Lit contrast tbi t I Iweea the planter and the merchant The former ap. their friends! no only 'lopped off the head of iben wool lo the west entrance, and with a

r rule of a higher wisdom ; 10 b..u.e any l lob from this Halt, the foothold upon .which II.n'exprorsiun. which convey ibo truth if history i| I par in the lat .j.k h.iot never before bad every moller'i son of them in office wbep he heavy plank used I a battering: engine stove
great doctrine of political pbilosopy was announced ba nol at fault, with tho expression of areaJidingtdshedgrndcroan Err I prainects.; The the of the door
' plant tbl'm..IY"-lh.! I assumption to ble' oklo 0".Ial. "' became but refused through panl..l. and
fixed! .glalur Pre.id..nt t. t Lrok
appoint
or not from Missouri a
Mr I
' 'X'II any new path question shirt belong to a differ. [ more or kw .h.ra""'ik th*.ual by th* I II. some w InJows. Numerous pistols were ,
9 free
fur human progress ".defined ; but 1 I.eau"! enl forum, and that wish wilt "be accomplish ItratwljshoJnelardthat j the yolut66aJ'ituedt1r11iswuricwnpmmbeuponlhunor 11 lori .t *n>er. list now, lb pktuutr put on rather tIb single toiler to o flee during the who!le and the mob became formidable, Time cen

by that cloud nu..ur hut been wrested front an The bill be'ore a* only' touches the quest( ; king fao pal Ilurr.by low wtth t bearj.sigh. 1'h.,;I period of hip stony Administration. His poi. tea watch house being in lime Immediate vicin

angry tbllbtK..rbh. which threatened .reverse a practice in conflict with this sole lireatuiethedefnrourcelowtaheage I n.pri..nrt' .llt.ab.J : Th gran* is about t lake icy "'I lo starve the rascal into the support ity, a pope of determined "..tbmrn dashed

lo cloud cleave tw.h" Ifthra yak method ol' securing perpetual quirt and lo and raiment .Iill.of the gentle! 'I' 0 hie bowl 6.Wa, mod weUdawe know ,;j rather than to purchase their "tequleeencrmq u In, and succeeded in arresting 8 or 10 of ibo
b.
that bad the I confess thai I I k e,
penetrated iniitiKul of
Ib"Con.tiuio. thou
1 1i
bare the of Rh ( rioters
f"rl..n coming Slates to eiercf WI most jraidaUe lu* down todayenditT In the leading alter a desperate conflict;
i il would have n 4 lohetr Cl I Compromise measures of J 13o,16e !
revealed < such
surprised, a from hi .
\ the charge m
> right which freemen
I tight oflhe
everywhere tp ready battle pt The prompt arrest ringleaders'
There
ell a is w
more lo bo commemorated lhan This kVa was also pressed I thegentleman k t" .m. icy adopted Pierce. Wo nippreosed -
rmYlmlb in the earnestly, Ly bI'rf.int rte further
II thi I
coulilry seeks to do what country ston at*om. wetk 1 violence, and an
ey\I
b.lr" eOnromll. I removed a presentemergency both the two great ufrel.partite In 'the North were 'from Pennsylvania, [Mr. (!hoc r.J] | Mot the tuiddle .\ I. or nMdteoTJune; ,any bore Llee lhat Southern Democrats coul W Tfco force who IW..r sown after inl..1 p
was The mi.lake of[ but coming front him U the u 0 .ihDtlh. cronc
aid lo have endorsed tnj
tu the of L lo sting Meb i neualiy long ihe soft shell Democrats Rationed Ibe several .
.
eorl.rOIIR. I very saris Then Ifla'ib of a
acting upon an basis, rather lhanUJM when from 0. >authe fnlroc.
arbitrary, I 1-V>, and what coining one own
if .
11.1 were an orig 0 tn"-I( rainy teeeoo, which i alma with the tb. North, and the fruit of iheir eoajlfton Court House will probably preserve quiet for
; planter *
>O principle, b. upon us many so.nous inal one, they became pledged If our noble South U bo a i1' the
do Horn
la in at i I.
lu- MSOOI tell tad confined in
la
refcbieii.( lh a week the nisht. an
s : Ibo responsibility; of act which aaa. r. far ready tin to a* it. upper
lure. tOleeof "bltIr. was the a necessity the l nif.1 I..lf .appearmo 6y Court House. The officer hav.
Dul whatever Importaneeor value oflhe rnd..I.nt of these compromise i l'rl'll'n. constrained her to adopt, or rice to submit Ihe v rusult can crop .., ttd w* have been ld the above remarks of rte Xatianu / log rO charge of him
q he alftrnative I .BMiany f.diarJr the in when tm "el armed, and had
14 ( which
It1' would
star laws Dud inflict eithertbo .Ol
adjustment pained lk. .n l ,, they nl..a lo say) tbal w ht'U a 1 the wan If 111.tn silencing: agilali.il\u bad a t enrte mob it i I. doubtful if
can bo treated Ifkit lal.. Jt)l ha* principle fur New Mexico and !'oo horror of a broken and convulsed' Union pl."r h b at l puts 0 s sadeoenuwanee they Iained.n elirn.
10Wh.r ofliberty d"Dc1lo { carried him
sanction, Ii or a tout 1 denial oflhe walks on, Ul pnUeda inc.ea Ih insolAe of Norb..r"ranlii.m. cO11 tl Colonel
-a"t
( Congee b
nor any ,greater xce 1 bebe might ao a good one Wrvahrrl'erritorear ? by) right South, claim{ Hum
North thus (It privilcga of a her i >"a a la, ( IH* *Wly Northern ate themlelve "'hl I properly,
not, Ibe sovereign "
a apply Lyo
tr"al. y the J.al. .
tll \ll I 'I Li "v..1 soul* ply* his bee was arrested lo day a charge attending
,
u.rt. then fo bawdriot o
its la Male, lo disgusted with
passage teal.1o ou. That I a.k.U abl fOft keepor t o <* and jUdo
o rilei.l. tlekr. to ciiisen
llai i I.b aal nuke lab and kidnap a Mjuacfautvtt' and! i lair
which the bas they chose. Il tier 0
rpLi lli bra tb | ple tare hushed the .1u generous I Th. u W. I. I ly bolt Sotb"rl D rata I bail.
I
I b stamped II )"y the HII dm about Ibel ear. ao'1' to ..the que- eO..ailn an emergency) 1 I trying strumwK I."ev. btu4y.Won"t. the mitthieC( r"Dib hel un

authority w rvlt &n (wing. 'I' lion caUuly' II its trI flay will ii I.I'balC a* her,0..la111 bow i I I o ale .prop M IP i t- The FugitiTe SIne Excitement Boston

South, fluffing It s by tb
ed ll u bet P" t go Lh.., I lo Castes any luteojporal .iiil of liidi merry o her opponent That opponeul ha I t:t. PbuUtf fM a reel saaMy uut b* .il b,I We clip ihe f fowrac "infallible BUJTOX, May 34.-Col. Si" owner

o inal ibta ana there to o lu. 1 lit* ati against the HouUi. No. sir ; inlead but to prupa aggression opal her rithltln|iwudw' W bw pa,... paW U gar i. from a conunwuemtlon to of ibo rclp" cube fugitive derv Burns, offers lo sell him
Ira I* a Olt of utralf b ohaerveellw adjuetiueiu rag IMMMH! ibo !real political inputs of TW .-pLit papers. w.b.r* d.ig. a said lo lie tuWnbed .
faithfully while\ 'o lie Imruiug Grin, or ut ike tolrauo n.n. *. M) .eM.nJ O.titers | ) n ,

II remalr lil. the slaluif.0., awl only tt t tC I'' jerini;"; iu cU).iri>) iiig la'a 1'/e' I) lu resist and 1..it bu tl.IIO accept a toil uf ysea .t -l.1. ...-t retire nuuv AMM. I i I. no 1 Imp. here. Th oor Parker and WeoJell{ Pbi.ip*. two

h rs to c;in yard It r ben It i. r-o.I', .1 'Tb ,men b-r. bold up lo out gore. Ihr l"ull. pit'uo.uion. for Ib.sake ol'"C", u yield* ".-,1 wyww carte cat prtul\<11 I,e_ where tyt have no mad dogs, lelt abolllonltl.! ) bate ,' to the au.ibontie .
rvuipaiiion of 'U'h' r\lkl : I irtUrto l chow Ue IWII "iiwibing, Ikougli u<4 aU that t* buried by lie 1- 6v barn ".t from the (ln,
,'ib 11:1 I twl a Iiuulo' w" '| d'wI.j.- &a"lllr" 'ii"j stub m'ret< heard or a cue of fi pn Itlllon b porulaIt
"Il "
'l t. tic ii LvIJ lu il u an aclimi. | r .'ik, .r .. tt AIJr"Iobii il who threaten
.l se' '| < >-i 1 a erk i li\ wpi .lbt I 1'ton k. The omi n u i "n lo avenge the li't'h' ol

r ad"3oe howeveb III, u c

.

r
"
.

.. : ), "- -



I II

night. Tl etrr t t. ,. ) I .. u 1 P
Friday a iowi 'i.i .IONl .
ed on I : :
.uj I ; r 1111:; 1 \.l: : i ': ;rf f f
eJ, and the military ti:1:I UIII"1 I ntim l lii, I. N ,'"-: I 0 I, Pr ''I" .,1' 'I ..1,. DAVID C. WILSON tJ.. ) I

\\ learn from the W >lnngi',m I "I"n ttitt .un p.r., -nl .." .j I, "i. i \ ir nit, I 10 Suhu i '
'
.President Pierce I I. determined t.> 110 III the t.I, Ihe pi.p ..,. "I| a.''pir, nj. ,'u''". a. a ..1.I \.. : ,. '. DEN HALL. rio 1. .ui.i t.l I,'. 'pt,:;: ,:,Ii?;: I::!"-:'' I I..t.i. tie :';. ', il' ,' \\11)' I : \11 I \.PHIIAr.I I ,

meant In hi* power that mat. he nece*.ary lo Null.. 'plll.l i olllavo.rl''< rr Irn.ln ....,''Imr" 01
1 V
? -- DRUGGISTS
enforce Ihe hvr. The ", / di.pl\tC'h( I I a jnner.I : U1 SPRING AND SUMMER GOODS ,
,
x r r. r I 0 n I In.\) ,
the Prf'id.'nt. Saturday : MARRIED. anvnnl, art I he ,
received by which h. has)".! rrrmed I, all lb. nrenl .rrl.l li .. IlK retelling hy .lmr> t every ....I,frufc ad).
In consequence of an attack upon the nil I. \/Sth "f MAY. by 0. |It. (11.1,1 iw,.. M,. see h'm II. pi"( ui.i i i ,in mw ..ing r"r impecli iii In the .I.t piW, 1\ dill,. 10 'thru I>HIUO; v

Court House last night lor the purpose of re*. Jeers ]) M.,. *nl Mns FstWM Mn Lie, all JrtUm term as stij house. EI1I1Y THE MTH OP MARCh ..").I.r. very fM.alo .

cuing a 'fugitive date) limit'r arrest, and In eomtjr. H. ___ ( tfcf sake i.rsn. ky any ... Ip this rlijrMMg ,.1.1. -ON ":nJ -

which one of my own guinti' win killed, t t 1831 .\ UM vkete, msy he KwrnJ nit, rare .nt .reeeivvd a f xapf, rr r and ee end Ceafce- a
( rcnl choIce slrctl lit I
Inee ter
lIme i
,, Cepacice
of the of the OBITUARY. 8.I.n" .
have availed myself resource eel A ) l "e."rk
LADILS FISH DRESS (OOOW M* **** .1
t'nited State", placed under my control by let. PinJ on he mnrnintr of the 1lnt ,M., |Itwt at t. Unit led. %i /\ bile. Pull v,"Ak. t .

from the War and .Department In ,1.or Crn W m Ilttil.r. ".f liffirv (V. XR.KfcS OftIl.lattolla pert of tim hun.., ,Idtweed (hi I
let '
151 and now hate two companie* oftroop \ r.. SEA!'. '(frl' I I.\ ,h itfhtn ellIs,. Ute Hen .L\\ U 0 II () ) I \ -L re.peetlfch Inf nvTlh' 4-1 Slack. Wlk I*,, IVrage aid PlMrai ReMid Cet J ter 8fm (KtTkltaheme 1..f' i .

L Rml stnl gnu"I I ,'lunifl, .f I n..rid Hr.w*. Ptthllc that (|TT>. red itpfll V tat :
from Fort Independence, stationed In the alaullyulow.ren'rul..rlu..etn I I tluvulu.auhuuf vats tnTfMinft II It ll !?Vnd refilled the Hvuec rrpa formerly Fancy' K.lh, It* .s-Whlt. rrtfI ....

Court House Everything I h now qtiel., so anmlilc. so well hel'.T.|. t'lntmif Inrrlr Cholera. ( known a* the Caro- I rap* d. I'arle, Worked, "FUfoll IUUSjn: ) ) !

The attack wa repulaed 1 by my own a<"rdVAIfeON pve vnittj.' I Toil ] on did .*>. FIgured OkwHie*, itCh. :
I (
*IIM M a Kln.hi to nil Nnor $ ttrr. 1.: .
\ IKCF.MVN, IhinktnK of act'. the IW h e le of a d im
abs male,! h. own hnpr ( nmlialelv S. lid tloI\I: Tan 81'CIt.'ler' fleragte, a) an)'ply" ., 1.iun

U. H. Marshall, .lotion, Maw. other* iwnxwln*MI a remarkable prnm<],fw wsrni ffortmns I I and! fowl llenee. where nnpo.il he niH|ll ilwaya pub- l>rir>.ai Heeh ltln.k : Uweye, IA'' ,t MKIHf't.YKlt: : I 1
President Pierce link Hlue, Ti*. ,e. of AleWenl st,1 lee, I
this
In reply to message tue inmifd a plim I in the hrnrt of aU-n.e. "re .in 'lIot"ft.lall"r, tho who .. ) '
BOWEL ** 1'ujiik ( ib, 4i', .
M t hue .
returned to Marshall Fneman the fdbwing entil I know \her but to bye 1 lirr. W i> frit it to think, t C him their : : Muslins of all ktttda, A* J.Y .'

answer : how we lmll mhs tier from nmonf u -mm the gen t ALSO AD ( ;I:: :;will b* f*rnl.h i.h; the heel the ALSO ssMitaienl oftiiwes -.hI.l- .r
the deep of b..r hint I I. the kInd t tnnn of her II afford and EtwhroraVrtcs, lists semi Cap,
TIIII Tfxw-Tot Mrale' armed
4 \OP COtOlCT APfROTtO.. tAw : : at any lime lo flomaasd nioiiNrm: F $
Aheee
our yea hi he f gin Ihnugh ealicut l from earth thus DlSLA ... TravellersTERM8! lMunn.tnandlrinsn.ings, "lrl.I
of{ )tt., nrind H I.
KltST liE MKCtTK early In the Aw t flwh f youth. when lIt seemed l.t |rinds cad fane, WI..I \\ ,ilhnv Ware, Istu Ugl .
has o- Mr. / (Okrvee Her, ,..., lUrdwi unt Cethepy i : \. l.',& ,
The case cf the fugitive slave Hunts, penIle iu Ui
caused Sabbath o(great eicitement in our ,..d; willing tj ro.( Cairo ant I compotnl nntit thil t month' with Lodging, till 00 ladies llaTer*. llellow Ware Iran,
Ti. and I"n... Ac ".. ....
U'imlly quiet ci'j, anJ continue lo agitate the but she r..1| tat ta enter the dark valley tW: of wnhMl l ditof, I tub '
T public min.t.1IIIlicatione. father burnt w.ul,I teal I her horn. BeauI.tuflaaLet Jay . Aid all iittwr req.|.il hy iH**.ntrT or
of organized attempt to lynch I lit It cur. 1'8 town .."I.t. In Ine, our Mark ... .. niatt I Ith t"
an f>rifHfiili,_ of self IIH! bertrusting taitlt'd"'I.I.| It .. ., . m W
the Hey. Theodore Parker, and Wendell Phil. :: lint trying hours, when, with! ealmnrM far tl 81 It cures light( em*' siibulanlial realuiri, Ikau ,ta fife nail c iwanliiieiranre
i i'L ceres .
who looked ai the insiigitors or years. sb. spoke wordsTf comfort to lurmutlter ; JOIII11.NIIY% : KMPtr *
are upon 41 h. 1 It
Ipi,
relieve* S April H, OH O. U.) \MLNGrccetlc mk
the reeent outrage, have In'!luced, the mAyor ausI l IhoM .,liml Lac J* l 01 not werp i(;>t me. Ath II curea I'",...". '_ _.
I I am fatng, horn to, Heav.4Jket| m* there" Diet* l IbtI. if
(force for the 6th ll Fresh
C
10 detail a strong police protee. ed MUranc She is noj InrVbut tune bf"c-ftntborne. cure* h :_ __ *.

lion of their person and property. There Fur ounrlvts, w* mourn that slis has left us ,t I 7th 8th II curea Pa .- meMlN aflee"mto7l I ekeS are now recoiviu front New fMMn. per
It :
lias however, hf'PIt 110 outbreak 1 lo.diiy.rtin -thnt the void .h. ha*1.-ft m 1JUU1'I"'art..n new Bth. li rtlievee, : aerevint lo the linn. Jd( ,< c WE Steamer UMTtT) 9TT* t lavj.jm if

Court 11 one* tit juaro was cleared mat be I'lllwl on e.rth-but!.r'lxr. w* .1..ul,1! ) I .jol'i that I IWh U ". tleAnt,, a. P >,-e.trn of the ol Cts.( ".n NMe*,

and the court house ,surrounded with abe I In. r.u,' a bonHrr*>hrr atv nw IMW enters liK "d.pd.restores, see,late .if aald Cotutly d,.n*Mil, email l nub Rlhl *' It .
night where all is hrpi'.Dd' joy fonrtrV I gar Cured Ham.,
12th. It. a I' i'\WiM r.' i'
I lence rope \ will n"w.ll on the' to thy thns given, I NEIl rti.No a
oy A rEtt SHORT
A detachment of one hundred United Slate And I learn the n.untcntl.tch 1 linxlit rltil with impart 1 '\4.. n J...trI.. I Wiooldere$ .

troops aro garrisoning the Court House and W* will tnwt I in ted( merry t t., meet;thee in: ILavfD, TEKS. T : - -- ---- -.-- M." Pork.. l-'..;.>

two companies of DtnUm Military' arc quar.' And t.Ii,i iball be balm to thin summing beart" r hue u..d I Nail. I rim. .

IIa.ll titan found it :OS Cur Nad. ,Inter receive I bv {lhilee "."'., a JOIIY at':.,. !
tered In the City -- a valu.bl remedy" llO1i6klvis.\ South Car. hn* II it*, DR -

Handbill were circui'jled' today denying 1iJI) UCWLPOflTOF I' ) 2$. I lv'.4. t'COTT. \\ rst.rn Cora, HONrI'L'igguONflW ::

the report that Colonel Siittlvj! h

It says he offered to call linn f.i 91200, and ST. )[ mend Jacob rd al I '.ttl. l'I.RFUMFfl'f: tC.-- i. vrftil Klin I o. Sum of the elet> ..
when ant I the : : : I emons, Ac, MW I. Ih. An,* '( ,. fka
raised and ollercd lion ARRIVED. eipenenoe I anpnna Upuhll
the via a larf smTHm-nt of Fans .
money .Mi r
I May 0 'M 1 I. 1.
I round i I. : r".
and the *.ro. New Orleans. i me, a : _. .. .
he demanded more, bargtln wai May 2& r. Jenny Litnl Sungreen fcw pan l l Aeiarteaa Muse' .
the Cummi adtisoj him W with |070 sat da com. S3 luliul, sides II *. I it to be all. that it ; ,I tun.. M mrwing .1..., LAST KoficrT Knrnpaan Klnfaampior '1. ,war ,....'I la than Ia
lu'n. though sioner j Rrnti,. \\ \\1. ) d. ,. Inarm lha ot tha rl"h I tor, ;. a.4 ._
I ,!nilhrf Oicrcvs lam. 123 Lbla. fl",nr. IJlbU.wVry ')" Prt n h and Huaitl.li Jo .. .. I .
.
keep it. tfdo. pork, 4 hhtls. sugar t bbl, lard. 8 j Formerly Judge ii ttsmlol %.1 dol., A(I.!. "..n. vim havr not given in theIr' Tore. tn as.'iu, AmerIcan. .4.. f'n.rib.ih wl p.|aa,al e .
rrinle,11otict' left in church I I fir lhimelvaor aa agent fw other, will .. ._
were every "dl'le. I tabs great p!' -VI.80- tim in Iii i li r I, waaui.n I h.h' .h !
nlee attend 11 the $tinmed. ., the 1 Imlnktw? s-nit Ni ate .",
and pulpit this morning requesting the valuable med cine it ** emu alely anItunli. M .Ir 1.1 .
..
prayers CLEARED. will be chisel IlieHr.l al ..f.II.11 lie, >nj I Ike sieb a.4 I p. rJOHN
'k.Z" .0rrlr .Ii.giao un day .
ol the l the of Hum I ea, fir which, I 1 : .
lor
congregation escape W..Il t..u. Luekl. fir l\. ,. ,I will 111)) !
ehr. doriledly snprrior, I Tas* not renilere by that lime b. daeU* 1) It. I. t.'H
from hi* oppressors Orteanf bt::'* spmU tUT'"illo. IS do. imn Mnbroiua. cut '
with 47b me. A, A. ( I .
Tun VERY LATzIT.-Tbe lihl of Cur". oil butt vamMi 141 u'* n and |"itch, ." tale* cot of 1'oma.lo., I can be (an J al the Prutf liere\ of ,Meaet I Ike.narul ) GHUT nURIUN KING O f !

tho alleged fugitive slav, han been postponed >">n yarn, t o,tluu gi. C I Thi efficient ,. ".lie. ft Matwell I I rtrnrr of I'liiuon I and Monroe I. Ua TnT" W".nnnue nina Wins-C. OA" PAIII.
until aid tho ionic1 !." (funs, .\"., it.u.r.ah. by StemS I.. 0 i. UtMILI.\'n I A....'. BnlMnJ knm.nlr *
Friday, excitement I ties IV POilTBoh { :
t lust = 7 ;
.
ly a as II I. X J. MH.INM-ri May 9, Hit 9 41 tIc ,Ii, .: nun my. r IWe :
u hat abated. On MonJiy petition praying \ lailor i Crane, Jenny Liml, Suegreed.XEY Kuasi. and .illinc I I I8M 4t .-- ...n4. .. in u'I.'" mwil _.,. .
fir the repeal of the Fugitive Slave Law was ';..r".. J,/'r.u'. I -i 'iIl. Nf\N' VORK -The lark R. ilf f It V.lrn;'a,vii..U:: ,T,. il.. an.pii7 4 or* 'Ih.lr anl hmllWThU icniit, Itw ....o pI i

signed i by many, who, In 1S50 sustained the r Fur tuy U. T NoriCk.-Hii nioMka II ) tl !Il.E. lloamcr, and llrig J fM ). ..,",1.I ,f.. o.lll. du'uI.1' bri.rpoi-ia.t I > .'. f '

Cumpiomiae fncayiros. COTTOi if tilT.rplIK ( f I d:lute, the utuilcrU.jnnI! Aihniol.teatu.r I i or ibe .\ \LIMII"l.mo{, ) will. nail for lit* aboe. t It.'h..I.Mro.lttf., an4,.situ h.. _r.| -haiptaim... .. i.nv lo ike es-a kMrte tunlu.sna t4. r.
.
,, , From the Savannah RtpnUetanTUB I I silly ti' ltIf.I-tI! ULMIMAToril I T. Ii.a .!"..I. niut. "'nil .,_ .. Cniiiruicnikin.. Pnui
HOSTO- UioTv Subc/fpiioii list will ..-.-- I I A.'d by this ,. r::; J.: lt.r.t tJ\Ii..: : :,t. Miptu, iiluy ", 5e04. .. ;.4 K :l Mf .iMi l' I
; b ;
the fila' MIHIM ; no.ii < i.AusrnStag
lie placed in the several pdvsraitem, | officer aTEf.TO0TIt CYI I tluo..Ch..1I auld \dniiiiialratkni -- of h'>...a ;il,'a eo IIH'P.|',. .
NfV PATENT
: ..1833. I .:.-fbll, d..(,. d.I". the an.I".n. .. .. o_ .
May :3, 1) I li'. F.W80X. km ronie, producea kr 4 t
in this city to.day, witb"a vi,'w Ip raising JL INDLIIGIN. whose failure baa l men reported I -. II.H IItllI A.lllliniatratur. I 1\ ed.aaOuirliinbt" MaWre, ofinfjnl, rh,I lien bouni.euoueli. .I .4 I I

fund lo be transmitted lo the wldjw, and fun. through all at the Cotton grow, Mulee, i* altll To'rlcE.Sly: Interested in crrlain renl dtale, ailtlaled In Ihe iSa w.ml.1, ..Ihe Ltstn. .ho ..alvuri namMtnvt M t- I

If of the late, James Uatchelder, U. S. Dfp al,v. and alilt tt run And ilurinj the list ...n i 1\ sent m a I llI.l (hltOCttlt4.-Jot:: recclyJ'New county of M,'nroe, .III I 'I'pl| IK Id* JUII,. of at., awiWleum000a.o.iwotuMrsegiyiiint JnliiM al -h* t. -.! us-na U net nla.hle nil Kiuii Knlir tI r

who hot d"IIlln the street has I hern brought to that atat uf perfection whichrendnre luJ tat ( ".., llrig huwann_ 1'"lIlIt. ('.>urt of .aid County, fir leave lo sell pa.I I l'iis a ilnjl., trial, aol I It -iU(.eli,y. >wrt .Ir k,Ituenee I J I
uty Marshall was it. 10..... certain For abort alapl It. : istrJlororthee.:!.!. : ; b: : : ::: :: Sad.?, !'liid. of squir \>. 10, In th. city of I Key a'.nt l t. on'.iuhtrr lit H. Uka, ,.'naos..n'a II. .r.". .I..,I ,.n..
of Boston taut week, while III the di chargn I .rc, nntn.uii.aIau.aiw l kr attlb a l hki great superiority hart Ih Saw Om la strikingly' anpareitto .. luuwJip. n> ant I for a. mat be or,' I and ,.. .
ceaaed l la.. of said : Tk. IrfulUia ni l and whOA tu, I
,
l'j.r"n.: t.il. "aIU"I. ,
of his duty attempting lo qiull Ibo fugitive good ju,Iges. This super! inly con.i.l. from aui.I Ad, ",.' U".d Oil, drrr-e it I I'by nail I I' \; 1MNU I DM I: IliaC lulfrrlns.rrln t.>te we hiie.lb &aut.iaawtiei.o 1.4.,
lave riot there. 'I'ho object la highly I..uh. in ,il. leaving the lint c/e aer, mare open mad fir.frees M. \13 ''M lotunli a May 11. IMI 3iM.. (lunrdknNO bha e> JiOn| .in art of b a. ,.r.l -m Ikal Ikef ea. I.
,. 1 .. ...f.p.iui.t .'. Thl. U a eawnflil nit Iralf 1 wnmol t ,
does in
jl and Ml break
/ cut, ,
or ;
will the favor f eny way .nr _
.
bo! aud we trail meet our 1--' II-II: = frm.I!, a>. all etlvmal iltovaM.. Mtr.',.wadhtfa, fcuraa,
the Til! at the time it the .IX .\ll I J mauls
civIl classes. iijure re eame imrariing C Hue, jliuto'e' C raki'ri, pirsuns having aeain.1th a..nndwmus-yini.miuoii.'sibliunaiaiueuu
citizen hat that salt and oily feeling ollrh is natural lotheataple ICE I '. (',iihu.r \ hitiaur, vetAle of I IIXM-RV \\'. I tower, lul.. of tllIl.I. I. U la pvi'nuy kamitaM sat Inranalile eT rra.lwlii.
Blood spilt for the country dt. t'rrr. well ol.la alien picked, by hand-making the lint from Will.In..., Put A>n, dun C'ounijr d. eaaed, are lurch1 n"tIIt""t\ lh. kad iotorh.au) .AMU lu tim. .ihltoai., .am atUia

the case it has been ,h,'d alto for the Ihe mine, lot of ..01. worth fr nn ( tali cf Die ptr >t.a,I lure and No. I in kegs, brfr claims |ir"ip<'rlv anllirtitaMtrj, within Ihe time It wMkMt la ron' .I.t, Ihlh,.Ike ctt,I nsl I womenlIMua .

South ; fur the Smith, a nun while dift ndmg ponnul> nor .thin when ginrd on Ihe saw fin. "BETTER of Him Cigars for auk by I.merilwd by law ur Ihi. notHv. will be plom.I l In bar of ,.brlhl.,.t is-. eul,". Iknvianila, al MnISratM .
lit death f. the feoulli It cleans ilia r>es Ulail Cotton beaiitirioty, s-n.h I I J. \\IIIIVMS. i,f ihiir reoovirj ; anl Ibiwe ln|i d lu "ll oatmor af w ,1.p ..bilila MM II.Iaut.s.msn i
has
her nghls mot : r *> >la 'a ic ,.
will, gin from 8tH) lo 1000 pounds ptr pay, anti sfiraaManutaituieraaavd COOL i tI |!.iI n r"-'tn, ';.'d to mauiki'hmtnmi'ihlate' uaynwkl lo the tin .ll= | .a Ike : all .
have boon anuitlt., 1 It I. Cargo
a wido and orphan. i tested tt, the lint la In a 1\ the I Jirnign.il.I '1 IIIOM.\8 ?, ,- kwra ikaa ;-. te i'-0: :7 I I Ita.
tSe and *houl j bo the pleasure of the on way (rom :'I'4:". JtJ\\-'r.\ .ti J
duty mitch letter condilien, for the Mill than from any lI'ort., MijVl: nd Llabilltlesof Union PImp J n aw _: .. .
Dank. lhM a J eontpanlnn.. awl wa ikale
.
$oiith to how hef gratitude, and tier regrct t, nther Omh -- --- Ii
Ith Uww
I wettU away woe. eoe.ltla] ,
antI to ritend her proteetiou to those, who in I North Caroline. Mc..,.. D.ttl A *on efKJjjecornb 'riCb/ .-Hit ., I '. by o A. ( OF, Notice.: Uuawe I t'0 :. ,
and Dt 11 I I. 11,11. \Veyne V< NO i'F a "'ine Street New Y tut.LI KINO Of t Alt l "
moment have thus ruthlessly been cad up. County account I( otk. 'LL l'-rwtnu having nmiiiU, aujislnat Ih. estate of J .

A on the world These conifjc rat ions, we Cotton IV anlaeveral the I l other have and tried th. Gin bn SI U".I, i! of Probato my for Ji. r: : : \ i I. Iii l"" 3.-ft A' IjiwU llargruvv, Ii.t.'iifjelhiurnoma l l Uiunly, do flenplaliil Woul.l ,,.>wularr tie ..., .alawat_,'1..1..1' ..f..Coil at.w.aa .| $
|t.v.uss.act are highly pleased -- I will tubs thai .. t
I of Hie Estate \\ etI. notion they luiiat |1..11. ibmatimha I
u.o. ItUUIKtKIT ka, T lk
ill have .their in cI.mmu.I i : > .wp > '>* ar not sakeet
doubt not w gIlt a the result! In Teia* the New Gin le bound la Chlasii: .
the .
eaid ConMy, and .. f Irntjrfled, d'ih aullu iitteiitt d within limepreenrrbed pain, tka raiuaily I.- an4 sirs woos-' ,
nit y *o generous a* this, and in,luce a warm sweep clean Cant, John Duncan of Mdt.gonla, minKtr.tion; by I tumw, or ihU nutiw will .. :ph.I:' bar Kll' .' UI: t'
that which who punhaacd the hr.t two (ld in 1 etaa, do.dire. ; from New VirL an awortment of of their An,I all ,. .
re ,
from the blood ol the murdered fattier and I that ihs had rnciuve,I the n in lime to hav | and gilt hina, Mans, Ac, cen.fct. ...r..It) nutifiwt t. iwk inHMMhai. pay :V 0.: .llruiava..nay elkaf wiMiatl. Match, .e raoaal
> --- -
t
UI It tke
Ulii,'d his whole! crop il waul I have made a diffi'f imwl to II.. un.I.'r..I.I M
laband' In I.tltalr.r bereaved widow and lice of from 2000 t lo auiOO dollar* in hi. favor AT whils China llaiaaml IH.he, AUX.\NIJIn: : IIrn.\'IT. AJm'r \QICA Klia Of PAtS. IwuitI |

he'pless children. The 5u"i inch Cine arc warranted, la pick 1500 LIKELY Cups Mid, .,, Ma/JjIWI. a $$1.In,3lvent yak s-u ...o lt tiond. Lilt Jnl. ., 5oe.
put.n,le of I In', in 13 hour Tb. 44 inch Gins mill A well iirown, :. ; ; : gulch, Cups aid Saucers with motloes, Wus-u't4Ia," :.be-s-mi, T.uaiw mu. II'I
t'sail iuuul., tappnd
..
ARRIVAL OF THE ASIA. do front 1000 to 1200 point of lint in Ih* annie Field band. Trrm. Toy"I to. E.tat Notice i : 11.1 .'

NrwORK, June 1st.-The British Steam turns. .ith |.rupirept-ri| I, mil to run s* long as a JOHN ) : : .J.I with mollora T.\'I'F. Of' rWi/O.\t :7-: nai.7 rn .'M 1.1."inu'. .
Saw !d t acme of failure. with u" Tallahnn..n May lln.ktlsanlMes,
Asia arrived tt [ Hook thl* afttv/ t'l ; si I proper je iigtinui O. pl'
hip Sandy they t be made gnnd nut I tim T. Petta, "inemmty or r..on. t a WaulJ va. be eare4 of Klaa;'. KU' Cause,
n win, bringing one wark a later news. Inn of 4S Inch Gin $3ik). For 60 inch '3i5 Family Mitch lloira. Htap Dillon. .i\r II. p.r.umnu healuig: cI.un.: qalust the esl.ti KnpUnu,ar anr aliaaM or tka Sklaklktil '..uu.4 s-p '

The Collins team.hip Arctic struck Uan a To b* livored at the nearest depot or I.ndn/l; to TUST received Unl., Oohl. ., Umnnlc Itlsises, Cuaudas Mu iii,, etua'it, dmiojpasl, see h.r.by si: Ikm we IH. Juka Bull siupnniia I "

rKk after leaving Liverpool, and had to put the purchaser, and a Man fu"mailed to set the Gin lJ from New .per Ui.He, 'uml lers. Ac, A*. ...d to .ppe.r, .nd III. the oiinis with hi Judge oflmril.atn aa4 Ik*Ikaa Klnewuua (a If'p-'i mu., sal aau.es-nuip......uts-w5... .:

"ac running, Term Cash on ton d.,.' trial hoice and fair' -A I. Stl- : o. I".('ou"t" ant, State .ror..ld au..r b. DR. JOhN DULL' I

k.LlVEnrooL MARKET There will b* a "Mk tke.e Gin kept In Tal. Clar Red Hugar, aupplv of tlui I, Molar and itt,I Umps, fire .b. km'S Moidap la Oelober cml or this no' ratKoirAL orrio '

I..h.... at the Ur ck Store ,recently oempied, by HirCamlh.' i and Holar Lamp W ink, Ac ,1 c. tim:. atay be pleat to bar J ,
'I"v rv. .
OWY'NS' fin Cae lanai pooa sauw ,
Lotion was dull with I.8 dicline. The Messrs. E. T. 'ay lor A Co., for the ase! uf their ha tJ I, A, J. WLOINMSS I ) I 0. .r '

sale on }'ridayw.re' 0000 bales ,, aw Gin.. ALSO ( liJI_ 4t May t. IU,. lIon, JU"If' Dr l'toba.e. : Jlmyu..KY. I a

eommuuic.tiona aldretJ the A.sorted .. 1MB liLJ IT tmOdOllTlkM incilASIT*TUUOUUU.
HreadatufT were active All |t. Agent --- ----- ------- I

On Tuesday Wheat arhanced from three Tallabaseee, will meet with prompt ii'tu"n.:: flutter bupenor and G,..... () 1M311 "j IOi\Tif. To Planters.rpllEBuherrihera OUT Till 111TU UU' I
M. \ f
JOIIt \
> AMES 'l'ullaba.p.Flas.I
Agent, I
to four pence. During the week fl iur Lad al Ckoeolale Corn I lines reoeived i a large ootwignL ; II
sauced two shillings, Wheat five pence and f1 8.-Theae Gift can be seen In operation on gr FORTUNE: FOR ONE TXII.AR mi.tit uf double width liiwn li.sabiegke, whlihthey April 11, .> o-Ant 1 1Post 1v -
Short Cotton al the commencement of the neat On., ------- -- --
Kiuurte Candiea ,1 oIl fur sal al the low prieo i-f 1>| eeute piurpant. .
Corn one shilling sing season at the Plantation of Col K W \\ il. :: c lo milk iiioiirr ly nil I all I early and aaiitily| yourecilvee. FASIIIONAIH.K): k

The general news i I. not Important.ClUHLLSTOV llama, U.n. \\n., Ilailey, Gov. John ranrh awl Also II.at A lomdon large .?. ,I I ut I In I Iulo or, out of business fo capital May: C, IM4, 4 BIYI'i.Llt liKMIAMVarieties SPHINU & S1JIEI .
eipeiix Incurred, ,it
W. F. 1.lo'd.or IXKHI Cojniy t Col. U F. hi'ner, rrquires --7 -- -
MARKETClIARLKSTOt of Cadaden Co. 'fhon. M. WIito, T. N. to. J. U. Root ] !. DO I'.ddl"rul gives ton tha sum CLOTHS AND CASSIMERES.
I .Vlao. Mbt., I ..,* with
Ih
thane to mo. from $l6u
, JUlie lal.Colloii Marruk and R. A. Young Jorkaon Ca ; J. (}. I \Vmdor (thai. ,month 1 l bu 1)tJltE lli.r.Ioat Oil. reemetiw an eslruiv.i <>f
| is no receipe vf kind", I t I"o
Andereon and f Daniel Bird of flVraonCo'inty any :
apt -
A. Ceju'iiMrcatatinii.. lEt.
( amlle Ih-ap
I .-The eaei to-day amount to 019balest and J. C: McUhee, Ee<|., and Col It. ll.m.on, I itc&c.firaol.by SIoyto,1814. ; ::d ;, ;genc of all. II ,is eunit'tl.ing il entirely new, twerm I', tIgers,, fIlivana ,r and Faney Union, \\'blt, '. and "Klguntd, i.
bales : persons j inng a ernin nl and
and lor the weak to 2.3 U at .f Madison. County |t Mnooaroni f which I I.m **pared IHI .h.

l. eitrtiue ranging from 0 3 4 a 10 cents.- Th teller from the Mill.. Manufacturing Company FOR : : :, ;p person-ei.clo.fng; ,KwtU $1 and l, l'.t knswlintgs ftij l will|, bet (lime, Ca k ll.J..n I_." Itr.nJy, (lent rwieed, -01..1, the. must tudtKNtabl| ityhr. an..I 0 up-a.. '
below
published gin. Sam* Idea ef the value t
'J he market closed quiel.I |II| E 8 KIIIPLM I : aid '-reule by J1UFI.HI/ A DE.SIIAM, I I la term.
OTElN TilK NFhUASkA IUU. of nina Uin for Long hupl Cotton .t&,1. Purte:: : : !! IMS. kingaiun' I 1':. <-o Ohio. hluaylLml I a -A f.HOA .. I

I I & continued, -- LiMits AID will: LKciau ru/K 0 .
, In the Senate -in 'favor of it. 35, Honou )Ia.., April! 1854. uted, aol 1 co ,. $100 REW ARD-: 'lIrt NEW YOPK.- Taveruler _
,
. It agutinti II, 13 B. R. raatHiiaaT, Eiai.Dear j lured intended fit .1 iwr, win have deayatuh M above. // R.4; /r. 'It /J: (] J, (T n i v ti t I .
_W. hav uaed th few < IHT JAMf B. ItROOMe lIE.tltLs It .
air : si Newport, McNs I '
, 11 1" I.Uf. I .u.islt.I tu of CWinwretl. FmeA utah I Sock,
Absent part
bLs 01 Sea lal.od ant l other long tapfe Cotton, I E. II. /Rwharjt ; HOUfks, May >, 1411.TOBACCO.. I
SHe
rftlW Mk
i In the Haute whwh l.laJKl Cotton : of'luJ If Hur'ull.IIFREVS -- 1 jpyUJurod Tnieli anJ I(weed Daaka Imp ,
jud say wu gmd on yourSt .
,
.., If. and lh.sIauu, AlpMealUi ..nlttvMiwa I
Tor .tg"ill'l.. Uta. May 30, IS5I. : it bus br. saaiIiioedrt *, W hUf Ifrow and r.uey IJwia .
Democrats from Slave State, 55 2 \Ve regret In not having a larger supply of thi hiiiwii t. m* tbal ELY JUHT received a largo and well s.wrltd let of Uwik l>rsp d. aol Kumnwr taeriui..*o

I do do l'r"" SllLlo.t I -13 Cotton le pam through our woraa,-a larger <)aji' Qufncy Mala! -ut1lEPIIENS' : karged with Ik* : I HfcROrR/ l tflIACCn; wbwh la Ibe trade, \vhlt* and '. "Liars '.nl.->\Mto neil FVntyvlaneillM

M higs from Slave Stale. 14ilu 7 lily would enable ua Judge more correctly :. rpllh: neil Hilton JOHN HI F.WAIIT.his will b* nail al ri.end charge., V-au., Fancy and llaOu HUb rtrrfrta,
tL
Ih* relative steAls cfy our Cut tun Gin .ovti C .J. .tnro.4idaimd I. a fugitive "Item 1 AP-ltSS, IMA4. D. \\OS'! CeHtara .
( I la.MtyAa
do'ree States, t moo roiler Om J 4tb and end t.. I J JiMtir, ratal*, U."lt Unw.NIu. I
.
The laetilution le kr< > 1 i .. I
With aureinenment* on llje,upiJlLt of Cotton .ITiMiU : : : I .rc/er., I, Jnaa b n_.., Uovtraor Notice. AprilLi.1. JolN
!
aupenor _. _
___
.. _
CationUrn
113 100Alteutcrf ireetved, are of the ofiflua tUt"pour I |* vr Hit da, b, virtue of the .asktie.ly
/ atul tfune nut eating, doe But IBjtir* the t>\'l, ee i. Cot Ion, Bad I fur obtaining a a (h.p tow, do bonn oAer a rew.nl of 1 A1 LI. ..having &.asads sgaia.l the e tae Tobacco.UOXKH .
washing.
that Iber I* an i improvement in ilM ....n... a>>4cleanlinaaa including dulUr. for tin, 01 I Ellendei lt.muiu.ragba, late ef U.ded.a >.. I
Democrat* from tint Northern Slate, S writ materially Increae I of Ib. Prniipai .'$ bppr.lteaat.e of acid ly, d.. will, laki nullr. that ship muat pri.ieee () ChuM T.=, k,
fiheaywheth jad hi. ufe delivery to lit Sheriff .
do from the S ju,hern Slale.8 the ..Olulr the article sod reduce the coetef ..lar. reapeclieg 1 gh ( ouutyUld of I them l. tl undwreignen1, d.ly aith.otir.t.dwkbin fO -fcCOTT

bigs from the Northern Slates, 4 Mansfactuiring.Howe's calakgu which avay }.. U ... A r..I. ... 'M piusetahind by law, er Shin a *. 28, |114. _

do .from lla Swulbejn Suites, 4 ,, these are queetiotis whirl ell be) more M N. ; eompieihM. blaek heir and eye., I wIll .pUd lnhfts.flh.ir r""",. and ail' per T.OR NEW: YORK -Ti.. nrt t
ea4ef ."1' settled by e>perie eeJ on Inter May IM4 ,... .y h.. and tile Ora& Heal.10'lit. so.. I : sell ; kink3 :aotul..iI| luiMke i Is-,..* Kagi.,

_!I., sad I. ovdar to aeeompheb thie, w. hop. yo* ii-'i. I Heat. W PWrieVa law. at .. Cap- i ,: -teu.be iudenigo.d)i ) Aif. to., llnbUtd. will -v. ': ri-Me.
21 wit be able to farniah, larger euaplie of long alaaJ. 1101 11 the ell; W TallahmM' iku17U4y .... .. 4AMt.:I U fiVK. .1.hock J. iHnhaia, will alao b.' re* iv*

Of the eight members from fieorgta (bur UeUMi fined by your 8.1.( .. Cotton ( $50 .'M.,. A I). 'IHM. '.%and .1 ... Admnl.i.tmntie._ ,.t.,. h0KAttD. .UQRM, -I

Democrat and two \\ bigs voted fur the bill, \our. Truly ;-r> L. tiiiamti. Aprtl, !5. II'_ -..._._- a. AI|, 4,.:" _____ _
!
the bill none. Two Democratic Shoei and
agaiiut ,
Talks C. Mille. --i Notice
ltdI.y T J I 1"M. 31R Admlnbtrtor' ..
member were absent it i I. not staled for 35a ,185k I It fruit New York a aaeuruoetit of Q lx.isth.. *W Isle, tke ..VtmJ.O ., 'I

what reason. Wnth, City Cowwd : > N'fW: OfU.EA NIf.-Ttt. .lNNer ,. J Duot. Md Kboea ** lod M .eoeael ). leslie 'the eeeate vt \\'..*, vf, .
.
\l 80A
OR NEW ORbKA%".-7V Silt,..., hue.withIn Iko pawl: M M, E. PETIE*. ljk Jt.mkeeused, tail) pev**.l hb) p
Capt Me Hut 1.
CONOBESSKJJfALTW Wild 1ig..n..u C. O'L.aq, wWm 1 auei er peraoaa have will amilMktwve 1 '- 1. ad lot asM ,- I
ea hurady, lle ante '
.ut>tTox, May 29 3.11 P. M.On I'" 'm t.rItIe,. Cab Let, cIA arri.Jweele gut limed, A* l ful rr ihl( Me* e aefli liBEAKD I.. o.lo w* .i.. el awl .11 "a .(t.;|
..' ul1'_ t'ar. .'VI' ff'jItt Of appIJfA .st.LV pouoo, line 4 rPNHAM. Mt t 111 4Hoei "tGI.kIM. I'. K. ( .
11At.
Monday a Committee of bub Houses of -
"Bt-\RD .t end ftf 4 IM4. 4M
eCily .,:May S3. 134 fcc.I April t' -
appointed to eoi f-r the .. IU- s- ,
wa J.
congress upon Mt e/ewrUiMM, --- -- .
disagrejcine vote upon the O,8eWncyllill. dostroyav dug or -- ltrT aerived.fruw t Bbmenot.a lumt mmtijftII k He!, -
In the House the PactC : : ;. ;.$. .her dale I will aprfe l. m. ) HOTEL J td ***. Boko, 4 HOIXJKIHH 4 KOOTTM .
t ? Representatives No th. H e faa e JloVe of Probate c..rt.tirl. .:: Oa. MMa.7 .1414. COMMISSION. I FKC 11 NT'. I
Balntrldjt
,
i Ie Rail KuaJ Rill h.ueJ. .
w tA' th :
lei caters f.Uuiiiisiratiea on eelat. tuTaw '
COHB.IV 1
:
on t Uy 9. P. '
of Ml.. Dora Tv H P'.r.u.d !late 01 4County i. u. a* I..' ::' h.nja4 .,.. the eot.ishmida- I R. JOltS WILMON, at Tahishaams, I. ,.. s..N..O.eTE | ,

\\ ASHIXOTOX, May SO, 1 4fl P. M J. O8OOt. AMt.RO.N. as, .. as ItJ..hs.i> m have nwmad Mk-MrlMHki. uJer tee .4

The Spanish Musietor bed ail vuJeuo w rib June ii, "M. 'w.-, wd at .rv HOTEL tit UVrRV nAlr.!; ai. I ies* ef ItNIT & MEL. lie', ike purpis .
tisI -. ig t Oei erl ?..**.. .*>d ( mmuttlm holt
-- ----- -- rawvv iw st moM '' 'ct, Iv.takes .. fneuda .
the Preeidi 011 MuinUy i Put W MerMetsed for Ml* hf7Jen ... B. fUT, '
.
The Seoaie has paMavl a j..int r ai !uUun FOR SALE" U aey MM!Otteei el pomeM.a4aT ::I= ., fkal he :i. peeparW U en. \_ l, I Wt nOfKIK. A M FOINKISgrlW tH. HLM MEL.
Ml... and! TrwaMenl Hnaea'.r IK.
R HOME AUOK aaJ te* :
d to adfouru on t. br>l Monday in July to the AKOL at Iko CM* ,. 'N dpi.., Ueutaunn
Jf (
WMOU is much muss -4.., h.4 et *e. ej wilt Ue bl its. eeeMtf; at e. Cee.fy, II L. : ) ;
third Monday jut OM itr. wulee ueHeiit rontli A U. 104WM ere ttlanSiM ..u.) give te ..*.( le/l --. T.ns .
a burgarn. Ta are i. ( r '1t us J. (t. A
.
The Deficientbill bat pese..l the Senate. R .. .
(ooe of Ikem wet ..4to o.ly tam 114! sal .* beasid .. J.V..
Senator Uuoter tpuke on erlsneaiiy Ula o, seaouuw-Uliug .._. A* I A-rrrwr-e.U.:... | ias will aH IMM.he wetf e f4i| | with -. I ..* J R'I.J.- ...
;
aaJ
lay eMmlv. HeMlen. .
ItUJltlUft..c tlte I're.-Al' vetu .. H'tPKIM A < NIU.Tsh.kaosei I I .k.aset.wmmis.ttI,. I II U: ,I:
1
iumm Ii It fceiae) niisaieis< in or p,*. : ) I I. M *4
Rokwrl
I lU heuau a rMudKlaa to peoel a \ .. M S. At aael shad aS fceesy. Iv01

aloe Iur the fcmily cflUickjeWer. I'. S. .\..uUul a. hue ay the day, 'l'IlhJuJ.ad.ataa4a i sh.f r u 1 :00& K .
and riaiine Iniafane pilllKINr X ... oftfc ----. $.... ., m
,! not Fire v r will Mar.balJ. kill.d ill the tie .
fugilit" L IIVSK.ot < tJ I l ., N .
,, : ; .i. .." M..IIII.u.ne.. <.o.I"L, : | r I". M>...,. ., r._... .. by kUatheat-M .are booby tu appose| oru.uAt tIsassi t ltIolt.
"Itrredtu the any #
ua* n :',' inprm v"i"i" :t 'rlI l.b..l. i V.' i M
the .
cad to l ak
. .,_ wa.1i 1.1. in ve n.ir
\u' i I .
it.a r".b .
I .
.. r I"
.
ib L' i II '' lib. 1''.ii i. t' ... _II ,
., .
.
I \1. u b' lto to.uit.bi > /HIIIBfKU: t., ,'ru" t
lUuTtxoar M.) ) -'..' N,tIII.r' 't .rk i tI'. J't I i. .. ..u I t" ,t.v. ," i t I.NrtC f I.a. MOy t., t1uI ". At\ "jI'
Scuemlie 'm Con f.5 lltrlJA, it u .' M da.'af It. Arr I (S. 1-.1 iu'"i


o J



: .
--._.- .-- -- .

T ,---- _______ .:_ ,_ ._ -



r


,



.

11. SPUING" & si Aeuitabl \\I iiI.LiC1L
MAfHIXE. G.D.METCALF&CO.' D. A3IhS I
'i'iil: r i ,,i t:.s; > j> nUrcJ ("to. NEW SHLVGLE ,

l'IULAlimilAiVSA\ANNAII\ ) : ; \\ \ \ I. i 't' .. .' .pl,.p.'IsoIcmaIc. ,LI:. \\'. it ) ,.aUi' 'u il igllM,,, at< ntio..*f.lepu, *. oonnissioN P1ERCIIANTS I TALLAIIASSCC:: ::, 1'LOUIDA.Wholeiale 0 :

I.. it?,. n.lr."l lHmt, 1,1 if T, P 1Iftw./fOorl"1F torll TUflT G
STEAMSHIP LINE. nml ItcinllA '' t new Shingle, Mouhine, We have we. Ihi mu' 31 (J'odras Mrccl,. nd Retail Dealer In ''t

chm in oocra.mn, end think It I 10 lbs "perfcoUon of* NEW' ORLEANS. tereuving, 51 the wdl hon
NO\\ otauud .
S Shingle M Is very simple ii"y.rt| ::* iIEDIOIES. CI.AnKt:. fin. .... o. \
iisiESS S h':1 DRUGS & ] "m.nt orm:8J1.jZIil3JB
:
: MererLoHopiroo
iiiiiii G:; dnraMe,awl 1 work tborwihly';I It $,w tndehtvr R.fcr I* -'P. P.fcenwius.

linen 1100 t" 1.1100 KhngU. poP hoof iht, .- : ) : ];:LD1LD;
W. K. pn..
.4. ..(.(0..)
r. (int lbe,smoothly" frmv bull potol.- g >
J... T. ncnun. }Tallsbuaaos minI
( g.ntiaid.w forSpring Summer w.". ,
MAIL .ompr"
CVRUT1XO THE mono tiTAn t"r..ilof T W" Duow, it. In part the following article tI

S -- --- VInIZITI1IAII if "B StYLI or Ho.. T... DLTU". Brown and WhOa Navy Drill Frock & Sack
.A I:) W ::fmJcrI4: flanmoi Loon, Newport Fancy and White Linen Drill da do Coat
STATI OF ilOflGIA J. O..n SatiN Monticello -- 0-- de"
Clouded and \\ hit* Frock and !
ItJW T.n.-C.pt. J. 1. aa.iJ.i! BARNARD\ \ & MAXWELL.\ MACHINE. Me..r BULL A Prrrra Bambridg, Ga. Perfumery, Dvcalaff., Surgical lilt rum"...*, f Striped; and Plain Gingham Sack Sack Com.Coat..
O. D M.rciir, > Snuff. mdow 01..., Pamla,
KHVSTOVn STATH, piefi. HI k cod Col'd D.p t El. Sick
and Frock Coat
'b la lk* M,.d.. II B Stoat. J Oil, Varmrhea, Putty" Manufactured Tobacco da !
1MO Tom.-Capt n H*.nit tar' TlltV will 'iJ'I..d moo<< rrODDARD PATENTEE.TI1IIE do Summer Cloth da da
..J pitraft .1 the 0 .f E. D.,...... J,., WII.U. November, 18S3.GOODS.. I,.}. and tibia Ware, Patent Medicines, V\ hit. ind Col'd" Drill P.nt.
P.re.- ,
.
Jf i tTT Faint |-(" "I1'. in. of Ik* Mrt.r. rnr....' of Mwr. and Oinlo.Kireel Fine Soap., Fin Tooth, Pure Wine and Brindie, Fancy Mir.*:lle* pint,

R,,er ntvlgnwim. IW( mfl oa ..Ite lMa..,*, *. where the, wilt keep f'rId and. ff.-r.l .. S.I.ribet having purcha: the ntafct' :m. of I'IID'W J1. :L3t a l.VXI9'. :l1n and Hair Brnihea, for Medicinal. purpoie, F.ncv Cai.imer df for !Summer

only two nk.>bl* tt ..... "MnnM-nl of article appertaining .. their* II.. J JL Ilk* Mai* of GOTMta IB the > MACIIISKnow Paint Braihee, Fancy Article, hUlk Drip d'Eti do do weir do ,
I :! ba>*Mand oMi the. patraMg of thmr Mw.a htrrnlrd, for RITHNO AND 8HAVINO' Garden Seed, Fin Havana l'Ie' ,..*. Fancy md White Marie illea V.."

BAItING DA 1s ZVERY WEDNESDAY and ... pnblir. 9IIINOIK. BARREL IIKUHNO: ke., ta .pro- THE ndere-gnedbeteto tnnounci kn *.. II. has recently received per brig. Ana Sawyer light Spring Silk V..... ,
POUT, a* roLidwiI : BtRVRD.' ,f.. pared. to *elli. u'Right. of 'M Usuntire orinflM*. and ISpublic thit h* hae )Juet received, and Monlauk.a Latgt s.d FreeS npply ofeter?
a*c
::1 riott O TKOLP MAXWELL .... tl poises nffialenlly .few la make It an mdoc by all the recent arrival, and il now opening one vinety. of articleau.uilly keptby dniggirt Plin- -ALSOA -

k STATE OF 'I KEYSTONE STATE. F.b. 1.T.)1M4.( ) ,newt Sw "prrhsseru.Tb. of the most ......1'., varied mod cholrei iM>rtmenl tees and rhy.icia will, alwiv find at Ik .1I1.blt.h. general iitortTirnt .f Shirt" Collars. Glove.

Frrnnfca; *. GEORGIA'I'"" [t'rtm Phil I From 8aFebruary ,. I.hll"Mol., .. eirnpl I. h* conduction, andnot af GOODS eve brought thu. mirkti.tll meal full nipp'j' of very thing needed,and oath Cravati Hoi,*ry. Drawer, L'nderthirte and vartou*
Joobu" III. r 8 rebruary I. 11 ew Coputnenhrp.-- liable I tn t>t iml of order b capable of .plittinc which art offered! on the moat reasonable term,and most liberal lrm*. other articles too num."",,. to mention.

) ( oO ? I" ISIS. S M DA\HVK, having bMtght th* entire soul *hvmTM: OTHOt8\M) $III>GLES PEIlHOI ar C.oU. lie will\ not k* undervold.b\'ii.'s, how Ordrra from the Country promnlv filled. and iilickrlloB A full boon menl Cloihi.. Cit.imere.,Vesting,

March : MarchAprfl K :V.rchfl I.: J. Mere of Thom.t 11 Hodk. In In* *bov* 'R, brtter than mad by band. It h portable, 5 thIs rity., U. C. .( guaranteed with regard both la price and which the aubtcrihtr. I I. prepared la manufacture to

1 ., J1MehI'j? :: :: I (onir th* I Irs< "b* eam April si I" m S ', S*. mM stand by J. P Jb.-.A::: : J. B M I>WU** sea Ten to flflrrn day work of a Machine will\ make. --- style and beat po.eibl, manner. All In want of

\ oO 19:'..Aprila I "I" 19. Aprfl 12 Vr th.t'riid' style JuRIH.N 1>A\ hintON enough Miinght. to pay th* price *.ked for t single on*. and Improved kTI "Aho, F.pplng'i. Compound Fluid Extract of Buchn. good Cloth,ng Call

MA ., I'' 14. whrr* ; ,b* pkwwd la ea their friend* awlpsw000 forge Inducement a,. oflVrrd. lo penon withinglo under,'gned offer for sale, all the valued Jsl8S4. nrO"efl from the country promptly'! attended
..t 10'' I.M.y 10 old .4lahmMilJOIIV. Kighrnf aevrnil oountir. On of th* 'i to
1.Mav of ih* cM r.retr.he known vaneilea of ih* dome.lic fowl, con.iit- by A. B. CLARKE
t M uirl 141 I" 31.IJ.n.' 24.i P JORP\V, Mk.binc can be ann In operation Ip.I thia City! gin part of th* following While. Red, Dull.Y.lIiw TLISS, OILS WHITE LEAD 1C.r March 21, 1854

Jun .n. <7SI. Jon. U 7. Qtimcy JHoe 27, ISRI. J. s. M \'lJII'OS.' 1'. 8TOVALL. Black I and Domin.qu. Shanghai. Chtlta-: 1 \ BOXES Window liI..., ...0" ." nines, ,
.. SMi U .!' I't! !II. Aajotla March !8rey Shanghai, W hit., Royal, Canton, lUU lOOkrs/Whit* Loudpure, enraA-No., Bonnets & Artificials.

Cabin W,. . . *2" '*' NiJl1CE.a monthi ftrr Hit. 'shall present Refer to the [h'Mti': ; for; any Information I ochm, China:; Block Spanish and eot 3 barrel. Blond Lao Bonnet. Polka Bonnet,

Steei'ags passage! (reduced 10)). 7 00pledger ( .. and voucher*, la lbs Hun in refrrenc to -S'm. M D'Antignac, lick mod \\hit Oon'.m,rul.nd..IJoUnC.. Boln 6 'J.on.r14"I RICH k opened worked lace da

; ran |O ihrough to New \ ork Jndje of Prabit for Jefferean .0,017, *e .l. Sheriffofiiid Hcranton rVymor* & Co.. Iklcher A I Inllininwonh, "' 0..,.. Chut.prill., Lngliah., In.n. Scotch, Su- SO Keg I MiMea' Illoomera

St'c'6.oefcirk Seeond QMI Train ft* tl W, tn4 county, and Administrator' ef oflicio, d; Himpon' ; Garlnrr. M. P. Hiovall, Beall A "o..n.L. m.I', :and Java Game, &0' Alto,Suffolk Pig. Inv 30 package. Fure-roofPainl,(bbl*. and'' bbl..) Rutland FlatoTrim'J, ,
I I in tb. J Firl CU.* Train r.w2 00. boats non of lbs e*>.<. of Samuel P Yenman., de liopkin., and K, b. R"--: '....... roved Sheep die., barrel Rectified: \\ hate Oil, Jenny Lind MJUir

'I.yth. caned, hi. ef nld county, sad ... fora discharge A* .pecimen of the quality of my fowls tnd .lock ,3 M Train Oil, I bbtf Copal Virniah ZIRMK: ,
AOllln n FUILaD1LPUt* I ( k M.'nTl from and Adminiitralion.' And three ."* to notifyall From New Orleans. I am permuted la refer to the lot* I h... fornuohellot Ipinta T.rp.".liie In bllTell'and at retail A I Box :Superior Green Letve,
mr.o: ptrnnna. I.,..'.. and dmtr butee* of and ,","10' T UST arriving! at the Stor of IMgkwa d} Scott ( UUU..J M.m *i All karo post polO Will b* general aiaortment Color\Bruihe and other I" French Row,
? o. 371 Noatn \\\mava uel P, V eoman*. and heir, ef..Id mat* la prtii'nt .1 ).. .,& W..ophsi.. I1so promptly attended lo. DAIVD A. JACKSON. '.iulert'm.teri.li. \ D. 11. AM E8. I'. Bundle ; Ad.
amorted Ac.
Ao.." n {lnlll... :C A. '. LAM All.UMTED . ,i .ohowIsw i tnranotic* w ill be plead in tlh.,'. new Siitfnr Cured do., October 15,1853. Tiunlon Mmichutedt. January 3 1854.. :
,
........ .IjSO*+. Nf bar thereof. New Ribbed Ilaoon Side, BUTLER ft; DEMIAM. \
'
---------- December I 1653.:; DA:MELT. LINGO 4. Leaf I.d, Hiving been n'en.I..I.urJIad, by M,. Jackson WINES Srnll'S.I.c.OI.D March 14, 34Spring 1

i I STATES MAIL\ LINT Oils, fcc. South E.tra" SI Carolina, Louie' Rio Flour, : lak pleaiur la recommending him:.to the ;1'lnn-I Otard Brandy r, .b Da.u. & Summer Goods- ;
,
breeder of
of Florida I lint Fancy
r* a* a rit* Port Claret .
.. Subscriber" ar. their usual
Km do d. receiving tiwort
reoeivM from New York brig Suwanncf Sop THE
,
I pet and Stock Paniea orderi.g i from
JeST Improved Madeira Old Pert Juice
New New Orleans r.I : of Good adapted 10h.* teaeun oonaiMIng -
(s1Ml.wEKLT.) "", I.ln.h.d Oil. Sjrop, will find him an honorable and liberal, dealer | j
do. do. do. do in Sherry Sparkling CI"er. of .
Boat Sperm Oil, t barrel.
>. nd they rely being nerved. with" the bestaelections
may upon London Porter Scotch Good
51.. Dry .
Choice New Orleans' .
NEW YORK AND SAVANNAH.ON llnrninir Hold, S"g.r.On I i offowl. and lock to b* hid in the tnt Brandy Peichei Brand AChernei.SardincT 0
SI M hito /ma, In Oil. ... Fancy
oil HI.' A. II 'RItISON. 4
I h II.. and .I<'D.lldI Pnr Vt hit* Ix anA after M. 18Lb. new No I \\hit Lead Sandy fod. Slnwberry II Freak l.ob. Ur, Ladio'a and Mix*'* Shoes & Gaiter' ,

.1,1..h..lmelollll| Putty In cane. IIODGKISS A SCOfl.Pi4mteary VTO. 1 Mnckenl, Fulton M Beef, I Books! Books I I I..mon" SbuGinger Hat &; Cap,
FLORIDA 13VO 'on.-Capt. 5!. 5. oonimti. !28. ISi4.:; 1 1 Lochfuln I Herring, Ilam llamt. I SalmoiTt Bonnet,
I ALABAMA, 1300 Inna-C.pt. O. It. Scuvi.Atclt'STA tried herring, >mh ((<...hen Butter, JUST received a larfe and well elcled! itch of Gou..1.1I* 14 ClimB| Groceries,

15K( ) loni-Capl. T. Lvow Qrocerlei.T "nltimor. Ro Herring, rrah Counlrv Butter ,Including m.nyorlhe Standard. Work ,, Preserved Qdlpee*, Crockery,
,
: oniied' Salmon, Pin Cher lately publuhed [n"li.h. l.auio< ,Greek and French Currant doSparkling. Hardware
Apple ,
KNOXVILLE 1500 ton-Cmpt.. C. D. IAl ...o.. > ETEIVFD by 8ch'r Anrrllt from New Orleani, and Cla ical Schoo Book
Elementary Tamarind Mood
; H keled Salmon Weitern Lhee Gelatine ware
,
J Will leav ,mew York and .uniiiifflli every IV Rioe, Hour, Ilaoon C'ufTiCorn, Pork and Died C..d Fish, Pluming Onion. I Highly, : Illustrated Annual., Juveuil and Toy rlivoring Ettracta, Spices' P.IC'TI' I Tinware,
I SATURDAY V\hi.key. BUTLMl A. DEMIAM.Marchl4 : D....... Yeast Powder PieU.
WEDNESDAY AND i '54 Also, Pie fruit. Pi-nerve, Pickle, Piccalilli Can BUTLER& DENIIAM.

The** .inlp ar. among th* largwl on th*cna l,un- -- ,-.-- --- flower, Caper" Prune, Cuooa. "arln..te ito., Family and Pocket Biblei, Hymn and Pnyerluok Corn Starch Salad Oil, f\Maroh 14,1834Attention
.rort-n.kia.. th' ..I!rnaMn b. !IS. 18.>4. HOIKK| & ,bCOTf.; Ii *. Olivea, Caper
cIla ipeed aafoly or ,- Su months after date I shall
.rpao NOTICE f pro. A choir election of Light Literature | Blank Woree..tenhlr R. Coco '
J, uc
.mIDAnI..1.
In 50 lo fill hour, and ar. l l by account and vouchere la the lion Farmers i
od.----: Hook. of Draw
I careful and ofliwr. They miter a mont Judg of Probate for the of Ieoes idmin-, New every virieiy i StationeryL'oiiery, English 1\Iu.lerd.\ D. H. AMES. .
.poliUi to iI.iver Stable "
akillful county
fl log and T...... Paper Paint and a variety afiancy January 3, 1854. ATTACHED my i.a Black
....i'.bl. oonveyano lo New' Tuek.b :i.tralor: d bunia non, ollh.e.in* of H M. Hal, JUST RECEIVED per Schooner Article.. in which all kind, of work ..

Cabin passage,.. .. . *25. let* of.aid county, dec.ed, and: ask for; a Dual k- Anthem from New York, a fine Maortmvnl A lot of well selected Oil l'.inlln..l arltlement and from aaid, IIo of Moot notice and
'diKharp adnnni.tration.March .Whoen die. fur November' !29 1953. JOHN McUOUUALL. on tereonibllerma ai at t-
Steerage pammage..9. II, 1254. JOHN W. liALE Spring sod Summer wctrM I tillE under.iKntd keep con.tanlly on dC' :! other shop' 2; the city. Farming
r ADW'OR?. FAT ('0.Ae.I.t. ._ "_i.I.oIo--.a.__. o.-u_....... -. __.... .._ NOTICE. aisea. of Ih* Patent Metallic I Burial, :. cbaeTnrnPloWt.Seoolere.: Rod.Clevicee.implements:heel
__ In !".. : D h. -- 44 Patent Lenthor S.rp Shore, mentioned in the accompanying certificate. Piuue.&C., kept ready mad and hand
!SAM! '!. I.. MITCHELL, Hedges I Hedgei-Live Fences.: .. SIlk fatting Congreaa Gaiter, rilHE highnt price In Can) will b* paid at all' lime J. A.EDMO.NDSOX.WJIIIIROTO Thin will afford Firmer.. opportunity constantly to on supply"

13 Broailwaj, New Turk.Eavannan Free She Marltna *r 0..,. Orange Col'd; CaiMinere, .1. by Id*.uIJIIC.."" for Hide*, I)"" r bkmi, Leather themselves without, being delayed.
March II 1 1854. I Indira' Black Tailing Gaiters, end Son Uland Cotton Seed-vu; *, April5th. Feb.7,1854.-Gm. P.D.
t W GUI.DeaH attention In n rRISH: SUPPLYOP DROKA W.
I .. Linen O"i'en. Prim hides, 10 to 13 cent per pound. Mteea.. Fun i_D HATHOKD.OIITI.IIIIII .

t M,OSAGh. It W. OKANUL Pnmm.. t: .BKKI.known: :\ ,jet".receivedfrom .1., In kid alkmg Shoe and Slipper, H" Detr Skma, !25 to 30 oil u -Wwitnenrd: th* utility of your Daniel F. Martin In th. Circuit Court for Mid.laun .
leather, IT to !20) *t* ornamental "Pitent Metallic I Burial Tl
A o..mplo..rImenl of: Boy and Childrcn'a per Caie uaed to County, Middle Circuit
which h
hEIR & RUST, lliii article, awurea na wit mthcred under hoe*. Soa. Inland Cotton Seed 30 lo 33 cents .per Bnihl convey the remain of Ihelat. lion.John CAlhoun I Chirle Kumell. of Florida Spring Term
direction the
hi. own .pent yrar .nI"'h.r"ro b* AI>*O l l. 1 hem may be lent to any of.h.llum.rou. CommiMion to the CongrnKional Cemetery, which Impremed u* } 1854.:;
fully I call the attention ofthdr ,...Ii.UPO" .. .fresh and guoiue. Ho much of th. ,
'Vogup: Ladi .' French Corxta Merchant or direct lo me, and sans mlcliorgoofCuonminsiuiu ''J with Ihcbtluf that III,. the beat article known lout Attachment
and Friend lo the n-ed artiil nf n.r;; : =b1::' worthlo make t valuable Silk ind Linen Laott, Ae, .h., f.r sale by : ( SAM'L. IIOTT, I I ">r ..n.portinll'be dead la their final re.ting.pluce Amount sworn to $172,.

fit. 149, EattHay, With w* subscribe. onrielvca,Your
0 & J MEGINN1SS.: reepcct Ac., 84-100.
TASTEFUL AND EXTENSIVE Every: year experience with th* 0.."* Orani March 7, '54 n-6w. Charleston' 8. C, J.n.IO. '54 alOlrrcnli 11. Clay D. R. Atchi.on, Jeff D.vn, Th* defendant and all
other
only Roc In .prov" lie VIM auperiority over any hed|(* >.i. (.... A C Greene W. R. King will t.lto perioni interested,
j aogTMi"iT! orI plant ever yet dilCO. ,..d. The ohjectiona oonimonlyurffid Warden Seed;. 15. S. Dickinson, Da*. Vi Outer notice of the eomm.ncem.nt of llls .u,'
Insolvent Estate Notice.* Henry Dodge by attachment and
.
agnlnrt other h..lldo not apply thl. It ar* hereby required la "
GROWTH or 1953.RUTA .. M.. M.ton, J. M. Berricn, W.P.Mangum. und to lies .i.P'
plead
and th .la.le-.Jura' declaration, in
r the
said
grows rnpidly on dryctt n<4prrad STATE OF FI.ORIHCourt) of Proh.t.. December. 1853.
S11tflG I SUIIIEIII from the root-.brara drought' and floiKlinf,and f.,nl
l, In II,... yearn from ttting make f.no. |nip.<.n<: '.. IXTII.i.lAM 1. McDONAID\ Admini.tralor of received D. II. AMES. Copper Tin and Sheet.Iron WHIT SMITH
ble to m.n. .beast or (bo I. A dtacriptiv pamphloteontaliiing 'I V the ..tat* of V.nlcMoJonald.I.\ late of aid January 3, J8114. A lIon.,.. for FhintifT
full direction for .' soil --- MaduonC. 11., }'I.. March lid .
.nllng-.IlIell ng 'ounly deceaied baring thi. day filtd t written MANUFACTORY.THE ((28))A O. 1\i5.1.
rearing bdgoa/ ice, givm to I..."" ........ ggimtion that ha beltevea .aid estate lo be liitol Cotton and Tobacco.: -

1) II. AMTallnha : .Atront. .rnlIt : Liberal advances made on ,ihipmenli the aov Rnhxnber Inform th* citiien, of Talla- Southern Mutual Insurance Company

Which they PVC now OIefltfl2eISutj1| in pert of -., March !..!854.:; nnm la onlrred and ailjudged): thai all persons wham b> arii Ue. bv HOUOK133 k SCOTT.! soul the aurcounutiogcountrythal* OF GEORGIA

Coul' HI k & Col'd Alapaeca, Sick & rook Coal Wakulla Iron Work. never holding claim or deniund ofwhnltocvrr No.'nberU.18113' .. .r* now prepared la lurniah eu.tomer: :h.b all_ -----
N M .4 "I.....* Saints afiain.t aaid ....1. do appear and file the -- -- -- kind. of war, w holeial stud retail4. in their. Im. of AIBPKT Hat PRESIDENT &. TREA'
..
I
.. ratlimeretl NEW POUT FLORIDA. ..,ne.du.ulh.n.iu..d.ln: ih. office of Ih* Judg UNION BANK LIABILITIES, iiiine.t.Th, J. U. PARSOM.SeCBETART.

.... .. Drap D'El* "" .4. e.l.bli.limfnl it now in full opention.- of Probit for laid County, on or befor the SVtfy 7 OR Saleby HOfKINS\ & !tIEOINNISS.I Subicriberi rail 1 th* attention t of the public r or. C. F. ?ilcCy! ACTVAIIT.

I Meino' 'V THIS ordera mill I b* attended lo with d. of July neil ensuing In accbrdanc with the December. !l0, 1 aSs. 'a their tHortment of Parlor I Cooking, and WOOd '
.. .. Paletolt proml'tnoasund ,
: : Siatuto in such raeo mad ind' pravid l.E Stove.. of the latent all above Company like
all work dun with neatneaa and denpalch Mylo | trimmed in complete THE: InlanulJilarin.' and
.,
.4' D Ei. C. LOVK of Probat. Seed Sate.
Prap Judge order. it the lowest risk., sod risks
market" }
.. u AU kinda of.o"ell. steam work mill. work, price 'Ie. call and on negro pioperly, on th*
,[ .4 W.llae Clauded.MarMille Cloth Frock e....., gin.fearing, augir mill, circular aaw machinery, Jan 23. 1854. 8m. OHO BUSHELS Heavy Seed Oat. atotJu examine befor purehaaingelsemhero. AIoRrit- moil libenhermi i she,, effect Life Attur.nce witt-

\ It Sack &. .Frock" .hilling i pulley.' hingera, plough ca.tmg, bra. NOTICE.: HODOKISS cV SCOTT. tunnia and Japanned Ware, Lcid Pip, Sheet Zinc, out the additional hilf per ct. aicharged. by northerncompiniea
4 4 .. Chimbraj eaMing., do. *0. Also, augar kettle' of any size January 3, 1554. i, Sheet Leadllou.e-workHoofing. Pancy Heidifor for living In Florida, The company uiu,
Kremlin' hand will make Cub AJvaneaa on Sos Mind -- -- gutter., Guttering Pipe.' -Shop work of a moil flouruhing condition.
... .. 4I kept con.tiiilly on All work don. In such vervdciriplion which will be ipl.ined
It .. Fancy 0nhant and Colored Linen Sack and .. a.Jsllinhmenl will b* done by u>, .with. a particular V Cotton ounagnscl la M.ttr. Jane tisitalen &TXA iNSURANCE COVPANY. don with neilne.t and d'.p.'eb.WIIITE lK by application la the agent who areprepared to t.k.
Brown v1sIt... rKvrdtolh* strength and durability, of the work. 4h Co of t'hirlt.ton, to tbot of our frieud. wbo rJ'IIE under.igned.. agent for the shove company. & SLUSS n. rube' HOPKINS & MEaINNI .AII nt.

1 4. Frock Wh.&O.eo..... Buff. Mantilla. >"enti, Competent" workmen always. in rcadmei la put wink. to iry that snarkot J. CEO ANDERSON: & CO.Ovloher .1. la prepared to Imke/iiki agiintt lo. by fire oniloililings October 4. 1853 (FloriJun! copy If April 30, 1850.: n
I i Ae Ac and their Content., -
.. and CoN WellingBrown II .r Knginre G ru 9e8'ne.n 0 n n h rV
Fancy men A
19.1S33 Sun &u
.. Linen It Trims will b* liberal and all work don alriclly J.n. III. 51. n. C. LEWIS.BE'rFON&WHITAKER7' MONROE HOUSE.TALLAHASSEE
for cnhor aceepud order torn biilnei firu in :::<-- month d.;;I John Ritter, Marble Manufacturer,
4 to DI'" Drip U Et. Paula, Qi: >ii after skull ,present ;
Tallahaiaea NOriCE ,
,. .. .. puce, or and FLORIDA NEW.IIAVrX: CT.
voucher la lha lion. Ju.lgnufProbsto
:: Ela.tiq.u" Liberal price paid' for old I Iron, Copper.nd Brae of Hamilton, for final irtite.meni tttltn in Ffitey cad S'4pDr/ G..J.-CI.'Ai"K well-known CONSTANTLY ouhndandmadlorderGrr
Merino county a hotel *
I Quen'a Cloth AU I...... mu.l b..addre.. .ed (r.. paid) loM and diKharg aa Ad,ninmtralor of the Saute Orcrrieara'irare Qfttnwtrt ".'..l..n. ,4.\ THIS, pined from lh* v> Stone aud Monumenli of vanoui putt.rnsT.

\V bit. and Fancy Linen, Drill ra.t.4I II. PU.NU & CO. or canard Does,late of mail' count, deceawdJan Monroe Street-Oppotttt Smtmtl Office.IF. "d. of To!,. E P. Moor. ble lope, Chimney Piece., Miiitl and Hearth,of

I lllue and French CutnaJ.p H New Port, n* J.n54. 1854.Administrator's:; 31, ItSI. JOHN SASSERAdI&r.l'rt.TOTICL'Sit T. lJETTUN. F. Will TAKER _:J '"'o tho.. ofth. nndemgn.: variouekindu of morbi.,olb. beat quality

1.1".. Bowm Shim, --- Oct.28. 1851Manufactured. ed ;ih*neb, proprietor gi... D 0. UIL&ONUtdulyeppoiut.dAgentforth: *
I Merino( Undonhtrta. I inonthaifterdal* I .hill p".n' -- n"Ii.. '0 lb. publIc .1.., h. above HOMIC,ind willrectir order. and furmth any
i and voucher
Notice. my iceount. lo the lion. Judg Tobacco.
I Brown and Bleached Jean Prawera, fi* prrp.red la entertainIran.ant oftheeaumer led article it coil and charge For
t Cent.1 Fa.hion.bl III" Silk II,'., (latest .tI...) SIX months after date, the underlined. Admini. of Adminiitr.iorti Probate, for JelTiraon officio county, aa .1.1.8b..ifr.T. TUT RECEIVING further stock or .om. toO ::1 .; ; and. peemanenl pecimnofth work,.*.Talliha.ieCinetry, ,and

# .. Drab Btaver Hate. of lbs .....* of John D hbcli.e, l.t *f deu...... latof, othn said rotate of of Job N.l'gr J b>iiea ...orted Manufuclured Tobacco allow. cudomir with lbs beat the market afford. and aa ..liorefertopallernainpo.ieieionaflhAgnt
and ink
4' It Bl'k Fur. Drab thumb and Leech II... JgfTinaiCounlr, ...CI....., will\ pretcnt hit finalaccouitlotha : ful ridge'. from, Mid ... inl..lton.eounly, .r priori than it can b* bought. any of the large reasonable a rout at the lima will admit of Tb. T.U.ha..M.30.I.U. Ire
Boy' ill'k and Fancy Colored Wooi and Fur lion Judge, uf Probate for said, County December a diMnirg::11.18113. DAMEL" T. LI.NGO. machete. North. Trader will do well to umin 4ou.. i* welliupphed. with ..,..nl.,and every con- -

KoMuth Hal., I and uk for t diachtrg.. from .id Adminirtralion. ample befor ordering their Spring itockt \\ ilforwirdaamplee ..aieoe.lo make gueitt eomfortabl, and Ih. pro- MILES NASh & Co.

I' Infanta' Pearl F ncy Hit ANDREW J. LEA i i. hereby" gives lo all' Creditors, Lega with prices attached to any Jemringil pi..o will ipar no patna to pi.... th.... who may .
J... 1 18U. 0m Adnilni.ir.tor., NOTICE! ml pcrton entitled la di.triHution. of the A credit la 11 of April will b* give nor him .ith Iheirpatronag*. Two nc.lleot Ijv. Dealers in Drugs Medicines, &::0.

d$ FANGYIOODS. ---'- --- -- .-' .- eitil*of\\ ilium Johnion. lat. of Gadiden Count, where any quantity la r.quir.d. D. LADU. cry tahl.adjoin luia Hotel C. A. BRYAN. W OULD Inform their friendo and Ihe pub.

Otis J. Cbkf.e, Mitchell. \\ In .the Circuit, Court. Florida I decea.ed. thai Ihclr claima i and demand Newport January 31, 1854:; Tllaha.ie. January 10, J8S4 tfCirorvrlett Ii,. thai ihey have .a ho" a good suuamrl.ment .
St Amandand
Thomas for Madnon. County --- --
will b* barred at th. .I of two from .r such articles II n. iD their
1 Croft pannera, Marrhanl., Middle. Circuit this d l*- ... lbs same ;b* exhibited yeara lo the undemgned NEW FIRM. NEW GOODS. Groceries Groceries line. of buuinoaa. and will generally loa receiving kept

j of all qualilwa. A... trsding, in Ih* same ftnjl } .of. frlorida-tpriog Adminiatrator 'el' said rotate within laid Now On Hand fresh soppliee. Their terms .lIb. regularly
t RIBBONS Cup BlackV bit. tnd Colored Satin of Choke. SI. Amand ..'m. 18S4. period. and all pertoni who hive any domand.giinil ,'pHE underilnd hav*juil received bjr Ih* late 'laUahseae.July Sub, 1851. rsaeonable

Hibuna,. \ Croft, AttachmentAmount Ih. *.lat. of Ih* said "",e..ed. ar. hereby A MOST beautiful and .., .i titortmemt of i- arm alt from New Orleana and New (jYork i a ---- .
I Black Whit and Colored Taffeta Ribbon., ,.. sworn toCharleaRuaaill. tilled preieul them without' delay la Ih* undereigned GOODS, which will'! be .old for CASHand cooL aupply FAMILY OI\.OCIiIlIES.on."o.\ : S. S. KNIGHT--- ----

J It .Dd" Velvet .. $1131 91-100. .b'O WM W JOH.SsON, fot the I'rodactie.a of the country, at a email ad in pan (is
I ? Tb. dlndnt and all other persons lnlr*>td., MarcklS. 1S5I 8w ununuetcator. vane on Ih. original coat al lbs Bacon Si,!.., South Carolina Hima. Wholesale I Bclail Grocer k Provision\ Dealer.
\ .will. lak. nouc ofth eooimenceni.nl of this mil Lrdinkga, Itrownanul Loaf Sugar,
: ; L\DIES' DRESS GOODS.Contl.lmg .b, attachment and *r. hereby required la appear, Family Qrocem.. Cash and Etthaage Room of Uhukty, Potato, TALLAHAKCE FLORID .
sod plead I* lb* declaration. in th* nil. cau>*. Flour barrela nod half barrelaThe. TTEEPS constantly I *n hindand offer foraal *l
In part *f O"M. l.IE: BY 'b. at. arrn.lt from New York. the !Subenhrra HODttKISS) & SCOTT. .. article are offered very low fer C... .na. .15. a imjll advance, onco.1. forcaab, all, the itinj-
Plain' and Printed Embroidered, Lawoa, H I. WHIT SMITH, kav. rercieved, t I'LL SUPPLY OF tlCCEMORI TO Coaonly BUTLER DEMIAM: .,d.rt.cle'IO thu line t'lour of pproted quilitiet

Black and Ind Mourning Attorn. for Plainttffa. CiIlOCERIKH, con.i.ting m pert of Qeo. W. Scott h Co. Jan. 5, 1854. -SII.or.. Coif.... **.. Bacon, hams, Pork, Soip
Plun, f..n.." and Euibro'd Organdiea, Madison C.H, Fl. March, SSd., ((88) A. I) 'S4.:; E. D Che*.., Na I Soap Candle. Lardand all lndn irticlei-tognhtrwili
Black V\ bit, and Cold Jaconet, Pin appl d. FiceUiorda WE will mike every cieiti.in l" render. dealer. Fruit, In.b Potatoe.Onion., Nyt
------- ,
Black Ind Mourning and Col'd 11.'.,., Soda Cracker, Pearl March" with u* .. *e.o/ii/. and tmplt tqtiMltit for lt DAGUERREAN SKY-LIGHT GALLERY, Almond.,and all other article Rai.ini.Fig.found' i IB
n..k. Colored and. iiibru'd, 1'1..U., Leon County Iron Worki.TALLAHAIIII Butter do Cnuhad Sugar, Cerium, in good of lb. .boat qualiliea, late.l and OVER DRVO llrttibliihninl.. B.ualli *iui'

t Plain$: aud Printed :Hernanr, FLOIIDA. Shaken Pipea and Sterna, "moil apf roved lI'I..t th. SAftffARD'S STORE. SiorneiiJaoraboteGio.il' Megionu ,oaMa.
\ Black Sod Mourning and Colored Ginghama Speckling Gelatin Scotch Snuff LOWEST aubtcribera la- -
I E.l.hli.hmenl U CASH PRICES. reip.ciiuUy aoaoounceto the coo itreetM.y .
U full THE
of all qaaht.s, THIS I order will b* limled now la with: -.. Muchel" ("......1.. in catee. Hail Road. do OUR axortmenl will conilanlly b* enlarged and gentlemen otTiUahaaae* and vwiuily I, '41. .
Fdiiag and luwrtingi of all: jwriptiona| work don* with neatnriaanddiMulch.i'ok.Oin prompt. 'n. \\ hit, Vi &in*lid fda. In.g.r and cnnched by freak aupplie, and will\ embrace that their O.,llerj la open dulv for tb* rceplion( ol

J Cold Paraaola and Para.oleitt.Black I "i"I" kind of work such Slum Work Hul.ick Ukampagn.' the entire variety, of goodi demanded in thl. mark*! .,..to'..Bundaya nc.p'... Miniaturva tak.a of all

F,./ and Snd' Rosining i'araaola and. Para- '\ Geinng, Sugar MIt a*, Cur. ularSow, Mill M.-. Old Cunb rUnd Whiskey, -ii may b. .... by perusal of the following aiiea and alyl* of lbs art LaJie. and gentlemen A ROYAL STOCK

loUn, eilln. tttr: Old Family dim GENERAL: SChEDULE are invited .*nil and ei.mine their pcimn' Of Carriage, Buggies, llarnrti Saddler,
Gloves of all\ description. Shifting, Pulbyi, lI.n..I'louII c... C",..... Brandy, 1011\6. : N R ',........;..... e.e.c. In ..... ....... ...1 ..11.. .....1. Collars Hornet ,
ing. Bra.a Castings, 4e kepi .. .. ... .NW 'NW. Maieri' Stock and Touit
t.mbroi.
| .- fipricg C.pe., Collar. and Viiillta, ', con.lanlljr.lr"l: : hurl Brandy, 18th.l I Iinrrrn : L. .Rlb"'n." and Trimming*, of Dagu.rreaa;; nalcnala i for ail*
I Limes Cauuri Handkercbi.fi. A U woik lana in such ** tblithmenl, ; __.. -*. .nuvuiMFcb. .-.......... Ladie' fins Ih.**UOOtl., Fancy Shanties, bhawl. KLIINSiBAILET.February Trunit, Values, Carpet flags, J('e., 4'$ ('.,
by u*. with ofik.workCompelrnt* p.nicol.r ,.,ud .Ib. .".D'b arnJihirobUwy 14, 1364. and ('...k., Fa.hwnabl Bonnrl, (Ulov., )lIU. 14, 18L is Its? Wow ArrEAiixo !If!
lyExecutor's
-- and lI \V orkmia always r.idiue.i. put Fresh Ulauikelu! ulolbing. Bool and Shoes Hat ltd alL of all
SADDLERY OF EVERY DESCRIPTION. Supplies. *orl*-ajnonf them tome of tk* f.moutStmlUaiting
up t'.giues. dec Caps, Bagging' and Rap*, Faddlery, Hardware Notice. .
Dual di, .!
f lacludmg. Ladi**' Saddlea. Velvet aid Much BeataGenta Term will b* lib.ral.aad all\ work don ctrirlly RrCEI\'ISO. from New 1 ark. Baltimore and and Cut lery, (tun.,Sub* and. lUHow.w.re.I Crock- monthafterd.te.theandereignedKieeotor. Pattern, which; will ,p 'ling,8iomp-.uriiiuuting
., Si g* Iweniy nil** an hour and
:
1 Patent Leather Eulaw Saudi., for cub or accepted order on '*ui. .bane Arm sri, .I..IIe Hones .nd Piinta, Powder, &ht and the lot will 1 anilruiament of MatikUMoor* lop only with the
I I., \ '*. Liberal prices p.M foe old I Fresh Oo.h.n Butter, Cabbages and B..... ).. lInens bo.a-bei. pcilly" adipledby .
4 I' MI' nl.b Ibl.l\M' ran Cop. da da. .d. Flaur Beef Duller Cheese and all late of Ln County .. ... .d, will eihibiltheir; aecouula ctrengihand high Cnitb la lie
in Kit rill
.... OnHMie and Hope (corduroy]
M It u Toe .u* p. kind. of Cr* .riend V'reei..ie... and voucher before the HgjiJftg* el Pro. ..
Wlrn Cb.... Ckocolat and Cocoa i; icnic Courting Carriage., for polil
All letters >.t t. addrw young
m ( paid) t I for-aletilrmml
M and. T.nn..n.. poet bat foraaid and
Rooms
Spanish Countyand apply
.
gnilem. and Sulkies for Ih ed.
J. M. SHINE:: A CO., TallahaaM Fta Pin Appl*Che..e, It mat* Catnip v4li.po. :-TU
o .
I'aUnl Leather Quilted Chamois Seal discharge from tbs Adaiintutrstiobfu.IJ" saute.
Soda UIMUII' W.Iau' do well\ known Jobs Gilpi SADDLES, .D.ol
.. .. Machsa, 1854.Watch F. B. Brokaw'sLIVERYAND span
M 1.osp.d.flrhIles. I..'nton do IIr.....' Peackea, p. II. IU'U.' I &a-'o which kit" world-renowned Captain I
.
Martinnt**,Riding & Ciniug whips Water Cracker, ... Ckemei, SALE STABLES K. lIE IBIl. Rod fourteen mile in 6nn dija,

ValiM,Carpet Gags, A. *.*., Clock Repairing tie.1IIC Butler da Swyr** Flgi Proprurtoe would isAir.. hi. Jau.24. 1854. '11I And never looked b.bla""illl."

nndi.rdtfUFd glv.. nolle Sugar da Pickled Oyiten, TI(tirade asd the pubic that b- And Bumerom other Palttrn. adopted" ID >.pe.d
}
ha
Leon
in
HARDWARE AND CUTLERY.Kniv 1L tbiiiltnofTalUhaM'. Dried Herring I'reh I..ktr* II.. rebuilt "i. Brick 8Ia1t1.. CIrcu3Cou.rt-SItt1.ug! and .rert.c. 8_. of i k. varieties' of IIA R> tSSfkif
; soul aurrounding. country that IIn. Bihiwtra. ROIl Herring, Sanfine, I old .nd. aDd urge I. sow .mtike Chancery, been .. read of" 110'.1.....'. mail be .... I* be
p'.d toisis.a
: ** and F.,.., Pen and 2Wk.l Kiiiv*., I In, permanent! i..ttld thwmty.. be kt.Ofwn.-d > Cod Fish. MMcaian, ,_ .< t....,Tne CII....., Trunk, B... doot andPadluaka >> amchCl..ck l .sat Jewelry repairing .4a4iahjinenl, .Huatr CttrJ H..., kiwraa and Star eiadle.. 5,. t. if well ipplied or will be liken back Ik* moot)

H_, \".., Sp.de., and HknveU, shun* all kind ol work bUoagtng la thai Uoaolbawn BMU MovMer. VI....* feug.r',, He a aahaaallarhfdlohiSlaMtgoadBlackimitk : CeI ,.':iu, Defendant. } :rirud -I no .io.k and: a receipt gnenin
I V\It.\ .... *"!.... Plane, 1lJ, .'. of tb* cameboil
Foe lbs pment, bu hop I I. the FloridaEuhang Bf T....... Stuart C..._. lbs poet winked in bone.l band.
n ,
; end II.*..,., A.I.. Vice..Mock* and. 11w.I llanlatHM work.Hone (booing,and Carriage week la Ika Court from Ih every
: Euranea itdieited. New FUtorU and Almond IT appearing aflMevite i tied "T* !lash lb. nwal naked. ikrovgk the world
I ficiewplai, Cut'n.ila. Pulwar, Ames, Turpentini I building" 10, 5 Syrup i in th* very bout. utaMr and with prompt***. tad in the above caua*, that i Cob Macra
Urotd and Club Am, .. 61*., LwP.mnou ha' ag ,' whisk da da in | bbl I. Capersit Aa., >inpatchNovember. ana allh I h*>.. alia, nun i Pitcnl Sale l Leather and otherrRt'yks
doOm. iaa Bifl af
1 I they da nut d.ir I* kiv* *-r.: :; .b:* uM s bourr. It. ISM.SIX I. Coaplaiil, la t reudmi 1 alScatltnd. i : i. abash th., di t&cuhla.. Cnd the key
Janutrr la) the Kingdom. of Grew U,,,.,. : It .. hoi .. llrtnuNei rfr
at thai hogs.>, by notug ma in persoN atkm. bv 154- *-Mvenl ibiefei h** f hung 1
QROCFRIES.SL'Q .,, All: work wanaulcd J, 6ll6NFUlFebruary >. ordered. 1>*I Ik* Hid. C ulin Mree, en bolero Ik.int pair OB account of M. liens J tBMc4hrrar-
Al
: I
14, UM .mUOtS -Valuabl. Lands for Sale l.srt'lIl.n'\: ". MugJay IB Sepumbcr, A. I D. ighlei. k*>Jrn' I den bald low I* *xegrnciof the
...n,1Io after dot. the und., Exulor: and kwVMroojr, appear ... 4J ...... the laid bill w,1 al.h
r.Jud
.
AR; T..4 ( 011'.., R.... U.rt Pal Otard A NYaflhetsadoblssgs.gt.th.ootat..vlls. o ne .1mb e>
.. Old ltje Wki.ar., ksctSod< WJu.k.y. : AND AXtD.-Jual received by ibm bark 13. ry da*. dca*..d, ..Y ba tnalwl fur tk* ett .ro.**, 11.... d..****. Iota .1 l ( amiUAil in ih. Mid. Court at M will Joe taken <. 1..a| t.. .,1 Tl,,j,h, ...t a., 1.1 1if
II \> vuna," an aaou'enomt of Bnde frnttti : QtdiJitj CousIn. will: .prvwni then tail I sccosgutad coaMiiiad ag. n.. b o II la further ordered., ih.. '
Oi.. KIM. WUw SLurry sod MM'''. Tobace 0' *,plictio. ,. .11...*. at, th* hirmr. nett HUM Apply l 0 J>. K. -
a.uflcs1u., OU**, Fauna, tag****.r sit.bs vui*, l'oIioIIod and Plauur. Hoa, l..I.. ..' kly. Aia, MKTHt> E.: tiacutr: vuucken la ibm Haaarabl Judg of "' ....,. *laaid t**>y af thi,* anlrr pubh.hed .it newapau. -KtPMKINO aLoe. .n'.aluua ,lu,.i so'

t .r situetse too soos.roae t. ........ _aa' 4., Ac, ic I It. II: l'\1.1.. I Count*, and ak l:r t nnl i dwoharg therefrom pMokad m the ely of aJlaha.we. one .i. .*cb iwo and rean.bl. terms Pol ll IHIHI, wt k>.
HEIR .t Iltn. I BITLET.:: 4 DElU.UI.I c. It IHPO.NT: J Eitcuian.retrujrvtl OWEN Fit LYAU 1 .*wK for th. .pac. a'f ntn. OuiiitlioAtChue.ticra -tliopxi ,.collar aid ti.t.l 1 I h. :irac*. a'l pail'
*ctilarrDemtr
jAMES F1LIYAW.t| j
Tnt. Hal W.ULXlt D.Una. .
"uellll.IN&. U 144 Sea : can bt again i ii i."'
) .. IIM o. Dec .0: !1-jJ .
:
u Joll,;' 1 "Uli4i>et !Nu.ci u I U !I'? '





--" -. _
-- -- u __
:
os:1 ---
-- -- -- -